3AM1A

Crystal structure of o-phosphoseryl-trna kinase complexed with anticodon-stem/loop truncated trna(sec)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
250
structure length
236
Chain Sequence
DIMLIILTGLPGVGKSTFSKNLAKILSKNNIDVIVLGSDLIRESFPVWKEKYEEFIKKSTYRLIDSALKNYWVIVDDTNYYNSMRRDLINIAKKYNKNYAIIYLKASLDVLIRRNIERGEKIPNEVIKKMYEKFDEPGKKYKWDEPFLIIDTTKDIDFNEIAKKLIEKSKEIPKFNISDKIDKETRKIVSEYIKSKKLDKDKIKEVVELRKEFLKKIKKVDADRVLKEFKDLLNSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title C-terminal domain of archaeal O-phosphoseryl-tRNA kinase displays large-scale motion to bind the 7-bp D-stem of archaeal tRNA(Sec)
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase/rna
molecule keywords L-seryl-tRNA(Sec) kinase
total genus 86
structure length 236
sequence length 250
ec nomenclature ec 2.7.1.164: O-phosphoseryl-tRNA(Sec) kinase.
pdb deposition date 2010-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08433 KTI12 Chromatin associated protein KTI12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.40 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3am1A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3am1A01
4URZR 5CIWA 2IS1A 3QPVA 5A5GA 2I3BA 1BIFA 1L7VC 5DN6A 2ZSFA 1GILA 2FFBA 3ASZA 1YZQA 2CK3D 4FN5A 3TUIC 3WP1B 1AJEA 1NN3A 2FX3A 2VF7A 2Z43A 4HSEA 1E4YA 1Q57A 1ANKA 3L82B 4JLDA 4O3MA 3AF2A 3H2YA 2CLDX 4LV8B 1I4LD 3FDIA 4DT1B 2FSIA 4MKIA 1XXHA 5CLQA 1QBKC 3F3YA 3TKLA 2P2LA 4US2R 2F1IA 1G291 2F9MA 721PA 4JT4A 3UK6A 1K5GA 1XEXA 4M22A 1CKEA 1YZLA 5LDDC 1YVDA 2HCBA 2Q21A 3KB2A 3FHTA 4DT1A 1P2UA 3VKGA 4A0FA 2W6JD 3BB3A 4G1UC 4KV9A 4ZV4A 2JEOA 3WYFA 3K8YA 2QT0A 3W6PA 1KK0A 4NCIA 1Z07A 3GLHE 4C0AC 1NVUQ 1XEXB 2P65A 4MH0R 3NH6A 4UNRA 3EZ2A 1J2JA 3B5JA 2RGAA 3VHXA 2WWYA 3CBQA 2A2ZA 3UMSA 1VCIA 4ERNA 2IC5A 3U3MA 2VHQA 4M9QA 3CRMA 4LOAA 1EG7A 1X6VA 2O0KA 3SFZA 1J7KA 1LNZA 5TY0A 1M7GA 2IHYA 1E79A 3P1JA 5EE5B 3RANA 4AKEA 4O25A 2IUSA 4L4UA 2AXPA 1DVRA 2J59A 3G5UA 1SXJB 1RRGA 3K70B 1ZW6A 4JLJA 2HJVA 3TW8B 4A2QA 2ZRKA 4ABYA 4C0QC 3U3KA 4S35A 2CCKA 3T06B 2VRWA 4Q03A 1YR8A 4DLTA 1A5TA 2QEQA 1IOZA 1TEVA 4PZLA 4PX9A 1AZTA 3IIKA 1G6OA 1G3QA 4I99A 3GJXC 3LXRA 1J90A 2FGKA 2YC4C 3QBVA 1KI9A 1OXTA 1XD8A 3ECCA 3DO6A 4M4SA 4BFVA 2YKGA 2OSBA 2WKPA 3X2SA 3QVVA 3MJHA 1XZPA 3R7WA 1GRNA 1R7RA 3T1QA 121PA 4EPRA 2OLKA 3ZVMA 2FSFA 4D4KA 5EUQB 1CJMA 3CB4A 4EPVA 2ZUCA 4L8GA 1PV4A 4KFRA 3VR5A 4WZBE 2R2AA 2SHKA 2CL0X 2GXSA 2OLJA 5TARA 4I4LA 5J47A 3W8NA 2RHMA 3R8CA 4QKQA 1P61B 2PMDA 2H5EA 5FL7A 4FINA 1W36B 4Z1MA 4BRUA 1KJWA 1NVXQ 4MKFA 2VBCA 1N2CE 4CZ2A 3RWMB 2GAAA 4DXAA 5L3QB 3I73A 2ZR9A 5FUYA 1RE0A 2ASEA 3TGPA 1R5NA 2ORIA 5L3SA 1BOFA 1KDPA 2DPXA 4QHYA 2Q3HA 4DJTA 1SVSA 2IXFA 2IXGA 3AGQA 1HY3A 3CRW1 5DI9A 1CJVC 3LV8A 2QI9C 4B2LA 2XB2A 3D8BA 5L3QA 1AKEA 2WOOA 4MRPA 2WJYA 3KQLA 4HZIA 1WQ1R 2C2HA 3K0CA 2D7DA 3GJ3A 2A5YB 1JECA 2OEPA 4V03A 4EPWA 1ZM9A 4UXIA 5FTNA 2DR3A 4LK2A 1RC8A 4UNPA 4B43A 1J8YF 4E5UA 5CB8A 1RW4A 3SHFA 1OFIA 4NBSA 2YWEA 1X8KA 4PAOA 3P4XA 1E69A 1JR3E 3UG7A 1GL7A 5H70A 2FEMA 2X2FA 2VA8A 1MABB 1FP7A 1OE0A 5DLQC 3C5HA 1G21E 2DYKA 4O0MA 2QAGC 2ZS9A 3U3OA 5JHGB 4TYYA 4OHWA 1F48A 1EESA 4FMCB 2F6RA 2HLDA 3ZIAA 4QFMA 3U44B 3BK7A 1T3SA 5EUMA 2R65A 3ZVNA 5G3YA 4PHGA 4HDQB 4BPBA 2JLYA 1MABA 2GCOB 4EJSB 1LF0A 1ZNZA 2XTNA 2MSDB 3I92A 1J70A 2G0NA 4D26A 4V0NA 2P3SA 1YZUA 1M6NA 2BMJA 5DYIA 2DWOA 3HYRA 2GA8A 2XNSA 5BYJA 5A4JA 1XD2B 1NI3A 3VR3A 3A4NA 1E2FA 3TIFA 3BAFA 1OIXA 4MGZR 4B73A 1NG9A 4PO8A 1XJCA 1YZKA 5EZ6B 5GVRA 5C4MA 4MYCA 2O8BA 3RSLA 3QG5A 1VG9B 1HUQA 4KFTA 3O8RA 4NL4H 4HAWA 1A2BA 4TMZA 3KDSE 4AYXA 1KI3A 5UKDA 5GADl 2AKYA 2WAXA 4X8OA 3K0SA 1EFTA 2E1RA 1W0JD 2WWGA 5C46F 3THXB 3QPWA 5AJYA 1IN8A 1KMHB 1H8ED 1U2RA 4IEIA 4UJ3A 4B2IA 4HDCA 1A1VA 3I3SR 2A3RA 1ZD1A 3GLFB 2EFDB 5FR2A 3NEJA 3A8TA 3GJ5A 1UKZA 4RZUA 1E9RA 3AUYA 2Y8EA 2YOFA 3BERA 1SHKA 3ZH9B 3GJ4A 4PC2A 4I1OA 3L8ZA 1O3YA 3O8DA 4IEEA 1AS3A 2GZAA 3QPUA 4TYNA 3MGCA 2IF0A 1HV8A 1CR4A 4IXNA 4RD2A 1D9ZA 1NL3A 3ASYA 4HZUB 4Z54A 4G5OA 3BIFA 3RC3A 1H65A 3TSZA 3DPUA 2NIPA 3WHKA 2XSZA 3RAPR 4IDOA 3V9PA 4F4JA 1E9AA 3NEYA 2GJ9A 2QY9A 4KVAA 2V54A 1SKYB 2OT3B 1JPNA 4PTLA 1IONA 3Q9LA 1ZC3A 3UMFA 2UVQA 4OHZA 4GP6A 4EKDA 1DOAA 1RFLA 2CEAA 3A1TA 2QBYA 1FOEB 1K5DA 3IBGA 4XWKA 1GWNA 1HEIA 4GP7A 4Q00A 2NPFA 1OF1A 1PUIA 2ZAOA 4BEBA 2CLSA 5B58C 3PR1A 4C4PA 3KTAB 3SS8A 2G1JA 1Z0AA 5J40A 3LLMA 4DLYA 2RH5A 2QENA 4TMXA 2JJ8A 4YLGA 4B47A 4QC2A 1HA3A 3C7KA 5CDFA 1OKKD 1IN6A 4B3CA 1MR3F 5DSZA 5CIQA 1W4BA 2GRJA 2H16A 5JECA 1S4QA 1F6BA 2VTKA 4TLBA 4EAQA 3K9GA 4B33A 2IS2A 1CULC 4Z51A 2IYQA 1P9WA 2VHUA 1VYTA 4EIWA 2YJTD 1YZNA 1G9XA 4V02A 5F9FA 3K09C 3AB3A 4Q4HA 4V0MA 3DL0A 1E9SA 4TLCA 3OFNA 1VG8A 1KY3A 1XPOA 5DISB 3A4LA 2ZREA 2ONJA 4DLUA 1T0JB 1W5SA 3U5ZB 2WMOB 1NLFA 2R6CA 4Q4HB 5HKKA 2ZRGA 3WMEA 1PVOA 1YR7A 5CITA 1GNPA 2ONKA 1EFRA 2WV9A 3NKVA 4P33A 1II9A 3QXXA 5FL7D 2V9PA 1PZNA 3A1SA 1RKBA 4BFZA 1EWQA 4ZDJA 2CJWB 2ZJZA 4JLKA 3QUSA 5EQTA 3B13B 1XTIA 5BXQC 4M21A 2QRZA 4IFBA 1DO2A 5HCIA 3ZYCA 5B30A 2IK8A 3T5GA 3E5HA 4S2EA 1D2NA 3T12A 1XBTA 4ZI3A 1R8SA 1L8QA 3PUWA 4UNSA 3HP1A 5E95A 4IHQA 5FTKA 2KBEA 1FW6A 2W6ID 4BGDA 1SZPA 3QKTA 1FNMA 2OESA 5FR1A 5HCNA 1L4YA 3ND8A 2IEYA 3RS0A 4QNRA 1S9DA 2QZ4A 3RDPA 2EFCB 2HF9A 2JJ2D 2QP9X 3EZ9A 1T5IA 3GLGA 1G4UR 2F1JA 4KHZA 4RKEA 4WXRA 5H68A 4YMTA 2AD1A 3A1VA 3LA6A 3OZXA 3THWB 3NC0C 3D7MA 5FUWA 1P2VA 4GOKA 4TSFA 3REGA 4DEYA 2AD5A 1AZSC 3SE0A 2QTVB 3I8XA 1M2OB 2ZE7A 4WAUA 3LX8A 4FCVA 2CE7A 1I4TD 1P9NA 2EFEB 3ZZUA 4AURA 5JJIA 3LW8A 3CRQA 3K53A 2JJ1D 4FCTA 2WTUA 1TTTA 2DWPA 4FWTA 1E9BA 4IXMA 1Z06A 2F1HA 4JL6A 2C96A 1CXZA 4XVQA 4CT4B 4GPTA 3CPEA 4QL3A 4CF7A 2WJGA 4DSTA 3QF4A 4IFEA 3B1ZA 1KI6B 4JVSB 4RD6A 3VX3A 5DGXA 3AV0B 1NIPA 1ZM3A 2GWHA 4Q01A 2V1XA 4NCJA 1P72A 1JR6A 2XZLA 3P32A 4B35A 4LJ9A 1W4CA 2GF9A 2WIBA 3QF4B 5JSZB 4A6XA 4K81B 3IEVA 2F3TA 2FF7A 4IKEA 3NDPA 4PR0A 2IYXA 3K9LA 3A36A 3U3JA 2G88A 2J45A 2VSXA 5JFGA 1N6KA 2XAUA 3AVQA 1MO4A 3L8YA 1DTSA 4IDQA 4I81A 1AGRA 1U8ZA 1ZM4A 1RYFA 2KI5A 2ZROA 5IK2A 5TB5A 4BZXA 1OYYA 1GSIA 1NBMD 1XTQA 3ZJYA 2FA9A 1G1MA 1JNYA 4U5XA 3H0KA 5FL3A 4BFSA 2JASA 3TUZC 4QJ5A 3EX7C 2NO9A 4QBHA 5KUTA 3FGNA 3PQCA 4B2PA 4DDUA 1SXJA 1OLOA 3UANA 5FH9A 1E2EA 5K8UA 4M1MA 3LRPA 3WNCA 1N6OA 1ZU4A 1U98A 1II0A 4KSBA 4GDFA 4ACAA 2FE4A 1AIPA 1XB2A 2B6HA 1KMQA 2PT7A 5J5CA 4RZ3A 1ZC4A 3SJBA 3I61A 2FDCA 4KODA 3R9WA 2N1BA 1VHLA 3BWDD 1NG1A 2NO7A 4JS0A 2P6NA 3TQFA 4JLMA 4CIDA 1NMZA 3UIEA 2DB3A 5B64A 8OHMA 3TH5A 5FPTA 1W4AA 4PFSA 3B9QA 2KSQA 4RFSA 2Q9AA 1Z29A 1ZD8A 2IYTA 1P7CA 1HE8B 3AKEA 2IYWA 2JATA 3KQHA 1N6PA 1BYUA 4NYIR 3MG9A 3SEAA 5F3WB 1JB1A 4AKHA 2QTFA 4Z1MD 1YU9A 5A0FA 4Q1AA 3TMKA 3LLUA 2BWJA 4ACBA 1OHHD 4RKFA 1MOZA 1R5BA 2WWHA 3TR0A 1P2SA 3NHBA 4BEJA 4GT1A 5HTKA 3PEWA 3QQ5A 3VHLB 3ZS8A 1KAOA 3TVDA 2RGBA 3EZ6A 5F98A 3AVYA 3U4QB 2UZIR 2D2FA 4V0KA 3ONWA 1GIAA 2J7PA 2DFTA 2FOLA 4UJ5A 1NJGA 3K9HA 4RZXA 2AK2A 2VP5A 2WZQA 2IA5A 2EYUA 4MGKR 4BZPA 2XZPA 3L2OB 3T1OA 3LNCA 3LFUA 1CR0A 1YJ5A 3QF7A 4JYBA 2EFGA 3Q72A 4URYR 4FMDB 4DLRA 1R0WA 4NH0A 1GKIA 3E1SA 1XTRA 1X1SA 1YR6A 2KE5A 1DAGA 4XVRA 3REFA 4F93B 1QHXA 4A8JA 3D3QA 2A5FA 3IDQA 1EWRA 2IYSA 1OB2A 4GSYA 3BORA 4MRRA 6Q21A 2IS4A 1XTJA 1DO0A 3T35A 1KI7A 4IOLA 4EFMA 2KJQA 3U7GA 1CIPA 1UADA 2WBLC 4A8JB 3BH6A 3KUDA 2PCLA 3ZGXA 4GOXA 1IN7A 2Z4SA 4G5QA 5K8LA 2MSCB 3BH0A 1YQTA 4RD0A 3QG1A 4WW0A 1RRPA 4ON9A 4DCNA 1P75A 1OIWA 4LV5B 4FMBB 4MYTA 4UNQA 3GJ0A 4WZAE 5JI3E 4XIGS 5FUXA 3EA0A 1KZGB 3KKOA 1Y63A 1N3BA 1G7TA 2ZSBA 4D25A 1Z08A 1QVRA 1ZUIA 3R20A 5D3MB 3UATA 1ZNYA 1F2TA 1NBMA 3B1VA 4CYMA 3QI2A 3FPAA 1Z6YA 2NG1A 1VG1A 2PBRA 5EXTA 5IF9A 1U0LA 4IRUB 4TT3A 4LZZA 2V55B 2H18A 3SI7A 1TUIA 4OI4A 5TV2A 1EX6A 3TRFA 1U0HC 1E2NA 1E32A 1AS2A 4FMCF 2AR7A 1TAGA 4GZLA 2ZRCA 4MUAA 4DSUA 2Q6TA 4ILEA 3IQXA 1VECA 4MYHA 3AVOA 3AF3A 4A92A 1WF3A 5AR1A 2OXCA 3HPQA 3I72A 1G20E 4Q4AB 5GJVC 1U8YA 3TAHA 4B76A 5FTLA 1TMKA 4BLQA 2REXB 2IT1A 1DPFA 1UBFA 2ZQ5A 5JMTA 2J46A 3U6KA 3PEVA 4Q4JA 3GLFA 3SZRA 4B3FX 4NYJQ 3KQNA 3V4RA 1B0UA 1ZMXA 5JEEA 1OH8A 2O0JA 3Q8XB 1OFUX 1R5OA 1W4RA 2PT5A 3Q85A 1JAIA 5C1BA 4LY6A 3THYA 3P4YA 4C0KA 2FNAA 4P4SA 1BMFD 1BO6A 1KNQA 3QIAA 2A9KA 3UXMA 5HZKA 2QSZA 1G8HA 4HZUA 4A6PA 4YMUA 1D6JA 4I1VA 4OQMA 1LV7A 2NO1A 1E2KA 3THYB 3LO5A 1GL9B 1G41A 1J99A 1WXQA 1Q1EA 2BKUA 1OH5A 3AVUA 4LPSA 1ZNXA 4TTPA 3VNUA 5DO9A 2GJSA 4LC0A 1KO1A 3LY5A 2MMCA 4M53A 3ADKA 5JS8A 2BBWA 4CEJA 2F1RA 2ZU0C 2ZE8A 2LKDA 4X8MA 2JLZA 4MQBA 2YNMA 2F43A 2ZYTX 1N0VC 2A5GA 4II7A 4RCYA 2WSSD 2HT1A 4FD2A 1E2QA 3EC1A 3GQBA 3KTAA 2QM8A 4Q18A 2PLRA 3FMFA 3GLIA 3QKRB 3QXCA 1AGPA 1E9DA 1XTKA 5CYOA 5FOUA 2JLUA 2XNDD 4DZZA 2XZOA 3X1WA 4N0EA 4YMVA 1KAGA 3T34A 2RCNA 4Q5IA 1SVLA 4A8JC 3AVWA 2AXNA 4RSGA 2VSFA 1ZIOA 3P26A 2O5VA 1TQDA 3OHMA 3QKRA 3TAUA 4DKXA 1UKVY 3F0TA 3GEEA 2Z5FA 2Q0HA 3OE7D 1KI8A 5ELXA 1DAFA 1KNXA 2A78A 2JLSA 4KCGA 1X1RA 5E4FA 2UKDA 4EJSA 5HKKD 2A30A 2JJ1A 5KSOA 2ZYUX 3QXJA 3G82C 4TMKA 5EE1A 5FPSA 1G3UA 1M34E 2OG2A 1EK0A 1GITA 2ZR0A 3PENA 1LTQA 1MO5A 3U3RA 2BBTA 4DSOA 1NVVQ 4BFTA 4ZKEA 1E2LA 2BIFA 3KXIA 2FN4A 3C16C 2JLXA 4F4CA 2GCPA 3AKCA 4M1TA 3IIMA 5AJWA 1N6HA 3RS5A 1A4RA 4DEXA 2RGCA 1Q1QA 4LDJA 5FPYA 1KDOA 3TE6A 5K8TA 3BGWA 3SBEA 4HUQA 2CHQA 2ZU6A 3CNLA 1T91A 3NC1C 3OAAD 1P62B 2GZDA 2RGXA 3ZQ6A 3AKYA 2PZEA 4JKYA 1KSGA 1MO6A 4KYUA 5BN3A 2VHTA 4KYIB 5EP3A 1O87A 4L15A 5FI1B 3KXKA 4I1SA 4ASUD 1VCMA 3ADBA 2ANBA 2WJVA 4EQ6B 1IXZA 4Q7MB 3B7GA 3CRVA 5K8IA 3CZQA 3LQQA 2GTPA 2H1LA 4BASA 2FJUA 2N46A 1NJFA 1XWIA 2W0SA 5KPJA 1Z47A 2GBLC 1Q0UA 2BBSA 5JLJA 4H1VA 4RFVA 2ATXA 3K1JA 3QSYA 2ZRIA 4EQ6A 5BQ5A 3W9YA 1R0XA 2D7CA 5JBQA 2EYQA 2EWVA 3CO5A 1II8B 1DE0A 3LWNA 4CT5A 2C99A 2ZRPA 1N5LA 1XXHE 2Q3MA 3NBFA 3OE7A 4PZYA 2IL1A 3NHAA 1UDWA 4AD8A 4X8LA 5DHFA 4RD1A 1QDEA 2OBNA 4LHZA 2VH5R 4DB2A 2GF0A 3CH4B 4QJ4A 5FPHA 4DIEA 2ZI3A 4V0OA 2QE7A 2HT6A 1U99A 2TMKA 1JBKA 2GNOA 3CRRA 3GJ7A 2QBYB 3ZD6A 3I32A 3DEFA 3W5JA 1NVWQ 2DHRA 4IOMA 3SHWA 4KLZA 1KI6A 3FKSD 3NWJA 1HE1C 4Q19A 1R0YA 2GKSA 2GK7A 4URVR 3UPUA 4TWZA 3AF1A 1R6BX 2ZUDA 4AG6A 3R9XA 1IY1A 5JCPA 5KDDA 4ZCIA 4TQ9A 4Z8XA 2HLDD 2R9VA 1SKQA 2XEXA 2ORWA 3OEEA 1Z83A 3CF0A 2GVDC 3GLGE 1FUUA 3SNHA 1SGWA 4O2RA 2WIAA 4OL0A 2QPTA 4Q66C 3I1FA 3K70D 5JHHB 4B3GA 1TU3A 1QHHA 4XTRA 4JKIA 3UKDA 3WMGA 1F5NA 3NBXX 4XSHA 5E7IA 3K0EA 1W36C 5J4LA 2VLIA 1P5ZB 2GHIA 4QGAA 1CTQA 2PJRA 4BWYA 3EARA 1CRQA 4KSCA 4JL8A 1FMLA 2J7KA 3K0AB 2ZI7A 3O8BA 3SDZA 3WRYC 3FWYA 4M9ZA 2OCPA 2V8OA 2VIIA 3BXZA 3DM5A 4JMPA 5FI0B 2LWIA 4MITA 2MSEB 2G1KA 2NPIA 4UXHA 2F3RA 5L3RA 2GJKA 3GPLA 2O8FB 2JAQA 4LBVA 1NRJB 3FMPB 1UEJA 2W83A 1KK2A 4MKHA 4AWXA 3JZMA 3KJHA 3LH5A 2ZJ8A 3AGPA 1DAIA 4LJAA 4ZIRA 1KO4A 2E9SA 2QQEA 1QHIA 4PC6A 1XDBA 4JVNA 1E1QD 2O8FA 1E1RD 4CDGA 421PA 2PZGA 2X77A 1N5KA 1Q21A 1BS1A 3QEJA 4NKRA 1ZUHA 1Z28A 3FE2A 4BECA 2CHVA 2VL7A 4JLAA 4P32A 4ZIRB 4U02A 5KDOA 2P6UA 2IUTA 4Q48A 3RC8A 3CX6A 4MKGA 1XMJA 2BCGY 4LI0A 5FOVA 1E99A 3TLXA 1JEDA 2BHRA 2QG6A 3WYAA 2BMEA 5HR5A 4A0GA 1Z3IX 2XJ9A 5EE9A 3OIYA 2B92A 2CMKA 1M7BA 2IWHA 2GXUA 4DCSA 3ADDA 1WP9A 2NO0A 2ZJ2A 3OEHA 4OK6A 4Y0VA 4DLSA 3KQUA 2A7QA 3SQWA 5AUOB 4OI1A 2AK3A 3GLHB 2CVHA 1IXRC 2AFIE 3P20A 4UNNA 1IN5A 1KHTA 2BEJA 4YMWA 1P60A 3FOZA 1E9FA 2QNRA 4OJQA 4P4TA 3TK1A 4JBYA 3SJAA 3OF5A 3FHCB 4DCTA 4OHYA 3ZZ0A 1GOTA 3BRWD 1AKYA 2JIZA 3SC3A 1KKLA 3RRZA 3VKHA 2GBLA 1GDDA 1UDXA 2F7SA 3WY9A 4QGHA 4DDVA 4QNMA 5KSPA 2J0UA 5FBQB 2FV8A 1G8PA 2OUKA 1Z0KA 2WKRA 3P27A 2QORA 3S1AA 1P4SA 2W58A 3I8SA 4F7WA 4N3NA 2PX0A 2EW1A 1F2UA 4DIDA 2CHGA 1EXMA 1ZD9A 1Z0JA 1XJQA 2YYZA 2O0HA 5CDFE 1EFUA 5KTYA 1JQJC 3IHWA 4TYQA 1COWA 4NP6A 1WB9A 1DG3A 2J1LA 4I1UA 1CBUA 1R2QA 4F4IA 3PUZA 3M1IA 3GEIA 1XTSA 1EFCA 2LKCA 3EPHA 3EG5A 4GBMA 2ZANA 3RHFA 2KB0A 1VCNA 2XOKD 2MMGA 2BM0A 2FZLA 1SVKA 2QSYA 1OHHA 1JALA 1ZNWA 2FFHA 3AEZA 4QBIA 1OW3B 2WHXA 4TL6A 2J0QA 2ZRJA 4GNKA 3DVLA 1GG2A 4N0DA 2QAJA 1B23P 4AY2A 2P0EA 5DHAA 4IDNA 2HYDA 2BV3A 2AWOA 4FWIB 4Q7LA 4DVGA 3U60B 1NSTA 2LCFA 2NO6A 3LD9A 4BFUA 5JJLA 821PA 3EAQA 3EZ7A 4QM7A 2FWRA 2CDNA 4B74A 3BOSA 2FEOA 2BBOA 221PA 2VQSA 3TR5A 4JYCA 3IKJA 4J0QA 1TUEA 3K9NA 3B1XA 5DI3A 2YV5A 5FTJA 2E87A 1KTVA 3VFDA 1E6CA 1LFDB 5FTMA 1H8EA 1XRJA 2KBFA 1T3HA 4CEIB 3VMFA 5FFMA 2Z83A 3KJGA 3KFVA 4RFSB 3FFAA 4GI7A 1R0ZA 1X3SA 2PZFA 2IYZA 2UZ3A 3QKUA 4JZKA 5KDLA 5JWOA 1QF9A 3U7FB 4OYHA 1VYVA 2HYIC 2J3EA 4A2WA 1GTVA 2QGNA 4Q4JB 4LJYA 4FMDF 5EJEA 1E0SA 4BE7B 1QG2A 4POAA 2QT1A 5JS7A 1XP8A 4YXWA 2YOHA 1M8PA 4UQOA 4DCVA 1K6MA 2JLWA 2ZIAA 2J87A 2X19A 1MV5A 3VR6A 2H7VA 3HDTA 4LJ4A 1NBME 5CJPA 4JL5A 5AUPB 2ZVPX 4GOJA 1OH6A 3X1DA 4DSNA 4R2IA 1YZTA 5SZHB 4CEHB 3VTKA 1E2JA 5BN4A 3U4QA 1GKYA 2AL7A 3MWLA 3Q7PA 1JXOA 3QEOA 2O8DA 2ATVA 4LJ6A 1T0HB 1UKYA 3BB1A 4N1AA 2D2EA 4HUTA 2QGZA 4U7DA 3W6OA 2GILA 4D0NA 2D74A 1N0WA 5FOTA 5KSYA 4WVFA 3MSXA 3PUVA 1QRAA 4H1UA 4A82A 1TX4B 4L16A 4IW3B 2ZYVX 1FX0B 2BKEA 4LBZA 3GLIB 1Q3TA 1OSNA 2QP3A 1Z63A 1ESNA 4C0HA 4HLDA 4JBWA 4TMWA 1QVAA 1AQYA 2GEDA 3M6AA 2QL6A 2RAPA 4Q4LA 1N25A 4XOIA 5D3QA 1DELA 1HYQA 1FQKA 1FX0A 5KNDA 4LHYA 4L9SA 3MJRA 1OV4A 1DBSA 1U8AA 3VQTA 2ZRNA 4AIIA 2YWGA 4B3DA 3L0IB 2RHDA 3SR0A 2X1VA 1OFTA 1G17A 3KKPA 3RWOA 1MRSA 1Z2CA 2JGNA 4M8NE 3L0OA 1XNJA 2R44A 2H17A 4LYHA 1OJLA 3EZFA 1OIVA 1Q20A 2ZVQX 5D3MA 3W6NA 2IYUA 1C1YA 4XJXA 2X8AA 1H8HD 2BEKA 2YVUA 4XTCS 3BD9A 5AUQA 3CWZA 5KNCA 2ZE6A 1AN0A 2XXAB 3EC2A 1TADA 1G6HA 4C30A 3TSWA 3VKWA 1S1MA 1RVDA 2WICA 2ZEJA 4P3YA 2W6JA 4QGGA 5C2JB 1F60A 3WYGA 4A15A 4QXAA 2FPKA 4LHVA 4Q02A 3CH5A 3W8RA 1FTSA 1QZXA 4JIMA 3BBPA 5JRZA 2XXAA 2OO7A 1C9KA 2CVFA 2N42A 4FW9A 4Q4AA 2V4ZA 4HB4A 3B1YA 3K0FA 3PFIA 1TF7A 1CRPA 2DCUA 1DS6A 5FBLB 3QE0A 1UPTA 1D8TA 2ZI9A 3GFOA 3TBKA 3RS4A 2NZ8A 1KI2A 3EW9A 4DLWA 1G5TA 2P67A 1S3GA 1Y3AA 4HB2A 1V5WA 2GJAA 2HDNB 4JLPA 4BLPA 5EP1A 2XJ4A 1HT2E 2JA1A 3QKSB 3K0FB 4NYMQ 4QGFA 4LJ5A 4NMMA 3A37A 1VHTA 4FI3C 4B3BA 2ZETA 3EXAA 3Q5EA 3MWKA 5KHOC 5SZKB 3VX4A 3AKDA 3AP3A 1YZGA 3EWAA 3GEHA 5LPNA 5JJKA 1COWD 3WHLA 3GFPA 2O52A 4MUBA 5JCZA 3QKSA 1KOFA 1ZCAA 2OCYC 3OIWA 4M2LA 4P31A 3SYLA 4CVNA 5H8WA 1X8JA 1ZYUA 3B78A 2GK6A 1KKMA 1ZINA 4C3ZA 2FG5A 1E98A 1MH1A 3GLIE 4F38A 2VP0A 1VCOA 2IHBA 4C2TA 3GP8A 1RYHA 2CLCX 2WJIA 4DB4A 4CEJB 1CJTC 2CE2X 5FPKA 2ZRMA 2FFAA 1WBDA 4TQUS 2F43B 4PHHA 1Q44A 3RRYA 3FKSA 2VHJA 5P21A 1A82A 4B6FA 2ZR7A 3FTQA 4BLTA 2NTYC 3QVUA 3OAAA 3K0CC 4C0LA 1E94E 4OQNA 4D4JA 4GZMA 1IQPA 1JPJA 3HR8A 2CBZA 3GJ8A 3SU8A 4DLVA 1E0JA 3B82A 3HJNA 3B60A 4W7SA 5JEDA 2PEZA 2JDIA 5TVKA 2QN6A 3MWJA 1NMXA 4P0TA 4TT3D 3AVTA 4C0BA 5LD2C 2GZHA 1IY2A 1ZU5A 3A58B 4W5JA 3RNLA 5IK2D 5IRCD 3TNFA 1Q1ZA 1G16A 3SOPA 1U81A 3PUYA 1E2MA 1CR1A 2IWRA 2VP9A 3IO5A 1P9RA 4G5SA 2C9CA 5KOYA 3WNDA 2WPDA 3AUXA 1NY6A 4YDSA 4US0R 4XWOA 2HUPA 1T4GA 1ZVQA 3MFYA 5KU1A 2X2EA 2FSHA 1ZAKA 4GFDA 4OHVA 5KSZA 4YMSA 5CLLA 2CJWA 1XF9A 3GMTA 5C18A 2V3CC 1AQUA 3ZDQA 3CX8A 1CP2A 1QHYA 1E9CA 2JLQA 4PO1A 5DIFA 4HLUC 1KYIA 3D31A 4YXWD 1NLYA 1NNEA 2EU8A 4TLDA 2QP4A 3CNOA 1BYIA 1G3MA 1SULA 1LY1A 2P6RA 5HE9A 4IOJA 4BQSA 2IX3A 4F92B 4ZI2A 1KO8A 4RY2A 1TF2A 3CKLA 3U2QA 1IJFA 4TTRA 3THWA 4TZ0A 1OYWA 4LJ8A 2W2TA 3CX7A 4NDZA 1IN4A 4KI0A 1M1YE 4G5GA 1V43A 4WOPA 2FGJA 1WCV1 1VIYA 1G7SA 1PJRA 4TYPA 3FYHA 4DLXA 4KO8A 4U00A 2EVWX 1IXSB 3DZDA 4HI0E 4WA7A 2ZITA 4MDEA 3QNUA 3F8TA 3ZZTA 1U0JA 1OT3A 4HLQB 4C2UA 4PSVA 1G19A 1GP2A 1A2KC 2GCOA 1X86B 3GLHA 1RRCA 3OEED 2BMDA 1KSFX 2P5TB 3MUFA 2VPPA 3CIOA 3B2EA 4OQXA 1P3JA 1SXJE 3GD7A 4NYJR 5IT5A 1SVMA 1G3RA 1G8FA 4MGYR 4LHXA 3WMFA 1NLZA 2ZRAA 4DLZA 3RRMA 2Q9BA 3X1ZA 1SVIA 4WXPA 5DYGA 4QJ3A 2ODEA 4JBXA 2GEUA 2JIZD 3PIRA 3JVUA 1G3IA 4JJZA 2ZAMA 1Z5ZA 4LCBA 2O8CB 1I2MA 3EA5A 1G5PA 2ZJYA 1AS0A 2REOA 1PUJA 2RGDA 2Z6VA 4HB3A 3V00A 4ZCMA 3K09A 3QENA 1HH4A 5G41A 3AVPA 3CR8A 5H1YA 5JWRA 1NN5A 3PV0A 4IJMA 3K70C 2VHCA 4QHTA 1Q1BA 1U90A 3RS7A 2OXRA 3THXA 3CM0A 4QG7A 4WIAA 4NHOA 1ESMA 4W5HA 1RZ3A 2QMHA 2QMEA 4Q7JB 2QM7A 4BLRA 3ADCA 3BFVA 3MD0A 4OQLA 4B44A 1NY5A 4TYWA 2IS6A 1DAKA 3HU1A 2PCJA 4HATA 1WRBA 4DC9A 1QHHB 1W49A 3H86A 2OAP1 2C95A 1JJ7A 3QXHA 1VDZA 1ZBDA 1NN1A 3LVRE 1NIJA 2WOJA 4M1OA 2BJVA 4TZ6A 4UKDA 3DKPA 3B6EA 4TL8A 4YDHB 5JWHA 4WZ6A 2WAYA 1JEEA 1W2GA 4YQFA 4ASUA 2ZRFA 4PQYA 2Z4RA 5EZ5A 3EPKA 3EPLA 1XPRA 4DBLC 5GJBA 2WSSA 4YC7A 5SZJA 1G18A 3KZ1E 1TQ6A 4M1WA 1G7RA 3DM9B 1G8GA 1GKUB 4BZQA 1EFHA 2D4HA 3EWSA 4LYJA 4EPYA 2YWFA 1Z2AA 1W2HA 2B7BA 3LVQE 4AC9A 1E2GA 1KY2A 1WMSA 2AFHE 3NXSA 3CPJB 1OPXA 4O2LA 5F9HA 3KJIA 2C98A 4JLOA 1E3MA 1JAHA 3VU9B 2XGJA 1VTKA 4NE2A 2O8EB 2ERXA 3DHWC 2B7CA 1ELOA 2P5SA 4PPNA 4YONB 4HAXA 4IVRA 4CRWB 3LX5A 1N6IA 3CONA 2WVJA 4LYAA 2ERYA 2EWWA 5FBVB 3L0SA 2OM2A 3X1YA 1BMFA 2J9RA 2ODBA 1WE2A 3AP2A 2WJHA 1R8QA 3BFKA 1UJ2A 2V1UA 4Q9JA 2ZSEA 3BFXA 1FMJA 1OXVA 2NOAA 3PITA 4JSYA 4PHFA 1AA9A 3E2IA 4WBSA 4E07A 2YOGA 1P6XA 4IVPA 4A2PA 3ZD7A 5EXSA 3QBTA 3I5YA 1F3OA 2YINC 3TVTA 4LC1A 1JR3A 1CU1A 1T8TA 3B1WA 5AJZA 1W36D 3G0HA 2AN9A 4B48A 2QUZA 1CJUC 4LJ7A 2B8WA 4CEHA 3IO3A 2ZI6A 5FBRB 4OI2A 3LQRA 4PPFA 4HAVA 3CNNA 4D80A 4MRVA 3V4FA 4B32A 1XU4A 4R98A 5AJXA 1S9HA 1W46A 2K5UA 4RJLA 4DCUA 2H57A 2G9NA 1VKJA 2GEVA 1HQCA 2BM1A 2C9OA 2OFXA 1XX6A 2PLFA 4D0GA 1E2HA 3R9IA 2GESA 5CM8B 4R7ZA 1T6NA 4G0NA 1ZM7A 2QPAA 2G83A 3B8HA 2C78A 3AVVA 3PEYA 1UBCA 2HEIA 1EX7A 1D5CA 5AUNB 2J0UB 5CM9C 2ZJBA 2OBLA 1YE8A 4Q1BA 2FPMA 4C0JA 1MO3A 4KFUA 4ARZA 1CS4C 3S1AB 3OIVA 4K8OA 1IHUA 3KFXA 2FH5B 4LBWA 1XFAA 4KVGA 5HZHA 3LAWA 5SZIA 4C7OB 4P4UA 4F91B 2VP2A 3PXGA 5J4HA 3RYTC 3HYTA 4ARZB 1W48A 3CLVA 3IPXA 3QY0A 2C77A 1XPUA 2ZJ5A 2BJWA 3E70C 3N2IA 2GETA 3ZQJA 3GJ6A 2JLRA 3SJCA 3MAAC 4EPTA 3VAAA 4Q9LA 1E1QA 2BDTA 2YWHA 3KX2A 4XH9B 2QE7D 1SQ5A 1G4AE 3W3AA 1XCPA 3EIHA 2BVNA 3RS2A 5KO2A 1S96A 4HLUA 1UEIA 4NONA 2R62A 4XWAA 4R2HA 2KWIA 2ZJAA 4L9WA 4QM6A 1GFIA 3EIQA 2OFOA 1XJ0A 4JLBA 2DFNA 3ND9A 3AH8A 3W34A 2DWQA 3RABA 4PPQA 3H4MA 1U9IC 3FMOB 2VEDA 2GDJA 4ZDIA 3O8CA 4HAZA 2QRNA 1WA5A 1TQ4A 3AF4A 3NTUA 5DI3B 3I62A 3IIJA 4M1YA 2GCNA 1PLJA 1KGDA 5J4VA 2ZE5A 4RZ2A 5C4GB 1W0JA 1GZSA 1IAQA 2QAGA 3BC1A 1OH7A 1YKSA 5TDHA 1ETUA 1KJZA 1C4OA 4LYFA 3WNBA 4LPKA 4EJSC 2QMOA 1GM5A 5GJWC 5EE3A 3VR1A 1PLLA 2I1VB 4PQFA 3T5DA 2R6FA 4OHXA 2RB4A 1FPMA 4P4SB 4K46A 1SHZA 2QAGB 1JQLB 2IYYA 1XEFA 3WRXC 2VSOA 2ZYWX 3MWYW 5BYKA 3KKQA 2C04A 1GUAA 3WBJA 4BFXA 3SYNA 3VR2A 5G3ZA 2PJZA 1TF5A 4D0LB 3FFBA 3N5CA 2D3WA 4US1R 3C41J 4DUGD 1XMIA 2XNDA 5BWMA 1BKDR 2PMKA 1E4VA 5FOXA 5JRJA 3ICQB 3IUYA 4LWZA 2IBMA 4W5WA 1HURA 4ESHA 2Z0MA 1GRRA 4GMDA 1NKSA 3SN6A 1H8HA 5BN5A 4M1KA 5AK0A 1US8B 2AX4A 3EASA 1ZP6A 1KI4A 2O8DB 3GCGA 2FSGA 1RJ9B 2HXSA 2BMFA 1S1CA 3NIBA 4IDHA 3GLFE 5EP2A 3IBYA 1TU4A 4HLCA 2AKAB 1KI1A 5B2ZA 1US8A 2ORVA 1I4DD 5J4YA 1N6LA 3JZAA 4JLNA 3Q7QA 5L8VA 2JLVA 1NN0A 1T9HA 3ZS9A 3ETLA 1HT1E 3Q3JB 4KITB 1N0UA 2AWNA 4XD7A 4QRHA 3SJZA 2NMVA 4ITRC 2OFWA 4FIDA 2A5JA 4XVUA 4RVCA 2HCJB 2D06A 3PCRB 1TL7C 2V6JA 4TLAA 4FCWA 4HYYA 1QG4A 3RS3A 2RGNA 4HAUA 4D4LA 2NGRA 4TL9A 1DARA 2OCAA 2RGNC 2DFKB 3CUEF 4PHTA 2ZUBA 4AK9A 4TTQA 3KXLA 1P2TA 5DNYB 1IY0A 2IEZA 2B21A 2G0TA 4PAQA 1I2DA 1SVWA 1XCMA 3OEHD 3CZPA 1XCGB 4IDPA 3ZLJA 3F5FA 5L3VA 2ECKA 2CL7X 3IQWA 4QBFA 5L3SB 2RMKA 4PSAA 4Q7KA 1TEXA 1W7AA 2ZTSA 4LHWA 4OBEA 3WBKA 3WP0A 3T61A 2QROA 2PL3A 4KJZA 4TSFD 3NVAA 4HUQB 1CEEA 1UKEA 1QHNA 2BCJQ 1Z22A 4URWR 1N5JA 3ZIAD 1DEKA 1KIMA 3KJEA 2IYVA 4BFYA 2YZ2A 2CNWA 4X8HA 4D81A 3TQCA 1XXHB 4Q1EA 4R9UC 5LB2A 4LRWA 3NG1A 5FBWB 1E2IA 2REBA 1SXJC 2VYFA 1DG1G 1EGAA 1VYUA 3BH7A 4AYTA 3CWQA 4JJKA 4EUNA 1VG0B 4LV6A 3X1XA 2ZS7A 4Q21A 3C15C 4QBGB 2JDID 4KXFB 1T8UA 3GFTA 2ZXUA 5E7MA 3HR7A 5EXPA 3CF6R 5HPYB 4HEJA 1NP6A 1YRAA 2ODNA 2Q9CA 2HV8A 1XEWX 2C8VA 2H8KA 2WKQA 2ZRBA 2ZSAA 3C4JA 3W3ZB 1D2EA 1II8A 2XTMA 2R6GA 2J0SA 3HU3A 2PH1A 5KYKA 2NQ2C 3I4LA 4V0ME 3FHOA 1YRBA 2GXQA 4ESVA 3EIEA 1D2MA 2WWFA 3VR4A 3CPHA 4ZDKA 3R8FA 4ZCLA 5KPDA 1JJVA 3T1VA 4AI6A 4CGZA 2HJGA 2I1QA 3SYKA 2WM9B 1LB1B 2ANCA 4Q47A 1P73A 3PUXA 1YHNA 3I5XA 1IM2A 2OHFA 5JI2E 1LW7A 1Z0DA 1AK2A 4DDTA 4R71A 2PEYA 2V7QD 1TQ2A 4NCNA 1WBBA 1IBRA 2NZJA 2XTZA 5LBIA 4EPXA 2J0VA 2OBMA 2PX3A 4B71A 4AYWA 5B57C 2O8BB 3IGFA 1F2TB 4PO9A 2DY1A 4ZKDA 2OAQ1 3O47A 1KZ7B 4HDOB 4KBFA 5EP4A 3TUJC 4A4DA 4D82A 5JZVA 2IYRA 4JSTA 4C9BA 2CXXA 1ONBA 3NBZC 3AQ4A 3DOEA 2W2XA 5TMPA 4MDFA 2O8CA 3R7WB 4MRNA 4Q9IA 4QHSA 4PPGA 3DZ8A 4OKSA 1KO7A 4KBGA 1G64A 4JVMA 1ZRHA 4JT2A 4OI0A 1E2DA 5AWFC 3D6TB 4LGMA 3KQKA 4AKGA 1E2PA 2F9LA 3C8UA 4DDWA 3MRSA 1GVNB 2CCGA 2BC9A 2FPLA 3FVQA 3QOFA 1JI0A 2A5DA 3Q5DA 3UG6A 2V6IA 2XOKA 4EFNA 3SBDA 3CR7A 1YR9A 4LUCA 1E1RA 1HQYE 2ZRDA 2QTHA 2QPOA 3BE4A 1GNQA 3L43A 1ODFA 3AP1A 1X8LA 1N6NA 5LD2B 1A7JA 2WJJA 3KKMA 3RLFA 4RD4A 1R10A 2C9YA 2WMNB 5FOWA 1LF5A 2XB4A 4M9SA 1Z6AA 1TNDA 2W00A 3ZVLA 4AG5A 1JR3D 2R6DA 2WPDD 3OESA 2OE2A 4KAXA 1W5TA 3CW2A 3WXMA 1UM8A 1KJYA 1JXMA 1FNNA 1UBGA 5GVSA 5GJCA 3ZVRA 1M74A 1OKKA 1W0KD 2GXAA 1IJEA 3L0PA 4TL7A 2L0XA 3U7EB 1E9EA 2IW3A 1S8FA 4M9XA 4AKIA 1KDRA 4Q9HA 1LS6A 1Q12A 2CK3A 1L4UA 2AHOA 2B8TA 4M1SA 1FQJA 2XITA 4B6EA 1UBEA 4OQFA 1W44A 3DMDA 3VU9A 2W0MA 3RSOA 1CF4A 1KDTA 1Z0IA 3KB1A 1MKYA 3C14C 1CJKC 4NPHA 1HTWA 1KK1A 1SKYE 1VPLA 3N70A 3QJYA 3T15A 5IDVA 4CW7A 5FUVA 4NTZA 1E96A 1UF9A 3DDCA 3KL4A 3U44A 1NSFA 4E09A 4KLNA 4Y0AA 5EE0A 1U94A 2C5LA 2OILA 4D6PA 3A6PC 1S0UA 4M0LA 3PJRA 4KFSA 4A36A 4NYIQ 4NU0A 1DAHA 4TQAA 1BH2A 4RD3A 1Q22A 4RCZA 5G40A 3W90A 1ZJ6A 3PEUA 4KU4A 1VMAA 1LS1A 3LBIA 1OFHA 1R4AA 4FXPA 1XD2A 3U61B 4GL2A 1LVGA 4BFWA 2VP6A 4A0HA 1S2MA 3LW7A 3H1TA 2G3YA 3LDAA 1ZM2A 3A1WA 2D62A 4XSGA 4EFLA 4LBYA 4PANA 5HE8A 3IPYA 5CYPA 3TSOA 2VF8A 4NZYA 3N2EA 2OV2A 3DOFA 1W47A 1KSJA 3UWKA 1DAMA 1WDTA 2J7PD 1Z0FA 1N5IA 1MT0A 3FKQA 2R6AA 4V0LA 1W0KA 3DMNA 1F2UB 1FZQA 3T1TA 4BLOA 3KUCA 1ZIPA 4L5BA 1Z6XA 3HWSA 1L2TA 1KMHA 4Z8YA 4W9MC 4GMXA 4E03A 4HB0A 5G53C 5IHPA 2ZI5A 3LBHA 2CNWD 2WWXA 1TPZA 2Q3FA 4A1FA 3UWOA 5CK4A 2FU5C 1VIAA 4NYMR 2EQBA 3ICEA 1FL9A 1D9XA 4BLSA 2ZRLA 3DKVA 4C7OA 4URUR 1PLKA 1Z6GA 1M7HA 2QA5A 4OK5A 2QU8A 5J4KA 2ZS8A 4LX0A 2ZJOA 3NH9A 3EPJA 1Q3HA 3QXSA 1ZUNB 4B75A 3AVXA 2FZ4A 2DFLA 3GLGB 2RGGA 3HU2A 4PXAA 3OFND 5AJVB 5KNBA 1NKTA 1GRQA 3U7HB 3RRNA 3TW4A 3BS4A 3LXXA 4PC1A 1N6RA 4PC7A 2OCBA 4IVQA 3HPRA 3BB4A 2GVZC 1E0AA 2IF2A 4OK3A 1T5LA 1W1WA 1Z8FA 2CCJA 3MLEA 4NCHA 4Q1DA 1OXUA 2QMUA 5TXGA 3PVSA 4B3XA 4MGIR 4EDHA 4TMVA 3J81k 2ZSDA 5M04A 1KK3A 1S3SA 1K8RA 4Q1CA 4BRWA 1CLUA 1NVVR 1GL6A 4CEIA 1FUKA 4G5RA 1XMSA 2EFHB 3TJZA 3IILA 5ANRB 4A9AA 2WWWA 4TLEA 2IUUA 2JJ2A 1G8YA 4MRSA 3MMPA 2J5XA 1QHGA 1FFHA 1G5RA 4TMTA 4PZZA 4G01B 3M4YA 1RRFA 2G77B 2O8EA 3A1UA 1G7CA 2W6IA 2HF8A 4PQRA 1DADA 2F55A 3LBNA 4D4MA 5JSZA 1XZQA 4PAMA 3FB4A 4ZPXA 2OZEA 1T3LA 1U9IA 2JCSA 1QHSA 3RVBA 2VO1A 2GJ8A 2VP4A 4GRAA 4MA4A 4D2IA 1XMVA 1SXJD 4DRZA 4ZDWA 2IXEA 3AF0A 3THOA 3PG5A 5DH9A 3SQXA 4TN1A 5LB4A 4UXJA 5DN6D 4DHEA 1E79D 3JVVA 4IOKA 4URXR 3CF2A 1DAEA 3U6BA 5BW8A 3OIUA 4PSKA 4DUGA 4JLVA 2XSZD 4A0RA 2HXYA 3W5IA 1OB5A 2I4IA 621PA 2ZI4A 1Z6TA 2ZPTX 3B9PA 2R8RA 2DBYA 2WSMA 2W2VA 4MYUA 1E0KA 1KO5A 4G3XA 5DE3A 1FTNA 3BJIC 3M0EA 1J8MF 2IYLD 1KSHA 3UMRA 3MCAA 2GAOA 5E3HA 3C5CA 2QQ0A 1OXXK 1RJ9A 3K0AA 5EXXA 4E22A 3VNVA 1MRNA 5CB6A 3H84A 1NF3A 4NCKA 4B34A 3IEUA 1CR2A 4Q9KA 1EFRD 3A4MA 1SVOA 1XD9A 3IHLA 2RKOA 3FMIA 4HAYA 1RPZA 4H9GA 4OJKA 4ZO4A 3NBYC 4PC3A 2FFQA 4XD7D 1ZCBA 2RGEA 4JVLA 2H92A 1OXSC 2C03A 1UFQA 2G6BA 4BUJA 3B85A 2BOVA 1AM4D 2WWIA 4QOSA 3KKNA 1NMYA 2CL6X 3SFVA 4DWJA 3NDBB 4C0SA 2ZRHA 5F2EA 1GNRA 1GAJA 521PA 5E7JA 2ODWA 3AM1A 4LSGA 5FOSA 2FMXA 5CK5A 2J41A 1UAAA 2YC2C 5CJ2A 2V7QA 1FP6A 2ZM5A 1XEWY 2YHSA 1RIFA 2XX3A 4Q1FA
chains in the Genus database with same CATH superfamily
2BPOA 3EMVA 3GUUA 3HVKA 2XYRA 3OE1A 3QPVA 4UHFA 4URZR 1XU9A 5CIWA 1GVHA 4F5DA 2B3TA 2B8EA 4QXOA 3S68A 4IYRA 1FPQA 4DNXA 1YZQA 4JDPA 3TUIC 3WP1B 1C9YA 4E2XA 4DTCA 3HV0A 4B84A 1YB1A 1SKUA 2IEAA 4AZVA 4OHFA 1E4YA 2X3UA 4C01A 3L82B 1JHOA 1RHUA 3KWJA 3WYEA 2JGKA 3FLEA 2Y9MB 3H2YA 4Q1VA 4N6NA 3CLUC 4E0BA 4R1MA 5TQ0A 3GP8A 1I4LD 5C53B 4DT1B 1BFDA 4X71A 1C1XA 5BSMA 5TPWB 2ZCVA 1YNSA 3L6RA 5KTSA 4BDTA 5KTRA 3EC7A 3SSAA 1Z4LA 5AW3A 3CLUD 2IRWA 4JT4A 5AJUA 1K5GA 3V1LA 1YZLA 4LVNA 1D2GA 2X5OA 4MAFA 3FHTA 2FMUA 1F2DA 5AVKA 1P2UA 4A0FA 1JG2A 3OPYA 4RVSA 1SUFA 2VTDA 4RZQA 4KV9A 4V0QA 4FZWC 4ZV4A 3MGKA 3WQSB 1E59A 2QT0A 2VDWB 3TG8A 4EHNA 1R12A 4CKYA 1K89A 2HBQA 3HI4A 1VIMA 2P65A 1E61A 2NZUG 3PFWO 1J2JA 3VHXA 1M2VB 2AJBA 1TKBA 3GF4A 3QTBA 2Z56A 3PDIA 3ELWA 1JEAA 1SUEA 1VGVA 4RBNA 3U3MA 3SOZA 4M9QA 1FXUA 4LOAA 1E3IA 2O0KA 2CXUA 3IA2A 3WYNA 5IAGA 1CS0B 1JBQA 5TY0A 1T9GS 1PZEA 2OV4A 5KJ1A 3ZDDA 4IS2A 3RANA 4KGDA 5CH5A 4AKEA 1ND6A 2IUSA 1RWOA 3AIOA 3BZWA 2YJ6A 4R81A 5D84A 1IBKB 2X41A 2R47A 2Z5LA 4JLJA 4JV5B 1LDMA 1N2EA 4FGUA 5TQVA 5ADHA 4K88A 3BWMA 1S7GA 3RVNA 2BGIA 2Z2JA 1BHJA 1U8TA 3PC8A 1JLLA 2J3LA 4PX9A 2XD4A 3GHYA 3BJRA 1Y4DE 3Q88A 1K68A 3KSUA 4HFMA 4I99A 4AUKA 4U39A 2CUKA 3VPXA 2CFRA 3W9UA 1IPFA 2FGKA 3P4UA 5HS6A 1KI9A 1GSOA 2B34A 1E1NA 2EKZA 1TM1E 2OSBA 3LP6A 4RDCA 4V1CI 5KWEA 3HVIA 2XCOA 5DASA 3X2SA 1V39A 3AY0A 3ETDA 3T1QA 4FYHA 4L73A 1PGQA 1OI2A 2CVQA 4KAFA 4TTTS 2FSFA 4P22A 1CJMA 5EUQB 2WQ6A 4U9HS 5ELXA 1ST3A 4I36A 3NAZA 4EPVA 3WFJA 4KFRA 3VR5A 1E2UA 1ZEMA 5TARA 2OLJA 1LLDA 5J47A 1Q95A 3W8NA 4JQYA 2QJFA 1TA4A 1GPNA 3M9LA 3R8CA 3W2TA 2H5EA 3FWKA 3E1KA 3HS3A 4Z1MA 3FGOA 4BYGA 1G20A 1ACLA 1RPJA 3IULA 4CZ2A 4MV0A 1FRZA 2VAMA 2Z8YA 1EUCB 3L7YA 1XDSA 2N3ZA 1RE0A 5JH7B 2R00C 4HUJA 1GPMA 3TOZA 1QTRA 4YNBA 4QZVA 5K01A 2ERCA 1JAZA 1FNCA 1M2HA 1R66A 2HCRA 3ZXUB 3CZCA 2D1SA 1E3TA 3UK0A 4QHYA 5HSGA 3TQIA 2XUPA 4QBTA 4EGFA 1PV1A 4E11A 2HTFA 4BMSA 2H4ZA 3LV8A 2BSQA 1YKGA 4FFBB 3N3AC 4G85A 4KUHA 3BJZA 5EHXA 2M6SA 2I8AA 2P9TA 3O8OB 3QFSA 1V96A 1XRQA 4HZIA 5LZ2A 1W88B 2C2HA 4QUKA 3K0CA 4WEQA 2D7DA 3ONFA 4IICA 2BONA 3SWXA 3FOAA 3WLLA 3IAUA 4F45A 1JECA 3FLMA 1GKKA 4ZCPA 3W5HA 4UXIA 5E6RA 3KZCA 5FTNA 3D0OA 2M1ZA 5I8ZA 1GUZA 2X0FA 4RPIA 5A0TA 3SBOA 1C7EA 3K1AB 1E6WA 3GROA 2A4KA 2C42A 4WLVA 2G17A 3DAYA 2IV3A 2IEBA 1NHGA 2R68A 2V7VA 3L1VA 3P0EA 1X8KA 4L57A 1N2OA 1U4NA 4L9AA 1E69A 1V71A 3S2FA 5K6TA 4F8JA 4DKJA 1GL7A 4WXEA 2Z3WA 3CS3A 3ZWKA 3FNHA 4FYWA 3ZNQA 1FTGA 3C5HA 4MVWA 4W9RA 5GOZA 4JI6B 2DYKA 3JWEA 3U3OA 4UUAA 4OHWA 2ETVA 1F48A 5AI8A 1XNQB 3HACA 3JD1A 3ZIAA 4FN4A 4L7QA 1UJNA 3LYHA 1AV7A 2YXEA 2OCLA 2VP3A 4JOSA 1FXWF 3OT4A 2FQ1A 3S2SA 3UM9A 3FLAA 4MW5A 5E6UB 2V0GA 2JLYA 1MABA 3T0FA 4EJSB 2FEAA 2O4CA 3I92A 5KX5B 1J70A 1ULAA 1UXIA 4D26A 1J39A 2P3SA 4RM3A 2A9OA 4XB6B 4B09A 1M6NA 3NQ41 2JKVA 2BMJA 1J1IA 2WT8A 1MB9A 2DWOA 3DOHA 4N9WA 5D01A 1FSGA 3N9IA 5BYJA 3I09A 1P4AA 1XD2B 5FWNA 1NI3A 2E4WA 3P5MA 4XVHA 3K4QA 4JBIA 4YRQA 1ZSYA 3QVTA 1FBTA 2Y1FA 1G2PA 4XLTA 4QVGA 3TJRA 1I5EA 4INAA 3N0XA 4U5QA 2CC2A 1BFKA 4CEJB 2AB0A 3K9WA 3PL5A 3UAXA 3RSLA 4EKEA 1W85A 1EF8A 4PYKA 1VG9B 1QAOA 1BE8A 2HMAA 4AS1A 4XM0A 2VC2B 4NL4H 4HAWA 2JI9A 4MPJA 1JDUA 2Y6UA 3Q6NA 1KI3A 4FVTA 4FYKA 2VPXA 1DJOA 1P9LA 3G5MA 3AETB 4V0RA 5BQPA 3R9KA 4YWHA 4X8OA 3ZDRA 1H6CA 1RADA 1W0JD 2WWGA 4DC0A 1H0KA 1JQDA 2EOAA 2H8GA 3Q3GE 4DR6B 2DH6A 3GUYA 4O8ZA 1TIKA 1PWEA 1AK9A 1ZIYA 5F7OA 2O2ZA 1U2RA 2VJYA 2Y99A 3KUKA 2V0NA 4QREA 4R5MA 2BI7A 5CTJA 4B2IA 4CODB 4ZN6A 4NXNB 2HJRA 2A3RA 3G8AA 4KQMA 3C1TA 1JDZA 4LOJA 3MT7A 3DLHA 1LV8A 2Q46A 2DPGA 1UDRA 3WGQA 4RZUA 4XIJA 3AUYA 4ZGGA 2YOFA 2OGUA 3QA3E 1C9EA 4HO1X 1CRLA 4L2IB 4QU9A 3TZEA 1QXSA 1D7AA 4JI1B 3N8IA 3L8ZA 3KDPA 1EFAA 3L1IA 4J0DA 1AS3A 1CDDA 2G4CA 3HZHA 5HZMA 2Q27A 1Y8QA 3PWSA 4FFRA 1JNXX 1HV8A 4RD2A 1WPRA 1OGYA 1C30A 3A1NA 3CBGA 3EDYA 4I2VA 3AX6A 3RC3A 3VNQA 1KR5A 4G0YA 1G2OA 1W73A 2B4RO 1TTHA 3JU3A 2W6QA 2PUBA 3WHKA 2XSZA 1FLVA 1DJLA 4IDOA 3KQTA 2NT4A 5DVZA 3ZTTA 3B1KA 2GJ9A 2VPZA 3EIWA 4H4CA 4E94A 2DH5A 2WG2A 2B0JA 2V54A 3IDZA 1NP3A 2CYBA 2OT3B 4B4OA 2GWRA 4C7VA 3ZU4A 3LNTA 3NHFA 1H66A 3Q9LA 1ZC3A 4HQOA 3LT4A 1LPPA 1H2AS 2NXJA 2UVQA 4ONEA 4BO3A 2B78A 1P91A 1XO1A 1ZXXA 3KR1A 2P2NA 3QXGA 3AHGA 1OBOA 4RU1A 3A1TA 3EEIA 4PR3A 3UKJA 3ZJ4A 5ABPA 1FOEB 4MWEA 5K3DA 1IRIA 1GWNA 4WQMA 1P4HA 3LPDA 3R6TA 2AXEA 4Q00A 5CXSA 5TMDA 2MTBA 2NPFA 4I6JA 1X7GA 5F7XA 4RF4A 4QODA 3MAJA 3I0MA 3CLSD 4Q7QA 4DLYA 1YBHA 1CFZA 2JJ8A 1ECGA 1YIDA 2DLDA 4QC2A 1JIXA 4QUAA 3QEAZ 1P7PA 1JQ5A 2YNMC 1DXOA 3W6ZA 2EKPA 4HTAA 4EY3A 3L8HA 1YFJA 3TE7A 3O1HB 4MW9A 4ISCA 4CTKA 5DSZA 4X24A 1W4BA 2DXIA 4EG8A 4FGJA 3OF2A 2YNMD 3STWA 3N6VA 1LLUA 2GRJA 1TO2E 4Q9DA 1UM9B 1KVTA 2BGNA 1Q7RA 3D64A 4TLBA 1WKBA 3KPWA 1YAJA 3K9GA 5IWAB 1JW9B 1PSWA 4JYLA 3STVA 3IOYA 1BCSA 2VHUA 2X5XA 3IUBA 3P9SA 1EWVA 4IXWA 3E1GA 2IKSA 3UA4A 4FZ5A 3PJFA 1G9XA 4YCCA 5ESWA 5FA6A 3VO8A 1ZL0A 1K8YB 1UBOS 3K09C 1HYBA 4ZOQI 4XPIB 1D1SA 4R40A 2FE1A 3DTNA 3JRWA 2ET6A 5LWQA 1FIUA 4J49A 2FF5A 3LSTA 2WU3A 2H3HA 2OD9A 1DJNA 5DISB 3IL2A 3WL3A 1Y1LA 4UQPA 1H93A 2QDKA 2WIFA 1E3JA 2QJWA 3BCRA 4DLUA 1KJNA 1W5SA 2FPPB 1VL2A 1TI7A 2AFHB 1ETHA 2UUPA 2WMOB 3PGA1 4JGGA 4Q4HB 5IDYA 5JAMA 5HKKA 2VYVD 5GONF 4J0JA 1G60A 3WMEA 5AKEA 4X1IB 3F4BA 2RSLA 1Z75A 5DFAA 4K6KA 2PGIA 1E58A 1Q0RA 1CP3A 1SFRA 2ONKA 1X9IA 2OBBA 4K28A 3ETNA 3IP3A 3QXXA 3IV7A 1PT7A 1PZNA 1WVIA 1EWQA 3H65A 5KHAA 1U11A 3D3JA 4WN9B 5GZ6A 3QWFA 2BHLA 1C8KA 3PI7A 3F73A 2ZJ3A 3GLRA 5AKIA 2BGMA 4IH9A 4B7AA 2C5SA 3D6FA 2YN4A 1QO9A 1D2NA 2HMUA 1WIWA 4BNNA 4FYVA 3Q9UA 4ZI3A 3PUWA 5U4XA 3HYLA 5LVAA 3JZFA 2OV3A 4JGIA 4I9HA 4IDCA 4NG5A 4BGDA 1QQAA 4W1PA 3QKTA 3HYSA 1L4YA 3ND8A 2IEYA 4J43A 1M2NA 4PONA 1S9DA 3RDPA 2G63A 3L77A 4KQ2A 1JKXA 4RTQA 4P8RA 1FFAA 1PGOA 1VP9A 2JJ2D 3HO8A 4RLFA 1NLUA 1T5IA 1G4UR 9ATCA 4PFQA 4YMTA 2FW9A 3RC9A 3A1VA 2FAXA 1A9TA 3F5SA 3LDGA 2BH9A 4GOKA 3REGA 4Z4HA 4D99A 2FZGA 2AD5A 4MUJA 2MCFA 5NULA 4MR7B 4BV9A 5CEEA 1AZSC 2QTVB 2PLNA 1Z0SA 3I8XA 4W82A 2ZE7A 3BMNA 3O2SB 4P93A 1C3XA 2YASA 4L4ZA 2X6TA 1P9NA 3LF1A 2EFEB 4UDNA 5JJIA 3LW8A 4BS9A 3CRQA 1ZD3A 2JJ1D 1XG5A 1TTTA 2DWPA 4MQEB 3IHKA 2R7NA 4FWTA 4KWIA 5DHQA 2FPGB 3T3DA 4BMXA 2XGOA 4JL6A 2B37A 4CT4B 4GPTA 5JSQA 1WZ2A 3CPEA 4QL3A 3TOXA 5DW0A 3E7PA 4RD6A 5TQ0B 3VX3A 4OH1A 1JHAA 1DC5A 1NIPA 2AJTA 4EEZA 3N59A 4NCJA 5IMSA 3ZZMA 4JROA 2P4SA 2XOEA 4ZI7B 2XCTB 1N1GA 1JR6A 5G0TA 3UUWA 4LF7B 1QIGA 3QX7A 4BEBA 2NUPA 4KXWA 4LJ9A 3HDHA 2GF9A 3JY6A 5JSZB 4A6XA 4FGZA 2SECE 3IEVA 2AR0A 4OREX 5E3IA 3NDPA 5EFOA 1VKOA 2VYQA 3U3JA 4KQGA 3EXEA 4MVJG 1HL7A 2VJDA 4ZJUA 4CIBA 1RU3A 2PV0A 1N6KA 3GY0A 3K92A 1WPXA 3O7WA 3PU6A 4LW8A 4NATA 4U2GA 2D7JA 3IBCA 3QW2A 4KAJA 3QHPA 3BHNA 3HB1A 4F3RA 1RYFA 4BNIA 1NUHA 1V11A 1VPVA 2FWNA 2C29D 2PYIA 1DU4A 5TB5A 1OYYA 1GD1O 5EZQA 2Q6IA 5IJAA 2C58A 4B45A 3TLKA 3F49S 4AXXA 1Q1NA 4RTPA 3NWPA 2FA9A 4BE9A 2AQHA 2Q49A 1G1MA 3VJMA 2OV8A 1K9SA 1Z5NA 4BFSA 1UT6A 3NBAA 1Y4UA 2NO9A 3I9FA 1PTKA 1MG5A 3BMQA 4B2PA 4DDUA 5I51A 3LXUX 2JFBA 4M1MA 5CPBA 3LRPA 4O33A 4X7RA 1N6OA 3QEMB 5FLYA 4BQIA 2Y67A 1U3UA 3HJRA 3WK7A 4XQGA 4NAVA 3OM9A 3DMFA 4YMLA 2FE4A 1V4BA 3HBJA 1AIPA 1XB2A 2PT7A 1KMQA 4UAJA 5T57A 1L5FA 3I61A 3F4LA 4C29A 1CY6A 4D44A 2QG4A 4ECEA 3MMSA 1Y64B 4X65B 3CT4A 3KIPA 3WLOA 5IEBA 3PUIA 2NO7A 4DMFA 2Q2WA 3TRHA 3E7FA 1FS6A 2BJHA 1NMZA 3K35A 3RTDA 6REQA 5B64A 1TB4A 3M6LA 4DLKA 2ZCUA 4J3NA 8OHMA 5FPTA 4PFSA 4RFSA 1I1HA 2KSQA 2Q9AA 3JAWB 5LZ7A 2QJRA 3ZJ5A 2R8YA 2MIIA 2P3OA 2Q0SA 4OHCA 1QIMA 2IYWA 3KQHA 4MUKA 3EBLA 3SEAA 4QECA 1JJFA 4S2UA 2JPDA 1NQOA 1CT9A 1JB1A 2BDEA 2HCTA 5F52A 1HT0A 3UUFA 2I62A 3PNQA 4AKHA 2PTGA 3SVTA 2GLUA 1YRQA 1S8AA 2QX4A 1GDTA 2EZTA 1O6ZA 3LLUA 3UC5A 2BWJA 1J8DA 3AUJB 4ACBA 3TR0A 4YJFB 1P2SA 2LIPA 1TKCA 4BEJA 1UPFA 5KINB 4R6XA 3GFFA 3PEWA 3VHLB 3ZS8A 1K8ZB 3OZRA 1V1JA 1UK6A 3FVWA 1YT5A 2JH8A 2BR3A 2CNDA 2I4RA 2IIBA 5D85A 3OE4A 2H63A 3ZX4A 5F98A 3NNNA 2ZUTA 1KRWA 1C8BA 2JIRA 3PVZA 1GIAA 2J7PA 3C3DA 3X1KA 1LI7A 3DT9A 3H5TA 1DFGA 2FOLA 3LWDA 2WG0A 4HXFB 1G9TA 2HQRA 3LCVB 3FRHA 4O1IA 1QZTA 3KB6A 2AK2A 4AECA 1GGNA 2CV0A 1EDBA 3RHZA 5C8ZA 1I9GA 2DF8A 3QF7A 2A14A 4JYBA 2V9ZA 1P0FA 4URYR 1GZ5A 4PCVA 2HOQA 2E4UA 3JD3A 1K6XA 3GXBA 1ZVVA 1GKIA 4O5AA 1XTRA 2JH9A 1H5NA 4RE5A 3VH1A 2JAOA 3EIFA 4U3JA 4I9GA 1KP9A 1RABA 1RYEA 3EGXA 3PDCA 3D5TA 4W1SA 4MUHA 4F93B 3UWDA 2IYSA 4M1QA 1UXOA 5B3JC 3FROA 3BORA 2I80A 3M4ZA 2BRUC 3N8NA 4G4JA 4O2BF 5DT9A 6Q21A 7ADHA 4XQ0A 1FU8A 4EFMA 1V0JA 2D3TA 3FDJA 3COSA 5IAEA 2NU6A 5MN4A 3K3PA 4NZNA 3BH6A 2XNCA 3QJ5A 4RPHA 2M6LA 1Y8RB 4YUXA 4BVAA 2GTRA 1BN6A 1HDCA 1DAOA 2Z4SA 2MSCB 1OVMA 3BH0A 3CY6A 5A71A 3QG1A 2WJ3A 4WW0A 1RRPA 4IGFA 4WCVA 3UFXA 3O3CA 1LSUA 4WZAE 4E13A 3GJ0A 3L9XA 3TRDA 3UK1A 2W42A 2LTAA 4BX2A 1WLYA 2A9JA 4LN1A 4M0PA 4F06A 1GR0A 3HDVA 3RT1A 1JTVA 1P7ZA 1KZGB 1AKQA 1Y63A 4F5EA 1Z18A 1BEZA 3U49A 1N3BA 1VPEA 3G2QA 1BJRE 2VT6A 1ADJA 2ZSBA 3DSRA 4KLCA 1Y6FA 4N7RA 4E30A 3NOXA 4EMUA 4BXOB 3TMYA 1H4TA 5G1NA 1NBMA 5JYDA 3BHIA 1BH6A 3CISA 2DPLA 1SIBE 2P2SA 3C98A 4JEHA 4PS0A 1KWGA 4WLNA 2NG1A 4GX5A 4U7FA 1VG1A 3AFMA 1HETA 2HLPA 2UXBB 1U0LA 4I4ZA 1RJWA 3HV2A 4B6OA 2QX6A 4LZZA 3MINA 3MMNA 3LO8A 2H18A 3JTMA 4RW0A 4KN8A 3SI7A 4A8TA 4OI4A 1I1QB 1EX6A 4KE7A 2JZOA 4KIWA 1E2NA 1RAGA 1QVZA 1U80A 2CUZA 1FTWA 3IT1A 4PZCA 1TAGA 2VAVA 4XM1A 2ZRCA 5E0OA 3DZBA 4IZBA 2W6MA 4F3YA 1CIJA 4IJ5A 3ZTWA 4LVUA 4O8CA 2PGAA 3DB2A 5AVQA 4A92A 2X9QA 3FW1A 2WJ6A 1WF3A 2Q6OA 4N49A 3HPQA 5ENZA 4EBBA 5BV1A 3TAHA 1YQWA 2ZBVA 1TMKA 1MF7A 2ZVJA 3OTWA 5IPFA 3OZUA 4MV9A 3WRYA 1I7NA 4NU6A 2J46A 4C6SA 1G8AA 1X1AA 4NHEA 1OT5A 4ZZ2A 3UCXA 5JASA 2Z57A 1ZMXA 5JEEA 1P4RA 1BGXT 5IW8A 1EFPA 1OH8A 3FTCA 4XA8A 5A4IS 1HM5A 1MD9A 1OXBB 1P6QA 3Q8XB 4QDUA 1QQBA 4FR5A 2XUJA 2QJTA 1R5OA 2Q4BA 3ISTA 2PT5A 2QD5A 4FNOA 3Q2OA 1JAIA 1BWQA 3RUHA 5C1BA 3THYA 3LHKA 2I9PA 1T2DA 2FNAA 1ZIXA 2IIVA 3FPGA 3K5PA 4XDYA 5EEHA 3RVDA 5IZCC 1XHFA 1IQRA 2A9KA 3AF6A 3O3NB 2I4TA 4OTZA 1DOZA 2IHUA 1Z34A 1G8HA 4A6PA 3HVRA 4LQ4A 1D6JA 4X63A 2CHEA 2C3PA 3HCRA 1Q15A 2HNAA 3GDGA 4DYHA 3F6EX 1QSGA 5JALA 1A9QA 1KC1A 4R8LA 4TVKA 4ZAWA 3RAEC 1D6NA 5A1JA 3VNUA 3FAKA 4R2JA 1CYDA 2GAIA 4MNTA 4OJTA 1IZ9A 1F06A 4CKWA 1UJ5A 3U3XA 4RIHA 3JZDA 5DNAA 4KXLA 4V0SA 5FF9A 2R3SA 2ZBQA 1EZZA 1HDGO 1RJMA 1X7ZB 1NNUA 1YDMA 3V2HA 4J0KA 3KJNA 5I4IA 2FUCA 3LE8A 4OV6B 3W2HA 2JLZA 1GY8A 3Q0GA 1ULBA 2F43A 2ZYTX 4ZVKA 5DCYA 4RCYA 4II7A 4IEFB 2WSSD 5D5HA 2GUGA 2Y77A 3AR8A 4G0WA 3DS8A 2NYRA 1E2QA 3DWFA 3KTAA 2I6SA 2QM8A 3EGWA 3H4VA 4Q18A 2PLRA 4LDQA 4RV5A 5CA0F 5JFOA 3EEFA 4YI3A 5HIAA 4MTCA 1DKLA 1E9DA 2RHBA 1CVIA 5JH7F 1M1YA 1Y9DA 3DF9A 4PWYA 1U3FA 1K5PA 4PY2A 1FLDA 1THGA 2JLUA 2J3KA 1GKLA 3GRAA 2HA6A 4RGQA 5F5NA 2X9GA 2DECA 3HMQA 3C97A 4UFNA 4AVYA 2VCHA 2GO1A 4GKAA 1SVLA 2R5WA 4X9XA 1VI2A 4O4JB 1SA0A 4N03A 3ZXYA 4RH1A 5A5EA 2LE0A 4DKXA 1TQDA 4OXKA 2C2MA 3F0TA 1QGZA 2RIRA 2FSVA 3L7AA 2V4UA 4K87A 4P7BA 5HJ5A 2QAIA 3FPKA 4B83A 4AX8A 2JLSA 4RX1A 2A78A 5KQSA 4NULA 1Q14A 4LSZA 2CZCA 5KSOA 2ZYUX 4TMKA 3G82C 5FPSA 4IJWA 4IMPA 1XXLA 3UK2A 1EK0A 2AF4C 4ND7A 5CFLA 2YKGA 3BMCA 3MHTA 4EX7A 2WYWA 1WNFA 2W7TA 1O9BA 4CG2A 2WMYA 3ZHUA 4PYMA 4P3NA 2V5AA 1T2EA 1UXHA 4F4CA 3AKCA 3TF5A 2OB1A 4PVCA 2PD6A 3IIMA 3O7MA 2G4LA 5AJWA 4ZP1A 4OLBA 3KTDA 4FC6A 4C03A 4GXNA 3TE6A 3SZGA 1IEQA 2JVKA 3NEAA 3OCUA 2Q3LA 5TQ2A 1DB3A 2ZUWA 1T9DA 4R1NA 2SBTA 1T91A 3AR7A 3VNSA 3R5SA 5JSUA 2B2XA 3DYBA 1Y7HA 2RGXA 2A6PA 3T9DA 3ZQ6A 3MERA 3H9BA 4E51A 2GHRA 2B5WA 2PZEA 3AKYA 5IVDA 3RW9A 5HJ7A 2BF7A 4TUYB 5EGNA 4ZYVA 2I34A 1GQOA 3VR5D 3UB3A 1GZUA 4KQHA 1QUEA 2ZIVB 1O87A 4L15A 5FI1B 1O7JA 2GYVA 4I1SA 2EJCA 2MYNA 4ASUD 1E20A 4U6SA 4EQ6B 1XK6A 3B7GA 3CRVA 1W94A 3CZQA 2G25A 1JA1A 3MTQA 2GTPA 1Y3BE 4BASA 3KUXA 1NJFA 1ORTA 1EIZA 1RI1A 5KPJA 4JODA 4MCIA 1ODCA 1SC1A 1UXJA 1Q0UA 2BBSA 1YAHA 2FRDA 2GBLC 3IOBA 1YQXA 3KTFA 4GMKA 4M0DA 5JLJA 3IQHX 2XXBA 3PPXA 1MX3A 1VL5A 2ZRIA 3C0KA 2FN7A 1QH9A 1U6KA 3GUZA 2EWVA 3W9YA 3CO5A 3OA0A 4WLFA 3A2NA 4HL6A 3ED5A 2TRSB 3DE3X 3E18A 5LXTF 3VGPA 1UBUS 1DCIA 1DE0A 4CT5A 5IYZA 2C99A 2C4KA 3R1IA 1MEOA 1N5LA 5F35A 3WWPA 2GZSA 1VMEA 1PJQA 3LC0A 1EYZA 4BLUA 2DOKA 5JPCA 3TPCA 4AD8A 4X8LA 4BP9A 5FPKA 1P1HA 3PTLA 1VBMA 2CLFB 4RD1A 1HQKA 1Y7LA 2VH5R 2OCIA 2GF0A 3PVCA 4D3ZA 3CH4B 4DB2A 4GE0A 3P9RA 9LDBA 4MAAA 4F9TA 4XYGA 3TNLA 2ZI3A 3S5UA 1J22A 3I52A 2PXAA 1ZVJA 2QE7A 4X6LA 3LKBA 2TMKA 2NSLA 4ZVMA 2O7QA 1FXSA 3WR5A 3U4AA 3WGUA 1JQEA 4MP3A 3W5JA 2Y92A 3T3NA 1GQRA 3D1JA 4CQMA 3QLUA 1OXMA 4IOMA 4DIUA 2GLTA 1HE1C 1ES9A 2HA7A 1OA1A 2EL9A 4EMSA 1G38A 1QZZA 3NYQA 2XECA 4NABA 4U2FA 1IY1A 5KDDA 2CYCA 3I2GA 1UMKA 2HLDD 4CN8A 3WS7A 1F4LA 3ABIA 1OBHA 5HKLA 3OEEA 4MIEA 3AIMA 2HU5A 4L72A 1FUUA 1P8JA 3PCTA 2L42A 3CZ5A 3G7NA 3I5MA 3L7CA 1HFKA 3BE8A 5AW9A 1ARZA 3ZHSA 3NWOA 4Y2PA 1XTVA 2AF3C 5E9AA 4U6QA 5JHHB 4R2LA 3M6WA 3UFBA 1FDOA 1LX6A 3G5TA 2Q2OA 1RXUA 2GZMA 3W6UA 1QHHA 1Z16A 4XTRA 1JDSA 4LF4B 1FJHA 1YF3A 4CF6A 3WMGA 3FETA 4XSHA 4NR0A 1W25A 3ESDA 1GPWB 1P5ZB 2XKJE 1EJ0A 1QOQB 1PHRA 3MTAA 1ISIA 1HSOA 4P7JA 4BWYA 5LQMA 1YKFA 3N8KA 4EYEA 2J7KA 4YCDA 3SDZA 5LQCA 4UM8B 1JILA 3Q11A 3WRYC 1V5FA 1DTWA 3DHEA 4XJSA 2OCPA 3MTEA 2V8OA 4HGZA 4EI2A 1ZVMA 2PZ8A 3SPXA 4JI0B 3D3WA 3MUNA 1HDEA 1IM8A 4TKZA 4ZO7A 4KRYA 4BEWA 4MCJA 5AI5A 3NHRA 4Q3OA 2MSEB 4QARA 4UXHA 5L3RA 2F3RA 3GPLA 1NZYB 1QCYA 2IP2A 4DR4B 1HTTA 2DR0A 3SSOA 1NW8A 4EGCB 1I7PA 3PC2A 1TDJA 3QYPA 1FS4A 4G56A 4ISBA 4X1KB 3WJ2A 3WK8A 1LDGA 3IUJA 4R3UC 5KCZA 2E9SA 2QQEA 2IY9A 1MAAA 1Z0ZA 2BGTA 3MSCA 1E1QD 2WFLB 4IR7A 5GQSA 4BCDA 5JC1A 1WZCA 1YVPA 3EXG1 2C3UA 5U4QA 3U9TA 4RA9A 421PA 1SXHA 1N5KA 3WIOA 3VPHA 3MPOA 1BS1A 4NKRA 1X9GA 4B7ZA 3W8EA 3GA0A 1ZUHA 1Z28A 1V7PC 5CFRA 2CHVA 5KNCD 1ZGJA 2PZAA 3OSUA 5LQAA 2IUTA 4OHBA 1XMJA 4LI0A 4JCOA 4DV6B 5AKJA 2BHRA 2WM8A 3WGIA 2D5CA 2H06A 4ZGWA 3E0QA 3INRA 2BMEA 1NUQA 1SCUB 1Z3IX 2V6FA 4DQVA 5EE9A 1RWXA 3AU9A 1IH8A 1T5OA 1RHMA 3CKYA 4ND8A 4TOIA 3PPWA 3Q5GA 2YBDA 4OK6A 2GEKA 4G86A 2FWAA 3IP6A 4JB8A 3SQWA 3KAPA 2HR1A 1RAIA 4YUAA 3EZXA 4OI1A 2VPQA 2IOHA 4KHPB 2IU3A 3GLHB 4UNNA 4YT5A 3KO8A 3RRBA 1QVVA 5IJXA 1AK1A 3LA8A 5KJCA 4BO0A 3EMDA 1P60A 3VTAA 5F51A 2OMKA 1E7RA 3PNOA 1E9FA 1CUXA 1MQ9A 4IX1A 2E4XA 3TK1A 3SAJA 1DX6A 3SJAA 4UBJA 2NUBA 4S1TA 5FULA 1TLLA 3FHCB 1U3TA 4DCTA 1YJAA 1YVRA 4YT4A 1GOTA 2QX7A 2C31A 4HQKA 2HA5A 4WFKA 2JIZA 3G2HA 3O92A 1KKLA 4UDOA 5HX7A 4HQLA 5T6BA 4QGHA 3EH1A 4DDVA 1O94A 4M88A 1IBMB 5T3YA 5KYYA 1FW8A 2J0UA 3HBMA 3WTBA 3HB5X 1UMDB 3DV9A 3P27A 3GDWA 1VHJA 5LDHA 3B6KA 3W8IB 1P4SA 1PZGA 1QGUA 4N3NA 4PPYA 4DV4B 3BZUA 3VHXB 1F2UA 4DIDA 3M5WA 5BSKA 3T4XA 4RTNA 1ZD9A 4N12A 5CDFE 4BAGA 1JDBC 3UXHA 2RHOA 1SR8A 3IHWA 4XEUA 3TSYA 3ZBTA 5AESA 5K0GA 4NP6A 1WB9A 5DM1A 2BFBA 5KJFA 1CZNA 1TMOA 3WWZA 4M36A 1EFCA 1E3QA 1GCGA 1MIHA 4H7FA 2B35A 1OX5A 3WLQA 1T36A 2D2XA 4JT9A 1V5GA 2Q3JA 2XE4A 3RHFA 2VHZA 2B82A 2MMGA 5DWVA 1RRVA 3HFRA 4JVOA 3TIIA 1SVKA 3AOGA 3TW0A 2BUCA 1OHHA 2XMGA 3OX1A 1DBIA 1U8UA 4HYTA 3WX0A 1KZHA 4BATA 2VHEA 4KO4S 2RK4A 3WKEA 3CLRC 4IGEA 1NDUA 5FPPA 3L4KA 4RKWA 4IDNA 3DCIA 3L0YA 2PWYA 4GC9A 1WUJS 1Z45A 2ZATA 5IARA 1IHXA 1KFJB 3Q3CA 4DVGA 2FEKA 2W2KB 3U60B 3L04A 4AJPA 3LD9A 2FMTA 1AXGA 3EZ7A 1UZLA 4J4TA 1CEQA 2R85A 3H16A 4RHTA 5E1BA 4E6EA 2NZWA 3WO1A 4DE5A 1VYHA 4UNIA 1M8KA 3ILXA 1CRWG 2BM8A 4JYCA 1D03A 3L49A 2XUFA 2EP7A 1SZJG 3M7IA 1MZVA 4HWOA 1DC3A 5TF0A 5DI3A 4BO6A 2YV5A 3G88A 1C3OA 2PGJA 2QT9A 1X94A 4ZHSA 1LFDB 5K8JB 1PP4A 5FTMA 3WSWA 5IC6A 1X1QA 3MS2A 4YMIA 1EUQA 1JE1A 3NBUA 4UPVA 5FFMA 3RYHA 2PKQO 1OFGA 1W1IA 1YU6A 4GI7A 4W9NA 5EZYB 5LIRA 3R3XA 1JYFA 2UUOA 3AJEA 1BS9A 4EGSA 3QKUA 1GTMA 4JZKA 5KDLA 1H0SA 2HYIC 3GLTA 2QGNA 4R1UA 2BLNA 1JHVA 4L0CA 1NASA 2FW2A 4KN5A 3T8AA 4BE7B 1XC7A 4C3UA 3R09A 3HRHA 4H18A 1YHZA 1E92A 5JS7A 4RZSA 3ZK8A 2X8JA 4YXWA 4ZK6A 2CXTA 2O3TA 1M8PA 4GF5A 4UQOA 2OK8A 5LU9A 2ZIAA 3P9KA 1ISFA 2X19A 3BWVA 4QFCA 3VR6A 5JZOA 2H7VA 1FJGB 3HDTA 3OZBA 1NBME 3LDFA 3JYHA 3G2IA 1YVUA 1U1DA 1R0BA 1I1OA 3Q3EA 1ODLA 4JL5A 4RM2A 4UCFA 3H19A 1BDJA 1SM4A 1MOSA 3KU4A 1JG3A 5SYMA 3U4QA 4UTVA 4B7CA 4ZEMA 5LJIA 2R79A 3FNIA 1Q92A 3KPUA 4PYQA 5TS3A 4OQ4A 1LU9A 2YCBA 4INOA 4EECA 4JP1A 4ZAZA 1NGSA 4F5YA 4LJ6A 1R0LA 2X42A 4HPXB 3BB1A 2VPTA 4M98A 5TNXA 3W0LB 3ORRA 4P5PA 1BKSB 2IOYA 1PBTA 3CMCO 2QGZA 3GZNA 3PGXA 4FLEA 4L28A 4AZ3B 1O97D 4ODIA 4P83A 1LDEA 5DSXA 3V80A 3A9UA 2PPVA 1Z56C 3DL2A 3N7UA 4KEAA 1OREA 1QH0A 2PMFA 1RJDA 3LFTA 4Q3NA 4ZALA 4H1UA 2ZWOA 3RO7A 5KI6A 4KPGA 5LMNB 4A82A 1TX4B 5KWJA 1NYLA 3IFSA 4MJXA 4BKMA 3P94A 1ZCZA 5JBNA 1UL1X 4AUNA 5IJZA 3CYFA 4UEJA 1PNOA 2W93A 5K0FA 1KDYA 4EATA 4IHAA 4C0HA 5F9MA 5LQRA 3KSBC 2HIGA 1YS2X 4AQDA 2MINB 4PLGA 2E3JA 3ON5A 4CM7A 5H80A 5J2UF 3C3MA 3JQPA 5CXXA 1JJAA 2BTQA 3AEUA 3RUDA 4QQRA 4YREA 3IE1A 1N75A 4LHYA 4YASA 5H3LA 3VI4B 1EEHA 1OV4A 5DOVA 3R3ZA 2AG6A 2PZJA 2ZRNA 2YWGA 4RS3A 1JMYA 1NJ5A 1TYZA 1U2GC 2D5BA 2E82A 3KE9A 4G1FA 3L0IB 2RHDA 2ZQZA 3U7RA 2PV7A 4KPFC 4QDZA 2NSDA 2A92A 1WHSA 1NZFA 2R44A 3NDRA 4F4UA 3LS2A 4QSHA 2VQEB 1OIVA 2I2XB 1Q20A 1N2ZA 2ZVQX 1PQWA 1ZAYA 1YZHA 1M6VB 4L27A 4OCZA 2NVWA 3SEZA 5JMOA 5BSTA 1SHLA 5FBHA 5LFAA 2IYUA 3K2EA 2QTLA 4XJXA 4YT8A 1E8NA 2X8AA 2AFVA 2YVUA 3ZU3A 4ENWA 4AYXA 4Z5XA 1GQYA 1UQTA 2I6QA 3GG9A 4J9UE 5IUKC 4ARUA 4C2BA 5IEJA 1AN0A 1C8LA 2XXAB 3GW8A 3ZU2A 1TADA 1M8GA 2I4NA 1C0EA 3FZEA 2WICA 3CX3A 4MI3A 1RQPA 2IDZA 2W6JA 4QGGA 5D7BA 4A15A 2FPKA 3GXOA 4LHVA 2ZOSA 2C7BA 3CH5A 5ERXA 4BL5A 1U7WA 1Y82A 1TW2A 1JG1A 2QRQA 3OHSX 3V8RA 1KAMA 1C9KA 1UT8A 3CN9A 3DVAA 4LI3X 3K0FA 3PFIA 2G1AA 2ZYDA 4EABA 2DCUA 1V9CA 3LMKA 3Q40A 1DS6A 1YQDA 5FBLB 3RTCA 2JGDA 2RARA 3E35A 4EK9A 1D8TA 2HWWA 3GFOA 3PGMA 2Z8ZA 1U2QA 3GPIA 4TXMA 2ZAGA 3ZBQA 5C31A 1KERA 1C30B 2WTEA 2QWXA 3EW9A 4K6GA 1Y3AA 4HB2A 3GN1A 4FONA 1RLUA 4JLPA 3ABSB 1EMDA 4HNHA 2XJ4A 3QKSB 2JA1A 4F1WA 4NYM