3AK3A

Superoxide dismutase from aeropyrum pernix k1, fe-bound form
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
210
structure length
210
Chain Sequence
MVSFKRYELPPLPYNYNALEPYIIEEIMKLHHQKHHNTYVKGANAALEKIEKHLKGEIQIDVRAVMRDFSFNYAGHIMHTIFWPNMAPPGKGGGTPGGRVADLIEKQFGGFEKFKALFSAAAKTVEGVGWGVLAFDPLTEELRILQVEKHNVLMTAGLVPILVIDVWEHAYYLQYKNDRGSYVENWWNVVNWDDVEKRLEQALNNAKPLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the cambialistic superoxide dismutase from Aeropyrum pernix K1 - insights into the enzyme mechanism and stability
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Mn/Fe]
total genus 73
structure length 210
sequence length 210
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3ak3A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3ak3A02
1MSDA 2QKCA 3DC5A 1GN6A 1EN6A 2P4KA 1IX9A 1I08A 2RCVA 3C3TA 1B06A 1AR5A 2ADPA 5AG2A 1I0HA 1IXBA 4JZ2A 4JZGA 4GUNA 1AP6A 1KKCA 4FFKA 1ZTEA 4YIPA 1N0JA 3EVKA 1N0NA 1BT8A 3AK3A 2ADQB 1AR4A 1AP5A 3AK2A 1GN2A 1EN4A 3K9SA 3OT7A 4BR6A 4C7UA 1JA8A 1XUQA 1QNMA 1ZUQA 1SZXA 1JR9A 1P7GA 1ZSPA 1LUWA 3MDSA 1BS3A 3IC9A 1XREA 1EM1A 3RN4A 1MNGA 1LUVA 1PL4A 3TJTA 1Y67A 2GDSA 1VARA 1WB8A 2CDYA 4E4EA 1VEWA 1MMMA 1MA1A 4F6EA 1PM9A 1BSMA 3BFRA 3KKYA 1XILA 2CE4A 3AK1A 1WB7A 1XDCA 4JYYA 2AW9A 1ZLZA 5A9GA 1GN4A 1IDSA 1GN3A 3C3SA 3QVNA 4YIOA 3DC6A 4X9QA 1D5NA 1EN5A 1AVMA 3CEIA 2QKAA 3LSUA
chains in the Genus database with same CATH superfamily
4IIJA 2LFSA 4TUYA 1MSDA 2HG5C 1AJPA 2YIBD 5B1OA 3ZEDA 4FLZA 5DEDA 2UXBB 4QE7A 1EN6A 5CBGA 5LYJB 1QLEB 1GM8A 4Q6GA 3LNMB 3D36A 2JS3A 2VRZA 4HNAB 3ABTA 1BCCH 3CC2V 3JAWA 3Q4HB 5KHJA 1P49A 1XHZA 1N0NA 1W59A 5H9CA 3KG2A 2LO1A 1AP5A 4QPJA 2YIDA 2Y69B 1EBOA 4LF6B 4MW3A 5JQGA 5H2FZ 1QNMA 3R65A 2CH7A 4DYLA 4EB6A 4IYIA 1XI1A 3HB3B 3JALB 3LDEA 1MSWD 1X4TA 2Z0AA 3SYAA 3JD1A 2IJKA 2UUCB 1VQ4V 2PZSA 3FB8C 4X20A 5LP6B 1SRYA 2GDSA 4R6ZA 2OCHA 3QNEA 1WLEA 1H2LA 4DO2A 1YTFB 4J80A 1RFYA 3PN1A 1SZTA 2OTJV 1H8HG 1WJZA 4JI0O 1EFRG 4I4TA 4KUMA 3KKYA 4B3RO 3TXSA 4E2LA 1VF6A 1XQ8A 4YJ2B 5B1AC 1Q6IA 3N2GA 5LGUA 5ITZA 3UKMA 2EIMB 5FPOA 5L3DA 1NTMH 1GM7A 2H8PC 5L3GA 2JK5C 1JOYA 4XBFA 1AROP 3JARA 4WFBV 2NNUA 4PDRA 1Y76A 1JMKC 2KSDA 2N04A 1JPXA 2QEXV 2CTWA 3KCXA 1K4DC 1GN6A 3B4SA 3L75H 4B3RB 4LFAO 4HAMA 2OCCC 4I0XA 2Y4UA 4JI1O 3CPWU 1I08A 3ABMC 2RMKB 4F6RB 4TQFA 5AG2A 5KUMA 1IXBA 2IJHA 4JZ2A 4J9YB 5LP6C 3SJCC 3T1YB 1AI5A 1XNRO 1OCRC 2EZPA 3CX5F 4I7ZB 1Z5VA 4TSFG 1DTOA 2K1EA 4LF9O 3SPIA 3L70H 4BIZA 4J7JA 4GKJO 1GN2A 2A9HA 4EB6B 4FZ0A 3OE7G 4GKKB 2ZCEA 3QG5A 2RQ6A 3AG2B 4P9PA 4N21A 4LFBB 1VQ9V 3K57A 3JARB 5CB4A 4TT3G 4DW0A 5IJ0A 4O2AA 3ZCCA 1MNGA 4EFEA 4DV5O 3CMEV 1IBMO 3OTOB 1P4RA 1VEWA 2QWQB 4DXWA 1NI8A 4MVZA 2WSSG 3BFRA 4MTXA 1CEZA 4PA6A 5C93A 3IC7A 1XMQO 5EBLC 2DJVA 5JWPA 2CK3G 3L73H 1ORQC 3OAAG 2YS8A 1F4NA 3AEIA 5EYPA 4UB8Z 1QR8A 3OFNG 4CH6A 1S76D 3MHHC 1S3JA 1IZ3A 1WA8B 2MK3A 1QLNA 4CH4A 4XDLA 2ZR2A 4GLXA 4K35A 3H1JH 2Q9LA 1N8RW 2BE3A 5KUKA 1R1BA 1YITV 4JI6O 3CXHF 1BQ0A 3ABMB 3RYFB 1AR1B 4BAYA 1K5QA 4X62O 1NQTA 5CA1B 3MHSC 4PI2A 3CCLV 1Z5WA 2E5LO 4G2KA 1M93A 4JYCA 4DR7B 3E89A 4QJFB 1Q3EA 2DYSB 3F7YC 3ZHUA 1BT8A 3RYIA 1VQ7V 5LOVA 4JI5O 3K59A 3A0BZ 5FLXN 3FX7A 1YF2A 3RYCB 5IYCO 2Q68A 1SESA 4PJ0Z 1V54B 1ZUQA 1FJGO 5IDJA 3D36C 2RJZA 2YI9A 4WF9V 3T1HB 1NZ6A 1AI7A 1WA8A 4LNUA 1YCIA 1XREA 1AJNA 3OMNB 1KD1W 2UUBO 2Q6AA 4MVOA 1FYJA 1NH2B 4I50B 3H1KH 3B09A 5CN0A 4RUFA 1D5AA 4DV2O 3SJBC 2QTSA 1JFFB 1SKVA 1QQCA 3JATB 1B3QA 2H94A 1XHXA 3ZHRA 3TCUA 1P7BA 2VWJA 1SQGA 4CBCA 4FLVA 1VF7A 1QHTA 3VQWA 1M56C 3JSNA 4LF4O 1QU7A 2P06A 3QVNA 4WFGA 1JQ0A 4X88A 3CCEV 5JJJB 2EZOA 3ETGA 4ZOLB 4B7KA 1R3JC 4GCZA 4WFAV 5KLVH 2BTOA 5IY5B 3CCSV 2DYRB 4LNUB 2P4VA 1N34O 2IU0A 4QPKA 4YY3B 2GTSA 4JF3A 3ABLC 2EIKC 3RFRA 4NTWA 2E5LB 1QLEC 2M6YA 2A3QA 3EFFK 4X20B 4HYOA 3ETDA 4YJ3B 3RYCA 3CRMA 3ASNB 2Y48A 4IYHA 1LNQA 2YI8A 1XEQA 4LF7B 5C8YB 3HKBA 1QVFU 2WLHA 2ZXWC 3LUTB 1LUWA 1UJWB 2V1DA 4NB5A 2ZT9B 4LH6A 2P22C 4CH5A 4LF8B 4HZ3A 3UCSC 4CS2A 4OX9B 3CCVV 3EXAA 2ZD9A 5JCOC 2HP8A 4TQDA 3K5OA 1VARA 1RSOA 4KP4A 4E4EA 5H6RA 4YHHO 1M5IA 4IT5A 3UO3A 3ETQA 1ZWIC 1PM9A 4DRXA 2ZM6B 2QWRB 2KQXA 2XAHA 3SJAC 2WLIA 4DK1A 2QDOA 3HKDA 1VF5B 3FD9A 3OEHG 5B1NA 3WB0A 3F7VC 1K97A 2EJ7A 3FYEB 4J9ZB 4K8XA 2ZQMA 5J2TB 5J9PC 1K33A 4PV1B 2CTRA 2UUCO 4UUJC 3ZN0A 1OZ0A 3G4SV 2PUSA 1GN4A 1F7YA 1ZX3A 5FPRA 2Q8VA 3HR0A 5LXTA 2XOKG 4JYBA 5CBFA 1AI4A 5IJ9B 3T2MA 5LA6B 2A79B 2L6LA 2WLNA 1E1RG 4JGSA 5BMVB 4XDKA 2N05A 2W6JG 1NT2B 3F5TA 4WFFA 4KXRA 1MZFA 2XAJA 1N4CA 4UCSA 3O9OA 1I5YA 2XAQA 4O4JB 3LNNA 3ZHQA 2YXLA 2WLIB 2DE0X 4PA7A 4LF6O 1QCEA 2BSKA 3G80A 4TV9B 2UUAB 4J10A 1VQMV 2UXCB 3L74H 1PD3A 4DV1B 2LGQA 2ODMA 3LSQA 2WPDG 4JI1B 2E75B 2CTQA 1Q82W 2JGDA 4FM0A 4OXSA 3ABKC 3IC9A 4MTFA 2WA3A 4ZBMA 4PDMA 2YUAA 2BOCC 3L9DA 3UQ8A 1JJOA 5IE9A 4JTAB 1UPGA 3GB7C 2UXBO 3ZHVA 5JJEB 2NR5A 2UXDB 4Q20A 1BHAA 3A8TA 5BMVA 2YIAA 4CZZA 1BSMA 2R70A 1FFXB 1NTKH 1HNWO 2FTKA 3JD0A 4DV7B 4AHCA 1CPYA 2R9IA 1IURA 4QE9A 4MVMA 1ZLZA 2P90A 4LWSB 2F95B 2KB1A 2WLJA 3VQVA 1K3EA 1CP9A 3J80N 4DR4O 4ZI7A 4LFCB 2X7RB 4GZRB 4XDJA 2VQEB 4FLWA 2OCCB 3OTOO 1V55C 2QKAA 2X0LA 3JD2A 1L1FA 5IYZB 1KMIZ 3ZX6A 5JCOA 3FYIB 3K04A 3HKEA 1AR5A 3W7XA 2FB5A 5D5PA 2EINB 3K58A 3CWBH 1PKXA 3N27A 3SPGA 4UCUA 1KKCA 1BGYH 1TVKA 4FPPA 3ZMVA 3P32A 2LJ2A 1N0JA 4K0KB 3JAWB 3RVZA 4I50A 4F6RA 1E1QG 3DSQA 1NJIW 4DV2B 2PY5A 2IJIA 3OGIB 2EIKB 4LWSA 2HFEC 4RUEA 4UVBA 3KDRA 1EZVH 4UV8A 1JR9A 4FVMA 3SYCA 3TXQA 5L3EA 5GONA 4X64O 4ZI7B 1R3LC 4JAVA 2PF4E 4JI8B 2LP7A 3BEHA 4DR3O 5L3CA 1XOUA 5IYDO 5LMNB 1PPJH 2RDCA 2LW7A 1KQSU 4X62B 1VQKV 4JI7O 3B77A 3ZRWB 1HNXB 2EIJC 2CGOA 1XNQO 1FXKC 2MW2B 4X1YB 1KP3A 3AG1B 4KFMA 3K5MA 2HJDA 3U10A 1NTZH 3X2QC 4BIOA 5EZYA 1WB7A 3E8HA 1VQOV 3WU2Z 3QO5A 1SERA 3AG2C 1MG1A 3STLC 5A9GA 1PNKA 2ZDIA 5GTIZ 5EK0A 5DN6G 3BA8A 3ZHTA 1U97A 2EIJB 3DXRB 1VQPV 1R3KC 5LL6Y 2QM8A 2OIGA 3DC6A 2EJRA 4X9QA 3OGCC 4KHPO 1EN5A 4MVUA 3BA9A 2JEXA 2F1MA 4O4LB 1NKDA 4X89A 3FB5C 1WN7A 2W6IG 1FS0G 3D8CA 4O4IA 3CE2A 3CSXA 4LP8A 3JAKB 3ZHSA 3QO8A 1U96A 2AGAA 1HW7A 1V54C 1SF9A 2RCVA 2EX3A 2DW4A 2HKOA 1I0HA 2X6BA 1WPBA 2GUZA 3OMAB 3APOA 3E8GA 3A2FA 1YVWA 4DV4O 4WCEV 5IWAO 4LH7A 1W0JG 4DR5O 4IGGA 2FKXA 5KX5A 3MD0A 4UCOA 2R9AA 4BIUA 1PNLA 1M9NA 1SA0A 1M4UA 5KA6A 4CS3A 1PNMA 2AXTZ 1SQVH 1YI2V 1P84F 4R7CA 4JI4B 2B1GA 3A0RA 2ITDC 1TAEA 2WA4A 3CRAA 1XNQB 3G6BA 4O4IB 4O2AB 3TJTA 1QR9A 2PGGA 4JI2B 3M8AA 2VS0A 2QE7G 1MMMA 3ASNC 1AJQA 2QKSA 1GTOA 4Z1MG 3UT5A 3ASOC 5FNVB 2GV9A 4MS2A 1Q6HA 4FM1A 4JYYA 2AW9A 4MVRA 4LBEC 3ZN1A 3BY6A 1HNZB 3OUFA 3P30A 3S3XA 5EYPB 1KC8W 1JFFA 1US6A 3CXCU 2HEPA 4K0KO 4DR2B 5IY5C 5CA0A 3IFXA 5E79Z 2HJFC 3JAKA 2O57A 4LF8O 4FM2A 4NTYA 3B8NA 1AI6A 2PYJA 4FFBA 1N36B 5CBHA 1YEWA 2BCCH 4JZGA 1ZL8A 1HNZO 1M57B 5H5NA 5J2UA 4GUNA 4ZOLA 4X65O 3VQXA 1HR0B 3R66A 4MT8A 1FKAO 3QO7A 4JV5O 4DR5B 1Q86W 1FOUA 3U0ZA 3M99B 3EVKA 1JJ2U 4I9QA 2P67A 4GT1A 5LGTA 3DTUB 5FNVA 3ASOB 3UO2A 5DM6V 4YJ2A 5LMUO 1IJGA 5IJ0B 3K03A 3OT7A 1JA8A 1L0LH 4CC6A 1MABG 4HBNA 1HWYA 3CRQA 2A0LA 3JD3A 4GX5A 1YZBA 1K5SA 4HNAA 4DV0O 1BS3A 1Y76B 1S5LZ 2ZE5A 2V7QG 2AHYA 3Q4HA 1NBMG 2JGUA 1KU9A 1PL4A 2XHBA 4B3SB 1SS3A 3JYCA 3ZMSA 2UUAO 4BWAA 4JI3B 1WAZA 2VQEO 3A0HZ 3UT5B 4FLYA 4DUYB 4DR1O 4CC5A 1N34B 1Q8IA 3NXSA 2H3OA 1T5EA 3H1LH 3CB2A 4KL1A 1FXVA 5LP6A 3SGIA 2HHHO 2XNDG 4B3TB 4FJCC 5H6QA 3W7TA 3SDLA 2WWWA 3KCYA 4FFBB 1DF4A 3DC5A 1ZAUA 1L8DA 2R72A 5IT9N 2Y4TA 3GVMA 2QGNA 3C3TA 5CMUA 1O9HA 3OEEG 4J41A 4DW1A 2Q4PA 3ZRSA 3CCMV 3T1YO 1GM9A 1R6TA 1DGSA 1AB3A 1KECA 4DV1O 1ENVA 1XMOB 4DV6O 3ZRWA 1OCZC 2E76B 2F4VO 3AK2A 4QGPA 1L0NH 1V9PA 3ML0A 3U11A 5E1AC 4FK5C 1XUQA 1Q90D 4O4JA 2UXNA 5LHIA 4DV0B 1URFA 4IHJB 4B08A 2V4DA 5B1BB 1CXZB 3IJ4A 3MDSA 4NXNB 4LF5B 3ICXA 1KKDA 2DQ0A 2AZ2A 1TA8A 2Y0PA 1XMOO 5JH7B 1ROPA 1JVMA 1S72V 4TV8A 3FAVA 1HDJA 3UM7A 3CP1A 3RWRD 2IH3C 1OJHA 3RGBA 3CJHB 3NR7A 1SETA 3JAMN 3HKDB 4PDLA 4P2ZA 3TK1A 1Q7YW 2R9RB 4LF5O 1IXMA 4JI8O 4DR4B 4GX2A 2IM9A 2EIMC 1B6QA 1VIBA 3LDDA 4QNHB 4N23A 2CAZC 3SPHA 3RVYA 4QIWF 2UXXA 3D3IA 2B1IA 2QWPB 3VQYA 2LFRA 4LFBO 4UXNA 1GK9A 4LFCO 3E2EA 1FXHA 1F4MA 2OTLV 1WP8A 2ZXWB 4JYAB 1BZKA 2P4KA 4JPRA 1G1XB 4DV3O 4U3JB 1K9MW 2WLLB 3JALA 4GX1A 3ZIAG 2ITCC 1JX9A 4H37A 4LC1A 3J81N 1K92A 4CS4A 1K8AW 1BHBA 1SQQH 3M7MX 2OIEA 5FL7G 1ZTEA 4DV5B 5EC1C 1S5HC 2ADQB 4DR7O 1KYOF 3TETA 1N33B 1RM1B 3SPJA 3HKCB 4TV9A 5LGNA 4AQYB 4JTDB 1X59A 1TVKB 3JASB 4PA4A 2P7TC 4I4TB 3SJQC 1NVPD 1NH2D 2YEVA 1DLBA 2Q0AA 1ZSPA 3T4DA 3ZRXA 2CUGA 5LHHA 3N2GB 4ZHQB 5ITZB 1YDXA 3OM3B 3ETEA 1EM1A 3H1HH 1MZEA 5KHHA 4W4LA 4DV4B 4MSWC 4TV8B 3AG1C 3CCJV 1GMGA 4ABMA 1G4YB 3B40A 1XNRB 1QBZA 2A06H 2Y69C 5LOVB 2GSMB 4AQYO 4TOIA 2QWOB 3CJHA 4BW9A 4JI7B 2Q5ZA 2F66C 4MVSA 4J7ZA 4R8CA 1NS1A 5LXTB 1FPOA 1IVSA 1N32B 2YC0A 1WPXA 1J5EO 2IW5A 1SQBH 3OMIB 5JVDA 2Q69A 4YJ3A 4X65B 1TUBA 3RT3C 3SYPA 3N2KB 2P5OA 2UXDO 3ZMZA 4L8JA 5HFLA 4MVQA 4JI2O 3FKSG 4GX0A 3LSUA 3K5LA 3CMAV 1H38A 3HKBB 2ZIMA 3SR2C 4X64B 3AG3C 4EEQA 1W0KG 3BHPA 2OT5A 1KB9F 4UCRA 2EULA 2GHYA 2D2CB 1XMQB 1N32O 4DR3B 4FFKA 4D7SA 2DYSC 2WLMA 2ZE7A 4FMTA 4YIPA 1RPRA 1NR1A 2F93B 4FLUA 5IWAB 4EKWA 3K9SA 3J7AU 3ZMUA 4FLTA 2L35A 3OTFA 1AVMA 2BTQA 3BABA 1FFTB 3I55V 2Z3YA 1OHHG 1RPOA 3IGAC 1SZXA 4U3FH 2EBOA 4NXMB 3JD4A 4LF4B 4DR1B 5GW7A 2W0XA 2PYLA 3ZS8C 1IBLO 4I0XB 4ZKIA 3RN4A 3ZRVA 1FXKA 3P3PA 1LUVA 3T1CA 1M1KW 2EILC 2CTPA 4RO2A 3CRCA 4ICGA 2LW1A 2NLJC 4AI8A 3AG4B 4UFZA 2XTAA 3E22A 5B66Z 4PA3A 4LFAB 4PDVA 5C8YA 3BRCA 2DQ3A 2RNBA 2B5UA 3G71V 5JVDB 4A5UB 3DGEA 1TUBB 2WLKA 4DUZB 2AZ0A 5IYZA 2LQTA 5CA1A 5LMNO 1FJGB 1OCCC 3N2KA 3K06A 1M90W 3CCQV 1HNXO 4GYCB 2YICA 1D5NA 1NU1H 3APQA 1RSOB 4LF7O 4R50A 1IBLB 2QSAA 4DV6B 3CC4V 4NKGB 2QKCA 2JDIG 1OV9A 4OPAA 1LR1A 3H01A 5DECA 3ABKB 4NVPA 3JCUZ 1HNWB 5A2QN 5B1BC 4J11A 1FXKB 3L72H 4O4HB 3W7UA 5J2TA 1SQXH 5KA5A 3K9AA 1M56B 3P3NA 4MW8A 4FLXA 4D6TH 4LR3A 2JVDA 3ZMTA 2X6CA 2UU9B 4MTGA 5IYBO 5LHGA 1OCZB 2ILMA 2JJ1G 2N74A 3G6EV 4D7TA 1YHQV 1AR4A 1Z2GA 2GTAA 2IBZH 2WAMA 2HHHB 2AHZA 4NXMO 4C7UA 3BVOA 2VQFB 1G8MA 1XBLA 2KKWA 3JATA 4K3AA 1H5WA 1J95A 4AILC 1EZJA 2ZINA 2XT9A 4LCUC 3OD4A 3E8BA 1YSCA 1XL4A 1FD9A 2KG7B 3BCCH 2NN4A 3E22B 1S77D 5KAFZ 5KHKA 4P9OA 4JI3O 1SC5B 1XILA 2CE4A 3RYIB 4RQEA 2ATKC 1S0VA 4BW5A 2CGNA 1F23A 1Q6UA 2Q7GA 4B3MB 1VF6C 3L71H 1I94B 2ZIOA 2E3CA 2ZNJA 1NR7A 1R6KA 1VMGA 2K9PA 1SQPH 5EIBC 3OUSA 4UVAA 1R73A 4ASUG 4NYKA 2IU3A 4UCVA 5CA0B 4B3TO 4UVCA 1O9GA 4WFHA 3CD6V 4O4HA 4GKKO 2YEVB 1MOFA 2ADPA 1Y4MA 2ZM6O 1IBKO 2ZNIA 4G27B 2YDEA 2KG7A 3O65A 1BL8A 2E74B 4ZHQA 1FAFA 3T1HO 3B2EE 3E8FA 1AP6A 4NR1A 1BQZA 4G28B 4KHPB 1THZA 2XAGA 2HLDG 3RYFA 2XASA 3QF7A 4WFEA 3RYHB 4F4LA 4B3MO 1RP3B 5HFMA 3S3WA 3VBBA 1JCHA 4BR6A 1M57C 4L87A 4DV3B 5CB4B 4X66O 4UCTA 4CH3A 3JCZA 1YJWV 1K73W 1W2BU 3SYQA 3CRRA 2EINC 3OR6C 2OWOA 3KZIZ 3K0DA 4P30A 5KAIZ 2EILB 3CCRV 1VQ8V 1OCOC 5KMGA 3B8MA 5KHIA 1R3IC 3D3QA 3I5DA 4PD4F 4NTXA 1MA1A 3T4ZA 4PI0A 2ZDIC 4Z1VA 1GAXA 3RW0A 2ZE6A 1KUQA 1B04A 3EHBB 3PJSK 4H0LB 1Y66A 4FZ1A 3AG7A 2DWDC 2YXYA 1KBHA 2Q7HA 2UU9O 1GN3A 2Y0IA 4YIOA 2JIZG 5EIBD 3CS5A 4H33A 1VQ6V 5J2UB 3FB7C 2F4VB 1XL6A 1YJNV 2LGWA 3VOUA 2Q0OC 3E35A 4NXNO 1G6UA 2QM7A 4DV7O 2YSUB 2BTQB 1H2MA 1IX9A 5EZYB 3WG7B 3W7SA 1YXBA 4DRXB 4EFBA 1WNSA 3F5WC 4I55B 1SQFA 5KMGB 2RN9A 2BOBC 3CCUV 1H2GA 2Z5UA 1PL0A 5EBWC 3DXRA 3FFQA 3RBZA 4X1IA 5B1AB 4OX9O 2D3OW 3AK3A 2WLLA 5K1PA 4IIJB 2P6JA 2HVKC 4IL6Z 4JASA 1N36O 2PTMA 5TISZ 4JI0B 3I56V 3MAQA 5D5QA 5EBMC 1D2DA 2DYRC 5IJ9A 1PV0A 3BPZA 4IHJA 4PELA 4RQFA 3K5NA 1HR0O 1GH6A 4DUZO 4TWKA 2HVJC 1JNBA 1I94O 2F23A 5F2VO 2DN9A 2HR3A 4JTCB 5KX5B 5JH7A 2A7WA 4ZIBA 1Q5OA 3G67A 4I55A 1IBMB 1K7DA 1J5EB 4WBNA 3STZC 5JQGB 4DR6B 2BSKB 4JYAO 5L3FA 4JAAA 1VQ5V 1HP8A 3HPLC 4X1IB 1NVPB 1IBKB 5L3BA 4DK0A 4J42A 2YIBA 2UUBB 3QTCA 4X1KB 4RWUA 3CHXA 3CEIA 5BR8O 4LF9B 3BAAA 5GTHZ 2PI4A 3W7WA 2Q67A 1I5XA 2GBOA 5EC2C 4DR6O 5CA3A 2X6AA 1OCRB 1BE3H 2W0FC 2QR4A 3K0GA 4U7OA 4X66B 1FFXA 3CYOA 3C90A 4JAUA 1I7FA 2FMLA 1TUEB 2IJJA 4OPHA 5LA6A 2QM4A 5KHGA 4MTOA 1E79G 1H8EG 1KP2A 1VQNV 1K34A 4WBNB 4YXWG 2ETNA 4YHHB 1A32A 2JJ2G 1DF5A 4U7NA 3HKCA 1PP9H 5LMUB 4YY3O 2QWNB 5BR8B 1Y74B 1P7GA 3FB6C 4FIPC 1ZL8B 3IAYA 3WB2A 2IH1C 4OGQB 2ZKOA 1Q43A 4RAIA 3OR7C 3TGUH 1H2SB 3HKEB 4X8AA 1Y67A 1OCOB 2JGDB 3GWKC 1N33O 1Y6XA 1TGOA 2CDYA 2DOSA 2QJ1A 5JJNB 3OW2U 3E83A 4F6EA 4PHZA 2M7WA 3K08A 3WB1A 2G38A 3H1IH 1DK1A 2Q73A 4JV5B 4JI6B 1QVGU 1GO3F 2F43G 3SPCA 1XDCA 3K3WA 1YJ9V 1YIJV 4X1KA 1OCCB 4O2BA 5GONB 3WFVA 3ABLB 2YXHA 5B3SB 2ZR3A 1Y74A 3RYHA 3X2QB 3GWOA 4I9WA 2UXCO 1SA0B 3LSSA 5B3SC 3JSLA 4TUYB 3E86A 1H2NA 1B06A 4X1YA 2FYUH 2JEUA 1S5JA 2JS5A 1RM1C 2XUMA 4Z2WA 1F51A 2ARHA 3K79A 3JASA 1VQLV 3ZBHA 4UB6Z 2DMXA 1WP7A 5BY1A 4B3SO 2VQFO 2C2AA 2PI5A 2Q7EA 3AG4C 1EN4A 1GRJA 4W4KA 2DWEC 1H2KA 3WG7C 4H13B 3CC7V 5BXZA 4H44B 2XAFA 4DUYO 4O2BB 4JI4O 4O4LA 4I5SA 1K4CC 2CH7B 2ZE8A 3SYOA 4B7EA 5K1XA 1GKFA 5LYJA 3LDCA 1R6NA 1AILA 4K8ZA 2JRIA 3H9VA 2QA4V 1VP7A 2GUZB 2FL4A 4JI5B 2OYQA 1WB8A 4U3JA 5BZBA 1COWG 2B9ZA 4GKJB 3ZJZA 1BMFG 5LBQA 2QTOA 4PA9A 5B5EZ 3ABUA 3AK1A 4J7KA 1V55B 1Q81W 1YTFD 4UV9A 2VWKA 4DR2O 1IDSA 3THOA 3C3SA 1UFIA 3AG3B 3FAVB
chains in the Genus database with same CATH topology
1MSDA 2QKCA 3DC5A 1GN6A 1EN6A 2P4KA 1IX9A 1I08A 2RCVA 3C3TA 1B06A 1AR5A 2ADPA 5AG2A 1I0HA 1IXBA 4JZ2A 4JZGA 4GUNA 1AP6A 1KKCA 4FFKA 1ZTEA 4YIPA 1N0JA 3EVKA 1N0NA 1BT8A 3AK3A 2ADQB 1AR4A 1AP5A 3AK2A 1GN2A 1EN4A 3K9SA 3OT7A 4BR6A 4C7UA 1JA8A 1XUQA 1QNMA 1ZUQA 3KDRA 1SZXA 1JR9A 1P7GA 1ZSPA 1LUWA 3MDSA 1BS3A 3IC9A 1XREA 1EM1A 3RN4A 1MNGA 1LUVA 1PL4A 3TJTA 1Y67A 2GDSA 1VARA 1WB8A 2CDYA 4E4EA 1VEWA 1MMMA 1MA1A 4F6EA 1PM9A 1BSMA 3BFRA 3KKYA 1XILA 2CE4A 3AK1A 1WB7A 1XDCA 4JYYA 2AW9A 1ZLZA 5A9GA 1GN4A 1IDSA 1GN3A 3C3SA 3QVNA 4YIOA 3DC6A 4X9QA 1D5NA 1EN5A 1AVMA 3CEIA 2QKAA 3LSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MSD A;  2QKC A;  3DC5 A;  1GN6 A;  1EN6 A;  2P4K A;  1IX9 A;  1I08 A;  2RCV A;  3C3T A;  1B06 A;  1AR5 A;  2ADP A;  5AG2 A;  1I0H A;  1IXB A;  4JZ2 A;  4JZG A;  4GUN A;  1AP6 A;  1KKC A;  4FFK A;  1ZTE A;  4YIP A;  1N0J A;  3EVK A;  1N0N A;  1BT8 A;  3AK3 A;  2ADQ B;  1AR4 A;  1AP5 A;  3AK2 A;  1GN2 A;  1EN4 A;  3K9S A;  3OT7 A;  4BR6 A;  4C7U A;  1JA8 A;  1XUQ A;  1QNM A;  1ZUQ A;  1SZX A;  1JR9 A;  1P7G A;  1ZSP A;  1LUW A;  3MDS A;  1BS3 A;  3IC9 A;  1XRE A;  1EM1 A;  3RN4 A;  1MNG A;  1LUV A;  1PL4 A;  3TJT A;  1Y67 A;  2GDS A;  1VAR A;  1WB8 A;  2CDY A;  4E4E A;  1VEW A;  1MMM A;  1MA1 A;  4F6E A;  1PM9 A;  1BSM A;  3BFR A;  3KKY A;  1XIL A;  2CE4 A;  3AK1 A;  1WB7 A;  1XDC A;  4JYY A;  2AW9 A;  1ZLZ A;  5A9G A;  1GN4 A;  1IDS A;  1GN3 A;  3C3S A;  3QVN A;  4YIO A;  3DC6 A;  4X9Q A;  1D5N A;  1EN5 A;  1AVM A;  3CEI A;  2QKA A;  3LSU A; 
#chains in the Genus database with same CATH topology
 4IIJ A;  2LFS A;  4TUY A;  1MSD A;  2HG5 C;  1AJP A;  2YIB D;  5B1O A;  3ZED A;  4FLZ A;  5DED A;  2UXB B;  4QE7 A;  1EN6 A;  5CBG A;  5LYJ B;  1QLE B;  1GM8 A;  4Q6G A;  3LNM B;  3D36 A;  2JS3 A;  2VRZ A;  4HNA B;  3ABT A;  1BCC H;  3CC2 V;  3JAW A;  3Q4H B;  5KHJ A;  1P49 A;  1XHZ A;  1N0N A;  1W59 A;  5H9C A;  3KG2 A;  2LO1 A;  1AP5 A;  4QPJ A;  2YID A;  2Y69 B;  1EBO A;  4LF6 B;  4MW3 A;  5JQG A;  5H2F Z;  1QNM A;  3R65 A;  2CH7 A;  4DYL A;  4EB6 A;  4IYI A;  1XI1 A;  3HB3 B;  3JAL B;  3LDE A;  1MSW D;  1X4T A;  2Z0A A;  3SYA A;  3JD1 A;  2IJK A;  2UUC B;  1VQ4 V;  2PZS A;  3FB8 C;  4X20 A;  5LP6 B;  1SRY A;  2GDS A;  4R6Z A;  2OCH A;  3QNE A;  1WLE A;  1H2L A;  4DO2 A;  1YTF B;  4J80 A;  1RFY A;  3PN1 A;  1SZT A;  2OTJ V;  1H8H G;  1WJZ A;  4JI0 O;  1EFR G;  4I4T A;  4KUM A;  3KKY A;  4B3R O;  3TXS A;  4E2L A;  1VF6 A;  1XQ8 A;  4YJ2 B;  5B1A C;  1Q6I A;  3N2G A;  5LGU A;  5ITZ A;  3UKM A;  2EIM B;  5FPO A;  5L3D A;  1NTM H;  1GM7 A;  2H8P C;  5L3G A;  2JK5 C;  1JOY A;  4XBF A;  1ARO P;  3JAR A;  4WFB V;  2NNU A;  4PDR A;  1Y76 A;  1JMK C;  2KSD A;  2N04 A;  1JPX A;  2QEX V;  2CTW A;  3KCX A;  1K4D C;  1GN6 A;  3B4S A;  3L75 H;  4B3R B;  4LFA O;  4HAM A;  2OCC C;  4I0X A;  2Y4U A;  4JI1 O;  3CPW U;  1I08 A;  3ABM C;  2RMK B;  4F6R B;  4TQF A;  5AG2 A;  5KUM A;  1IXB A;  2IJH A;  4JZ2 A;  4J9Y B;  5LP6 C;  3SJC C;  3T1Y B;  1AI5 A;  1XNR O;  1OCR C;  2EZP A;  3CX5 F;  4I7Z B;  1Z5V A;  4TSF G;  1DTO A;  2K1E A;  4LF9 O;  3SPI A;  3L70 H;  4BIZ A;  4J7J A;  4GKJ O;  1GN2 A;  2A9H A;  4EB6 B;  4FZ0 A;  3OE7 G;  4GKK B;  2ZCE A;  3QG5 A;  2RQ6 A;  3AG2 B;  4P9P A;  4N21 A;  4LFB B;  1VQ9 V;  3K57 A;  3JAR B;  5CB4 A;  4TT3 G;  4DW0 A;  5IJ0 A;  4O2A A;  3ZCC A;  1MNG A;  4EFE A;  4DV5 O;  3CME V;  1IBM O;  3OTO B;  1P4R A;  1VEW A;  2QWQ B;  4DXW A;  1NI8 A;  4MVZ A;  2WSS G;  3BFR A;  4MTX A;  1CEZ A;  4PA6 A;  5C93 A;  3IC7 A;  1XMQ O;  5EBL C;  2DJV A;  5JWP A;  2CK3 G;  3L73 H;  1ORQ C;  3OAA G;  2YS8 A;  1F4N A;  3AEI A;  5EYP A;  4UB8 Z;  1QR8 A;  3OFN G;  4CH6 A;  1S76 D;  3MHH C;  1S3J A;  1IZ3 A;  1WA8 B;  2MK3 A;  1QLN A;  4CH4 A;  4XDL A;  2ZR2 A;  4GLX A;  4K35 A;  3H1J H;  2Q9L A;  1N8R W;  2BE3 A;  5KUK A;  1R1B A;  1YIT V;  4JI6 O;  3CXH F;  1BQ0 A;  3ABM B;  3RYF B;  1AR1 B;  4BAY A;  1K5Q A;  4X62 O;  1NQT A;  5CA1 B;  3MHS C;  4PI2 A;  3CCL V;  1Z5W A;  2E5L O;  4G2K A;  1M93 A;  4JYC A;  4DR7 B;  3E89 A;  4QJF B;  1Q3E A;  2DYS B;  3F7Y C;  3ZHU A;  1BT8 A;  3RYI A;  1VQ7 V;  5LOV A;  4JI5 O;  3K59 A;  3A0B Z;  5FLX N;  3FX7 A;  1YF2 A;  3RYC B;  5IYC O;  2Q68 A;  1SES A;  4PJ0 Z;  1V54 B;  1ZUQ A;  1FJG O;  5IDJ A;  3D36 C;  2RJZ A;  2YI9 A;  4WF9 V;  3T1H B;  1NZ6 A;  1AI7 A;  1WA8 A;  4LNU A;  1YCI A;  1XRE A;  1AJN A;  3OMN B;  1KD1 W;  2UUB O;  2Q6A A;  4MVO A;  1FYJ A;  1NH2 B;  4I50 B;  3H1K H;  3B09 A;  5CN0 A;  4RUF A;  1D5A A;  4DV2 O;  3SJB C;  2QTS A;  1JFF B;  1SKV A;  1QQC A;  3JAT B;  1B3Q A;  2H94 A;  1XHX A;  3ZHR A;  3TCU A;  1P7B A;  2VWJ A;  1SQG A;  4CBC A;  4FLV A;  1VF7 A;  1QHT A;  3VQW A;  1M56 C;  3JSN A;  4LF4 O;  1QU7 A;  2P06 A;  3QVN A;  4WFG A;  1JQ0 A;  4X88 A;  3CCE V;  5JJJ B;  2EZO A;  3ETG A;  4ZOL B;  4B7K A;  1R3J C;  4GCZ A;  4WFA V;  5KLV H;  2BTO A;  5IY5 B;  3CCS V;  2DYR B;  4LNU B;  2P4V A;  1N34 O;  2IU0 A;  4QPK A;  4YY3 B;  2GTS A;  4JF3 A;  3ABL C;  2EIK C;  3RFR A;  4NTW A;  2E5L B;  1QLE C;  2M6Y A;  2A3Q A;  3EFF K;  4X20 B;  4HYO A;  3ETD A;  4YJ3 B;  3RYC A;  3CRM A;  3ASN B;  2Y48 A;  4IYH A;  1LNQ A;  2YI8 A;  1XEQ A;  4LF7 B;  5C8Y B;  3HKB A;  1QVF U;  2WLH A;  2ZXW C;  3LUT B;  1LUW A;  1UJW B;  2V1D A;  4NB5 A;  2ZT9 B;  4LH6 A;  2P22 C;  4CH5 A;  4LF8 B;  4HZ3 A;  3UCS C;  4CS2 A;  4OX9 B;  3CCV V;  3EXA A;  2ZD9 A;  5JCO C;  2HP8 A;  4TQD A;  3K5O A;  1VAR A;  1RSO A;  4KP4 A;  4E4E A;  5H6R A;  4YHH O;  1M5I A;  4IT5 A;  3UO3 A;  3ETQ A;  1ZWI C;  1PM9 A;  4DRX A;  2ZM6 B;  2QWR B;  2KQX A;  2XAH A;  3SJA C;  2WLI A;  4DK1 A;  2QDO A;  3HKD A;  1VF5 B;  3FD9 A;  3OEH G;  5B1N A;  3WB0 A;  3F7V C;  1K97 A;  2EJ7 A;  3FYE B;  4J9Z B;  4K8X A;  2ZQM A;  5J2T B;  5J9P C;  1K33 A;  4PV1 B;  2CTR A;  2UUC O;  4UUJ C;  3ZN0 A;  1OZ0 A;  3G4S V;  2PUS A;  1GN4 A;  1F7Y A;  1ZX3 A;  5FPR A;  2Q8V A;  3HR0 A;  5LXT A;  2XOK G;  4JYB A;  5CBF A;  1AI4 A;  5IJ9 B;  3T2M A;  5LA6 B;  2A79 B;  2L6L A;  2WLN A;  1E1R G;  4JGS A;  5BMV B;  4XDK A;  2N05 A;  2W6J G;  1NT2 B;  3F5T A;  4WFF A;  4KXR A;  1MZF A;  2XAJ A;  1N4C A;  4UCS A;  3O9O A;  1I5Y A;  2XAQ A;  4O4J B;  3LNN A;  3ZHQ A;  2YXL A;  2WLI B;  2DE0 X;  4PA7 A;  4LF6 O;  1QCE A;  2BSK A;  3G80 A;  4TV9 B;  2UUA B;  4J10 A;  1VQM V;  2UXC B;  3L74 H;  1PD3 A;  4DV1 B;  2LGQ A;  2ODM A;  3LSQ A;  2WPD G;  4JI1 B;  2E75 B;  2CTQ A;  1Q82 W;  2JGD A;  4FM0 A;  4OXS A;  3ABK C;  3IC9 A;  4MTF A;  2WA3 A;  4ZBM A;  4PDM A;  2YUA A;  2BOC C;  3L9D A;  3UQ8 A;  1JJO A;  5IE9 A;  4JTA B;  1UPG A;  3GB7 C;  2UXB O;  3ZHV A;  5JJE B;  2NR5 A;  2UXD B;  4Q20 A;  1BHA A;  3A8T A;  5BMV A;  2YIA A;  4CZZ A;  1BSM A;  2R70 A;  1FFX B;  1NTK H;  1HNW O;  2FTK A;  3JD0 A;  4DV7 B;  4AHC A;  1CPY A;  2R9I A;  1IUR A;  4QE9 A;  4MVM A;  1ZLZ A;  2P90 A;  4LWS B;  2F95 B;  2KB1 A;  2WLJ A;  3VQV A;  1K3E A;  1CP9 A;  3J80 N;  4DR4 O;  4ZI7 A;  4LFC B;  2X7R B;  4GZR B;  4XDJ A;  2VQE B;  4FLW A;  2OCC B;  3OTO O;  1V55 C;  2QKA A;  2X0L A;  3JD2 A;  1L1F A;  5IYZ B;  1KMI Z;  3ZX6 A;  5JCO A;  3FYI B;  3K04 A;  3HKE A;  1AR5 A;  3W7X A;  2FB5 A;  5D5P A;  2EIN B;  3K58 A;  3CWB H;  1PKX A;  3N27 A;  3SPG A;  4UCU A;  1KKC A;  1BGY H;  1TVK A;  4FPP A;  3ZMV A;  3P32 A;  2LJ2 A;  1N0J A;  4K0K B;  3JAW B;  3RVZ A;  4I50 A;  4F6R A;  1E1Q G;  3DSQ A;  1NJI W;  4DV2 B;  2PY5 A;  2IJI A;  3OGI B;  2EIK B;  4LWS A;  2HFE C;  4RUE A;  4UVB A;  3KDR A;  1EZV H;  4UV8 A;  1JR9 A;  4FVM A;  3SYC A;  3TXQ A;  5L3E A;  5GON A;  4X64 O;  4ZI7 B;  1R3L C;  4JAV A;  2PF4 E;  4JI8 B;  2LP7 A;  3BEH A;  4DR3 O;  5L3C A;  1XOU A;  5IYD O;  5LMN B;  1PPJ H;  2RDC A;  2LW7 A;  1KQS U;  4X62 B;  1VQK V;  4JI7 O;  3B77 A;  3ZRW B;  1HNX B;  2EIJ C;  2CGO A;  1XNQ O;  1FXK C;  2MW2 B;  4X1Y B;  1KP3 A;  3AG1 B;  4KFM A;  3K5M A;  2HJD A;  3U10 A;  1NTZ H;  3X2Q C;  4BIO A;  5EZY A;  1WB7 A;  3E8H A;  1VQO V;  3WU2 Z;  3QO5 A;  1SER A;  3AG2 C;  1MG1 A;  3STL C;  5A9G A;  1PNK A;  2ZDI A;  5GTI Z;  5EK0 A;  5DN6 G;  3BA8 A;  3ZHT A;  1U97 A;  2EIJ B;  3DXR B;  1VQP V;  1R3K C;  5LL6 Y;  2QM8 A;  2OIG A;  3DC6 A;  2EJR A;  4X9Q A;  3OGC C;  4KHP O;  1EN5 A;  4MVU A;  3BA9 A;  2JEX A;  2F1M A;  4O4L B;  1NKD A;  4X89 A;  3FB5 C;  1WN7 A;  2W6I G;  1FS0 G;  3D8C A;  4O4I A;  3CE2 A;  3CSX A;  4LP8 A;  3JAK B;  3ZHS A;  3QO8 A;  1U96 A;  2AGA A;  1HW7 A;  1V54 C;  1SF9 A;  2RCV A;  2EX3 A;  2DW4 A;  2HKO A;  1I0H A;  2X6B A;  1WPB A;  2GUZ A;  3OMA B;  3APO A;  3E8G A;  3A2F A;  1YVW A;  4DV4 O;  4WCE V;  5IWA O;  4LH7 A;  1W0J G;  4DR5 O;  4IGG A;  2FKX A;  5KX5 A;  3MD0 A;  4UCO A;  2R9A A;  4BIU A;  1PNL A;  1M9N A;  1SA0 A;  1M4U A;  5KA6 A;  4CS3 A;  1PNM A;  2AXT Z;  1SQV H;  1YI2 V;  1P84 F;  4R7C A;  4JI4 B;  2B1G A;  3A0R A;  2ITD C;  1TAE A;  2WA4 A;  3CRA A;  1XNQ B;  3G6B A;  4O4I B;  4O2A B;  3TJT A;  1QR9 A;  2PGG A;  4JI2 B;  3M8A A;  2VS0 A;  2QE7 G;  1MMM A;  3ASN C;  1AJQ A;  2QKS A;  1GTO A;  4Z1M G;  3UT5 A;  3ASO C;  5FNV B;  2GV9 A;  4MS2 A;  1Q6H A;  4FM1 A;  4JYY A;  2AW9 A;  4MVR A;  4LBE C;  3ZN1 A;  3BY6 A;  1HNZ B;  3OUF A;  3P30 A;  3S3X A;  5EYP B;  1KC8 W;  1JFF A;  1US6 A;  3CXC U;  2HEP A;  4K0K O;  4DR2 B;  5IY5 C;  5CA0 A;  3IFX A;  5E79 Z;  2HJF C;  3JAK A;  2O57 A;  4LF8 O;  4FM2 A;  4NTY A;  3B8N A;  1AI6 A;  2PYJ A;  4FFB A;  1N36 B;  5CBH A;  1YEW A;  2BCC H;  4JZG A;  1ZL8 A;  1HNZ O;  1M57 B;  5H5N A;  5J2U A;  4GUN A;  4ZOL A;  4X65 O;  3VQX A;  1HR0 B;  3R66 A;  4MT8 A;  1FKA O;  3QO7 A;  4JV5 O;  4DR5 B;  1Q86 W;  1FOU A;  3U0Z A;  3M99 B;  3EVK A;  1JJ2 U;  4I9Q A;  2P67 A;  4GT1 A;  5LGT A;  3DTU B;  5FNV A;  3ASO B;  3UO2 A;  5DM6 V;  4YJ2 A;  5LMU O;  1IJG A;  5IJ0 B;  3K03 A;  3OT7 A;  1JA8 A;  1L0L H;  4CC6 A;  1MAB G;  4HBN A;  1HWY A;  3CRQ A;  2A0L A;  3JD3 A;  4GX5 A;  1YZB A;  1K5S A;  4HNA A;  4DV0 O;  1BS3 A;  1Y76 B;  1S5L Z;  2ZE5 A;  2V7Q G;  2AHY A;  3Q4H A;  1NBM G;  2JGU A;  1KU9 A;  1PL4 A;  2XHB A;  4B3S B;  1SS3 A;  3JYC A;  3ZMS A;  2UUA O;  4BWA A;  4JI3 B;  1WAZ A;  2VQE O;  3A0H Z;  3UT5 B;  4FLY A;  4DUY B;  4DR1 O;  4CC5 A;  1N34 B;  1Q8I A;  3NXS A;  2H3O A;  1T5E A;  3H1L H;  3CB2 A;  4KL1 A;  1FXV A;  5LP6 A;  3SGI A;  2HHH O;  2XND G;  4B3T B;  4FJC C;  5H6Q A;  3W7T A;  3SDL A;  2WWW A;  3KCY A;  4FFB B;  1DF4 A;  3DC5 A;  1ZAU A;  1L8D A;  2R72 A;  5IT9 N;  2Y4T A;  3GVM A;  2QGN A;  3C3T A;  5CMU A;  1O9H A;  3OEE G;  4J41 A;  4DW1 A;  2Q4P A;  3ZRS A;  3CCM V;  3T1Y O;  1GM9 A;  1R6T A;  1DGS A;  1AB3 A;  1KEC A;  4DV1 O;  1ENV A;  1XMO B;  4DV6 O;  3ZRW A;  1OCZ C;  2E76 B;  2F4V O;  3AK2 A;  4QGP A;  1L0N H;  1V9P A;  3ML0 A;  3U11 A;  5E1A C;  4FK5 C;  1XUQ A;  1Q90 D;  4O4J A;  2UXN A;  5LHI A;  4DV0 B;  1URF A;  4IHJ B;  4B08 A;  2V4D A;  5B1B B;  1CXZ B;  3IJ4 A;  3MDS A;  4NXN B;  4LF5 B;  3ICX A;  1KKD A;  2DQ0 A;  2AZ2 A;  1TA8 A;  2Y0P A;  1XMO O;  5JH7 B;  1ROP A;  1JVM A;  1S72 V;  4TV8 A;  3FAV A;  1HDJ A;  3UM7 A;  3CP1 A;  3RWR D;  2IH3 C;  1OJH A;  3RGB A;  3CJH B;  3NR7 A;  1SET A;  3JAM N;  3HKD B;  4PDL A;  4P2Z A;  3TK1 A;  1Q7Y W;  2R9R B;  4LF5 O;  1IXM A;  4JI8 O;  4DR4 B;  4GX2 A;  2IM9 A;  2EIM C;  1B6Q A;  1VIB A;  3LDD A;  4QNH B;  4N23 A;  2CAZ C;  3SPH A;  3RVY A;  4QIW F;  2UXX A;  3D3I A;  2B1I A;  2QWP B;  3VQY A;  2LFR A;  4LFB O;  4UXN A;  1GK9 A;  4LFC O;  3E2E A;  1FXH A;  1F4M A;  2OTL V;  1WP8 A;  2ZXW B;  4JYA B;  1BZK A;  2P4K A;  4JPR A;  1G1X B;  4DV3 O;  4U3J B;  1K9M W;  2WLL B;  3JAL A;  4GX1 A;  3ZIA G;  2ITC C;  1JX9 A;  4H37 A;  4LC1 A;  3J81 N;  1K92 A;  4CS4 A;  1K8A W;  1BHB A;  1SQQ H;  3M7M X;  2OIE A;  5FL7 G;  1ZTE A;  4DV5 B;  5EC1 C;  1S5H C;  2ADQ B;  4DR7 O;  1KYO F;  3TET A;  1N33 B;  1RM1 B;  3SPJ A;  3HKC B;  4TV9 A;  5LGN A;  4AQY B;  4JTD B;  1X59 A;  1TVK B;  3JAS B;  4PA4 A;  2P7T C;  4I4T B;  3SJQ C;  1NVP D;  1NH2 D;  2YEV A;  1DLB A;  2Q0A A;  1ZSP A;  3T4D A;  3ZRX A;  2CUG A;  5LHH A;  3N2G B;  4ZHQ B;  5ITZ B;  1YDX A;  3OM3 B;  3ETE A;  1EM1 A;  3H1H H;  1MZE A;  5KHH A;  4W4L A;  4DV4 B;  4MSW C;  4TV8 B;  3AG1 C;  3CCJ V;  1GMG A;  4ABM A;  1G4Y B;  3B40 A;  1XNR B;  1QBZ A;  2A06 H;  2Y69 C;  5LOV B;  2GSM B;  4AQY O;  4TOI A;  2QWO B;  3CJH A;  4BW9 A;  4JI7 B;  2Q5Z A;  2F66 C;  4MVS A;  4J7Z A;  4R8C A;  1NS1 A;  5LXT B;  1FPO A;  1IVS A;  1N32 B;  2YC0 A;  1WPX A;  1J5E O;  2IW5 A;  1SQB H;  3OMI B;  5JVD A;  2Q69 A;  4YJ3 A;  4X65 B;  1TUB A;  3RT3 C;  3SYP A;  3N2K B;  2P5O A;  2UXD O;  3ZMZ A;  4L8J A;  5HFL A;  4MVQ A;  4JI2 O;  3FKS G;  4GX0 A;  3LSU A;  3K5L A;  3CMA V;  1H38 A;  3HKB B;  2ZIM A;  3SR2 C;  4X64 B;  3AG3 C;  4EEQ A;  1W0K G;  3BHP A;  2OT5 A;  1KB9 F;  4UCR A;  2EUL A;  2GHY A;  2D2C B;  1XMQ B;  1N32 O;  4DR3 B;  4FFK A;  4D7S A;  2DYS C;  2WLM A;  2ZE7 A;  4FMT A;  4YIP A;  1RPR A;  1NR1 A;  2F93 B;  4FLU A;  5IWA B;  4EKW A;  3K9S A;  3J7A U;  3ZMU A;  4FLT A;  2L35 A;  3OTF A;  1AVM A;  2BTQ A;  3BAB A;  1FFT B;  3I55 V;  2Z3Y A;  1OHH G;  1RPO A;  3IGA C;  1SZX A;  4U3F H;  2EBO A;  4NXM B;  3JD4 A;  4LF4 B;  4DR1 B;  5GW7 A;  2W0X A;  2PYL A;  3ZS8 C;  1IBL O;  4I0X B;  4ZKI A;  3RN4 A;  3ZRV A;  1FXK A;  3P3P A;  1LUV A;  3T1C A;  1M1K W;  2EIL C;  2CTP A;  4RO2 A;  3CRC A;  4ICG A;  2LW1 A;  2NLJ C;  4AI8 A;  3AG4 B;  4UFZ A;  2XTA A;  3E22 A;  5B66 Z;  4PA3 A;  4LFA B;  4PDV A;  5C8Y A;  3BRC A;  2DQ3 A;  2RNB A;  2B5U A;  3G71 V;  5JVD B;  4A5U B;  3DGE A;  1TUB B;  2WLK A;  4DUZ B;  2AZ0 A;  5IYZ A;  2LQT A;  5CA1 A;  5LMN O;  1FJG B;  1OCC C;  3N2K A;  3K06 A;  1M90 W;  3CCQ V;  1HNX O;  4GYC B;  2YIC A;  1D5N A;  1NU1 H;  3APQ A;  1RSO B;  4LF7 O;  4R50 A;  1IBL B;  2QSA A;  4DV6 B;  3CC4 V;  4NKG B;  2QKC A;  2JDI G;  1OV9 A;  4OPA A;  1LR1 A;  3H01 A;  5DEC A;  3ABK B;  4NVP A;  3JCU Z;  1HNW B;  5A2Q N;  5B1B C;  4J11 A;  1FXK B;  3L72 H;  4O4H B;  3W7U A;  5J2T A;  1SQX H;  5KA5 A;  3K9A A;  1M56 B;  3P3N A;  4MW8 A;  4FLX A;  4D6T H;  4LR3 A;  2JVD A;  3ZMT A;  2X6C A;  2UU9 B;  4MTG A;  5IYB O;  5LHG A;  1OCZ B;  2ILM A;  2JJ1 G;  2N74 A;  3G6E V;  4D7T A;  1YHQ V;  1AR4 A;  1Z2G A;  2GTA A;  2IBZ H;  2WAM A;  2HHH B;  2AHZ A;  4NXM O;  4C7U A;  3BVO A;  2VQF B;  1G8M A;  1XBL A;  2KKW A;  3JAT A;  4K3A A;  1H5W A;  1J95 A;  4AIL C;  1EZJ A;  2ZIN A;  2XT9 A;  4LCU C;  3OD4 A;  3E8B A;  1YSC A;  1XL4 A;  1FD9 A;  2KG7 B;  3BCC H;  2NN4 A;  3E22 B;  1S77 D;  5KAF Z;  5KHK A;  4P9O A;  4JI3 O;  1SC5 B;  1XIL A;  2CE4 A;  3RYI B;  4RQE A;  2ATK C;  1S0V A;  4BW5 A;  2CGN A;  1F23 A;  1Q6U A;  2Q7G A;  4B3M B;  1VF6 C;  3L71 H;  1I94 B;  2ZIO A;  2E3C A;  2ZNJ A;  1NR7 A;  1R6K A;  1VMG A;  2K9P A;  1SQP H;  5EIB C;  3OUS A;  4UVA A;  1R73 A;  4ASU G;  4NYK A;  2IU3 A;  4UCV A;  5CA0 B;  4B3T O;  4UVC A;  1O9G A;  4WFH A;  3CD6 V;  4O4H A;  4GKK O;  2YEV B;  1MOF A;  2ADP A;  1Y4M A;  2ZM6 O;  1IBK O;  2ZNI A;  4G27 B;  2YDE A;  2KG7 A;  3O65 A;  1BL8 A;  2E74 B;  4ZHQ A;  1FAF A;  3T1H O;  3B2E E;  3E8F A;  1AP6 A;  4NR1 A;  1BQZ A;  4G28 B;  4KHP B;  1THZ A;  2XAG A;  2HLD G;  3RYF A;  2XAS A;  3QF7 A;  4WFE A;  3RYH B;  4F4L A;  4B3M O;  1RP3 B;  5HFM A;  3S3W A;  3VBB A;  1JCH A;  4BR6 A;  1M57 C;  4L87 A;  4DV3 B;  5CB4 B;  4X66 O;  4UCT A;  4CH3 A;  3JCZ A;  1YJW V;  1K73 W;  1W2B U;  3SYQ A;  3CRR A;  2EIN C;  3OR6 C;  2OWO A;  3KZI Z;  3K0D A;  4P30 A;  5KAI Z;  2EIL B;  3CCR V;  1VQ8 V;  1OCO C;  5KMG A;  3B8M A;  5KHI A;  1R3I C;  3D3Q A;  3I5D A;  4PD4 F;  4NTX A;  1MA1 A;  3T4Z A;  4PI0 A;  2ZDI C;  4Z1V A;  1GAX A;  3RW0 A;  2ZE6 A;  1KUQ A;  1B04 A;  3EHB B;  3PJS K;  4H0L B;  1Y66 A;  4FZ1 A;  3AG7 A;  2DWD C;  2YXY A;  1KBH A;  2Q7H A;  2UU9 O;  1GN3 A;  2Y0I A;  4YIO A;  2JIZ G;  5EIB D;  3CS5 A;  4H33 A;  1VQ6 V;  5J2U B;  3FB7 C;  2F4V B;  1XL6 A;  1YJN V;  2LGW A;  3VOU A;  2Q0O C;  3E35 A;  4NXN O;  1G6U A;  2QM7 A;  4DV7 O;  2YSU B;  2BTQ B;  1H2M A;  1IX9 A;  5EZY B;  3WG7 B;  3W7S A;  1YXB A;  4DRX B;  4EFB A;  1WNS A;  3F5W C;  4I55 B;  1SQF A;  5KMG B;  2RN9 A;  2BOB C;  3CCU V;  1H2G A;  2Z5U A;  1PL0 A;  5EBW C;  3DXR A;  3FFQ A;  3RBZ A;  4X1I A;  5B1A B;  4OX9 O;  2D3O W;  3AK3 A;  2WLL A;  5K1P A;  4IIJ B;  2P6J A;  2HVK C;  4IL6 Z;  4JAS A;  1N36 O;  2PTM A;  5TIS Z;  4JI0 B;  3I56 V;  3MAQ A;  5D5Q A;  5EBM C;  1D2D A;  2DYR C;  5IJ9 A;  1PV0 A;  3BPZ A;  4IHJ A;  4PEL A;  4RQF A;  3K5N A;  1HR0 O;  1GH6 A;  4DUZ O;  4TWK A;  2HVJ C;  1JNB A;  1I94 O;  2F23 A;  5F2V O;  2DN9 A;  2HR3 A;  4JTC B;  5KX5 B;  5JH7 A;  2A7W A;  4ZIB A;  1Q5O A;  3G67 A;  4I55 A;  1IBM B;  1K7D A;  1J5E B;  4WBN A;  3STZ C;  5JQG B;  4DR6 B;  2BSK B;  4JYA O;  5L3F A;  4JAA A;  1VQ5 V;  1HP8 A;  3HPL C;  4X1I B;  1NVP B;  1IBK B;  5L3B A;  4DK0 A;  4J42 A;  2YIB A;  2UUB B;  3QTC A;  4X1K B;  4RWU A;  3CHX A;  3CEI A;  5BR8 O;  4LF9 B;  3BAA A;  5GTH Z;  2PI4 A;  3W7W A;  2Q67 A;  1I5X A;  2GBO A;  5EC2 C;  4DR6 O;  5CA3 A;  2X6A A;  1OCR B;  1BE3 H;  2W0F C;  2QR4 A;  3K0G A;  4U7O A;  4X66 B;  1FFX A;  3CYO A;  3C90 A;  4JAU A;  1I7F A;  2FML A;  1TUE B;  2IJJ A;  4OPH A;  5LA6 A;  2QM4 A;  5KHG A;  4MTO A;  1E79 G;  1H8E G;  1KP2 A;  1VQN V;  1K34 A;  4WBN B;  4YXW G;  2ETN A;  4YHH B;  1A32 A;  2JJ2 G;  1DF5 A;  4U7N A;  3HKC A;  1PP9 H;  5LMU B;  4YY3 O;  2QWN B;  5BR8 B;  1Y74 B;  1P7G A;  3FB6 C;  4FIP C;  1ZL8 B;  3IAY A;  3WB2 A;  2IH1 C;  4OGQ B;  2ZKO A;  1Q43 A;  4RAI A;  3OR7 C;  3TGU H;  1H2S B;  3HKE B;  4X8A A;  1Y67 A;  1OCO B;  2JGD B;  3GWK C;  1N33 O;  1Y6X A;  1TGO A;  2CDY A;  2DOS A;  2QJ1 A;  5JJN B;  3OW2 U;  3E83 A;  4F6E A;  4PHZ A;  2M7W A;  3K08 A;  3WB1 A;  2G38 A;  3H1I H;  1DK1 A;  2Q73 A;  4JV5 B;  4JI6 B;  1QVG U;  1GO3 F;  2F43 G;  3SPC A;  1XDC A;  3K3W A;  1YJ9 V;  1YIJ V;  4X1K A;  1OCC B;  4O2B A;  5GON B;  3WFV A;  3ABL B;  2YXH A;  5B3S B;  2ZR3 A;  1Y74 A;  3RYH A;  3X2Q B;  3GWO A;  4I9W A;  2UXC O;  1SA0 B;  3LSS A;  5B3S C;  3JSL A;  4TUY B;  3E86 A;  1H2N A;  1B06 A;  4X1Y A;  2FYU H;  2JEU A;  1S5J A;  2JS5 A;  1RM1 C;  2XUM A;  4Z2W A;  1F51 A;  2ARH A;  3K79 A;  3JAS A;  1VQL V;  3ZBH A;  4UB6 Z;  2DMX A;  1WP7 A;  5BY1 A;  4B3S O;  2VQF O;  2C2A A;  2PI5 A;  2Q7E A;  3AG4 C;  1EN4 A;  1GRJ A;  4W4K A;  2DWE C;  1H2K A;  3WG7 C;  4H13 B;  3CC7 V;  5BXZ A;  4H44 B;  2XAF A;  4DUY O;  4O2B B;  4JI4 O;  4O4L A;  4I5S A;  1K4C C;  2CH7 B;  2ZE8 A;  3SYO A;  4B7E A;  5K1X A;  1GKF A;  5LYJ A;  3LDC A;  1R6N A;  1AIL A;  4K8Z A;  2JRI A;  3H9V A;  2QA4 V;  1VP7 A;  2GUZ B;  2FL4 A;  4JI5 B;  2OYQ A;  1WB8 A;  4U3J A;  5BZB A;  1COW G;  2B9Z A;  4GKJ B;  3ZJZ A;  1BMF G;  5LBQ A;  2QTO A;  4PA9 A;  5B5E Z;  3ABU A;  3AK1 A;  4J7K A;  1V55 B;  1Q81 W;  1YTF D;  4UV9 A;  2VWK A;  4DR2 O;  1IDS A;  3THO A;  3C3S A;  1UFI A;  3AG3 B;  3FAV B; 
#chains in the Genus database with same CATH homology
 1MSD A;  2QKC A;  3DC5 A;  1GN6 A;  1EN6 A;  2P4K A;  1IX9 A;  1I08 A;  2RCV A;  3C3T A;  1B06 A;  1AR5 A;  2ADP A;  5AG2 A;  1I0H A;  1IXB A;  4JZ2 A;  4JZG A;  4GUN A;  1AP6 A;  1KKC A;  4FFK A;  1ZTE A;  4YIP A;  1N0J A;  3EVK A;  1N0N A;  1BT8 A;  3AK3 A;  2ADQ B;  1AR4 A;  1AP5 A;  3AK2 A;  1GN2 A;  1EN4 A;  3K9S A;  3OT7 A;  4BR6 A;  4C7U A;  1JA8 A;  1XUQ A;  1QNM A;  1ZUQ A;  3KDR A;  1SZX A;  1JR9 A;  1P7G A;  1ZSP A;  1LUW A;  3MDS A;  1BS3 A;  3IC9 A;  1XRE A;  1EM1 A;  3RN4 A;  1MNG A;  1LUV A;  1PL4 A;  3TJT A;  1Y67 A;  2GDS A;  1VAR A;  1WB8 A;  2CDY A;  4E4E A;  1VEW A;  1MMM A;  1MA1 A;  4F6E A;  1PM9 A;  1BSM A;  3BFR A;  3KKY A;  1XIL A;  2CE4 A;  3AK1 A;  1WB7 A;  1XDC A;  4JYY A;  2AW9 A;  1ZLZ A;  5A9G A;  1GN4 A;  1IDS A;  1GN3 A;  3C3S A;  3QVN A;  4YIO A;  3DC6 A;  4X9Q A;  1D5N A;  1EN5 A;  1AVM A;  3CEI A;  2QKA A;  3LSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...