3AK9A

Crystal structure of the sep22 dodecamer, a dps-like protein from salmonella enterica subsp. enterica serovar enteritidis, fe-soaked form
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
155
structure length
155
Chain Sequence
NLLYTRNDVSESDKKATVELLNRQVIQFIDLSLITKQAHWNMRGANFIAVHEMLDGFRTALTDHLDTMAERAVQLGGVALGTTQVINSKTPLKSYPLDIHNVQDHLKELADRYAVVANDVRKAIGEAKDEDTADIFTAASRDLDKFLWFIESNIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA protection during starvation protein
publication title Structures of the SEp22 dodecamer, a Dps-like protein from Salmonella enterica subsp. enterica serovar Enteritidis
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar kentucky
molecule tags Metal binding protein, oxidoreductase
total genus 65
structure length 155
sequence length 155
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.16.-.-:
pdb deposition date 2010-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 3ak9A00
3GE4A 3E1JA 3OGHA 4Y08A 3T9JA 5IX6A 3BT5A 3RBCA 1JI5A 4EVBA 1NFVA 3O7RA 1RCGA 4LQHA 2JD60 3E1LA 3HL1A 4TOHA 2ITBA 5GN8B 3F38A 4MN9A 2XJOA 3AJOA 5GU3X 2CEIA 1BCFA 2CN6A 3SIDA 1JIGA 3E6SA 3PVRA 5E2DA 4ISMA 2WLUA 4KVSA 2HR5A 4ZL5A 3A68A 3O7SA 2VZBA 2WTLA 4MJYA 5K52A 4XGSA 2C41A 4DYUA 4II4A 1TJOA 3PZAA 2C6RA 2QQYA 2GYQA 4CVPA 1TKPA 3E1OA 2XGWA 3R2KA 1L8IA 3AF7X 4RC7A 5J9VA 4CVSA 4TODA 5GU2X 1OTKA 5ERJA 3R2MA 1RCIA 3PW8A 2CIHA 3E6RA 4TOEA 4ISPA 5D8SA 3R2LA 2YJJA 4CMYV 4EVDA 1ZS3A 3RE7A 4A25A 2RBDA 1S2ZA 5C6FA 3E1QA 3VNXA 2IB0A 2CHIA 1BFRA 1SQ3A 1Z6OA 2FG4A 4ZKXA 2UX1A 4RC6A 3WVUA 2ZA6A 2V2NA 2Z5RA 4PGIA 3H7GA 2ZURX 2VXIA 4RC5B 4DASA 2YW7A 2Z90A 5LBHA 1XZ1A 4KVQA 4LYUA 1O9RA 1F30A 3AJQA 4XKTA 3BVLA 4ITTA 1MFRA 4QUWA 5J8WA 2W0OA 3RAVA 3UOFA 4TOAA 5HJHA 3ES3A 1N1QA 5K53A 3NP0X 1NF4A 4LQVA 4Z5SA 5GOUA 2XJNA 3WNWA 3Q4OA 2ZA8A 5JKLG 5HJFA 1DPSA 3WVVA 4PG0A 1JTSA 4DYYA 4M33A 1YV1A 4PG1A 4DI0A 3WVWA 1VELA 2F7NA 1AEWA 3KA8A 4ITWA 2ZG8X 4EVEA 5ERKA 4TW3A 2V2SA 3SH6A 5GU0X 3TA8A 1QGHA 2CLBA 3SE1A 3BKNA 5JACA 5FFEA 3QHBA 3F37A 2Z5QA 4ETRA 1RCDA 2V2IA 3PVTA 1VEIA 3QZ3A 3KX9A 1JI4A 2C2FA 3NP2X 3Q4QA 4AM5A 5JKLA 1R03A 1UVHA 2BK6A 3AK9A 1RCEA 4IXKA 2BKCA 5AXSA 2XKQA 2JD70 2ZG9X 1VLGA 3QHCA 3QVDA 2V2JA 3FSEA 2V2RA 2V2PA 4ZTTA 3PW1A 2FKZA 1JKVA 3R2HA 1VEQA 3E1MA 4TOGA 2FZFA 4EVCA 5D8PA 3GVYA 1FHAA 1NF6A 3ISFA 3NOZX 2V2LA 1F33A 4XKSA 1EUMA 4CYAA 5CMRA 1H96A 2OC5A 1NNQA 2FL0A 2GYDA 2CLUA 3BVFA 3KXUA 1B71A 2FHAA 5D8YA 5GN8A 3PVYB 2QF9A 4IWKA 4E6KA 2V15A 3FI6A 3PWQC 1JYBA 3BVKA 1JKUA 3BVEA 4ZLWA 2C2UA 1BG7A 1LKMA 3FVBA 1O9IA 2GS4A 4P18A 3PVRB 3ISEA 2FFXJ 3IS8A 3UNOA 5CMQA 3IQ1A 5FFBA 5J8SA 3U90A 4II4B 4TOBA 2Z5PA 2ZG7X 2ZA7A 3F36A 2FG8A 5D8QA 2CN7A 4AM2A 1MOJA 4ZJKA 4XKUA 4DYXA 1JGCA 1LKPA 4ERUA 2PYBA 4RC7B 5I4JA 2OH3A 4TOCA 4CVTA 1RYTA 1QYBA 1YUXA 4RC8A 4ZL6A 3KA6A 4IWJA 5FFCA 4MY7A 4LQNA 1DVBA 3R2RA 4ZMCA 5CZUA 4REUA 1Z4AA 3IS7A 1UMNA 4Z3BA 2FJCA 4DE6A 1S3QA 4TOFA 2VXXA 1DATA 4RC6B 1GWGA 3F35A 2Y3QA 3AF9X 5HQOA 1VJXA 2BW1A 2CF7A 3EZUA 3PVYA 4R42A 5D8RA 3R2OA 5GU1X 1Z6OM 1RCCA 2YW6A 5FFDA 3F34A 4RC5A 4U3GA 2IU2A 2CHPA 3GHQA 3HIUA 2V2MA 3E1NA 4MUDA 5FEJA 5LG2A 3BVIA 1L8HA 3EGMA 4M35A 3E1PA 2V2OA 1XZ3A 3KA4A 2XJMA 4M34A 3AF8X 3OJ5A 2C2JA 4CY9A 4CVRA 2D5KA 4ZKWA 3KWOA 3PWQA 4LPJA 5J93A 5JKMG 3RGDA 1TKOA 5E1UA 2WLAA 4CMYA 2BJYA 1LKOA 5FFAA 3ERZA 3UOIA 3Q4RA 3R2SA 4TO9A 3QB9A 4KVRA 4ML5A 1JREA 1S30A 3PWFA 3Q4NA 4ZKHA 3RD0A 2Z6MA 3MPSA 4DYZA 1ZUJA 3E2CA 4LQJA 1YUZA 2JD80 3SHXA 3QD8A 4M32A 2IY4A 3PVTB 3F32A 5LG8A 1IERA 3F39A 4LYXA 5D8OA 5LS9A 2X170 4PGKA 1LB3A 5JKMA 1HRSA 4DZ0A 3PW8C 3EZ0A 4MKUA 4CYBA 3F33A 4LPMA 2YJKA 3KA9A 2HTNA 1TK6A 3A9QA 1IESA 2G4HA 3PW1B 4LPNA 3KA3A 1SOFA 4YKHA 1KRQA 1J30A 4OYNA 5D8XA 4AM4A 3AK8A 3AJPA
chains in the Genus database with same CATH superfamily
3GE4A 3E1JA 4E40A 3OGHA 4Y08A 4X0JA 3T9JA 5IX6A 3BT5A 3RBCA 1JI5A 4EVBA 1NFVA 3O7RA 1RCGA 4LQHA 2JD60 3E1LA 3HL1A 4TOHA 2ITBA 5GN8B 3UFBA 3F38A 3M6JA 4MN9A 2XJOA 3AJOA 5GU3X 2CEIA 4W4LB 1BCFA 2CN6A 3SIDA 5JDOB 1JIGA 3E6SA 3PVRA 5E2DA 4ISMA 2WLUA 4KVSA 2HR5A 4ZL5A 3A68A 3O7SA 2VZBA 2WTLA 4MJYA 5K52A 4XGSA 2C41A 4DYUA 3V3KB 4II4A 1TJOA 3PZAA 4W4KB 2C6RA 2QQYA 3C1ZA 2GYQA 4CVPA 1TKPA 3E1OA 2XGWA 3VV9A 3R2KA 1L8IA 2N02A 3AF7X 4RC7A 5J9VA 4CVSA 4TODA 5GU2X 1OTKA 5ERJA 3R2MA 1RCIA 3PW8A 2CIHA 3E6RA 4TOEA 4ISPA 5D8SA 3R2LA 2YJJA 4CMYV 4EVDA 1ZS3A 3RE7A 4A25A 2RBDA 1S2ZA 5C6FA 3E1QA 3VNXA 2IB0A 2CHIA 1BFRA 1SQ3A 1Z6OA 4MXPA 2FG4A 3FRRA 4ZKXA 2UX1A 4RC6A 3WVUA 2ZA6A 2V2NA 2Z5RA 4PGIA 3H7GA 2ZURX 2VXIA 2CWLA 4RC5B 4YVZA 3D19A 4DASA 2YW7A 2Z90A 5LBHA 1XZ1A 4KVQA 4LYUA 1O9RA 4WJG4 1F30A 3AJQA 4XKTA 3BVLA 4ITTA 1MFRA 4QUWA 5J8WA 2W0OA 3RAVA 3UOFA 4TOAA 5HJHA 3ES3A 1N1QA 5K53A 3NP0X 1NF4A 4LQVA 4Z5SA 5GOUA 2XJNA 3WNWA 3Q4OA 2ZA8A 5JKLG 2OKCA 5HJFA 1DPSA 3WVVA 4PG0A 1JTSA 4DYYA 4M33A 1YV1A 4PG1A 4DI0A 3WVWA 1VELA 2F7NA 1AEWA 3KA8A 4ITWA 2ZG8X 4EVEA 5ERKA 4TW3A 2V2SA 3SH6A 5GU0X 3TA8A 1QGHA 2CLBA 3SE1A 3BKNA 5JACA 5FFEA 3QHBA 3F37A 2Z5QA 2V8TA 4ETRA 1RCDA 2V2IA 3PVTA 1VEIA 3QZ3A 3KX9A 1JI4A 2C2FA 3NP2X 3Q4QA 4AM5A 5JKLA 1R03A 1UVHA 3DBYA 2BK6A 3AK9A 1RCEA 4IXKA 2BKCA 5AXSA 2XKQA 2JD70 2ZG9X 1VLGA 3QHCA 3QVDA 2V2JA 3FSEA 2V2RA 2V2PA 4ZTTA 3PW1A 2FKZA 1JKVA 3R2HA 1VEQA 3E1MA 3C21A 3L0MA 2Y44A 3W54A 4TOGA 2FZFA 4EVCA 5D8PA 3GVYA 1FHAA 1NF6A 2WWXB 3ISFA 3NOZX 2V2LA 1F33A 4XKSA 1EUMA 4CYAA 5CMRA 1H96A 2OC5A 4YXMA 1NNQA 2G38B 2FL0A 2GYDA 2CLUA 3BVFA 3KXUA 1B71A 2AR0A 2FHAA 5D8YA 5GN8A 3PVYB 2QF9A 4IWKA 4E6KA 3JZAB 2V15A 3FI6A 3PWQC 1JYBA 3BVKA 1JKUA 3BVEA 4ZLWA 2C2UA 1BG7A 1LKMA 3FVBA 1O9IA 2GS4A 4P18A 3PVRB 4KXRB 3ISEA 2FFXJ 3IS8A 3UNOA 5JDOA 5CMQA 3IQ1A 5FFBA 5J8SA 3U90A 4II4B 4TOBA 2Z5PA 2ZG7X 2ZA7A 3F36A 2FG8A 5D8QA 3LKDA 2CN7A 4AM2A 1MOJA 4ZJKA 3N6OA 4XKUA 3KHKA 4DYXA 1JGCA 1LKPA 4ERUA 2PYBA 2V8UA 4RC7B 5I4JA 2OH3A 4TOCA 4CVTA 1RYTA 1QYBA 1YUXA 4RC8A 4ZL6A 3KA6A 4IWJA 5FFCA 4MY7A 4LQNA 1DVBA 3R2RA 2MGYA 3GGYA 4ZMCA 5CZUA 4REUA 1Z4AA 3IS7A 1UMNA 4Z3BA 2FJCA 4DE6A 1S3QA 4TOFA 2VXXA 1DATA 4RC6B 1GWGA 3F35A 2Y3QA 3AF9X 5HQOA 1VJXA 2BW1A 2CF7A 3EZUA 3PVYA 4R42A 5D8RA 3R2OA 3C1YA 5GU1X 1Z6OM 1RCCA 2YW6A 5FFDA 3F34A 4RC5A 4U3GA 2IU2A 2CHPA 3GHQA 3HIUA 2V2MA 3E1NA 4MUDA 5FEJA 5LG2A 3KDQA 3BVIA 1L8HA 3EGMA 4M35A 3E1PA 2V2OA 1XZ3A 3KA4A 2XJMA 4M34A 3AF8X 3OJ5A 2C2JA 4CY9A 4CVRA 2D5KA 4ZKWA 3KWOA 3PWQA 4LPJA 5J93A 5JKMG 3RGDA 1TKOA 5E1UA 2WLAA 4CMYA 2BJYA 1LKOA 4YXJA 5FFAA 3ERZA 3UOIA 3Q4RA 3GGZA 3R2SA 4TO9A 3QB9A 4KVRA 4ML5A 1JREA 1S30A 3PWFA 3Q4NA 3JZ9A 4ZKHA 3RD0A 2Z6MA 3MPSA 4DYZA 1ZUJA 3E2CA 4LQJA 1YUZA 2JD80 3SHXA 3QD8A 4M32A 2IY4A 5HU6D 3PVTB 3F32A 5LG8A 1IERA 3F39A 3FRSA 4LYXA 5D8OA 5LS9A 2X170 4PGKA 1LB3A 5JKMA 1HRSA 4DZ0A 3PW8C 3C23A 3EZ0A 4MKUA 4CYBA 3F33A 4LPMA 2YJKA 3KA9A 2HTNA 1TK6A 3A9QA 3VVAA 1IESA 2G4HA 3PW1B 4LPNA 3KA3A 1SOFA 4YKHA 1KRQA 1J30A 4OYNA 5D8XA 4AM4A 3AK8A 3AJPA
chains in the Genus database with same CATH topology
3GE4A 3E1JA 4E40A 3OGHA 4Y08A 4X0JA 3T9JA 5IX6A 3BT5A 3RBCA 1JI5A 4EVBA 1NFVA 3O7RA 1RCGA 4LQHA 2JD60 3E1LA 3HL1A 4TOHA 2ITBA 5GN8B 3UFBA 3F38A 3M6JA 4MN9A 2XJOA 3AJOA 5GU3X 2CEIA 4W4LB 1BCFA 2CN6A 3SIDA 5JDOB 1JIGA 3E6SA 3PVRA 5E2DA 4ISMA 2WLUA 4KVSA 2HR5A 4ZL5A 3A68A 3O7SA 2VZBA 2WTLA 4MJYA 5K52A 4XGSA 2C41A 4DYUA 3V3KB 4II4A 1TJOA 3PZAA 4W4KB 2C6RA 2QQYA 3C1ZA 2GYQA 4CVPA 1TKPA 3E1OA 2XGWA 3VV9A 3R2KA 1L8IA 2N02A 3AF7X 4RC7A 5J9VA 4CVSA 4TODA 5GU2X 1OTKA 5ERJA 3R2MA 1RCIA 3PW8A 2CIHA 3E6RA 4TOEA 4ISPA 5D8SA 3R2LA 2YJJA 4CMYV 4EVDA 1ZS3A 3RE7A 4A25A 2RBDA 1S2ZA 5C6FA 3E1QA 3VNXA 2IB0A 2CHIA 1BFRA 1SQ3A 1Z6OA 4MXPA 2FG4A 3FRRA 4ZKXA 2UX1A 4RC6A 3WVUA 2ZA6A 2V2NA 2Z5RA 4PGIA 3H7GA 2ZURX 2VXIA 2CWLA 4RC5B 4YVZA 3D19A 4DASA 2YW7A 2Z90A 5LBHA 1XZ1A 4KVQA 4LYUA 1O9RA 4WJG4 1F30A 3AJQA 4XKTA 3BVLA 4ITTA 1MFRA 4QUWA 5J8WA 2W0OA 3RAVA 3UOFA 4TOAA 5HJHA 3ES3A 1N1QA 5K53A 3NP0X 1NF4A 4LQVA 4Z5SA 5GOUA 2XJNA 3WNWA 3Q4OA 2ZA8A 5JKLG 2OKCA 5HJFA 1DPSA 3WVVA 4PG0A 1JTSA 4DYYA 4M33A 1YV1A 4PG1A 4DI0A 3WVWA 1VELA 2F7NA 1AEWA 3KA8A 4ITWA 2ZG8X 4EVEA 5ERKA 4TW3A 2V2SA 3SH6A 5GU0X 3TA8A 1QGHA 2CLBA 3SE1A 3BKNA 5JACA 5FFEA 3QHBA 3F37A 2Z5QA 2V8TA 4ETRA 1RCDA 2V2IA 3PVTA 1VEIA 3QZ3A 3KX9A 1JI4A 2C2FA 3NP2X 3Q4QA 4AM5A 5JKLA 1R03A 1UVHA 3DBYA 2BK6A 3AK9A 1RCEA 4IXKA 2BKCA 5AXSA 2XKQA 2JD70 2ZG9X 1VLGA 3QHCA 3QVDA 2V2JA 3FSEA 2V2RA 2V2PA 4ZTTA 3PW1A 2FKZA 1JKVA 3R2HA 1VEQA 3E1MA 3C21A 3L0MA 2Y44A 3W54A 4TOGA 2FZFA 4EVCA 5D8PA 3GVYA 1FHAA 1NF6A 2WWXB 3ISFA 3NOZX 2V2LA 1F33A 4XKSA 1EUMA 4CYAA 5CMRA 1H96A 2OC5A 4YXMA 1NNQA 2G38B 2FL0A 2GYDA 2CLUA 3BVFA 3KXUA 1B71A 2AR0A 2FHAA 5D8YA 5GN8A 3PVYB 2QF9A 4IWKA 4E6KA 3JZAB 2V15A 3FI6A 3PWQC 1JYBA 3BVKA 1JKUA 3BVEA 4ZLWA 2C2UA 1BG7A 1LKMA 3FVBA 1O9IA 2GS4A 4P18A 3PVRB 4KXRB 3ISEA 2FFXJ 3IS8A 3UNOA 5JDOA 5CMQA 3IQ1A 5FFBA 5J8SA 3U90A 4II4B 4TOBA 2Z5PA 2ZG7X 2ZA7A 3F36A 2FG8A 5D8QA 3LKDA 2CN7A 4AM2A 1MOJA 4ZJKA 3N6OA 4XKUA 3KHKA 4DYXA 1JGCA 1LKPA 4ERUA 2PYBA 2V8UA 4RC7B 5I4JA 2OH3A 4TOCA 4CVTA 1RYTA 1QYBA 1YUXA 4RC8A 4ZL6A 3KA6A 4IWJA 5FFCA 4MY7A 4LQNA 1DVBA 3R2RA 2MGYA 3GGYA 4ZMCA 5CZUA 4REUA 1Z4AA 3IS7A 1UMNA 4Z3BA 2FJCA 4DE6A 1S3QA 4TOFA 2VXXA 1DATA 4RC6B 1GWGA 3F35A 2Y3QA 3AF9X 5HQOA 1VJXA 2BW1A 2CF7A 3EZUA 3PVYA 4R42A 5D8RA 3R2OA 3C1YA 5GU1X 1Z6OM 1RCCA 2YW6A 5FFDA 3F34A 4RC5A 4U3GA 2IU2A 2CHPA 3GHQA 3HIUA 2V2MA 3E1NA 4MUDA 5FEJA 5LG2A 3KDQA 3BVIA 1L8HA 3EGMA 4M35A 3E1PA 2V2OA 1XZ3A 3KA4A 2XJMA 4M34A 3AF8X 3OJ5A 2C2JA 4CY9A 4CVRA 2D5KA 4ZKWA 3KWOA 3PWQA 4LPJA 5J93A 5JKMG 3RGDA 1TKOA 5E1UA 2WLAA 4CMYA 2BJYA 1LKOA 4YXJA 5FFAA 3ERZA 3UOIA 3Q4RA 3GGZA 3R2SA 4TO9A 3QB9A 4KVRA 4ML5A 1JREA 1S30A 3PWFA 3Q4NA 3JZ9A 4ZKHA 3RD0A 2Z6MA 3MPSA 4DYZA 1ZUJA 3E2CA 4LQJA 1YUZA 2JD80 3SHXA 3QD8A 4M32A 2IY4A 5HU6D 3PVTB 3F32A 5LG8A 1IERA 3F39A 3FRSA 4LYXA 5D8OA 5LS9A 2X170 4PGKA 1LB3A 5JKMA 1HRSA 4DZ0A 3PW8C 3C23A 3EZ0A 4MKUA 4CYBA 3F33A 4LPMA 2YJKA 3KA9A 2HTNA 1TK6A 3A9QA 3VVAA 1IESA 2G4HA 3PW1B 4LPNA 3KA3A 1SOFA 4YKHA 1KRQA 1J30A 4OYNA 5D8XA 4AM4A 3AK8A 3AJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GE4 A;  3E1J A;  3OGH A;  4Y08 A;  3T9J A;  5IX6 A;  3BT5 A;  3RBC A;  1JI5 A;  4EVB A;  1NFV A;  3O7R A;  1RCG A;  4LQH A;  2JD6 0;  3E1L A;  3HL1 A;  4TOH A;  2ITB A;  5GN8 B;  3F38 A;  4MN9 A;  2XJO A;  3AJO A;  5GU3 X;  2CEI A;  1BCF A;  2CN6 A;  3SID A;  1JIG A;  3E6S A;  3PVR A;  5E2D A;  4ISM A;  2WLU A;  4KVS A;  2HR5 A;  4ZL5 A;  3A68 A;  3O7S A;  2VZB A;  2WTL A;  4MJY A;  5K52 A;  4XGS A;  2C41 A;  4DYU A;  4II4 A;  1TJO A;  3PZA A;  2C6R A;  2QQY A;  2GYQ A;  4CVP A;  1TKP A;  3E1O A;  2XGW A;  3R2K A;  1L8I A;  3AF7 X;  4RC7 A;  5J9V A;  4CVS A;  4TOD A;  5GU2 X;  1OTK A;  5ERJ A;  3R2M A;  1RCI A;  3PW8 A;  2CIH A;  3E6R A;  4TOE A;  4ISP A;  5D8S A;  3R2L A;  2YJJ A;  4CMY V;  4EVD A;  1ZS3 A;  3RE7 A;  4A25 A;  2RBD A;  1S2Z A;  5C6F A;  3E1Q A;  3VNX A;  2IB0 A;  2CHI A;  1BFR A;  1SQ3 A;  1Z6O A;  2FG4 A;  4ZKX A;  2UX1 A;  4RC6 A;  3WVU A;  2ZA6 A;  2V2N A;  2Z5R A;  4PGI A;  3H7G A;  2ZUR X;  2VXI A;  4RC5 B;  4DAS A;  2YW7 A;  2Z90 A;  5LBH A;  1XZ1 A;  4KVQ A;  4LYU A;  1O9R A;  1F30 A;  3AJQ A;  4XKT A;  3BVL A;  4ITT A;  1MFR A;  4QUW A;  5J8W A;  2W0O A;  3RAV A;  3UOF A;  4TOA A;  5HJH A;  3ES3 A;  1N1Q A;  5K53 A;  3NP0 X;  1NF4 A;  4LQV A;  4Z5S A;  5GOU A;  2XJN A;  3WNW A;  3Q4O A;  2ZA8 A;  5JKL G;  5HJF A;  1DPS A;  3WVV A;  4PG0 A;  1JTS A;  4DYY A;  4M33 A;  1YV1 A;  4PG1 A;  4DI0 A;  3WVW A;  1VEL A;  2F7N A;  1AEW A;  3KA8 A;  4ITW A;  2ZG8 X;  4EVE A;  5ERK A;  4TW3 A;  2V2S A;  3SH6 A;  5GU0 X;  3TA8 A;  1QGH A;  2CLB A;  3SE1 A;  3BKN A;  5JAC A;  5FFE A;  3QHB A;  3F37 A;  2Z5Q A;  4ETR A;  1RCD A;  2V2I A;  3PVT A;  1VEI A;  3QZ3 A;  3KX9 A;  1JI4 A;  2C2F A;  3NP2 X;  3Q4Q A;  4AM5 A;  5JKL A;  1R03 A;  1UVH A;  2BK6 A;  3AK9 A;  1RCE A;  4IXK A;  2BKC A;  5AXS A;  2XKQ A;  2JD7 0;  2ZG9 X;  1VLG A;  3QHC A;  3QVD A;  2V2J A;  3FSE A;  2V2R A;  2V2P A;  4ZTT A;  3PW1 A;  2FKZ A;  1JKV A;  3R2H A;  1VEQ A;  3E1M A;  4TOG A;  2FZF A;  4EVC A;  5D8P A;  3GVY A;  1FHA A;  1NF6 A;  3ISF A;  3NOZ X;  2V2L A;  1F33 A;  4XKS A;  1EUM A;  4CYA A;  5CMR A;  1H96 A;  2OC5 A;  1NNQ A;  2FL0 A;  2GYD A;  2CLU A;  3BVF A;  3KXU A;  1B71 A;  2FHA A;  5D8Y A;  5GN8 A;  3PVY B;  2QF9 A;  4IWK A;  4E6K A;  2V15 A;  3FI6 A;  3PWQ C;  1JYB A;  3BVK A;  1JKU A;  3BVE A;  4ZLW A;  2C2U A;  1BG7 A;  1LKM A;  3FVB A;  1O9I A;  2GS4 A;  4P18 A;  3PVR B;  3ISE A;  2FFX J;  3IS8 A;  3UNO A;  5CMQ A;  3IQ1 A;  5FFB A;  5J8S A;  3U90 A;  4II4 B;  4TOB A;  2Z5P A;  2ZG7 X;  2ZA7 A;  3F36 A;  2FG8 A;  5D8Q A;  2CN7 A;  4AM2 A;  1MOJ A;  4ZJK A;  4XKU A;  4DYX A;  1JGC A;  1LKP A;  4ERU A;  2PYB A;  4RC7 B;  5I4J A;  2OH3 A;  4TOC A;  4CVT A;  1RYT A;  1QYB A;  1YUX A;  4RC8 A;  4ZL6 A;  3KA6 A;  4IWJ A;  5FFC A;  4MY7 A;  4LQN A;  1DVB A;  3R2R A;  4ZMC A;  5CZU A;  4REU A;  1Z4A A;  3IS7 A;  1UMN A;  4Z3B A;  2FJC A;  4DE6 A;  1S3Q A;  4TOF A;  2VXX A;  1DAT A;  4RC6 B;  1GWG A;  3F35 A;  2Y3Q A;  3AF9 X;  5HQO A;  1VJX A;  2BW1 A;  2CF7 A;  3EZU A;  3PVY A;  4R42 A;  5D8R A;  3R2O A;  5GU1 X;  1Z6O M;  1RCC A;  2YW6 A;  5FFD A;  3F34 A;  4RC5 A;  4U3G A;  2IU2 A;  2CHP A;  3GHQ A;  3HIU A;  2V2M A;  3E1N A;  4MUD A;  5FEJ A;  5LG2 A;  3BVI A;  1L8H A;  3EGM A;  4M35 A;  3E1P A;  2V2O A;  1XZ3 A;  3KA4 A;  2XJM A;  4M34 A;  3AF8 X;  3OJ5 A;  2C2J A;  4CY9 A;  4CVR A;  2D5K A;  4ZKW A;  3KWO A;  3PWQ A;  4LPJ A;  5J93 A;  5JKM G;  3RGD A;  1TKO A;  5E1U A;  2WLA A;  4CMY A;  2BJY A;  1LKO A;  5FFA A;  3ERZ A;  3UOI A;  3Q4R A;  3R2S A;  4TO9 A;  3QB9 A;  4KVR A;  4ML5 A;  1JRE A;  1S30 A;  3PWF A;  3Q4N A;  4ZKH A;  3RD0 A;  2Z6M A;  3MPS A;  4DYZ A;  1ZUJ A;  3E2C A;  4LQJ A;  1YUZ A;  2JD8 0;  3SHX A;  3QD8 A;  4M32 A;  2IY4 A;  3PVT B;  3F32 A;  5LG8 A;  1IER A;  3F39 A;  4LYX A;  5D8O A;  5LS9 A;  2X17 0;  4PGK A;  1LB3 A;  5JKM A;  1HRS A;  4DZ0 A;  3PW8 C;  3EZ0 A;  4MKU A;  4CYB A;  3F33 A;  4LPM A;  2YJK A;  3KA9 A;  2HTN A;  1TK6 A;  3A9Q A;  1IES A;  2G4H A;  3PW1 B;  4LPN A;  3KA3 A;  1SOF A;  4YKH A;  1KRQ A;  1J30 A;  4OYN A;  5D8X A;  4AM4 A;  3AK8 A;  3AJP A; 
#chains in the Genus database with same CATH topology
 3GE4 A;  3E1J A;  4E40 A;  3OGH A;  4Y08 A;  4X0J A;  3T9J A;  5IX6 A;  3BT5 A;  3RBC A;  1JI5 A;  4EVB A;  1NFV A;  3O7R A;  1RCG A;  4LQH A;  2JD6 0;  3E1L A;  3HL1 A;  4TOH A;  2ITB A;  5GN8 B;  3UFB A;  3F38 A;  3M6J A;  4MN9 A;  2XJO A;  3AJO A;  5GU3 X;  2CEI A;  4W4L B;  1BCF A;  2CN6 A;  3SID A;  5JDO B;  1JIG A;  3E6S A;  3PVR A;  5E2D A;  4ISM A;  2WLU A;  4KVS A;  2HR5 A;  4ZL5 A;  3A68 A;  3O7S A;  2VZB A;  2WTL A;  4MJY A;  5K52 A;  4XGS A;  2C41 A;  4DYU A;  3V3K B;  4II4 A;  1TJO A;  3PZA A;  4W4K B;  2C6R A;  2QQY A;  3C1Z A;  2GYQ A;  4CVP A;  1TKP A;  3E1O A;  2XGW A;  3VV9 A;  3R2K A;  1L8I A;  2N02 A;  3AF7 X;  4RC7 A;  5J9V A;  4CVS A;  4TOD A;  5GU2 X;  1OTK A;  5ERJ A;  3R2M A;  1RCI A;  3PW8 A;  2CIH A;  3E6R A;  4TOE A;  4ISP A;  5D8S A;  3R2L A;  2YJJ A;  4CMY V;  4EVD A;  1ZS3 A;  3RE7 A;  4A25 A;  2RBD A;  1S2Z A;  5C6F A;  3E1Q A;  3VNX A;  2IB0 A;  2CHI A;  1BFR A;  1SQ3 A;  1Z6O A;  4MXP A;  2FG4 A;  3FRR A;  4ZKX A;  2UX1 A;  4RC6 A;  3WVU A;  2ZA6 A;  2V2N A;  2Z5R A;  4PGI A;  3H7G A;  2ZUR X;  2VXI A;  2CWL A;  4RC5 B;  4YVZ A;  3D19 A;  4DAS A;  2YW7 A;  2Z90 A;  5LBH A;  1XZ1 A;  4KVQ A;  4LYU A;  1O9R A;  4WJG 4;  1F30 A;  3AJQ A;  4XKT A;  3BVL A;  4ITT A;  1MFR A;  4QUW A;  5J8W A;  2W0O A;  3RAV A;  3UOF A;  4TOA A;  5HJH A;  3ES3 A;  1N1Q A;  5K53 A;  3NP0 X;  1NF4 A;  4LQV A;  4Z5S A;  5GOU A;  2XJN A;  3WNW A;  3Q4O A;  2ZA8 A;  5JKL G;  2OKC A;  5HJF A;  1DPS A;  3WVV A;  4PG0 A;  1JTS A;  4DYY A;  4M33 A;  1YV1 A;  4PG1 A;  4DI0 A;  3WVW A;  1VEL A;  2F7N A;  1AEW A;  3KA8 A;  4ITW A;  2ZG8 X;  4EVE A;  5ERK A;  4TW3 A;  2V2S A;  3SH6 A;  5GU0 X;  3TA8 A;  1QGH A;  2CLB A;  3SE1 A;  3BKN A;  5JAC A;  5FFE A;  3QHB A;  3F37 A;  2Z5Q A;  2V8T A;  4ETR A;  1RCD A;  2V2I A;  3PVT A;  1VEI A;  3QZ3 A;  3KX9 A;  1JI4 A;  2C2F A;  3NP2 X;  3Q4Q A;  4AM5 A;  5JKL A;  1R03 A;  1UVH A;  3DBY A;  2BK6 A;  3AK9 A;  1RCE A;  4IXK A;  2BKC A;  5AXS A;  2XKQ A;  2JD7 0;  2ZG9 X;  1VLG A;  3QHC A;  3QVD A;  2V2J A;  3FSE A;  2V2R A;  2V2P A;  4ZTT A;  3PW1 A;  2FKZ A;  1JKV A;  3R2H A;  1VEQ A;  3E1M A;  3C21 A;  3L0M A;  2Y44 A;  3W54 A;  4TOG A;  2FZF A;  4EVC A;  5D8P A;  3GVY A;  1FHA A;  1NF6 A;  2WWX B;  3ISF A;  3NOZ X;  2V2L A;  1F33 A;  4XKS A;  1EUM A;  4CYA A;  5CMR A;  1H96 A;  2OC5 A;  4YXM A;  1NNQ A;  2G38 B;  2FL0 A;  2GYD A;  2CLU A;  3BVF A;  3KXU A;  1B71 A;  2AR0 A;  2FHA A;  5D8Y A;  5GN8 A;  3PVY B;  2QF9 A;  4IWK A;  4E6K A;  3JZA B;  2V15 A;  3FI6 A;  3PWQ C;  1JYB A;  3BVK A;  1JKU A;  3BVE A;  4ZLW A;  2C2U A;  1BG7 A;  1LKM A;  3FVB A;  1O9I A;  2GS4 A;  4P18 A;  3PVR B;  4KXR B;  3ISE A;  2FFX J;  3IS8 A;  3UNO A;  5JDO A;  5CMQ A;  3IQ1 A;  5FFB A;  5J8S A;  3U90 A;  4II4 B;  4TOB A;  2Z5P A;  2ZG7 X;  2ZA7 A;  3F36 A;  2FG8 A;  5D8Q A;  3LKD A;  2CN7 A;  4AM2 A;  1MOJ A;  4ZJK A;  3N6O A;  4XKU A;  3KHK A;  4DYX A;  1JGC A;  1LKP A;  4ERU A;  2PYB A;  2V8U A;  4RC7 B;  5I4J A;  2OH3 A;  4TOC A;  4CVT A;  1RYT A;  1QYB A;  1YUX A;  4RC8 A;  4ZL6 A;  3KA6 A;  4IWJ A;  5FFC A;  4MY7 A;  4LQN A;  1DVB A;  3R2R A;  2MGY A;  3GGY A;  4ZMC A;  5CZU A;  4REU A;  1Z4A A;  3IS7 A;  1UMN A;  4Z3B A;  2FJC A;  4DE6 A;  1S3Q A;  4TOF A;  2VXX A;  1DAT A;  4RC6 B;  1GWG A;  3F35 A;  2Y3Q A;  3AF9 X;  5HQO A;  1VJX A;  2BW1 A;  2CF7 A;  3EZU A;  3PVY A;  4R42 A;  5D8R A;  3R2O A;  3C1Y A;  5GU1 X;  1Z6O M;  1RCC A;  2YW6 A;  5FFD A;  3F34 A;  4RC5 A;  4U3G A;  2IU2 A;  2CHP A;  3GHQ A;  3HIU A;  2V2M A;  3E1N A;  4MUD A;  5FEJ A;  5LG2 A;  3KDQ A;  3BVI A;  1L8H A;  3EGM A;  4M35 A;  3E1P A;  2V2O A;  1XZ3 A;  3KA4 A;  2XJM A;  4M34 A;  3AF8 X;  3OJ5 A;  2C2J A;  4CY9 A;  4CVR A;  2D5K A;  4ZKW A;  3KWO A;  3PWQ A;  4LPJ A;  5J93 A;  5JKM G;  3RGD A;  1TKO A;  5E1U A;  2WLA A;  4CMY A;  2BJY A;  1LKO A;  4YXJ A;  5FFA A;  3ERZ A;  3UOI A;  3Q4R A;  3GGZ A;  3R2S A;  4TO9 A;  3QB9 A;  4KVR A;  4ML5 A;  1JRE A;  1S30 A;  3PWF A;  3Q4N A;  3JZ9 A;  4ZKH A;  3RD0 A;  2Z6M A;  3MPS A;  4DYZ A;  1ZUJ A;  3E2C A;  4LQJ A;  1YUZ A;  2JD8 0;  3SHX A;  3QD8 A;  4M32 A;  2IY4 A;  5HU6 D;  3PVT B;  3F32 A;  5LG8 A;  1IER A;  3F39 A;  3FRS A;  4LYX A;  5D8O A;  5LS9 A;  2X17 0;  4PGK A;  1LB3 A;  5JKM A;  1HRS A;  4DZ0 A;  3PW8 C;  3C23 A;  3EZ0 A;  4MKU A;  4CYB A;  3F33 A;  4LPM A;  2YJK A;  3KA9 A;  2HTN A;  1TK6 A;  3A9Q A;  3VVA A;  1IES A;  2G4H A;  3PW1 B;  4LPN A;  3KA3 A;  1SOF A;  4YKH A;  1KRQ A;  1J30 A;  4OYN A;  5D8X A;  4AM4 A;  3AK8 A;  3AJP A; 
#chains in the Genus database with same CATH homology
 3GE4 A;  3E1J A;  4E40 A;  3OGH A;  4Y08 A;  4X0J A;  3T9J A;  5IX6 A;  3BT5 A;  3RBC A;  1JI5 A;  4EVB A;  1NFV A;  3O7R A;  1RCG A;  4LQH A;  2JD6 0;  3E1L A;  3HL1 A;  4TOH A;  2ITB A;  5GN8 B;  3UFB A;  3F38 A;  3M6J A;  4MN9 A;  2XJO A;  3AJO A;  5GU3 X;  2CEI A;  4W4L B;  1BCF A;  2CN6 A;  3SID A;  5JDO B;  1JIG A;  3E6S A;  3PVR A;  5E2D A;  4ISM A;  2WLU A;  4KVS A;  2HR5 A;  4ZL5 A;  3A68 A;  3O7S A;  2VZB A;  2WTL A;  4MJY A;  5K52 A;  4XGS A;  2C41 A;  4DYU A;  3V3K B;  4II4 A;  1TJO A;  3PZA A;  4W4K B;  2C6R A;  2QQY A;  3C1Z A;  2GYQ A;  4CVP A;  1TKP A;  3E1O A;  2XGW A;  3VV9 A;  3R2K A;  1L8I A;  2N02 A;  3AF7 X;  4RC7 A;  5J9V A;  4CVS A;  4TOD A;  5GU2 X;  1OTK A;  5ERJ A;  3R2M A;  1RCI A;  3PW8 A;  2CIH A;  3E6R A;  4TOE A;  4ISP A;  5D8S A;  3R2L A;  2YJJ A;  4CMY V;  4EVD A;  1ZS3 A;  3RE7 A;  4A25 A;  2RBD A;  1S2Z A;  5C6F A;  3E1Q A;  3VNX A;  2IB0 A;  2CHI A;  1BFR A;  1SQ3 A;  1Z6O A;  4MXP A;  2FG4 A;  3FRR A;  4ZKX A;  2UX1 A;  4RC6 A;  3WVU A;  2ZA6 A;  2V2N A;  2Z5R A;  4PGI A;  3H7G A;  2ZUR X;  2VXI A;  2CWL A;  4RC5 B;  4YVZ A;  3D19 A;  4DAS A;  2YW7 A;  2Z90 A;  5LBH A;  1XZ1 A;  4KVQ A;  4LYU A;  1O9R A;  4WJG 4;  1F30 A;  3AJQ A;  4XKT A;  3BVL A;  4ITT A;  1MFR A;  4QUW A;  5J8W A;  2W0O A;  3RAV A;  3UOF A;  4TOA A;  5HJH A;  3ES3 A;  1N1Q A;  5K53 A;  3NP0 X;  1NF4 A;  4LQV A;  4Z5S A;  5GOU A;  2XJN A;  3WNW A;  3Q4O A;  2ZA8 A;  5JKL G;  2OKC A;  5HJF A;  1DPS A;  3WVV A;  4PG0 A;  1JTS A;  4DYY A;  4M33 A;  1YV1 A;  4PG1 A;  4DI0 A;  3WVW A;  1VEL A;  2F7N A;  1AEW A;  3KA8 A;  4ITW A;  2ZG8 X;  4EVE A;  5ERK A;  4TW3 A;  2V2S A;  3SH6 A;  5GU0 X;  3TA8 A;  1QGH A;  2CLB A;  3SE1 A;  3BKN A;  5JAC A;  5FFE A;  3QHB A;  3F37 A;  2Z5Q A;  2V8T A;  4ETR A;  1RCD A;  2V2I A;  3PVT A;  1VEI A;  3QZ3 A;  3KX9 A;  1JI4 A;  2C2F A;  3NP2 X;  3Q4Q A;  4AM5 A;  5JKL A;  1R03 A;  1UVH A;  3DBY A;  2BK6 A;  3AK9 A;  1RCE A;  4IXK A;  2BKC A;  5AXS A;  2XKQ A;  2JD7 0;  2ZG9 X;  1VLG A;  3QHC A;  3QVD A;  2V2J A;  3FSE A;  2V2R A;  2V2P A;  4ZTT A;  3PW1 A;  2FKZ A;  1JKV A;  3R2H A;  1VEQ A;  3E1M A;  3C21 A;  3L0M A;  2Y44 A;  3W54 A;  4TOG A;  2FZF A;  4EVC A;  5D8P A;  3GVY A;  1FHA A;  1NF6 A;  2WWX B;  3ISF A;  3NOZ X;  2V2L A;  1F33 A;  4XKS A;  1EUM A;  4CYA A;  5CMR A;  1H96 A;  2OC5 A;  4YXM A;  1NNQ A;  2G38 B;  2FL0 A;  2GYD A;  2CLU A;  3BVF A;  3KXU A;  1B71 A;  2AR0 A;  2FHA A;  5D8Y A;  5GN8 A;  3PVY B;  2QF9 A;  4IWK A;  4E6K A;  3JZA B;  2V15 A;  3FI6 A;  3PWQ C;  1JYB A;  3BVK A;  1JKU A;  3BVE A;  4ZLW A;  2C2U A;  1BG7 A;  1LKM A;  3FVB A;  1O9I A;  2GS4 A;  4P18 A;  3PVR B;  4KXR B;  3ISE A;  2FFX J;  3IS8 A;  3UNO A;  5JDO A;  5CMQ A;  3IQ1 A;  5FFB A;  5J8S A;  3U90 A;  4II4 B;  4TOB A;  2Z5P A;  2ZG7 X;  2ZA7 A;  3F36 A;  2FG8 A;  5D8Q A;  3LKD A;  2CN7 A;  4AM2 A;  1MOJ A;  4ZJK A;  3N6O A;  4XKU A;  3KHK A;  4DYX A;  1JGC A;  1LKP A;  4ERU A;  2PYB A;  2V8U A;  4RC7 B;  5I4J A;  2OH3 A;  4TOC A;  4CVT A;  1RYT A;  1QYB A;  1YUX A;  4RC8 A;  4ZL6 A;  3KA6 A;  4IWJ A;  5FFC A;  4MY7 A;  4LQN A;  1DVB A;  3R2R A;  2MGY A;  3GGY A;  4ZMC A;  5CZU A;  4REU A;  1Z4A A;  3IS7 A;  1UMN A;  4Z3B A;  2FJC A;  4DE6 A;  1S3Q A;  4TOF A;  2VXX A;  1DAT A;  4RC6 B;  1GWG A;  3F35 A;  2Y3Q A;  3AF9 X;  5HQO A;  1VJX A;  2BW1 A;  2CF7 A;  3EZU A;  3PVY A;  4R42 A;  5D8R A;  3R2O A;  3C1Y A;  5GU1 X;  1Z6O M;  1RCC A;  2YW6 A;  5FFD A;  3F34 A;  4RC5 A;  4U3G A;  2IU2 A;  2CHP A;  3GHQ A;  3HIU A;  2V2M A;  3E1N A;  4MUD A;  5FEJ A;  5LG2 A;  3KDQ A;  3BVI A;  1L8H A;  3EGM A;  4M35 A;  3E1P A;  2V2O A;  1XZ3 A;  3KA4 A;  2XJM A;  4M34 A;  3AF8 X;  3OJ5 A;  2C2J A;  4CY9 A;  4CVR A;  2D5K A;  4ZKW A;  3KWO A;  3PWQ A;  4LPJ A;  5J93 A;  5JKM G;  3RGD A;  1TKO A;  5E1U A;  2WLA A;  4CMY A;  2BJY A;  1LKO A;  4YXJ A;  5FFA A;  3ERZ A;  3UOI A;  3Q4R A;  3GGZ A;  3R2S A;  4TO9 A;  3QB9 A;  4KVR A;  4ML5 A;  1JRE A;  1S30 A;  3PWF A;  3Q4N A;  3JZ9 A;  4ZKH A;  3RD0 A;  2Z6M A;  3MPS A;  4DYZ A;  1ZUJ A;  3E2C A;  4LQJ A;  1YUZ A;  2JD8 0;  3SHX A;  3QD8 A;  4M32 A;  2IY4 A;  5HU6 D;  3PVT B;  3F32 A;  5LG8 A;  1IER A;  3F39 A;  3FRS A;  4LYX A;  5D8O A;  5LS9 A;  2X17 0;  4PGK A;  1LB3 A;  5JKM A;  1HRS A;  4DZ0 A;  3PW8 C;  3C23 A;  3EZ0 A;  4MKU A;  4CYB A;  3F33 A;  4LPM A;  2YJK A;  3KA9 A;  2HTN A;  1TK6 A;  3A9Q A;  3VVA A;  1IES A;  2G4H A;  3PW1 B;  4LPN A;  3KA3 A;  1SOF A;  4YKH A;  1KRQ A;  1J30 A;  4OYN A;  5D8X A;  4AM4 A;  3AK8 A;  3AJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...