3AM1A

Crystal structure of o-phosphoseryl-trna kinase complexed with anticodon-stem/loop truncated trna(sec)
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
250
structure length
236
Chain Sequence
DIMLIILTGLPGVGKSTFSKNLAKILSKNNIDVIVLGSDLIRESFPVWKEKYEEFIKKSTYRLIDSALKNYWVIVDDTNYYNSMRRDLINIAKKYNKNYAIIYLKASLDVLIRRNIERGEKIPNEVIKKMYEKFDEPGKKYKWDEPFLIIDTTKDIDFNEIAKKLIEKSKEIPKFNISDKIDKETRKIVSEYIKSKKLDKDKIKEVVELRKEFLKKIKKVDADRVLKEFKDLLNSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title C-terminal domain of archaeal O-phosphoseryl-tRNA kinase displays large-scale motion to bind the 7-bp D-stem of archaeal tRNA(Sec)
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase/rna
molecule keywords L-seryl-tRNA(Sec) kinase
total genus 86
structure length 236
sequence length 250
ec nomenclature ec 2.7.1.164: O-phosphoseryl-tRNA(Sec) kinase.
pdb deposition date 2010-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08433 KTI12 Chromatin associated protein KTI12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.40 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 3am1A02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3am1A01
2ZRPA 2NO0A 3H2YA 4FMCB 3O8RA 621PA 1T5IA 1ZNZA 2ZUBA 2H57A 5FL3A 1DG1G 3B6EA 5TMPA 5CM8B 5J5CA 2BMFA 3CIOA 1Q1QA 2KBFA 5K8LA 1MH1A 1HE1C 2F1JA 1TEVA 1BMFD 1SXJC 1K5DA 4XWAA 1KJYA 5IT5A 1G6HA 5GJBA 4A9AA 3ZD7A 5DYIA 2CLCX 1M7GA 1UBEA 3QXCA 1JQJC 3PG5A 1MABB 1KDTA 721PA 4I4LA 1OFUX 1SXJD 3BBPA 4PC1A 5FUVA 1Z6TA 1UKZA 4QBHA 4CDGA 3RS5A 1SVOA 4I1OA 2JLUA 4M1WA 1F2TB 4PAMA 1KI6A 1VYTA 3ADCA 1EFHA 1NF3A 1NVWQ 2TMKA 4JL6A 1Z63A 1D5CA 5TVKA 2NZJA 2ZR0A 2ZRAA 4Z1MA 3LXXA 4DSTA 1XF9A 3CONA 1Q1BA 3SDZA 4L5BA 1U94A 2W2XA 1N6OA 2LKDA 4HATA 4NYJR 3L0IB 3KQNA 2XNDD 1AQUA 2R6DA 2YWEA 1CTQA 3G0HA 1R6BX 2G83A 4YMSA 2XTMA 4HUQB 2GKSA 4DLVA 1HYQA 3ZDQA 3RWMB 3QPVA 3ZVLA 1Z6GA 1E9FA 3K9NA 1I4TD 2ECKA 3LO5A 4JLDA 1T6NA 2WJIA 4XH9B 3T15A 1HT2E 5LD2C 2AR7A 2DBYA 4X8OA 3QKRA 2EYUA 1ZNWA 1DS6A 1W0JA 2ONKA 1RKBA 3BH6A 4L16A 3BAFA 2J9RA 3OESA 1NN3A 4C0HA 1R8QA 3VNVA 4EPTA 4Q5IA 3K0AA 2ASEA 2ORVA 1P9WA 1W4RA 3HU1A 1R0YA 1XMIA 1EK0A 1NN5A 2F55A 4Q02A 3TJZA 2HV8A 5SZHB 5UKDA 2W0MA 3QEJA 4ZV4A 4MYUA 2XITA 3SFZA 4BQSA 1ZCBA 3B78A 4KLZA 3ZS9A 3AVQA 4FW9A 5EUMA 4L4UA 2D7CA 2V6IA 3LRPA 1EXMA 4M2LA 1ZD8A 4F91B 4TYYA 4QHSA 1CJTC 3U44A 1Q3TA 1J8YF 2FF7A 4FINA 1P2VA 2OCYC 3AKCA 2IEZA 1E2QA 4WXRA 3MJHA 4AC9A 2IXEA 1OV4A 2A2ZA 4R98A 3UG6A 4E5UA 4MKIA 5AUQA 3H0KA 3T1OA 3B2EA 3K9LA 3FKQA 1AN0A 4Q18A 3VKHA 5JSZA 3GLHE 4WOPA 1LW7A 1RYHA 5KPJA 4ILEA 1QF9A 1KGDA 5CLQA 3VR1A 1HH4A 4PSKA 3CPEA 1TUEA 1AS0A 3VX4A 5G40A 1VCNA 3T34A 2C9YA 1G4AE 3AUXA 4C0SA 1FTSA 4Z8XA 4JLVA 3B1WA 2GBLA 1YZNA 2W0SA 4BLPA 1TF2A 3SS8A 5L8VA 1P3JA 3X1YA 1IY1A 1Z0DA 4C0QC 3J81k 2N46A 3I32A 1KIMA 2FPMA 2D2FA 1X8LA 2IWHA 3CW2A 1JR3A 2ZJAA 4XSGA 2QTHA 2CLDX 4EAQA 3MD0A 2G88A 1SZPA 1G18A 2ZRDA 3DEFA 2DWOA 2ORWA 3LVQE 2HUPA 5DISB 4CW7A 3THXA 1AJEA 2X8AA 1E2MA 1G9XA 3WMEA 4EPRA 3THWB 1XZPA 1QHXA 4WZAE 2GK6A 1YZGA 1BMFA 1G8YA 2YWGA 2GTPA 1GUAA 3EWAA 4NCIA 4D4MA 4QGGA 1DO0A 2O8CA 1NVUQ 4TYQA 1G8PA 5J47A 2JLQA 4NHOA 1VECA 2JJ1D 4NYMQ 2ZRJA 4QGFA 3W8RA 1E98A 1XEWX 1CBUA 3I73A 2YWFA 1X1RA 2HT6A 2P3SA 3B9QA 4G5OA 1W49A 4S2EA 1X3SA 3BB4A 1E4VA 4Q4AB 4TYNA 4A8JC 3LQRA 3BFVA 4BLRA 2QMOA 2CXXA 1Z0AA 1NBMA 2QQEA 3HR7A 1FPMA 4IRUB 1UBCA 3VFDA 2VSFA 2QUZA 4EFNA 1Z0KA 4G5SA 2JJ2A 3AF2A 2C77A 1YE8A 4PPQA 1M8PA 2VP0A 2W2TA 2FSHA 3CWQA 4OK3A 3T1TA 2JLWA 1U9IA 3JZAA 2Q0HA 3WNCA 4BZPA 1D9ZA 3FHTA 2YJTD 1KO7A 3KB1A 4AI6A 4LI0A 1P5ZB 3R9XA 1OE0A 2PMKA 3L8ZA 3EARA 4GI7A 4KYUA 3HU2A 2C99A 4RD6A 4QM7A 5FUYA 4D81A 2KSQA 4HZUB 3CNLA 4Z8YA 3B9PA 4NTZA 1E0JA 2UVQA 2QZ4A 4TSFD 2D7DA 3WYFA 1OYYA 5BYKA 2O8DB 2NQ2C 5AJWA 1XX6A 4UJ5A 3V4FA 2VHJA 2FX3A 2P6UA 5BQ5A 1N3BA 2ZJ2A 2NIPA 3SZRA 2BM1A 1NJGA 2XB4A 2FH5B 2XZPA 5DSZA 5KSPA 3R8CA 3U44B 2QT0A 1XB2A 2AL7A 3BWDD 3AVTA 3P4XA 2F1IA 3DKPA 2V9PA 2XGJA 1G8GA 2K5UA 4PX9A 2ZYWX 2ZETA 3RSOA 5JECA 1II0A 5G3ZA 1NKTA 1AZTA 5FBVB 1G4UR 4OI4A 2ZE6A 1XPOA 1O3YA 2Y8EA 4A0RA 1X8KA 2VHUA 1FFHA 1Z6AA 2IXGA 2YVUA 4UNPA 1UBFA 1DAHA 5BWMA 3PITA 1EWQA 5FPSA 2DCUA 2GK7A 2LWIA 3CZQA 2ATXA 4URXR 1ESNA 1Z0FA 2IUUA 5EXPA 2VYFA 1CXZA 3TE6A 2R6GA 1RFLA 1TF5A 4GZMA 1XEFA 4LPSA 2RHMA 3QXHA 1GP2A 2P2LA 5TB5A 1RRCA 3LW7A 2AX4A 4HLCA 3SJCA 5EXXA 2YV5A 3A1WA 2D4HA 2JJ8A 2IYLD 3GLGE 4P3YA 1OKKD 2VRWA 2IEYA 4JLOA 1XXHA 3RS7A 4DB4A 1OH6A 2JAQA 3NEJA 4GZLA 4JL8A 1G6OA 1U0JA 3X2SA 1QHHB 1NJFA 3T06B 1E2GA 5JMTA 3LLMA 4WAUA 2E1RA 1W1WA 3HR8A 1GFIA 4B76A 1L2TA 2HJGA 3KTAA 4BGDA 2A5DA 3BXZA 1W4BA 2GCOB 2V4ZA 2XEXA 2JIZD 3EZ7A 3K9HA 3KX2A 1J7KA 1TTTA 1Z5ZA 2JLZA 3I92A 3WBJA 4DIDA 3RRZA 1JBKA 4RD2A 3TRFA 3SYKA 1HTWA 2BCJQ 3SQWA 1ETUA 2RAPA 2OFWA 4URYR 1XEXB 4C2TA 1W2GA 2VHQA 4P32A 5E95A 4KODA 3CRMA 1KKLA 3MFYA 4LJAA 4DCUA 2WOJA 4QNMA 5C2JB 4OHYA 4B2LA 3IEVA 3GFTA 1E9DA 1NMZA 4LRWA 5FBQB 1OH8A 3O8BA 4R9UC 2PCJA 4HAYA 4LHXA 2GDJA 2ZITA 2FE4A 1OH5A 1E2KA 4NYJQ 1XZQA 5EQTA 1DAGA 4O3MA 3RS4A 2VL7A 2EWWA 1R8SA 3ADKA 1F48A 4A36A 5DHAA 1R5BA 4LYHA 4PO1A 2NO9A 1F2UB 2YC2C 2ZSDA 2PX3A 3BERA 3KUDA 4KYIB 1CF4A 4Q01A 4LHVA 5KDDA 3P27A 4Q9LA 1IJEA 3AVXA 4DLYA 2FSFA 1XD9A 2VP5A 5HPYB 4AKGA 2GZHA 1W36D 1QHHA 4LJ7A 3S1AA 1SKYE 5D3MA 4XVRA 1FMJA 3RHFA 1Z3IX 2JEOA 4X8HA 3AF1A 4ERNA 3QKSB 5BN3A 3KXKA 1JB1A 2Q3MA 5B2ZA 2NOAA 2IA5A 4B33A 3THYB 3P1JA 1AKEA 4JVNA 4Q03A 2OBMA 1S9HA 3VHXA 3I5XA 3THOA 4TT3A 1JR3D 4EJSA 1SVMA 5EZ5A 3BB3A 4ZKDA 3A58B 4GP6A 1GKYA 4ABYA 3PV0A 1S3SA 1YKSA 4RD0A 5HCNA 2KJQA 1GITA 3OAAA 5FH9A 3SJBA 2XSZD 2OM2A 4JLNA 1DELA 2WJGA 2X2FA 1SXJE 3AKYA 1XTRA 2ZS8A 4G01B 2QBYA 4IVQA 2R65A 1NSFA 4GOJA 5CJ2A 4YDHB 3X1XA 2ZYVX 2AXNA 2ZJ5A 3U60B 4EFLA 3EIHA 3FMFA 1DBSA 3QBVA 4XOIA 3L0SA 4B6EA 2QMHA 4FN5A 1AKYA 3GLHA 3V00A 4TMKA 3W90A 1DE0A 2WMOB 4URWR 1Z0JA 2JLYA 2CJWA 4B44A 1NBMD 1EFRD 4CGZA 2ZI7A 4IOKA 4BFUA 5FTJA 5FBRB 1BOFA 2C8VA 3EZFA 2XX3A 3BK7A 4XSHA 2AHOA 1ZC3A 5FOXA 2REOA 2OBLA 3DDCA 1KKMA 3L2OB 4DLXA 2Z0MA 1YHNA 1KO8A 4TQAA 1OB5A 4OJKA 4US0R 4Q4LA 4AKEA 1E79A 3CX7A 3U4QB 2WJHA 4MRNA 2CCJA 3K0CA 2QNRA 2N1BA 4DSNA 3UIEA 1NG9A 5BXQC 3GMTA 4QKQA 1PV4A 1RIFA 4OQLA 2XZLA 4LK2A 5JWOA 3O8CA 1KO1A 1TQDA 4RKEA 1QHYA 2DFTA 1H8HD 4TL6A 2RB4A 5E7IA 1JJVA 3HYTA 1HEIA 3L82B 3WBKA 3NH9A 2VP9A 1M7BA 4BLQA 1RVDA 4HZUA 1K8RA 4NCNA 1LVGA 1L4UA 5B58C 2QAGB 1U8AA 4KVAA 2QE7D 4BLSA 4TTQA 4HLUA 2ZI9A 2YINC 1UF9A 2LKCA 2VP2A 1ZIOA 2FNAA 3N2EA 1KI9A 4Q19A 2G0NA 1GOTA 2X77A 4BEJA 5BW8A 3ZYCA 3LW8A 3NXSA 3OFND 4Z51A 3LX8A 3NVAA 2C9CA 2QRNA 5F98A 2ZUDA 1EFCA 2OG2A 1LV7A 3T35A 1K6MA 5KTYA 2AFHE 2IS2A 2KB0A 2DYKA 3RLFA 1YR6A 3IO5A 4TQ9A 4NYMR 4B3CA 1OLOA 2G6BA 4M9QA 3VKWA 1QHIA 1VYVA 4PZYA 2IWRA 4EJSB 2F3TA 2F6RA 1XEXA 1M74A 2CEAA 3D8BA 4G1UC 4LUCA 1P62B 5AUOB 3EAQA 3L0OA 5DI3A 1T8TA 2GA8A 4BZQA 3SOPA 5CJPA 1BYUA 3QUSA 4PPNA 1QZXA 4DDTA 1G17A 4PXAA 1ZM3A 3ASZA 1SVWA 1XMVA 1OIXA 2W2VA 1D9XA 2BDTA 3B82A 3U5ZB 5IF9A 2ZSBA 3QKRB 2ZJ8A 5CB8A 3L8YA 4ARZA 4DHEA 1C9KA 2ZR9A 4QGAA 3K70D 1ZD1A 2IYRA 2F43B 4YMWA 4OI1A 1T3SA 4M53A 5HR5A 1G8FA 5C4MA 4B35A 3PVSA 5B57C 4MGZR 1Z06A 4LHZA 2FDCA 3QJYA 4Q4JA 4V0ME 1G1MA 1N5JA 2CNWD 1PVOA 5LPNA 2VHTA 3VX3A 1UAAA 2IHYA 2J5XA 5CK4A 4DBLC 4DCNA 2PT5A 3PXGA 2B92A 2Q9BA 3TIFA 1BIFA 5HCIA 3VKGA 4GMDA 3EPLA 4RKFA 4PANA 1XD2B 3NWJA 4QJ4A 5JS8A 1KSHA 1FL9A 1VIAA 2ZJBA 1KJWA 1L4YA 4PR0A 4AURA 2PEZA 4C7OB 3AVPA 3FTQA 4Q9JA 4KLNA 3NIBA 4E09A 1PLJA 2ZJZA 4LY6A 5ELXA 4IOJA 1VTKA 1XJCA 4C0KA 1Z47A 3BFKA 1T0JB 1WCV1 2C96A 4TMVA 2OE2A 1LS6A 3HYRA 2JLVA 4QHTA 1FQKA 3FKSD 1TU4A 4GL2A 3G5UA 3LWNA 5A0FA 4IDQA 4E03A 1IONA 3RANA 1U90A 1HQYE 1E9SA 3E70C 3HU3A 3NC1C 3W3AA 2A30A 1XCMA 1O87A 2A7QA 3MWJA 5SZKB 5J4VA 2B6HA 3UMRA 4C0BA 3FOZA 2IYQA 3LDAA 1DEKA 1A2KC 1NSTA 4IW3B 1JXMA 4MA4A 4I1UA 1GWNA 2WHXA 3FB4A 3ND8A 4FMDF 4NCJA 1OH7A 3TLXA 2ANCA 2XNDA 4XTCS 3ICQB 2QBYB 3MMPA 2IT1A 3N5CA 3OEHA 5CYOA 2GJSA 3R9WA 2CE7A 4M0LA 2XJ9A 2RHDA 2GXAA 2QPAA 3A1TA 5FI0B 4HYYA 1R10A 1D2NA 3RS0A 5FR1A 1FNNA 1OXXK 1KDOA 1NN0A 4RD3A 4BFVA 1W5SA 3QKUA 1NRJB 5E3HA 4NH0A 3IILA 3THYA 3IKJA 1VCIA 1OXVA 4C30A 4D80A 3M0EA 4IOMA 4KFRA 3ECCA 3D3QA 5SZIA 3NHAA 3TVDA 2QAJA 2D62A 4MRRA 3SBEA 1E0KA 1IAQA 1G16A 2A78A 4IJMA 4ZCLA 3LD9A 4CT5A 2FGJA 3A4MA 1X86B 2QMEA 3SYLA 1DOAA 1SHKA 221PA 3TBKA 4JBXA 1Q44A 2ZRGA 4ZDIA 4KITB 1S8FA 1SXJB 2BJWA 3SE0A 3I1FA 4TLCA 2HJVA 2P5SA 4P4UA 4JLBA 3N70A 5P21A 5KUTA 5FTMA 2H18A 1BKDR 1CR2A 4JBWA 2J7PA 3NH6A 2QGZA 3UWOA 1SVSA 5JCPA 1PJRA 3VAAA 2EW1A 4IKEA 1J8MF 3F3YA 2BMEA 4DLWA 2IS4A 2O8DA 4OHXA 3C14C 2Q3FA 1OT3A 2WAXA 5K8UA 1ZCAA 2OXCA 3QKTA 3ZGXA 4MDEA 1ODFA 4MYTA 1OXUA 2WWIA 2AXPA 2QENA 4KHZA 1S2MA 2O0JA 4P4SB 4PO8A 4C0JA 1HURA 2BIFA 4Q7KA 4IDOA 1GL6A 3VMFA 1ZU5A 2YHSA 3PJRA 4C7OA 1E2LA 2BHRA 4CEIA 3GJ5A 3LA6A 4FXPA 4EQ6B 2QORA 4G5GA 4GOKA 2WM9B 1WE2A 2WKRA 4ASUA 2OAQ1 2ZR7A 2NZ8A 1GL7A 4L15A 1R0XA 2BKUA 5DI3B 3BE4A 3FHCB 3N2IA 1KOFA 3A36A 3A4LA 4AG6A 3JZMA 4R2IA 4DSUA 2UZ3A 3VNUA 4DC9A 4XVQA 1E2PA 4HAXA 3A1VA 3W5IA 5KPDA 1US8A 4YMTA 2O8BB 3ZIAA 2FPLA 4JMPA 2KBEA 3GEIA 3T1VA 5FUXA 4ZDWA 2O8BA 1CR1A 2BBSA 2EQBA 3A1SA 3CH5A 5KSZA 2W83A 1NVVQ 3EC2A 4WZ6A 4Q1FA 2WWHA 4Q47A 1G5RA 3X1ZA 3UWKA 2H17A 2HYIC 1QHGA 2QU8A 2CVHA 3KFVA 3A8TA 3NBYC 1R4AA 2W6IA 4A2WA 1WXQA 3VHLB 1D2MA 3LY5A 4MRVA 2O8CB 2E87A 1V43A 3THXB 1IN4A 5JWHA 1U2RA 5EE0A 3ZZ0A 5AUNB 3O8DA 2F1HA 5DH9A 3W6NA 4A8JA 1JEDA 2DY1A 1P61B 5IDVA 2VSOA 1WF3A 4X8MA 3LBHA 1KMHB 3FDIA 1SVLA 1NMYA 1FZQA 4XD7A 2WBLC 3BD9A 5G53C 1E2HA 1Z2AA 2XB2A 4ZCMA 3DKVA 3IIMA 2IYYA 4LGMA 1IN6A 2HLDD 1DG3A 4PC2A 2F1RA 1B23P 2CL6X 4DB2A 2AFIE 5DHFA 2GCNA 4LV5B 4PSAA 5GVRA 2ZI5A 4B43A 3WP0A 3PR1A 4YLGA 2GXUA 5KU1A 1IQPA 4CEHA 1UJ2A 1ANKA 2ZPTX 3AKDA 2QEQA 4DXAA 1S1MA 4Q7JB 3HPQA 5EXTA 3I3SR 3QY0A 1J70A 3AVWA 4OQXA 1W44A 5CITA 2Q9CA 4CT4B 2GZAA 4NCKA 4ESHA 4FD2A 1FP7A 1N25A 2WWXA 3BRWD 4XIGS 4CIDA 2V6JA 2X19A 4LDJA 1M34E 5FOVA 4JL5A 2WSSA 4DWJA 4M4SA 3PQCA 4YXWA 5G3YA 1J99A 4Q9IA 4B34A 1CP2A 4QG7A 2QI9C 3LNCA 2PJZA 3CF0A 1BS1A 2FFHA 4RD4A 2CHQA 1TQ2A 2AWNA 4HSEA 2O5VA 3RWOA 3GLGA 2H92A 3CUEF 4RVCA 3KDSE 4GMXA 1XFAA 2UZIR 5C46F 2IYSA 1JEEA 4F93B 1BYIA 1RC8A 3QKSA 3SNHA 2AKYA 1Z6YA 2FZLA 1ZYUA 4B3GA 1P2UA 4LBYA 4TZ0A 3U4QA 1ZVQA 4A2QA 3KFXA 4NDZA 3QQ5A 5AJYA 4AYTA 1E9RA 4CEJB 2GEVA 2PZFA 5EXSA 3Q5DA 3UG7A 1T5LA 4CVNA 1Z0IA 2ZREA 1SULA 1NN1A 2IBMA 1JPJA 2IX3A 2C95A 2GZDA 2FN4A 2JATA 3I8SA 4TN1A 2PBRA 2RMKA 1KTVA 4QOSA 3QVVA 3VR4A 2A9KA 1BH2A 1P6XA 4RCYA 3K70C 5HZKA 1G20E 3CX8A 4JVSB 5TARA 1T91A 4D0NA 1E69A 2GJAA 4JLMA 1NG1A 2GRJA 4Q1CA 2EVWX 1RRPA 3DZ8A 2ZEJA 4EQ6A 2B8TA 2ZS7A 3EG5A 3CNNA 3U3OA 3S1AB 3WXMA 5JJIA 4V0OA 1XXHB 1MO6A 1N6NA 1W5TA 1G7TA 2JDID 2VF7A 3EA5A 3NBZC 5FPTA 3CRVA 3WRXC 1ZNYA 3R7WB 1P75A 3OHMA 1OIVA 3CF6R 1TQ4A 1F3OA 2G77B 5D3QA 1A2BA 3X1DA 1GM5A 1RJ9A 1Z29A 2FWRA 4X8LA 4ZPXA 4D26A 1P7CA 3DM9B 3LX5A 2GBLC 3TSWA 1RE0A 2PCLA 3OZXA 1CR4A 3GEHA 1S9DA 3UKDA 1VDZA 5FL7D 1KSGA 2DB3A 5DE3A 1VCMA 3SJZA 1HY3A 3QVUA 4A92A 4LJYA 5KSOA 2IYUA 4BFWA 2O8EB 4A4DA 2YYZA 2JLSA 2W00A 3LXRA 2FZ4A 2VSXA 4EPWA 1G5TA 2V3CC 4V0KA 2OO7A 3KJGA 3CRW1 3BJIC 3OIVA 4KXFB 4F7WA 5A5GA 5L3QB 3EPJA 1HUQA 3KUCA 5EP4A 2HLDA 1J2JA 1E1QA 4RZXA 1YU9A 1NKSA 3I4LA 1I2DA 2BOVA 4LHYA 1KNXA 2B7BA 2IYTA 5F9HA 1KK2A 3WNDA 1G3RA 1QG2A 3QF4B 3BC1A 2MMGA 1NMXA 1OIWA 4LJ4A 1KI4A 4TSFA 3RRYA 2ZE7A 5CIWA 4FI3C 4AYWA 1K5GA 1Q1ZA 1X8JA 4Q1BA 5DN6A 1SHZA 2AKAB 4Q00A 3SI7A 1S0UA 5JLJA 5KHOC 4OYHA 2FSGA 3PUWA 4A0FA 1G7RA 2OFXA 2Q3HA 1RRFA 1N0VC 4V03A 3GLIA 5AK0A 2OT3B 1EGAA 1IY0A 4Q9HA 2WWGA 4IXNA 1XTSA 3RYTC 4DZZA 3LFUA 1JR3E 2ZYTX 4PHTA 1M2OB 1JALA 2O0HA 4PSVA 5EE5B 2XOKD 2QPTA 4OK5A 2X1VA 1TEXA 2ZRCA 3MSXA 2V8OA 2H16A 4ARZB 2OCPA 3C8UA 3ZVNA 2FV8A 2R6FA 1VG8A 3SYNA 1QHNA 3TAUA 3ZZTA 4JLPA 5HZHA 4ACBA 3ZVMA 4TMXA 4AK9A 3V9PA 2I4IA 2C78A 4HAZA 3AVUA 4Z1MD 3LBNA 1ZIPA 2QGNA 3EIEA 3IUYA 3TW4A 4NZYA 4EJSC 1GL9B 4PHHA 3PCRB 4CEHB 1XCGB 3L0PA 4B73A 4A8JB 2IUTA 1ZC4A 4Q48A 2OILA 4AWXA 3LLUA 4KBFA 1VHTA 4FMBB 3B85A 4PC7A 1RZ3A 4DCTA 4DLTA 1IM2A 3RC8A 3EC1A 2XAUA 3IHLA 2FJUA 3T12A 1LFDB 3GEEA 2J1LA 5IK2D 2EFEB 3Q7QA 3W3ZB 1YZKA 5BN5A 1DPFA 4IVRA 4JJKA 4F4CA 2I1QA 3P26A 4LSGA 2V1UA 4V02A 4EPXA 5JRZA 1KK0A 1P73A 1G3UA 2R6CA 2C03A 4PAOA 5JZVA 3FPAA 4MQBA 1X6VA 4B3XA 2CLSA 3OIWA 1II8B 3CF2A 3F8TA 1KK1A 5H1YA 4LBWA 1IBRA 1N2CE 1QVRA 5KNCA 3AUYA 4PC6A 3LBIA 4UKDA 1VYUA 2G1KA 2RGEA 5B30A 1GNQA 4GBMA 5A4JA 4AD8A 4OJQA 5JI3E 4QNRA 3ZQ6A 2ZRLA 1XTKA 5HE8A 3NHBA 4LC0A 4BECA 3D7MA 1CLUA 1DAKA 1T4GA 1PUJA 4HAVA 4B71A 5DNYB 1XDBA 3GLHB 2REXB 1Y3AA 1MRNA 1E2NA 4RFVA 1FOEB 3B1VA 3B5JA 5J4YA 2RGGA 4EIWA 2GVZC 1JJ7A 3REGA 4TLAA 3I61A 2VP4A 3OIYA 4DJTA 4FWTA 3CBQA 4Q4HB 2ZVPX 4Q7MB 1XD8A 2SHKA 1W2HA 3BS4A 3KKMA 4F4JA 2WICA 3LQQA 5CB6A 3PUYA 1LS1A 5KYKA 3NKVA 2J87A 1JPNA 3SR0A 3UPUA 2P6RA 4LBZA 4GNKA 4DCVA 3QXXA 3RABA 1GRNA 4NYIQ 1FW6A 1DTSA 1C1YA 2JLXA 1W46A 4MGYR 1Z08A 3QNUA 3EPHA 1XBTA 1HQCA 3GLIB 2BM0A 4DLZA 5JSZB 1FUUA 3EZ9A 1E32A 4F92B 4TMZA 2FSIA 1T3HA 2VLIA 3U7GA 1WRBA 4JKYA 3U7HB 1KI2A 4TLEA 5J4KA 4E07A 1GRQA 1II8A 4DLUA 4M1MA 2QP9X 4DDUA 1EG7A 1KI7A 2V7QA 4UQOA 3H1TA 1GDDA 1QRAA 4OI2A 3EXAA 5DIFA 4XWKA 2QE7A 3ADBA 3NG1A 2GWHA 4LV8B 1A4RA 1D2EA 3E1SA 1FUKA 2WV9A 4R7ZA 4HEJA 1NL3A 2QT1A 2ZRHA 4MKGA 5E4FA 2J0VA 4TTPA 3U2QA 4U00A 4FIDA 4ZI3A 1KMQA 2QSYA 3WYAA 4JZKA 2OUKA 4JT4A 2EU8A 4OK6A 2V1XA 4HLQB 1U81A 1MO5A 2AK3A 3SFVA 1E2EA 3AM1A 3WRYC 2J0UA 1OXSC 3GJ4A 4PZLA 3ONWA 2BBTA 4G5QA 3SQXA 3AP1A 1AQYA 3ETLA 4HUQA 3VR2A 3TUZC 1YR9A 2CJWB 4N1AA 4CYMA 4LC1A 2JIZA 2CHGA 1ZNXA 2QTFA 4UXIA 4ZDJA 4DVGA 1DAMA 2WTUA 2VA8A 4HAWA 5E7JA 2F9LA 4MGKR 4Q1DA 1Z2CA 3OAAD 4L9WA 3VU9B 2XSZA 1VG1A 4LJ9A 1DVRA 4KU4A 4LV6A 1OYWA 3AF4A 2Z4RA 1HV8A 1E0SA 3NBFA 1XRJA 2KE5A 3ZJYA 3NDBB 1SKQA 4JYCA 1QBKC 3QSYA 2FFQA 3TW8B 2G0TA 2B8WA 1UPTA 2ZIAA 1N6PA 3Q72A 5IK2A 2BKEA 2NO7A 1ELOA 5C4GB 1KI8A 3A37A 4J0QA 5M04A 1XPRA 3RS3A 2I3BA 1FX0B 2JA1A 1UM8A 4ACAA 1TMKA 5L3RA 3UMFA 2A5GA 2RKOA 2JLRA 2ZE5A 4QJ3A 4PHFA 3RC3A 4DRZA 1KYIA 2VF8A 3A1UA 4A6PA 4U02A 4XJXA 1Q57A 2WAYA 2P6NA 2HCJB 2GXSA 1OFTA 3IBYA 2P67A 2C5LA 1DARA 4LX0A 4Q1AA 1ZW6A 2IUSA 2BEKA 2VH5R 3VR6A 1UEIA 4P4SA 4O0MA 1E3MA 1XXHE 2QP4A 4Q9KA 5FTNA 3SBDA 3ZQJA 2J0UB 2IK8A 3QG1A 3CO5A 4BFXA 4WVFA 5KNDA 1XD2A 2OBNA 4C9BA 2GESA 3Q7PA 1H8HA 1YR8A 3B1XA 5F2EA 2ZAOA 3FKSA 1U0LA 1U8ZA 4UXHA 3PIRA 3KTAB 4BEBA 3EASA 3FGNA 1JECA 2Z43A 4D82A 1M6NA 1GNRA 1G7SA 2WOOA 1AGRA 1VKJA 4I99A 1R2QA 4URUR 5HE9A 1DAFA 2EFHB 2EWVA 3QI2A 2JJ2D 1E2FA 1ESMA 5GJWC 3VTKA 2QMUA 4OKSA 4S35A 3TMKA 3AVVA 1W36B 1FX0A 3K53A 4FMCF 4XWOA 3U7EB 5KNBA 4DEYA 4P0TA 2J59A 4R2HA 3C15C 4B3BA 3CWZA 3TR0A 2R2AA 2IF0A 4F4IA 1UKVY 3CB4A 3OF5A 4G5RA 5L3VA 4NBSA 1XPUA 3A6PC 4Z54A 4V0NA 2J46A 3TSZA 4NMMA 2ZSFA 3RNLA 2GAAA 3AEZA 4JS0A 1L7VC 4XTRA 2ZJOA 2IL1A 2FA9A 4V0MA 1D8TA 1R5OA 3O47A 3ZD6A 2UKDA 1G3IA 2MMCA 1AM4D 3KQHA 3DMNA 3E2IA 4A15A 3EX7C 1U9IC 1XCPA 2A5JA 4KV9A 5H68A 2CDNA 1T8UA 821PA 1GAJA 1WMSA 5EUQB 3DM5A 3QPWA 4NL4H 2CE2X 2ERYA 1TL7C 1GKIA 1N0UA 1P2TA 3P20A 3QE0A 2PZGA 1N5LA 1L8QA 1FQJA 3AB3A 3TQFA 5FPYA 1G3MA 1KJZA 4O25A 3ZH9B 1E2IA 2JCSA 2EFGA 4N3NA 1GIAA 2GEDA 4CEJA 4QBIA 2GJ8A 1P4SA 3WNBA 3P4YA 4PZZA 1TUIA 2PEYA 1ZAKA 3C7KA 4LCBA 2HXYA 2O0KA 2HCBA 1A7JA 4NPHA 4P33A 1ZUHA 5IRCD 1WBBA 3LV8A 2A5FA 4E22A 1E9CA 1XNJA 3DHWC 4WXPA 2OV2A 2GVDC 1AK2A 5ANRB 3THWA 1SQ5A 4UNNA 2YOHA 1KAOA 2ZSEA 1AIPA 1YZQA 3GFOA 3VR5A 2N42A 5IHPA 4QJ5A 4OHZA 3KKPA 5SZJA 1R5NA 1AGPA 3I72A 4MGIR 5FBWB 3TNFA 1RPZA 3U6BA 2GXQA 3K09A 3RRNA 2BBOA 2RCNA 3FYHA 3P32A 1YZTA 1HT1E 2J41A 2BWJA 2RGNC 5DO9A 1Z8FA 1VPLA 3CPJB 3GLFE 2IYXA 3IEUA 1JXOA 5JCZA 3W6OA 4GRAA 4KI0A 4DLSA 1W36C 5FL7A 4A2PA 1FP6A 3GCGA 4JVLA 1OFIA 3L43A 1IXSB 3MLEA 4XVUA 4W7SA 3NTUA 4CF7A 3K1JA 2ZXUA 3AVYA 1P9NA 2I1VB 4NU0A 4RZ2A 5J4LA 1TX4B 1ZM7A 2WWFA 1KMHA 4BLTA 1KNQA 1W0KD 4NONA 2J7KA 4EUNA 1E9EA 1N6RA 4BFYA 2FOLA 3GFPA 4II7A 3W34A 1R7RA 3QENA 3AF3A 2CK3A 2O52A 3K0FB 1J90A 2PX0A 3C41J 4D4LA 3MUFA 4AIIA 1SGWA 2H5EA 3K0FA 3QG5A 3F0TA 4IDHA 3WMFA 2BV3A 4JLKA 4TLBA 5GJVC 3ZLJA 1Z83A 4QHYA 4LZZA 2ZS9A 4MRSA 4W5HA 2GJ9A 1SXJA 3W9YA 4BRUA 5JFGA 3MAAC 3GD7A 4RFSA 4DSOA 1FTNA 2Q6TA 4O2LA 5FOTA 4LYAA 3B13B 1NVVR 4EPVA 5CDFA 3B8HA 1EFRA 1TQ6A 4JSTA 4W9MC 4BE7B 2ZE8A 1XWIA 5KOYA 4HZIA 2XTNA 3KJHA 1II9A 5E7MA 2VHCA 2VEDA 2YKGA 1S1CA 1XU4A 3KL4A 3H84A 1H8EA 4H1UA 5G41A 1NIPA 2GETA 2IW3A 2ZRFA 5D3MB 1FMLA 5HKKD 4TZ6A 1E79D 2A3RA 2ZVQX 3K9GA 1KK3A 4TTRA 3FWYA 3REFA 2CHVA 2WPDA 1YVDA 3IPXA 4HUTA 4M8NE 4NKRA 1N6IA 3UXMA 2ODWA 2WMNB 4ZI2A 2Q9AA 1I2MA 4TQUS 4DDWA 3CRRA 3DOEA 1D6JA 1Q12A 3KQKA 1NVXQ 3B1YA 1OJLA 5CYPA 3FE2A 4B2PA 2J7PD 2OCBA 3MGCA 1CJVC 4TT3D 5H8WA 2J3EA 1KZ7B 1WDTA 3MWYW 1E9AA 3WP1B 3G82C 3ICEA 521PA 2P65A 1AS2A 2YOFA 3GJXC 4AY2A 2IYVA 2J45A 2Z83A 4PPGA 5AWFC 2RGBA 1U99A 5JHGB 3C5HA 1TNDA 3SHFA 2WKQA 4LWZA 2JDIA 1YR7A 3MG9A 1N5IA 3TGPA 4JLAA 1KSFX 5GVSA 3GJ7A 4DUGA 3OFNA 3WHKA 1AA9A 5C1BA 1MOZA 2WWYA 4JJZA 4OI0A 4C3ZA 4B3DA 1CJKC 4FCTA 3FMIA 3K8YA 2XZOA 1KI1A 4Y0AA 2YWHA 1SKYB 1EX6A 5EJEA 3JVUA 1COWD 1VIYA 1XP8A 2OCAA 3CR8A 4RZUA 5JRJA 4WIAA 3KQUA 2DHRA 3QBTA 4AKHA 3OE7D 2C9OA 4G0NA 4RCZA 2XJ4A 2PH1A 2DFKB 2Q21A 3DVLA 1CKEA 2ZU0C 1F6BA 3KZ1E 1KHTA 2VTKA 1CS4C 1P72A 2WZQA 4PO9A 4C2UA 2OZEA 2ZRNA 2R62A 4PC3A 5TY0A 4PAQA 2DWPA 2QTVB 2ZRIA 3IGFA 1E99A 1IHUA 3FFBA 3NBXX 4BFSA 4M1SA 2ZUCA 2PLFA 5LB4A 4MRPA 3D31A 1G291 3PUXA 4ITRC 1P60A 3MJRA 1RYFA 1JNYA 4QGHA 1W4CA 2HF8A 4C0LA 3PUVA 2F9MA 2QRZA 1N6KA 1OPXA 1E2JA 2ODEA 3CRQA 3IQXA 1GZSA 2QROA 1KAGA 1COWA 1F5NA 4M1TA 4MYCA 3T5GA 1UKYA 3HJNA 4M1KA 3M4YA 4NYIR 1F2TA 3ZS8A 4KFUA 4US2R 4URVR 5AJVB 4MDFA 2MSCB 5CIQA 3WMGA 2H8KA 3B1ZA 4WA7A 1GNPA 5CM9C 1N5KA 4W5WA 2WKPA 4DLRA 3TUIC 2QAGA 3KXLA 4TL9A 1U98A 4OQNA 1BO6A 1PLKA 2H1LA 4POAA 1RW4A 2LCFA 4LPKA 5TXGA 4JKIA 2ZYUX 3FMOB 3KXIA 8OHMA 4LOAA 2RGDA 3TQCA 4H9GA 4PFSA 4MITA 2XNSA 1VCOA 3QXJA 3CKLA 1ZJ6A 4ZDKA 3BFXA 1IN8A 4PHGA 4M9SA 2OEPA 2A5YB 4LHWA 3GLGB 4QFMA 3OEED 3EIQA 2GEUA 1EFTA 2G1JA 1OHHA 4YMUA 1UADA 1RJ9B 3SN6A 3U3KA 4GOXA 4PQRA 3AF0A 4TYWA 2EYQA 3EZ2A 3VR3A 3F5FA 1DAIA 5GADl 1CULC 2QP3A 1UBGA 2C98A 5L3QA 5L3SA 1TAGA 2IXFA 2WIAA 3Q3JB 4UNSA 4UJ3A 2R44A 1P2SA 4DT1B 4L9SA 3V4RA 2IC5A 1KO5A 1GG2A 2QG6A 3GJ3A 3U3MA 5DI9A 3GPLA 4OQFA 3U3RA 2HF9A 4HDQB 2J0QA 2CNWA 3RDPA 1EFUA 3TR5A 1CEEA 3UMSA 4HB2A 4HI0E 2RGXA 1LF5A 4Q4HA 4KSCA 3HP1A 4A1FA 1Q0UA 3GQBA 2WSMA 3R8FA 4Q4JB 4UXJA 1MR3F 2B21A 2QAGC 4HDOB 3PEUA 1XJ0A 4NCHA 5FOUA 5JHHB 4P4TA 2WVJA 2FMXA 5GJCA 2RGNA 1JQLB 2YC4C 3R7WA 4KSBA 3RSLA 1JAHA 3QPUA 1YRBA 4AYXA 5FTKA 3TK1A 3AGQA 2KI5A 3PEVA 1UDXA 4GSYA 4RSGA 2W6JD 4NP6A 2Z6VA 3FMPB 4K81B 2RH5A 4GPTA 3NEYA 5DYGA 3DL0A 4OHWA 4ZO4A 4B32A 3KKOA 4BRWA 5J4HA 3EPKA 2OLJA 1IN7A 4CRWB 2ODNA 2YNMA 1E9BA 3CPHA 2NO6A 1GSIA 3BOSA 3RS2A 1VG0B 1KO4A 3BH0A 2KWIA 3CZPA 2OFOA 1N0WA 421PA 4N0DA 3CR7A 4IEIA 3W8NA 5C18A 3LVRE 3BB1A 1F60A 2ZTSA 4A0HA 4RY2A 4QBGB 1NP6A 2V55B 2AN9A 4FWIB 1OXTA 1EESA 3ASYA 4Q7LA 4QL3A 3PEWA 3K0AB 1T9HA 2R8RA 3QOFA 5LBIA 1OW3B 1T3LA 4RFSB 2BBWA 3IBGA 1XMSA 2D2EA 1CRPA 4BFTA 4IDNA 5JS7A 5JWRA 2ZSAA 4YXWD 1PZNA 4IFEA 4EDHA 1OB2A 2F3RA 1Q21A 3Q8XB 3I5YA 2NGRA 1V5WA 1NI3A 1Z28A 4JYBA 1QVAA 1OFHA 1TPZA 1E0AA 2IF2A 2NMVA 1WB9A 2OSBA 1MT0A 2PJRA 2HDNB 1X1SA 3T61A 2JGNA 1A5TA 5FUWA 3T5DA 5BYJA 2C2HA 3FVQA 2YZ2A 3QF7A 3SU8A 4UNQA 1MO3A 1DADA 4JBYA 2CL0X 5KDLA 1MV5A 4K46A 2ZU6A 1RRGA 4M1YA 2XXAA 1TADA 2NPIA 4Q4AA 2ANBA 2WJJA 2WIBA 1GKUB 2DR3A 4PTLA 4GFDA 3T1QA 1N6HA 2ZJYA 3TAHA 2CCKA 2FGKA 2BMDA 4TMTA 1OF1A 5KSYA 3IQWA 1IXRC 1EWRA 2XTZA 3HDTA 4B2IA 3K09C 1W0JD 3IIKA 1M7HA 1N6LA 4D4JA 5L3SB 1E2DA 2QM7A 1E4YA 2QA5A 3KJIA 4GDFA 2ZROA 1QG4A 1CU1A 2CMKA 2QN6A 4AKIA 2WJVA 1LY1A 5EP3A 2E9SA 1TF7A 3EZ6A 2QY9A 3H4MA 1UEJA 4P31A 3TVTA 3K70B 1I4DD 1VMAA 3WYGA 2QL6A 1CJMA 2ZANA 3I8XA 5FTLA 4HLDA 1XEWY 1ZD9A 3AH8A 4IHQA 2YOGA 2FEMA 2QQ0A 1E6CA 4ON9A 4B47A 3UK6A 4YONB 3OEHD 4JT2A 1YZLA 5FR2A 3TUJC 1VHLA 2AD5A 2HYDA 2NTYC 2X2EA 4D6PA 2ZI4A 5FI1B 4FCVA 2AWOA 4IXMA 4Q66C 1MKYA 3KKNA 2AD1A 3QEOA 2F7SA 4MH0R 3CLVA 3TSOA 3MCAA 1S4QA 4WBSA 1KSJA 2FU5C 1Q22A 3PEYA 1W48A 1ZMXA 3UANA 2IHBA 2G9NA 2DPXA 5EP2A 6Q21A 1TU3A 1Q20A 4NE2A 1CRQA 1YQTA 1Q1EA 3K0CC 3IPYA 4HLUC 3GJ8A 3DPUA 1NIJA 1KI3A 1AZSC 1R0ZA 2BVNA 2CL7X 2ZI6A 3MRSA 4DIEA 4QBFA 2GILA 4MKHA 4KAXA 5TDHA 1Z07A 1QDEA 2O8EA 4YMVA 4LYJA 4ZKEA 1C4OA 1GILA 3Q9LA 1I4LD 3QXSA 4OL0A 1R0WA 3NC0C 2WSSD 3W6PA 5JBQA 3BH7A 3JVVA 1Z22A 2W6ID 3OIUA 2ZM5A 3HWSA 1KDRA 4OQMA 1PUIA 4D2IA 121PA 4BFZA 3DO6A 5EZ6B 3GP8A 1NBME 5FPHA 2B7CA 3AGPA 5EE9A 3TKLA 2D3WA 4EKDA 2ZRKA 3FHOA 1NLZA 3OEEA 2EFCB 1JAIA 2IS6A 1KY3A 2QM8A 4URZR 1IOZA 2WJYA 2DFLA 1W0KA 4B6FA 3EWSA 1E96A 4KCGA 5EE3A 4CEIB 1G41A 3QIAA 4BUJA 2J0SA 3A4NA 1NY5A 5DLQC 4HB0A 3U6KA 3B7GA 1B0UA 3B60A 4M9ZA 2GCPA 3HPRA 4LJ5A 5K8TA 1IN5A 4QC2A 4WZBE 1H65A 5AJXA 2WWWA 1G3QA 2REBA 3Q5EA 1ZM9A 2GF9A 2GNOA 2HXSA 4QM6A 4TLDA 4PQYA 4TL7A 4ASUD 1A82A 4MUAA 2FFBA 2FEOA 2MSEB 3KKQA 3KJEA 1E1RA 2VP6A 1DAEA 3RVBA 1KDPA 2V7QD 4KBGA 2RGCA 1W47A 4TMWA 2FPKA 4D0GA 4PQFA 5FOSA 2CCGA 4QXAA 1MO4A 2BCGY 1XMJA 3BORA 5FOWA 3ZIAD 1WQ1R 4ZCIA 4JVMA 3IIJA 1YJ5A 2FG5A 4D25A 1MABA 4HB4A 1U8YA 4FCWA 5F9FA 3C4JA 3KQLA 1H8ED 4K8OA 3SHWA 4EFMA 4BASA 1XTIA 2BMJA 3EW9A 1G64A 4CZ2A 2VPPA 2P0EA 4C0AC 3DMDA 3FFAA 4KO8A 4M22A 4I81A 1G19A 2GCOA 2Z4SA 2D74A 3AVOA 4BLOA 1QHSA 5CDFE 5FFMA 2BC9A 1ZUIA 4H1VA 3M6AA 3VU9A 3SJAA 4YDSA 2XXAB 2EFDB 4MKFA 2JASA 2MSDB 4BWYA 3E5HA 2GJKA 4JLJA 4U5XA 4RJLA 4TL8A 3ZVRA 1MRSA 1ZM4A 2ONJA 4IDPA 1XJQA 1G5PA 1ONBA 2OESA 4Q21A 4XD7D 4TYPA 3Q85A 3K0SA 5HTKA 4A6XA 4C4PA 1WA5A 4KFTA 2IS1A 2JJ1A 2VQSA 1XTJA 2F43A 5EP1A 3U7FB 3I62A 1LNZA 4O2RA 4DCSA 2ODBA 4UNRA 1G7CA 1W4AA 2P5TB 3TH5A 3W5JA 1SVKA 4TWZA 4I1SA 3C16C 4QRHA 4BZXA 4GP7A 2CBZA 1Q3HA 4HB3A 2L0XA 4L8GA 5H70A 2BEJA 4B75A 5AR1A 3H86A 5DN6D 2ZRBA 1KZGB 4KFSA 2AK2A 4BPBA 2CVFA 3NDPA 3SEAA 2VO1A 2PT7A 3M1IA 3DZDA 4M21A 2IYZA 4A0GA 1EX7A 2FFAA 2QPOA 2GAOA 4ESVA 1HA3A 4IFBA 4IVPA 3GJ6A 2CK3D 1DO2A 1OKKA 2ATVA 2ERXA 4V0LA 3CNOA 5JI2E 3D6TB 5HKKA 1G8HA 3ADDA 5F3WB 2HEIA 1ZBDA 3PUZA 3U3JA 2H7VA 2D06A 4Y0VA 1PLLA 1S3GA 1WP9A 3X1WA 4KVGA 1GVNB 2DFNA 1IY2A 1JI0A 2ZAMA 3WHLA 1SVIA 4IOLA 5JEEA 4M9XA 2VBCA 3CH4B 4I1VA 4ZIRB 1A1VA 4LYFA 5KO2A 1NY6A 4B3FX 5LDDC 4G3XA 2NG1A 4M1OA 4PPFA 3VQTA 1VG9B 4ZIRA 3AP3A 1KY2A 4GT1A 1UDWA 3KB2A 1ZU4A 5EE1A 2R9VA 2OXRA 4HDCA 3DOFA 4D4KA 4F38A 1U0HC 1JR6A 1XTQA 2G3YA 3AP2A 4B48A 5TV2A 1M1YE 5CLLA 5FPKA 1OSNA 3AKEA 4OHVA 4DT1A 3SC3A 2ZRMA 4W5JA 4DKXA 2OLKA 4DUGD 1E1QD 2V54A 1FNMA 1NLYA 1Z6XA 5AJZA 1E1RD 3IDQA 2VIIA 1UKEA 1ZM2A 4LBVA 4LJ6A 2R6AA 2PMDA 3EA0A 3U61B 2C04A 5FBLB 1GRRA 1P9RA 4RZ3A 2NO1A 1CR0A 3WY9A 2RGAA 1CJUC 1CIPA 1LF0A 1ZUNB 3AV0B 1OHHD 4Q1EA 4D0LB 4IEEA 4N0EA 4YQFA 1GTVA 1Y63A 1YZUA 2Z5FA 4KJZA 5CK5A 3RAPR 5BN4A 5LD2B 4JSYA 5JJLA 1S96A 3R20A 2OHFA 3UATA 4OBEA 1HE8B 2O8FA 2NPFA 3BGWA 5JJKA 1E94E 3K0EA 3MWKA 5K8IA 2PL3A 2XOKA 4JIMA 2HT1A 2GF0A 1ZINA 1G21E 1LB1B 1ZRHA 3CM0A 3CX6A 1US8B 2ZQ5A 3RRMA 4U7DA 3BIFA 1NNEA 4US1R 3PFIA 3IHWA 2PZEA 1IXZA 3LAWA 4HAUA 1T0HB 5AUPB 5B64A 3MWLA 4MUBA 4WW0A 1KI6B 3PENA 4MYHA 3OE7A 3LH5A 1W7AA 1F2UA 2OAP1 3QF4A 1YRAA 3ND9A 3AQ4A 3GLIE 4R71A 2PLRA 4B74A 4EPYA 4RD1A 5LB2A 2W6JA 2ORIA 3GJ0A 4A82A 2BJVA 1AS3A 2WPDD 4FMDB 1UFQA 2QSZA 3C5CA 3ZZUA 3IO3A 3GLFA 4AG5A 1IJFA 4LJ8A 2DWQA 4YC7A 5KDOA 4DEXA 2ZI3A 4DDVA 1NLFA 1WBDA 5J40A 5DGXA 2W58A 1LTQA 3R9IA 3GLFB 2GHIA 1ZP6A 2O8FB 2IYWA 5JEDA
chains in the Genus database with same CATH superfamily
4HGRA 2NO0A 1EWVA 3PNYA 4FMCB 4J2OA 3LHKA 3RJTA 4YDQA 5GQSA 2A9PA 1ZNZA 2FN3A 2H57A 1PZFA 3IEXA 5FL3A 1V47A 3B6EA 4YPFA 7GPBA 2WTBA 1FFCA 4H31A 3A1CA 1NVEA 3JSXA 1Q1QA 1ARZA 3PXEA 3M81A 1EAYA 3G8DA 1HE1C 1UMDB 1YB7A 2F1JA 3PI6A 5LLSA 2VTVA 5CT5A 1H3NA 4ECEA 1I32A 4UAJA 1SXJC 1K5DA 2IVZA 1KJYA 2IZ1A 1IYZA 5LMNB 3LK7A 1T43A 2VNHA 2B5VA 3NYWA 3L06A 3ETDA 4Y8VA 1L4FA 1RC0A 5TNXA 4B4KA 1JQJC 3LPMA 2XOEA 4WX2B 1KDTA 1KYVA 3BBPA 1SXJD 1NDQA 2ZSIA 4MPRA 1QYWA 1T6BY 1AA6A 4QBHA 1XRSB 4S12A 4CDGA 2B1RA 1B7GO 2GYVA 4F3NA 2JLUA 2PSEA 5LYJF 1N1GA 3VOTA 4KZKA 1I2AA 3PRHA 4H6PA 2IXDA 2P11A 4PAMA 1EFHA 4N47A 4AJLA 1QZ3A 4AS2A 4UE3S 1ITZA 1PKXA 2NZJA 2ZR0A 2ZRAA 3CZAA 2AN1A 4DSTA 4DIBA 2D0OB 4ZVOA 3LUKA 3FPFA 2OHIA 3EXG2 4QWMA 4YAGA 3NHMA 1N6OA 1M0EA 4REOA 2RIRA 2YVQA 4NFSA 2XNDD 4X6UA 4BRZA 1GZ3A 1CTQA 4YO7A 4CM3A 3LQ2A 3UV6A 2XTMA 2WKWA 2FPXA 4S1OA 3QPVA 3WADA 1TTHA 3ZDQA 3K9NA 4ALMA 2BJHA 2YVLA 3JV7A 5ALVA 4JELA 5LMZA 2IOFA 3FUXA 3G2IA 1HT2E 2E18A 2AR7A 3BICA 3KPWA 4Z1OA 1E3JA 4W5OA 4KQGA 5LDHA 1QKKA 4BPBA 1RAAA 1ZNWA 1DS6A 3ZHYA 3OOSA 1WQ3A 4ALIA 3BH6A 4EX7A 1NE2A 4JDPA 3BAFA 1XHEA 3S81A 1QB8A 3ADPA 4UCWA 1UBJS 4Q5IA 3ZU3A 1ZO8A 3C74A 4IO0A 1R0YA 5JJ5A 2FSSA 4H18A 1QMGA 3VSAA 1DRVA 1EK0A 2BRUA 3D4BA 4BBAA 5J1SB 2F55A 4I50A 1NTRA 4BJ6A 3LCCA 4LYYA 5A3RA 5JO0A 4C22A 2W0MA 3FDJA 2WM8A 4C4TA 5IJ0B 4KR6A 1ISGA 1OILA 5B37A 2IYOA 3AI2A 5JMOA 1P5RA 4UUMA 4W4TA 4KLZA 3ZS9A 3P52A 3AVQA 3ANLA 3DUFB 5EUMA 1WG8A 2D7CA 4C5CA 3H2GA 1EXMA 3KEGA 1ZD8A 4TYYA 1N5DA 1C7JA 2H29A 1IWOA 2K4MA 2HLHA 4QHSA 3NOQA 4FINA 2DPLA 3AKCA 4RXTA 5KTTA 2CNKA 1X14A 1WPGA 5DHSA 4YX9A 2JNWA 1OV4A 3FPKA 4E5UA 3VNRA 4I9GA 3H0KA 1R3UA 3T1OA 3ZV7A 2O3TA 1E3DA 2CJXA 1MFZA 4Q18A 3EUWA 2DBRA 4WOPA 3K4PA 1ONNA 1LW7A 1Q0QA 5ARBA 4JBGA 2PSHA 1UWLA 1XCLA 5JXJA 5KPJA 1QF9A 1C3OB 4RTQA 1KGDA 2YHBA 2E55A 4PYLA 3VR1A 1PJZA 1HH4A 4PSKA 3CPEA 4R2LA 1ZXBA 4ZO7A 4ED9A 4N6OA 4WN9B 4YRQA 5ITZA 5G40A 3VBCA 1V95A 3A1DA 3EEBA 4P5PA 4RVGA 3ETEA 5L3ZA 1G4AE 2YWJA 4RTKA 1OQAA 5KAPA 1V1MB 3C3CA 4GMFA 1GZ6A 1YZNA 2DC1A 2W37A 4ER3A 4XOUA 4IZBA 4QDKA 4JI1B 2NZVG 4A23A 3R9XB 4PCUA 2RJOA 3KE9A 1QRSA 3J81k 3F49S 5I9MA 2YTZA 3RANA 2IWHA 5AKYA 1JR3A 1DZIA 1JRLA 2DY0A 2PSFA 4XSGA 2IH4A 4QJIA 2FZKA 4TKUA 2G88A 3OQJA 4ATNA 2GT1A 3DEFA 1U8UA 2DWOA 3CH7A 3VYWA 3IPRA 4PHFA 4L02A 4Z4EA 1QHXA 3E84A 2P9YA 4RA9B 1NFRA 2GK6A 2RAVA 1IK4A 1XZCA 3Q11A 1G8YA 1V5IA 1HE3A 4G0ZA 4H7PA 4QE3A 4RKWA 5K0LA 4EKNB 1GUAA 2RCYA 1HTTA 3EWAA 1D1QA 1CUIA 4ZI7F 4Y9UA 1PX0A 3T9EA 1K89A 2O8CA 4IIYA 2DRIA 4F2GA 4F4DA 3DOUA 2HW8A 1PQYA 3G2LA 4KQWA 2JBHA 3G7SA 4QGFA 3W8RA 1K0UA 2V7XA 3H7AA 4XYBA 4JR2A 5LYYA 5L7TA 1U8CB 1YGYA 2E85A 3I73A 1X1RA 5AQ1A 1OZGA 3HY6A 3B9QA 1DHTA 3I9V6 4G5OA 5ALWA 1T24A 2QKYA 1X3SA 4BP9A 5I8WA 3IB6A 4TYNA 3R4CA 4WRRA 2QXTA 1T9ZA 2QMOA 2CXXA 4HFRA 1NBMA 1PF7E 3WK7A 1PQ4A 5KVSA 2EFJA 3FAKA 2FQYA 4HQ6A 3NONA 1YVRA 3GRRA 5CLHA 1Z0KA 3T7DA 2JJ2A 3LHIA 3Q6MA 1AUXA 3CZ5A 4MICA 1A98A 1YE8A 3F67A 4MWTA 4NDNE 2FSHA 4EJ2A 4MJ7A 4H3VA 4IFIA 2QNIA 2C82A 4BATA 2AR0A 4U2BA 3HI6A 4WUTA 1SVNA 2ETVA 1RQXA 1XK6A 2IEBA 3KZCA 1FJHA 5EIBD 2H9IA 3EXEA 3KB1A 4LI0A 1JMKC 2QUHA 5REQB 4OLBA 1H0HA 1U3GA 4D44A 1EHIA 3CF4A 1JDBB 3L9WA 4KYUA 1G8JA 4ZYZA 2V7BA 2C99A 4RD6A 2Z4TA 5BUZA 2ZBVA 1J8FA 1Z26A 4J2HA 4ZOEA 4KZPA 3C6KA 3E8SA 3IPCA 5IDQA 4NTZA 2YZGA 3LPLA 3IBSA 2BW0A 1BN6A 2H1CA 1QYVA 1G8KA 2BHLA 3V4FA 2VHJA 4KUGA 1N3BA 2OOKA 2O7RA 2ZJ2A 5DYNA 3ILYA 1QIEA 3KB8A 5BN5B 5BSKA 5JNVA 1GZ5A 3VOAA 3D0RA 2FH5B 3ZCRA 1XB2A 2AL7A 2Q5LA 5KJ6A 3AVTA 5AJUA 3DOJA 4ER5A 5JNUA 4GUAA 3DKPA 2QLBA 1BH6A 3JYOA 1A5BB 3OMXA 4HYTA 5K3BA 2PUEA 4DN6A 5LMCA 1PQUA 2ZETA 1H9CA 3T5PA 1PP4A 1TCUA 2BZGA 1B0PA 4NJOA 5EAIA 5BSWA 1H3EA 2IELA 1ECCA 5JNLA 1JBEA 1O3YA 3PNPA 1JXQA 1UBHS 1X8KA 1N3LA 4IIDA 5JALA 5LOVA 1JG1A 2WA1A 5CBPB 1UBFA 1SCNE 1TKCA 3PITA 2E4ZA 1Y34E 4ZHQF 5KOJA 4Y18A 4CTNA 4URXR 4M0FA 1ESNA 4KMSA 2VT6A 3D0QA 1H4SA 2XUIA 4ONEA 2VYFA 4FNOA 1CXZA 3R74A 3PFHA 1XEFA 4JU8A 4LQCA 4KL8S 5DSXA 2ZKLA 3C7CB 5HUQA 1LK0A 1M2WA 1R66A 3QTBA 3RG8A 3W0LB 1V2GA 4F45A 2DULA 4TVSA 2ZT5A 4RA6A 4CMEC 1RBQA 2Q45A 1P2DA 3LXMA 2JJ8A 2BFAA 2ZCVA 3NJRA 2GEBA 1ULZA 2HSWA 1QQ6A 4RHEA 2VDVE 3H16A 2P9CA 4LXTA 1T26A 5JAOA 2MIIA 3FLEA 4JLOA 2G63A 2XODA 4M6WB 2JAQA 3NEJA 4NRDA 2WTEA 4U5QA 4XDGA 5FB3A 1QHHB 1NJFA 3T06B 3W4KA 1SFRA 3LLMA 3KOWA 5EJ6A 2E1RA 2XHZA 3EQZA 5JDIA 3RSCA 5H5JA 3VR4D 3G89A 4B76A 1AF7A 3PC3A 4J49A 1VPDA 3SYMA 4BGDA 1TYCA 3VC2A 2XEXA 2V4ZA 2FCRA 2JIZD 4ZVUA 1BVHA 3AYZB 4F04A 1VP9A 1TTTA 2WIGA 1I36A 2JLZA 4INZA 3GJYA 3I92A 1KYYA 3S2IA 2HWWA 3B52X 1C2TA 1EVIA 1K3FA 3UJHA 4DIDA 2BCJQ 1JTVA 1EFVA 2EERA 3SQWA 3U49A 2JHCA 2WB4A 5TEVA 4MS3A 1YRWA 1W2GA 2VHQA 1W0CA 3K94A 4DA8A 4KODA 3W05A 3FWKA 1ISJA 3S2EA 1BROA 3MFYA 1SZCA 4LJAA 4DCUA 2A1TR 5HKAA 4D3YA 3ZDBA 4QNMA 1R27A 4ARUA 1TMGE 4J9UE 4ZOCA 4LFCB 4KBYA 4JI0B 4B2LA 4OHYA 3GFTA 1NMZA 1OH8A 2VK4A 4F6LA 3IE1A 2XIJA 3I76A 1CUGA 4M60A 1M2GA 1YS7A 1W52X 4GLOA 2ZITA 3CLTD 3ZU4A 1OH5A 1CF2O 2BFEA 2J6CA 4HMPA 1XZQA 4FT4A 1DAGA 1HKUA 4NYJQ 4YRSA 5JCJD 4LZJA 3PDIB 5DHAA 2NVUB 1MB3A 4IQFA 4U7FA 1F2UB 2VPTA 4WZAB 2ZUTA 3VVCA 1NJ6A 4BWVA 3HH8A 3L1VA 1K3TA 4RE6A 5BR7A 2XQIA 2OYRA 1JIQA 1SZJG 1RQGA 2UZ1A 3BUSA 1UPUA 1Z5NA 1QX3A 3SSMA 4IJ6A 4PX2A 3HRKA 4RPHA 1SKYE 4XVRA 1O58A 5ALYA 4YJ3A 4X8HA 3IESA 3RHFA 3AF1A 2GFQA 2E2WA 3DNFA 2DWCA 1JB1A 1NONA 1NW4A 2Q3MA 3V4SA 5BN3A 1LX6A 1PZHA 4B33A 3BL6A 3O1HB 4NV0A 2DPHA 1AKEA 2WE7A 2XDAA 4NAVA 3C98A 2GPBA 3T1HB 1CK4A 4OO3A 4PX3A 4TT3A 1U3VA 1SVMA 4BX9A 4EJSA 2J3HA 2Y1XA 3DFIA 3GLVA 4Y1GA 4YMHA 4JXZA 1NXOA 1HRDA 1S3SA 3EBPA 1DUBA 2AFIB 1MC8A 4BBZA 2PD3A 5AI6A 5BPHA 2PAFA 3OAAA 2IOYA 1YRQA 2ISQA 1R0LA 3T4UA 4F3TA 1T0UA 3LX4A 3WQHA 4JLNA 1LDNA 2ZUEA 2WJGA 2IDZA 2YDXA 1SXJE 2FKNA 2WT9A 1HLPA 3AKYA 1NU6A 4MVYA 1XTRA 5ULLA 5A4AA 2UXDB 4FLMA 4YDHB 3U62A 1K86A 2WRZA 3C8DA 3RE1A 3W1WA 4FR2A 2X0IA 1E3LA 1GUDA 2JANA 3HEMA 4YAUA 1JIJA 4IJUA 5BWBA 4B6EA 4V0QA 2VP3A 1TCBA 1GLVA 3TTXA 3LUDA 1AKYA 4GPD1 1MB9A 1ZQ9A 1M6HA 1E58A 5FF9A 4RTLA 5KJPA 3OQIA 1KY5A 4IHJF 1ONPA 1Y3BE 2AE2A 3AY7A 2PIAA 5FV4A 3CISA 1Z0JA 3F5DA 1LPAB 2JLYA 3EFHA 1RADA 3I4FA 4CGZA 4BFUA 4M0DA 5CCEA 1CS0A 5FTJA 4JT9A 1UMKA 1WEHA 1B6GA 3BSWA 1VL8A 4GYWA 4J4HA 5DYWA 3I9FA 3KVRA 3UHOA 2H11A 2RH4A 3L04A 1S7GA 3K1AB 3D7NA 1KKMA 1UC8A 4EYKA 4W5NA 1TW3A 2Z0MA 3I1YA 1F8FA 3FZGA 4ER7A 2ZOSA 3ZUGA 2C5BA 1O4WA 1WM1A 4US0R 1Y1PA 2EEZA 4Q4LA 4QPPA 1E79A 4XFDA 1EDEA 5ALSA 5H0IA 4MHTA 2HCRA 4XXHA 3CIFA 2RE8A 4DSNA 1IHPA 1NVFA 3CZ4A 1CUFA 1JYFA 1OREA 1OR8A 5BXQC 3SIRA 4FYIA 3ZV3A 3D3WB 1OWOA 2QGFA 5DU2A 4EEXA 4TXJA 5JWOA 3O8CA 4GDMA 5CX1B 4QDUA 3BXGA 2NYUA 1FA9A 1KIFA 3O31A 4ZAYA 1U31A 3FETA 1QHYA 1QAQA 1H8HD 1R6TA 4LRYA 1JJVA 1DKNA 1WXIA 3QTLA 5JS2A 4EL5A 5JQGF 4LF5B 1M7BA 4JBIA 4GI1A 2A94A 4UM9D 4HZUA 5DBHX 5AVVA 3HUDA 4X85A 2FWIA 4KVAA 4EG0A 5B58C 4KXVA 3MBKA 5I8ZA 5KEIA 1QORA 1P81A 1PW5A 1SD1A 4GL4A 2YFKA 4AF8A 4HLUA 2ZI9A 3RJZA 1AXRA 4EY5A 1L1EA 1ZIOA 1ONSA 2Q27A 1QHEA 1DMSA 1KI9A 1L5QA 1HL3A 3VKFA 3VBEA 4AJIA 2X77A 1OD6A 4YCLA 4EW6A 2RBKA 4Z51A 2NT3A 3ZC3A 4E1BA 5IT9A 3NVAA 4CI9A 2EJVA 2QRNA 2YJNA 1FP1D 1L4KA 3QU4A 4PEVA 2ZUDA 5FLXA 1PJBA 1A8SA 2OG2A 3UMMA 2AFHE 2BKAA 1S5PA 4OFZA 3HZHA 5EMLA 1QS0A 2FQ1A 1RIIA 4KE6A 4LY0A 4EMSA 1YR6A 5KB3A 4KAJA 4A26A 2QTVA 5CA1B 3HMKA 4U6NA 3VKWA 3ZW7A 4MULA 4TZKA 4PZYA 3SBXA 1GCIA 1NXVA 2PKYX 2F6RA 1HM5A 2D3TA 1CQJB 1Y33E 2YV4A 3KALA 1TZKA 2QVZX 1SOWA 3JU3A 1V4BA 2EZTA 4HN2A 4FUTA 3C7TA 1L8AA 1M8JA 1RJEA 4XM2A 4CDMA 5DX1A 1R9GA 1UJMA 4Y6LA 1QFXA 4QASA 3SOPA 3VYSB 2PMCA 4DF3A 3E3MA 4P35A 4W8OA 3ASZA 4BNVA 1OIXA 1MQSA 2BDTA 4DCPA 2FFJA 3D6HA 3NU1A 3NUGA 3DBRA 4XA8A 5KTMA 3X2FA 5CB8A 1GY8A 3L8YA 4G1VA 3WNZA 5FXMA 3ZCVA 5A7FA 2Q6IA 2ZR9A 4G1FA 4QGAA 3K70D 3UC5A 3DDNA 1T3SA 3I05A 3MIZA 1G8FA 3UUEA 1P0PA 3TEFA 4C76A 3UQZA 2AMLA 3IP3A 3NHYA 4LHZA 2HA0A 2ZZMA 1G1MA 1DKQA 4OJNA 4GBGA 5LPNA 2VHTA 2XYPA 4QBKA 1XFDA 2OD7A 3I9NA 3OZAA 3QPDA 5FEUA 4TRNA 1UAAA 2EGHA 5F5LA 4XEHA 3VVBA 4DBLC 2FR1A 4UFNA 1JQKA 3QRWA 2PV0A 2Q9BA 1BIFA 2JKZA 4HSGA 4WJKB 3VKGA 1VLHA 5HM6A 5ALEA 2F4NA 4PANA 1XD2B 3NWJA 4Z0PA 3PC8A 2E1PA 4RSRA 1WSDA 1DJPA 4L0MA 4WLUA 4L5JA 3OM8A 2NN3C 4AURA 2X8JB 1FDOA 3I2YX 1Z8HA 3FTQA 2PZ8A 4N39A 2Q49A 4Q9JA 5JD6A 1PLJA 1Y9EA 5C4IA 1DQYA 1JMVA 2ZJZA 4LY6A 3FGZA 4R7GA 3G1UA 1VTKA 1PQWA 4MUHA 5EUCA 3IFSA 3BFKA 5EY5B 2C96A 3FNRA 4WDQA 2YBEA 1YJBA 4MYSA 5DM1A 1UMDA 4TMVA 4U39A 4ND6A 4DR1B 4EF4A 2FPUA 5ICSA 1JHYA 4QHTA 1XAJA 1TU4A 1Y8QA 1R9JA 2D54A 1NA5A 5TSDA 1Z74A 1RI1A 2ST1A 3MTQA 5A0FA 1DEHA 1IEXA 1K75A 1PFYA 1U90A 1HQYE 1E9SA 2GDZA 2XGOA 4IGFA 1LZKA 2YXPX 2A7QA 1O87A 3HCBA 4PO3X 4RK7A 4AUNA 4ETIA 3R44A 2DLDA 3H5LA 5EMMA 3FOZA 2IYQA 2CNLA 1DEKA 1A2KC 3CNEA 3E6AA 3KIPA 4QWWA 5DTQA 4Z9YA 4BX8A 4F11A 4ZFNA 4DM4A 1FDVA 1V8OA 4QULA 2JFFA 5L95A 5ALRA 1RBYA 1ZIDA 1W30A 3BA6A 4J0JA 4JKOA 4NCJA 3TLXA 2I91A 2PBLA 2CSUA 3NNNA 4HEA6 1PT9A 3WLKX 1AV7A 3ICQB 3TFOA 4GC5A 3OLWA 2QBYB 4II3A 1SU8A 5AKXA 5CYOA 5C1DA 1I7QB 5ILQA 2GJSA 4ARAA 1TFUA 1BDJA 4K2AA 1U7HA 1UOOA 2GZSA 1CZKA 3HKDA 1E66A 4M0LA 2QWXA 1ZN7A 1CFJA 1AKTA 2R1TA 2SICE 3VDNB 1E4OA 1MN6A 3QMMA 4YIKA 1NMSA 4FFOA 3NGMA 4J3NA 3RS0A 4DIUA 5BR4A 3EVAA 5EEGA 2I4MA 5JYCA 3D8RA 2X14A 1O0BA 3OZGA 4NF2A 1W5SA 4LWOA 1OI7A 4R7TA 2OY0A 2ZZNA 2GD0A 2H59A 1AHHA 3L6DA 2K2WA 3IKJA 1VSTA 1VCIA 2H3EA 1OXVA 3GPDG 3LGAA 2ZWOA 2RHOA 3KEOA 4PV7A 4KFRA 2A35A 1ZA1A 2QAJA 3UWDA 2C3MA 3SBEA 1E5LA 5K8VA 3ES9A 3R0VA 5FI3A 4UW9A 2CLKB 3E58A 2P9BA 1U9YA 1X86B 2PUVA 4K0RA 1X1EA 3HVJA 3KE8A 3MCTA 1ZRSA 4MRMB 221PA 1SHKA 3DBRB 3QW4B 4UUOA 3SQOA 4I1PA 1ML4A 4FSXA 1S8FA 2JIBA 4P4NA 3TDKA 1SXJB 5D51S 5B3AA 4EW2A 4RDXA 4RJ2A 3SE0A 1TXGA 2P6PA 1PR5A 3QW2A 1XLUA 1V96A 2PT9A 2ZIWB 4OD0A 5KUTA 3DWFA 3F97A 4LNHA 5FTMA 1Z5OA 2J0EA 1CR2A 2WU0A 2J7PA 1MOQA 4JBWA 1NOJA 4RQBA 4TKVA 3GRVA 2C2XA 2RK6A 5K0BA 4Y1FA 3RODA 5LM3A 1OI3A 5JCPA 3VAAA 3RJ9A 3LRXA 1YKFA 2BMEA 2FZ5A 2IS4A 2O8DA 1N5RA 4OHXA 2P41A 3HJAA 3B12A 1DPGA 4IYJA 4DE5A 1DOHA 3GOHA 1ODFA 1KC1A 3ZGXA 4C05A 3O4FA 1PSDA 3DAFA 1EQ2A 4LI3X 2WWIA 4CM7A 1E89A 3EDCA 1T2UA 5IBCA 1E60A 4PZ0A 4IDOA 3VMFA 2ZUFA 2PQ0A 3I39X 4YJKA 2XA1A 3DMTA 1BJTA 1B43A 3FSJX 2JIMA 2DLNA 3II6X 3U0BA 3KHKA 2JFUA 4EQ6B 4QOIA 1M2JA 1YGPA 2PH3A 3IP6A 1WE2A 5JNTA 1QPZA 3T3PB 3IJRA 4YJ2F 3VC7A 4ASUA 3C6QA 1Y4ZA 3DVSX 4ZYYA 1GL7A 3AJRA 5DI3B 1FC0A 4YAFA 5JVDF 2AMJA 3U48A 2BP7B 1XDDA 2PMFA 1WDWB 4ERXA 3L4KA 1X74A 1RCFA 1PEKE 4KMMA 1Z13A 2HFJA 1XZ8A 1GO2A 3O84A 1JVBA 4XVQA 4ZVKA 1E2PA 3O9VA 5KPDA 3RADC 4ZHQB 4FSHA 2QTLA 2AA3A 3ZHRA 4XVUA 4BNIA 4X66B 4DSAA 2FWAA 5BVHA 1OYVA 1KYZA 3I04M 1C1XA 3AFHA 4N7MA 4O02B 3T1VA 4ZMRA 5FUXA 1M1ZA 1SBQA 1G4HA 1SH7A 2ZXFA 3ZV5A 3O7WA 2B8EA 1C0IA 1NVVQ 1QNFA 3EC2A 3PQ8A 2C0QA 4IGAA 2HFKA 1PWXA 4RK5A 1HDCA 3DVAA 4WZ6A 3U4GA 4Q1FA 3TDMA 3VPAA 2ARKA 2VCHA 4YRLA 4G0UA 3OD5A 1CWUA 1KEWA 1G5RA 2WWHA 3TX6A 3X1ZA 4KI7A 1DP4A 3FRHA 1E2UA 2JPDA 1KP2A 1N3YA 2CVHA 2V7UA 1DWPA 1VM6A 3ICVA 4MQEA 1WZCA 2ATEA 2JFWA 2W6IA 3ZNPA 3VHLB 3LY5A 3GBVA 4MRVA 5A6VA 4HN9A 3NTOA 2O8CB 4UDYX 4WHMA 1U2RA 4ZV7A 5AUNB 2CNDA 3H05A 4JY7A 3O8DA 5ALDA 3B3FA 4HTAA 1EZ1A 1IG3A 1JEDA 3W7VA 2DY1A 3L1HA 4YRAA 4ZICA 1XMOB 3D5TA 1HETA 3V7UA 1PT5A 3LY7A 1YUBA 4DMMA 1F6WA 3F8WA 5EMNA 1SA0B 1NMYA 2C92A 5CVCA 1KDZA 1QLHA 1E1YA 2OXEA 3BD9A 3ZKAA 4F21A 1E2HA 3NT5A 1KR5A 3JQ7A 2PJUA 4P6VF 4GHWA 3IIMA 2IYYA 2P30A 4LGMA 5C34B 1QYIA 4RORA 2QVYX 3VR6D 1VKOA 3BZBA 4HXEB 5EGNA 4PC2A 2EBUA 3O83A 1T36A 2M6SA 2Q0SA 2W6MA 2WJPA 3EGIA 2L18A 3V8NA 1K7FB 1GGFA 4WPGA 5TX7A 3TGWA 2AFIE 4Z9XA 3KU4A 5DASA 1DO8A 5AP9A 3H6HA 3QUAA 1Q16A 1TCAA 4J1QA 2ZUSA 3ZEIA 4DM3A 4FOOA 4INJA 5T8KA 2X7HA 1ZN9A 4O29A 4XIIA 5FQNA 4GPEA 4RWZA 2QEQA 2BKXA 3ER6A 4DXAA 1GARA 1GZUA 1NVTA 1ZH6A 5G1PA 1NVBA 3C3BA 4EJFA 1SOUA 1A77A 5CITA 4ID9A 3C6XA 4ESHA 4P7GA 1OVMA 2FHPA 2OR3A 1RP1A 1JDVA 1FP7A 3SLLA 2VTEA 2X86A 3Q0EA 3OIGA 3V4OA 3PGJA 4CIDA 1QCZA 1IIRA 2HU7A 1QJCA 4EA7A 4GI3A 1LSJA 1ULUA 1KPIA 3NPMA 1BDBA 3Q15C 3O2JA 3PQCA 4M4SA 2B4YA 2C5HA 1MCZA 1J99A 4QQ8A 4YUXA 3WL6A 3MQ2A 2ISSD 3EGDB 5EG5A 1FJGB 4MVJD 1XROA 2WUDA 3CF0A 2H8GA 2I6UA 3OU7A 3MT8A 1TQ2A 4A8TA 2AWNA 2DUWA 3EIOA 3GLGA 2YZ7A 5IC6A 3CUEF 1FNBA 3DMYA 3G2JA 1EM8A 3KDSE 3C70A 1U1CA 2A86A 3KXDA 4MV5A 2X8WA 2AUMA 1VZ3A 3FFWA 5FDFA 3KG2A 1BYIA 1PDOA 2BF7A 1H2BA 4X1IB 3IYLW 4XB1A 1G21A 1PL8A 4X92A 1Z6YA 2CXNA 3OZTA 3PXCX 1L1FA 3RSZA 3DDWA 3K1TA 3KFXA 1W73A 1IM5A 2C7VA 2OK7A 2PT6A 2P2NA 3OSZA 3QQ5A 4J76A 3UB4A 4AYTA 2HPZA 4EA8A 2GEVA 3CKMA 5EXSA 4UAVA 1KJ8A 2HQRA 1X13A 1Z0IA 2P2ZA 4MLDA 5JLAA 4YJ2A 4RYLA 1V11B 5KTSA 1J21A 4XZ3A 5C8YB 3CCFA 5JRDS 5JVDA 3OO0A 4IHJA 4DJEC 3E3AA 2P4SA 4L28A 4AT1A 4DC1A 2A9KA 1GHTA 1UWVA 4JVSB 5AKGA 2IHTA 3CV3A 1XN4A 4NR0A 4I5IA 3DBVO 2C0PA 3IKLA 3OJLA 3LTEA 1ZK0A 3CH6A 5JDIC 2YHIB 4HH3C 5K0SA 2BFMA 2GRJA 1BNCA 4GO1A 2TMDA 3WX0A 2PGDA 2EVWX 3AHGA 3IRBA 3DZ8A 1CCWA 2C4UA 4QLAA 5EZYB 3X1JA 1E6LA 2ZS7A 3EG5A 1WMEA 5E6UB 1GCAA 3JASB 5IVKA 2VWHA 1K2VN 4I66A 1T2VA 3WXMA 1XXHB 2Z5GA 3EA5A 2VF5X 3KUUA 2VF7A 3IAXA 4P4GA 5FPTA 4ZXFA 3RIEA 5THXA 3DGEC 3SQLA 1ZNYA 2ET6A 4MMXB 1P75A 3SM9A 3UB2A 3OHMA 2G77B 1OWPA 3EQ9A 1GM5A 4ZT4A 1NNSA 4BTVA 5CFMA 2R00A 4WACA 3MTEA 3OZXA 1CR4A 1KSGA 2O7SA 3DZJA 4YRFA 3EH2A 5U4QA 4BLVA 5EJ4A 3IAAA 4LGCA 3LCMA 1KJ9A 5G0TA 3TKYA 2LTAA 3TL6A 4FLFA 4A4DA 1IU9A 1LZLA 3VTZA 1MAWA 2BISA 1BX3A 5JYBA 4FNMA 1PE0A 5GY7A 3MQ4A 4B3IA 4B7ZA 1MEEA 1Y1RA 2VQ6A 1DZ3A 3QLJA 1G2QA 1QCDA 2M9MA 3AEYA 3FYSA 5B1SA 1V25A 1MNAA 3KZKA 1NAIA 4UTOA 3WL8A 4U1RA 2V3CC 1ADYA 1X7HA 3KJGA 2YIDA 1SVUA 1H2ZA 2B98A 2G09A 3OIVA 4OLHA 5A5GA 5L3QB 1RJDA 2PXXA 1OA0A 3FTPA 1WCIA 4NDZA 4P84A 1UZLA 3MF4A 4YPVA 2C2OA 3ANXA 3WKBA 2VVTA 2Q5HA 4DS3A 2R1TB 2V7WA 5ALIA 3N7TA 4LHYA 4NBNA 1SK8A 5NLLA 4TV9A 5JXWA 5T57A 3G3EA 3NM5A 4MARA 1A3CA 1WAMA 1KK2A 1OROA 2C84A 3OCVA 3WNDA 3TTUA 4B84A 1DBPA 1OIWA 1KI4A 3GG9A 4LIPD 4WKCA 1NULA 3GT3A 4YRDA 5TF4A 3TD6A 1ODTC 4Z4QA 1Q1ZA 3EZGA 4F5ZA 5LQAA 1U0SY 2OD9A 4Q00A 1P5JA 4O1IA 3VU8A 3IUEA 4OL9A 3WHIA 1Y5MA 3WLIA 4BVHA 3FCYA 2A57A 3AK4A 1P31A 2YWBA 2ATCA 4U3JA 1ZQ1A 3CEPB 3N2KA 1K92A 5H9VA 2N0SA 3JQQA 3Q98A 3QBJA 4IH4A 5EWMA 5CLFA 1C3LA 1XLTA 2DCMA 2IPMA 3ND5A 3BCRA 3PR2B 2B8JA 5IMBA 1XTSA 1KC3A 2RBEA 2GLXA 3ELYA 3NHPA 3ZWMA 2ZYTX 4OVKA 4PHTA 1M2OB 4L3OA 1IHXA 2XOKD 1Z4QA 2QPTA 4MS4B 4OHRA 4OK5A 4WCZA 3TTTA 2AMYA 5IKXA 3TD9A 4UFPA 3NW9A 3MSXA 4CCWA 5C1PA 5CLIA 3OZVA 4IMIB 3PCXA 4TMFA 4BV3A 1OC4A 2OCPA 3C8UA 4ZOLA 4L5AA 1QWSA 3OZEA 3VR2D 2HU2A 2IUEA 3O5AA 1GTG1 1WD7A 1FRFS 3SYNA 1ACLA 3QX7A 1F2DA 1N9GA 3VUEA 4BNLA 3IP7A 4TMXA 3SKVA 4AK9A 1YVEI 1U0NA 1ZMOA 3JARB 2I4IA 4PM4A 3B3AA 1TECE 4D9HA 1O97C 4Z1MD 3LBNA 1K66A 1ZIPA 3SDBA 1JAXA 1N2SA 4H7HA 4NZYA 1RHUA 4EUEA 3FPHA 3W5AA 1DAPA 1K68A 1M6VB 3GY0A 5ADVA 2AB0A 2FEPA 4CEHB 4FDVA 3CVXA 2WNIA 1I1HA 1Q0SA 3IP1A 3KNZA 4LISA 2IUTA 4QU8A 3VUFA 4B7UA 5HQTA 1V2HE 3E9RA 4AICA 3NTRA 2V97A 4AWXA 4KBFA 4DRXA 1NURA 4FMBB 1NWCA 4Y2RA 1D3AA 5BURA 5CFLA 3DMGA 3IV6A 5JZSA 4NCBA 3RC8A 4PG8A 2FJUA 3RV4A 1VJGA 4H35A 1LFDB 3GXOA 1HOXA 4BYMA 3CA8A 3HRXA 4YT5A 4BX3A 4S1VA 1NVDA 5MFPA 5BN5A 4C5BA 5CCBA 4QA9A 4WBNB 1ZI6A 3P26A 2V1UA 4S0XA 4V02A 3JZDA 4K9NA 4V0RA 3V55A 1RXYA 3WTCA 5CAEB 3DL2A 4W1PA 2HSZA 5ALXA 4ZAWA 2VDPB 5FHQA 5L4LA 1ZMRA 3MELA 5JZVA 4RE5A 3FPAA 1T2NA 2UVPA 2CLSA 3IRVA 1BQ3A 2AOVA 2PRIA 3IV7A 1II8B 3JQ8A 5C5EA 1KK1A 4RPJA 3QFTA 4LBWA 2O2ZA 4H6XA 3UMYA 2IYEA 4WVLA 1VBNA 4UKDA 5K3AA 4HPJB 5B7PA 3V8MA 2EW2A 2RGEA 5JI3E 4MUIA 5M2QA 1G9TA 1QDUA 5HE8A 3NHBA 4LC0A 5E9QA 3FLAA 4RXUA 1BWRA 1H69A 1WOYA 3W79A 7REQB 4LXIA 2REXB 1R5JA 1OXKB 3V2HA 1E2NA 1KBZA 2C29D 1FOEB 3KKLA 1BJKA 2I6SA 2UV8A 3V5NA 3QFHA 3IR6A 3E9NA 4EIWA 3WOVA 5EIWA 4CKBB 4HQ0A 2GVZC 5A5EA 1LGYA 4JCCA 5JMPA 1NVMB 2VDKB 2JL1A 4HVTA 4LDPA 4DJTA 4L75A 3FJYA 4Q4HB 5DLEA 4EZEA 2ZDQA 5E9JA 1XD8A 1T0IA 3AEKB 3KKMA 2R87A 4B40A 4BVLA 5CB6A 4U3JB 2JFYA 1LS1A 3LIPA 4RTJA 5ITWA 3NKVA 1CY1A 3LOUA 1UBNA 2O7VA 2JI6A 3A14A 1XCOA 4UTZA 1N36B 3R24A 1ENPA 4U0KA 3V4LA 2P6RA 5KQSA 4JNCA 2YJ3A 2FJ0A 1JX6A 3RT1A 1GPAA 5LBUA 3G2QA 4FNGA 2O3SA 2W98A 5IABA 4Y2PA 1CHNA 1J06A 2MINB 2H4HA 3EG9B 1W46A 3G88A 1EKXA 4QLOA 1Y9JA 4J7AA 1XBTA 1UFKA 1Y8AA 2BM0A 3G0OA 3MMXA 4MA5A 2Z5LA 2ZIFA 3UTCA 3V4PB 4DLZA 1SG0A 3DG9A 3PFCA 2RJ3A 4QEKA 4UHBA 4UHFA 1KMMA 1K8YB 4FEAA 4OJMX 4B7AA 4WUVA 5AVTA 3HVIA 5C9GA 1KE2A 1Y1SA 4G1MB 3F96A 1WRBA 3KQQA 1DJQA 1KI2A 1N8NA 5J4KA 4E07A 1BC5A 4LWPA 4F8YA 2WSYB 1ZY2A 4AP9A 4TKVB 4YHBA 4XASA 4QGBA 2PUGA 2VPXA 3QY9A 4IFTA 1NW3A 2VDWB 3WFJA 3KZMA 2GWHA 4RF5A 1D2EA 4JI3B 1FUKA 4S1PA 4R7ZA 4CQMA 4HEJA 2ZRHA 4O4IA 1A9RA 3A25A 2GARA 2DEUA 3VPCA 3S4YA 1D4ZA 2DUMA 1C7QA 4X90A 5TS3A 1BJRE 2X4IA 1F06A 1F0YA 1KMQA 2QSYA 3R3UA 3BULA 3BL8A 4G8DA 5BWNA 1H93A 1QTQA 2C2MA 1U9CA 2H6EA 4FYHA 3ZQ4A 1NXXA 1GPLA 4HLQB 4MWZA 5EHXA 4D9EA 2QRHA 4TKZA 4OFWA 3L8HA 5C5CA 5F21A 3SIXA 3GJ4A 2ZG6A 4BMNA 3LE8A 4CQNA 3EWNA 2UZAA 3AP1A 1HI9A 5I7OA 3KSMA 1UDRA 3ZYZA 3QEMA 2CJWB 4N1AA 3N8DA 2PKQP 1AQNA 2MSLA 2XI4A 2CHGA 2QJTA 1R8JA 1V1RA 2GKOA 3T9CA 4A1OA 2X5KO 2Y68A 3H8WA 2WTUA 4X1IA 2VA8A 1WSAA 5E7JA 3FWZA 4F8JA 1Z2CA 3K9FC 4ALKA 3R3SA 1BSVA 4EYQA 4YRIA 1EM8B 4LV6A 1OYWA 1ZG3A 5NULA 3U0VA 3KYJB 1FMFA 4KR3A 2CNNA 4S04A 3A70A 4JJ6A 5DBOA 4C7JA 1MDFA 3QVWA 3GIDA 1DSSG 3OFKA 4W8HA 4GZ6A 2G0TA 4JUBA 5C8YA 1GR1A 2B8WA 1WXHA 4BV8A 3ICCA 2ZIAA 3Q72A 1QU2A 3C6BA 3IUPA 3WB9A 3T7CA 2NO7A 2OAEA 1RKQA 4J0QA 3T7SA 1XPRA 2Q2QA 4MKRA 4DXDA 3IOYA 1FX0B 3CB2A 1UM8A 3TZHA 2NZYA 1TMKA 5L3RA 4UUAA 4UVDA 3TIIA 1W6RA 2A5GA 3AWDA 1OAAA 2HQOA 4XCQA 2JLRA 1EGVB 2O2JA 4XIYA 5ENVA 2O06A 1AXEA 1C9NA 1E64A 1EU1A 2ZE5A 3AERB 3DFUA 3L46A 4JASB 3USCS 1KYIA 1TKRA 4PNZA 5AI0A 1B74A 4DRZA 2WAYA 3G0CA 3LT1A 1I0IA 3H4IA 1OLXA 2GASA 2D5I