The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
68
|
sequence length |
276
|
structure length |
276
|
Chain Sequence |
GSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDNDAASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMHGCELGPDRRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQDGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure of a Human Major Histocompatibility complex
rcsb |
| molecule keywords |
HLA class I histocompatibility antigen, alpha chain E
|
| molecule tags |
Immune system
|
| source organism |
Homo sapiens
|
| total genus |
68
|
| structure length |
276
|
| sequence length |
276
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 2010-08-18 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00129 | MHC_I | Class I Histocompatibility antigen, domains alpha 1 and 2 |
| A | PF07654 | C1-set | Immunoglobulin C1-set domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins | ||
| Alpha Beta | 2-Layer Sandwich | Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 | MHC class I-like antigen recognition-like |
