3AK3A

Superoxide dismutase from aeropyrum pernix k1, fe-bound form
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
210
structure length
210
Chain Sequence
MVSFKRYELPPLPYNYNALEPYIIEEIMKLHHQKHHNTYVKGANAALEKIEKHLKGEIQIDVRAVMRDFSFNYAGHIMHTIFWPNMAPPGKGGGTPGGRVADLIEKQFGGFEKFKALFSAAAKTVEGVGWGVLAFDPLTEELRILQVEKHNVLMTAGLVPILVIDVWEHAYYLQYKNDRGSYVENWWNVVNWDDVEKRLEQALNNAKPLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn/Fe]
publication title Crystal structure of the cambialistic superoxide dismutase from Aeropyrum pernix K1 - insights into the enzyme mechanism and stability
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Oxidoreductase
total genus 73
structure length 210
sequence length 210
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3ak3A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3ak3A02
4JZGA 4X9QA 3BFRA 2CDYA 1XILA 3K9SA 3DC5A 1SZXA 1JR9A 1JA8A 2QKAA 1MMMA 3C3TA 1VARA 2GDSA 4BR6A 2AW9A 1BS3A 3LSUA 3RN4A 1IDSA 1LUVA 1D5NA 3AK2A 4F6EA 1AR4A 1ZLZA 2ADQB 1N0JA 1ZTEA 3C3SA 1Y67A 1EN4A 1I0HA 1IXBA 4JYYA 1XUQA 3IC9A 1GN4A 3EVKA 1EN6A 1GN3A 4FFKA 3AK3A 1GN6A 1ZSPA 1PM9A 2RCVA 2P4KA 1IX9A 4GUNA 1LUWA 2CE4A 1I08A 1AR5A 4E4EA 1BT8A 3MDSA 3KKYA 4YIOA 1MA1A 1WB8A 3AK1A 1BSMA 1ZUQA 1MSDA 1B06A 1AP5A 3TJTA 1EN5A 3OT7A 5AG2A 2ADPA 1GN2A 1XDCA 5A9GA 1MNGA 4JZ2A 1PL4A 4C7UA 1KKCA 4YIPA 1QNMA 1N0NA 1AVMA 3QVNA 1VEWA 1WB7A 1EM1A 1AP6A 3DC6A 2QKCA 3CEIA 1P7GA 1XREA
chains in the Genus database with same CATH superfamily
1B6QA 1SS3A 4B3RO 4PA6A 3ABMC 2B5UA 4O4JB 5BZBA 1ROPA 4CZZA 3L75H 1AI7A 4ABMA 5KHGA 3L9DA 2ZQMA 2IJJA 4BW5A 2CUGA 3ZRSA 4MVUA 3LSUA 3OR6C 2WLIA 2HHHB 4I50B 3JASA 1R3LC 3RN4A 3JARB 3TCUA 3IGAC 2GHYA 1P84F 1R1BA 4CH4A 2Q73A 5LOVA 4JI6O 5K1XA 2DOSA 4TQDA 5EC1C 4NTXA 3SYPA 3FAVA 3CCUV 4LF5B 5JJJB 1Y67A 3BA9A 1QLEC 1OCRB 4MS2A 4DUYB 3SJAC 1B04A 2YC0A 3A0HZ 1P4RA 3FD9A 3HKBA 4PI0A 3CRCA 1YXBA 2V1DA 4XDJA 4KHPB 4I9QA 1ZSPA 1HNZB 5LP6C 3GWKC 4X1IA 5J9PC 3CMAV 1VQ5V 3RYCA 5ITZB 1JFFB 1VQLV 4LFBO 3R65A 4RWUA 5DN6G 2GUZB 2CE4A 1K3EA 3JD2A 2PZSA 3EFFK 5L3CA 1H2SB 5B1BC 4RAIA 4G2KA 3DXRA 4B3RB 1KECA 1NH2B 1EN5A 3CCVV 3CCJV 4WBNA 1N32O 4QE9A 1MNGA 3SPCA 3T2MA 3JCZA 3E89A 1AVMA 4UCTA 2Y0IA 2Y0PA 4H0LB 4MTXA 4LWSA 3DTUB 2P6JA 2P90A 1GRJA 4JV5O 4FLXA 3E86A 4JI6B 4ICGA 2PUSA 1PV0A 3SYQA 4B3SB 2LFRA 2EILB 1SERA 2EINC 4X20A 4DR6O 3J80N 3PN1A 1FD9A 3LSSA 5EBWC 4TV8A 1EZJA 2GTAA 3RGBA 1BHAA 1F23A 1NTZH 1JJOA 4OGQB 2WPDG 4LFBB 1WA8A 4A5UB 2Q68A 5IYCO 5EIBC 3M8AA 1F7YA 2IU0A 3ZJZA 4UV9A 2A06H 2CTQA 2Q0OC 2X6BA 1QR9A 1K7DA 3RT3C 2AZ0A 1JX9A 1N32B 1R6NA 2H94A 3W7TA 1VIBA 2YSUB 3ABUA 1YJWV 1HNWO 3HKEA 2FTKA 5LHHA 1BT8A 4JAUA 1WAZA 3CRAA 1F51A 3AK1A 2Q69A 3AG2C 3Q4HB 4JV5B 3S3XA 5DEDA 3UQ8A 3ABKB 4FK5C 2EIKC 1GN2A 4PDVA 4B3MO 1N33O 5A9GA 3A0RA 4JZ2A 1BQ0A 2WLLB 5KA5A 4X62O 4DR6B 4JF3A 2QA4V 3KDRA 4EFEA 1M56C 3QTCA 3DC6A 2P67A 2JJ1G 1WJZA 1QLEB 3RFRA 3G71V 3H1HH 1R3JC 3SPGA 2JEXA 3U10A 2ZXWB 5KMGA 4YHHO 2Q6AA 1D5AA 3N2GB 3RYIB 5JJEB 5LA6A 5H5NA 4IGGA 5FLXN 2LW7A 3G67A 3LDEA 3JALA 1THZA 4GCZA 4EB6A 4JI4O 4JI3O 5EK0A 1HNWB 3OMNB 1H2NA 3BAAA 5EYPB 5CN0A 3AG1C 2EIMB 2HP8A 5EBLC 4FZ1A 3UT5B 2HEPA 4TQFA 4IIJA 4JTAB 3EVKA 3HKDB 1G4YB 5GTHZ 3AG4B 1PP9H 1TVKA 4NXMO 4X62B 2Q8VA 1XI1A 1TUBA 2YXHA 3KKYA 3C90A 2QTSA 3BEHA 2VQEO 2YDEA 2F43G 1UPGA 4YHHB 3X2QC 4CH5A 3SPHA 2UXDO 3CC4V 2Q5ZA 2NLJC 2QWNB 5LBQA 4DK0A 2DYRC 2DMXA 1EBOA 1IBMO 4CH6A 3QO7A 1MABG 4UVBA 1Q43A 2OYQA 3K3WA 3UT5A 2XAJA 4NKGB 4KUMA 2A9HA 2FMLA 3OTOO 4JI4B 4JI3B 3P32A 3QO5A 4PV1B 1PNKA 2DWDC 3ZS8C 4JPRA 3K5OA 1LR1A 2X6AA 4DRXA 4O4IB 3FB6C 1MG1A 4ZKIA 1JA8A 5HFLA 3I55V 2Q0AA 5IYZB 3CE2A 3AG7A 1DLBA 2R9RB 4I5SA 3OM3B 2MW2B 4QNHB 2ZIOA 4OXSA 2DW4A 2N05A 1XHZA 5LGTA 1KP2A 1WPXA 2JJ2G 2QJ1A 3UO2A 4IL6Z 5CA1B 3JSNA 1IDSA 2WWWA 1P49A 1ZL8A 4IHJB 4WFHA 4WFEA 4AILC 4KP4A 2DQ0A 2QGNA 4TOIA 1GN4A 2BSKA 4W4LA 1VQNV 3JAKB 3CMEV 2KKWA 2VQEB 2HG5C 1W0KG 4G28B 2W6IG 4X1YA 1XEQA 2UXDB 1OCCC 1NKDA 4HYOA 5LHIA 1KP3A 3K0GA 1XMQO 3CWBH 1IBMB 1K9MW 5EIBD 3ABLC 5JQGA 1VQOV 5IYZA 4TWKA 4OX9O 1B06A 1IBKB 1SA0A 3TJTA 2H8PC 2P5OA 4ZI7B 1PPJH 1QNMA 4MT8A 4DK1A 4I0XB 2ZR3A 3K59A 4ZOLA 1WB7A 3CSXA 1YCIA 3CS5A 3H1JH 1MOFA 2LW1A 5JH7B 4WFAV 4LBEC 1DF5A 1YEWA 3OGCC 5D5QA 1J95A 4X66O 4TSFG 1T5EA 2CK3G 3UCSC 4FM1A 1SZXA 2E75B 2P4VA 1MMMA 4DR1O 1HDJA 1I5YA 2ATKC 2W6JG 4ASUG 1FKAO 1G6UA 3CYOA 4F6RB 4AQYO 3OE7G 3GVMA 1XMQB 1FOUA 1D2DA 2FB5A 2PTMA 2RMKB 3J81N 1RM1B 1EN4A 1FFXA 4FZ0A 4MVZA 5B3SC 2B1GA 4Q20A 1IXMA 2CGOA 3CCEV 2R72A 4DV3O 1KQSU 2QM7A 3HPLC 2Q7EA 5KA6A 1H38A 2B9ZA 3K06A 2HR3A 5A2QN 3HKCA 2RCVA 1YJNV 2RNBA 1UFIA 4TUYA 1BGYH 2M7WA 1V54C 4FLUA 4TV9A 1IBLB 2BOCC 4JYAO 2UUBO 3HR0A 2OCCC 4RO2A 3ZMSA 1F4MA 1WB8A 3K08A 5CA0A 3CCQV 2CAZC 1Y66A 3OW2U 2IM9A 4X66B 2ZINA 1VQ6V 1TAEA 3BHPA 1J5EO 1XBLA 2QWRB 2JVDA 4WFBV 4C7UA 1AI5A 3CPWU 5BMVA 4DR1B 3T4DA 4JASA 1P7BA 1SESA 3JD1A 1N0NA 5KHJA 3T1CA 4ZHQA 2QWQB 2GSMB 1NTMH 3CC2V 1S76D 1COWG 1Y74A 2AHYA 4D7TA 4X1KB 4AQYB 5IYBO 4MVSA 2K1EA 4FJCC 4UCOA 4B3TO 1NZ6A 4X9QA 1W2BU 1OCZB 3F7VC 2P06A 3DC5A 1S0VA 3BRCA 1AB3A 3B77A 3HB3B 1NVPD 3U0ZA 3A8TA 3RYFB 4DV3B 4FFBA 4X88A 4K8XA 2ZDIA 2ZR2A 2DN9A 1TA8A 1RPOA 5B5EZ 4MVOA 2EIJC 3LDDA 3D3QA 2L35A 3MHHC 1KMIZ 1VF6A 2KG7B 2UUBB 5EC2C 5KX5A 5GW7A 3L72H 1H8EG 2RQ6A 3IC9A 1I7FA 1EN6A 1JVMA 4DW0A 1DF4A 5E1AC 4PA4A 1JPXA 4UFZA 1VQ8V 4KXRA 4MVQA 4AHCA 2JGDA 1K4CC 2UXNA 4LCUC 1J5EB 1URFA 2K9PA 1BE3H 1FYJA 1IX9A 1V55C 2ZCEA 2IBZH 2F23A 3ASNB 1AR5A 4DV4O 1M90W 3WB0A 1YDXA 1U96A 5B1OA 3BA8A 1K33A 5FPRA 4X65O 4PA3A 5B66Z 2JEUA 1JCHA 4HAMA 4LF4O 4O4JA 2WLJA 4EFBA 5L3FA 4NXNO 2ARHA 4MVRA 3ZHQA 1VEWA 2ZE8A 4DR2O 2KQXA 5B3SB 5TISZ 2DYSB 5IJ9B 1XMOO 1WLEA 4I50A 2HJDA 5IT9N 1HP8A 1OJHA 1L1FA 3JARA 3FB5C 1JR9A 2CH7B 3ABTA 2ZT9B 4JI5O 4Z2WA 2DQ3A 5LYJB 3SDLA 3CHXA 3U11A 2PYJA 3ASOC 4U3JB 2G38A 1SETA 2M6YA 4RUEA 5KHHA 2UU9O 4LF6O 2Q7GA 3VQXA 1EZVH 1O9GA 2IH3C 5ITZA 2F1MA 1JFFA 2DE0X 2ZNJA 1JOYA 2WAMA 4PDMA 2YI9A 5IWAO 3W7SA 4J9YB 2GUZA 3D36A 3JAWB 4JI1O 4CC6A 1FXKB 4X65B 4GKJO 1NTKH 1V9PA 4CS2A 1VQMV 5IY5B 1PM9A 2LJ2A 4PELA 4J80A 3T1HO 4Z1MG 4LF4B 3WG7C 1XHXA 2EX3A 2HJFC 3ETEA 3D8CA 1SQFA 1K8AW 5EBMC 4LH6A 3H1LH 2UXBO 5FNVB 3L70H 4DV6O 5CB4B 1XMOB 2E5LO 4JI8O 1MSDA 1VQPV 2EZOA 3G6BA 2E3CA 3K5LA 5H6RA 5GTIZ 3CC7V 1W59A 3OMIB 3CRMA 4LP8A 4O2BB 1YTFB 1G8MA 1BCCH 1KKCA 3ABMB 4K3AA 3STZC 1LNQA 1S5HC 3ZIAG 2PYLA 2FYUH 2LO1A 1S5JA 3ZMVA 2RJZA 4LF6B 1NBMG 2CDYA 4O4LB 3OUFA 4CH3A 1HNXO 1VQ9V 4MSWC 5IWAB 3IC7A 2IJIA 1HR0O 4PI2A 3CJHB 4JI1B 5FNVA 2PY5A 4PA7A 4GKJB 2OCHA 2F93B 4OPHA 2EBOA 4UCSA 3NR7A 4I55B 3T1HB 3VOUA 1D5NA 3AK2A 1GTOA 3ZN1A 1ZLZA 4LFAO 5J2UB 3CXCU 3FYIB 3FKSG 2ADQB 2QR4A 1QVFU 2UXBB 5LP6B 3EXAA 5JCOA 2JS3A 4DV6B 4JYYA 2OIEA 2E5LB 4WFFA 4JI8B 3JD0A 3RVYA 5LL6Y 1RP3B 4RQEA 1YZBA 1VQKV 4QJFB 4O2AB 4BIOA 1GN3A 1KBHA 5B1BB 4YJ2B 1ZAUA 1YTFD 3Q4HA 1M93A 3ETDA 5LMUO 1VF5B 3R66A 1H8HG 1LUWA 1SQVH 5H9CA 2WLLA 4LH7A 3T1YO 2PI5A 3PJSK 1YSCA 1Y6XA 3ASOB 2QDOA 3QO8A 4B3MB 1N33B 5AG2A 1S5LZ 4U7NA 4I55A 1HNXB 1YJ9V 4LF9O 2VRZA 1RSOB 2O57A 3UM7A 4B08A 2AHZA 5GONB 1AJNA 2EINB 4WF9V 1SQQH 3N2GA 1M57C 3RYIA 1K5SA 4DXWA 1SRYA 1RPRA 1A32A 5H6QA 4LFAB 4LF8O 5JVDB 1E1RG 3OD4A 1QR8A 3SYCA 2GV9A 4D6TH 3WG7B 4FPPA 5EYPA 3KG2A 2XOKG 2HFEC 2JDIG 1VARA 2QEXV 1Q3EA 2AW9A 2ETNA 2ZE5A 1XL4A 3ZHRA 1JQ0A 2XAFA 4FIPC 4JYBA 3K57A 5LMNO 3ICXA 3HKDA 2RDCA 4DYLA 1K4DC 3H01A 3M7MX 1DGSA 5LXTB 1N36O 1R3KC 2Y69C 3AG3C 3JATB 1N0JA 3K03A 3ML0A 3C3SA 3A0BZ 5K1PA 1Q90D 3N2KB 4DO2A 3T1YB 5B1AC 3NXSA 3STLC 5CBHA 2E76B 2YEVB 1UJWB 4UUJC 1NI8A 1TUEB 1H2GA 2BTOA 2Z0AA 4FFKA 4NTYA 3TGUH 3ZHTA 4FLZA 4NXMB 3AG2B 2ZDIC 4LF9B 4FLWA 1XL6A 5JVDA 4RQFA 3RWRD 2EIKB 4JI2O 1XNQO 3E8HA 4X8AA 3LNNA 2GTSA 2X0LA 5J2TB 3MD0A 5IJ0B 1GM8A 1BSMA 2F4VO 1VF6C 4J10A 1M56B 4LF8B 1OCOC 2IJKA 5HFMA 3J7AU 3O9OA 3CRQA 2YIBA 4TT3G 4IYIA 4XDLA 1H2KA 1NR1A 3K79A 2CTWA 4O4IA 3ZRWB 5BY1A 2ITCC 1M9NA 1OZ0A 4O4HB 2Y4TA 4DV1O 1ZX3A 3G4SV 1KD1W 3OUSA 1EM1A 2XHBA 2BTQB 1WPBA 2WA3A 4B7EA 1Q7YW 3OTOB 5LMNB 2WLNA 1YITV 4QE7A 2DWEC 4BWAA 3CCSV 3QF7A 1N36B 5CA1A 1KKDA 4QPJA 2YXYA 3E8GA 3DSQA 1Y4MA 1WNSA 3CD6V 3TXQA 4IHJA 1I5XA 3AG1B 4I4TB 3RYHB 5IJ0A 2JIZG 2A3QA 4CBCA 3JAKA 1PD3A 1HW7A 2CGNA 3E2EA 2WLHA 2L6LA 4F6EA 3B09A 3CCMV 4JI2B 1XNQB 4DR4O 1MZEA 4BIUA 1US6A 3K0DA 4HNAB 1ZTEA 1QVGU 2F4VB 2B1IA 1KUQA 5E79Z 4NR1A 3L73H 2XAGA 1YI2V 3MHSC 4H44B 2Z3YA 1PL0A 4PDLA 2ITDC 4ZI7A 1OCRC 2Z5UA 3O65A 3K9AA 1FS0G 4DV1B 1X4TA 3X2QB 3JD4A 4E2LA 3L74H 3ZHSA 4I0XA 4OX9B 1NVPB 2DYRB 3W7WA 3ZRXA 1QHTA 2YIDA 4QPKA 5JH7A 3B8NA 4LNUB 1S77D 3JD3A 4YXWG 1NR7A 3D36C 2Y48A 4QGPA 5KAFZ 4GX1A 4YIPA 4R6ZA 3P30A 4R50A 2PI4A 3QVNA 4QIWF 3E8FA 5KHIA 3B4SA 5FL7G 1WN7A 1P7GA 1YF2A 4J42A 3DGEA 1GM7A 2EZPA 4F6RA 2UUAO 1GAXA 3K9SA 3JSLA 3CRRA 4PHZA 3I5DA 2JK5C 2QKAA 2QE7G 5B1NA 1CEZA 1N8RW 4DR3O 1Y76B 1AILA 1QU7A 5C8YB 1AR1B 1VQ4V 4W4KA 1KU9A 2YUAA 1SQBH 2HVJC 3LUTB 3RBZA 4K0KO 5IDJA 2Q67A 2W0XA 2EILC 2XAHA 3W7UA 4GZRB 4G27B 4LNUA 3TETA 4FM0A 4P2ZA 1B3QA 3ETGA 3KCXA 1OCCB 5JJNB 4F4LA 2WLIB 4UB6Z 4CC5A 2KSDA 1N34O 3JASB 1K34A 1VF7A 3ABLB 5BXZA 2UUCO 4LR3A 3E22B 3M99B 2Q7HA 5KUKA 5LOVB 3CCLV 4FLYA 3LSQA 3OEEG 1I94O 3FAVB 2R9IA 2OTLV 2W0FC 3ZX6A 1ZWIC 4JYAB 1W0JG 3HKBB 2A79B 1H2LA 2AXTZ 3ZBHA 4UB8Z 4X1IB 5IE9A 5JCOC 1L0LH 2HVKC 3RYCB 3OT7A 2UUAB 4X1KA 4YJ3B 3IAYA 3ZHUA 1FXVA 1PL4A 3W7XA 4PDRA 4DR3B 2F95B 3VQWA 3F5TA 4UVCA 1JJ2U 3DXRB 1K92A 1SC5B 3T4ZA 3ABKC 2QKCA 3APOA 2YS8A 4K0KB 2AGAA 3RYFA 4WBNB 4MW3A 4B3TB 2NN4A 3THOA 2X6CA 3E22A 1XILA 2EJRA 1M1KW 4B3SO 4OPAA 2KG7A 1N34B 2BCCH 2HLDG 5CBFA 4LWSB 2UUCB 1Q81W 3ZRVA 4P9PA 1PKXA 4JI7O 3BPZA 4DV0O 5C93A 2P7TC 2ZXWC 2V4DA 2ZNIA 1I94B 2D2CB 1M5IA 1SQXH 2UXXA 1Q6IA 1FAFA 4X20B 2ZE7A 4WFGA 1OHHG 2QWOB 4YJ3A 1BL8A 1CPYA 2BE3A 2ODMA 3QG5A 4TV8B 3L71H 4LC1A 4H37A 4BW9A 1V54B 4MVMA 4UCVA 2CTPA 2OCCB 4GT1A 1WA8B 1VMGA 2EIMC 1U97A 1NU1H 1O9HA 2EULA 4BAYA 1NT2B 1Q86W 4R8CA 3FB8C 3G80A 4GUNA 4DV4B 1E1QG 2YXLA 1NQTA 3AG4C 4YIOA 3FB7C 1AJQA 3ZN0A 4GKKO 3CXHF 2OWOA 5IJ9A 1AI4A 2IH1C 1S3JA 3HKEB 4KL1A 4NXNB 3QNEA 3SYOA 1MSWD 4PD4F 1X59A 2CH7A 2CTRA 4U3FH 4DR2B 1AP6A 3K5MA 4JI7B 2AZ2A 3CCRV 4DV0B 4CS4A 5LYJA 4UCUA 4U3JA 3RW0A 2JRIA 4JTCB 3G6EV 1Q8IA 5JWPA 1Z5VA 2EIJB 3D3IA 4PJ0Z 1M4UA 4DR5O 3ETQA 4JI5B 2FKXA 4KFMA 4CS3A 3E8BA 3B40A 3AEIA 3C3TA 1NH2D 2X7RB 2JS5A 4BR6A 4HBNA 2LGQA 2VWKA 2WA4A 3K04A 3E35A 5BR8O 3N27A 3JAWA 2UU9B 1LUVA 4MTFA 1E79G 1FXKA 5KMGB 4RUFA 4ZIBA 4JGSA 5DECA 5L3DA 1FJGO 3UO3A 4GLXA 5LA6B 1V55B 1IURA 2V7QG 3CX5F 3JALB 1PNMA 1R3IC 4GKKB 4EB6B 5CB4A 2ZM6O 3AK3A 1GN6A 1SF9A 3MAQA 4MW8A 2JGUA 2XASA 3OEHG 2P4KA 3FFQA 5KHKA 4YY3O 4IIJB 1QBZA 4O2BA 3MDSA 3VQVA 2QSAA 2IJHA 3WB1A 1MA1A 3K5NA 4WCEV 3FX7A 3VBBA 1TVKB 1EFRG 4DR7O 3CB2A 1SKVA 4EKWA 4DV2O 2ADPA 2XT9A 1XDCA 2NNUA 2IW5A 4J9ZB 4DR5B 3H9VA 3H1KH 2XNDG 5DM6V 4O4LA 1TUBB 3OMAB 4BIZA 4DW1A 4N23A 1ORQC 3SGIA 4IT5A 5BR8B 3P3NA 3CJHA 2OIGA 2QM8A 2VS0A 2YIAA 4JZGA 1FPOA 4J41A 4UXNA 1FJGB 1FFTB 5KLVH 4FM2A 3ZEDA 1Q82W 4DUZO 1HR0B 5J2UA 3KZIZ 5LP6A 3BVOA 2R9AA 1KYOF 1BS3A 2ZM6B 1GH6A 5EZYB 4J7KA 4D7SA 3WB2A 3H1IH 4DRXB 1JNBA 3LNMB 3S3WA 3SJBC 4O2AA 3ZMZA 4ZBMA 4YY3B 4YJ2A 2H3OA 2LQTA 1AR4A 4DV7O 1L8DA 2HKOA 3ZCCA 5KAIZ 1I0HA 1DK1A 1XUQA 2P22C 3OGIB 1ENVA 4FLTA 3JYCA 1MZFA 2ILMA 3ZHVA 3TK1A 4DR7B 1K5QA 3KCYA 4DV2B 1YVWA 1K97A 3WU2Z 1ZL8B 4MTOA 3B2EE 5LMUB 1AJPA 1F4NA 1RM1C 4K8ZA 2RN9A 4B7KA 2LP7A 4NVPA 4L8JA 2BSKB 1XQ8A 3K58A 4E4EA 3ZMTA 1SZTA 1BHBA 2QWPB 1RSOA 4I7ZB 1WP8A 4Z1VA 4R7CA 3BY6A 4X1YB 5GONA 4K35A 2OTJV 5EZYA 1IBKO 4LF7O 2YICA 2LFSA 5JQGB 2A7WA 3F7YC 4DUZB 3SR2C 5L3BA 4UV8A 1CXZB 4U7OA 5LGUA 1SA0B 2XAQA 4GX5A 3ZMUA 1BZKA 3SPIA 3P3PA 5LGNA 1XREA 5F2VO 4X64O 1QCEA 2N74A 2UXCO 3VQYA 3BFRA 4DV7B 2OT5A 1VQ7V 1SQGA 3IJ4A 2DJVA 2VQFO 3EHBB 3RVZA 5CMUA 4I9WA 4ZOLB 4NB5A 5LXTA 2KB1A 2GBOA 4JAVA 1CP9A 3JATA 5KUMA 2GDSA 4UVAA 2FL4A 3N2KA 4GX2A 1OCZC 4LFCO 2YEVA 2F66C 2E74B 4NYKA 4FVMA 2N04A 4PA9A 4P9OA 4X89A 3FYEB 2ZE6A 5D5PA 4JI0O 1Z5WA 1IXBA 2YI8A 2XTAA 2YIBD 4JAAA 3E83A 1KC8W 5J2TA 4LF7B 2XUMA 1DTOA 1Q6HA 5CA3A 4JYCA 2Q9LA 4DV5O 3I56V 1AI6A 1FFXB 1L0NH 2WLKA 1PNLA 3TXSA 4Q6GA 1I08A 1BMFG 1GM9A 1IBLO 1S72V 3SJCC 3BCCH 3ZRWA 4NTWA 3BABA 4O4HA 1ZUQA 4X64B 5CBGA 3HKCB 2BTQA 1AP5A 2UXCB 3SYAA 2PGGA 2C2AA 4J7JA 4TUYB 1M57B 2BOBC 1QQCA 3GWOA 2VQFB 3ASNC 3SPJA 4TV9B 2Q4PA 2LGWA 1RFYA 1G1XB 1H2MA 1GO3F 5CA0B 2ZKOA 4MTGA 4H33A 3OR7C 2PF4E 1YHQV 1FXHA 4LFCB 1Z2GA 4I4TA 2QM4A 2ZD9A 1JMKC 3RYHA 1GMGA 3JCUZ 5BMVB 3WFVA 4JI0B 2R70A 1HWYA 4XDKA 4ZHQB 2A0LA 1K73W 2DYSC 1Y74B 4FLVA 2Y69B 1IZ3A 3AG3B 4HNAA 1XOUA 2WLMA 1R6KA 1XNRO 4L87A 3OAAG 3SJQC 2QTOA 1VP7A 1IJGA 1WP7A 3GB7C 5B1AB 2ZIMA 1KB9F 4DV5B 4AI8A 4J11A 4DR4B 4P30A 1QLNA 3UKMA 3B8MA 1R73A 4FFBB 3A2FA 3APQA 2QKSA 1GKFA 2VWJA 1N4CA 1R6TA 5IYDO 4N21A 4GYCB 3OTFA 2HHHO 2WSSG 1GK9A 4EEQA 1YIJV 2D3OW 4GX0A 4J7ZA 5KX5B 1OCOB 2IU3A 1AROP 2Y4UA 2MK3A 4LF5O 1FXKC 3LDCA 3CP1A 3OFNG 2JGDB 5IY5C 4DUYO 1NJIW 4HZ3A 1BQZA 5H2FZ 5L3EA 1Q6UA 5FPOA 4XBFA 4KHPO 5L3GA 4JTDB 1HNZO 2EJ7A 2NR5A 3IFXA 4IYHA 1IVSA 1TGOA 3JAMN 1H5WA 4FMTA 1SQPH 4UCRA 4H13B 1XNRB 5LHGA 1OV9A 1Y76A 1NS1A 3F5WC 5C8YA 3CEIA 1Q5OA
chains in the Genus database with same CATH topology
4JZGA 4X9QA 3BFRA 2CDYA 1XILA 3K9SA 3DC5A 1SZXA 1JR9A 1JA8A 2QKAA 1MMMA 3C3TA 1VARA 2GDSA 4BR6A 2AW9A 1BS3A 3LSUA 3RN4A 1IDSA 1LUVA 1D5NA 3AK2A 4F6EA 1AR4A 1ZLZA 2ADQB 1N0JA 1ZTEA 3C3SA 1Y67A 1EN4A 1I0HA 1IXBA 4JYYA 1XUQA 3IC9A 1GN4A 3EVKA 1EN6A 1GN3A 4FFKA 3AK3A 1GN6A 1ZSPA 1PM9A 2RCVA 2P4KA 1IX9A 4GUNA 1LUWA 2CE4A 1I08A 1AR5A 4E4EA 1BT8A 3MDSA 3KKYA 4YIOA 1MA1A 1WB8A 3AK1A 1BSMA 1ZUQA 1MSDA 1B06A 1AP5A 3TJTA 1EN5A 3OT7A 5AG2A 2ADPA 1GN2A 1XDCA 5A9GA 1MNGA 4JZ2A 1PL4A 4C7UA 1KKCA 4YIPA 3KDRA 1QNMA 1N0NA 1AVMA 3QVNA 1VEWA 1WB7A 1EM1A 1AP6A 3DC6A 2QKCA 3CEIA 1P7GA 1XREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JZG A;  4X9Q A;  3BFR A;  2CDY A;  1XIL A;  3K9S A;  3DC5 A;  1SZX A;  1JR9 A;  1JA8 A;  2QKA A;  1MMM A;  3C3T A;  1VAR A;  2GDS A;  4BR6 A;  2AW9 A;  1BS3 A;  3LSU A;  3RN4 A;  1IDS A;  1LUV A;  1D5N A;  3AK2 A;  4F6E A;  1AR4 A;  1ZLZ A;  2ADQ B;  1N0J A;  1ZTE A;  3C3S A;  1Y67 A;  1EN4 A;  1I0H A;  1IXB A;  4JYY A;  1XUQ A;  3IC9 A;  1GN4 A;  3EVK A;  1EN6 A;  1GN3 A;  4FFK A;  3AK3 A;  1GN6 A;  1ZSP A;  1PM9 A;  2RCV A;  2P4K A;  1IX9 A;  4GUN A;  1LUW A;  2CE4 A;  1I08 A;  1AR5 A;  4E4E A;  1BT8 A;  3MDS A;  3KKY A;  4YIO A;  1MA1 A;  1WB8 A;  3AK1 A;  1BSM A;  1ZUQ A;  1MSD A;  1B06 A;  1AP5 A;  3TJT A;  1EN5 A;  3OT7 A;  5AG2 A;  2ADP A;  1GN2 A;  1XDC A;  5A9G A;  1MNG A;  4JZ2 A;  1PL4 A;  4C7U A;  1KKC A;  4YIP A;  1QNM A;  1N0N A;  1AVM A;  3QVN A;  1VEW A;  1WB7 A;  1EM1 A;  1AP6 A;  3DC6 A;  2QKC A;  3CEI A;  1P7G A;  1XRE A; 
#chains in the Genus database with same CATH topology
 1B6Q A;  1SS3 A;  4B3R O;  4PA6 A;  3ABM C;  2B5U A;  4O4J B;  5BZB A;  1ROP A;  4CZZ A;  3L75 H;  1AI7 A;  4ABM A;  5KHG A;  3L9D A;  2ZQM A;  2IJJ A;  4BW5 A;  2CUG A;  3ZRS A;  4MVU A;  3LSU A;  3OR6 C;  2WLI A;  2HHH B;  4I50 B;  3JAS A;  1R3L C;  3RN4 A;  3JAR B;  3TCU A;  3IGA C;  2GHY A;  1P84 F;  1R1B A;  4CH4 A;  2Q73 A;  5LOV A;  4JI6 O;  5K1X A;  2DOS A;  4TQD A;  5EC1 C;  4NTX A;  3SYP A;  3FAV A;  3CCU V;  4LF5 B;  5JJJ B;  1Y67 A;  3BA9 A;  1QLE C;  1OCR B;  4MS2 A;  4DUY B;  3SJA C;  1B04 A;  2YC0 A;  3A0H Z;  1P4R A;  3FD9 A;  3HKB A;  4PI0 A;  3CRC A;  1YXB A;  2V1D A;  4XDJ A;  4KHP B;  4I9Q A;  1ZSP A;  1HNZ B;  5LP6 C;  3GWK C;  4X1I A;  5J9P C;  3CMA V;  1VQ5 V;  3RYC A;  5ITZ B;  1JFF B;  1VQL V;  4LFB O;  3R65 A;  4RWU A;  5DN6 G;  2GUZ B;  2CE4 A;  1K3E A;  3JD2 A;  2PZS A;  3EFF K;  5L3C A;  1H2S B;  5B1B C;  4RAI A;  4G2K A;  3DXR A;  4B3R B;  1KEC A;  1NH2 B;  1EN5 A;  3CCV V;  3CCJ V;  4WBN A;  1N32 O;  4QE9 A;  1MNG A;  3SPC A;  3T2M A;  3JCZ A;  3E89 A;  1AVM A;  4UCT A;  2Y0I A;  2Y0P A;  4H0L B;  4MTX A;  4LWS A;  3DTU B;  2P6J A;  2P90 A;  1GRJ A;  4JV5 O;  4FLX A;  3E86 A;  4JI6 B;  4ICG A;  2PUS A;  1PV0 A;  3SYQ A;  4B3S B;  2LFR A;  2EIL B;  1SER A;  2EIN C;  4X20 A;  4DR6 O;  3J80 N;  3PN1 A;  1FD9 A;  3LSS A;  5EBW C;  4TV8 A;  1EZJ A;  2GTA A;  3RGB A;  1BHA A;  1F23 A;  1NTZ H;  1JJO A;  4OGQ B;  2WPD G;  4LFB B;  1WA8 A;  4A5U B;  2Q68 A;  5IYC O;  5EIB C;  3M8A A;  1F7Y A;  2IU0 A;  3ZJZ A;  4UV9 A;  2A06 H;  2CTQ A;  2Q0O C;  2X6B A;  1QR9 A;  1K7D A;  3RT3 C;  2AZ0 A;  1JX9 A;  1N32 B;  1R6N A;  2H94 A;  3W7T A;  1VIB A;  2YSU B;  3ABU A;  1YJW V;  1HNW O;  3HKE A;  2FTK A;  5LHH A;  1BT8 A;  4JAU A;  1WAZ A;  3CRA A;  1F51 A;  3AK1 A;  2Q69 A;  3AG2 C;  3Q4H B;  4JV5 B;  3S3X A;  5DED A;  3UQ8 A;  3ABK B;  4FK5 C;  2EIK C;  1GN2 A;  4PDV A;  4B3M O;  1N33 O;  5A9G A;  3A0R A;  4JZ2 A;  1BQ0 A;  2WLL B;  5KA5 A;  4X62 O;  4DR6 B;  4JF3 A;  2QA4 V;  3KDR A;  4EFE A;  1M56 C;  3QTC A;  3DC6 A;  2P67 A;  2JJ1 G;  1WJZ A;  1QLE B;  3RFR A;  3G71 V;  3H1H H;  1R3J C;  3SPG A;  2JEX A;  3U10 A;  2ZXW B;  5KMG A;  4YHH O;  2Q6A A;  1D5A A;  3N2G B;  3RYI B;  5JJE B;  5LA6 A;  5H5N A;  4IGG A;  5FLX N;  2LW7 A;  3G67 A;  3LDE A;  3JAL A;  1THZ A;  4GCZ A;  4EB6 A;  4JI4 O;  4JI3 O;  5EK0 A;  1HNW B;  3OMN B;  1H2N A;  3BAA A;  5EYP B;  5CN0 A;  3AG1 C;  2EIM B;  2HP8 A;  5EBL C;  4FZ1 A;  3UT5 B;  2HEP A;  4TQF A;  4IIJ A;  4JTA B;  3EVK A;  3HKD B;  1G4Y B;  5GTH Z;  3AG4 B;  1PP9 H;  1TVK A;  4NXM O;  4X62 B;  2Q8V A;  1XI1 A;  1TUB A;  2YXH A;  3KKY A;  3C90 A;  2QTS A;  3BEH A;  2VQE O;  2YDE A;  2F43 G;  1UPG A;  4YHH B;  3X2Q C;  4CH5 A;  3SPH A;  2UXD O;  3CC4 V;  2Q5Z A;  2NLJ C;  2QWN B;  5LBQ A;  4DK0 A;  2DYR C;  2DMX A;  1EBO A;  1IBM O;  4CH6 A;  3QO7 A;  1MAB G;  4UVB A;  1Q43 A;  2OYQ A;  3K3W A;  3UT5 A;  2XAJ A;  4NKG B;  4KUM A;  2A9H A;  2FML A;  3OTO O;  4JI4 B;  4JI3 B;  3P32 A;  3QO5 A;  4PV1 B;  1PNK A;  2DWD C;  3ZS8 C;  4JPR A;  3K5O A;  1LR1 A;  2X6A A;  4DRX A;  4O4I B;  3FB6 C;  1MG1 A;  4ZKI A;  1JA8 A;  5HFL A;  3I55 V;  2Q0A A;  5IYZ B;  3CE2 A;  3AG7 A;  1DLB A;  2R9R B;  4I5S A;  3OM3 B;  2MW2 B;  4QNH B;  2ZIO A;  4OXS A;  2DW4 A;  2N05 A;  1XHZ A;  5LGT A;  1KP2 A;  1WPX A;  2JJ2 G;  2QJ1 A;  3UO2 A;  4IL6 Z;  5CA1 B;  3JSN A;  1IDS A;  2WWW A;  1P49 A;  1ZL8 A;  4IHJ B;  4WFH A;  4WFE A;  4AIL C;  4KP4 A;  2DQ0 A;  2QGN A;  4TOI A;  1GN4 A;  2BSK A;  4W4L A;  1VQN V;  3JAK B;  3CME V;  2KKW A;  2VQE B;  2HG5 C;  1W0K G;  4G28 B;  2W6I G;  4X1Y A;  1XEQ A;  2UXD B;  1OCC C;  1NKD A;  4HYO A;  5LHI A;  1KP3 A;  3K0G A;  1XMQ O;  3CWB H;  1IBM B;  1K9M W;  5EIB D;  3ABL C;  5JQG A;  1VQO V;  5IYZ A;  4TWK A;  4OX9 O;  1B06 A;  1IBK B;  1SA0 A;  3TJT A;  2H8P C;  2P5O A;  4ZI7 B;  1PPJ H;  1QNM A;  4MT8 A;  4DK1 A;  4I0X B;  2ZR3 A;  3K59 A;  4ZOL A;  1WB7 A;  3CSX A;  1YCI A;  3CS5 A;  3H1J H;  1MOF A;  2LW1 A;  5JH7 B;  4WFA V;  4LBE C;  1DF5 A;  1YEW A;  3OGC C;  5D5Q A;  1J95 A;  4X66 O;  4TSF G;  1T5E A;  2CK3 G;  3UCS C;  4FM1 A;  1SZX A;  2E75 B;  2P4V A;  1MMM A;  4DR1 O;  1HDJ A;  1I5Y A;  2ATK C;  2W6J G;  4ASU G;  1FKA O;  1G6U A;  3CYO A;  4F6R B;  4AQY O;  3OE7 G;  3GVM A;  1XMQ B;  1FOU A;  1D2D A;  2FB5 A;  2PTM A;  2RMK B;  3J81 N;  1RM1 B;  1EN4 A;  1FFX A;  4FZ0 A;  4MVZ A;  5B3S C;  2B1G A;  4Q20 A;  1IXM A;  2CGO A;  3CCE V;  2R72 A;  4DV3 O;  1KQS U;  2QM7 A;  3HPL C;  2Q7E A;  5KA6 A;  1H38 A;  2B9Z A;  3K06 A;  2HR3 A;  5A2Q N;  3HKC A;  2RCV A;  1YJN V;  2RNB A;  1UFI A;  4TUY A;  1BGY H;  2M7W A;  1V54 C;  4FLU A;  4TV9 A;  1IBL B;  2BOC C;  4JYA O;  2UUB O;  3HR0 A;  2OCC C;  4RO2 A;  3ZMS A;  1F4M A;  1WB8 A;  3K08 A;  5CA0 A;  3CCQ V;  2CAZ C;  1Y66 A;  3OW2 U;  2IM9 A;  4X66 B;  2ZIN A;  1VQ6 V;  1TAE A;  3BHP A;  1J5E O;  1XBL A;  2QWR B;  2JVD A;  4WFB V;  4C7U A;  1AI5 A;  3CPW U;  5BMV A;  4DR1 B;  3T4D A;  4JAS A;  1P7B A;  1SES A;  3JD1 A;  1N0N A;  5KHJ A;  3T1C A;  4ZHQ A;  2QWQ B;  2GSM B;  1NTM H;  3CC2 V;  1S76 D;  1COW G;  1Y74 A;  2AHY A;  4D7T A;  4X1K B;  4AQY B;  5IYB O;  4MVS A;  2K1E A;  4FJC C;  4UCO A;  4B3T O;  1NZ6 A;  4X9Q A;  1W2B U;  1OCZ B;  3F7V C;  2P06 A;  3DC5 A;  1S0V A;  3BRC A;  1AB3 A;  3B77 A;  3HB3 B;  1NVP D;  3U0Z A;  3A8T A;  3RYF B;  4DV3 B;  4FFB A;  4X88 A;  4K8X A;  2ZDI A;  2ZR2 A;  2DN9 A;  1TA8 A;  1RPO A;  5B5E Z;  4MVO A;  2EIJ C;  3LDD A;  3D3Q A;  2L35 A;  3MHH C;  1KMI Z;  1VF6 A;  2KG7 B;  2UUB B;  5EC2 C;  5KX5 A;  5GW7 A;  3L72 H;  1H8E G;  2RQ6 A;  3IC9 A;  1I7F A;  1EN6 A;  1JVM A;  4DW0 A;  1DF4 A;  5E1A C;  4PA4 A;  1JPX A;  4UFZ A;  1VQ8 V;  4KXR A;  4MVQ A;  4AHC A;  2JGD A;  1K4C C;  2UXN A;  4LCU C;  1J5E B;  1URF A;  2K9P A;  1BE3 H;  1FYJ A;  1IX9 A;  1V55 C;  2ZCE A;  2IBZ H;  2F23 A;  3ASN B;  1AR5 A;  4DV4 O;  1M90 W;  3WB0 A;  1YDX A;  1U96 A;  5B1O A;  3BA8 A;  1K33 A;  5FPR A;  4X65 O;  4PA3 A;  5B66 Z;  2JEU A;  1JCH A;  4HAM A;  4LF4 O;  4O4J A;  2WLJ A;  4EFB A;  5L3F A;  4NXN O;  2ARH A;  4MVR A;  3ZHQ A;  1VEW A;  2ZE8 A;  4DR2 O;  2KQX A;  5B3S B;  5TIS Z;  2DYS B;  5IJ9 B;  1XMO O;  1WLE A;  4I50 A;  2HJD A;  5IT9 N;  1HP8 A;  1OJH A;  1L1F A;  3JAR A;  3FB5 C;  1JR9 A;  2CH7 B;  3ABT A;  2ZT9 B;  4JI5 O;  4Z2W A;  2DQ3 A;  5LYJ B;  3SDL A;  3CHX A;  3U11 A;  2PYJ A;  3ASO C;  4U3J B;  2G38 A;  1SET A;  2M6Y A;  4RUE A;  5KHH A;  2UU9 O;  4LF6 O;  2Q7G A;  3VQX A;  1EZV H;  1O9G A;  2IH3 C;  5ITZ A;  2F1M A;  1JFF A;  2DE0 X;  2ZNJ A;  1JOY A;  2WAM A;  4PDM A;  2YI9 A;  5IWA O;  3W7S A;  4J9Y B;  2GUZ A;  3D36 A;  3JAW B;  4JI1 O;  4CC6 A;  1FXK B;  4X65 B;  4GKJ O;  1NTK H;  1V9P A;  4CS2 A;  1VQM V;  5IY5 B;  1PM9 A;  2LJ2 A;  4PEL A;  4J80 A;  3T1H O;  4Z1M G;  4LF4 B;  3WG7 C;  1XHX A;  2EX3 A;  2HJF C;  3ETE A;  3D8C A;  1SQF A;  1K8A W;  5EBM C;  4LH6 A;  3H1L H;  2UXB O;  5FNV B;  3L70 H;  4DV6 O;  5CB4 B;  1XMO B;  2E5L O;  4JI8 O;  1MSD A;  1VQP V;  2EZO A;  3G6B A;  2E3C A;  3K5L A;  5H6R A;  5GTI Z;  3CC7 V;  1W59 A;  3OMI B;  3CRM A;  4LP8 A;  4O2B B;  1YTF B;  1G8M A;  1BCC H;  1KKC A;  3ABM B;  4K3A A;  3STZ C;  1LNQ A;  1S5H C;  3ZIA G;  2PYL A;  2FYU H;  2LO1 A;  1S5J A;  3ZMV A;  2RJZ A;  4LF6 B;  1NBM G;  2CDY A;  4O4L B;  3OUF A;  4CH3 A;  1HNX O;  1VQ9 V;  4MSW C;  5IWA B;  3IC7 A;  2IJI A;  1HR0 O;  4PI2 A;  3CJH B;  4JI1 B;  5FNV A;  2PY5 A;  4PA7 A;  4GKJ B;  2OCH A;  2F93 B;  4OPH A;  2EBO A;  4UCS A;  3NR7 A;  4I55 B;  3T1H B;  3VOU A;  1D5N A;  3AK2 A;  1GTO A;  3ZN1 A;  1ZLZ A;  4LFA O;  5J2U B;  3CXC U;  3FYI B;  3FKS G;  2ADQ B;  2QR4 A;  1QVF U;  2UXB B;  5LP6 B;  3EXA A;  5JCO A;  2JS3 A;  4DV6 B;  4JYY A;  2OIE A;  2E5L B;  4WFF A;  4JI8 B;  3JD0 A;  3RVY A;  5LL6 Y;  1RP3 B;  4RQE A;  1YZB A;  1VQK V;  4QJF B;  4O2A B;  4BIO A;  1GN3 A;  1KBH A;  5B1B B;  4YJ2 B;  1ZAU A;  1YTF D;  3Q4H A;  1M93 A;  3ETD A;  5LMU O;  1VF5 B;  3R66 A;  1H8H G;  1LUW A;  1SQV H;  5H9C A;  2WLL A;  4LH7 A;  3T1Y O;  2PI5 A;  3PJS K;  1YSC A;  1Y6X A;  3ASO B;  2QDO A;  3QO8 A;  4B3M B;  1N33 B;  5AG2 A;  1S5L Z;  4U7N A;  4I55 A;  1HNX B;  1YJ9 V;  4LF9 O;  2VRZ A;  1RSO B;  2O57 A;  3UM7 A;  4B08 A;  2AHZ A;  5GON B;  1AJN A;  2EIN B;  4WF9 V;  1SQQ H;  3N2G A;  1M57 C;  3RYI A;  1K5S A;  4DXW A;  1SRY A;  1RPR A;  1A32 A;  5H6Q A;  4LFA B;  4LF8 O;  5JVD B;  1E1R G;  3OD4 A;  1QR8 A;  3SYC A;  2GV9 A;  4D6T H;  3WG7 B;  4FPP A;  5EYP A;  3KG2 A;  2XOK G;  2HFE C;  2JDI G;  1VAR A;  2QEX V;  1Q3E A;  2AW9 A;  2ETN A;  2ZE5 A;  1XL4 A;  3ZHR A;  1JQ0 A;  2XAF A;  4FIP C;  4JYB A;  3K57 A;  5LMN O;  3ICX A;  3HKD A;  2RDC A;  4DYL A;  1K4D C;  3H01 A;  3M7M X;  1DGS A;  5LXT B;  1N36 O;  1R3K C;  2Y69 C;  3AG3 C;  3JAT B;  1N0J A;  3K03 A;  3ML0 A;  3C3S A;  3A0B Z;  5K1P A;  1Q90 D;  3N2K B;  4DO2 A;  3T1Y B;  5B1A C;  3NXS A;  3STL C;  5CBH A;  2E76 B;  2YEV B;  1UJW B;  4UUJ C;  1NI8 A;  1TUE B;  1H2G A;  2BTO A;  2Z0A A;  4FFK A;  4NTY A;  3TGU H;  3ZHT A;  4FLZ A;  4NXM B;  3AG2 B;  2ZDI C;  4LF9 B;  4FLW A;  1XL6 A;  5JVD A;  4RQF A;  3RWR D;  2EIK B;  4JI2 O;  1XNQ O;  3E8H A;  4X8A A;  3LNN A;  2GTS A;  2X0L A;  5J2T B;  3MD0 A;  5IJ0 B;  1GM8 A;  1BSM A;  2F4V O;  1VF6 C;  4J10 A;  1M56 B;  4LF8 B;  1OCO C;  2IJK A;  5HFM A;  3J7A U;  3O9O A;  3CRQ A;  2YIB A;  4TT3 G;  4IYI A;  4XDL A;  1H2K A;  1NR1 A;  3K79 A;  2CTW A;  4O4I A;  3ZRW B;  5BY1 A;  2ITC C;  1M9N A;  1OZ0 A;  4O4H B;  2Y4T A;  4DV1 O;  1ZX3 A;  3G4S V;  1KD1 W;  3OUS A;  1EM1 A;  2XHB A;  2BTQ B;  1WPB A;  2WA3 A;  4B7E A;  1Q7Y W;  3OTO B;  5LMN B;  2WLN A;  1YIT V;  4QE7 A;  2DWE C;  4BWA A;  3CCS V;  3QF7 A;  1N36 B;  5CA1 A;  1KKD A;  4QPJ A;  2YXY A;  3E8G A;  3DSQ A;  1Y4M A;  1WNS A;  3CD6 V;  3TXQ A;  4IHJ A;  1I5X A;  3AG1 B;  4I4T B;  3RYH B;  5IJ0 A;  2JIZ G;  2A3Q A;  4CBC A;  3JAK A;  1PD3 A;  1HW7 A;  2CGN A;  3E2E A;  2WLH A;  2L6L A;  4F6E A;  3B09 A;  3CCM V;  4JI2 B;  1XNQ B;  4DR4 O;  1MZE A;  4BIU A;  1US6 A;  3K0D A;  4HNA B;  1ZTE A;  1QVG U;  2F4V B;  2B1I A;  1KUQ A;  5E79 Z;  4NR1 A;  3L73 H;  2XAG A;  1YI2 V;  3MHS C;  4H44 B;  2Z3Y A;  1PL0 A;  4PDL A;  2ITD C;  4ZI7 A;  1OCR C;  2Z5U A;  3O65 A;  3K9A A;  1FS0 G;  4DV1 B;  1X4T A;  3X2Q B;  3JD4 A;  4E2L A;  3L74 H;  3ZHS A;  4I0X A;  4OX9 B;  1NVP B;  2DYR B;  3W7W A;  3ZRX A;  1QHT A;  2YID A;  4QPK A;  5JH7 A;  3B8N A;  4LNU B;  1S77 D;  3JD3 A;  4YXW G;  1NR7 A;  3D36 C;  2Y48 A;  4QGP A;  5KAF Z;  4GX1 A;  4YIP A;  4R6Z A;  3P30 A;  4R50 A;  2PI4 A;  3QVN A;  4QIW F;  3E8F A;  5KHI A;  3B4S A;  5FL7 G;  1WN7 A;  1P7G A;  1YF2 A;  4J42 A;  3DGE A;  1GM7 A;  2EZP A;  4F6R A;  2UUA O;  1GAX A;  3K9S A;  3JSL A;  3CRR A;  4PHZ A;  3I5D A;  2JK5 C;  2QKA A;  2QE7 G;  5B1N A;  1CEZ A;  1N8R W;  4DR3 O;  1Y76 B;  1AIL A;  1QU7 A;  5C8Y B;  1AR1 B;  1VQ4 V;  4W4K A;  1KU9 A;  2YUA A;  1SQB H;  2HVJ C;  3LUT B;  3RBZ A;  4K0K O;  5IDJ A;  2Q67 A;  2W0X A;  2EIL C;  2XAH A;  3W7U A;  4GZR B;  4G27 B;  4LNU A;  3TET A;  4FM0 A;  4P2Z A;  1B3Q A;  3ETG A;  3KCX A;  1OCC B;  5JJN B;  4F4L A;  2WLI B;  4UB6 Z;  4CC5 A;  2KSD A;  1N34 O;  3JAS B;  1K34 A;  1VF7 A;  3ABL B;  5BXZ A;  2UUC O;  4LR3 A;  3E22 B;  3M99 B;  2Q7H A;  5KUK A;  5LOV B;  3CCL V;  4FLY A;  3LSQ A;  3OEE G;  1I94 O;  3FAV B;  2R9I A;  2OTL V;  2W0F C;  3ZX6 A;  1ZWI C;  4JYA B;  1W0J G;  3HKB B;  2A79 B;  1H2L A;  2AXT Z;  3ZBH A;  4UB8 Z;  4X1I B;  5IE9 A;  5JCO C;  1L0L H;  2HVK C;  3RYC B;  3OT7 A;  2UUA B;  4X1K A;  4YJ3 B;  3IAY A;  3ZHU A;  1FXV A;  1PL4 A;  3W7X A;  4PDR A;  4DR3 B;  2F95 B;  3VQW A;  3F5T A;  4UVC A;  1JJ2 U;  3DXR B;  1K92 A;  1SC5 B;  3T4Z A;  3ABK C;  2QKC A;  3APO A;  2YS8 A;  4K0K B;  2AGA A;  3RYF A;  4WBN B;  4MW3 A;  4B3T B;  2NN4 A;  3THO A;  2X6C A;  3E22 A;  1XIL A;  2EJR A;  1M1K W;  4B3S O;  4OPA A;  2KG7 A;  1N34 B;  2BCC H;  2HLD G;  5CBF A;  4LWS B;  2UUC B;  1Q81 W;  3ZRV A;  4P9P A;  1PKX A;  4JI7 O;  3BPZ A;  4DV0 O;  5C93 A;  2P7T C;  2ZXW C;  2V4D A;  2ZNI A;  1I94 B;  2D2C B;  1M5I A;  1SQX H;  2UXX A;  1Q6I A;  1FAF A;  4X20 B;  2ZE7 A;  4WFG A;  1OHH G;  2QWO B;  4YJ3 A;  1BL8 A;  1CPY A;  2BE3 A;  2ODM A;  3QG5 A;  4TV8 B;  3L71 H;  4LC1 A;  4H37 A;  4BW9 A;  1V54 B;  4MVM A;  4UCV A;  2CTP A;  2OCC B;  4GT1 A;  1WA8 B;  1VMG A;  2EIM C;  1U97 A;  1NU1 H;  1O9H A;  2EUL A;  4BAY A;  1NT2 B;  1Q86 W;  4R8C A;  3FB8 C;  3G80 A;  4GUN A;  4DV4 B;  1E1Q G;  2YXL A;  1NQT A;  3AG4 C;  4YIO A;  3FB7 C;  1AJQ A;  3ZN0 A;  4GKK O;  3CXH F;  2OWO A;  5IJ9 A;  1AI4 A;  2IH1 C;  1S3J A;  3HKE B;  4KL1 A;  4NXN B;  3QNE A;  3SYO A;  1MSW D;  4PD4 F;  1X59 A;  2CH7 A;  2CTR A;  4U3F H;  4DR2 B;  1AP6 A;  3K5M A;  4JI7 B;  2AZ2 A;  3CCR V;  4DV0 B;  4CS4 A;  5LYJ A;  4UCU A;  4U3J A;  3RW0 A;  2JRI A;  4JTC B;  3G6E V;  1Q8I A;  5JWP A;  1Z5V A;  2EIJ B;  3D3I A;  4PJ0 Z;  1M4U A;  4DR5 O;  3ETQ A;  4JI5 B;  2FKX A;  4KFM A;  4CS3 A;  3E8B A;  3B40 A;  3AEI A;  3C3T A;  1NH2 D;  2X7R B;  2JS5 A;  4BR6 A;  4HBN A;  2LGQ A;  2VWK A;  2WA4 A;  3K04 A;  3E35 A;  5BR8 O;  3N27 A;  3JAW A;  2UU9 B;  1LUV A;  4MTF A;  1E79 G;  1FXK A;  5KMG B;  4RUF A;  4ZIB A;  4JGS A;  5DEC A;  5L3D A;  1FJG O;  3UO3 A;  4GLX A;  5LA6 B;  1V55 B;  1IUR A;  2V7Q G;  3CX5 F;  3JAL B;  1PNM A;  1R3I C;  4GKK B;  4EB6 B;  5CB4 A;  2ZM6 O;  3AK3 A;  1GN6 A;  1SF9 A;  3MAQ A;  4MW8 A;  2JGU A;  2XAS A;  3OEH G;  2P4K A;  3FFQ A;  5KHK A;  4YY3 O;  4IIJ B;  1QBZ A;  4O2B A;  3MDS A;  3VQV A;  2QSA A;  2IJH A;  3WB1 A;  1MA1 A;  3K5N A;  4WCE V;  3FX7 A;  3VBB A;  1TVK B;  1EFR G;  4DR7 O;  3CB2 A;  1SKV A;  4EKW A;  4DV2 O;  2ADP A;  2XT9 A;  1XDC A;  2NNU A;  2IW5 A;  4J9Z B;  4DR5 B;  3H9V A;  3H1K H;  2XND G;  5DM6 V;  4O4L A;  1TUB B;  3OMA B;  4BIZ A;  4DW1 A;  4N23 A;  1ORQ C;  3SGI A;  4IT5 A;  5BR8 B;  3P3N A;  3CJH A;  2OIG A;  2QM8 A;  2VS0 A;  2YIA A;  4JZG A;  1FPO A;  4J41 A;  4UXN A;  1FJG B;  1FFT B;  5KLV H;  4FM2 A;  3ZED A;  1Q82 W;  4DUZ O;  1HR0 B;  5J2U A;  3KZI Z;  5LP6 A;  3BVO A;  2R9A A;  1KYO F;  1BS3 A;  2ZM6 B;  1GH6 A;  5EZY B;  4J7K A;  4D7S A;  3WB2 A;  3H1I H;  4DRX B;  1JNB A;  3LNM B;  3S3W A;  3SJB C;  4O2A A;  3ZMZ A;  4ZBM A;  4YY3 B;  4YJ2 A;  2H3O A;  2LQT A;  1AR4 A;  4DV7 O;  1L8D A;  2HKO A;  3ZCC A;  5KAI Z;  1I0H A;  1DK1 A;  1XUQ A;  2P22 C;  3OGI B;  1ENV A;  4FLT A;  3JYC A;  1MZF A;  2ILM A;  3ZHV A;  3TK1 A;  4DR7 B;  1K5Q A;  3KCY A;  4DV2 B;  1YVW A;  1K97 A;  3WU2 Z;  1ZL8 B;  4MTO A;  3B2E E;  5LMU B;  1AJP A;  1F4N A;  1RM1 C;  4K8Z A;  2RN9 A;  4B7K A;  2LP7 A;  4NVP A;  4L8J A;  2BSK B;  1XQ8 A;  3K58 A;  4E4E A;  3ZMT A;  1SZT A;  1BHB A;  2QWP B;  1RSO A;  4I7Z B;  1WP8 A;  4Z1V A;  4R7C A;  3BY6 A;  4X1Y B;  5GON A;  4K35 A;  2OTJ V;  5EZY A;  1IBK O;  4LF7 O;  2YIC A;  2LFS A;  5JQG B;  2A7W A;  3F7Y C;  4DUZ B;  3SR2 C;  5L3B A;  4UV8 A;  1CXZ B;  4U7O A;  5LGU A;  1SA0 B;  2XAQ A;  4GX5 A;  3ZMU A;  1BZK A;  3SPI A;  3P3P A;  5LGN A;  1XRE A;  5F2V O;  4X64 O;  1QCE A;  2N74 A;  2UXC O;  3VQY A;  3BFR A;  4DV7 B;  2OT5 A;  1VQ7 V;  1SQG A;  3IJ4 A;  2DJV A;  2VQF O;  3EHB B;  3RVZ A;  5CMU A;  4I9W A;  4ZOL B;  4NB5 A;  5LXT A;  2KB1 A;  2GBO A;  4JAV A;  1CP9 A;  3JAT A;  5KUM A;  2GDS A;  4UVA A;  2FL4 A;  3N2K A;  4GX2 A;  1OCZ C;  4LFC O;  2YEV A;  2F66 C;  2E74 B;  4NYK A;  4FVM A;  2N04 A;  4PA9 A;  4P9O A;  4X89 A;  3FYE B;  2ZE6 A;  5D5P A;  4JI0 O;  1Z5W A;  1IXB A;  2YI8 A;  2XTA A;  2YIB D;  4JAA A;  3E83 A;  1KC8 W;  5J2T A;  4LF7 B;  2XUM A;  1DTO A;  1Q6H A;  5CA3 A;  4JYC A;  2Q9L A;  4DV5 O;  3I56 V;  1AI6 A;  1FFX B;  1L0N H;  2WLK A;  1PNL A;  3TXS A;  4Q6G A;  1I08 A;  1BMF G;  1GM9 A;  1IBL O;  1S72 V;  3SJC C;  3BCC H;  3ZRW A;  4NTW A;  3BAB A;  4O4H A;  1ZUQ A;  4X64 B;  5CBG A;  3HKC B;  2BTQ A;  1AP5 A;  2UXC B;  3SYA A;  2PGG A;  2C2A A;  4J7J A;  4TUY B;  1M57 B;  2BOB C;  1QQC A;  3GWO A;  2VQF B;  3ASN C;  3SPJ A;  4TV9 B;  2Q4P A;  2LGW A;  1RFY A;  1G1X B;  1H2M A;  1GO3 F;  5CA0 B;  2ZKO A;  4MTG A;  4H33 A;  3OR7 C;  2PF4 E;  1YHQ V;  1FXH A;  4LFC B;  1Z2G A;  4I4T A;  2QM4 A;  2ZD9 A;  1JMK C;  3RYH A;  1GMG A;  3JCU Z;  5BMV B;  3WFV A;  4JI0 B;  2R70 A;  1HWY A;  4XDK A;  4ZHQ B;  2A0L A;  1K73 W;  2DYS C;  1Y74 B;  4FLV A;  2Y69 B;  1IZ3 A;  3AG3 B;  4HNA A;  1XOU A;  2WLM A;  1R6K A;  1XNR O;  4L87 A;  3OAA G;  3SJQ C;  2QTO A;  1VP7 A;  1IJG A;  1WP7 A;  3GB7 C;  5B1A B;  2ZIM A;  1KB9 F;  4DV5 B;  4AI8 A;  4J11 A;  4DR4 B;  4P30 A;  1QLN A;  3UKM A;  3B8M A;  1R73 A;  4FFB B;  3A2F A;  3APQ A;  2QKS A;  1GKF A;  2VWJ A;  1N4C A;  1R6T A;  5IYD O;  4N21 A;  4GYC B;  3OTF A;  2HHH O;  2WSS G;  1GK9 A;  4EEQ A;  1YIJ V;  2D3O W;  4GX0 A;  4J7Z A;  5KX5 B;  1OCO B;  2IU3 A;  1ARO P;  2Y4U A;  2MK3 A;  4LF5 O;  1FXK C;  3LDC A;  3CP1 A;  3OFN G;  2JGD B;  5IY5 C;  4DUY O;  1NJI W;  4HZ3 A;  1BQZ A;  5H2F Z;  5L3E A;  1Q6U A;  5FPO A;  4XBF A;  4KHP O;  5L3G A;  4JTD B;  1HNZ O;  2EJ7 A;  2NR5 A;  3IFX A;  4IYH A;  1IVS A;  1TGO A;  3JAM N;  1H5W A;  4FMT A;  1SQP H;  4UCR A;  4H13 B;  1XNR B;  5LHG A;  1OV9 A;  1Y76 A;  1NS1 A;  3F5W C;  5C8Y A;  3CEI A;  1Q5O A; 
#chains in the Genus database with same CATH homology
 4JZG A;  4X9Q A;  3BFR A;  2CDY A;  1XIL A;  3K9S A;  3DC5 A;  1SZX A;  1JR9 A;  1JA8 A;  2QKA A;  1MMM A;  3C3T A;  1VAR A;  2GDS A;  4BR6 A;  2AW9 A;  1BS3 A;  3LSU A;  3RN4 A;  1IDS A;  1LUV A;  1D5N A;  3AK2 A;  4F6E A;  1AR4 A;  1ZLZ A;  2ADQ B;  1N0J A;  1ZTE A;  3C3S A;  1Y67 A;  1EN4 A;  1I0H A;  1IXB A;  4JYY A;  1XUQ A;  3IC9 A;  1GN4 A;  3EVK A;  1EN6 A;  1GN3 A;  4FFK A;  3AK3 A;  1GN6 A;  1ZSP A;  1PM9 A;  2RCV A;  2P4K A;  1IX9 A;  4GUN A;  1LUW A;  2CE4 A;  1I08 A;  1AR5 A;  4E4E A;  1BT8 A;  3MDS A;  3KKY A;  4YIO A;  1MA1 A;  1WB8 A;  3AK1 A;  1BSM A;  1ZUQ A;  1MSD A;  1B06 A;  1AP5 A;  3TJT A;  1EN5 A;  3OT7 A;  5AG2 A;  2ADP A;  1GN2 A;  1XDC A;  5A9G A;  1MNG A;  4JZ2 A;  1PL4 A;  4C7U A;  1KKC A;  4YIP A;  3KDR A;  1QNM A;  1N0N A;  1AVM A;  3QVN A;  1VEW A;  1WB7 A;  1EM1 A;  1AP6 A;  3DC6 A;  2QKC A;  3CEI A;  1P7G A;  1XRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...