3AK3A

Superoxide dismutase from aeropyrum pernix k1, fe-bound form
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
210
structure length
210
Chain Sequence
MVSFKRYELPPLPYNYNALEPYIIEEIMKLHHQKHHNTYVKGANAALEKIEKHLKGEIQIDVRAVMRDFSFNYAGHIMHTIFWPNMAPPGKGGGTPGGRVADLIEKQFGGFEKFKALFSAAAKTVEGVGWGVLAFDPLTEELRILQVEKHNVLMTAGLVPILVIDVWEHAYYLQYKNDRGSYVENWWNVVNWDDVEKRLEQALNNAKPLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Mn/Fe]
publication title Crystal structure of the cambialistic superoxide dismutase from Aeropyrum pernix K1 - insights into the enzyme mechanism and stability
pubmed doi rcsb
source organism Aeropyrum pernix
molecule tags Oxidoreductase
total genus 73
structure length 210
sequence length 210
chains with identical sequence B, C, D
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 3ak3A01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 3ak3A02
3DC6A 1IXBA 2CE4A 3AK2A 3AK3A 4X9QA 1XUQA 2CDYA 1PM9A 2QKCA 2QKAA 1LUVA 1XDCA 4YIOA 1I0HA 1D5NA 1N0JA 1EM1A 1BS3A 2ADPA 1Y67A 1ZTEA 1EN6A 1BT8A 4C7UA 4JZ2A 1PL4A 1WB7A 3C3TA 4JZGA 1AP5A 1P7GA 2GDSA 1AR4A 4JYYA 4YIPA 1GN2A 1ZLZA 3IC9A 1AP6A 1MA1A 4FFKA 1GN4A 1JR9A 3K9SA 1SZXA 3MDSA 3QVNA 3KKYA 1MMMA 3LSUA 5AG2A 1AVMA 2ADQB 1XREA 1VEWA 2RCVA 3AK1A 1ZUQA 1AR5A 4GUNA 1LUWA 3TJTA 1MSDA 1B06A 1N0NA 1JA8A 1EN5A 1GN3A 3RN4A 1QNMA 4E4EA 1EN4A 1MNGA 1IDSA 1WB8A 3EVKA 1GN6A 2P4KA 1IX9A 1XILA 4F6EA 4BR6A 2AW9A 3BFRA 1VARA 1KKCA 5A9GA 3DC5A 1ZSPA 3CEIA 1BSMA 3C3SA 1I08A 3OT7A
chains in the Genus database with same CATH superfamily
4FLVA 2XHBA 4DR4O 1Y66A 1P49A 3SYOA 1CEZA 1FXVA 3N2KA 4UB8Z 4JYAB 4TV9B 3LDDA 2WLLB 4CZZA 1YCIA 1Z2GA 4MSWC 1NTKH 5EK0A 1YJNV 2H8PC 2Q6AA 2ZM6O 5EC1C 2CH7A 4JYBA 4GKJO 5JVDA 1BS3A 4X20A 2WA3A 2R9RB 2YSUB 1OCZB 5HFMA 3K3WA 3APOA 2LW1A 3ZN0A 5EYPA 3SR2C 1HP8A 4JI5O 1N36O 1NS1A 3GVMA 3Q4HB 5E1AC 5F2VO 3DXRB 4FLUA 2ARHA 3ICXA 1SQGA 4YIPA 1NH2D 4DR7O 5GONA 5L3EA 1XL4A 3WB2A 5CBHA 1F4MA 4LNUB 2HJDA 5GW7A 5EZYA 4B7EA 1R3JC 2AHYA 5DM6V 3JD2A 1YIJV 2C2AA 4J7ZA 3CRCA 1VEWA 1Q82W 4GUNA 4FVMA 1AI7A 4O4IA 4J9ZB 5FL7G 1SQFA 4K3AA 3T1YO 1U96A 3QO7A 1N0NA 3IFXA 4NTYA 2ITDC 1YDXA 2PTMA 1QLNA 1SRYA 2BOCC 1SQQH 1QHTA 2FTKA 5C8YA 4DRXA 4DR2O 2VRZA 1R3KC 2CTQA 2ETNA 4DR5B 1Q7YW 3MAQA 3OR6C 4H37A 1S5JA 1AI4A 1IBMB 3DC5A 1FXKB 3AG3B 4FPPA 1N32B 2UXDB 4HNAA 3LSQA 1H8EG 1BL8A 1M1KW 1M57B 2GUZA 3OFNG 1E1RG 2CK3G 4YJ2A 1UPGA 4RQFA 5LGTA 4LWSB 4NVPA 1QVGU 4LFBB 1XDCA 3JD0A 2P6JA 4MTGA 4B08A 3CS5A 3JD1A 1AJQA 5BZBA 4LF7O 4X64O 2QWQB 2Q67A 5BR8O 1PPJH 1WB7A 2F43G 3FFQA 3G80A 2LO1A 2H94A 3N2KB 4MVZA 2A0LA 3BY6A 2QWOB 4B3RO 3BA8A 2YIBD 1GN2A 1H2LA 1Q90D 3H1LH 4NXNO 2P4VA 3D8CA 3OEHG 4N21A 2CH7B 3ETQA 5JVDB 3OR7C 5JJEB 3QTCA 4X20B 4QIWF 2L6LA 4WFGA 2DQ0A 1W0JG 4P9PA 3HB3B 5LMUO 5IT9N 3J80N 3IGAC 5EYPB 3AK1A 4DW0A 1YITV 4UVAA 4PA6A 4IHJB 3J81N 4JASA 5GONB 2RN9A 2W0FC 4BWAA 3IC7A 4DR1O 4JV5O 1FS0G 1L0LH 5EZYB 4LCUC 1FAFA 1J95A 1SS3A 4LF6O 1GN6A 2P4KA 4R6ZA 4PDRA 2UUAO 1Y76A 5KUKA 4YY3O 3STLC 5IJ9A 2Y48A 3VQYA 1AB3A 4J41A 4O4IB 4UCOA 3WG7C 3CD6V 3OT7A 3ZBHA 1KMIZ 4LFCB 4PELA 5C93A 2PY5A 3LDEA 4H44B 4UXNA 1IBKB 5C8YB 1PM9A 4DRXB 2UXNA 4TUYA 3HKEA 3B77A 1LUVA 3AG4C 1S76D 4O4HA 2WLNA 5JWPA 4X65B 5E79Z 2YI8A 1EM1A 2GBOA 3K58A 3OGIB 2VQEO 2BTQA 2ZR3A 3ABKC 2JGDA 3ZRWA 3ZX6A 1N34B 1K7DA 4HNAB 1HNXB 1O9HA 3B8NA 2QKSA 5BR8B 1QR8A 2JS3A 1RSOA 2GUZB 2QJ1A 4JYYA 5IY5B 2CTPA 2QDOA 2IJKA 2EIKC 4YJ2B 2RNBA 4B3RB 4FFBB 2QEXV 4D7SA 3LUTB 1GN4A 1KECA 2JJ2G 3CSXA 3K04A 4QE9A 2W0XA 4Z2WA 1QVFU 4DUYO 3F7YC 2ADQB 1DF5A 2A9HA 3OE7G 3TXQA 2XAFA 1NVPB 2XAHA 4YJ3A 1UJWB 2UUCO 3CRRA 2UXCB 3ZHTA 5LOVA 3ASOB 5EBWC 1PL0A 1HR0O 1AILA 4LF8B 5B66Z 1QBZA 2QWPB 2ZD9A 3CCSV 3CMEV 1F4NA 1M9NA 3RWRD 2ZIOA 3JASA 5KHJA 4X1YA 5CBFA 2R70A 3A0BZ 3BHPA 4B3SB 1VQ6V 3A2FA 3D36C 1YF2A 1TUBA 3BPZA 2XAQA 3P32A 2YXLA 3RYFB 2HKOA 3ZHQA 3E35A 3MD0A 4U3JA 2RQ6A 1KBHA 1IXBA 2CE4A 4KHPO 2JS5A 3FX7A 1VQMV 3FAVA 3CCMV 2V7QG 1VQ5V 3ZMTA 1Y76B 2OCHA 1I0HA 4YHHO 4JTCB 5IJ9B 1YZBA 1BT8A 3ZRVA 1YJWV 1M90W 2YS8A 1B6QA 5KUMA 2A3QA 3IAYA 4JAUA 3ABLC 1AR1B 1Q8IA 2MW2B 3L75H 2XAJA 2Q7HA 5L3FA 4TUYB 2DWEC 1VQOV 3HKEB 4LF5B 2QE7G 1BMFG 3SJAC 1NR7A 4O4HB 4UCSA 1XMOB 2QGNA 5EBMC 3ML0A 2KG7B 1V54C 2BTQB 3ZRWB 2JGDB 2P5OA 4CC5A 2YI9A 3K0DA 4FM0A 1K3EA 1RSOB 3RYIB 2H3OA 4FLWA 2Y4UA 4B3TB 3ZMVA 4BW9A 4PA3A 1GN3A 3D3IA 3RN4A 3VQXA 3SPIA 3OM3B 4CS4A 4UVCA 3ZCCA 2BSKA 4NTXA 4Q20A 1I94O 4JGSA 4LFAB 3GB7C 1MABG 1O9GA 1S5LZ 2ILMA 4GKKB 5EBLC 1L1FA 2AW9A 1XOUA 1VARA 4YJ3B 1TVKA 1X59A 3H1HH 4UCRA 1TA8A 4LF9B 2CTWA 4K0KO 5LOVB 2EJRA 4QPJA 1GAXA 2E74B 4IYIA 2CTRA 4X8AA 4CH5A 3ZMUA 1IURA 1OCCC 3B4SA 3JASB 5EC2C 4X1YB 3L71H 1NKDA 4ZKIA 5FPRA 1TUBB 2ZCEA 4PV1B 3S3XA 2VQFO 2QTOA 1NT2B 2GTAA 4DK0A 2BOBC 1K92A 3C3TA 4GX1A 1ZWIC 4CC6A 1QR9A 3FAVB 1R6NA 3ETEA 4DR6O 2GDSA 2VWJA 4KUMA 4DV6O 1R73A 1J5EO 3I5DA 4CH3A 3W7SA 2IU3A 3K06A 4EB6A 2PI4A 1I5XA 3SPCA 5B1NA 2EIJC 4MVRA 3UCSC 2YIBA 1Q6HA 3JARA 5H6RA 3ZJZA 4DV2B 1N33O 1NU1H 4JI0B 2WAMA 2Y0PA 1SQXH 4P2ZA 1HNWB 2EBOA 1DF4A 1GMGA 2DN9A 1XNQO 4MVUA 3CC4V 2K1EA 2E75B 1EFRG 1R3IC 2R72A 4JI4O 2AGAA 1M56C 1NH2B 4NKGB 1JJOA 2CGOA 4AQYO 3CCQV 2OTJV 5A9GA 2P90A 5K1PA 3JATA 2HFEC 2ODMA 2LGWA 2HP8A 5KHHA 2A7WA 3JSLA 2F95B 1DLBA 5B3SC 3HKCA 4PA7A 3KG2A 1JMKC 5KMGA 4O2AA 2BSKB 2OCCC 4CS3A 3K08A 4WFAV 1JVMA 3OTFA 2QA4V 2UUBB 2JIZG 2OT5A 2ZNJA 1SA0A 3O9OA 1QLEB 1G6UA 2GHYA 1OCRC 3B09A 3B2EE 1TVKB 1ZTEA 1YJ9V 1K97A 1Z5WA 1TGOA 3OTOO 2ZXWB 2EINB 4HBNA 2A79B 3OEEG 3ABUA 2ZE7A 4J9YB 2QWNB 4I9WA 3CC2V 3T1CA 1DTOA 3K5NA 1MZFA 1I7FA 2FB5A 4U3FH 4WFFA 5IE9A 4NXMB 3K57A 1S5HC 1AVMA 3STZC 3CWBH 2Q7EA 1X4TA 4IHJA 5LA6A 1IBLO 3U11A 1GM9A 4JPRA 4R8CA 5HFLA 4BIOA 2EILC 3FD9A 1R3LC 2EIKB 1PV0A 4EB6B 1MNGA 1VMGA 2L35A 3ZHRA 1IDSA 2HLDG 5H5NA 3EVKA 4QJFB 2YIAA 3G67A 1S72V 4DV1O 3JARB 4Q6GA 3ZHVA 3FYIB 5IDJA 2LGQA 1PP9H 1FXKC 4LF4O 4MW8A 1PD3A 4DV7B 3K03A 1I08A 4JI1B 4GX2A 1VF7A 3B8MA 2ATKC 1E1QG 3BVOA 3CB2A 5BMVA 5JQGA 4G27B 3TCUA 4I7ZB 2GV9A 1XI1A 2ZQMA 3RVYA 1M93A 5JH7A 4JI2B 3MHHC 2QKAA 5LBQA 2KB1A 4JI8B 4DK1A 1SERA 3BABA 2Q5ZA 1P84F 5JJJB 5KAIZ 4JZ2A 4WFEA 3JATB 1PL4A 1QCEA 2Q68A 3BCCH 4I0XA 4I9QA 3HKCB 3UQ8A 5CB4A 4PDLA 1K4CC 5KMGB 4O2AB 1FOUA 5CA3A 4DR4B 1Q81W 4X66O 4W4LA 4PJ0Z 3SYPA 4FFBA 2JRIA 1SA0B 3K5LA 3E8BA 1AROP 3ETGA 2ZM6B 3P30A 2GSMB 5B1BC 4GKJB 3LSUA 2YICA 1S77D 4DV4O 4OXSA 2YXYA 1RM1B 4JI5B 1N36B 2F4VO 3W7UA 1VF6A 1YSCA 4TT3G 2P06A 2ZR2A 2P67A 2OWOA 4DR7B 4PD4F 1QNMA 1BHBA 5B1OA 2Y0IA 4UCVA 5H9CA 3X2QB 3B40A 5KHIA 4W4KA 3QNEA 5GTHZ 4J11A 2HG5C 3N27A 4P9OA 1FFXA 3E22A 4HYOA 4WFBV 5EIBC 2DMXA 1VQ4V 3BFRA 3RYFA 5LA6B 2WLIA 3CHXA 4JI3O 1BHAA 3FB5C 1F7YA 2FMLA 4DV3O 1LNQA 3BA9A 3T1YB 3ETDA 2WWWA 1SQBH 4ZI7A 1SQVH 1QQCA 2CUGA 4DR2B 5K1XA 4TQDA 1JQ0A 4YIOA 4NR1A 4QE7A 4FZ0A 3RFRA 1Y67A 3F5WC 1FJGO 3FB8C 1VQNV 1VQLV 4X89A 2M6YA 3RBZA 2QR4A 2NR5A 2XNDG 3CJHA 1XMQO 5BMVB 1KP2A 4H0LB 5JQGB 2OTLV 3L72H 1GM7A 3KDRA 5IY5C 5TISZ 4ASUG 5KAFZ 4TWKA 3GWOA 5JH7B 4X62O 2JEXA 2ZE8A 4MS2A 3VQVA 3WFVA 3CCUV 1DK1A 1HNZO 4ZHQA 1AP6A 3IJ4A 3A0RA 3H01A 2E5LO 2MK3A 1K33A 4Z1MG 1WP7A 2KG7A 3PJSK 1MMMA 4JTAB 3CMAV 4LF7B 2DJVA 4X64B 3CCEV 1W0KG 4X1KA 4I0XB 1U97A 3OUFA 1V55B 4QGPA 5CB4B 3RYIA 4BW5A 3QG5A 2F93B 1YVWA 4JI6O 3SPHA 4JI7O 5IJ0A 3WG7B 1K34A 3LDCA 1W59A 4XDKA 1S3JA 4NXNB 2K9PA 4QPKA 5LHHA 1WA8B 1WP8A 4RQEA 1Q3EA 2HVKC 5LMUB 4YXWG 3T4ZA 2N74A 3AG4B 2WA4A 2VWKA 5LHIA 3I56V 4DR3O 3BRCA 3ABKB 3ZRSA 4IL6Z 1BQZA 4DR1B 4JV5B 3SGIA 4LH7A 1VF5B 2BE3A 3D3QA 4LBEC 1GM8A 3OW2U 2YXHA 1FFXB 2IJJA 5JCOC 4LF6B 4DV0O 3E22B 1V9PA 5EIBD 2WLIB 2UUAB 3ZMZA 2LJ2A 4YY3B 4CS2A 1XHXA 3C90A 1XNRO 1B3QA 4J80A 3T4DA 3APQA 3M7MX 1VP7A 2Q8VA 2DYSC 4NYKA 3OUSA 4ZI7B 2XUMA 1P7GA 5CN0A 4FZ1A 2EIMC 2QTSA 3ZHSA 4OPAA 1ZLZA 1WNSA 1E79G 1Q43A 4R50A 3K9SA 2A06H 1TUEB 3KKYA 2HVJC 2WLMA 1AI6A 4GX0A 3BEHA 3K59A 2VQEB 3CJHB 5B1AC 1TAEA 2IJIA 4JYCA 3UM7A 1P7BA 2QM8A 3ZS8C 1XL6A 2XOKG 2G38A 1R1BA 5H6QA 3DGEA 3JD4A 4JI6B 4ZHQB 3CCLV 2HHHO 4PDMA 2ZE6A 2V4DA 3HR0A 1AJNA 3TXSA 3AEIA 2UXXA 3JSNA 3T1HO 4X1KB 1XILA 5J2TA 2OIGA 4I4TA 1HDJA 4DUYB 4DV5O 4QNHB 1VQPV 1VIBA 2Z5UA 3HKBA 4O4JA 3SYAA 1N4CA 3CEIA 5IJ0B 3E89A 2F23A 4UV8A 3OGCC 2UUCB 1FD9A 2BCCH 1P4RA 5H2FZ 2DOSA 1WLEA 5GTIZ 4EFEA 4F6RA 2OYQA 1HR0B 2E76B 2NLJC 3CC7V 4CH4A 3ABLB 3JAWA 2CGNA 3RT3C 2JJ1G 3G71V 3RYHA 5D5PA 5KLVH 4OX9O 3OAAG 1XBLA 3ZIAG 2PYLA 4L8JA 1V54B 3GWKC 3W7TA 3CPWU 1ZL8B 4TV8A 4KHPB 5KX5A 2KKWA 4BIUA 1B04A 4LR3A 4FJCC 2UXBO 1R6KA 2P22C 1MA1A 3PN1A 2EZOA 2UU9O 3F5TA 2YUAA 3ZMSA 4YHHB 1CXZB 3MDSA 1OZ0A 4DUZO 1KD1W 1FYJA 3CP1A 3AG2C 1K5SA 3LSSA 3OMAB 1XREA 4NTWA 3K5MA 1KYOF 1ZX3A 2Q0AA 4X88A 1IZ3A 5IWAO 3ABMC 1ORQC 5D5QA 4O4LA 3TGUH 2AZ0A 4TQFA 4I50A 5CMUA 1FXHA 3CRMA 5LGUA 1YTFD 4CH6A 3ASNC 1F23A 4JYAO 1NQTA 4JTDB 3W7XA 3L73H 3K0GA 4RO2A 5LXTA 4ICGA 2ZKOA 4RWUA 2ZIMA 4FIPC 4F6EA 2RMKB 5LP6C 1JOYA 2VS0A 4UUJC 3CYOA 2EX3A 4B7KA 2QSAA 5A2QN 2DYRC 2LFSA 1L8DA 1OCOC 3JALA 1JFFA 4IGGA 1H2MA 4E2LA 2FKXA 4FLZA 2HJFC 2Q7GA 3UT5A 3DSQA 2PF4E 1I94B 2Y69C 4TOIA 2P7TC 3RVZA 3CCJV 1NBMG 1VQKV 5J2TB 4MVQA 2FL4A 4I4TB 1ZAUA 2IH3C 2X6BA 5BXZA 4UV9A 3HKBB 4O4JB 2EIJB 1JX9A 2YIDA 4KL1A 4K0KB 2QM4A 3M8AA 1XQ8A 3HKDA 4F6RB 1HW7A 3E83A 4FLYA 1OV9A 1SF9A 3JAWB 1H8HG 3SJCC 3ZN1A 4PDVA 5J9PC 5L3BA 5LYJA 5ITZA 2RJZA 4MTOA 1SZXA 3QVNA 4UCTA 3RYHB 2WPDG 3CX5F 1OCZC 4DR5O 3UO2A 2VQFB 1WJZA 3QO8A 3TETA 1M56B 1LR1A 3W7WA 4FLTA 1IBMO 4TV8B 3WB0A 2F1MA 3TJTA 1FFTB 1OHHG 1Y4MA 5KX5B 2PI5A 1H38A 1N32O 2UXDO 4DR6B 4ZIBA 2ZDIC 1MSWD 3E86A 1GRJA 4DV6B 1K5QA 5B3SB 1J5EB 1H2KA 2ZE5A 4ZOLA 2XTAA 2OCCB 4LFBO 3RGBA 3THOA 4MW3A 4EFBA 3LNMB 3M99B 1KKCA 1OCRB 3E8GA 3AG1B 4MTXA 1N33B 4O4LB 4K8XA 4I50B 1KUQA 1WPXA 4AHCA 2DE0X 2PUSA 4X9QA 4CBCA 1XNQB 4BAYA 2QKCA 1KB9F 1G1XB 2CAZC 4J10A 4JAVA 5LXTB 2EULA 1D2DA 4H33A 4JI4B 2W6JG 2B5UA 1D5NA 1N0JA 3T2MA 2XT9A 1YEWA 3AG3C 2ADPA 1GO3F 4AQYB 4EKWA 4B3MO 2OIEA 1NR1A 3JD3A 3JALB 1JFFB 3A0HZ 1M57C 5L3GA 4AILC 3P3PA 1T5EA 1PNKA 2ZINA 1RPOA 3K9AA 3UT5B 2AHZA 4RAIA 4L87A 3VOUA 2D3OW 4H13B 2EILB 4OGQB 3DTUB 3EFFK 1K9MW 2E3CA 2ZT9B 3P3NA 1K73W 4J7JA 1MOFA 2JEUA 3SYCA 4OPHA 1RM1C 3HKDB 1LUWA 3OTOB 4WCEV 4Z1VA 1PKXA 4LFCO 4JF3A 1JA8A 3L9DA 2AZ2A 4GT1A 1IBKO 3X2QC 5ITZB 5LYJB 4G2KA 2N04A 2Q0OC 1WA8A 3JAMN 1URFA 3SJBC 4PHZA 4X65O 2D2CB 1GK9A 1D5AA 3G6BA 5CBGA 3BAAA 1N34O 1IBLB 2XAGA 1HNXO 3C3SA 1SKVA 4DO2A 1JPXA 1K8AW 5DEDA 4FK5C 3ABTA 4MVSA 2R9AA 4G28B 4IT5A 3O65A 4ZOLB 3OMNB 3K5OA 1KKDA 1SC5B 4DV1B 5KHGA 3CE2A 4FM1A 4ABMA 2YEVA 4NB5A 2B9ZA 4O2BA 2Q9LA 3JCZA 5B1BB 4FLXA 4LF4B 1SESA 4B3MB 2YC0A 3WB1A 4JZGA 2JK5C 1CP9A 1H2GA 1AP5A 2UXCO 2LQTA 1IXMA 2V1DA 3I55V 5BY1A 4LF8O 1CPYA 1SETA 1SZTA 2JVDA 4UCUA 4KP4A 4I5SA 5KA5A 5LL6Y 1THZA 1Z5VA 3WU2Z 4DYLA 5IYBO 3ZEDA 4LP8A 1RP3B 4B3SO 2LFRA 1EZVH 2DQ3A 1V55C 3OD4A 5JCOA 1ZUQA 3SPJA 3D36A 1GKFA 4WBNA 2BTOA 2X0LA 2X7RB 5FPOA 4X66B 4PA9A 3VQWA 1BZKA 1EBOA 5FNVA 3KZIZ 1M4UA 4E4EA 4I55A 2O57A 2X6AA 1KP3A 2Q73A 5LMNO 4KFMA 1YHQV 3E8FA 1IX9A 1DGSA 3LNNA 3U0ZA 4X1IA 1AI5A 4DV4B 2AXTZ 1MG1A 1ROPA 2LW7A 4IYHA 2PGGA 1VF6C 2FYUH 3ASOC 2F4VB 4GZRB 2GTSA 3NXSA 1Q5OA 1YXBA 3AK3A 4UB6Z 2CDYA 1H5WA 5IYCO 3G6EV 4LF5O 4TSFG 1FKAO 1EZJA 1W2BU 2ITCC 3ZHUA 1XMOO 4U7OA 3CXHF 2WLKA 3UO3A 4GLXA 3EXAA 2Q69A 3JYCA 3U10A 3CCVV 2RDCA 4JI3B 3MHSC 4K8ZA 4N23A 1L0NH 1M5IA 2EJ7A 4DV3B 1ZL8A 4RUFA 2JDIG 4K35A 4B3TO 3R66A 3HPLC 2R9IA 3ZRXA 1K4DC 3NR7A 3RW0A 3TK1A 1H2NA 4LFAO 2YEVB 4O2BB 1JCHA 3SYQA 5KHKA 1WPBA 1BCCH 5JJNB 5FLXN 4GKKO 1S0VA 4JAAA 1FJGB 1Y74A 2KQXA 4IIJA 2Z3YA 3KCYA 1XMQB 4LF9O 5KA6A 2PZSA 1US6A 1B06A 2IBZH 4HAMA 2LP7A 4X62B 1COWG 1HNZB 3UKMA 5J2UA 1Y6XA 2EZPA 2E5LB 1GH6A 1BQ0A 1VQ7V 1WB8A 2KSDA 3CRAA 1H2SB 3R65A 4GX5A 5L3DA 1JNBA 5LMNB 1Q6IA 2QM7A 2B1GA 1F51A 4WBNB 5IYDO 2HEPA 1BGYH 3H1JH 1Q86W 5IYZA 4JI7B 4KXRA 5FNVB 1PNLA 4I55B 2DYSB 1XUQA 5CA1A 4J7KA 5B5EZ 1VQ9V 2EIMB 1NVPD 4X1IB 1YTFB 2ZNIA 3FB7C 4UVBA 2Q4PA 3RYCA 3E2EA 4DR3B 4U7NA 1YI2V 2QWRB 3SDLA 4DV2O 5DN6G 5B1AB 5LP6A 4JI0O 3JAKA 1G8MA 3H1IH 3CCRV 1XEQA 4XBFA 1HNWO 1AJPA 1GTOA 1NI8A 4A5UB 4UFZA 4DV0B 4MVOA 3L70H 5CA0A 2NN4A 1XNRB 3JCUZ 3H1KH 2RCVA 4MVMA 3SPGA 1G4YB 2JGUA 1MSDA 4HZ3A 2DWDC 1VQ8V 3CRQA 3N2GA 2F66C 3CXCU 1FPOA 2Y4TA 1NTZH 1OJHA 4MTFA 4TV9A 3FKSG 2UUBO 5DECA 2WLLA 2HR3A 2XASA 4RUEA 1N8RW 1NJIW 1Y74B 4WF9V 4GYCB 4IIJB 4EEQA 4XDLA 1RFYA 4PA4A 5IWAB 2B1IA 3A8TA 4FM2A 1ZSPA 1BSMA 1KU9A 4U3JB 3K79A 3DC6A 4PI0A 4D7TA 2IU0A 4BIZA 2HHHB 5J2UB 3Q4HA 3AK2A 3DXRA 4GCZA 3S3WA 1OCCB 2WSSG 2YDEA 1IJGA 3FB6C 3T1HB 1Q6UA 2ZDIA 1R6TA 1WN7A 1IVSA 4NXMO 4LNUA 1NZ6A 4DV5B 1EN6A 3QO5A 4C7UA 2X6CA 5IYZB 3G4SV 4FMTA 2DW4A 1MZEA 3F7VC 3AG2B 4AI8A 4LH6A 5L3CA 4XDJA 1QU7A 5LHGA 3FYEB 2WLJA 3QF7A 5CA1B 1NTMH 1AR4A 1KQSU 3ABMB 2IJHA 1UFIA 1QLEC 3IC9A 1XHZA 1RPRA 4DW1A 4R7CA 1A32A 1ENVA 4FFKA 3EHBB 1JR9A 3ASNB 4WFHA 5LGNA 1HWYA 1JJ2U 4MT8A 4LC1A 5AG2A 3VBBA 3RYCB 3L74H 1BE3H 2M7WA 2Z0AA 4J42A 4OX9B 2ZXWC 2EINC 1AR5A 2N05A 2WLHA 4F4LA 5LP6B 1PNMA 2PYJA 3KCXA 4DV7O 3JAKB 4JI1O 1FXKA 2DYRB 1EN5A 1SQPH 1WAZA 2UXBB 2IW5A 4D6TH 3E8HA 1OCOB 1EN4A 2UU9B 2IH1C 4DXWA 4JI2O 4PI2A 4ZBMA 5CA0B 3SJQC 3J7AU 3H9VA 1KC8W 2NNUA 4DUZB 4P30A 4JI8O 4LWSA 2Y69B 4BR6A 2IM9A 3AG1C 3AG7A 2W6IG 3OMIB 3N2GB 1I5YA
chains in the Genus database with same CATH topology
3DC6A 1IXBA 2CE4A 3AK2A 3AK3A 4X9QA 1XUQA 2CDYA 1PM9A 2QKCA 2QKAA 1LUVA 1XDCA 4YIOA 1I0HA 1D5NA 1N0JA 1EM1A 1BS3A 2ADPA 1Y67A 1ZTEA 1EN6A 1BT8A 4C7UA 4JZ2A 1PL4A 1WB7A 3C3TA 4JZGA 1AP5A 3KDRA 1P7GA 2GDSA 1AR4A 4JYYA 4YIPA 1GN2A 1ZLZA 3IC9A 1AP6A 1MA1A 4FFKA 1GN4A 1JR9A 3K9SA 1SZXA 3MDSA 3QVNA 3KKYA 1MMMA 3LSUA 5AG2A 1AVMA 2ADQB 1XREA 1VEWA 2RCVA 3AK1A 1ZUQA 1AR5A 4GUNA 1LUWA 3TJTA 1MSDA 1B06A 1N0NA 1JA8A 1EN5A 1GN3A 3RN4A 1QNMA 4E4EA 1EN4A 1MNGA 1IDSA 1WB8A 3EVKA 1GN6A 2P4KA 1IX9A 1XILA 4F6EA 4BR6A 2AW9A 3BFRA 1VARA 1KKCA 5A9GA 3DC5A 1ZSPA 3CEIA 1BSMA 3C3SA 1I08A 3OT7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DC6 A;  1IXB A;  2CE4 A;  3AK2 A;  3AK3 A;  4X9Q A;  1XUQ A;  2CDY A;  1PM9 A;  2QKC A;  2QKA A;  1LUV A;  1XDC A;  4YIO A;  1I0H A;  1D5N A;  1N0J A;  1EM1 A;  1BS3 A;  2ADP A;  1Y67 A;  1ZTE A;  1EN6 A;  1BT8 A;  4C7U A;  4JZ2 A;  1PL4 A;  1WB7 A;  3C3T A;  4JZG A;  1AP5 A;  1P7G A;  2GDS A;  1AR4 A;  4JYY A;  4YIP A;  1GN2 A;  1ZLZ A;  3IC9 A;  1AP6 A;  1MA1 A;  4FFK A;  1GN4 A;  1JR9 A;  3K9S A;  1SZX A;  3MDS A;  3QVN A;  3KKY A;  1MMM A;  3LSU A;  5AG2 A;  1AVM A;  2ADQ B;  1XRE A;  1VEW A;  2RCV A;  3AK1 A;  1ZUQ A;  1AR5 A;  4GUN A;  1LUW A;  3TJT A;  1MSD A;  1B06 A;  1N0N A;  1JA8 A;  1EN5 A;  1GN3 A;  3RN4 A;  1QNM A;  4E4E A;  1EN4 A;  1MNG A;  1IDS A;  1WB8 A;  3EVK A;  1GN6 A;  2P4K A;  1IX9 A;  1XIL A;  4F6E A;  4BR6 A;  2AW9 A;  3BFR A;  1VAR A;  1KKC A;  5A9G A;  3DC5 A;  1ZSP A;  3CEI A;  1BSM A;  3C3S A;  1I08 A;  3OT7 A; 
#chains in the Genus database with same CATH topology
 4FLV A;  2XHB A;  4DR4 O;  1Y66 A;  1P49 A;  3SYO A;  1CEZ A;  1FXV A;  3N2K A;  4UB8 Z;  4JYA B;  4TV9 B;  3LDD A;  2WLL B;  4CZZ A;  1YCI A;  1Z2G A;  4MSW C;  1NTK H;  5EK0 A;  1YJN V;  2H8P C;  2Q6A A;  2ZM6 O;  5EC1 C;  2CH7 A;  4JYB A;  4GKJ O;  5JVD A;  1BS3 A;  4X20 A;  2WA3 A;  2R9R B;  2YSU B;  1OCZ B;  5HFM A;  3K3W A;  3APO A;  2LW1 A;  3ZN0 A;  5EYP A;  3SR2 C;  1HP8 A;  4JI5 O;  1N36 O;  1NS1 A;  3GVM A;  3Q4H B;  5E1A C;  5F2V O;  3DXR B;  4FLU A;  2ARH A;  3ICX A;  1SQG A;  4YIP A;  1NH2 D;  4DR7 O;  5GON A;  5L3E A;  1XL4 A;  3WB2 A;  5CBH A;  1F4M A;  4LNU B;  2HJD A;  5GW7 A;  5EZY A;  4B7E A;  1R3J C;  2AHY A;  5DM6 V;  3JD2 A;  1YIJ V;  2C2A A;  4J7Z A;  3CRC A;  1VEW A;  1Q82 W;  4GUN A;  4FVM A;  1AI7 A;  4O4I A;  4J9Z B;  5FL7 G;  1SQF A;  4K3A A;  3T1Y O;  1U96 A;  3QO7 A;  1N0N A;  3IFX A;  4NTY A;  2ITD C;  1YDX A;  2PTM A;  1QLN A;  1SRY A;  2BOC C;  1SQQ H;  1QHT A;  2FTK A;  5C8Y A;  4DRX A;  4DR2 O;  2VRZ A;  1R3K C;  2CTQ A;  2ETN A;  4DR5 B;  1Q7Y W;  3MAQ A;  3OR6 C;  4H37 A;  1S5J A;  1AI4 A;  1IBM B;  3DC5 A;  1FXK B;  3AG3 B;  4FPP A;  1N32 B;  2UXD B;  4HNA A;  3LSQ A;  1H8E G;  1BL8 A;  1M1K W;  1M57 B;  2GUZ A;  3OFN G;  1E1R G;  2CK3 G;  4YJ2 A;  1UPG A;  4RQF A;  5LGT A;  4LWS B;  4NVP A;  1QVG U;  4LFB B;  1XDC A;  3JD0 A;  2P6J A;  4MTG A;  4B08 A;  3CS5 A;  3JD1 A;  1AJQ A;  5BZB A;  4LF7 O;  4X64 O;  2QWQ B;  2Q67 A;  5BR8 O;  1PPJ H;  1WB7 A;  2F43 G;  3FFQ A;  3G80 A;  2LO1 A;  2H94 A;  3N2K B;  4MVZ A;  2A0L A;  3BY6 A;  2QWO B;  4B3R O;  3BA8 A;  2YIB D;  1GN2 A;  1H2L A;  1Q90 D;  3H1L H;  4NXN O;  2P4V A;  3D8C A;  3OEH G;  4N21 A;  2CH7 B;  3ETQ A;  5JVD B;  3OR7 C;  5JJE B;  3QTC A;  4X20 B;  4QIW F;  2L6L A;  4WFG A;  2DQ0 A;  1W0J G;  4P9P A;  3HB3 B;  5LMU O;  5IT9 N;  3J80 N;  3IGA C;  5EYP B;  3AK1 A;  4DW0 A;  1YIT V;  4UVA A;  4PA6 A;  4IHJ B;  3J81 N;  4JAS A;  5GON B;  2RN9 A;  2W0F C;  4BWA A;  3IC7 A;  4DR1 O;  4JV5 O;  1FS0 G;  1L0L H;  5EZY B;  4LCU C;  1FAF A;  1J95 A;  1SS3 A;  4LF6 O;  1GN6 A;  2P4K A;  4R6Z A;  4PDR A;  2UUA O;  1Y76 A;  5KUK A;  4YY3 O;  3STL C;  5IJ9 A;  2Y48 A;  3VQY A;  1AB3 A;  4J41 A;  4O4I B;  4UCO A;  3WG7 C;  3CD6 V;  3OT7 A;  3ZBH A;  1KMI Z;  4LFC B;  4PEL A;  5C93 A;  2PY5 A;  3LDE A;  4H44 B;  4UXN A;  1IBK B;  5C8Y B;  1PM9 A;  4DRX B;  2UXN A;  4TUY A;  3HKE A;  3B77 A;  1LUV A;  3AG4 C;  1S76 D;  4O4H A;  2WLN A;  5JWP A;  4X65 B;  5E79 Z;  2YI8 A;  1EM1 A;  2GBO A;  3K58 A;  3OGI B;  2VQE O;  2BTQ A;  2ZR3 A;  3ABK C;  2JGD A;  3ZRW A;  3ZX6 A;  1N34 B;  1K7D A;  4HNA B;  1HNX B;  1O9H A;  3B8N A;  2QKS A;  5BR8 B;  1QR8 A;  2JS3 A;  1RSO A;  2GUZ B;  2QJ1 A;  4JYY A;  5IY5 B;  2CTP A;  2QDO A;  2IJK A;  2EIK C;  4YJ2 B;  2RNB A;  4B3R B;  4FFB B;  2QEX V;  4D7S A;  3LUT B;  1GN4 A;  1KEC A;  2JJ2 G;  3CSX A;  3K04 A;  4QE9 A;  2W0X A;  4Z2W A;  1QVF U;  4DUY O;  3F7Y C;  2ADQ B;  1DF5 A;  2A9H A;  3OE7 G;  3TXQ A;  2XAF A;  1NVP B;  2XAH A;  4YJ3 A;  1UJW B;  2UUC O;  3CRR A;  2UXC B;  3ZHT A;  5LOV A;  3ASO B;  5EBW C;  1PL0 A;  1HR0 O;  1AIL A;  4LF8 B;  5B66 Z;  1QBZ A;  2QWP B;  2ZD9 A;  3CCS V;  3CME V;  1F4N A;  1M9N A;  3RWR D;  2ZIO A;  3JAS A;  5KHJ A;  4X1Y A;  5CBF A;  2R70 A;  3A0B Z;  3BHP A;  4B3S B;  1VQ6 V;  3A2F A;  3D36 C;  1YF2 A;  1TUB A;  3BPZ A;  2XAQ A;  3P32 A;  2YXL A;  3RYF B;  2HKO A;  3ZHQ A;  3E35 A;  3MD0 A;  4U3J A;  2RQ6 A;  1KBH A;  1IXB A;  2CE4 A;  4KHP O;  2JS5 A;  3FX7 A;  1VQM V;  3FAV A;  3CCM V;  2V7Q G;  1VQ5 V;  3ZMT A;  1Y76 B;  2OCH A;  1I0H A;  4YHH O;  4JTC B;  5IJ9 B;  1YZB A;  1BT8 A;  3ZRV A;  1YJW V;  1M90 W;  2YS8 A;  1B6Q A;  5KUM A;  2A3Q A;  3IAY A;  4JAU A;  3ABL C;  1AR1 B;  1Q8I A;  2MW2 B;  3L75 H;  2XAJ A;  2Q7H A;  5L3F A;  4TUY B;  2DWE C;  1VQO V;  3HKE B;  4LF5 B;  2QE7 G;  1BMF G;  3SJA C;  1NR7 A;  4O4H B;  4UCS A;  1XMO B;  2QGN A;  5EBM C;  3ML0 A;  2KG7 B;  1V54 C;  2BTQ B;  3ZRW B;  2JGD B;  2P5O A;  4CC5 A;  2YI9 A;  3K0D A;  4FM0 A;  1K3E A;  1RSO B;  3RYI B;  2H3O A;  4FLW A;  2Y4U A;  4B3T B;  3ZMV A;  4BW9 A;  4PA3 A;  1GN3 A;  3D3I A;  3RN4 A;  3VQX A;  3SPI A;  3OM3 B;  4CS4 A;  4UVC A;  3ZCC A;  2BSK A;  4NTX A;  4Q20 A;  1I94 O;  4JGS A;  4LFA B;  3GB7 C;  1MAB G;  1O9G A;  1S5L Z;  2ILM A;  4GKK B;  5EBL C;  1L1F A;  2AW9 A;  1XOU A;  1VAR A;  4YJ3 B;  1TVK A;  1X59 A;  3H1H H;  4UCR A;  1TA8 A;  4LF9 B;  2CTW A;  4K0K O;  5LOV B;  2EJR A;  4QPJ A;  1GAX A;  2E74 B;  4IYI A;  2CTR A;  4X8A A;  4CH5 A;  3ZMU A;  1IUR A;  1OCC C;  3B4S A;  3JAS B;  5EC2 C;  4X1Y B;  3L71 H;  1NKD A;  4ZKI A;  5FPR A;  1TUB B;  2ZCE A;  4PV1 B;  3S3X A;  2VQF O;  2QTO A;  1NT2 B;  2GTA A;  4DK0 A;  2BOB C;  1K92 A;  3C3T A;  4GX1 A;  1ZWI C;  4CC6 A;  1QR9 A;  3FAV B;  1R6N A;  3ETE A;  4DR6 O;  2GDS A;  2VWJ A;  4KUM A;  4DV6 O;  1R73 A;  1J5E O;  3I5D A;  4CH3 A;  3W7S A;  2IU3 A;  3K06 A;  4EB6 A;  2PI4 A;  1I5X A;  3SPC A;  5B1N A;  2EIJ C;  4MVR A;  3UCS C;  2YIB A;  1Q6H A;  3JAR A;  5H6R A;  3ZJZ A;  4DV2 B;  1N33 O;  1NU1 H;  4JI0 B;  2WAM A;  2Y0P A;  1SQX H;  4P2Z A;  1HNW B;  2EBO A;  1DF4 A;  1GMG A;  2DN9 A;  1XNQ O;  4MVU A;  3CC4 V;  2K1E A;  2E75 B;  1EFR G;  1R3I C;  2R72 A;  4JI4 O;  2AGA A;  1M56 C;  1NH2 B;  4NKG B;  1JJO A;  2CGO A;  4AQY O;  3CCQ V;  2OTJ V;  5A9G A;  2P90 A;  5K1P A;  3JAT A;  2HFE C;  2ODM A;  2LGW A;  2HP8 A;  5KHH A;  2A7W A;  3JSL A;  2F95 B;  1DLB A;  5B3S C;  3HKC A;  4PA7 A;  3KG2 A;  1JMK C;  5KMG A;  4O2A A;  2BSK B;  2OCC C;  4CS3 A;  3K08 A;  4WFA V;  1JVM A;  3OTF A;  2QA4 V;  2UUB B;  2JIZ G;  2OT5 A;  2ZNJ A;  1SA0 A;  3O9O A;  1QLE B;  1G6U A;  2GHY A;  1OCR C;  3B09 A;  3B2E E;  1TVK B;  1ZTE A;  1YJ9 V;  1K97 A;  1Z5W A;  1TGO A;  3OTO O;  2ZXW B;  2EIN B;  4HBN A;  2A79 B;  3OEE G;  3ABU A;  2ZE7 A;  4J9Y B;  2QWN B;  4I9W A;  3CC2 V;  3T1C A;  1DTO A;  3K5N A;  1MZF A;  1I7F A;  2FB5 A;  4U3F H;  4WFF A;  5IE9 A;  4NXM B;  3K57 A;  1S5H C;  1AVM A;  3STZ C;  3CWB H;  2Q7E A;  1X4T A;  4IHJ A;  5LA6 A;  1IBL O;  3U11 A;  1GM9 A;  4JPR A;  4R8C A;  5HFL A;  4BIO A;  2EIL C;  3FD9 A;  1R3L C;  2EIK B;  1PV0 A;  4EB6 B;  1MNG A;  1VMG A;  2L35 A;  3ZHR A;  1IDS A;  2HLD G;  5H5N A;  3EVK A;  4QJF B;  2YIA A;  3G67 A;  1S72 V;  4DV1 O;  3JAR B;  4Q6G A;  3ZHV A;  3FYI B;  5IDJ A;  2LGQ A;  1PP9 H;  1FXK C;  4LF4 O;  4MW8 A;  1PD3 A;  4DV7 B;  3K03 A;  1I08 A;  4JI1 B;  4GX2 A;  1VF7 A;  3B8M A;  2ATK C;  1E1Q G;  3BVO A;  3CB2 A;  5BMV A;  5JQG A;  4G27 B;  3TCU A;  4I7Z B;  2GV9 A;  1XI1 A;  2ZQM A;  3RVY A;  1M93 A;  5JH7 A;  4JI2 B;  3MHH C;  2QKA A;  5LBQ A;  2KB1 A;  4JI8 B;  4DK1 A;  1SER A;  3BAB A;  2Q5Z A;  1P84 F;  5JJJ B;  5KAI Z;  4JZ2 A;  4WFE A;  3JAT B;  1PL4 A;  1QCE A;  2Q68 A;  3BCC H;  4I0X A;  4I9Q A;  3HKC B;  3UQ8 A;  5CB4 A;  4PDL A;  1K4C C;  5KMG B;  4O2A B;  1FOU A;  5CA3 A;  4DR4 B;  1Q81 W;  4X66 O;  4W4L A;  4PJ0 Z;  3SYP A;  4FFB A;  2JRI A;  1SA0 B;  3K5L A;  3E8B A;  1ARO P;  3ETG A;  2ZM6 B;  3P30 A;  2GSM B;  5B1B C;  4GKJ B;  3LSU A;  2YIC A;  1S77 D;  4DV4 O;  4OXS A;  2YXY A;  1RM1 B;  4JI5 B;  1N36 B;  2F4V O;  3W7U A;  1VF6 A;  1YSC A;  4TT3 G;  2P06 A;  2ZR2 A;  2P67 A;  2OWO A;  4DR7 B;  4PD4 F;  1QNM A;  1BHB A;  5B1O A;  2Y0I A;  4UCV A;  5H9C A;  3X2Q B;  3B40 A;  5KHI A;  4W4K A;  3QNE A;  5GTH Z;  4J11 A;  2HG5 C;  3N27 A;  4P9O A;  1FFX A;  3E22 A;  4HYO A;  4WFB V;  5EIB C;  2DMX A;  1VQ4 V;  3BFR A;  3RYF A;  5LA6 B;  2WLI A;  3CHX A;  4JI3 O;  1BHA A;  3FB5 C;  1F7Y A;  2FML A;  4DV3 O;  1LNQ A;  3BA9 A;  3T1Y B;  3ETD A;  2WWW A;  1SQB H;  4ZI7 A;  1SQV H;  1QQC A;  2CUG A;  4DR2 B;  5K1X A;  4TQD A;  1JQ0 A;  4YIO A;  4NR1 A;  4QE7 A;  4FZ0 A;  3RFR A;  1Y67 A;  3F5W C;  1FJG O;  3FB8 C;  1VQN V;  1VQL V;  4X89 A;  2M6Y A;  3RBZ A;  2QR4 A;  2NR5 A;  2XND G;  3CJH A;  1XMQ O;  5BMV B;  1KP2 A;  4H0L B;  5JQG B;  2OTL V;  3L72 H;  1GM7 A;  3KDR A;  5IY5 C;  5TIS Z;  4ASU G;  5KAF Z;  4TWK A;  3GWO A;  5JH7 B;  4X62 O;  2JEX A;  2ZE8 A;  4MS2 A;  3VQV A;  3WFV A;  3CCU V;  1DK1 A;  1HNZ O;  4ZHQ A;  1AP6 A;  3IJ4 A;  3A0R A;  3H01 A;  2E5L O;  2MK3 A;  1K33 A;  4Z1M G;  1WP7 A;  2KG7 A;  3PJS K;  1MMM A;  4JTA B;  3CMA V;  4LF7 B;  2DJV A;  4X64 B;  3CCE V;  1W0K G;  4X1K A;  4I0X B;  1U97 A;  3OUF A;  1V55 B;  4QGP A;  5CB4 B;  3RYI A;  4BW5 A;  3QG5 A;  2F93 B;  1YVW A;  4JI6 O;  3SPH A;  4JI7 O;  5IJ0 A;  3WG7 B;  1K34 A;  3LDC A;  1W59 A;  4XDK A;  1S3J A;  4NXN B;  2K9P A;  4QPK A;  5LHH A;  1WA8 B;  1WP8 A;  4RQE A;  1Q3E A;  2HVK C;  5LMU B;  4YXW G;  3T4Z A;  2N74 A;  3AG4 B;  2WA4 A;  2VWK A;  5LHI A;  3I56 V;  4DR3 O;  3BRC A;  3ABK B;  3ZRS A;  4IL6 Z;  1BQZ A;  4DR1 B;  4JV5 B;  3SGI A;  4LH7 A;  1VF5 B;  2BE3 A;  3D3Q A;  4LBE C;  1GM8 A;  3OW2 U;  2YXH A;  1FFX B;  2IJJ A;  5JCO C;  4LF6 B;  4DV0 O;  3E22 B;  1V9P A;  5EIB D;  2WLI B;  2UUA B;  3ZMZ A;  2LJ2 A;  4YY3 B;  4CS2 A;  1XHX A;  3C90 A;  1XNR O;  1B3Q A;  4J80 A;  3T4D A;  3APQ A;  3M7M X;  1VP7 A;  2Q8V A;  2DYS C;  4NYK A;  3OUS A;  4ZI7 B;  2XUM A;  1P7G A;  5CN0 A;  4FZ1 A;  2EIM C;  2QTS A;  3ZHS A;  4OPA A;  1ZLZ A;  1WNS A;  1E79 G;  1Q43 A;  4R50 A;  3K9S A;  2A06 H;  1TUE B;  3KKY A;  2HVJ C;  2WLM A;  1AI6 A;  4GX0 A;  3BEH A;  3K59 A;  2VQE B;  3CJH B;  5B1A C;  1TAE A;  2IJI A;  4JYC A;  3UM7 A;  1P7B A;  2QM8 A;  3ZS8 C;  1XL6 A;  2XOK G;  2G38 A;  1R1B A;  5H6Q A;  3DGE A;  3JD4 A;  4JI6 B;  4ZHQ B;  3CCL V;  2HHH O;  4PDM A;  2ZE6 A;  2V4D A;  3HR0 A;  1AJN A;  3TXS A;  3AEI A;  2UXX A;  3JSN A;  3T1H O;  4X1K B;  1XIL A;  5J2T A;  2OIG A;  4I4T A;  1HDJ A;  4DUY B;  4DV5 O;  4QNH B;  1VQP V;  1VIB A;  2Z5U A;  3HKB A;  4O4J A;  3SYA A;  1N4C A;  3CEI A;  5IJ0 B;  3E89 A;  2F23 A;  4UV8 A;  3OGC C;  2UUC B;  1FD9 A;  2BCC H;  1P4R A;  5H2F Z;  2DOS A;  1WLE A;  5GTI Z;  4EFE A;  4F6R A;  2OYQ A;  1HR0 B;  2E76 B;  2NLJ C;  3CC7 V;  4CH4 A;  3ABL B;  3JAW A;  2CGN A;  3RT3 C;  2JJ1 G;  3G71 V;  3RYH A;  5D5P A;  5KLV H;  4OX9 O;  3OAA G;  1XBL A;  3ZIA G;  2PYL A;  4L8J A;  1V54 B;  3GWK C;  3W7T A;  3CPW U;  1ZL8 B;  4TV8 A;  4KHP B;  5KX5 A;  2KKW A;  4BIU A;  1B04 A;  4LR3 A;  4FJC C;  2UXB O;  1R6K A;  2P22 C;  1MA1 A;  3PN1 A;  2EZO A;  2UU9 O;  3F5T A;  2YUA A;  3ZMS A;  4YHH B;  1CXZ B;  3MDS A;  1OZ0 A;  4DUZ O;  1KD1 W;  1FYJ A;  3CP1 A;  3AG2 C;  1K5S A;  3LSS A;  3OMA B;  1XRE A;  4NTW A;  3K5M A;  1KYO F;  1ZX3 A;  2Q0A A;  4X88 A;  1IZ3 A;  5IWA O;  3ABM C;  1ORQ C;  5D5Q A;  4O4L A;  3TGU H;  2AZ0 A;  4TQF A;  4I50 A;  5CMU A;  1FXH A;  3CRM A;  5LGU A;  1YTF D;  4CH6 A;  3ASN C;  1F23 A;  4JYA O;  1NQT A;  4JTD B;  3W7X A;  3L73 H;  3K0G A;  4RO2 A;  5LXT A;  4ICG A;  2ZKO A;  4RWU A;  2ZIM A;  4FIP C;  4F6E A;  2RMK B;  5LP6 C;  1JOY A;  2VS0 A;  4UUJ C;  3CYO A;  2EX3 A;  4B7K A;  2QSA A;  5A2Q N;  2DYR C;  2LFS A;  1L8D A;  1OCO C;  3JAL A;  1JFF A;  4IGG A;  1H2M A;  4E2L A;  2FKX A;  4FLZ A;  2HJF C;  2Q7G A;  3UT5 A;  3DSQ A;  2PF4 E;  1I94 B;  2Y69 C;  4TOI A;  2P7T C;  3RVZ A;  3CCJ V;  1NBM G;  1VQK V;  5J2T B;  4MVQ A;  2FL4 A;  4I4T B;  1ZAU A;  2IH3 C;  2X6B A;  5BXZ A;  4UV9 A;  3HKB B;  4O4J B;  2EIJ B;  1JX9 A;  2YID A;  4KL1 A;  4K0K B;  2QM4 A;  3M8A A;  1XQ8 A;  3HKD A;  4F6R B;  1HW7 A;  3E83 A;  4FLY A;  1OV9 A;  1SF9 A;  3JAW B;  1H8H G;  3SJC C;  3ZN1 A;  4PDV A;  5J9P C;  5L3B A;  5LYJ A;  5ITZ A;  2RJZ A;  4MTO A;  1SZX A;  3QVN A;  4UCT A;  3RYH B;  2WPD G;  3CX5 F;  1OCZ C;  4DR5 O;  3UO2 A;  2VQF B;  1WJZ A;  3QO8 A;  3TET A;  1M56 B;  1LR1 A;  3W7W A;  4FLT A;  1IBM O;  4TV8 B;  3WB0 A;  2F1M A;  3TJT A;  1FFT B;  1OHH G;  1Y4M A;  5KX5 B;  2PI5 A;  1H38 A;  1N32 O;  2UXD O;  4DR6 B;  4ZIB A;  2ZDI C;  1MSW D;  3E86 A;  1GRJ A;  4DV6 B;  1K5Q A;  5B3S B;  1J5E B;  1H2K A;  2ZE5 A;  4ZOL A;  2XTA A;  2OCC B;  4LFB O;  3RGB A;  3THO A;  4MW3 A;  4EFB A;  3LNM B;  3M99 B;  1KKC A;  1OCR B;  3E8G A;  3AG1 B;  4MTX A;  1N33 B;  4O4L B;  4K8X A;  4I50 B;  1KUQ A;  1WPX A;  4AHC A;  2DE0 X;  2PUS A;  4X9Q A;  4CBC A;  1XNQ B;  4BAY A;  2QKC A;  1KB9 F;  1G1X B;  2CAZ C;  4J10 A;  4JAV A;  5LXT B;  2EUL A;  1D2D A;  4H33 A;  4JI4 B;  2W6J G;  2B5U A;  1D5N A;  1N0J A;  3T2M A;  2XT9 A;  1YEW A;  3AG3 C;  2ADP A;  1GO3 F;  4AQY B;  4EKW A;  4B3M O;  2OIE A;  1NR1 A;  3JD3 A;  3JAL B;  1JFF B;  3A0H Z;  1M57 C;  5L3G A;  4AIL C;  3P3P A;  1T5E A;  1PNK A;  2ZIN A;  1RPO A;  3K9A A;  3UT5 B;  2AHZ A;  4RAI A;  4L87 A;  3VOU A;  2D3O W;  4H13 B;  2EIL B;  4OGQ B;  3DTU B;  3EFF K;  1K9M W;  2E3C A;  2ZT9 B;  3P3N A;  1K73 W;  4J7J A;  1MOF A;  2JEU A;  3SYC A;  4OPH A;  1RM1 C;  3HKD B;  1LUW A;  3OTO B;  4WCE V;  4Z1V A;  1PKX A;  4LFC O;  4JF3 A;  1JA8 A;  3L9D A;  2AZ2 A;  4GT1 A;  1IBK O;  3X2Q C;  5ITZ B;  5LYJ B;  4G2K A;  2N04 A;  2Q0O C;  1WA8 A;  3JAM N;  1URF A;  3SJB C;  4PHZ A;  4X65 O;  2D2C B;  1GK9 A;  1D5A A;  3G6B A;  5CBG A;  3BAA A;  1N34 O;  1IBL B;  2XAG A;  1HNX O;  3C3S A;  1SKV A;  4DO2 A;  1JPX A;  1K8A W;  5DED A;  4FK5 C;  3ABT A;  4MVS A;  2R9A A;  4G28 B;  4IT5 A;  3O65 A;  4ZOL B;  3OMN B;  3K5O A;  1KKD A;  1SC5 B;  4DV1 B;  5KHG A;  3CE2 A;  4FM1 A;  4ABM A;  2YEV A;  4NB5 A;  2B9Z A;  4O2B A;  2Q9L A;  3JCZ A;  5B1B B;  4FLX A;  4LF4 B;  1SES A;  4B3M B;  2YC0 A;  3WB1 A;  4JZG A;  2JK5 C;  1CP9 A;  1H2G A;  1AP5 A;  2UXC O;  2LQT A;  1IXM A;  2V1D A;  3I55 V;  5BY1 A;  4LF8 O;  1CPY A;  1SET A;  1SZT A;  2JVD A;  4UCU A;  4KP4 A;  4I5S A;  5KA5 A;  5LL6 Y;  1THZ A;  1Z5V A;  3WU2 Z;  4DYL A;  5IYB O;  3ZED A;  4LP8 A;  1RP3 B;  4B3S O;  2LFR A;  1EZV H;  2DQ3 A;  1V55 C;  3OD4 A;  5JCO A;  1ZUQ A;  3SPJ A;  3D36 A;  1GKF A;  4WBN A;  2BTO A;  2X0L A;  2X7R B;  5FPO A;  4X66 B;  4PA9 A;  3VQW A;  1BZK A;  1EBO A;  5FNV A;  3KZI Z;  1M4U A;  4E4E A;  4I55 A;  2O57 A;  2X6A A;  1KP3 A;  2Q73 A;  5LMN O;  4KFM A;  1YHQ V;  3E8F A;  1IX9 A;  1DGS A;  3LNN A;  3U0Z A;  4X1I A;  1AI5 A;  4DV4 B;  2AXT Z;  1MG1 A;  1ROP A;  2LW7 A;  4IYH A;  2PGG A;  1VF6 C;  2FYU H;  3ASO C;  2F4V B;  4GZR B;  2GTS A;  3NXS A;  1Q5O A;  1YXB A;  3AK3 A;  4UB6 Z;  2CDY A;  1H5W A;  5IYC O;  3G6E V;  4LF5 O;  4TSF G;  1FKA O;  1EZJ A;  1W2B U;  2ITC C;  3ZHU A;  1XMO O;  4U7O A;  3CXH F;  2WLK A;  3UO3 A;  4GLX A;  3EXA A;  2Q69 A;  3JYC A;  3U10 A;  3CCV V;  2RDC A;  4JI3 B;  3MHS C;  4K8Z A;  4N23 A;  1L0N H;  1M5I A;  2EJ7 A;  4DV3 B;  1ZL8 A;  4RUF A;  2JDI G;  4K35 A;  4B3T O;  3R66 A;  3HPL C;  2R9I A;  3ZRX A;  1K4D C;  3NR7 A;  3RW0 A;  3TK1 A;  1H2N A;  4LFA O;  2YEV B;  4O2B B;  1JCH A;  3SYQ A;  5KHK A;  1WPB A;  1BCC H;  5JJN B;  5FLX N;  4GKK O;  1S0V A;  4JAA A;  1FJG B;  1Y74 A;  2KQX A;  4IIJ A;  2Z3Y A;  3KCY A;  1XMQ B;  4LF9 O;  5KA6 A;  2PZS A;  1US6 A;  1B06 A;  2IBZ H;  4HAM A;  2LP7 A;  4X62 B;  1COW G;  1HNZ B;  3UKM A;  5J2U A;  1Y6X A;  2EZP A;  2E5L B;  1GH6 A;  1BQ0 A;  1VQ7 V;  1WB8 A;  2KSD A;  3CRA A;  1H2S B;  3R65 A;  4GX5 A;  5L3D A;  1JNB A;  5LMN B;  1Q6I A;  2QM7 A;  2B1G A;  1F51 A;  4WBN B;  5IYD O;  2HEP A;  1BGY H;  3H1J H;  1Q86 W;  5IYZ A;  4JI7 B;  4KXR A;  5FNV B;  1PNL A;  4I55 B;  2DYS B;  1XUQ A;  5CA1 A;  4J7K A;  5B5E Z;  1VQ9 V;  2EIM B;  1NVP D;  4X1I B;  1YTF B;  2ZNI A;  3FB7 C;  4UVB A;  2Q4P A;  3RYC A;  3E2E A;  4DR3 B;  4U7N A;  1YI2 V;  2QWR B;  3SDL A;  4DV2 O;  5DN6 G;  5B1A B;  5LP6 A;  4JI0 O;  3JAK A;  1G8M A;  3H1I H;  3CCR V;  1XEQ A;  4XBF A;  1HNW O;  1AJP A;  1GTO A;  1NI8 A;  4A5U B;  4UFZ A;  4DV0 B;  4MVO A;  3L70 H;  5CA0 A;  2NN4 A;  1XNR B;  3JCU Z;  3H1K H;  2RCV A;  4MVM A;  3SPG A;  1G4Y B;  2JGU A;  1MSD A;  4HZ3 A;  2DWD C;  1VQ8 V;  3CRQ A;  3N2G A;  2F66 C;  3CXC U;  1FPO A;  2Y4T A;  1NTZ H;  1OJH A;  4MTF A;  4TV9 A;  3FKS G;  2UUB O;  5DEC A;  2WLL A;  2HR3 A;  2XAS A;  4RUE A;  1N8R W;  1NJI W;  1Y74 B;  4WF9 V;  4GYC B;  4IIJ B;  4EEQ A;  4XDL A;  1RFY A;  4PA4 A;  5IWA B;  2B1I A;  3A8T A;  4FM2 A;  1ZSP A;  1BSM A;  1KU9 A;  4U3J B;  3K79 A;  3DC6 A;  4PI0 A;  4D7T A;  2IU0 A;  4BIZ A;  2HHH B;  5J2U B;  3Q4H A;  3AK2 A;  3DXR A;  4GCZ A;  3S3W A;  1OCC B;  2WSS G;  2YDE A;  1IJG A;  3FB6 C;  3T1H B;  1Q6U A;  2ZDI A;  1R6T A;  1WN7 A;  1IVS A;  4NXM O;  4LNU A;  1NZ6 A;  4DV5 B;  1EN6 A;  3QO5 A;  4C7U A;  2X6C A;  5IYZ B;  3G4S V;  4FMT A;  2DW4 A;  1MZE A;  3F7V C;  3AG2 B;  4AI8 A;  4LH6 A;  5L3C A;  4XDJ A;  1QU7 A;  5LHG A;  3FYE B;  2WLJ A;  3QF7 A;  5CA1 B;  1NTM H;  1AR4 A;  1KQS U;  3ABM B;  2IJH A;  1UFI A;  1QLE C;  3IC9 A;  1XHZ A;  1RPR A;  4DW1 A;  4R7C A;  1A32 A;  1ENV A;  4FFK A;  3EHB B;  1JR9 A;  3ASN B;  4WFH A;  5LGN A;  1HWY A;  1JJ2 U;  4MT8 A;  4LC1 A;  5AG2 A;  3VBB A;  3RYC B;  3L74 H;  1BE3 H;  2M7W A;  2Z0A A;  4J42 A;  4OX9 B;  2ZXW C;  2EIN C;  1AR5 A;  2N05 A;  2WLH A;  4F4L A;  5LP6 B;  1PNM A;  2PYJ A;  3KCX A;  4DV7 O;  3JAK B;  4JI1 O;  1FXK A;  2DYR B;  1EN5 A;  1SQP H;  1WAZ A;  2UXB B;  2IW5 A;  4D6T H;  3E8H A;  1OCO B;  1EN4 A;  2UU9 B;  2IH1 C;  4DXW A;  4JI2 O;  4PI2 A;  4ZBM A;  5CA0 B;  3SJQ C;  3J7A U;  3H9V A;  1KC8 W;  2NNU A;  4DUZ B;  4P30 A;  4JI8 O;  4LWS A;  2Y69 B;  4BR6 A;  2IM9 A;  3AG1 C;  3AG7 A;  2W6I G;  3OMI B;  3N2G B;  1I5Y A; 
#chains in the Genus database with same CATH homology
 3DC6 A;  1IXB A;  2CE4 A;  3AK2 A;  3AK3 A;  4X9Q A;  1XUQ A;  2CDY A;  1PM9 A;  2QKC A;  2QKA A;  1LUV A;  1XDC A;  4YIO A;  1I0H A;  1D5N A;  1N0J A;  1EM1 A;  1BS3 A;  2ADP A;  1Y67 A;  1ZTE A;  1EN6 A;  1BT8 A;  4C7U A;  4JZ2 A;  1PL4 A;  1WB7 A;  3C3T A;  4JZG A;  1AP5 A;  3KDR A;  1P7G A;  2GDS A;  1AR4 A;  4JYY A;  4YIP A;  1GN2 A;  1ZLZ A;  3IC9 A;  1AP6 A;  1MA1 A;  4FFK A;  1GN4 A;  1JR9 A;  3K9S A;  1SZX A;  3MDS A;  3QVN A;  3KKY A;  1MMM A;  3LSU A;  5AG2 A;  1AVM A;  2ADQ B;  1XRE A;  1VEW A;  2RCV A;  3AK1 A;  1ZUQ A;  1AR5 A;  4GUN A;  1LUW A;  3TJT A;  1MSD A;  1B06 A;  1N0N A;  1JA8 A;  1EN5 A;  1GN3 A;  3RN4 A;  1QNM A;  4E4E A;  1EN4 A;  1MNG A;  1IDS A;  1WB8 A;  3EVK A;  1GN6 A;  2P4K A;  1IX9 A;  1XIL A;  4F6E A;  4BR6 A;  2AW9 A;  3BFR A;  1VAR A;  1KKC A;  5A9G A;  3DC5 A;  1ZSP A;  3CEI A;  1BSM A;  3C3S A;  1I08 A;  3OT7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...