3AKKA

Crystal structure of a helicobacter pylori proinflammatory kinase ctka
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
296
structure length
296
Chain Sequence
PTIDFTFCEINPKKGFGGANGNKISLFYNNELYMVKFPPKPSTHKEMSYTNGCFSEYVACHIVNSLGLKVQETLLGTYKNKIVVACKDFTTHQYELVDFLSLKNTMIELEKSGKDTNLNDVLYAIDNQHFIEPKVLKCFFWDMFVADTLLGNFDRHNGNWGFLRASNSKEYQIAPIFDCGSCLYPQADDVVCQKVLSNIDELNARIYNFPQSILKDDNDKKINYYDFLTQTNNKDCLDALLRIYPRIDMNKIHSIIDNTPFMSEIHKEFLHTMLDERKSKIIDVAHTRAIELSLQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Helicobacter pylori proinflammatory protein up-regulates NF-kappaB as a cell-translocating Ser/Thr kinase
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transferase
molecule keywords CtkA
total genus 102
structure length 296
sequence length 296
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07804 HipA_C HipA-like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1070.20 Mainly Alpha Orthogonal Bundle Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5 Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5 3akkA02
3.30.200.120 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3akkA01
3AKLA 3AKKA 3AKJA
chains in the Genus database with same CATH superfamily
3Q6WA 5GJDA 4MD9E 3GXLA 1Y6AA 4BYJA 4FKUA 4DLIA 4UWLA 4S30A 2VTTA 3AT2A 1FOTA 4AT5A 3FLYA 2JITA 2R5TA 3D5XA 3VF9A 2H6DA 4X3FB 5AP6A 3ANQA 4TL0A 2PSQA 3DPDA 4C02A 2ITVA 4RIYB 4FKSA 2VD5A 1ZZLA 5L6PA 3WF8A 3W2RA 3FLNC 4QYGA 4PS8A 3U4WA 2Z7SA 1ZMUA 3VS1A 4EORA 4IB1A 4F4PA 4E6DA 3FDNA 3UODA 2JDOA 4YUQA 3TYKA 1Q8YA 2PVKA 4R5YA 3SDJA 4YO6A 4YTIA 1Q4LA 4CEGA 5FGKA 3V6SA 4J71A 4USFA 3EKNA 2R3RA 4NU1A 2I7QA 4RVMA 3KGAA 1TQIA 3IW4A 2XYNA 3MPTA 3QWJA 3GOKA 3CSVA 5H9BA 3PA4A 5ANDA 4FOBA 3KXZA 4DTBA 1Y91A 5I9VA 1O6KA 4G5PA 5DRBA 3BL7A 3P79A 3L54A 1XH8A 2I1MA 5GINE 3R00A 1ZY5A 4M69B 5E8SA 4FTTA 5CF8A 5M08A 3DGKA 2Y6MA 4RWKA 4XG7A 4CFMA 4G11A 3R7QA 4EHVA 2XUUA 3SXFA 5L2WA 4I5CA 5IEYA 4ZXTA 3FUPA 4PS7A 4MH7A 4O0YA 3IONA 4ZIMA 5JKGA 2P4IA 4GIHA 4GT3A 4LL0A 5KMIA 3E7OA 3V04A 4GL9A 2DUVA 4MK0A 4W4WA 3NMUF 1W8CA 5HX6A 4HPTE 2A27A 5ICPA 4YSMA 3DDPA 4RIWB 3Q4CA 4ZP5A 3CJGA 2O2UA 3L9LA 4YC8A 4U3YA 4AZFA 4I6BA 4WO5A 4AG8A 4U43A 5D1JA 3ZIMA 3WILA 4CMOA 3KC3A 3OS3A 2WXQA 2PTKA 3PRFA 4NM0A 2W9ZB 3QTIA 5ANJA 2UW0A 2VRXA 3S2PA 3F3ZA 3PWYA 4ANXA 4EQCA 3DFCB 1URWA 1PJKA 3DBSA 3ULIA 5CAVA 4B0GA 1GZKA 2W4KA 4XHKB 5EDSA 2IZUA 3NS9A 4X6RA 3R8VA 3RAWA 4TYJA 4NJDA 3TDWA 3MGYA 5AUUA 4QTDA 3VULA 3U51A 3C9WA 3W8LA 1UU7A 3ZXTA 3CD8A 4FV7A 5DR6A 3UQGA 5JQ8A 3DA6A 5KMOA 4E4XA 5L2SA 4ALUA 1K2PA 2XARA 4Y72A 4HVDA 2C6TA 3MI9A 4YPSA 5BVKA 1JKSA 1W98A 1E8WA 3ZLWA 5AWMA 4U8ZA 4BCKA 2QO2A 2JAVA 3C13A 3Q4ZA 3H3CA 4F64A 5GHVA 5A3XA 2WQMA 4R1YA 3NRMA 2AUHA 5EH0A 5T6KA 4D0WA 4FYNA 4JG7A 2XYUA 4QMTA 5B0XA 3CCNA 3HECA 4FT7A 4MAOA 3BU5A 4FSYA 2OJ9A 4BCNA 3RHKA 1QMZA 2C3JA 3ZH8A 4ARKA 3CQEA 3TEIA 3SLSA 4HW7A 3KEXA 2UZWE 3OD6X 3QC4A 4NK9A 4ZSLA 4RVKA 3UJGA 4D5HA 5E92A 3WBLA 3DBQA 1U4DA 3JS2A 4RIXA 4RIYA 4DC2A 5LOHA 5A54A 1KV1A 4HVGA 1E1VA 2C30A 4QP1A 3A7GA 2QOCA 3FQSA 2YDJA 3W0MA 3K2LA 5J9ZA 4IX6A 1H1QA 3A8WA 4QTCA 3QA0A 4KIOA 4C36A 4XX9A 1XR1A 5HTCA 3KY2A 4BY9E 2QI8A 2H8HA 3LXKA 4L6QA 3BGZA 4FICA 3GC9A 4GVAA 2XK9A 1FINA 5CENA 3R7OA 2P33A 3TV6A 3TNWA 2NO3A 4FSTA 4YP8A 1VLRA 2H34A 4ZMEA 3QHWA 4CNHA 3D0EA 5TO8A 1CTPE 2VTLA 2YWVA 3LJ0A 4RZVA 2BCJA 2OJGA 3UZRA 3F9NA 1TKIA 2R3KA 4R78A 3GCVA 4DFBA 1OI9A 4IZ5A 4JR3A 2JD5A 4LL5A 5LMKA 4ANWA 3S95A 1LEZA 2QU6A 3KIOC 3NNXA 1PXJA 3IO7A 4ZTLA 4F09A 2BUJA 4BBEA 2YJSA 3PA5A 2FA2A 4G9RA 2CJMA 4Y46A 4ZTQA 1H8FA 2QO9A 2FYSA 3BHUA 3QRKA 4I1ZA 5CNOA 4B7TA 4HCTA 2C6DA 4UWBA 4BJJA 2C4GA 4BHZA 4FT0A 5HVJA 3ZM9A 4EZLA 3IDCA 4OVUA 5T3QA 4JT3A 4HOKA 2VAGA 2C5XA 3RPOA 3TV4A 4FIFA 4FNWA 1WFCA 3VW6A 3R73A 4JR7A 3HYHA 2GCDA 4DK5A 3DBFA 4FKTA 5IDNA 2ZMCA 4M68A 2ZJWA 3HUBA 2QO7A 4UEUA 4YHTA 4GFGA 4JG8A 1G8JA 5L6WL 3FZRA 4I94A 3TZ9A 5I5ZA 5JGDA 1H27A 4HGLA 3VBYA 3FLSA 4IVDA 1GOLA 2ZV2A 3BPRA 1OPJA 5FTOA 4EH5A 4ANVA 3E8EA 3IW6A 5AP0A 3ZO4A 2OJJA 4C62A 2X6FA 3NNWA 3SV0A 4H05A 2V55A 3W16A 2GMXA 5L8KA 3APDA 5TKDA 2BDFA 1OKWA 1XH5A 2IVVA 5KZ0A 4CFNA 5E90A 4FEXA 5EOLA 3R7RA 1U54A 2R3GA 4TV3A 1BYGA 3EHAA 5CS6A 4FVQA 4GU6A 3QTQA 4RA4A 5E9EA 4DFNA 3FLWA 5AUYA 2YFXA 5EI2A 1R0EA 5M55A 1ZYJA 4UWCA 3HA8A 3Q52A 3HVCA 2YITA 5CLPA 4CV9A 2GNHA 4RFMA 3QALE 1H24A 3CKXA 5E8XA 3WF6A 3TNHA 1YXSA 3GB2A 2C3LA 3FZSA 3R7EA 2AEGA 4WNMA 3DY7A 5G55A 4U81A 1MRVA 2RG5A 4C3FA 4E1ZA 2V0DA 4FX3A 5HLPA 4EK8A 4F7SA 4RPVA 4I20A 5C27A 4AN9A 2UVYA 4DEGA 3ZLXA 3ZFMA 3O8PA 3C5IA 2PE0A 4PMMA 4GJ2A 3MFRA 3EQGA 1Z57A 2UUEA 4IHPA 1XBAA 1JKLA 2VTSA 4EH7A 2GS6A 2W1DA 4RZWA 3CPCA 4QMNA 4YU2A 2EUFB 1YOJA 5IA1A 2JFLA 4U45A 4DT9A 4KNBA 4P2KA 4RLLA 4C33A 4XG9A 1BLXA 4A06A 4FTKA 3R04A 4I4FA 5DR2A 4AX8A 4DH8A 4AZEA 5AAEA 5FTGA 2C6LA 4FT9A 2XK4A 5HVYA 4E73A 3FSKA 2ERKA 4A07A 3W2OA 4WRSA 3RAIA 2X2LA 4RJ8A 3WE8A 2C69A 5KCVA 3L8XA 1IAJA 4J99A 3EN7A 3BGPA 2ZB1A 3PLAE 4QMWA 2R3IA 4LV7A 5HESA 5CTPA 5H8GA 2J90A 4KAOA 5KMLA 1OB3A 3UVRA 3O50A 4XMOA 5E8TA 3FL4A 5F4NA 4O6EA 1XH9A 4FR4A 4FTQA 4GMYA 4QMUA 3AKLA 3KN5A 5A9UA 1HE8A 2X8EA 3N4VA 4O22A 4PF4A 4NZWB 3ZBXA 4AXFA 3UPZA 4YMJA 4WD5A 2FUMA 3DB8A 3O0GA 1JQHA 3WZUA 2X6IA 5M44A 4U44A 5D41A 3RCDA 4EJ7A 4IAZA 1ZZ2A 1E7UA 2IW6A 4MWIA 1QPCA 2WMTA 3NAXA 3KRRA 3VBXA 5CT0A 3G90X 2O63A 2QC6A 2XKDA 3SD0A 3R8ZA 3UZTA 2W06A 3JY9A 4BRXA 2PZYA 4EC8A 2WQBA 3HV5A 4EK5A 3OY1A 1U59A 3LW0A 1ZOGA 4Y85A 4QMMA 4OW8A 3U9NA 4DCEA 5LCKA 4NTSA 2C0IA 2FSLX 5ENNA 3FL5A 3OCSA 1GZ8A 3TIYA 5DG5A 2UVXA 2QCSA 4MYGA 1R0PA 3PVGA 3BYOA 3MFTA 3HEGA 3FZPA 1WBVA 3NGAA 2OXDA 4MXAA 4YJOA 4ZK5A 3PG1A 5HU9A 4ZZOA 4LG4A 1YDRE 5IQAA 5IUIA 4NM3A 5E8YA 3ZONA 4FSUA 5BQ0A 4JBOA 5D11A 4YJVA 3KREA 5KX8A 2PY3A 3M2WA 4IZYA 3RALA 4D1ZA 4IBMA 2VX3A 2WGJA 4A55A 2HWPA 4GVJA 5HEZA 3BEGA 3HIZA 3C4ZA 5DT0A 2YZAA 3BGQA 3TZ8A 3GFWA 3LQ8A 4CQEA 5ANLA 4FG9A 3C4WA 1OL5A 4XLVA 2BDJA 3OUKA 3GQIA 3MJ2A 5ACKA 3PTGA 4K33A 4D9UA 3I1AA 3ORMA 3EB0A 4O0UA 5IUGA 2WMXA 2HENA 3RKBA 3D83A 2ZVAA 3TV7A 5D10A 2NRYA 4O7LA 5FEEA 3BEAA 4ORKA 5IPJA 1FGIA 3OTUA 3TTJA 3MYGA 5DVRA 3APFA 3H30A 4FK3A 3D2KA 2CGXA 3LZBA 4D1XA 4N0SA 3AC4A 5B7VA 5JT2A 2J51A 3R7UA 4GFMA 1V0PA 1A48A 4RX9A 4I5PA 5BYLA 3HX4A 3SQQA 3BYVA 1Q99A 4OTHA 2GTMA 3QC9A 4FV2A 4LDTA 2B1PA 4FULA 2ITZA 2W99B 5C03A 3A7IA 1OIYA 3RTPA 5EQPA 3QZFA 5C8NA 5ETIA 3N4TA 4BCMA 4Y95A 2F49A 4CMUA 3FQHA 4II5A 4L45A 5J87A 4FZFB 3BU6A 3F66A 4HYIA 3IS5A 5DWRA 5AUXA 2RIOA 4U79A 3FMMA 4FKPA 2ITOA 4EOSA 5B2KA 1M2RA 2XNPA 3LS8A 4GT4A 3PIZA 3W2QA 2WTIA 1PMNA 3V01A 4F63A 3HNGA 4F7NA 3TUDA 2BKZA 3AC3A 5L8JA 2ITPA 5I9UA 3MA6A 5J95A 3LXNA 5KNJA 1YI4A 4O91A 1KWPA 3LFAA 4FE2A 2PVRA 4DYMA 2XJ1A 4EOOA 3MV5A 3QKKA 3L1SA 4BTMA 5AM7A 4BDBA 3APCA 1KOBA 5G2NA 3OW3A 3UVPA 3W55A 3OG7A 3F5XA 5LWMA 2PZPA 2BRBA 3DJ7A 3H10A 4XLIA 4JDJA 2IW8A 5CVHA 2Q0NA 4HLEA 4PTEA 3RK5A 4APPA 3CEKA 3ODZX 3OXZA 4FIJA 3W8QA 4BDGA 1YOLA 4DH1A 4BDEA 2X6DA 1A9UA 3LIJA 4NYEA 3R6XA 1BUHA 1OZ1A 4DH5A 3N51A 3SVVA 2ONLC 5M4IA 3K5VA 4N70A 4L3JA 4CT2A 4DFYA 1W84A 3EFLA 3TL8A 4DEDA 3UIMA 3ZEWA 1KV2A 2X38A 4F9CA 2JLDA 4L67A 4QTAA 4S34A 2BR1A 4CMTA 4ZEGA 3EFJA 4FTUA 5AP5A 3EQBA 3DAKA 4QQJA 1OL7A 2RFEA 3H0ZA 3JVSA 4IZ7A 2JGZA 4RJ5A 3DCVA 5AV2A 4AQCA 4CFVA 1QPEA 2VWXA 4EQMA 5JHAA 1L8TA 5CU0A 5J5SA 3FI2A 1KOAA 4X2FA 3UQFA 1PXKA 2G2HA 1Q8UA 3QUPA 3ORIA 4FC0A 4GUEA 4HYSA 3UYTA 3SXSA 4QQTA 4O96A 4FKVA 4J8NA 2YM6A 3QCYA 4IMYA 1JSVA 4EYJA 2XEZA 5CF5A 3U8WA 4FKLA 2XM9A 3R8LA 4RT7A 3MVHA 2CHXA 3RPVA 3T8MA 2A4LA 2WZJA 4GJ3A 5AUZA 3UC4A 4ZJVA 5CAQA 1ZWSA 4DF3A 4E4LA 4ZSAA 3JUHA 3HAVA 2NP8A 2VN9A 5G1XA 4MTAA 3MFSA 4HVIA 4DFZE 4IB3A 4DA5A 4BJJB 3PFYA 3W2CA 3ET7A 3NNUA 4IM0A 2XIYA 3V8WA 3ZM4A 2WPAA 2I40A 5K9IA 4F6UA 4YJNA 1GY3A 4KWPA 2O64A 1UVRA 3TZMA 3ENMA 5FRIA 2CNVA 5L8LA 4JI9A 4CSVA 4OBOA 2GNLA 4QQ5A 3OBGA 4UBAA 4J7BA 4CRSA 1W82A 4CLIA 1FMOE 2CLQA 3IPHA 3Q53A 4BI0A 3HP2A 3U6JA 2ETRA 3D14A 2OICA 3FBVA 3Q9ZA 4C35A 5IZFA 4FNXA 1STCE 1M14A 2ITTA 1E9HA 2BRMA 3GU4A 4IJ9A 2Y9QA 1NVSA 1LEWA 5J9LA 4F1MA 3UPXA 3CSFA 5E91A 4FV4A 1H1WA 2I6LA 5EDRA 5EG3A 2GNGA 4I5HA 5EHLA 1P4OA 2BKKA 5IQDA 5CSXA 4FIIA 4AQKA 1Q3WA 3AXWA 2ESMA 2YM8A 2PZIA 3A60A 4JBVA 3LHJA 1FPUA 4IWOA 5ANEA 4QTEA 4QP7A 4FV5A 4FKWA 3IBEA 4EHEA 1NVQA 5HCXA 2JFMA 4UZDA 5EQYA 4JIKA 3VAPA 3EIDA 5HLNA 3BQCA 4X21A 2J0JA 2O65A 3V3VA 1WBTA 4L44A 5HE0A 4CT1A 3HRFA 3FI8A 2PMLX 3IDBA 4R7BA 4UWYA 3NR9A 4CV8A 5L3AA 3BHYA 2R7BA 2XF0A 4YSJA 3FE3A 4MEDA 4Z7HA 4E6CA 2OJFE 4QMZA 5A4TA 2Y4PA 2ITWA 4IC7A 5E8ZA 4OYSA 1UV5A 2XKFA 3PYYA 4XOZA 2GTNA 3AD6A 3HAMA 4TWCA 3W0QA 4L00A 4F6WA 1OBDA 3KK9A 4E8AA 1YWVA 2YCRA 4HJOA 4RQKA 4GCJA 2ETKA 3FPMA 2QURA 4H36A 4LOOA 1QPJA 3KRLA 3JYAA 4FODA 5FEDA 3LFDA 3WARA 2J9MA 2W9FB 3ORKA 2QOIA 2I0EA 2OBJA 1Q8ZA 1SVGA 3R9OA 4FV3A 4J53A 3KA0A 2VO6A 3TM0A 3EQCA 1WBOA 3FJQE 4KBCA 4O7YA 2G2FA 3WYYA 1GIHA 3UIXA 3NYXA 2ACXA 3KXMA 4LOQA 1NT2A 3GC8A 3D5UA 3MPAA 2GNJA 4FL2A 4MXZA 2KTYA 3DTCA 3QU0A 4G31A 2VUWA 2ITQA 4EK6A 4FIHA 3QAQA 2LAVA 3KRWA 4D4SA 3AOXA 1YW2A 3P4KA 4CZUA 5CWZA 4ASZA 4D1SA 5K5NA 2QOKA 2BRGA 3QD3A 4O2PA 1FMKA 4B8LA 3F6XA 3OWLA 3QTSA 3HLLA 4N4SA 4BB4A 4DE4A 1IASA 5BYZA 3DU8A 2EXMA 3BV3A 3KB7A 2QOQA 2WO6A 4QP9A 3DK7A 4KZ0A 4L46A 5IEXA 4C38A 4WOVA 5TF9A 3Q3BA 3IECA 1O9UA 4FNZA 3OW4A 3POZA 4TRLA 1F3MC 4X3FA 3A4PA 5H2UA 4RJ3A 3ROYA 3FMDA 3PXZA 4Q9ZA 3TUBA 2QU5A 3P5KA 2CNQA 4FTRA 4UWKA 4IH8A 2RL5A 3CR0A 3TUCA 2XKCA 4FKJA 3A61A 2KULA 2ZM1A 5AP1A 4AZWA 3CXWA 2QR7A 3O7LD 1CJAA 1U5QA 1P2AA 3WOWA 3OTVA 1O6YA 3CTJA 2WXLA 2VTHA 4M7IA 1MRUA 3MA3A 5DYJA 2HZNA 4C34A 4JMQA 4F1TA 3E7VA 1B6CB 3VJNA 2HIWA 1IA8A 5A6NA 5IDPA 4WWNA 1YXUA 4PTCA 3DT1A 2BFXA 1YDSE 4GIIA 3Q5IA 4BGGA 3ORZA 3P08A 5LVPA 1SMHA 1U54B 2UZVA 4LRMA 2HZIA 4KSPA 2XIZA 1M7NA 2CKPA 4S32A 4RWJA 3W18A 2YDIA 3NEWA 2J2IB 3HMOA 4OT6A 3D7ZA 3QUDA 4TYHB 2WIPA 5BUIA 4XP3A 1T45A 3V5QA 3ZDUA 3DBCA 2J5EA 5DLSA 4BGQA 5ETFA 5IQIA 3D5WA 2XS0A 1YI3A 4J98A 1OGUA 3LOKA 3NCGA 3F5GA 4YNEA 3MIAA 3OAWA 1J1CA 4AW0A 4XP2A 1OGYA 4YJPA 2JDRA 4BDKA 2JDSA 3TG1A 3VJOA 5BVDA 3EFKA 2BRHA 3KN6A 2ZM3A 4FUXA 4C4EA 2IZSA 2CN8A 3PS6A 3PREA 3EKKA 4QMPA 3NSZA 4C4JA 5LMBA 2WXJA 2OIDA 3P5JC 4EZ7A 2EVAA 2BAJA 3GU8A 5KMJA 1R1WA 2GNIA 3PSCA 4F1OA 2QQ7A 4TUUA 1ZYDA 1OKVA 1OIRA 1ZMWA 2UW7A 3MWUA 3VIDA 3WZJA 4OTIA 3DOGA 4KABA 5EFQA 3OCTA 2FSOX 4RJ7A 3DNEA 4M13A 4KKEA 3D2IA 3OZ6A 4FKQA 3GU6A 4IQ6A 3E8NA 4MD8E 2VWUA 2Q83A 4MHAA 4TY1A 4XOYA 3UOLA 4A9TA 4BHNA 4BTJA 4ZZMA 2JBOA 2B54A 3GU5A 4HYUA 2RKUA 4JRVA 3HV3A 2P2IA 3GCUA 4EWQA 3LCTA 4YLLA 3W1FA 3DJ6A 4KB8A 4XBUA 2PULA 2ZMDA 3QRTA 4AU8A 5CEMA 1PRYA 5AV3A 4G3FA 3WZEA 3FYJX 3MIYA 5JRQA 2YHVA 4O2ZA 3O17A 1BX6A 2XM8A 2FVDA 3R0TA 4UV0A 1KUTA 2GDOA 3FKNA 3ML1A 3IW8A 2J0IA 1JAMA 3H4JA 1E7VA 1WBPA 4ZTNA 3SHEA 4A9UA 4U0IA 3TN8A 2BHHA 2X7FA 3DLSA 2BTSA 4IFGA 2RFNA 3NAYA 5DA3A 5CZHA 4DEAA 2OW3A 4Y8DA 5FG8A 3VS3A 2E2BA 4QP3A 3BE9A 4L23A 5F20A 5HE2A 4J8MA 4M0YA 2W1FA 3FPQA 3R2BA 4FEWA 4OTQA 4GK2A 3KRXA 1OKYA 1X8BA 3FY0A 4OTWA 5BVWA 4I0SA 4TYHA 4BIEA 2PK9A 4BBMA 4EZJA 4G3DA 1H07A 5CEOA 3KCKA 5H8BA 3EQPA 3GUBA 5HG7A 3C4FA 3ETAA 2ITUA 2CKOA 3NUXA 4JAJA 5CAPA 2J0MB 2C6EA 3VS4A 5CXHA 2F7EE 1XMLA 3KU2A 3R71A 1E90A 4FTNA 2C47A 4FEQA 1UU9A 3BX5A 4RX8A 5T8IA 1GIIA 1MRYA 2YIXA 4BCJA 5IG1A 3UG2A 4QYHA 1W83A 4IVBA 4XBRA 5I0BA 5JFSA 1ERKA 3TDVA 3QQKA 3QZIA 1Y57A 1R3CA 3CS9A 4PS3A 4ZSEA 3TTIA 3NZ0A 4F99A 3P78A 3MFUA 4J95A 4X6QC 4LI5A 1ZOEA 5K4IA 3MTLA 4UWHA 2G01A 5CF4A 4U97A 2X0GA 2QKWB 3MVLA 4DGMA 3ML9A 2R64A 4CFUA 5A14A 2PZRA 4AGCA 2WXKA 1UU3A 2DYLA 2WOTA 1J7LA 3KVWA 3PY0A 5C4LA 1NVRA 3DQXA 3OROA 2W5AA 2ITYA 4QRCA 5JZJA 3EN4A 4PMTA 4YLJA 5EM7A 4RFZA 3S00A 4ZY6A 3DK6A 4FTAA 1DI9A 1G8KA 2WTCA 3POOA 4BC6A 3Q9YA 3SRVA 4WT6A 5DHJA 4GKIA 2C6MA 1G8AA 3W33A 4KA3A 5AAGA 3C0HA 4G3GA 3VUIA 3QL8A 5CAUA 4L2YA 1QCFA 3HRCA 3OWJA 5ANGA 3P7BA 3B2WA 3N9XA 3ORLA 2Z8CA 5H8EA 4BDAA 4FLHA 1REJA 3G2FA 3QZHA 2WXVA 4N57A 4U80A 5FM2A 3Q4UA 3VUKA 4BKJA 2C68A 3S3IA 2PVJA 4MXCA 2WTJA 3BLRA 3Q5ZA 4V04A 3TJDA 4RIWA 3FWQA 4ZS4A 2GQGA 2W1HA 2WTWA 1OECA 3QGWA 4XV1A 5A4LA 3V51A 4LMUA 2OGVA 1O6LA 2G15A 5I9XA 4MUQA 5EYCA 1ST4A 4UN0C 4AUAA 4G16A 3FZTA 5GJGA 3DV3A 1YHVA 2BIYA 1BI7A 2BIKB 2PMIA 2XCHA 4RC2A 3LJ3A 2ZOQA 4FV1A 2V22A 3RCJA 3V5JA 3V8TA 1PKGA 4IWDA 1U5RA 4YNOA 4MCVA 2X9EA 5KKRC 3Q2JA 4AW2A 5CALA 1E1XA 3ZO3A 2X6JA 3D7TA 3R02A 3R1NA 3LCSA 1RJBA 4G6OA 2CMWA 4I6HA 4M14A 2GNFA 3QQJA 4RSSA 5EW8A 2J4ZA 2VTIA 2XK7A 3BKBA 4AOTA 2VGOA 2PPQA 3BYSA 4XE0A 2UV2A 2WKMA 3NLBA 3PA3A 4TWOA 3SOCA 4UX9A 4I4EA 5AV0A 4F9WA 1IRKA 1UKHA 4WWPA 3HDMA 3FZOA 5DRDA 2SRCA 4BIDA 3ROCA 4EJNA 3UOJA 1FVRA 4DITA 2IVTA 3VBTA 3MH1A 4RA5A 3BE2A 2HAKA 2IPXA 4GEOA 5CQUA 5F9EA 5C26A 2W0JA 4WAFA 2B4SB 2QR8A 4LFIA 3K3IA 4ANMA 2R3QA 4QYYA 2WOUA 3MJWA 4EBVA 1YRPA 1NY3A 2JAMA 3QTWA 4XJ0A 3ZHPC 1CKIA 4F0GA 1GJOA 1NA7A 2W1CA 2X6EA 4USDA 5DI1A 4C3PA 2AC5A 2UZBA 4EHGA 1MQ4A 3A62A 3AC5A 3G0EA 3GCSA 4GKHA 3UMXA 3BYMA 2VWZA 4RLKA 4WSYA 3QBNA 4QMVA 3VBVA 2VWIA 1IEPA 2OF4A 5KBQA 3DJ5A 4ACCA 2HZ4A 3FSFA 1PF8A 4QOXA 4FA6A 4O7WA 1XH7A 4K9YA 5EHYA 4B4LA 4L52A 1CSNA 3DBDA 4MQ1A 5LMAA 2XK3A 5LWNA 5FQDC 3D15A 4O82A 3T9IA 3PUPA 3AC2A 5LMKC 1EH4A 5HG9A 3RMFA 4JDHA 4TXCA 4JBPA 3U54A 2OI4X 2HY0A 3SRVB 1TVOA 4BF2A 3QARA 2BDWA 5E7RA 2JEDA 5T68A 5L6OA 3GU7A 1F5QA 3KXNA 3EQHA 3VS6A 2IWIA 4K11A 3KF4A 4DTKA 3FC2A 2B9JA 4J52A 1VYWA 3E5AA 3KQ7A 3QCQA 1LR4A 3UBDA 4EH9A 5CASA 2B52A 4EHZA 2XBAA 2W5BA 1H08A 4Z16A 4WNKA 5LJJA 4G6NA 4MD7E 3P7CA 2X39A 2CGUA 4ZSGA 5CEQA 4ENXA 2R3OA 2XRWA 3VUHA 4FG7A 2FSTX 3NNVA 2UZOA 3QTXA 4ZY4A 4CG9A 5DEYA 4EWHA 4FT3A 3H9RA 4HCUA 4PTGA 4W4VA 4KS7A 3B8RA 4O7SA 3UG1A 5E1EA 5AIRA 4U6RA 4X2GA 1WBSA 2OFVA 1GAGA 3PXQA 4O83A 4E7WA 4XRJA 4RWLA 5HD4A 2WTKB 3RGFA 3AQVA 1RDQE 2J5FA 3G9LX 3H0YA 3PLSA 2QLQA 4JLCA 5HU3A 4YJUA 3LCDA 4S31A 3I5ZA 4IM2A 4QNAA 2XNMA 3D9VA 4BVUA 5CEPA 2DQ7X 2VWVA 3KXHA 3RNYA 4NTTA 4FL1A 4A9RA 2HZ0A 4YPDA 2XNOA 5K5XA 5C01A 4R7IA 4ERWA 3WIKA 3EQRA 3PG3A 1Q8TA 2VX1A 3Q60A 5FBNC 5BMSA 4FT5A 4K2RA 5CX9A 3EQIA 1AGWA 4IJPA 3MVJA 3L8VA 2QHMA 4IAFA 4F9BA 3NW5A 4RVTA 5IH4A 1BKXA 4KIQA 3ZSIA 4J6IA 1GZOA 2A0CX 2XEYA 3P1AA 2XJ2A 2BZHB 2BHEA 5AAFA 4MNEA 4C4FA 3ZXZA 2QVSE 3TZ7A 4ANBA 3RWPA 4B9DA 3CIKA 3NIEA 4FTOA 4ALVA 2R2PA 2WMAA 3WZKA 2UZLA 4FZDB 5DNRA 3VBQA 4PMPA 4FUYA 3HKOA 4DBXA 4OLIA 4BBFA 3V5WA 1CDKA 3VN9A 4I3ZA 5J1WA 3IW7A 1YWNA 3PE1A 3ID6C 4EONA 4YO4A 4NUSA 5EI8A 4L3LA 2B55A 2HCKA 4WHZA 4G2FA 2NPQA 4FZAB 4I21A 3WYXA 4EKKA 3EL7A 2YERA 4YGAA 5EYDA 4QMXA 2R7IA 4YZBA 3S4QA 2F4JA 3NPCA 3RAKA 1E8XA 1XH4A 2WMRA 3U9CA 5E1SA 1Y8GA 2ONLA 3PY3A 3VHKA 4QMSA 4ZAUA 2BAQA 2B9HA 3D4QA 5FDPA 4U3ZA 4MF1A 5EI6A 4EUUA 2OO8X 4AE9A 2OKRA 3NUYA 4AZSA 1XMMA 4DEHA 5A46A 2VTAA 4P5QA 2IZTA 3CGOA 4A4XA 2GFCA 5LVOA 3R9DA 4O0TA 4J1RA 3ZO2A 3QWKA 5ETAA 3LKMA 4Q2AA 4O86A 3LE6A 4PX6A 5IQGA 3MY1A 1APME 4EK4A 1H28A 1U46A 1ZAOA 3BCEA 3IGGA 5E4HA 3RM6A 3PJ8A 3R2YA 4ASXA 5IA3A 4EH3A 4QYFA 5FXQA 3VNTA 3ZRLA 5AV1A 4E20A 2UW9A 4FVRA 4YHFA 1YXXA 2WQEA 3EQDA 4JAIA 2OZAB 3UTOA 4D28A 5C9CA 3BBTB 2XIKA 3OWKA 3DAJA 5IH5A 2RFDA 3T3UA 2Z7QA 2A5UA 2Y3AA 3R28A 2C6KA 2A2AA 5HE1A 4YURA 2PMNX 2W1IA 2VTOA 4G9CA 3ZUUA 3UE4A 3IW5A 4TZRA 1E8YA 3SXRA 3ALNA 3UO6A 2WAJA 4FEUA 2GFSA 1B38A 1TQMA 4EOJA 3FXXA 5HLWA 4DG2E 2WMVA 2ZDTA 2YJRA 2YEXA 3FI3A 3BLQA 3I7BA 3ZRMA 4Z55A 1K3AA 5DR9A 3A7FA 4FSNA 4TNDA 2WXRA 3MTFA 4X2KA 3GOPA 2Y4IC 4OVVA 4IAKA 3L8PA 5EYKA 3VQHA 3QLGA 3CPBA 1ZYSA 3E63A 4F6SA 2Y4IB 5DT4A 4CZTA 3ZUVA 3RZBA 4GUBA 4CLJA 2Y8OA 5A6OA 3ZLYA 3MBLA 4XCUA 4O7NA 3C4EA 4TYEA 4IC8A 3F2AA 3U87A 3O71A 3NZSA 2E9OA 2YABA 4KKHA 3DB6A 3COIA 4IFCA 4FTLA 1Y8YA 3UDZA 4BCIA 3C0GA 3CQWA 2WIHA 5FP6A 3UO4A 4AWIA 3DDQA 2X81A 4AAAA 4PNKA 3LMIA 1YWRA 4W4XA 5HZNA 2B9IA 5F1ZA 5CQWA 1RE8A 3AGLA 3QCXA 4QP6A 4PDOA 4YBKA 4ZJIA 3LAUA 2ZAZA 2WB8A 2CNUA 4QMQA 2X2MA 3KK8A 4MXXA 5DN3A 2YAKA 4MX9A 3W0PA 3OOMA 3CSTA 4P4CA 5E8WA 3PPZA 3UOHA 3LMGA 3CP9A 4KZCA 4IWQA 4LUEA 2HW6A 1Z5MA 5E8UA 2YA9A 3VWAA 3P0MA 1G5SA 1LP4A 4JS8A 5CNNA 4F0IA 4JJRA 4XP0A 4QP4A 2ITXA 3E3PA 2XJ0A 3COMA 3K5UA 3OEZA 4O21A 4GYGA 3SW7A 3UO5A 2X4ZA 2B9FA 3HRBA 3EYGA 2JDVA 2BMCA 4XEYA 4FGRA 3TKUA 2W96B 2VTQA 1H25A 2O3PA 4MXOA 4KBAA 5CSVA 3OMVA 3G0FA 4BDDA 3C50A 3G51A 3PFQA 5HNBA 5HI2A 5HNIX 4GG7A 3ZVVA 3Q9WA 3W0OA 2WMBA 4TT7A 5HO8A 4Z7GA 1H0WA 3IK3A 4GW8A 5BPYA 3NUAA 4I6LA 4RBLA 4EOKA 3KKVA 5A4CA 2DWBA 4O0WA 4IACA 4AN3A 4ZTRA 5AX3A 3TIZA 4WA9A 3ORPA 4FSWA 3MESA 3FLQA 3PJ3A 4XV3A 4FJVA 5IQFA 1PMUA 5LVNA 1R78A 2PVFA 4FV9A 4K77A 2VO0A 3MSSA 2QKRA 5AX9A 4H3QA 1DS5A 2JIVA 4MWHA 3DBEA 1DAYA 5HGIA 3TKIA 4UZHA 4AA5A 1VJYA 4J97A 4BCFA 1WBNA 1PMVA 4ZOGA 4KSQA 1W7HA 2R4BA 4UYAA 4P5ZA 4FZ7A 2UW3A 5ANKA 4ANLA 4BYIA 2YN8A 2B0QA 2O5KA 5KKRB 1LPUA 2EXCX 3ELJA 4QMLA 1S9JA 4ANSA 1YVJA 4YTFA 3BI6A 2J6MA 3GEQA 3KVXA 3MH2A 4K18A 3SG8A 3K54A 4UXQA 4NH1A 3T3VA 4QDEA 2C5OA 3ATSA 3LM0A 5IF1A 4I93A 4HGTA 4FA2A 2GHLA 3QTRA 4HNFA 3VC4A 1Q62A 3ERKA 1KE9A 3KULA 2ZFYA 1OIQA 3ACKA 2WMWA 3FHRA 4K6ZA 2YIQA 3CTHA 3E64A 3NCZA 4M8TA 3ZC6A 4I0RA 3P2BA 3TI1A 2VWWA 3GENA 1KE7A 3FI4A 4Y5HA 3VBWA 2GS2A 4A4LA 1BL7A 3L17A 3DK3A 1WVYA 4AA4A 2W5HA 2PVMA 3UNZA 3HMNA 3TT0A 3GBZA 2V4LA 2V7AA 3G6HA 2EU9A 1J91A 3LFQA 3IOPA 2QONA 1UNLA 4UB7A 2G2IA 3CLYA 3BQRA 4FL3A 4O84A 5JN2A 4DHJA 3HHMA 2BALA 4GFOA 2FO0A 4G1WA 4BDCA 2GQRA 2R3MA 4C4IA 4KKGA 4KD1A 2YM3A 3CY2A 5IA0A 2OIBA 4KUJA 4ZY5A 3UMWA 5IU2A 4ZLOA 4OTFA 3PWDA 4AA0A 2C6OA 4AAYA 5IUHA 3ZRKA 3NFGB 4B6LA 4CXAA 3I79A 5EM6A 2CGWA 4IVAA 1ZOHA 4LUDA 5LCJA 1WCCA 2R0UA 3D7TB 4M15A 2WXNA 3BRBA 3IQ7A 3GFEA 4YTHA 5D7VA 3DS6A 4GU9A 4LYNA 3WIGA 4AW1A 1UA2A 2GPHA 4ITJA 3PJ2A 5M4FA 1Q97A 2WMSA 3W0NA 1Q3DA 1OKZA 4MBIA 4AGWA 4E93A 3A8XA 4DFUA 2JBPA 4XRLA 2X7GA 5AP3A 4QYEA 1PXPA 3ZZWA 1VR2A 1JLUE 4FYOA 4YBJA 3HZTA 4RFYA 4WBBB 3M11A 3RJCA 2VX0A 3KXGA 3AD5A 4F70A 4Y83A 5J1VA 2XALA 4I23A 4ID7A 3C0IA 4PRJA 2WXHA 4F65A 2GHMA 5M09A 3TXOA 1A06A 3B8QA 2CPKE 4ZLZA 3Q32A 2F57A 3ZYAA 4CTCA 1SVHA 4YHJA 3R9NA 2PE2A 1JSUA 3OY3A 3CJFA 2HWOA 4F0FA 3PSBA 2Q0BA 4FSRA 3TMOA 1M52A 3DXNA 1SYKA 3ZUTA 1M17A 2WXMA 3TCPA 4XH6A 2BAKA 4DTAA 3T8OA 3UZPA 1YOMA 2ZM4A 1UNHA 3BV2A 4AOIA 3BWFA 1FBNA 1H26A 3EJ1A 4IWPA 3SW4A 3VUMA 4AXAA 4AZVA 4CKJA 1JOWB 4TYGA 4OTRA 5IMXA 3BELA 1IAHA 4JRNA 1NXKA 1SNXA 2XVDA 4IIRA 4QEBA 4U42A 3R1YA 3DZOA 4KRDA 4RX7A 4N6ZA 1PW2A 4BZNA 2CKQA 5HIBA 1FGKA 4H39A 4WNOA 4DGOA 4BCOA 4XG4A 5J9YA 4FJZA 2OXXA 2P3GX 2EB3A 3VS5A 4HPUE 4Z3VA 3EMGA 3BIZA 4NWMA 2OWBA 5BYYA 4TWPA 5GNKA 2XANA 5JGBA 4ANUA 2CN5A 2VO7A 3CBLA 3JY0A 4WBOA 3PRZA 4BFRA 3I0QA 2XK6A 4OTGA 5I9YA 4Q9SA 3K3JA 4KIPA 2QG7A 1YDTE 3VUGA 1ZXEA 3GNIB 3LXLA 2W4JA 4LRKA 3EH9A 4CG8A 4XV9A 1J3HA 4ONAA 5F95A 3NYVA 2UW4A 1Y6BA 3G9NA 3U6IA 3DKFA 5JRSA 4ALWA 2I0VA 5DEWA 5LVLA 3RPSA 4FI1A 5HE3A 4XG2A 4W8DA 5BX0A 5KE0A 2I0YA 2UW6A 5CXZA 3C51A 5BNJA 3OCGA 5BUJA 3MJ1A 3O51A 3WF7A 1YXVA 3WI6A 3LFFA 4AXDA 4CKRA 2BILB 4X3FC 1OIUA 1SVEA 2XNGA 3P7AA 5CVGA 4EBWA 3FXZA 4V05A 1Q5KA 3PP1A 2BROA 4OTDA 5M51A 4G5JA 4D55A 3S0OA 3EL8A 3KCFA 4OT5A 3HL7A 4RIOA 2X4FA 4DH3A 5IQEA 3C1XA 4P7EA 4USEA 1OM1A 2XBJA 3LJ1A 3NVMB 3VRYA 5LQFA 1PKDA 2FGIA 3NWWA 4XYFA 4WNPA 4B8MA 4EI4A 5JFWA 3SX9A 1XH6A 4DEIA 4PDYA 4DINA 4F9AA 2XNNA 1ZYLA 5DOSA 3F61A 3O2MA 4LV8A 4FTIA 5IQBA 4H3PA 3R7IA 5J8IA 4CFFA 2HY81 1CKPA 2IN6A 3O5AA 4JNWA 4O6LA 3AC8A 5AFVA 3ZS5A 4AGDA 5KMKA 4E6AA 1JSTA 4AS0A 3PIYA 3NYNA 4DEEA 2FB8A 3NDMA 4IAAA 4D4VA 4BCGA 4R6VA 2W05A 2R3PA 2C5YA 3ENEA 4XZ4A 4LMNA 5CY3A 2JDTA 3PRIA 3PY1A 2AYPA 2VTMA 4GG5A 3ZFYA 3I7CA 3DQWA 3AG9A 4RX5A 4RG0A 3W0RA 3AKKA 2B7AA 2XH5A 2YWPA 2RD0A 3QX4A 3R9HA 1GIJA 4EH6A 2XA4A 4HYHA 4FHKA 3DFAA 3C7QA 3LLTA 5EW9A 3FMLA 5AUVA 1TFFA 3O7LB 1JPAA 3NIZA 2E9PA 4U40A 1P5EA 1FQ1B 2P2HA 1PHKA 2EB2A 5EM5A 4ACDA 4CTBA 2PUNA 3ZMMA 4I92A 5HD7A 3ZDIA 4ACGA 5JHBA 4QNYA 3I81A 3FMNA 4Q5HA 3W2PA 1VYZA 4FHJA 3NZUA 3C4CA 4FZ6A 2YM7A 4JXFA 2UZEA 4FADA 1IG1A 3LM5A 4QDVA 1P14A 3R1SA 2C1AA 3QQGA 5JH6A 3F5UA 2OXYA 3UNKA 3KFAA 3L9NA 4BR3A 2OZOA 4BICA 4YC6A 3KULB 5F94A 1V0OA 3BHTA 1XHAA 4PQNA 4X2NA 3LLAA 4BTKA 3SOAA 5HX8A 4FVPA 4JVGA 5CU4A 5ITAA 2H96A 3FMKA 4TYIA 3R8PA 2HXLA 2Z7RA 3FQEA 4RVLA 4M67A 2ZDUA 1H00A 4JG6A 2JC6A 3QXOA 3UDSA 3G5DA 4V0GB 4CD0A 4AP7A 4X0MA 5JFVA 3OXIA 3DKCA 4JDIA 4YC3A 5M4CA 4GSBA 5HBEA 3LQ3A 4EH8A 2O0UA 5EOBA 4BI1A 2PL0A 4O38A 2YZLA 1P4FA 3ZTXA 5KZIA 4O7RA 4L7FA 3E92A 5HBJA 2ZV7A 3QA8A 3QK0A 3OEFX 4QP8A 4Y73A 3O96A 2VZ6A 3RPRA 2Y0AA 4FKRA 4GK4A 4XV2A 3ZBFA 3PZEA 5IH6A 1MP8A 3PPKA 3GP0A 2QOBA 3FMJA 4F7JA 1PMEA 1PXNA 2HXQA 2WTDA 3JPVA 3LFSA 5EK7A 5GIOE 2JKQA 3P9JA 4GT5A 3ORNA 3UIUA 3OT8A 1V1KA 2PVYA 2E9NA 3DXPA 5K3YA 3ULZA 2B53A 4D9TA 3LFEA 3OBJA 4EC9A 2XIXA 4O0VA 3OT3A 4ZS0A 2OIQA 2ZB0A 2Z7LA 1KE5A 4TW9A 2V5QA 4FTMA 5JFXA 1UWHA 5HIEA 3A7JA 5GIPE 4GYIA 2YISA 3OUNB 4C3RA 2Z2WA 4JX7A 4YJTA 3N4UA 3U6HA 3F3UA 5I4NA 4ACMA 1BI8A 3ML8A 4AGUA 3HA6A 3MH3A 3BHVA 1GNGA 4R3CA 3KL8A 1H0VA 4BDIA 4LQMA 4ITIA 4M12A 3PP0A 3Q4TA 3EQFA 3PXRA 4NL0A 4RIXB 3AKJA 2W4OA 5FP5A 3U55A 3TJCA 4EZ5A 5CSPA 3V5TA 3RWQA 4I6QA 2QNJA 4MKCA 1H1SA 3NFFB 3QQHA 4M84A 2XB7A 3W2SA 4FSMA 2C5NA 3HUCA 3OHTA 3RNIA 3TNIA 5HTBA 3QQLA 4E6QA 4XG6A 2CHZA 3E62A 2ZV9A 1B39A 4JL9A 4A4OA 4C4GA 5CEKA 1MUOA 3A4OX 4LM5A 2C6IA 5AP7A 3UQCA 4NFNA 1G3NA 2OZAA 3R9RA 4AF3A 2WTVA 4U7ZA 3ZOSA 3SA0A 4DH7A 3B2TA 3P23A 2FH9A 3F3VA 5LARA 5LXMA 2WXIA 5CF6A 3H9OA 3NUPA 4FK6A 5JGAA 3UIBA 1T46A 2YIYA 2JKKA 3F7WA 2OG8A 5FEQA 5IQHA 2HW7A 3ITZA 3R01A 4FTJA 4BDHA 3RK7A 4F9YA 2NYAA 2CHLA 1J7UA 3ENHA 4IEBA 4UY9A 4APCA 3HDNA 3QTUA 4GV1A 2HYYA 5AM6A 4H1MA 4AFJA 4RQVA 2WU6A 2J7TA 3MH0A 3NYOA 1Z9XA 5EQEA 3SAYA 3FV8A 1PXLA 2QLUA 2WELA 3BL9A 2C0TA 3Q04A 2CCIA 3PVUA 3WF5A 3VS2A 4EYMA 2PUPA 4QPSA 2VNWA 4O7TA 3OC1A 5BVEA 4JOAA 3CC6A 2XAOA 2Z60A 3I60A 4I6FA 2WXOA 3VVHA 2X7OA 4L9IA 4QTBA 4NSTA 1ZRZA 3R7VA 3FMHA 2R3NA 3W10A 3OF0A 4X2JA 4Y5QA 4DBNA 3MDYA 4IZAA 4I22A 3TL5A 2DS1A 1KSWA 2CCHA 2YCQA 5KO1A 4G3CA 4DCAA 2YDKA 5IA4A 4MBJA 4CCUA 5IMEA 1RQQA 2QG5A 2VTPA 5DH3A 2WXFA 2XK8A 3PUFC 3QQFA 4TNBA 5CSHA 2Z02A 3FAAA 4LV5A 3LFBA 3F82A 4JBQA 5CT7A 2CGVA 4IADA 5D12A 3PXFA 4YJQA 4WUAA 4DDIA 2EWAA 3EN9A 1OL1A 2CSNA 2Y7JA 2IG7A 1H01A 2IVUA 3KMUA 4TPTA 3VS7A 1FVVA 3S1HA 1JBPE 4J96A 4E5WA 5KUPA 1WBWA 4TWNA 3UGCA 3COHA 4L42A 2XNEA 3HMIA 4XG3A 2HELA 3MY5A 4H3BA 4DHFA 2WXPA 3PZHA 4QMOA 3ZSGA 5JQ5A 4IANA 3IHYA 3WZDA 2IVSA 4ENYA 4ASDA 2F9GA 2YAAA 1UKIA 4X3JA 1DM2A 4AT4A 2WU7A 3QD0A 2JIUA 5EW3A 3O23A 4OUCA 3DPKA 3VONA 5I9ZA 3DXQA 4JPSA 3L9PA 4IDVA 3TNPC 3VO3A 1J7IA 4EKLA 5BVNA 1KE6A 1BL6A 3QX2A 4ZSJA 4LOPA 2RF9A 2V62A 4U41A 5FM3A 4WUNA 4E4NA 1UNGA 3UP2A 3RI1A 4C2VA 4FEVA 4D58A 3Q6UA 5HVKA 5B2LA 1AD5A 3HP5A 1XQZA 5AUWA 1CMKE 4DDGA 5ACBC 4D2SA 4P90A 2C0OA 3AGMA 5M4UA 2JKMA 3QYWA 4EEVA 4JQ7A 3JVRA 1ATPE 4AXCA 3RPYA 2RFSA 3CKWA 2JKOA 2WEVA 3FZ1A 2CHWA 1XKKA 3AMAA 2F7XE 2R3JA 3HV7A 3ZO1A 4R3PA 3ZZEA 4FG8A 2VWBA 2XRUA 4WG5A 2YM5A 5M06A 3FHIA 3OXTA 1OMWA 5CVFA 4WWOA 4E5AX 4FIEA 4JDKA 3II5A 3LJ2A 2PUUA 4O81A 4D4YA 1ZLTA 3FMEA 4DAWA 1PXMA 4W4YA 1S9IA 5CI6A 1ST0A 4X7QA 3PJCA 4MVFA 4PH4B 2W1ZA 3IDPA 1REKA 5FBOA 4F78A 2J0LA 1JVPP 1XO2B 2AC3A 3GVUA 3PPJA 2G9XA 4QMYA 4OBQA 4V01A 4HVHA 3F7ZA 4WKQA 2BVAA 4DGLC 5JMSA 3TACA 2WFYA 4K8AA 3DAEA 3ZU7A 4JX3A 5FXRA 3L08A 3F3WA 1XBBA 3L16A 1CM8A 1YHSA 4C4HA 3LQ5A 4HZRA 4NM7A 2RG6A 4IW0A 4QO9A 5AP2A 2PU8A 2V7OA 2XMYA 2GS7A 3A7HA 3R8UA 2PWLA 3TWJA 4EOQA 2PVNA 4K1BA 2X6KA 2BFYA 2W1EA 3V8SA 5KHWA 4MQ2A 5IEVA 4DGGA 1YQJA 1DAWA 4G6LA 4IX5A 4U5JA 1JKKA 3MW1A 4HGEA 1SM2A 2X8IA 5EYMA 4NFMA 3NW7A 4ZTSA 4DG3E 4RWIA 1WVXA 3MPMA 4C0TA 1H1PA 4D5KA 2J50A 4FBXA 3QRUA 1I44A 2BRNA 3MB6A 1CKJA 4EH2A 5JEBA 3LFNA 1Q41A 5HNGA 5IA5A 1OUYA 2BZKB 5EDQA 4AE6A 1OITA 4U9AA 3HV6A 3OVVA 3R7YA 3UP7A 5B2MA 4NCTA 5M53A 1UWJA 3AC1A 2OH0E 2WEIA 2WNTA 2WQOA 3I4BA 4NW6A 3NX8A 4C58A 3FXWA 4BDJA 3TJPA 5HBHA 4IVCA 2F7ZE 5C8KA 1PXIA 5ANOA 4PWNA 3OP5A 3EZVA 3SG9A 4DHZA 3MB7A 2LGCA 4EOLA 4XG8A 3RP9A 4AT3A 3I6UA 4O27B 4EZ3A 3W32A 3R63A 4R5SA 4HVBA 2NRUA 3I6WA 3O8UA 5FD2A 2XP2A 5K4JA 3KMMA 4XUFA 2CLXA 4EZKA 4H58A 1GZNA 3PXKA 4M97A 1HOWA 3BLHA 3ACJA 3SC1A 4CRLA 5I9WA 5AUTA 2NNWB 5DGZA 1J1BA 2R0IA 3GCQA 2VNYA 4EOMA 4NJ3A 3ZSHA 3BZ3A 4FTCA 4MXYA 4NKSA 5C1QB 2ITNA 4ZLYA 1I09A 5CU2A 3RINA 4F08A 4YJRA 4PL5A 3DKGA 2ZYBA 1BMKA 1IA9A 4R1VA 5FDXA 3ZC5A 1M2PA 3DKOA 3PE2A 2PYWA 3GQLA 4IM3A 2E9UA 4M3QA 5AEPA 2UZDA 2QOHA 2W7XA 5BVOA 2C3KA 3EN5A 4PMSA 4ZZNA 1IR3A 5FUTA 3NUSA 1L3RE 3D94A 4DGNA 4ZTMA 2CKEA 2VWYA 3LMHA 1YXTA 5AA9A 5C4KA 3ZFXA 3VRZA 4GK3A 3E87A 4AZTA 4YR8A 3R83A 3ORTA 4UWFA 3T9TA 4DN5A 1AQ1A 4FV6A 2PUIA 3F3TA 4IAYA 5M56A 3QKMA 4CGAA 3MN3A 3VQUA 2YACA 4DEBA 4EK3A 4FSZA 4IX3A 5DT3A 3UVQA 4Q5EA 3V5LA 3AT3A 3FEGA 3PIXA 4ASEA 2X6HA 2Y6OA 3E93A 4WG4A 4O0RA 3ZCLA 4FGBA 1WMKA 4R3RA 5M57A 5JK3A 3E8CA 5ANIA 3QF9A 1M2QA 4H1JA 4YJSA 5HG5A 5AADA 4C61A 1PY5A 2WD1A 4FKOA 3EOCA 4LGGA 4QPAA 4XX5A 3V5PA 2QOLA 2A1AB 2WMQA 4IE9A 3CGFA 3AD4A 4CKIA 1ZY4A 4PDSA 2WHBA 2X9FA 3L9MA 4FOCA 3SGCA 3LCKA 4PP7A 2XNBA 4IDTA 3ZEPA 4B99A 1PYEA 5A4QA 3PXYA 3VF8A 3RK9A 3QD4A 5AV4A 1XBCA 5CAOA 1HCLA 3QGYA 5HIDA 2OU7A 2P0CA 3BU3A 3Q2MA 5BV3A 4BCPA 5AA8A 4L3PA 3L13A 1DI8A 1OPKA 3GC7A 3Q9XA 4WRGA 3ALOA 4A9YA 2UW8A 5HHWA 4K0YA 3LFCA 4DFLA 3A99A 3OFMA 2IJMA 2BPMA 4HGSA 3WF9A 2VV9A 4W8EA 3FY2A 2QOFA 3LPBA 3BLAA 3QQUA 4FNYA 4JQ8A 3L8SA 4O7VA 3IGOA 5KMMA 3E3BX 4D0XA 4A9SA 1OUKA 4R77A 4KS8A 4O7ZA 1QL6A 4L01A 3SKCA 3GC0A 4PNIA 4AACA 4EL9A 4NKAA 4E5BA 1ND4A 4GS6A 5CANA 3CE3A 5L2IA 1VEBA 2OLCA 3NW6A 4L8MA 3R22A 5EDPA 4BZDA 1XJDA 1RW8A 5HCYA 3D5VA 3JR1A 5H3QA 4ZMFA 3UNJA 3W0SA 5CU3A 3ZLSA 2JIIA 3G33A 1OPLA 2PHKA 2PVLA 3QTZA 4NT4A 4RMZA 2C3IB 4F1SA 4UALA 5FTQA 5TT7A 4CVAA 2PE1A 1VZOA 3A2CA 3U4UA 2QHNA 5EHOA 1KE8A 4PL3A 4UXLA 4ERKA 3QZGA 3V6RA 4LRJA 3UYSA 4A7CA 3Q96A 3BHHA 4FV0A 3IG7A 5IISA 4M0ZA 2X1NA 4YZMA 2QD9A 2OJIA 3R1QA 4WG3A 3AMBA 3PJ1A 1ZARA 1YI6A 3E88A 4YZ9A 5AMNA 3PDTA 5HKMA 3VS0A 5M07A 2W17A 1Q61A 4UYNA 1ZYCA 5DIAA 1SZMA 3REPA 3H9FA 4OGRA 2VTNA 5ETCA 2F2UA 1E8ZA 2OH4A 1W0XC 2RGPA 3P86A 4PP9A 3HMPA 2UZNA 3KF7A 3OCBA 3QLFA 4NIFB 4D4RA 4EOIA 4YZCA 1PYXA 1R39A 5TR6A 4EUTA 3WE4A 4S33A 4Z9LA 2XZSA 1WAKA 3DLZA 5DE2A 5D7AA 2P55A 3QCSA 1H4LA 1OL2A 3NUUA 3MY0A 3BBWA 2OSCA 3RAHA 4PUZA 3THBA 3I5NA 4C2WA 3IOKA 2VO3A 4IB5A 4ZJJA 3FKLA 3FC1X 2YIRA 4IX4A 2ERZE 4KINA 4I5MA 4V0GA 5IQCA 2YIWA 2BTRA 3R21A 5HG8A 3HGKA 3GT8A 2QODA 4RGJA 4JQEA 4XNEA 4L53A 4AJWA 2YCFA 5FXSA 1JWHA 2G1TA 3AMYA 5HICA 1QPDA 3VUDA 4AW5A 4F7LA 5KBRA 3NVKI 4QP2A 2UZUE 3QYZA 1HCKA 5LVMA 4FV8A 1K9AA 1WVWA 4G17A 4G3EA 1YKRA 4OBPA 4ACHA 2GSFA 3M42A 1XWSA 3PSDA 3QD2B 1YHWA 4R7HA 4FJYA 2A19B 3BYUA 4BZOA 2ZV8A 4L43A 4LGHA 4URKA 2XKEA 2YCSA 3HV4A 2PZ5A 4YTCA 4RJ6A 2GHGA 4YZNA 2REIA 3EFWA 4FKGA 4E4MA 3MS9A 5HQ0A 3PVWA 5TOZA 1FVTA 4MNFA 4D2RA 5KHXA 4DHIB 4AOJA 3FYKX 3CY3A 4AXEA 5HCZA 2OFUA 4CCBA 5HO7A 5FLFA 1MQBA 3FKOA 3ANRA 5EKOA 3RVGA 3TKHA 2FSMX 4GH2A 4HCVA 4DLJA 4QT1A 1JNKA 2E9VA 4L1BA 2OK1A 1TQPA 4BCHA 2A4ZA 2GU8A 3UOKA 5EKNA 4NCTC 5AJQA 4ITHA 1M7QA 3GCPA 3ORXA 4L68A 2PMOX 5CI7A 4GRBA 1WZYA 2BZJA 1ZMVA 3KXXA 1OL6A 4PDPA 5GJFA 2W1GA 3G15A 4I41A 3E8DA 4I0TA 4ZTHA 4RC3A 2UW5A 4WIHA 5EM8A 3F2RA 3RHXA 4BN1A 3TNQB 2PVHA 3QRJA 1Q8WA 2I0HA 3LVPA 2XIRA 4MNEB 4TKSA 5AIKA 1OBGA 2VU3A 3F2NA 5CYIA 5C8MA 3RM7A 4CFXA 5L2TA 4NM5A 5CZIA 4BIBA 4HZSA 3MVMA 3ATTA 1LUFA 1OVEA 2HK5A 2J0KA 2OF2A 2WTKC 3CTQA 4I24A 4KRCA 4N6YA 4YZDA 3R8MA 2O8YA 3FLZA 2VTJA 2R3LA 3DNDA 4BCQA 5CSWA 2IO6A 3LCOA 3EYHA 1H1RA 5DFPA 4O0XA 1UU8A 5DBXA 4BTFA 4RRVA 4EOPA 2GQSA 4O0SA 5G6VA 1V0BA 4FKIA 3S2AA 4E26A 3JXWA 2WXGA 4BGHA 4BI2A 1URCA 2R3HA 2XCKA 3PVBA 3EWHA 2HOGA 5A4EA 3AT4A 4IAIA 2XAMA 3NUNA 5E8VA 3CD3A 4DT8A 4FMQA 1PXOA 5IA2A 4AOFA 4YLKA 3F88A 2VTRA 2H9VA 2WMUA 4NW5A 3C5UA 4JIAA 3UC3A 1F0QA 2C1BA 2ETMA 2VGPA 3DZQA 2QOOA 4OR5A 1Q24A 2IZRA 3EN6A 3GGFA 2IW9A 4ANQA 3QHRA 4RC4A 3KMWA 4PY1A 3QFVA 5CU6A 5D9HA 3OWPA 4C59A 5DPVA 3ODYX 4HNIA 2UVZA 3EZRA 3F69A 3I0OA 3M1SA 2X8DA 3QUEA 3ZW3A 4IB0A 4PL4A 4DG0E 4TN6A 4HVSA 4GB9A 3VHEA 2CDZA 4EH4A 4AFEA 3C4XA 5HORA 4FIGA 4BDFA 5AP4A 3IKAA 5CEIA 5BUEA 3QKLA 4XS2A 3QAME 1NW1A 4S2ZA 5J7HA 5JSMA 3F5PA 4G34A 2R9SA 4MBLA 2C5VA 2R3FA 4TTHB 3CQUA 3QJZA 4UWGA 5BMMA 5BVFA 3GI3A 3OOGA 4L7SA 4AN2A 3COKA 5JZNA 2UZTA 1G8SA 3DTWA 3UDTA 3BWJA 5KMNA 4FSQA 3O8TA 4RJ4A 4QQCA 3QXPA 3KRJA 2F2CB 4KBKA 3UDBA 2WQNA 4C37A 4C7TA 2X2KA 3QRIA 4CFWA 4EQUA 2BZIB 2YM4A 3LXPA 4PV0A 1SNUA 3R30A 3SD5A 4DFXE 3G6GA 3HMMA 1JKTA 3VW8A
chains in the Genus database with same CATH topology
3Q6WA 5GJDA 4MD9E 3GXLA 1Y6AA 4BYJA 4FKUA 4DLIA 4S30A 2VTTA 3AT2A 1FOTA 4AT5A 3FLYA 2JITA 2R5TA 3D5XA 3VF9A 2H6DA 4X3FB 5AP6A 3ANQA 4TL0A 2PSQA 4C02A 2ITVA 4RIYB 4FKSA 2VD5A 1ZZLA 5L6PA 3WF8A 3W2RA 3FLNC 4QYGA 3U4WA 2Z7SA 1ZMUA 3VS1A 4EORA 4IB1A 4F4PA 4E6DA 3FDNA 3UODA 2JDOA 4YUQA 3TYKA 1Q8YA 2PVKA 4R5YA 3SDJA 4YO6A 4YTIA 1Q4LA 4CEGA 5FGKA 3V6SA 4J71A 4USFA 3EKNA 2R3RA 4NU1A 2I7QA 4RVMA 3KGAA 1TQIA 3IW4A 2XYNA 3MPTA 3QWJA 3GOKA 3CSVA 5H9BA 3PA4A 5ANDA 4FOBA 3KXZA 4DTBA 1Y91A 5I9VA 1O6KA 4G5PA 5DRBA 3BL7A 3P79A 1XH8A 2I1MA 5GINE 3R00A 1ZY5A 4M69B 5E8SA 4FTTA 5CF8A 5M08A 3DGKA 2Y6MA 4RWKA 4XG7A 4CFMA 4EHVA 5L2WA 2XUUA 3SXFA 4I5CA 5IEYA 4ZXTA 3FUPA 4MH7A 4O0YA 5JKGA 3IONA 4ZIMA 2P4IA 4GIHA 4GT3A 4LL0A 5KMIA 3E7OA 3V04A 4GL9A 2DUVA 4MK0A 4W4WA 3NMUF 1W8CA 5HX6A 4HPTE 2A27A 5ICPA 4YSMA 3DDPA 4RIWB 3Q4CA 4ZP5A 3CJGA 2O2UA 3L9LA 4YC8A 4U3YA 4AZFA 4I6BA 4WO5A 4AG8A 4U43A 5D1JA 3WILA 4CMOA 3KC3A 3OS3A 3PRFA 2PTKA 4NM0A 5ANJA 2W9ZB 3QTIA 3S2PA 2UW0A 2VRXA 3F3ZA 3PWYA 4EQCA 3DFCB 1URWA 1PJKA 3ULIA 5CAVA 4B0GA 1GZKA 2W4KA 4XHKB 2IZUA 3NS9A 4X6RA 3R8VA 3RAWA 4TYJA 4NJDA 3TDWA 3MGYA 5AUUA 4QTDA 3VULA 3U51A 3C9WA 3W8LA 1UU7A 3ZXTA 3CD8A 4FV7A 5DR6A 3UQGA 5JQ8A 3DA6A 5KMOA 4E4XA 5L2SA 4ALUA 1K2PA 2XARA 4Y72A 4HVDA 2C6TA 3MI9A 4YPSA 5BVKA 1JKSA 1W98A 3ZLWA 5AWMA 4U8ZA 4BCKA 2QO2A 2JAVA 3C13A 3Q4ZA 3H3CA 4F64A 5GHVA 5A3XA 2WQMA 4R1YA 3NRMA 2AUHA 5EH0A 5T6KA 4D0WA 4FYNA 4JG7A 2XYUA 4QMTA 5B0XA 3CCNA 3HECA 4FT7A 4MAOA 3BU5A 4FSYA 2OJ9A 4BCNA 3RHKA 1QMZA 2C3JA 3ZH8A 4ARKA 3CQEA 3TEIA 3SLSA 4HW7A 3KEXA 2UZWE 3OD6X 3QC4A 4NK9A 4ZSLA 4RVKA 3UJGA 4D5HA 5E92A 3WBLA 3DBQA 1U4DA 3JS2A 4RIXA 4RIYA 4DC2A 5LOHA 5A54A 1KV1A 4HVGA 1E1VA 2C30A 4QP1A 3A7GA 2QOCA 3FQSA 2YDJA 3W0MA 3K2LA 5J9ZA 4IX6A 1H1QA 3A8WA 4QTCA 3QA0A 4KIOA 4C36A 4XX9A 1XR1A 5HTCA 3KY2A 4BY9E 2QI8A 2H8HA 3LXKA 4L6QA 3BGZA 4FICA 3GC9A 4GVAA 2XK9A 1FINA 5CENA 3R7OA 2P33A 3TV6A 3TNWA 2NO3A 4FSTA 4YP8A 1VLRA 2H34A 4ZMEA 3QHWA 4CNHA 3D0EA 5TO8A 1CTPE 2VTLA 2YWVA 3LJ0A 4RZVA 2BCJA 2OJGA 3UZRA 3F9NA 1TKIA 2R3KA 4R78A 3GCVA 4DFBA 1OI9A 4IZ5A 4JR3A 2JD5A 4LL5A 5LMKA 3S95A 1LEZA 2QU6A 3KIOC 3NNXA 1PXJA 3IO7A 4ZTLA 4F09A 2BUJA 4BBEA 2YJSA 3PA5A 2FA2A 4G9RA 2CJMA 4Y46A 4ZTQA 1H8FA 2QO9A 2FYSA 3BHUA 3QRKA 4I1ZA 5CNOA 4B7TA 4HCTA 2C6DA 4UWBA 4BJJA 2C4GA 4BHZA 4FT0A 5HVJA 3ZM9A 3IDCA 5T3QA 4JT3A 4HOKA 2VAGA 2C5XA 3RPOA 3TV4A 4FIFA 4FNWA 1WFCA 3VW6A 3R73A 4JR7A 3HYHA 2GCDA 3DBFA 4FKTA 5IDNA 2ZMCA 4M68A 2ZJWA 3HUBA 2QO7A 4UEUA 4YHTA 4GFGA 4JG8A 1G8JA 5L6WL 3FZRA 4I94A 3TZ9A 5I5ZA 5JGDA 1H27A 4HGLA 3VBYA 3FLSA 4IVDA 1GOLA 2ZV2A 3BPRA 1OPJA 5FTOA 4EH5A 3E8EA 3IW6A 5AP0A 3ZO4A 2OJJA 4C62A 3NNWA 3SV0A 4H05A 2V55A 3W16A 2GMXA 5L8KA 5TKDA 2BDFA 1OKWA 1XH5A 2IVVA 5KZ0A 4CFNA 5E90A 4FEXA 5EOLA 1U54A 2R3GA 1BYGA 3EHAA 5CS6A 4FVQA 4GU6A 3QTQA 4RA4A 5E9EA 4DFNA 3FLWA 5AUYA 2YFXA 5EI2A 1R0EA 5M55A 1ZYJA 4UWCA 3HA8A 3Q52A 3HVCA 2YITA 5CLPA 4CV9A 2GNHA 4RFMA 3QALE 1H24A 3CKXA 5E8XA 3WF6A 3TNHA 1YXSA 3GB2A 2C3LA 3FZSA 3R7EA 2AEGA 4WNMA 3DY7A 4U81A 1MRVA 2RG5A 4C3FA 4E1ZA 2V0DA 4FX3A 5HLPA 4EK8A 4F7SA 4RPVA 4I20A 5C27A 4AN9A 2UVYA 4DEGA 3ZLXA 3ZFMA 3O8PA 3C5IA 2PE0A 4PMMA 4GJ2A 3MFRA 3EQGA 1Z57A 2UUEA 4IHPA 1XBAA 1JKLA 2VTSA 4EH7A 2GS6A 2W1DA 4RZWA 3CPCA 4QMNA 4YU2A 2EUFB 1YOJA 5IA1A 2JFLA 4U45A 4DT9A 4KNBA 4P2KA 4RLLA 4C33A 4XG9A 1BLXA 4A06A 4FTKA 3R04A 4I4FA 5DR2A 4AX8A 4DH8A 4AZEA 5AAEA 5FTGA 2C6LA 4FT9A 2XK4A 5HVYA 4E73A 3FSKA 2ERKA 4A07A 3W2OA 4WRSA 3RAIA 2X2LA 4RJ8A 3WE8A 2C69A 5KCVA 3L8XA 1IAJA 4J99A 3EN7A 3BGPA 2ZB1A 3PLAE 4QMWA 2R3IA 4LV7A 5HESA 5CTPA 5H8GA 2J90A 4KAOA 5KMLA 1OB3A 3UVRA 3O50A 4XMOA 5E8TA 3FL4A 5F4NA 4O6EA 1XH9A 4FR4A 4FTQA 4GMYA 4QMUA 3AKLA 3KN5A 5A9UA 2X8EA 3N4VA 4O22A 4PF4A 4NZWB 3ZBXA 4AXFA 3UPZA 4YMJA 4WD5A 2FUMA 3DB8A 3O0GA 1JQHA 3WZUA 5M44A 4U44A 5D41A 3RCDA 4EJ7A 4IAZA 1ZZ2A 2IW6A 4MWIA 1QPCA 2WMTA 3NAXA 3KRRA 3VBXA 5CT0A 3G90X 2O63A 2QC6A 2XKDA 3SD0A 3R8ZA 3UZTA 2W06A 3JY9A 4BRXA 2PZYA 4EC8A 2WQBA 3HV5A 4EK5A 3OY1A 1U59A 3LW0A 1ZOGA 4Y85A 4QMMA 4OW8A 3U9NA 4DCEA 5LCKA 4NTSA 2C0IA 2FSLX 3FL5A 3OCSA 1GZ8A 3TIYA 5DG5A 2UVXA 2QCSA 4MYGA 1R0PA 3PVGA 3BYOA 3MFTA 3HEGA 3FZPA 1WBVA 3NGAA 2OXDA 4MXAA 4YJOA 4ZK5A 3PG1A 5HU9A 4ZZOA 4LG4A 1YDRE 5IQAA 5IUIA 4NM3A 5E8YA 3ZONA 4FSUA 5BQ0A 4JBOA 5D11A 4YJVA 3KREA 5KX8A 2PY3A 3M2WA 4IZYA 3RALA 4D1ZA 4IBMA 2VX3A 2WGJA 2HWPA 4GVJA 5HEZA 3BEGA 3C4ZA 5DT0A 2YZAA 3BGQA 3TZ8A 3GFWA 3LQ8A 4CQEA 4FG9A 3C4WA 1OL5A 4XLVA 2BDJA 3OUKA 3GQIA 3MJ2A 5ACKA 3PTGA 4K33A 4D9UA 3I1AA 3ORMA 3EB0A 4O0UA 5IUGA 2WMXA 2HENA 3RKBA 3D83A 2ZVAA 3TV7A 5D10A 2NRYA 4O7LA 5FEEA 3BEAA 4ORKA 5IPJA 1FGIA 3OTUA 3TTJA 3MYGA 5DVRA 3H30A 4FK3A 3D2KA 2CGXA 3LZBA 4D1XA 4N0SA 3AC4A 5B7VA 5JT2A 2J51A 3R7UA 4GFMA 1V0PA 1A48A 4RX9A 4I5PA 5BYLA 3HX4A 3SQQA 3BYVA 1Q99A 4OTHA 2GTMA 3QC9A 4FV2A 4LDTA 2B1PA 2ITZA 2W99B 5C03A 3A7IA 1OIYA 3RTPA 5EQPA 3QZFA 5C8NA 5ETIA 3N4TA 4BCMA 4Y95A 2F49A 4CMUA 3FQHA 4II5A 4L45A 5J87A 4FZFB 3BU6A 3F66A 4HYIA 3IS5A 5DWRA 5AUXA 2RIOA 4U79A 3FMMA 4FKPA 2ITOA 4EOSA 5B2KA 1M2RA 2XNPA 3W2QA 4GT4A 3PIZA 2WTIA 1PMNA 3V01A 4F63A 3HNGA 4F7NA 3TUDA 2BKZA 3AC3A 5L8JA 2ITPA 5I9UA 3MA6A 5J95A 3LXNA 5KNJA 1YI4A 4O91A 1KWPA 3LFAA 4FE2A 2PVRA 4DYMA 2XJ1A 4EOOA 3MV5A 3QKKA 3L1SA 4BTMA 5AM7A 4BDBA 1KOBA 3OW3A 3UVPA 3W55A 3OG7A 3F5XA 5LWMA 2PZPA 2BRBA 3DJ7A 3H10A 4XLIA 4JDJA 2IW8A 5CVHA 2Q0NA 4PTEA 3RK5A 4APPA 3CEKA 3ODZX 3OXZA 4FIJA 3W8QA 4BDGA 1YOLA 4DH1A 4BDEA 2X6DA 1A9UA 3LIJA 4NYEA 3R6XA 1BUHA 1OZ1A 4DH5A 3N51A 3SVVA 2ONLC 5M4IA 3K5VA 4N70A 4L3JA 4CT2A 4DFYA 1W84A 3EFLA 3TL8A 4DEDA 3UIMA 3ZEWA 1KV2A 4F9CA 2JLDA 4L67A 4QTAA 4S34A 2BR1A 4CMTA 4ZEGA 3EFJA 4FTUA 5AP5A 3EQBA 3DAKA 4QQJA 1OL7A 2RFEA 3H0ZA 3JVSA 4IZ7A 2JGZA 4RJ5A 3DCVA 5AV2A 4AQCA 4CFVA 1QPEA 2VWXA 4EQMA 1L8TA 5CU0A 5J5SA 3FI2A 1KOAA 4X2FA 3UQFA 1PXKA 2G2HA 1Q8UA 3QUPA 3ORIA 4FC0A 4GUEA 4HYSA 3UYTA 3SXSA 4QQTA 4O96A 4FKVA 4J8NA 2YM6A 3QCYA 4IMYA 1JSVA 4EYJA 2XEZA 5CF5A 3U8WA 4FKLA 2XM9A 3R8LA 4RT7A 3MVHA 3RPVA 2A4LA 4GJ3A 2WZJA 5AUZA 3UC4A 4ZJVA 5CAQA 1ZWSA 4DF3A 4E4LA 4ZSAA 3JUHA 3HAVA 2NP8A 2VN9A 5G1XA 4MTAA 3MFSA 4HVIA 4DFZE 4IB3A 4DA5A 4BJJB 3PFYA 3W2CA 3ET7A 3NNUA 4IM0A 2XIYA 3V8WA 3ZM4A 2WPAA 2I40A 5K9IA 4F6UA 4YJNA 1GY3A 4KWPA 2O64A 1UVRA 3TZMA 3ENMA 5FRIA 2CNVA 5L8LA 4JI9A 4CSVA 4OBOA 2GNLA 4QQ5A 3OBGA 4UBAA 4J7BA 4CRSA 1W82A 4CLIA 1FMOE 2CLQA 3IPHA 3Q53A 4BI0A 3HP2A 3U6JA 2ETRA 3D14A 2OICA 3FBVA 3Q9ZA 4C35A 5IZFA 4FNXA 1STCE 1M14A 2ITTA 1E9HA 2BRMA 3GU4A 4IJ9A 2Y9QA 1NVSA 1LEWA 5J9LA 4F1MA 3UPXA 5E91A 4FV4A 1H1WA 2I6LA 5EDRA 5EG3A 2GNGA 4I5HA 5EHLA 1P4OA 2BKKA 5IQDA 5CSXA 4FIIA 4AQKA 1Q3WA 3AXWA 2ESMA 2YM8A 2PZIA 3A60A 4JBVA 3LHJA 1FPUA 4IWOA 5ANEA 4QTEA 4QP7A 4FV5A 4FKWA 4EHEA 1NVQA 5HCXA 2JFMA 4UZDA 5EQYA 4JIKA 3VAPA 3EIDA 5HLNA 3BQCA 4X21A 2J0JA 2O65A 3V3VA 1WBTA 4L44A 5HE0A 4CT1A 3HRFA 3FI8A 2PMLX 3IDBA 4R7BA 4UWYA 3NR9A 4CV8A 5L3AA 3BHYA 2R7BA 2XF0A 4YSJA 3FE3A 4MEDA 4Z7HA 4E6CA 2OJFE 4QMZA 5A4TA 2Y4PA 2ITWA 4IC7A 5E8ZA 1UV5A 2XKFA 3PYYA 4XOZA 2GTNA 3AD6A 3HAMA 4TWCA 3W0QA 4L00A 4F6WA 1OBDA 3KK9A 4E8AA 1YWVA 2YCRA 4HJOA 4RQKA 4GCJA 2ETKA 3FPMA 2QURA 4H36A 4LOOA 1QPJA 3KRLA 3JYAA 4FODA 5FEDA 3LFDA 3WARA 2J9MA 2W9FB 3ORKA 2QOIA 2I0EA 2OBJA 1Q8ZA 1SVGA 3R9OA 4FV3A 4J53A 3KA0A 2VO6A 3TM0A 3EQCA 1WBOA 3FJQE 4KBCA 4O7YA 2G2FA 3WYYA 1GIHA 3UIXA 3NYXA 2ACXA 3KXMA 4LOQA 1NT2A 3GC8A 3D5UA 3MPAA 2GNJA 4FL2A 4MXZA 2KTYA 3DTCA 3QU0A 4G31A 2VUWA 2ITQA 4EK6A 4FIHA 2LAVA 3KRWA 4D4SA 3AOXA 1YW2A 3P4KA 4CZUA 5CWZA 4ASZA 4D1SA 5K5NA 2QOKA 2BRGA 3QD3A 4O2PA 1FMKA 4B8LA 3F6XA 3OWLA 3QTSA 3HLLA 4N4SA 4BB4A 4DE4A 1IASA 5BYZA 3DU8A 2EXMA 3BV3A 3KB7A 2QOQA 2WO6A 4QP9A 3DK7A 4L46A 5IEXA 4C38A 4WOVA 5TF9A 3Q3BA 3IECA 1O9UA 4FNZA 3OW4A 3POZA 4TRLA 1F3MC 4X3FA 3A4PA 5H2UA 4RJ3A 3ROYA 3FMDA 3PXZA 4Q9ZA 3TUBA 2QU5A 3P5KA 2CNQA 4FTRA 4IH8A 2RL5A 3CR0A 3TUCA 2XKCA 4FKJA 3A61A 2KULA 2ZM1A 5AP1A 4AZWA 3CXWA 2QR7A 3O7LD 1U5QA 1P2AA 3WOWA 3OTVA 1O6YA 3CTJA 4M7IA 2VTHA 5DYJA 1MRUA 3MA3A 4F1TA 2HZNA 4C34A 4JMQA 3E7VA 1B6CB 3VJNA 2HIWA 1IA8A 5A6NA 5IDPA 1YXUA 4PTCA 3DT1A 2BFXA 1YDSE 4GIIA 3Q5IA 4BGGA 3ORZA 3P08A 5LVPA 1SMHA 1U54B 2UZVA 4LRMA 2HZIA 4KSPA 2XIZA 1M7NA 2CKPA 4S32A 4RWJA 3W18A 2YDIA 3NEWA 2J2IB 3HMOA 4OT6A 3D7ZA 3QUDA 4TYHB 2WIPA 5BUIA 4XP3A 1T45A 3V5QA 3ZDUA 3DBCA 2J5EA 5DLSA 4BGQA 5ETFA 5IQIA 3D5WA 2XS0A 1YI3A 4J98A 1OGUA 3LOKA 3NCGA 3F5GA 4YNEA 3MIAA 4AW0A 1J1CA 4XP2A 1OGYA 4YJPA 2JDRA 4BDKA 2JDSA 3TG1A 3VJOA 5BVDA 3EFKA 2BRHA 3KN6A 2ZM3A 4FUXA 4C4EA 2IZSA 2CN8A 3EKKA 4QMPA 5LMBA 4C4JA 3NSZA 2OIDA 3P5JC 4EZ7A 2EVAA 2BAJA 3GU8A 5KMJA 1R1WA 2GNIA 3PSCA 4F1OA 2QQ7A 1ZYDA 3WZJA 1OIRA 1OKVA 1ZMWA 2UW7A 3MWUA 3VIDA 4OTIA 3DOGA 4KABA 5EFQA 3OCTA 2FSOX 4RJ7A 3DNEA 4M13A 4KKEA 3D2IA 3OZ6A 4FKQA 3GU6A 4IQ6A 3E8NA 4MD8E 2VWUA 2Q83A 4MHAA 4TY1A 4XOYA 3UOLA 4A9TA 4BHNA 4BTJA 4ZZMA 2JBOA 2B54A 3GU5A 4HYUA 2RKUA 4JRVA 3HV3A 2P2IA 3GCUA 4EWQA 3LCTA 4YLLA 3W1FA 3DJ6A 4KB8A 4XBUA 2PULA 2ZMDA 3QRTA 4AU8A 5CEMA 1PRYA 5AV3A 4G3FA 3WZEA 3FYJX 3MIYA 5JRQA 2YHVA 4O2ZA 3O17A 1BX6A 2XM8A 2FVDA 3R0TA 4UV0A 1KUTA 2GDOA 3FKNA 3ML1A 3IW8A 2J0IA 1JAMA 3H4JA 1WBPA 4ZTNA 3SHEA 4A9UA 4U0IA 3TN8A 2BHHA 2X7FA 3DLSA 2BTSA 4IFGA 2RFNA 3NAYA 5DA3A 5CZHA 4DEAA 2OW3A 4Y8DA 5FG8A 3VS3A 2E2BA 4QP3A 3BE9A 5F20A 5HE2A 4J8MA 4M0YA 2W1FA 3FPQA 3R2BA 4FEWA 4OTQA 4GK2A 3KRXA 1OKYA 1X8BA 3FY0A 4OTWA 5BVWA 4I0SA 4TYHA 4BIEA 2PK9A 4BBMA 4G3DA 1H07A 5CEOA 3KCKA 5H8BA 3EQPA 3GUBA 5HG7A 3C4FA 3ETAA 2ITUA 2CKOA 3NUXA 4JAJA 5CAPA 2J0MB 2C6EA 3VS4A 5CXHA 2F7EE 1XMLA 3KU2A 3R71A 4FTNA 2C47A 4FEQA 1UU9A 3BX5A 4RX8A 1GIIA 1MRYA 4BCJA 2YIXA 5IG1A 3UG2A 4QYHA 1W83A 4IVBA 4XBRA 5I0BA 5JFSA 1ERKA 3TDVA 3QQKA 3QZIA 1Y57A 1R3CA 3CS9A 3TTIA 4ZSEA 4F99A 3NZ0A 3P78A 3MFUA 4J95A 4X6QC 4LI5A 1ZOEA 5K4IA 3MTLA 2G01A 5CF4A 4U97A 2X0GA 2QKWB 3MVLA 4DGMA 5A14A 2R64A 4CFUA 2PZRA 4AGCA 1UU3A 2DYLA 2WOTA 1J7LA 3KVWA 3PY0A 5C4LA 1NVRA 3DQXA 3OROA 2W5AA 2ITYA 4QRCA 5JZJA 3EN4A 4PMTA 4YLJA 5EM7A 4RFZA 3S00A 4ZY6A 3DK6A 4FTAA 1DI9A 1G8KA 2WTCA 3POOA 4BC6A 3Q9YA 3SRVA 4WT6A 5DHJA 4GKIA 2C6MA 1G8AA 3W33A 4KA3A 5AAGA 3C0HA 4G3GA 3VUIA 3QL8A 5CAUA 1QCFA 3HRCA 3OWJA 5ANGA 3P7BA 3B2WA 3N9XA 3ORLA 2Z8CA 5H8EA 4BDAA 3G2FA 1REJA 4U80A 3QZHA 2WXVA 4N57A 5FM2A 4BKJA 3Q4UA 3VUKA 2C68A 3S3IA 2PVJA 4MXCA 2WTJA 3BLRA 3Q5ZA 4V04A 3TJDA 4RIWA 3FWQA 4ZS4A 2GQGA 2W1HA 2WTWA 1OECA 3QGWA 4XV1A 5A4LA 3V51A 4LMUA 2OGVA 1O6LA 2G15A 5I9XA 4MUQA 5EYCA 1ST4A 4UN0C 4AUAA 4G16A 3FZTA 5GJGA 3DV3A 1YHVA 2BIYA 1BI7A 2BIKB 2PMIA 2XCHA 4RC2A 4FV1A 2ZOQA 3RCJA 2V22A 3V5JA 3V8TA 1PKGA 4IWDA 1U5RA 4YNOA 4MCVA 2X9EA 5KKRC 3Q2JA 4AW2A 5CALA 1E1XA 3ZO3A 3D7TA 3R02A 3R1NA 3LCSA 1RJBA 4G6OA 2CMWA 4I6HA 4M14A 2GNFA 3QQJA 4RSSA 5EW8A 2J4ZA 3BKBA 2XK7A 2VTIA 4AOTA 2VGOA 2PPQA 3BYSA 3NLBA 2UV2A 2WKMA 3SOCA 3PA3A 4TWOA 5JGAA 4UX9A 4I4EA 5AV0A 4F9WA 1IRKA 1UKHA 3HDMA 3FZOA 5DRDA 2SRCA 4BIDA 3ROCA 4EJNA 3UOJA 1FVRA 4DITA 2IVTA 3VBTA 3MH1A 4RA5A 3BE2A 2HAKA 2IPXA 4GEOA 5CQUA 5F9EA 5C26A 2W0JA 2B4SB 2QR8A 4LFIA 3K3IA 4ANMA 2R3QA 4QYYA 2WOUA 4EBVA 1YRPA 1NY3A 2JAMA 3QTWA 4XJ0A 3ZHPC 1CKIA 4F0GA 1GJOA 1NA7A 2W1CA 2X6EA 4USDA 5DI1A 4C3PA 2AC5A 2UZBA 4EHGA 1MQ4A 3A62A 3AC5A 3G0EA 3GCSA 4GKHA 3UMXA 3BYMA 2VWZA 4RLKA 4WSYA 3QBNA 4QMVA 3VBVA 2VWIA 1IEPA 2OF4A 5KBQA 3DJ5A 4ACCA 2HZ4A 3FSFA 1PF8A 4QOXA 4O7WA 1XH7A 4K9YA 5EHYA 4B4LA 4L52A 1CSNA 3DBDA 4MQ1A 5LMAA 2XK3A 5LWNA 5FQDC 3D15A 4O82A 3T9IA 3PUPA 3AC2A 5LMKC 1EH4A 5HG9A 3RMFA 4JDHA 4TXCA 4JBPA 3U54A 2OI4X 2HY0A 3SRVB 1TVOA 4BF2A 2BDWA 5T68A 5E7RA 2JEDA 5L6OA 3GU7A 1F5QA 3KXNA 3EQHA 3VS6A 2IWIA 4K11A 3KF4A 4DTKA 3FC2A 2B9JA 4J52A 1VYWA 3E5AA 3KQ7A 3QCQA 1LR4A 3UBDA 4EH9A 5CASA 2B52A 4EHZA 2XBAA 2W5BA 1H08A 4Z16A 5LJJA 4G6NA 4MD7E 3P7CA 2X39A 2CGUA 4ZSGA 5CEQA 4ENXA 2R3OA 2XRWA 3VUHA 4FG7A 2FSTX 3NNVA 2UZOA 3QTXA 4ZY4A 4CG9A 5DEYA 4EWHA 4FT3A 3H9RA 4HCUA 4PTGA 4W4VA 4KS7A 3B8RA 4O7SA 3UG1A 5E1EA 5AIRA 4U6RA 4X2GA 1WBSA 2OFVA 1GAGA 3PXQA 4O83A 4E7WA 4XRJA 4RWLA 5HD4A 2WTKB 3RGFA 3AQVA 1RDQE 2J5FA 3G9LX 3H0YA 3PLSA 2QLQA 4JLCA 5HU3A 4YJUA 3LCDA 4S31A 3I5ZA 4IM2A 4QNAA 2XNMA 3D9VA 4BVUA 5CEPA 2DQ7X 2VWVA 3KXHA 3RNYA 4NTTA 4FL1A 4A9RA 2HZ0A 4YPDA 2XNOA 5K5XA 5C01A 4R7IA 4ERWA 3WIKA 3EQRA 3PG3A 1Q8TA 2VX1A 3Q60A 5FBNC 5BMSA 4FT5A 4K2RA 5CX9A 3EQIA 1AGWA 4IJPA 3MVJA 3L8VA 2QHMA 4IAFA 4F9BA 3NW5A 4RVTA 5IH4A 1BKXA 4KIQA 3ZSIA 1GZOA 2A0CX 3P1AA 2XEYA 2XJ2A 2BZHB 2BHEA 5AAFA 4MNEA 4C4FA 3ZXZA 2QVSE 3TZ7A 4ANBA 3RWPA 4B9DA 3CIKA 3NIEA 4FTOA 4ALVA 2R2PA 2WMAA 3WZKA 2UZLA 4FZDB 5DNRA 3VBQA 4PMPA 4FUYA 3HKOA 4DBXA 4OLIA 4BBFA 3V5WA 1CDKA 3VN9A 4I3ZA 5J1WA 3IW7A 1YWNA 3PE1A 3ID6C 4EONA 4YO4A 4NUSA 5EI8A 4L3LA 2B55A 2HCKA 4WHZA 4G2FA 2NPQA 4FZAB 4I21A 3WYXA 4EKKA 3EL7A 2YERA 4YGAA 5EYDA 4QMXA 2R7IA 4YZBA 3S4QA 2F4JA 3NPCA 3RAKA