3AM1A

Crystal structure of o-phosphoseryl-trna kinase complexed with anticodon-stem/loop truncated trna(sec)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
250
structure length
236
Chain Sequence
b'DIMLIILTGLPGVGKSTFSKNLAKILSKNNIDVIVLGSDLIRESFPVWKEKYEEFIKKSTYRLIDSALKNYWVIVDDTNYYNSMRRDLINIAKKYNKNYAIIYLKASLDVLIRRNIERGEKIPNEVIKKMYEKFDEPGKKYKWDEPFLIIDTTKDIDFNEIAKKLIEKSKEIPKFNISDKIDKETRKIVSEYIKSKKLDKDKIKEVVELRKEFLKKIKKVDADRVLKEFKDLLNSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-seryl-tRNA(Sec) kinase
molecule tags Transferase/rna
source organism Methanocaldococcus jannaschii
publication title C-terminal domain of archaeal O-phosphoseryl-tRNA kinase displays large-scale motion to bind the 7-bp D-stem of archaeal tRNA(Sec)
pubmed doi rcsb
total genus 86
structure length 236
sequence length 250
ec nomenclature ec 2.7.1.164: O-phosphoseryl-tRNA(Sec) kinase.
pdb deposition date 2010-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08433 KTI12 Chromatin associated protein KTI12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.40 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3am1A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3am1A01
2ATXA 1LF5A 2R2AA 4I1SA 1E1QD 5FTJA 4X8OA 2QT1A 4A8JB 3CIOA 4PZLA 3VU9A 3UMRA 4PO1A 2HF8A 2JLXA 1DO0A 1MABB 2ODEA 1Q1QA 4BPBA 2BIFA 1D9ZA 1ZIPA 1AK2A 1LV7A 4B35A 3Q5DA 4O0MA 1Y63A 4LOAA 2PMDA 4UXIA 2YNMA 5JS7A 4YMUA 2OHFA 4A92A 3K0FA 2YKGA 3L0PA 1E0KA 1JBKA 5DN6D 4GP7A 4IOLA 2ZJOA 2ZRNA 3NEJA 3NXSA 1HQCA 2QM8A 2PEZA 4B2IA 2ZR0A 3UMFA 3REFA 1CEEA 4ON9A 5CYPA 3RAPR 4KODA 1KAOA 4A0RA 3Q7QA 2O8DB 1E2IA 3HDTA 3KXIA 2GZHA 3B60A 2HDNB 1OH7A 2IUTA 5KDDA 1RFLA 1DTSA 2RHMA 2YWFA 3I8XA 5AUPB 2XZLA 2IS2A 2EWWA 2WV9A 4C3ZA 2QUZA 2A9KA 1FPMA 2D7CA 1QHNA 3V00A 3WYAA 1UKEA 5BQ5A 4BEJA 5FL7D 2XOKA 4LV5B 1UEIA 4KFUA 4L9SA 1LS6A 4BFWA 5FPHA 5FBWB 3LNCA 1I4TD 1WB9A 5FOUA 2GTPA 2OT3B 5FPYA 1GUAA 2RGBA 1T4GA 1VPLA 3K9LA 121PA 2XEXA 2FV8A 3AGPA 4D80A 1R2QA 2VHUA 3NBFA 3K09C 1N5KA 3E2IA 4Q1AA 4BFZA 2NTYC 2Q9CA 3GFTA 5SZJA 2IS1A 4EPWA 3C7KA 2C03A 4KBFA 2CHGA 2GEUA 4LBVA 3E1SA 2UZIR 3HU1A 3OF5A 5CLLA 4CRWB 4NU0A 3TAUA 2XX3A 4DRZA 1P72A 1HQYE 3TUJC 5IK2D 1TUIA 2V6JA 1ZM4A 1S3GA 3CRQA 2ZVQX 4TQ9A 3DPUA 3CPEA 3A1WA 2E9SA 1NL3A 3F0TA 1OIWA 2NOAA 3PVSA 3VKGA 4ZCIA 3ECCA 2RB4A 3QKSA 2F6RA 2VHCA 4Z8XA 4DWJA 2V7QA 1XEXB 1SKQA 2G88A 3VNVA 2ORVA 4MGZR 1IXSB 4OQXA 1EXMA 2PCLA 4C0HA 2JASA 5HKKD 4YMWA 1CXZA 2FH5B 3UWOA 3RRYA 1ETUA 4PQYA 4EFMA 2F43A 2JLZA 3Q7PA 2FFBA 4HUTA 2R6DA 4Q5IA 2J0SA 1GP2A 2YWHA 1VMAA 3AEZA 2GK7A 4OI1A 4C0BA 2IBMA 3H86A 2OFWA 3ZS8A 1FL9A 1G3QA 3P1JA 4NYMQ 2HF9A 4OI2A 1YR8A 5D3QA 4BASA 3G82C 4CDGA 3KFXA 3QKRA 3I72A 4M22A 3GEIA 1Z63A 2ZYTX 1Z07A 1S1CA 2BC9A 4M1WA 2WJHA 3MMPA 1NLZA 3QXHA 2QENA 3OAAA 4U02A 3THOA 1NMXA 2OZEA 1BMFD 1A2BA 2DBYA 1S9HA 2CLSA 5ANRB 3WMEA 5JI2E 2ZSEA 3TBKA 3C5HA 1UDWA 3WHLA 1MO5A 2KE5A 2J87A 4A9AA 4FI3C 4LSGA 4LDJA 3A4NA 1WP9A 5B64A 2CLCX 1GVNB 4UKDA 4DEYA 1IN4A 5BXQC 4CEJB 1E0AA 4HAUA 3DVLA 5HKKA 1G18A 2BKEA 4NH0A 3EPKA 4GSYA 2C96A 1N0VC 5AJZA 1NG1A 1XXHA 3Q85A 4ESVA 4YC7A 3P4YA 1KMHA 1Z5ZA 1T0JB 2P2LA 1X8KA 1W47A 1YR6A 2X19A 1N6OA 4Q9KA 2P6NA 5KPJA 4FMCB 4NTZA 4BFVA 5FUYA 1O3YA 1W46A 5FBQB 4DKXA 2RMKA 2IA5A 4RD1A 1HT2E 1SQ5A 1N6NA 4US2R 1GTVA 2VP2A 5CIQA 3NHBA 1F60A 3QF7A 1CJMA 1YZLA 1EFHA 2ZR7A 1E2LA 4RCZA 3RS7A 1TEVA 1TU4A 5DHFA 4Q48A 2QQ0A 1TEXA 4MGIR 1GRRA 3LBNA 3AF1A 1PUIA 4DIEA 2OAP1 1UBGA 1A5TA 2XTZA 1KSGA 2QTHA 1G20E 4M4SA 3EA0A 3EG5A 1U94A 2NIPA 3EXAA 4TT3A 1OSNA 2VPPA 1KK0A 4B33A 2F7SA 1VYUA 4UNSA 2WMOB 1NBMA 5FPTA 2F55A 1A4RA 2WZQA 1Z22A 3ZGXA 2NO7A 4DUGA 4QHYA 4DLWA 3TE6A 2FEOA 2MSDB 2NG1A 3BFVA 2GJSA 4BLOA 3AGQA 4WW0A 4E07A 3HP1A 5E3HA 4RD6A 3W6PA 3AVUA 1XTIA 2AXNA 4KCGA 4GFDA 1HURA 1K5GA 5IDVA 4P32A 2QEQA 1MV5A 4POAA 1JJ7A 4CYMA 2GF0A 2J7PA 2OV2A 4AYTA 2QN6A 1CRPA 2QTVB 1G3MA 1ZD9A 4L4UA 3I1FA 4KXFB 2JCSA 5J40A 1G5TA 2CVHA 3LFUA 2RH5A 3HYRA 2IS6A 1YRAA 5JFGA 2WWWA 3OEHD 1ZYUA 3KKNA 3MRSA 1Z3IX 3CR7A 1OE0A 2A5JA 3NG1A 1G1MA 4FWIB 2P6RA 2XJ4A 1G5RA 1WBDA 5EP2A 2C77A 4EPRA 4KLNA 2GCPA 621PA 2H7VA 1YU9A 2IT1A 2X2EA 2ZRLA 5G53C 2GEVA 1KZ7B 4NCHA 4JVNA 4C0KA 3I61A 4Q01A 1P5ZB 3NIBA 1SKYB 4I1UA 3MG9A 1I2DA 2D74A 5B30A 3B9PA 5FOTA 4XTRA 5L3QB 2IWHA 1OFUX 5CITA 3PUZA 4IJMA 3U5ZB 2GXAA 1EWQA 1NBMD 1YZGA 3L0SA 4MRNA 5FPKA 2ZM5A 2P65A 1SVWA 4MUBA 2VYFA 2ZANA 1HV8A 3UPUA 4IEEA 3SE0A 1UPTA 4ABYA 1P75A 1Z6TA 3HPQA 2EYUA 1W2GA 3K70B 1CJTC 4JLJA 5JRJA 3TAHA 2CCGA 5FTNA 1NIJA 4M1OA 3FHOA 1SGWA 1XTQA 4IFEA 4KYUA 1YZUA 3KB2A 3MWKA 1KI7A 2DB3A 2YOGA 5GJWC 2KB0A 1VCNA 4PPFA 2DFTA 2P67A 2Q6TA 3MSXA 1N5LA 2JLUA 3KQUA 3RYTC 1YHNA 3OEHA 2PMKA 1N3BA 2OG2A 5EE0A 4LZZA 2ZI7A 4MYTA 3NVAA 1TAGA 1N25A 4IOMA 4UNQA 1P4SA 4NKRA 2ZRHA 3GQBA 4OI4A 3T61A 3RWOA 1M2OB 4AWXA 4XWOA 5AUNB 4A6PA 4CEHA 3K9NA 2FNAA 3TH5A 4TYYA 2ZJ8A 4HLQB 3SS8A 2ZE8A 1NKSA 4NYIR 3GLGB 4O3MA 2QP9X 1DARA 5DO9A 4PSVA 4EJSB 3OHMA 4G5SA 2V9PA 5BN5A 3ADDA 4EDHA 5K8LA 2BVNA 1XEWY 3KQKA 1W0KA 4KV9A 1U0LA 4KAXA 2AD1A 3ZLJA 1R8QA 2NGRA 5L3SA 2ZQ5A 421PA 2NZ8A 2W0MA 1P73A 3LVRE 3PEVA 1QRAA 1DAHA 5EQTA 3WXMA 2VQSA 1T6NA 3QIAA 1KDRA 4NMMA 5FL7A 4Q1BA 1E2NA 4Q1FA 1NBME 1AA9A 1G17A 1M34E 2FX3A 3UIEA 1U9IC 2ODWA 4KVAA 3OIWA 1IONA 3U6KA 4DIDA 3K09A 3B1VA 2XXAA 4BEBA 3BB3A 2UZ3A 3CBQA 2AKYA 1OYWA 3X1ZA 4M1MA 2HEIA 4V0LA 1XTSA 2FF7A 1GIAA 4M9ZA 3NEYA 3FFAA 4LBZA 2OCYC 3K70C 4GT1A 2W2XA 3LO5A 5TXGA 1CTQA 2GILA 4QL3A 4OYHA 2AD5A 2ZI5A 4YXWA 4AG6A 3PV0A 2ONKA 2DR3A 1P60A 5FTKA 2YINC 2V7QD 1U90A 4Q1EA 1JI0A 1NG9A 4M21A 3GJXC 4BRWA 2JAQA 1OYYA 4EUNA 1U8ZA 3MGCA 4ARZB 2ZREA 3FMPB 1IQPA 4Q4HA 2R8RA 4A8JC 3BORA 3DZDA 1XJQA 1FUUA 3GJ3A 2VRWA 2WKPA 4OQFA 2ZRDA 3LVQE 2A5YB 2AL7A 3V4FA 4AIIA 1ZUHA 2IEYA 5E95A 5E7JA 2MSEB 3ZVLA 2Z4RA 3IDQA 4TZ6A 2I3BA 4DLRA 4L15A 1DAFA 3T5GA 3ETLA 4E09A 3FHTA 1II8B 3KZ1E 1RRFA 1AQUA 4B6FA 4G5QA 1XD2A 3AP2A 2DCUA 5FR2A 4NPHA 4IHQA 3UANA 3C14C 5FBVB 3KX2A 3GEHA 4TL7A 4AKGA 1BMFA 3A4MA 1X1SA 2ZS9A 2CNWA 3WNCA 3CX6A 3BB1A 4A4DA 2ANBA 3IHLA 4GOKA 2ZROA 3CRVA 3RWMB 3CRRA 2G1JA 4RCYA 1QHHA 4PAMA 1OW3B 4DCSA 2HXYA 4V0ME 2QPOA 5CM8B 1H8EA 3JZMA 2PX3A 4UNNA 3WP0A 3AF0A 2OBLA 1IOZA 3K9HA 1X86B 5G41A 3H4MA 4YONB 1TL7C 1VECA 4BZXA 1NVWQ 4CW7A 4TZ0A 1K5DA 3AVXA 4JL8A 2J0UB 5DE3A 4RFVA 4IW3B 4XH9B 1DS6A 1TPZA 2EYQA 3K0CC 5IRCD 4MUAA 4OHZA 1OT3A 2FFHA 3GP8A 1G8FA 4QC2A 4A2PA 2C78A 3FMOB 4JL5A 3T1TA 2ZI6A 2GXUA 4R2HA 4YQFA 1XTRA 3TMKA 2ZSBA 4URYR 3A37A 3O8CA 3LA6A 1VG1A 3DDCA 3MLEA 5SZKB 3VTKA 1YVDA 2QP4A 3WHKA 1KO4A 4MGKR 4TTPA 2HUPA 2WJVA 1G64A 4HB4A 5SZIA 1EESA 1T9HA 4DDWA 2R6GA 4C0AC 1T3SA 2VP5A 2CK3D 4RFSB 3LW8A 5JJIA 3C4JA 2CCJA 3KJGA 4Q9HA 4YMTA 2B21A 4DT1A 3LAWA 5ELXA 2FFQA 2QE7D 4HB0A 4B76A 1XXHE 2HLDD 1DEKA 2JDIA 3AVPA 1NN1A 2ZETA 1CR1A 1P3JA 3DKVA 3U3KA 4KSBA 4GRAA 2Z0MA 2YC4C 1VIYA 3SN6A 4ACAA 2FOLA 1KO1A 2GCOB 3M1IA 2C99A 2O8EB 1Z47A 5L3VA 1CJVC 4TWZA 3NDBB 5KYKA 4B6EA 3IEVA 2ZUCA 2GKSA 3GLHB 4RD3A 3R8CA 1OHHA 2FDCA 3VX3A 3NBYC 1LNZA 2WICA 4ZDWA 3A6PC 2FPMA 3AP3A 3MAAC 4MGYR 4F93B 3KFVA 2J1LA 1TF5A 3R8FA 4TL9A 4A6XA 1FNMA 4URUR 2RGAA 5JHHB 2J5XA 1U2RA 2F1RA 4AURA 3IHWA 3N2IA 2P3SA 4FMDF 4EJSC 1XD2B 2G3YA 4YXWD 5JS8A 1F2UB 4LYFA 5J47A 2B8WA 3PQCA 1G9XA 1SVLA 3TRFA 3AV0B 3Q9LA 2H8KA 1XMSA 2J0UA 1DAIA 3KTAA 3CH5A 1L2TA 4JBXA 4QBHA 2IXEA 4M9XA 3AF2A 3RRMA 2ZUDA 5FUXA 3BGWA 2IYZA 4W5HA 3P32A 4KU4A 4S2EA 1E2MA 5FBRB 3LLUA 1MO3A 4DLSA 5FBLB 4PHFA 2PZFA 3V4RA 1VTKA 3HU3A 3Q72A 2DY1A 4LJAA 4ZDIA 1GL9B 2G77B 1W4RA 3QUSA 5FFMA 1UBEA 1AS3A 1D2EA 4ZCLA 3QPWA 4QG7A 1NJGA 2CEAA 2OLKA 3M6AA 1H8HD 2ZSAA 4US1R 2YC2C 4FWTA 3PEUA 3X1DA 2JLWA 4LYJA 4B75A 4FN5A 5CJPA 1AN0A 5H8WA 4F7WA 1OH5A 2BJVA 5BYKA 3BC1A 2WWFA 2B7CA 3W8NA 1FQKA 1GKYA 1MOZA 3A36A 4B2LA 2CL7X 1EK0A 3QXXA 3U61B 1EG7A 1U8AA 4TQAA 2BM1A 4NP6A 1ZM2A 4CEJA 2A7QA 3EASA 4ZI2A 2ZU0C 3EPJA 4OBEA 5HTKA 3U3RA 3GLIA 1R0XA 2GESA 4TMXA 4AKHA 2FZLA 3VFDA 3CF0A 3AVQA 5AJVB 5AJWA 4NYJQ 4TQUS 1D9XA 4PZZA 2D4HA 3PUXA 5JEDA 2AN9A 2RHDA 4G3XA 2OCPA 4BECA 2GAAA 3R9XA 3C15C 3K0CA 2XZOA 3Q5EA 2XTNA 4DB2A 1H8HA 2GETA 1OPXA 2LWIA 1JQJC 2HJGA 4LJYA 5LBIA 4YMVA 2IYWA 2Q3MA 1H65A 4HZUA 2JJ2D 1QVRA 2ZU6A 4JIMA 1JEDA 3BK7A 1US8B 4A0FA 5EXSA 2QPTA 2PLFA 2C9OA 2XNDD 2GNOA 2GK6A 3UG6A 2YWGA 4DVGA 2FA9A 3LV8A 2ZRBA 1EX7A 3ND9A 5AR1A 1RPZA 1KI1A 1W5SA 3DM5A 1XMVA 4HDQB 1KO5A 1NSFA 3QENA 2XNSA 1UKZA 2ZPTX 2JIZA 4PC7A 1I4LD 3N2EA 1R8SA 3C41J 1KHTA 2WWYA 3KXLA 3U3JA 3ZJYA 4EFNA 1EFRD 1WBBA 4PC6A 2BEKA 3AVVA 1NN0A 5AWFC 4EPTA 4IDPA 4R71A 2A30A 4GMDA 5GJVC 3S1AA 3O8BA 2IL1A 2VP9A 2HCJB 2E1RA 3PCRB 4PPGA 4ASUD 3QPUA 4FMBB 2IX3A 2BBSA 2KBFA 3ZDQA 1OLOA 2V55B 1ONBA 1GKIA 3ZD7A 1D2MA 1WMSA 4NONA 3EZ7A 2ZS8A 3TR5A 4I99A 1TX4B 4XVRA 1IJEA 4TSFD 1KNXA 4CEHB 1KZGB 4M9SA 1ZMXA 4PQRA 3CR8A 3N5CA 2Q0HA 1OXXK 2WM9B 5EUMA 3NC1C 4FMDB 5AK0A 4JLKA 2BMFA 3CX8A 5KDLA 4PO8A 1S1MA 4ZV4A 2CL0X 2GJAA 5A5GA 1GWNA 3BH7A 3RS4A 4LK2A 3WNBA 2BMDA 3GJ0A 1WDTA 3KJIA 4ZIRA 4MH0R 1P9RA 1YR9A 3QVVA 3GLIB 3HR8A 2H57A 5A4JA 1KTVA 1OIVA 1J8YF 2A5GA 4MQBA 1AJEA 1SVKA 2GVZC 3EA5A 1XCGB 1PVOA 4D0LB 4TYNA 2XJ9A 5KSZA 5L3QA 2IYLD 2Q3HA 1A82A 2VHJA 4U7DA 1A1VA 3GMTA 2YOHA 3X1YA 1E2GA 3MD0A 4MDEA 1MR3F 1NSTA 3CPHA 2AR7A 2ORIA 4JLPA 1CS4C 5L8VA 5SZHB 4MKIA 4TLDA 1D2NA 5EXPA 3AVTA 2W83A 1KNQA 1ZJ6A 2EFCB 4EQ6A 2QU8A 4URZR 4BFTA 5HZKA 3LRPA 3C8UA 4Q9IA 1KJYA 1N5JA 2BOVA 3VR1A 4BZQA 3G0HA 2HYIC 1LF0A 1VKJA 221PA 3QVUA 2FSHA 3U7GA 2GRJA 1KI2A 3I32A 4KJZA 3GLFA 1FFHA 8OHMA 5EP3A 1Q1EA 1JECA 4IVQA 1XD9A 4CEIB 3ZVRA 1EFUA 2HCBA 2W00A 2QTFA 3EW9A 4DT1B 3QEOA 1AGRA 4NYIQ 2RGEA 4B47A 3ZH9B 4GL2A 2UVQA 3EWAA 3AKDA 1BYUA 1FP7A 1Z0KA 1CRQA 4ZDJA 4KVGA 3ADCA 3QNUA 1R0WA 5HZHA 4Z8YA 2IYSA 5BN3A 3TUIC 4DLTA 2IYVA 4LHWA 2ZE7A 1RYFA 4Q4JA 5F98A 4QJ5A 1AS0A 4C30A 1W1WA 4UNPA 4HYYA 3RS0A 4ZO4A 4IFBA 3U44B 4I81A 4Q4AA 1OJLA 2QMHA 1T3LA 1C1YA 1PV4A 4L9WA 4AC9A 3GEEA 3A1UA 1D6JA 1ZC4A 2J7KA 4QGAA 1E0JA 3T35A 721PA 5KOYA 1JPJA 3JVVA 2EW1A 3DKPA 1SXJA 3F5FA 3BH6A 5JJKA 2F43B 1KDTA 3DL0A 3HU2A 1VYTA 3KUDA 2YYZA 4OQNA 1RRGA 1SXJE 2ZSDA 4KFRA 5G3YA 3TLXA 2LCFA 3ONWA 1V43A 1ZD8A 4HI0E 1GFIA 1E2HA 1T5IA 4IVPA 2F1JA 1WCV1 4M0LA 1ESMA 2NPFA 3RSOA 3LW7A 2R6CA 3PFIA 3QKSB 3MUFA 4Q7MB 5EE5B 3SYLA 4XJXA 5GADl 2F1HA 1MRNA 3BE4A 5J4VA 5IHPA 2JLQA 4HLUC 3RNLA 4OJQA 3T12A 3MJRA 4XSHA 2YWEA 2NO1A 3SBDA 3MWYW 4S35A 1QG2A 2QRZA 3SQWA 3CM0A 3CF6R 4D4MA 1S3SA 1Z28A 4QRHA 2C9YA 2GXSA 4TLCA 1CR2A 2E87A 4OHYA 1QDEA 4IEIA 1HUQA 2J3EA 2OEPA 3BXZA 2D2FA 3VQTA 2FN4A 3H1TA 3WNDA 1G8PA 5LDDC 2QNRA 2ZYWX 4ZKEA 5B57C 4BFSA 3FKQA 2PT5A 2QA5A 1ZNWA 3O8DA 2OCAA 4FIDA 5BYJA 4P3YA 2FU5C 1W48A 4H1VA 2C2HA 4LCBA 1XEXA 2G0TA 3WBKA 1OHHD 4QGFA 1YQTA 3SJBA 3E70C 5H68A 3ZD6A 2LKCA 3LBIA 1II8A 4II7A 4Q02A 5DSZA 4QFMA 1E98A 4OHWA 1XZQA 3R9WA 1M6NA 1Z29A 2VF7A 4P4SA 2KBEA 4TL6A 3I4LA 4UXJA 4KSCA 4AG5A 2IUSA 3C16C 4Z1MD 2QAGA 1LFDB 1P6XA 4M1YA 4P4UA 1GL6A 2CBZA 1EFCA 5DYGA 2Z43A 2OFXA 2SHKA 3TW8B 1Q0UA 2BJWA 4CIDA 5FR1A 2EU8A 5JCPA 5JJLA 1CJUC 1WF3A 4Q18A 2BV3A 2DPXA 1PLKA 4JT4A 1J99A 1MH1A 2A5DA 4HAXA 3BB4A 4GZLA 3GLIE 3F3YA 3BJIC 3R7WB 2GJ9A 3QKUA 4NL4H 3SJAA 2FZ4A 3IQWA 5E4FA 1NRJB 2B6HA 3GFPA 1YRBA 4RY2A 1JAIA 4XIGS 3U4QA 4OQMA 4MYHA 4N1AA 1MRSA 5CB6A 4HAWA 5UKDA 1YZKA 2WWXA 4GDFA 1EFRA 4D0NA 2QQEA 1KSHA 2FGJA 4U5XA 1NVUQ 1R10A 2GWHA 4ZPXA 1Z0DA 1VG9B 4HAVA 1A2KC 1EWRA 3VR3A 4BFYA 4PPNA 2XITA 4PC3A 2V8OA 4D26A 2AWOA 3DOFA 4WXPA 2B92A 3K70D 5KNDA 3I73A 4BLSA 2QM7A 1OXSC 4Z1MA 2VA8A 4LJ5A 1HH4A 3FB4A 5DGXA 1HE8B 4TSFA 2OE2A 1OF1A 3W3ZB 2AFIE 3LDAA 4JSYA 1RW4A 1FMLA 2HT1A 3EC1A 1SXJD 3CPJB 1YJ5A 4NHOA 4ILEA 1ZW6A 1F5NA 1Y3AA 3DO6A 2ZJZA 5DI3B 2MSCB 3ICQB 5KNBA 5FI1B 4Q7LA 2BBTA 5LD2B 2R44A 4WZAE 4MRPA 1D5CA 1W49A 4NYMR 1NI3A 1ZM7A 4A82A 2I1VB 1W4AA 1DVRA 2WKRA 1ANKA 1ZRHA 4O25A 1P9WA 2JJ8A 3B2EA 3QF4B 5DI3A 1NY5A 4DLYA 1ZC3A 2OLJA 2JJ1D 3L2OB 1E9CA 4Q1DA 4LUCA 4D6PA 3L82B 4LJ7A 2V6IA 2WSMA 1G4AE 1SHZA 3MWLA 2V4ZA 3ADBA 3UXMA 1KI6B 1SHKA 3SFZA 2V3CC 3HYTA 5F2EA 3L8YA 1XB2A 3TKLA 3SR0A 3TGPA 4LHXA 1ZUIA 4HZIA 3AVYA 1UDXA 1GILA 4URXR 3W34A 1FZQA 2VBCA 3FKSD 3EZ9A 3LXXA 2RGDA 1EFTA 4LHVA 4N0EA 1HTWA 3T1QA 4O2LA 2I1QA 4Y0AA 1W0JD 4Q4JB 1Q22A 4MYCA 1LW7A 2CVFA 4EFLA 3KQNA 1TNDA 4PAQA 4LWZA 1NY6A 1X6VA 1GOTA 2YZ2A 4XVQA 1DPFA 3DM9B 3RS3A 3TNFA 1RVDA 3J81k 4HATA 2IS4A 2HT6A 4C0SA 2Q3FA 1KY2A 2PLRA 2GA8A 4Q47A 2HJVA 4WZ6A 5JEEA 1P62B 4RKFA 3ND8A 4M8NE 3SFVA 3U3OA 4Z54A 2PZGA 4FW9A 4V03A 1ODFA 5HE8A 3P26A 1UBCA 4RKEA 1DO2A 3WRYC 3REGA 1E9EA 2ZTSA 4ERNA 5TMPA 1VG8A 1GSIA 2HV8A 2XZPA 3IKJA 3SJZA 1U8YA 1E6CA 3GLFB 3Q8XB 1NN5A 5TB5A 1FX0B 4HUQB 4AK9A 1R5NA 2EFEB 2N1BA 4A0HA 5C2JB 1ELOA 1SKYE 4JLBA 4A0GA 1XD8A 2ZI3A 4QXAA 3VMFA 4YDHB 4PHTA 5K8TA 1Q44A 3FKSA 1Z8FA 1KI4A 4LYHA 3W3AA 1Z2CA 1FNNA 2ZXUA 1TUEA 4YLGA 3PEWA 1YZTA 4OL0A 1QZXA 3DMDA 5JECA 2WSSA 3FVQA 4PZYA 5EE9A 1LS1A 5H70A 3EIEA 4JLAA 1L7VC 4LC1A 2BDTA 1H8ED 3C5CA 4TMWA 2H18A 4Z51A 2VHTA 1UF9A 1XP8A 4LJ8A 1RE0A 4ZDKA 3LH5A 1GZSA 5EE1A 1OH8A 3I3SR 4DUGD 2DWPA 3CW2A 4DLVA 2CL6X 1E69A 4URVR 1G19A 1XXHB 3IPXA 4FD2A 4A1FA 2IXFA 5FOSA 3OFND 2DFLA 4AYXA 3PG5A 2G6BA 1N2CE 3W6NA 1VCMA 2ZJ2A 4CF7A 3TR0A 4ARZA 3HR7A 3JVUA 2ZYUX 1AZSC 4ZKDA 4XSGA 5J4YA 5FOVA 2ZRFA 2WOJA 4HDCA 2IK8A 4JYBA 3ZQJA 4LPKA 4DSOA 2W6ID 2P5SA 3CWQA 4OI0A 2YVUA 3FMIA 5DISB 4LV6A 1G8YA 4V02A 2FSIA 3CNOA 1XF9A 1ZD1A 3WMFA 5AJXA 1OKKD 4BGDA 3E5HA 5JRZA 2ZI4A 1KKLA 2PBRA 4OQLA 1VCIA 5JLJA 5TARA 3U7EB 1XFAA 5JSZB 4LRWA 3AKCA 2BEJA 3TSZA 4JT2A 3K53A 4C0JA 2H16A 3GLGA 3QSYA 1Q20A 3GD7A 3KUCA 3EWSA 2PCJA 1R0YA 4RD2A 1WRBA 5AJYA 3RS5A 1KDPA 1RZ3A 5D3MA 1TADA 3X1XA 2QL6A 4EAQA 3RRZA 5J4KA 1YR7A 2GZAA 4MRRA 2J45A 2ZJAA 4WOPA 5KPDA 1F6BA 3VHXA 1MKYA 2VO1A 3FGNA 3SDZA 5DHAA 3QJYA 521PA 3TW4A 4TLAA 5JSZA 2V54A 1S9DA 1B23P 1XJCA 1IAQA 4BZPA 5F9HA 1A7JA 2F3RA 4QNRA 5CDFE 2D7DA 2ATVA 1XEWX 2CNWD 2FGKA 2ZR9A 5FPSA 1VG0B 5FH9A 1RJ9B 4WVFA 5F9FA 3NWJA 2X2FA 3PIRA 2ZAMA 1X8LA 3IO5A 2H17A 3B78A 4TT3D 3RANA 3THWA 2PJRA 1ZVQA 5J5CA 1G8HA 4BRUA 2CLDX 2YOFA 2DWQA 3EIHA 1Z6YA 3B1YA 2ZS7A 1DG1G 3PUWA 1E9DA 1CF4A 5C18A 3CRMA 4WZBE 4G5OA 1I2MA 2QI9C 5D3MB 1JJVA 3FHCB 3ASZA 2R62A 2ORWA 3Q3JB 2TMKA 5EP1A 3LQRA 3TIFA 2QGZA 1E2DA 2O5VA 2A3RA 2ZIAA 3CZPA 5KDOA 1JR3D 5CK4A 2CCKA 1JXMA 2OCBA 4DSUA 4TMVA 5C1BA 1E94E 4MYUA 3BERA 3L0OA 3LD9A 1Q3TA 1LTQA 2X1VA 1TU3A 3KKQA 4NCJA 3RC8A 1Z6GA 1KYIA 2P5TB 4I1OA 1AZTA 4NE2A 4OHXA 5DH9A 3SBEA 4BWYA 3EZFA 3L43A 4KLZA 4XOIA 2WAYA 4GP6A 2F3TA 3D8BA 1R4AA 2Z83A 1NKTA 2XOKD 4A2WA 3I8SA 2IUUA 2JDID 2CMKA 2IF0A 1Z0JA 2OBNA 4P33A 2CHVA 3A1TA 1E32A 2GAOA 3W5IA 4CEIA 2XB4A 2IHYA 4PHHA 4W7SA 1J7KA 3QKTA 2ECKA 1KSFX 4LBWA 4X8HA 3PR1A 1LB1B 5EE3A 3VU9B 1RRPA 2H5EA 3KKOA 2ZRMA 3SYNA 1S0UA 1W4CA 2W2TA 1ESNA 4GNKA 2QBYA 2W2VA 2OESA 5GVRA 3W5JA 2WKQA 1GL7A 4PO9A 1GNPA 1KI3A 2C9CA 1E0SA 2G83A 3TQCA 1C4OA 4KI0A 4F38A 3BH0A 4QJ4A 2QMEA 2EWVA 1HEIA 3AQ4A 1SXJC 1E1RD 4KHZA 3SI7A 5EXXA 2BHRA 4DCVA 2EFGA 3AKYA 1DG3A 1DADA 2OAQ1 1GM5A 1KDOA 1KI9A 3PUVA 2QMUA 1E2KA 5DLQC 4D4KA 1RKBA 1VHTA 4AKIA 2JJ1A 4IDQA 2J41A 4JVLA 2BM0A 3N70A 1E4VA 3HPRA 4PC2A 1N6RA 2J59A 5JCZA 5B58C 3AVWA 1NNEA 3B82A 1JPNA 3K0FB 4BQSA 4LJ6A 4DXAA 5C46F 3K8YA 1WXQA 3FYHA 1V5WA 3QXSA 4RZUA 5CM9C 4DDTA 1IY2A 4Q7KA 1KO7A 4MITA 5LPNA 1P2UA 1ZBDA 1S8FA 1W0KD 4PANA 2JLRA 5CJ2A 3U6BA 4DLUA 1IN7A 3ASYA 3K0SA 3B7GA 3ZZTA 1FOEB 3AF4A 2J7PD 3NH6A 1NP6A 4TYQA 2GBLC 2PT7A 4F4JA 4RZ2A 1R7RA 1NN3A 2FFAA 2IEZA 2IYUA 4JMPA 4D81A 1G7RA 2EFHB 2N46A 3EAQA 3K0EA 3WYFA 4D2IA 1L8QA 3FFBA 2DWOA 2NMVA 3RABA 3CRW1 1TF2A 821PA 3M0EA 2I4IA 1SULA 3MWJA 4LGMA 2QG6A 2GCOA 3EPLA 2RGNA 2VF8A 3SQXA 1FTSA 2J46A 1TQ2A 4OJKA 2B7BA 3CKLA 1KKMA 3BBPA 3QBVA 5CIWA 4AD8A 4FCTA 3GJ7A 1KI6A 5FOWA 1G3UA 5DN6A 1XPOA 1P2VA 5KSPA 5JZVA 2Q9AA 4HZUB 1W44A 2LKDA 4RFSA 1Z6AA 4TLEA 2FMXA 2RGNC 1C9KA 4H1UA 1UBFA 4L5BA 3U3MA 1NMYA 1BYIA 5AUOB 5FTLA 1JEEA 4L8GA 4BLPA 3EZ2A 4DDUA 4GOJA 4DCTA 2QSYA 4GOXA 1TF7A 1J8MF 1CIPA 1JR3A 2F9LA 5LB4A 1U99A 1AKEA 3NC0C 3SHFA 3UMSA 2O0HA 2WSSD 4JLMA 2KWIA 1PLJA 2WIBA 3BRWD 2CHQA 2A78A 1GAJA 4JLNA 3ICEA 1IXZA 4FMCF 5CB8A 1Q3HA 2XNDA 3NHAA 3FTQA 3WYGA 4QM7A 6Q21A 2GJ8A 3CZQA 3X1WA 3BS4A 2H1LA 2VL7A 3RVBA 4PSAA 1KK2A 4A2QA 4F92B 2EQBA 2GDJA 4V0MA 3SOPA 4JBYA 3GFOA 4TLBA 1XJ0A 1UADA 4E03A 1KI8A 4FCVA 4J0QA 4PHGA 2XSZD 4PC1A 1T8UA 1Z2AA 2W6IA 2ZRPA 5GVSA 2WWIA 2YV5A 3VR4A 4BLQA 3DOEA 4F4IA 4F91B 3ZVMA 1DAKA 1CP2A 4UJ3A 3SZRA 3GJ8A 1QHYA 2FPLA 1FUKA 2RKOA 4HEJA 4JLVA 1CULC 2FG5A 3VR5A 4DLZA 3V9PA 5JWOA 2PH1A 5EXTA 1IBRA 4G0NA 4P4TA 1KY3A 2P6UA 1CLUA 1E1RA 3OE7D 1G41A 4B3DA 5JWHA 4M53A 3O47A 4DBLC 1FX0A 4HUQA 1E2QA 1F2TB 2ZE6A 1IJFA 1ZINA 1CU1A 3K0AA 4WIAA 3B8HA 3PJRA 1DBSA 3K1JA 1MO4A 2WJIA 5BN4A 2PJZA 5CLQA 1NMZA 3B5JA 4C0QC 4TMKA 1PUJA 3EC2A 2O8FB 4TTQA 3IPYA 4JVMA 1N6PA 2Z6VA 5JI3E 2AKAB 4TTRA 4C2UA 3W9YA 1DE0A 4DEXA 4QJ3A 1U9IA 2JGNA 1YE8A 3ADKA 3B85A 4N0DA 1T0HB 2P0EA 1XCMA 3CF2A 3CX7A 4PFSA 4D4JA 1W7AA 3RLFA 3CB4A 1RRCA 2WHXA 4OK5A 2WBLC 4EJSA 2YJTD 5JHGB 1N6KA 2NQ2C 3OESA 4QOSA 1XTJA 3AM1A 1XPUA 3TK1A 4JZKA 3FDIA 3OIUA 1ZNZA 2IYRA 3VHLB 2O8EA 2OXRA 3SNHA 2VTKA 3OE7A 5HPYB 2C5LA 3F8TA 5DYIA 4B43A 2VH5R 1G6OA 2GCNA 3ZVNA 2O8BB 1QHGA 4BE7B 1YKSA 5CYOA 4V0OA 1Q57A 4Q9LA 3OFNA 1T3HA 2ZJBA 4FXPA 4CT5A 3CO5A 2O0KA 1G6HA 2KJQA 4C0LA 4PTLA 1MABA 2VSXA 2X77A 5G40A 5L3RA 4OK6A 2ODNA 3U60B 1DAMA 5P21A 4PQFA 2GBLA 4KFTA 1G16A 1LVGA 2CE2X 1AIPA 2QY9A 1M8PA 2ZJYA 3GLHE 4FCWA 3QEJA 4DZZA 4IRUB 5GJCA 2D3WA 4CGZA 3OZXA 1OV4A 1Z0FA 2ZE5A 1N0WA 2FEMA 3PUYA 3GLHA 3KL4A 2FSGA 1OXVA 1WE2A 3KB1A 3HJNA 3U7HB 2BKUA 1ZM3A 2QMOA 4NBSA 1DAEA 4TYWA 3TVDA 1Q1BA 2C98A 4QGHA 1E9SA 3CNLA 2MMGA 2Q21A 2O8BA 3T1VA 1COWA 3AB3A 1WQ1R 1XNJA 4JBWA 1E9FA 3FMFA 2Y8EA 2ERXA 2REOA 3I62A 3AP1A 4V0NA 1UKYA 1II0A 5KO2A 1QHHB 5EZ5A 2R6AA 2VP0A 2WPDD 1NVVR 2XAUA 4W5JA 1N0UA 1G3RA 3KJHA 4Q21A 2K5UA 3LLMA 4P31A 4QBGB 2WTUA 4JYCA 2IYXA 5LD2C 1RYHA 1UKVY 1N6LA 2FPKA 2DFNA 3QG5A 1GKUB 2KI5A 2NO0A 1XU4A 4XVUA 3ZS9A 1S2MA 1XPRA 2WWHA 1OXUA 3NTUA 3T06B 2ANCA 1B0UA 4LBYA 1S96A 5HCNA 5K8IA 4HB3A 2D62A 1G8GA 4B73A 3IEUA 2QE7A 4MRSA 1KAGA 1KIMA 2HYDA 3IQXA 4DSTA 3L8ZA 1IHUA 1COWD 4C9BA 4RVCA 1CR0A 1BKDR 4I4LA 4P4SB 2CXXA 2NZJA 3I92A 3GJ4A 1J70A 1W36C 4M1TA 1QHSA 1VDZA 2ZJ5A 2BBOA 4LY6A 1OH6A 1I4DD 3ZQ6A 1M7GA 2VLIA 1K8RA 1T91A 4TN1A 4R9UC 4B3BA 5KSOA 3MFYA 1J90A 3LX5A 1P7CA 1E2JA 2QPAA 1E4YA 2N42A 3CUEF 3K9GA 3TJZA 1M7HA 4OHVA 1AS2A 2GVDC 3A58B 2BCJQ 1ZU5A 3BOSA 4JL6A 3KKPA 3THXA 1ZCAA 2CDNA 3LY5A 2IYTA 2OFOA 4O2RA 2HXSA 3R7WA 5B2ZA 1N5IA 5DI9A 1HA3A 2FWRA 2ZRAA 1FTNA 3IGFA 5H1YA 4M1KA 3LXRA 3BD9A 4E22A 3PENA 3SC3A 3K0AB 2WIAA 4BLRA 1Z6XA 3BIFA 1F2TA 4NZYA 1NVXQ 2QAGB 1Q12A 2DFKB 2WOOA 5CK5A 3THWB 1R0ZA 4N3NA 1GNQA 1P9NA 4B48A 3G5UA 4KO8A 5HE9A 1X8JA 3MCAA 4MA4A 2YHSA 3S1AB 3PXGA 4ZIRB 5HR5A 5A0FA 1VHLA 3A4LA 2AK3A 2IW3A 2OXCA 2IF2A 4QGGA 3MJHA 2A2ZA 2OO7A 2BWJA 2VSOA 1II9A 4GBMA 1LY1A 1BOFA 4B32A 4B3GA 2QP3A 2C95A 3ZZUA 3ZIAD 2GXQA 4XTCS 5DNYB 3QKRB 2NO9A 1E3MA 2ZI9A 4NCIA 1GNRA 3X2SA 1AM4D 3T34A 4P0TA 1EX6A 4MRVA 3TQFA 2F9MA 4UJ5A 4HDOB 2ZRIA 3D31A 4B44A 3B6EA 5KUTA 3W6OA 4RSGA 2CK3A 2QRNA 3DEFA 4JS0A 1QHXA 4B3CA 5HCIA 1AGPA 1W0JA 1DAGA 3OEED 2RGXA 1M74A 4XWAA 2XB2A 1E2EA 2OUKA 1IN5A 1E9AA 5JMTA 3EPHA 3KJEA 3TSOA 3QG1A 1NJFA 3A8TA 4YMSA 1BIFA 4EPVA 1FMJA 1Z83A 1UM8A 4Y0VA 2G0NA 2XSZA 4LHYA 4PPQA 4HLCA 2AHOA 4GMXA 5TVKA 2WPDA 1QHIA 4B2PA 3PITA 3AH8A 1ZP6A 1BO6A 2O52A 3B1XA 4M9QA 2OM2A 3NKVA 2OSBA 4IXMA 1R5BA 2R6FA 4I1VA 2EFDB 3CH4B 4Q66C 3QQ5A 4RD4A 3W90A 2QAGC 5EZ6B 1NLFA 4WBSA 4HAZA 1G7TA 1JNYA 4DHEA 1E2FA 1US8A 3RSLA 1R6BX 1ZAKA 4DB4A 4PX9A 3O8RA 1TMKA 3VR2A 4MKFA 3A1SA 3A1VA 3NBZC 1JAHA 1L4YA 4RJLA 2IWRA 4DDVA 2VSFA 4MKHA 3KQHA 3FWYA 2OBMA 4G01B 4G5GA 1KK3A 2AWNA 3UKDA 1GDDA 1OFHA 3M4YA 1JB1A 1ZCBA 1E99A 2J9RA 3QI2A 4Q00A 2C8VA 4LI0A 5JBQA 5GJBA 3T5DA 2JIZD 2AXPA 1QBKC 4C7OA 3LQQA 4Q9JA 1E9BA 2QGNA 4HLDA 1BS1A 2BMJA 2QSZA 3QXCA 1KJZA 2W0SA 3CWZA 2W6JD 3KDSE 1TQ4A 4G1UC 1E96A 1OIXA 3ZZ0A 2QBYB 4NCKA 3UG7A 4ASUA 4OK3A 3B1ZA 1ZU4A 3AVOA 4XD7D 4D4LA 5F3WB 2KSQA 5TV2A 4IDOA 1SVOA 2VIIA 1TQ6A 4C2TA 2BMEA 3SYKA 5E7MA 1CKEA 4BLTA 4HSEA 1KOFA 2NPIA 4QBFA 1OXTA 4JKYA 3RC3A 3IILA 3BFKA 4WA7A 4BFUA 3THXB 1WA5A 5TDHA 4NYJR 4QM6A 2AX4A 3W8RA 1L4UA 1HT1E 2EVWX 3B9QA 1W2HA 1D8TA 2ASEA 1XX6A 4GPTA 4KYIB 4LJ9A 1CBUA 1X1RA 4TMTA 2GEDA 5FI0B 3VKWA 1OB5A 1E1QA 1Z08A 3KQLA 1GRQA 4C7OB 1ZM9A 1XCPA 4K46A 2NO6A 4HLUA 3I5YA 1DELA 3QOFA 4WXRA 3GPLA 1Q1ZA 3D3QA 4D82A 1DOAA 3P20A 4KITB 2O8DA 1JR6A 3R9IA 4ACBA 5DIFA 4D25A 3SU8A 2IXGA 2JEOA 3P4XA 3ZIAA 2VP4A 3QE0A 3WY9A 4BUJA 4F4CA 1Z06A 3H0KA 5IT5A 2B8TA 3SJCA 5CDFA 1KJWA 2ZUBA 3GJ5A 1KO8A 2HLDA 4LX0A 1JR3E 1G21E 2DYKA 1T5LA 2WVJA 3D7MA 5M04A 1TTTA 1ZNXA 4JKIA 3OAAD 4HB2A 4IKEA 1PJRA 3LWNA 3FPAA 3TSWA 2FE4A 2PEYA 2FSFA 1P61B 3OEEA 4JLDA 1IM2A 2JLVA 3WRXC 5K8UA 4G5RA 2Z5FA 1IY0A 2BCGY 3IUYA 4IOJA 3T15A 4Q7JB 2G9NA 2A5FA 1XDBA 3KXKA 1G7CA 5FOXA 2IHBA 2AK2A 1JXOA 4MKGA 2IYQA 3QPVA 5G3ZA 4EPYA 2D06A 1XTKA 3UATA 1SVSA 3BWDD 1RC8A 1KMQA 3SEAA 1FP6A 1SZPA 4LV8B 5LB2A 2WMNB 1KMHB 2XGJA 2ODBA 2QZ4A 2WJJA 4EPXA 4IDNA 1P2TA 3DZ8A 1R5OA 1IXRC 2R9VA 3AF3A 3NDPA 3RDPA 2PX0A 5IK2A 4DJTA 1E2PA 5KTYA 4UQOA 1QVAA 1G5PA 4DSNA 5J4LA 1NVVQ 5C4MA 2IYYA 1XMIA 3DHWC 4LC0A 1FW6A 4RD0A 1HYQA 1EGAA 4WAUA 2C04A 4DCNA 1N6IA 4HAYA 3SHWA 5JWRA 3FE2A 4JJKA 1G3IA 2JLYA 3PEYA 3BAFA 2REXB 2RGCA 2VHQA 2ZEJA 1QF9A 1RJ9A 2CJWA 4TMZA 4Q19A 3LX8A 4Q1CA 1M7BA 3U7FB 3CLVA 3R20A 3WBJA 4XWKA 2ERYA 3IO3A 2QAJA 3QY0A 2VP6A 1E79A 5BWMA 3HWSA 4NCNA 3RRNA 2BBWA 4NDZA 2QORA 2ZRGA 4AY2A 3UWKA 3TVTA 1XBTA 4TYPA 2ZRCA 4JJZA 4GI7A 4DC9A 1O87A 1U81A 1W4BA 2R65A 3D6TB 4CZ2A 3NBXX 2O8CA 4X8LA 4MDFA 2GJKA 1NIPA 1QG4A 3VX4A 1P2SA 3GLGE 1NLYA 2ZAOA 2ZYVX 3GCGA 4KFSA 2ZITA 4B34A 4IXNA 1XRJA 5BW8A 3IIKA 5FUWA 3IIMA 4M1SA 5EUQB 5FTMA 2WAXA 1W36D 4CT4B 2V1UA 4QNMA 3AUYA 3THYB 5IF9A 2DHRA 2VEDA 4DLXA 1Z0IA 3WMGA 2ZSFA 1G4UR 3GJ6A 1F48A 1GITA 1VIAA 2RCNA 3EZ6A 3U4QB 4LJ4A 1PZNA 2PZEA 4QHTA 2J0QA 1ZUNB 3L0IB 4K81B 4PXAA 3WP1B 4ITRC 4TL8A 2AFHE 2GZDA 3TUZC 1CJKC 2O8FA 1GRNA 3IIJA 1IN8A 1CR4A 3I5XA 1JQLB 2XTMA 3NH9A 4LYAA 2JJ2A 4JSTA 4B3FX 1K6MA 5EP4A 4BFXA 1G7SA 1XEFA 4Q4HB 4R98A 1N6HA 3KTAB 4K8OA 1MT0A 4ESHA 1J2JA 1SVIA 4Q03A 2REBA 3OIVA 4US0R 1HE1C 1X3SA 4JVSB 1GG2A 3VNUA 3UK6A 2WJGA 3H2YA 1UFQA 4Q4LA 1KK1A 5C4GB 2GHIA 2CJWB 4AKEA 4W9MC 1IN6A 1VCOA 4KBGA 3ZYCA 5L3SB 4QHSA 4GZMA 4AI6A 4QKQA 1T8TA 5FUVA 3THYA 3U2QA 1W36B 3QBTA 1VYVA 2ZRJA 1OFIA 3VAAA 1MO6A 3EIQA 3AUXA 2RGGA 1M1YE 3AKEA 4CVNA 1UJ2A 2ZVPX 1ZIOA 3B1WA 1HY3A 2CE7A 4H9GA 3VKHA 2WJYA 1YZQA 3QXJA 1Q21A 2RAPA 4LHZA 2OILA 2Z4SA 1IY1A 4LPSA 2O8CB 1BH2A 2XXAB 1ZNYA 4PR0A 1NF3A 3DMNA 1XZPA 4AYWA 4IDHA 4ZCMA 4UNRA 3EARA 4E5UA 2IC5A 4A36A 3LBHA 1KSJA 3FOZA 2V1XA 5KSYA 3CONA 2G1KA 1JALA 1U98A 4URWR 1F2UA 5KU1A 1OB2A 3IBYA 4IOKA 4JLOA 1OKKA 3IBGA 4R2IA 3RHFA 4EIWA 2FJUA 4A8JA 4DCUA 1AQYA 1KGDA 2PL3A 3KKMA 2JLSA 2H92A 2W58A 3H84A 2QROA 4C4PA 2Q9BA 4B71A 1UAAA 4X8MA 2JA1A 1YZNA 4B74A 1UEJA 5FL3A 2JATA 4IVRA 4YDSA 2W6JA 1AKYA 1XWIA 2GF9A 1OFTA 3JZAA 4EKDA 2F1IA 3B13B 1E9RA 2J0VA 1W5TA 4OKSA 4UXHA 1SXJB 4PSKA 2MMCA 4XD7A 1G291 5AUQA 4M2LA 5EJEA 4A15A 4ZI3A 1E79D 5KHOC 1PLLA 4RZ3A 4R7ZA 5TY0A 2O0JA 4L16A 4W5WA 2D2EA 3CNNA 2ONJA 3P27A 3EX7C 2WWGA 4Q4AB 3U44A 1FQJA 1TQDA 4QBIA 3BFXA 1SVMA 2X8AA 4FINA 1RIFA 4RZXA 2QT0A 1XMJA 1Z0AA 3RS2A 5E7IA 1U0JA 3T1OA 4PAOA 2UKDA 1U0HC 4B3XA 4V0KA 5KNCA 4D0GA 4EQ6B 3QF4A 3VR6A 1S4QA 2ZRKA 3OIYA 2L0XA 3GLFE 4U00A 5J4HA 1F3OA
chains in the Genus database with same CATH superfamily
2ATXA 2HK9A 1CY4A 4I1SA 1FRZA 3JX9A 1XTVA 3IESA 3B38A 5FTJA 4KDRA 3UMRA 1L7EA 1TCAA 2HF8A 3PF9A 3VYTB 4C20A 5A9RA 5HTOA 1PJLA 3K4PA 4LJSA 1A8PA 1GNVA 1CNFA 1ZIPA 1AB5A 2BIFA 3Q8WA 4HN4B 4U9UA 5T3YA 4RABA 3TNDA 4B6JA 2B25A 1SFRA 2Z3VA 2QN7A 1QP0A 2PMDA 3WLPA 5JS7A 2OHFA 3K0FA 4IO1A 3L0PA 4AS2A 4ETMA 3AU9A 4R68A 3RT7A 2ZJOA 5JMOA 2ZJ1A 3DV0B 3ES9A 2V7BA 3FVTA 4JA0A 3I01A 5IM4F 3ND7A 1F2DA 3LI2A 2ZR0A 5AKLA 4B2IA 4B8WA 1VPTA 2AN1A 4KODA 5JUWA 3MM4A 1PP4A 3Q7QA 4KWEA 5GP1A 4FZWA 3D4OA 2FWJA 2H4WA 5KDDA 1NBIA 3I8XA 1GG8A 4FHGA 1RTTA 4CNQA 3LHKA 3VNRA 3EFBA 4G5YA 4AJLA 4C3ZA 1T15A 3L7IA 1BU5A 1G8AA 3ERCA 2ETVA 2F00A 3GBPA 3NAQA 4KUHA 5BQ5A 3AXTA 4HSGA 3A6ZA 4RS4A 1CFZA 2YDXA 1N8KA 5FL7D 1KYXA 3VDQA 4NESA 3ASUA 1TM2A 3I9JA 3EFEA 5FPHA 1WB9A 1W2WB 4EB6A 4QDTA 3T95A 1PJQA 1REQA 3COZA 5KBYA 2GTPA 2OT3B 3PQ8A 4GLJA 4KQIA 4V24A 2HPHA 5E38A 4UPDA 4J1SA 2B9EA 4BPRA 3BX1A 3N76A 2VHUA 3W4IA 2GQ0A 2WNSA 3OO1A 5K3AA 3K09C 1TM5E 4Y67A 1EPUA 3O2SB 3C8MA 4Q1AA 4K6OA 4ZIRB 1K9VF 2NYRA 3NAMA 2IS1A 1WP4A 4EQZA 7MHTA 3A9RA 2C03A 2XT9A 5K3DA 2GEUA 4FFMA 4I52A 3I58A 3C7AA 3HU1A 3OF5A 5CLLA 4NU0A 3TUJC 3QNWA 1N33B 5IK2D 3T89A 1TUIA 3UOWA 1ZM4A 4Q3AA 3TD6A 4FILA 3P9RA 2NU7A 1D09A 1I13A 2P27A 2E9SA 3AR6A 3CPEA 5KWJA 1T2NA 2JI4A 4Y6RA 1DG9A 4N7MA 4OD0A 4ZCIA 2RB4A 1E3TA 2R96A 1PWHA 3DMGA 1V96A 2V7QA 4I3HA 3C85A 5EIXA 1K7YA 2E18A 1U1DA 2ICAA 4G1MB 4TXNA 2XCRB 2IXBA 2PIAA 2R47A 4BGUA 1H2XA 4G1FA 2JASA 4W8OA 4YMWA 1CXZA 3O1LA 4OQZA 4TUYA 4X3CA 2IDJA 3VGPA 1QGDA 2BFEB 4BNNA 4F84A 2BEVA 1NXOA 2WWYA 3FUWA 3GRPA 2F43A 1K7SN 3HC7A 3UWSA 4HH1A 3PNYA 3GN2A 4DG9A 1VBFA 4BJ6A 1NE2A 1GP2A 1I2AA 4E5DA 4CM6A 4H2DA 3HLYA 3AEZA 3G5MA 3PWTA 3Q0IA 4C0BA 3H86A 4UM5A 2PR7A 1M2OA 3WGUA 1G3QA 1KMNA 1RKUA 4NYMQ 4BB5A 3RTCA 3U62A 4C4ZA 4DV1B 3TXXA 2RAFA 3DSRA 3KNZA 2W70A 4C76A 1XRNA 4OSOA 4CDGA 1XL0A 2VJNA 3I72A 3GEIA 2WVAA 4WBNA 1FX1A 1CUVA 4ZCSA 1NR7A 2WJHA 4XWWA 1NLZA 2OYRA 2F2TA 1SBYA 1VDMA 3DE4X 2WHPB 2OZEA 2GZSA 1Q1NA 4LTMA 1VJ1A 3E8SA 3LP8A 5KJ6A 2XCQA 2CLSA 4BGIA 4X41A 5A0VA 4QSMA 1DIGA 5IP5A 3C5HA 5FFNA 5AKGA 3DVSX 3TBKA 2HHJA 1UDWA 1MO5A 3SDSA 1EJBA 4DA4A 4DR1B 4FI3C 2JS7A 2VK8A 4LSGA 4LDJA 3SR4A 3UAGA 2HCFA 2Q5CA 4QDXA 3WA6A 1O6ZA 3ZXXA 2I80A 2CLCX 2XT6A 5IAAA 3BD8A 1KZ4A 4PBRA 4PAGA 1E8MA 3L1JA 4RBNA 1DCFA 2EKZA 5BXQC 3C3AA 2WYVA 2FB9A 4HAUA 3DVLA 5IYZB 3SXJA 4NH0A 1W19A 2C96A 1U8FO 3DQPA 3Q6MA 1NG1A 1T26A 2WIDA 5DRTA 3ELDA 4R9NA 1W47A 1QAOA 1YR6A 2X19A 2BFEA 3CS3A 3ILYA 2Z2YA 4IGFA 5KPJA 4FMCB 2EFJA 2FUEA 1G0OA 2ASVA 3A32A 3GB9A 3HXTA 2H59A 4BFVA 1L5FA 2X8BA 2Z1NA 4F2DA 1FFXA 2IA5A 4RD1A 2A57A 3AYZB 2VP2A 3HBNA 2C97A 3KHKA 3G13A 4MVJD 4PW0A 5SYAA 3R7NA 1KXJA 3M5CA 1CJMA 3AB7A 1EFHA 4RJIA 2BI7A 1HDCA 1TEVA 2C7BA 1F0YA 4DG5A 3MN1A 1X92A 2EHJA 3L0ZA 4G5XA 1ECPA 4MGIR 4EMLA 4UMDA 4K9PA 5KHLB 1UKBA 2CW5A 4Z7NB 1KSGA 1P4RA 4JGBA 1G20E 3FTNA 4M4SA 5FI3A 1PT9A 1NOIA 2DP4E 2O50A 2SKDA 1JHOA 3EA0A 3EG5A 4HBGA 5KVAA 1ABEA 1B74A 1MJFA 4PSDA 5CFNA 5IPFA 1U2SA 3DMPA 1MENA 2WMOB 1NBMA 2QUKA 1RLUA 3TFWA 4FYXA 1QNFA 4QHYA 1ZK4A 2FEWB 2YVLA 5K3SA 3TE6A 2GJSA 3NANA 4IF4A 3BMQB 4WW0A 4BLOA 4XASA 4D92A 4E07A 4KMSA 2QLTA 5E3HA 4RD6A 1GGHA 2JCBA 4NOMA 4ZOBA 1QR6A 5DEIA 5BUCA 1QVWA 1GFWA 1XAGA 4XR4A 1H5QA 1K5GA 3WLRA 4CR6A 2IPLA 5AM0A 1XVUA 4MICA 5H02A 2C9BA 1MJNA 1I2ZA 2J7PA 3MA0A 1EXNA 1L5WA 1L5HB 2C8LA 3QE2A 3K3PA 1H3EA 1LWNA 1U7HA 2DTXA 3AL0C 3BIWA 2VREA 1G5FA 1G5TA 1GGMA 3BMOB 2OQRA 4QVKA 4BTEA 1NXQA 5E3JA 3H42B 5CLJA 1SXQA 2IS6A 2XGGA 4F6CA 5JS6A 2WWWA 1RAFA 3D2AA 3A6FA 3CR7A 3N2KB 3G79A 1GCUA 3OLWA 1QO9A 3I9V1 3K72B 1G5RA 1W96A 1OGYA 3K9CA 4RK5A 4G4GA 3SEFA 1E3SA 1IAVA 2C77A 3CTMA 1MC4A 3RVMA 2ACKA 5FFFA 2GTHA 4OHKA 4RVNA 3VC1A 4DZTA 2H4JA 2YYSA 5EYPA 1X3LA 2PFSA 2GEVA 1KZ7B 3SIXA 3TOCA 1A9TA 3KZMA 2VHXA 4C0KA 4Q01A 4UM7A 1N2JA 4I1UA 5LLDA 1JTEA 1PQYA 1EMDA 2D74A 3CURA 4M7WA 1Z38A 2OHIA 3SXPA 5FOTA 3UQYS 1EWQA 4KO1S 5J2UB 4NF2A 3F3SA 3PUZA 5IYZF 3RROA 1YZGA 3ED5A 5HNKA 3IXQA 2C94A 3DE5X 1MD9A 2ZANA 4WZZA 4F7DA 3UPUA 3A4IA 1UPTA 3DG9A 5DSXA 4ABYA 1P75A 2CSXA 4FQ8A 1CJTC 1TGYA 4E94A 1N7JA 2DM6A 4H1TA 1SUBA 1AK1A 3F7NA 3JV7A 4EHJA 3E35A 1XNRB 2LRHA 3MWKA 2VCEA 1RM5A 1SQ6A 1I9CA 3QLEA 4WKPA 4B4WA 2QG4A 1GQRA 2P30A 5GJWC 3GUVA 4PPFA 1JGTA 4FDVA 1T0UA 2EZTA 3A9CA 3FSGA 3D2LA 3G2LA 3JRNA 3QKWA 4X20A 3DZFA 1YHNA 3GR6A 4B8YA 3Q7IA 2PMKA 1MB2A 4NCXA 3TOVA 2ZI7A 1VLHA 4JGIA 4XQEA 4WK0B 1P0CA 3TNYA 4H27A 5EG5A 2P40A 3M6WA 4WXEA 2D2VA 4CM5A 4BO3A 4OI4A 4NBKA 3VRHA 4D3YA 3E7DA 3OI7A 1U1CA 2Z56A 1ZITA 1M2OB 1G63A 1JDNA 3HVKA 4JT8A 4MR9A 1N8SA 2C82A 1OROA 2NYUA 1CLEA 2PBFA 2VAMA 3IKMB 3K9NA 4PLWA 3AUAA 4RLSA 3TH5A 4DQXA 3SS8A 2J8ZA 4QIHA 1VP9A 2WZDA 2YVKA 3JQBC 4CLDA 4FDTA 4X24A 3U1VA 1ZR4A 4NYIR 3GLGB 4BLWA 3VOTA 3CC8A 4QTTB 3K0BA 1BNCA 4UTXA 2Z2JA 2PE5A 1XEWY 2YXEA 3KQKA 4KV9A 3AR8A 1U0LA 4KAXA 1NVKA 3B6IA 2FVXA 1M10A 2R751 5ESDA 5L3SA 3NP7A 2NZ8A 2VNHA 4LSMA 1P73A 4GBJA 2CXOA 2Z5GA 3LTEA 2X6TA 3LCUA 2RHOA 5EQTA 3ONVA 2B8NA 2GBPA 3HYLA 4E0BA 3W2IA 2IY8A 4BNIA 1B42A 1Z37A 4C4TA 1XHLA 1MQ8B 1AA9A 1WMFA 3Q1KA 3H1AA 1P0QA 3O31A 3RYHA 4DBZA 3L92A 5IN4A 3E2PA 1M6VB 2O5RA 2XZDA 3QMMA 3U6KA 4BNDB 3K09A 5ILOA 1Z68A 1VGRA 3HO1A 4B2YA 2QJWA 1GU7A 4HXFB 3LVFO 4AKTA 1E5VA 4XCQA 4S0ZA 4OM8A 1U8EA 3X1ZA 1EINA 4LXTA 4V0LA 3FBTA 5KHAA 2VDMB 4BC1A 2FYTA 1FDVA 1P4HA 4CGYA 5DNUA 4QUJA 1JE0A 2JB9A 3PPXA 3LO5A 1X7XB 4I9NA 2RG7A 1CTQA 5TXGA 1SWWA 3EZGA 3R0OA 1JR2A 1ULBA 2KM1A 2O14A 4D1YA 6REQA 4B0PA 4YXWA 2ZI5A 1C9DB 1SB9A 4M83A 3PV0A 4RNCA 2NXCA 4EJFA 1WSWA 4M89A 4FDLA 1JQ3A 1OVMA 1MOSA 1XWFA 3KTDA 3PC3A 5FTKA 1T1SA 1T5SA 2YINC 3LL7A 2OHVA 5G4LA 3L1HA 2XIQA 5JJBA 3PDIB 3L9WA 1B6TA 1YL7A 4P5EA 1SIBE 3F6EX 4OOFA 4UDOA 5ETJA 3BXOA 5ARDA 4GX5A 1YRWA 4H17A 3TEFA 4M21A 4EY6A 2OCLA 3Q0GA 4BRWA 1JYSA 4TKLA 1X0XA 1U8ZA 1WKVA 3MGCA 4ARZB 4C88A 1ZQ9A 3FMPB 3IEVA 1LTKA 1U2GA 3GYGA 3IUSA 1XJQA 2FK8A 4FYMA 4AQDA 3WGJA 1RJMA 2QMQA 1NWCA 5ALOA 2GN4A 2Q2NA 2O7NA 4LJLA 5E95A 4A10A 3ZVLA 5T67A 1TYCA 2Z4RA 3FM9A 3PC8A 3JTEA 3T5GA 3ETLA 4E09A 3QVMA 3FHTA 1M2VA 3SEZA 1JEJA 2ISSD 3P9SA 1Z8NA 1AQUA 4MPRA 4DNOA 4G5QA 2I99A 4TKZA 1EUYA 5COBA 4NRDA 2YN2A 5I7OA 1PGNA 2IBTA 1Z5UA 4PFQA 3C14C 3UANA 4O4JF 1DNPA 3TOXA 2AE1A 4EARA 2W6NA 5LIPA 1N1DA 2YVAA 1K6JA 2ZS9A 3G2KA 3S2YA 3JW8A 1Y89A 1YCHA 1ZEJA 2FX2A 2FSSA 4D8WA 5DXJA 5BOVA 3CRRA 3F6SA 2G1JA 1HZZA 1NYRA 1QHHA 2E4XA 2SCUA 4I9HA 3O0DA 5FWYB 4F4HA 1U5AA 3EMDA 4V0ME 2R00A 3VPSA 4MUFA 2CV2A 5CM8B 4QDKA 2JAPA 4FW8A 1U7ZA 3RU9A 2P9FA 2KLBA 2OBLA 4FFVA 2H54A 1TM1E 4G5FA 1MIHA 5G41A 4F45A 3PR2B 5FT9A 4A5OA 2HIAA 3GDHA 1VECA 4WPGA 1NVWQ 3EGOA 4CLOA 4CE6A 2Y1KA 2ZYRA 4M38A 3VU8A 3AVXA 3FPBA 3QLVA 3WKDA 1P7YA 3HM2A 1ESDA 4RFVA 4XH9B 5TQJA 4K9QA 1GVHA 3N05A 3A3PA 2OENG 5FA6A 4XQ9A 3TIVA 2C7QA 1W5BA 2FFHA 3GP8A 1GTJ1 3GGDA 4MZDA 1UJNA 3FMOB 3PLNA 3ZJUA 4I50B 4JL5A 2HDHA 5JMPA 1T25A 1X13A 2WHYA 3KEQA 1ZI6A 4R2HA 1DTWB 1FLNA 3CJQA 1C9EA 1XTRA 5GGXA 2Q4TA 1N2CA 4ZXPA 3TMKA 2ZSBA 3F9CA 3LUAA 3Q7TA 3VH4A 4LFAB 1VG1A 4YJ3F 1YVDA 1RYNA 2NTEA 3CJTA 4UDNA 1KO4A 1TU0A 1WXIA 2Y1CA 3ANLA 4R05A 4ALIA 3AJAA 4HB4A 2P2ZA 1HC7A 4DDWA 2R6GA 4U2EA 2A1TR 1Z0ZA 3R6TA 2HJHA 2CK3D 5DHRA 2HMWA 4RA9A 4LZAA 5ELXA 3G2NA 3LAWA 2QE7D 1C9JA 2NSJA 4AJNA 4B76A 5AQ1A 2VPQA 4UREA 1XXHE 1KYQA 5IASA 2QF7A 1DCKA 1MEJA 3V7WA 2ZETA 2V7GA 5A4AA 5CT4A 2Z0MA 3I28A 2YC4C 4ACAA 3WWEA 3HBFA 2FOLA 4EGAA 4V0QA 3DL4A 1JTVA 2JZOA 4JEUA 2O8EB 5K01A 3FVVA 4TWZA 3DTVD 1Q0SA 4L8LA 1BXRA 2GYYA 4ZYXA 3TL3A 3JVEA 2GH1A 1OHHA 1V35A 3KWMA 3S68A 1ZI8A 5JQGA 2GD1O 2G0AA 1LZLA 2HQBA 2VNKA 3EDOA 3MAAC 4DWOA 4CETA 3OJEA 2R5FA 3GJSA 3R8FA 4TL9A 3RRFA 3NHMA 1N1GA 1SY7A 3MCVA 4URUR 3U1BA 1IEQA 3R3YA 2UXBB 2D2XA 4JUBA 2P3SA 4EJSC 2G3YA 1SG6A 3KZOA 5JS8A 3KJXA 3DZCA 1Z0SA 4O1MA 1UMBB 5AVJA 2Z95A 1O96A 3VAZA 4NQZA 1SVLA 1C3EA 2CJFA 5TMBA 3WB1A 3Q9LA 3WZLA 4CQLB 1A8UA 2PGAA 5KVCA 1ODLA 3K31A 4Y9UA 5ES4B 8ABPA 3DBOB 2HRDA 1DAIA 2WT9A 2IH4A 2D5IA 4YGXB 1Q6ZA 1L2TA 3GRYA 1SOMA 4C22A 4KGDA 4RWZA 3ZJTA 1TUBA 3AIOA 4EW2A 3OTOB 1QKKA 2AFRA 3RRMA 1GTG1 3SNKA 3NVMB 5JO9A 4FLFA 2IYZA 1M9NA 4W5HA 3P32A 2A9FA 4J76A 1ZG3A 3EDCA 1MO3A 2LD4A 2V8BA 4ZOEA 4I4TF 1ESEA 4EAAA 3H13A 5AVSA 2RIRA 1H3NA 2PZFA 2W2OA 3M2PA 3ZD8A 3FSJX 2DY1A 5K7SA 1L4NA 2QL9A 2EKQA 1D6NA 2I2XB 2IKSA 3DWFA 2I9PA 3WL6A 1GZ6A 1R27A 2PQ0A 4OATA 4GO1A 2VLBA 2GLTA 3CR3C 1H8HD 1RQLA 3O8QA 3OQVA 2YC2C 5ERXA 1R00A 3TPZA 3JWJA 4JQOA 1DINA 4B75A 3HHEA 4C7XA 5CB4F 4KPFC 1HE5A 3QHPA 1MIOB 4EA6A 2FP4B 1NQUA 3AEKA 2UVPA 5EXEA 1PI3A 1GKYA 2IODA 5JW6A 3A36A 1JA0A 1EK0A 2CL7X 5ALDA 1NLMA 1ZCZA 1X19A 2Z04A 5JSFA 1U8AA 3RRJA 4TQAA 2BM1A 2XF8A 1N8NA 4KN8A 3D7NA 4CEJA 1UJBA 2GRAA 4BX9A 5KB3A 4OBEA 1ZD3A 1RJNA 3E0XA 4NK5A 4ZQEA 1T29A 1GG5A 2CNNA 2GESA 1YJAA 4RADA 4RK4A 4DV2B 3OZAA 4TMXA 1KIFA 1UXJA 3DBIA 1Q0ZA 3FSRA 5DT9A 4CM4A 5IZCA 4AKHA 1ENOA 3LT2A 3OZTA 1ACLA 3KU4A 2SECE 3BK2A 3W2GA 3KPUA 5ELMA 3PVCA 2JCXA 3ZDRA 1PGOA 1D9XA 1QMGA 3CGGA 4PZZA 2D4HA 2GJ4A 1UFOA 1Q95A 4ENSA 1HNXB 3RIGA 3SWWA 5CNMA 1PJAA 2UUPA 3QJGA 1H69A 1VB5A 1RQPA 5GQSA 4G07A 2I3DA 3GMDA 4J0KA 3OZUA 4N5MA 3DDSA 2P79A 3Q5EA 5AW7A 1QFXA 4WASA 4DB2A 2WJ4A 1H8HA 2DKOA 1T9AA 1UJ6A 2Y99A 2HJGA 4HN9A 1RWPA 4LF7B 2GM9A 3NCHA 3INNA 4HZUA 5JBXA 1HMPA 4K9SA 1RQNA 1NX6A 1QVRA 1ZOPA 4MARA 5FQNA 3BK7A 2ODQA 2R7LA 3OA2A 1AC5A 2R7AA 4YCCA 3V3KA 2QW0X 1DHRA 1OLSA 2C9OA 2WJZB 4LNUB 5BORA 4GVLA 2GK6A 4O0LA 4PG5A 1O9BA 2JLCA 2O0MA 4P3OA 5G1NA 4E31A 2HWXA 5AR1A 3DM5A 4EHBA 1RPZA 4O02B 4LF5B 4XM2A 1NSFA 3QENA 1UXIA 4ENQA 1JTFA 3RAFC 1P81A 5EKDA 3G85A 1I4LD 4YACA 1AF4A 3K1TA 1FYVA 4LVOA 2Q4BA 3ZJYA 4EFNA 2B69A 2X41A 3H8WA 4MIOA 4EPTA 4RVSA 2A30A 3FPGA 2AFVA 4GMDA 2OPHA 5CDSA 1ZGJA 1C7IA 4CUJA 1H93A 2VP9A 2HCJB 2E1RA 2V65A 2ZKLA 4WBNB 2Q62A 2DR0A 4ETNA 2IX3A 2BBSA 1OLOA 2R8BA 1R8YA 5CXXA 4YT8A 1JJIA 2YRXA 4M54A 1TM4E 4NONA 1CJSA 1UWVA 4B6QA 2ZPUA 3F9IA 1WKCA 4X1IB 4HVCA 2XAAA 2C4NA 1J2RA 4GYKA 4IR7A 4C89A 1V1MB 1MXFA 2B78A 3VNQA 2MHCA 1O95A 4M9SA 1JZSA 1TT5A 1ZMXA 1K7CA 2YN4A 3RHSA 5E3IA 2BMVA 4TUYB 5BW6B 3FWPA 2GKGA 1ADYA 2J30A 1SHTX 2WUWE 4QU5A 4FMDB 3EXIA 5AK0A 5HQJA 3K71B 1RWKA 2XNHA 4TXMA 2O3JA 4E5SA 1EWTA 2OXTA 1V1RB 3PC2A 4JJAA 3KYCB 2HQ1A 1V4VA 4CM1A 4S04A 3C3KA 3BH7A 4LK2A 4CDMA 2X3YA 4Z7JA 5H4GA 2BW0A 3F8SA 2H08A 1FBTA 3H1FA 2OHXA 3BJRA 4BO8A 5JJ5A 1EVZA 3KJIA 4ZIRA 4GC5A 4MUMA 5DBFA 3I9V6 5I7VA 4R54A 4UFNA 1JIIA 2RBGA 1YR9A 3ZNOA 5BVHA 2WW8A 3BFJA 4L0DA 2HA7A 4UEOA 1JDJA 1FXWF 1QF7A 1Y8RA 2H57A 2AQHA 2ZTVA 1OIVA 3PSHA 4QQ8A 2A5GA 4J1QA 4JLWA 2QW8A 4FFRA 4MQBA 1UWLA 1DFIA 1NZDA 4CLRA 4ZYVA 2BM8A 3HVUA 1JJAA 2XA2A 3DMTC 4NS1A 2IYLD 1PFKA 2QXYA 2Q3HA 3NT4A 5K0LA 4BUZA 2ZYHA 1FS6A 4X5OA 2FN8A 4G63A 3IVAA 4AECA 3PNQA 3U3XA 5D3ZA 5K3CA 3I5AA 4BDTA 3ZIUA 4HNSA 5D6NA 3HZRA 4JHLA 3WL7A 1NSTA 3OZCA 4AT1A 2ORIA 4WZBA 4JLPA 4N3AA 1CUUA 4HRYA 3RVKA 5I7WA 4GR4A 4YAJA 5EXPA 3QIVA 2W83A 1KNQA 1MAAA 1HWYA 1OC4A 4GGMX 4UTPA 5JJCA 1N34B 4AXBA 4GH5A 1HSZA 5AI0A 4BCBA 1EEXB 3BTOA 3ICCA 4EQ6A 2PT6A 1GN8A 1VOTA 1N3LA 1NU8A 5T4EA 4EKGA 1VYHA 1YT5A 2GRUA 5IVPA 2BOVA 5G02A 3VR1A 2PS9A 3TD2A 2HYIC 4NU6A 3I34X 3LHDA 5DU2A 3SSMA 4F2HA 3ESBA 9LDBA 2C4VA 1HTBA 2GRJA 6CHYA 3A4YA 2Q8NA 1K92A 2C9DA 4YAGA 2FEAA 1IM8A 5DYWA 3V4PB 3WOHA 1JILA 1FZTA 1P1IA 4E4YA 1B0PA 4Q6WA 2YWDA 3RGGA 1XD9A 4HNQA 1XZFA 5L95A 4DS3A 3HDYA 3RC8A 5DBGA 1GFSA 1RYZA 4MI1A 3RTEA 4P5DA 3T4PA 1SCNE 1NM5A 2HO4A 4NICA 1J56A 4EG5A 5C80A 2C7VA 5CXQA 3M82A 3EWAA 4IUCS 1OGJA 2XI4A 5EWLB 5IT9A 3HJTA 4BP1A 2V96A 1NXPA 2GUGA 1Z0KA 1GAWA 1FCJA 1HYEA 1WABA 4EUSA 5BMOA 3GIDA 3ZBQA 4H7JA 5HZHA 4N6GA 5IVHA 4DRXA 4RIFA 4WLNA 3TUIC 4UEKA 5JMWA 3LKDA 1O94A 3DEAA 1C30B 4ALJA 1H22A 2ZE7A 2H3EA 4Q4JA 4QJ5A 1AS0A 2GN9A 4S1OA 4J0HA 3OOJA 4E2FA 1M5UA 1W1WA 3HGQA 4UNPA 2BYTA 4ZRMA 3RS0A 1FU8A 1NAIA 4IFBA 2XCOA 1K06A 3QTLA 3DQQA 3R7AA 4I81A 2I78A 3EXIB 4K6HA 2OBFA 3BGOS 1T3LA 1WD5A 4QIJA 1H9BA 3NFRA 1U28C 2P2DA 3GEEA 4L9WA 1D6JA 1ZC4A 3T35A 1PR9A 4XVCA 2UYYA 3CF4G 3W6ZA 2E21A 5LWQA 1UMCA 5B1DA 1DFHA 2EQAA 5L6MB 1C0KA 2FY8A 1YE3A 3NBQA 3BH6A 2WYUA 3LCRA 1UOPA 3NATA 3O4IA 2C8JA 4JELA 3T5TA 2ZB3A 2WSYB 4J2TA 3QBDA 1YONA 1DLJA 5D5QA 2FRXA 5LC1A 1VHDA 3G0DA 1RRGA 4ZVLA 5DK4A 4G26A 1V43A 3BSFA 4I1YA 2AFIA 4F46A 4RJTA 4EHLA 3R9XB 4IJVA 4KWCA 1D2RA 4R2XA 4QXMA 1R6UA 2B4TO 2EW2A 3LW7A 2I34A 4Q7MB 4RSHA 5DB4A 3KT8A 4E03A 1NGSA 2BFDA 3F5MA 2F67A 3BE4A 1AUOA 4U1AA 4XJXA 3UT0A 1QC5A 4YRQA 4F72A 5KQPA 3RNLA 2Z2IA 4HLUC 4JEHA 4OJQA 3T9FA 3HQ4O 3WZ2A 3SJUA 5JDIA 3SR3A 5CDGA 1WLSA 2OV1A 3GK3A 4GKJB 1V2HE 2CDBA 2VDPB 2P1ZA 4INPA 1T1JA 2ZTMA 1XYYA 3CF6R 3PWKA 4M0FA 3HCPA 3M81A 4CCWA 3AR4A 3BKWA 1AQLA 1JEOA 1RABA 5JBIA 5B4TA 2C9YA 4C6HA 1GV1A 2E5LB 1KEPA 5CT6A 1HUQA 4M9RA 2WNIA 5F7ZA 1L8XA 2JF0A 2PUJA 4JXKA 5E9QA 3WGMA 1YSCA 2GFIA 1V39A 4TTJA 1G8PA 5EMLA 3OCJA 5LDDC 1TK9A 2GPYA 3K35A 3PTLA 2PRSA 3ITKA 4X66B 1V8BA 1WCXA 3ZDXB 3O8RA 1USWA 4DMHA 2O7VA 1QV9A 3C39A 4UMVA 4XUDA 4FIDA 5BYJA 4MW7A 5IAEA 3SX4A 1CB7A 3UF0A 4Z1OA 4PY2A 4DSAA 1S2LA 1P4JA 4EYSA 5DHSA 1UMDB 1WDWB 4MR7B 5IMBA 1XEXA 2JGDA 1UFRA 1MC1A 1ULHA 2Q6OA 2ADOA 2ZT6A 3UCEA 3PRKE 3SJBA 4RX1A 5H68A 3ANSA 4IYJA 2LKCA 5KJ1A 1HKHA 4BS9A 3GL9A 1XZQA 1JN0A 4P4SA 1O8BA 3O73A 3UJ7A 3A6GA 4MUXA 3RSCA 1KIAA 1XKLA 5J2TB 3IX7A 1V8OA 3DC2A 2QAGA 1O6FA 5JSKA 2ZTLA 3IQDB 1OLUA 2Z43A 1V95A 4BNKA 2SHKA 1WMDA 2BGJA 1MN6A 2BUAA 3ESQA 1JNXX 1PLKA 4JT4A 1J99A 4FFDA 4QVGA 2IGTA 5FKJA 2HV9A 4ZVMA 4QYIA 2YXBA 3QKUA 1GFZA 2FZ4A 1CV2A 1JG1A 4AZVA 1SD1A 3UV3A 4RY2A 1YRBA 2PX4A 2PYDA 1B8VA 3AHIA 3KE8A 1UBMS 1CVLA 2NXWA 1BU8A 5CFZA 4RH3A 3TTSA 3UJBA 4MYHA 4H1HA 4FS8A 3ZQ4A 3UA3A 3P2OA 2I76A 3STXA 3ZHUA 4BMYA 3G23A 3DDUA 4UMFA 2FAXA 1WHSB 4K9NA 3GLVA 2QVLA 4RY8A 4XGIA 1KSHA 2AEEA 4MR8B 4CQMD 5L9AA 4BTLA 2CUKA 2B36A 4YMHA 1PFUA 4YAOA 1PJZA 3AR2A 3I6BA 4J9VA 4R1QA 4Y3UA 1WV0A 3G2HA 1A2KC 3C6XA 4RL4A 2GHQA 1UT5A 1JA1A 2XITA 2RK3A 3KHUA 3GFGA 4PPNA 4ZREA 2PUEA 2B92A 9ATCA 1AVTA 1SVNA 4KQGA 4GS5A 3G8DA 3TGLA 1QQTA 1G20A 2NNWB 3UJ8A 2ZUVA 1I3CA 5KOIA 3T8AA 5EPUA 4Z4CA 4BMPB 1UUFA 3FCEA 4CIXA 1RW4A 2XNKA 5FEMA 3DVQX 2G08A 4W5NA 1CRWG 1ZW6A 4JJ4A 5DI3B 5KNBA 3DCNA 5TEWA 3RU3A 4K0KB 4WZAE 4LDZA 1NQWA 2HSEA 2IZOA 2R68A 2VP3A 4NYMR 2JLUA 4A82A 2XUFA 3C3DA 2I1VB 3E15A 3R6WA 1ZRHA 1WPGA 4NDNE 1SXPA 5DI3A 3RAJA 2O2YA 1C2YA 3WLHA 3SQMA 2PSJA 3IMFA 1VPVA 1SVUA 4OFZA 3L2OB 3Q5GA 5ALYA 1VRWA 4LUCA 3TEJA 3LLSA 3ND6A 2V6IA 1SBTA 1TCCA 2WSMA 3O91A 4XAQA 4MJLA 3MWLA 2XNCA 5TPWA 1ATIA 3UXMA 3JRXA 3V8EA 2PUVA 3VYVA 3SFZA 2PKEA 3DMTA 1XB2A 1O95C 3A27A 3TGPA 4NAHA 4LHXA 3N6VA 2PIDA 1ZUIA 3E61A 5E4TA 3RHZA 1UDXA 4J4TA 2GKOA 1GILA 2VAPA 4ID3A 3VTAA 5KNLA 4URXR 1P44A 2B94A 2PGDA 1OU0A 2C5AA 2CJPA 2RGDA 1C9NA 3KVYA 3LXXA 3R77A 1Y1QA 1JSXA 3CEPB 1R6XA 4IS2A 2VK4A 3R5FA 4BMCA 3N8GA 3HP7A 3HY6A 3A2NA 3KQNA 3VSDA 1T9KA 1TZKA 1X6VA 1U3VA 4ZOAA 4XVQA 3NJ4A 1DV1A 3AUJB 2CFCA 3PSAA 4OSPA 3FNIA 1UZMA 2E37A 1TD9A 4PLTA 3DAYA 5AK5A 5TQ2B 4EB8A 2VQ6A 1X7ZB 3TQQA 1CY7A 3OCZA 4U8HA 5JEEA 1P62B 4RKFA 4M8NE 1UJ4A 4RV5A 1U6JA 1QYXA 2B1GA 3U3OA 4B3RB 3SCZA 4QZVA 2JRCA 3T3IA 1Y6QA 2UYGA 4BWVA 3U19A 1XT6A 1OXBB 1OAOA 2NXEA 3P26A 2W71A 1TJ5A 3N0RA 1DIBA 1GPLA 4MSUA 3GOHA 4RKEA 3REGA 4ERNA 4DM7A 2MDTA 2BHSA 1RWBA 2P2YA 3O74A 1GSIA 4MV6A 1B3RA 2CXQA 3SJZA 1U8YA 3I6IA 4RXUA 4EKNB 1SM4A 5AFSA 1E6CA 1MOPA 3GLFB 2O1SA 3TB6A 3Q8XB 3LIPA 3ZU2A 5CA1F 5KKNB 1FX0B 1XZJA 4AK9A 1WULS 2FKAA 3MJEA 1R4NB 1ZJYA 5DLYA 1RDFA 3OD1A 2VTBB 4A0HA 1ELOA 3TLAA 2MINB 1PQPA 2QOEA 4JLBA 5AK3A 4EG7A 3C3BA 2HY7A 2ZI3A 4NOJA 4OOEA 4PGHA 3RW9A 4D97A 4DLLA 3GLRA 4F1WA 1ZIDA 1MJ3A 1EVKA 1KI4A 1NDHA 3I47A 2DUJA 1GNLA 2B30A 2QRMA 2WZBA 3EGDB 4NMLA 3S5UA 2ZXUA 5DXFA 3T94A 2HPAA 4JBLA 3QWHA 4OL0A 1QZXA 1ZUD1 1PBNA 1QIDA 2OBYA 2ZZKA 4J6FA 2OHJA 2Y71A 3FVQA 4OAPA 1TMOA 5JVDB 1LS1A 3ILVA 2VX2A 1MFPA 1ZHHA 1GGEA 4JLAA 4Y1RA 4YDRA 1U3CA 2BDTA 3BRWA 2VHTA 1UF9A 4FNOA 4LJ8A 4RF2A 2A4KA 1YQWA 1GZSA 4YJFA 1H4TA 3GF4A 1OH8A 5JXGA 2B61A 1PT7A 3N7AA 4RK6A 1D1QA 4JA2A 4Q4CA 1TEHA 3JWIA 3TYXA 3EYAA 1EX9A 2V0CA 1G19A 1AGXA 4FD2A 2I87A 3DXZA 3OCVA 1UIYA 3KZXA 4WKCA 2ZR8A 4BYMA 1W9HA 3TM5A 1F17A 4L4YA 4RESA 2QN1A 2YY7A 1GCAA 2ZJ2A 3BG5A 2YJ3A 3CPSA 4MVJE 5BMVB 1M5TA 4XSGA 2ZJ7A 3O03A 5HX7A 5JXWA 1O5IA 4LZPA 4JWTA 4HDCA 1SU7A 4DSOA 5FBHA 2YVUA 3DYBA 3LRTA 5BR4A 1SU4A 5DISB 1G8YA 3O94A 4V02A 2H2DA 3LUBA 1TOAA 1TW3A 4B40A 1A7UA 2P4EA 2OXEA 3LCMA 4XJVA 1ZD1A 3PGJA 5KINB 2O4CA 3CZCA 4E5YA 3PVZA 4BEVA 3RKRA 2IYFA 3T4XA 4WCDA 5JRZA 3GIWA 4CMHA 4RF4A 4L0QA 2V7PA 3OCUA 1Z2NX 1VCIA 5TARA 5EJ2A 1KJQA 3U7EB 1Z82A 2BEJA 3WL8A 2PZ8A 4MQEB 4RKQA 3R9KA 4A73A 1F5SA 3EHDA 1KETA 3GLGA 2FMTA 4OUKX 4Y2RA 3KUCA 1IUPA 3I42A 4NMXB 2C88A 4JI5B 3ZWOA 1V26A 5C7LO 3WIOA 3ZY3A 3MMNA 1TADA 1OFUA 1VIMA 5HIMA 3X1XA 1EWYA 5J4KA 1ORDA 3RRZA 1YR7A 4B9EA 4D45A 4PX5A 1TEZA 5KPDA 3KIPA 4YIHA 1NURA 1N9GA 3FNHA 5DHAA 1BJRE 3TW4A 3NALA 3DTNA 4TRJA 4PYJA 2HMVA 4IDBA 5CURA 3ZI4A 1B23P 3U4IA 2QD1A 4BZPA 3MIZA 1A7JA 3B3AA 4XPIB 3AYXB 3T7TA 2OQIA 5CDFE 4DUZB 4BGEA 1DDGA 5DCUA 1NW9B 3LT0A 1QE0A 3OPMA 3RVRA 4YRBA 5EIOA 1R0KA 1T36A 2EJCA 1TM3E 3QVTA 1XEWX 3LPDA 4EYOA 3JQPA 2ZR9A 2PPYA 2ZIEA 1DT5A 5FH9A 1B00A 5A3VA 1M8KA 5KNCD 3RSIA 2BRUC 4HLNA 1E3WA 1YRLA 3PIRA 3NR2A 1GPMA 2ZAMA 5EKTA 1KA9H 5CBPA 2AI2A 2FPUA 2H17A 3IO5A 1DCIA 2YRFA 4RIGA 4TT3D 3RVPA 4KQJA 3THWA 1IMJA 2JIQA 4TZKA 5J5CA 4BRUA 3I4FA 2CUZA 1A95A 1Q7GA 4YRDA 4FYYA 1Z6YA 5EWJA 3W5HA 2VH2A 4KG7A 1RQRA 3IIIA 1P7VA 2AVNA 1GEEA 2E4WA 3PE4A 1UZAA 5JV5A 4B5KA 1CF4A 3DZGA 3V32A 3U4AA 2Z1MA 4KR2A 5D3MB 5JC1A 7AT1A 5IXJA 3FHCB 1S6YA 2BRUA 4JB8A 3ASZA 4BUCA 3CA8A 1IG3A 5HMLA 3M5WA 2V98A 1BHQ1 3Q3JB 4H18A 2GBFA 3VNUA 4KLCA 2AF4C 4DIOA 2QGZA 2ZQYA 4O8ZA 5EYPB 4ZU2A 1V4NA 3G9QA 3TTYA 4WV3A 3S81A 1G5QA 3C0KA 1JR3D 1MTOA 2KQUA 3B20A 4QXRA