3AO2A

Fragment-based approach to the design of ligands targeting a novel site on hiv-1 integrase
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
153
structure length
138
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQEESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment-based design of ligands targeting a novel site on the integrase enzyme of human immunodeficiency virus 1
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/transferase inhibitor
molecule keywords POL polyprotein
total genus 51
structure length 138
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ao2A00
3ZSVA 4K8XA 3ALYA 4DSFA 1KVAA 3VA3A 3V81A 3RMBA 1U45A 4B9TA 1QQCA 4IG3A 3S3MA 4FLVA 4BE2A 4FJ7A 3OYHA 2PZSA 1VSFA 2P1JA 4CIFA 2VG6A 4I9LA 3BGRA 4KTQA 1I3AA 4PWDA 4DQSA 4CE9A 1S1TA 4UQGA 3F9KA 4PUOA 1YT3A 3G0ZA 4FZYA 3HJFA 3MAQA 1A5WA 1ZBUA 1RTHA 3ZSQA 4OGCA 4ELVA 2HHTA 1HJRA 2E6LA 1U4BA 4DWIA 4KREA 4TSXA 3ZT0A 1BIUA 4CEDA 3TARA 4CFCA 4DQPA 2A1SA 4W5NA 4CHOA 4CEFA 3QLHA 4CF0A 3SQ4A 1CXQA 4HCBA 1CXUA 1HMVA 1W9HA 5HBMA 4CGGA 1XHZA 4J2DA 1KSPA 3TR8A 4KO0A 4FJXA 4XIUA 3NHGA 3AVLA 4ELTA 3KTQA 2E6MA 2ZQBA 1CZ9A 5J2MA 2G8HA 3O3FA 3KLFA 2PYLA 4AHTA 3TAEA 4ID1A 3I0SA 1UA0A 1HNVA 4LSNA 1WAFA 4CF2A 1KLNA 4F2SA 3RMDA 3SPZA 5E41A 2G8FA 1ASVA 4M41A 1TVRA 3AVAA 4FLYA 4M3WA 2Q3SA 3B6OA 4FK2A 2DFHA 4KHWA 3RR7A 3SV3A 1RBVA 3ULDA 1L3UA 1HQUA 3K57A 4AHRA 4NCAA 4E1MA 3OYDA 4FM2A 4RW4A 3TAPA 2BE2A 2W42A 4Q5VA 4FLWA 4DSJA 4DSEA 4O44A 3AVCA 4EP5A 4H4OA 4RG8A 2G8WA 3K5OA 1IH7A 4FLTA 4DQIA 4EZ9A 1UA1A 3UIQA 3TAQA 1QSSA 4DFPA 1L3TA 3NH2A 3KLHA 4DMNA 4ZHRA 3V9SA 3KK2A 3QEIA 2Y1IA 1UAXA 1VSKA 4CGHA 4B9VA 1WLJA 4FJ9A 4M3YA 1X9MA 4RW9A 1B92A 4I7FA 4Z4HA 3I8DA 4FLUA 1G15A 2FBTA 1ASUA 2I5JA 4CGIA 3AA5X 1D9FA 4OGEA 1C1AA 3AO3A 3ZSRA 3ZT1A 4B9UA 1RTIA 1VSLA 4Q0BA 4M45A 3KIOA 2O4IA 5I3UA 3AVBA 3ITHA 3LWMA 1LWCA 2VG7A 4CEAA 2X74A 1WSJA 3O3GA 2VWKA 4OJRA 1HYVA 4PA1A 1BCOA 2F8SA 5C24A 1NOZA 3LPTA 3NBPA 3NGYA 3DLBA 3C95A 3AVMA 4J2BA 4NYFA 2KZZA 1JLGA 5KRTA 4N47A 4W5QA 1MU2A 1NK9A 1IG9A 4DSIA 3LP3A 4LH4A 3LANA 5KGXA 2HNZA 4M3XA 3KLIA 3ZT2A 4AHVA 4CK3A 4G1QA 3SZ2A 2HHSA 3OYCA 5CZ1A 4Z4IA 4QAGA 3E01A 2LSNA 3DOKA 3AA4A 2PY5A 3ZCMA 2IAJA 1QSYA 4IDKA 2HW3A 3VQ9A 3NH0A 2BGGA 5T7BA 3NE6A 1BL3A 1WSGA 4GMJB 2YNFA 2DTUA 2E4LA 3CYMA 5HRSA 3QEWA 4N41A 1UOCA 3DRPA 1VK0A 3M8PA 3VQQA 4CEEA 3OYJA 1ZBFA 2GBZA 1D8YA 4M3ZA 1C0MA 1KFDA 2D5RA 2ZE2A 1RBUA 1TKDA 3VQCA 1K6YA 4CFDA 3DYAA 3SQ1A 4DF8A 1B9DA 2BDPA 2YKMA 3KD5E 1TL1A 3OYIA 1I39A 4FM0A 4B8CA 1NJYA 4DF4A 1LAVA 1NOYA 1QS4A 2P5OA 3VQ8A 1CZBA 2YKNA 2X6NA 3PO4A 3TANA 2KW4A 3HPHA 2HHQA 1XC9A 3HVTA 1REVA 4C8OA 1WAJA 4CECA 4CJ3A 3ZSWA 4MFBA 3CM5A 3HXMA 2KTQA 3LALA 4FJGA 1KTQA 1RBTA 2IOCA 4CJPA 3VQPA 4CFBA 3NFAA 4F3TA 3SJJA 1FK9A 3IG1A 3VN5A 1SL2A 1D5AA 3V9ZA 2ATQA 3QEVA 3V9WA 1KVBA 5HP1A 1LV5A 1T7PA 1KVCA 3OYEA 4F3OA 4J2AA 4CHYA 1NKBA 4JS4A 4CESA 3CQ8A 4B8AB 4B9LA 4WE1A 3P5JA 1Q9YA 1LWFA 4DG1A 3ZT4A 3OS1A 3O4QA 2XHBA 4JS5A 2XRIA 4IG0A 3K58A 3SNNA 4CERA 4BE1A 4AHUA 3PV8A 3RRHA 3OYLA 2OPSA 1RT7A 1IKWA 5C42A 4HHTA 2ZD1A 4CJEA 4DLEA 2OZSA 4FZXC 3A2FA 4FJ5A 2HVIA 4HUGA 3EZ5A 4CEZA 4E7IA 4DTXA 3PUFA 3MEGA 4KI6A 3DLKA 3LZIA 4E7JA 3AVIA 3QESA 4Z0UA 3KLEA 3OS0A 5I42A 2IC3A 3OYGA 3K5LA 2B4JA 1SL1A 1C1CA 1U04A 2JLEA 4CHPA 1JLEA 4OPKA 4JRQA 3QNNA 1J5OA 4F4KA 4OLBA 4DU3A 1B9FA 1BCMA 4QOZB 4CGFA 4LD0A 4ZTFA 1RNHA 4KHYA 3HP9A 4CIGA 4FVMA 3AVHA 3QNOA 1VSJA 4IFVA 1T05A 4OLAA 1KFSA 3IAYA 3DLGA 3V9UA 2G8VA 2DFFA 3L2QA 3SI6A 1JLCA 3CM6A 1ZBHA 4E7LA 4JRPA 1HPZA 3NGIA 4DU1A 2NUBA 1TAUA 4M3TA 3L2RA 3V4IA 4O0IA 4PY5A 4AH9A 4KB0A 3HPGA 3NF8A 1NK0A 2QKBA 4FJKA 2DY4A 1S1WA 3K59A 4LSLA 3HO1A 1NKCA 1S5JA 2OZMA 1Z26A 3B6PA 4DQQA 3NF7A 2HVHA 4FW2A 1ZYQA 2KZMA 1EKEA 1C0UA 3C94A 1RDBA 1HNIA 2WONA 4Y1DA 4JLHA 3V1RA 3AA3A 1BQNA 2YHBA 2IS3A 1JXBA 2P5GA 3VQEA 3HSTB 3OJSA 1R0AA 1QTMA 2HMIA 3ASMA 1S1VA 3DI6A 4N56A 4I2PA 4YNQA 4FJNA 4OVLA 1L3VA 2R7YA 3NCIA 4IKFA 1S1UA 2AJQA 5K14A 3OYFA 4DTSA 4RW8A 5KI6A 2ETJA 4KV8A 4CJVA 1NJWA 1L3SA 2HHWA 1GOAA 3TI0A 3L2VA 2EX3A 2FC0A 4AHCA 3HVRA 4CF9A 1XHXA 3VA0A 4DSLA 1JLFA 1YVUA 3DLRA 1QHTA 3LDSA 3AA2A 1SKSA 3OS2A 4IFYA 2A1RA 3VQ5A 3OJUA 5HLFA 4OKKA 1CLQA 3LAKA 1LW2A 4O0JA 4OKJA 3DLHA 5FDLA 4KHNA 3MECA 3C6UA 2IDOA 1N6QA 4FZZA 3KD1E 5HRNA 4NYNA 4KRFA 3RMCA 1HRHA 2VG5A 2RPIA 2D0BA 3P83D 4CGJA 1LW0A 4Z4GA 2YHAA 1RT2A 3P1GA 4CJKA 3T1AA 3WNFA 5JS1A 3HK2A 1DTTA 4CJ4A 1SKRA 2G8KA 4B9MA 4F2RA 3D0PA 3TABA 3HL8A 4DS4A 4OPJA 2HB5A 2QXFA 3D45A 4CJRA 1NK7A 3PO5A 3DRSA 3AVKA 3OYNA 2XY7A 4KTZA 3M8QA 4FK4A 4Z4CA 3MEDA 5HRRA 3SPYA 4E19A 1L5UA 4NCBA 3PX4A 2KQ2A 1U47A 1RTJA 1D9DA 3V1OA 3RRGA 1Q9XA 4KHUA 1C6VA 4CF1A 1JLAA 4CFAA 4CHQA 3VQDA 2GUIA 2F96A 2FBYA 5FROA 3VQ4A 1QE1A 3NH1A 3T19A 2RN2A 4F8RA 2PYJA 3AVJA 4W5TA 5J2NA 2F8TA 4FJMA 1RT3A 1FKPA 4E89A 1ITGA 3SCXA 3TWHA 3LPUA 4W5OA 1S6QA 4CJUA 2HHXA 3AO1A 2RKIA 3ZSZA 1KCFA 3IS9A 1EP4A 3KLGA 4BDYA 3L3VA 1GOBA 2EHGA 3HM9A 1RBRA 3SYZA 5DMRA 1TAQA 1RT5A 3L2UA 3L2WA 1F21A 2KFNA 3V9XA 4FW1A 3LZJA 4BWMA 5CZ2A 4CEBA 1IKVA 1DTQA 5KRSA 3ZT3A 4BDZA 2RF2A 3MXMA 1TKXA 4LY7A 5HRPA 4B9SA 3U6FA 1Z25A 1U48A 3ISNC 4DTOA 1X1PA 3NF6A 4DFMA 3QEPA 1WSEA 3MEEA 1TV6A 5FRNA 4H8KA 1ZBIA 2Z1HA 3C6TA 3WNGA 3HP6A 4E7KA 1RCHA 4ELUA 1HQEA 1RT6A 3VQ6A 1ZBLA 1J9AA 1WSFA 1O1WA 3DMJA 2KFZA 4IBNA 4QCLA 3VQ7A 3DLEA 2Z1IA 3CG7A 3TAMA 4I2QA 4GW6A 3VQAA 3VQBA 4EP4A 3NDKA 4FJJA 2XO7A 4BACA 1RBSA 1S9EA 3ZSOA 2XY5A 1TKZA 4DQRA 4CJTA 1VSEA 3PX6A 4B3OA 4HUEA 1DLOA 4NCGA 4CJQA 4DTNA 1BIZA 3LAMA 2YNIA 3OYBA 4H4MA 3WNEA 5D3GA 2OPQA 4ID5A 5JS2A 2O4GA 1VSMA 4B08A 4YFUA 3V6DA 2G8IA 1NK8A 3IRXA 3QINA 2OA8A 1IKXA 4M42A 4CJLA 4CHNA 5J1EA 3M8RA 3CFRA 4FJIA 1WNSA 1Q8IA 3CFOA 4DFJA 4DTRA 1KLMA 1TK0A 1QSLA 2X6SA 1X9SA 4CIEA 5HROA 1XI1A 3DOLA 1A5XA 4CJSA 4W5RA 4C8KA 1XWLA 2VWJA 2HHVA 2IGIA 3WNHA 1IKYA 3K5NA 1C1BA 3S3OA 4CCHA 3QIPA 3O3HA 5J2PA 2JGUA 2OPPA 1S1XA 3DRRA 3QO9A 3RTVA 1RDDA 3MXJA 1NJXA 3AVGA 4O4GA 1SUQA 2DFEA 4FYDA 1NK5A 1RT4A 1FKOA 4CJFA 5EU7A 3M8SA 1TK5A 2OYQA 2D0CA 1VSDA 2HNDA 3EY1A 4E0DA 4CEOA 1JLQA 3OYAA 3F73A 4FCYA 1BHLA 3SUQA 2HHUA 4DLGA 1NJZA 4Z4EA 4DTMA 4DS5A 4ICLA 2B6AA 4E1NA 3SUNA 2P51A 3K5MA 3MXIA 4BWJA 4Y1CA 4DTJA 4CK2A 1WN7A 1J53A 3LP0A 4M3RA 1WSHA 3FFIA 3JSMA 3QETA 1SV5A 3QERA 3RMAA 3SQ0A 4N5SA 3NF9A 4CHZA 2XY6A 4BDPA 3AVNA 1RILA 5FRMA 2D0AA 4E3SA 1LAWA 4RW6A 1NK4A 4CJ5A 1RDAA 4R5PA 1TKTA 1VRUA 4AHSA 4FM1A 3T3FA 1BGXT 5J2QA 1C0TA 3HYFA 3ZSYA 3H08A 2HNYA 4FLXA 1NKEA 4CGDA 3AVFA 4EZ6A 4PQUA 1BI4B 1BI4A 4CF8A 4DSKA 4O5BA 3O4NA 1HYZA 1EX4A 4HCCA 4C8LA 3U3YA 1S6PA 5CY4A 3SUOA 3KKRA 4E7HA 1TL3A 1W0HA 4GVMA 3TAGA 4KI4A 2Z1JA 3OYMA 1BQMA 2YNHA 4LH5A 4MQ3A 1J54A 1BISA 2G8UA 4HTUA 1NK6A 3L3UA 3THVA 4CJWA 4M3UA 3PX0A 4FJ8A 4KB1A 4FLZA 3G10A 1SKWA 4KPYA 1EXQA 3KK1A 4L8RB 1X9WA 1UWBA 3V1QA 4BE0A 4I9QA 5SZTA 4O55A 2OPRA 3S9HA 1TGOA 3SQ2A 1U49A 3KK3A 3NGZA 1A5VA 3QIOA 1KRPA 5KGWA 4CEQA 3RWUA 1ASWA 3L8BA 4DTUA 3OVNA 2Z1GA 3LP1A 4KHQA 1S9GA 1JL1A 1Y97A 3HT3A 4DU4A 3EYZA 2FBVA 4KKOA 3LP2A 3ZSXA 4HUFA 4B9NA 1SL0A 3KJVA 2Y1JA 4FJLA 4FK0A 4N76A 4RW7A 1RDCA 4CK1A 1FXXA 4ZTJA 1GOCA 1JL2A 2YV0X 3U3GA 1TK8A 1IO2A 3RR8A 1T8EA 4OKEA 5CYMA 4FXDA 2ITGA 1RT1A 4AILC 4Z4FA 4KHSA 3SV4A 2B5JA 1YTUA 1VSIA 4KTWA 1YTAA 4HVJA 3KKSA 3QEXA 1JLBA 2X78A 3HPOA 4C8MA 2BANA 1JXEA 2YNGA 4C8NA 5CYQA 3AV9A 3OY9A 4KFBA 3TAFA 3AO4A 3SUPA 3S3NA 3K2PA 3JYTA 1HYSA 1WSIA 3PY8A 2GV9A 5C25A 3CFPA 3OYKA 4KAZA 1T03A 1EETA 2XY8A 3I0RA 5SWMA 4DFKA 1RTDA 4K8ZA 2FBXA 5DK5A 4DTPA 2QKKA 3BDPA 4J2EA 3DM2A 3LWLA 1N5YA 3AO5A 4FJHA 1JKHA 1LWEA 1VRTA 3AO2A 2WOMA 1VSHA 3NAEA 2QK9A 5KTQA
chains in the Genus database with same CATH superfamily
2E20A 3E9LA 4H5NA 4B9TA 3J80O 4BROA 2JWLA 2PZSA 2VG6A 4I9LA 3BF1A 1I3AA 1S1TA 4UQGA 2P9LA 3HJFA 3ZSQA 3M5RA 3EZWA 4CF0A 4YOVA 1HMVA 1W9HA 4C1NK 3AVLA 3KTQA 1U2VA 3J8AA 2ZQBA 4JK9A 2VGMA 3KLFA 1BO5O 2PYLA 3TAEA 4JI8K 2QWOA 4BGAA 4ID1A 4LSNA 1GLDG 3RMDA 3SPZA 5E41A 1ASVA 3HM8A 2Q3SA 4C23A 3R1XA 3L6QA 1RBVA 3ULDA 3CF5L 1NU0A 5BREA 3OYDA 4FM2A 1NMNA 2BE2A 5AQHA 3U4LA 4Q5VA 2YX6A 1KD1O 3AVCA 4RG8A 2G8WA 3CCVN 4DR3K 4FLTA 4DV6K 4DQIA 1T3VA 2GX9A 2Q1NA 3O9RA 3KLHA 4DMNA 3V9SA 2W6LA 3VERA 1WLJA 3R9PA 3I8DA 4I7FA 2IVPA 1G15A 4OGEA 3U9DA 1CZAN 5BRFA 2QM1A 2VGNA 3CPEA 4LFAK 4KH4A 3LWMA 2KKZA 1LWCA 4CEAA 4B1ZA 1BCOA 3BUZB 3P39A 3LPTA 4O8KA 3C95A 4KH5A 2ITMA 4LF5K 1NBWA 4KBOA 4W5QA 3LP3A 4LH4A 1E4FT 4QS9A 4AHVA 3CJ7A 4H03B 3HSCA 1QZ6A 2HW3A 3VQ9A 2BGGA 4GMJB 2YNFA 3VTHA 2DTUA 3QEWA 4N41A 3M8PA 4HWIA 3OYJA 2ZE2A 4DF8A 1B9DA 2YKMA 1BU6O 1LAVA 2CGLA 4CJ7A 3TANA 4LF8K 5EVZA 2HHQA 3HVTA 2QWQA 3HXMA 5GAHP 1KTQA 4CFBA 3HTVA 3QICA 1SL2A 1S72N 3V9ZA 1N32K 5HP1A 4JI7K 3OYEA 1DEJA 3I8BA 3CQ8A 4FPBA 4DG1A 3ZT4A 3OS1A 3O4QA 3AY9A 1RT7A 4HHTA 2HVIA 1ZC6A 4DR7K 3WXIA 5AQXA 3MEGA 4DUZK 4E7JA 3AVIA 4L3QA 3OYGA 3K5LA 1N33K 2CH6A 1J5OA 1GLBG 1BCMA 1GLFO 2NRVA 2P9PB 4EIAA 1RNHA 1YHQN 1T05A 3IAYA 3L2QA 1S22A 1ZBHA 4QS7A 1HPZA 5AZIA 1NLVA 4M3TA 4O0IA 4CBWA 3QFUA 4CZHA 4KB0A 1NK0A 2DY4A 1S1WA 5GINA 4LSLA 1XNRK 4NO7A 4NLBA 3EL2A 4JK8A 2UUCK 3MN7A 2KZMA 1EKEA 1RDBA 3AAQA 4Y1DA 1BQNA 4IJNA 4B3MK 1SZ2A 5H1SQ 1NM1A 2VYPA 1HNWK 1YVNA 3ASMA 1S1VA 5AQTA 2KHOA 3E1YA 4IKFA 5K14A 5BR9A 2ETJA 5E84A 3L2VA 2FC0A 4AHCA 3HVRA 1XHXA 3KK7A 3VA0A 3DLRA 1SKSA 5HLFA 4OKKA 4PKGA 2YI1A 1W7AA 3PIPL 3C6UA 1N6QA 3KD1E 4BRNA 3RMCA 2UUAK 3FZKA 3CCUN 4CGJA 2ZJQL 1LW0A 4Z4GA 3P1GA 1BG3A 3HBTA 4H0XB 3ZYYX 4CJ4A 1SKRA 3D0PA 3TABA 1HPMA 1HR0K 3EO3A 4H0VB 2E2PA 3J81O 2XY7A 3SPYA 5AZJA 1O13A 4E19A 1L5UA 4NCBA 1D9DA 1RTJA 4KHUA 3T7ZA 4CF1A 1VAZA 4CFAA 2F9WA 2GUPA 3CCMN 5FROA 2F96A 2FBYA 4B3RK 2O8FA 2FF3B 3AVJA 1KXPA 1N36K 2NRHA 1YITN 4G9ZA 1ITGA 1HLUA 3SCXA 3K9JA 3AO1A 2RKIA 1KCFA 1TUUA 3KLGA 1EP4A 3R3LA 3L3VA 2EHGA 1RBRA 3L2UA 1F21A 4CEBA 2P9KB 5CZ2A 1DTQA 4BRGA 5KRSA 2RF2A 1OH8A 1TKXA 5HRPA 1Z05A 1Z25A 3ISNC 4DTOA 1Q82O 4B9QA 4BR5A 3C6TA 3WNGA 1NGGA 4Z94A 1ZBLA 1WSFA 3W0LA 3DMJA 3UB5A 4N56A 1ILYA 4M42A 3O6WA 4I2QA 3VQAA 3QBXA 3CCQN 4I6MA 1S9EA 3D2EB 3PX6A 1NGBA 4ILJA 2YNIA 2YJFA 3OBYA 2OPQA 3F2KA 2O4GA 3SMSA 5AQIA 2NZTA 1NK8A 3QINA 4XEIA 5J1EA 3M8RA 4FJIA 4DTRA 4MO4A 2X6SA 5HROA 2W6KA 4MDAA 5AQYA 2E2OA 4A2AA 3VF2A 1Q81O 1IKYA 3K5NA 3HZ6A 3S3OA 2WUSA 2OTLN 4BC2A 3ENHA 1NJXA 4CJFA 3M8SA 1TK5A 2D0CA 3CXCM 1E4GT 2E1ZA 1JLQA 3OYAA 2HHUA 1KC8O 5GIPA 1J5EK 1XQSC 3J7ZO 3K5MA 4DTJA 4CK2A 4M3RA 1M1KO 3FR0A 2XY6A 1RILA 4JKGA 4CZMA 3R6MA 2FSNA 2WFBA 3SLCA 1RDAA 4CJ5A 4DKWA 3THWA 2NRTA 3GG4A 2YHWA 1H1VA 1NKEA 3H08A 2F4VK 1NGIA 4PQUA 3LM9A 4C8LA 3U3YA 1S6PA 3KKRA 1W0HA 4KI4A 1BISA 2OANA 5AFUA 3LDLA 3L3UA 3PX0A 1Q7YO 3H3NO 3WXKA 4KB1A 2BH1A 3QFPA 1S3XA 2O8BA 1UWBA 5SZTA 1BWFO 2OPRA 1EWQA 3HOTA 4IEEA 1KRPA 3O9SA 4DTUA 3HI0A 2PFUA 2RE2A 4DU4A 5ADXA 4KKOA 3LP2A 4B1YB 4CK1A 4ZTJA 3CCSN 4YDUC 1GOCA 3E9PA 1TK8A 1IO2A 3RR8A 2ITGA 4AILC 2UXCK 2B5JA 5ADXH 1YTAA 4CBUA 1JLBA 4K42A 1NWKA 2YNGA 4KFBA 3SUPA 3K2PA 4JI0K 3PY8A 4KAZA 2QW9A 2FBXA 4DQ8A 5B8HA 4J2EA 4WQ4C 1JKHA 3W3DA 1V4TA 2WOMA 1VSHA 3O4WA 3OTOK 3VA3A 1XUPO 3V81A 3RMBA 1JCFA 4FLVA 4FJ7A 3OYHA 3G25A 1VSFA 5JMVA 4DQSA 4CE9A 3M3ZA 1ATRA 1YT3A 4M7YA 4FWSA 4FZYA 3MAQA 1RTHA 1SQKA 4WFBL 3GE1A 4CEDA 4W5NA 3TARA 2A1SA 3EKSA 3ZEUA 4CHOA 4CEFA 3B8AX 3CERA 4HCBA 1CXUA 1XHZA 1KSPA 4XIUA 3O9UA 4ELTA 1CZ9A 5J2MA 3EE8A 2G8HA 1HNVA 4CF2A 4H5TA 3H46O 1KLNA 2G8FA 3VEVA 2H3GX 4M41A 4DV5K 4FK2A 5AZJB 3CQXA 1L3UA 4AHRA 4FOEA 2AP1A 4K41A 4BC5A 3TAPA 3ATUA 4FLWA 3ENOA 4DSEA 4FO0A 4BRMA 3K5OA 1IH7A 1UA1A 3H45C 1K8KA 5HL7L 4XH1A 2E8AA 4B1UB 3QEIA 3KK2A 1VQKN 1UAXA 5AQKA 4FJ9A 3CJ1A 4RW9A 4BRFA 4FLUA 4ISFA 1NG9A 2FBTA 4F9OA 1ASUA 3AA5X 4DHYA 1C1AA 3ZSRA 4B9UA 5AQUA 3SJHA 4Q0BA 3IUCA 1E3MA 5E26A 3KIOA 4BGBA 4JYAK 2A3ZA 3AVBA 1T6CA 4CD1A 4FWLA 3O3GA 4PA1A 5LY3A 4V19S 3DLBA 3AVMA 4J2BA 3P4IA 5AQOA 3THWB 4YY3K 2KZZA 3ZETB 1TYQA 4A59A 3G71N 4H0PA 5KRTA 4DV0K 5AQGA 4AM7A 1IG9A 4DSIA 3RSEB 2D4WA 4U7BA 2KLAA 4BR9A 3SZ2A 4OO1J 3MDQA 2CGJA 3E01A 1QHAA 3THYB 3AA4A 1NGHA 3ZCMA 2PY5A 4IDKA 4JKGB 2ZJRL 3A5NC 1BA1A 4LFBK 1WSGA 4GKKK 5HRSA 3D2FA 1UOCA 3DRPA 3VQQA 4CEEA 2D5RA 3CCRN 1YJWN 3VQCA 4CFDA 1JJ2M 3DYAA 2BDPA 5C0YA 4FWOA 5F0XA 2A42A 2YKNA 2WTUA 4DR1K 1D4XA 5BN9A 3HPHA 5A2QO 1QQOA 4CZLA 1REVA 1KAYA 1WAJA 1U6ZA 4CJ3A 3ZSWA 4MFBA 3LALA 4NB4A 1RBTA 3TU5A 4F3TA 5FPDA 3IG1A 3Q7BA 3VN5A 2ATQA 3QEVA 1LV5A 1KVBA 5AQVA 4F3OA 4DV7K 4CHYA 4B9LA 4CESA 1LWFA 2XHBA 4JS5A 2QI2A 4AHUA 3TSPA 3RRHA 3PV8A 3OYLA 2OPSA 4FWKA 3MN9A 3E9OA 4FZXC 3CPWM 3H3OB 4CEZA 4E7IA 4DTXA 3PUFA 4JI3K 3QESA 4LF6K 2CGKA 4Z0UA 2A40A 5HOOA 5AQPA 3OS0A 4H0OA 1C1CA 1JLEA 2P9KA 4OPKA 1YJ9N 3JXUA 4DU3A 3WQUA 4LD0A 4IOCL 4ZTFA 3HP9A 4CIGA 4FVMA 4OLAA 4IFVA 3O08A 3V9UA 3QMLA 3SI6A 2AA4A 4JRPA 4IEIA 1TAUA 1VQPN 4AH9A 3HPGA 3NF8A 2QKBA 2P9UA 3B6PA 3NF7A 4BVOA 1ZYQA 3C94A 3G6EN 3SAGA 2IS3A 2D0OA 3OJSA 1R0AA 2OCEA 2IIRA 3DI6A 4I2PA 2QWNA 4J8FA 2WC9A 4A2BA 3BEXA 1HNZK 4RW8A 1NJWA 4KV8A 3DLLL 1HNXK 3TI0A 5AQFA 4X66K 3VOVA 3CC4N 5JLHA 1YVUA 1QHTA 2BUPA 3SBGA 1NMDA 4YHHK 4IFYA 5IT9O 2FSKA 1CLQA 2F7TA 2A5XA 3LAKA 4O0JA 3VPZA 3DLHA 2IVNA 4EFHA 2D0PA 4NYNA 2VG5A 4DV1K 2RPIA 2D0BA 3P83D 2NNWA 3HRGA 1X3MA 5JS1A 3HK2A 4F2RA 4YOYA 4CJRA 3TTCA 3AVKA 3OYNA 4EAHD 2P9IA 1XNQK 1GLJO 4FK4A 4YOWA 4CW7B 2KQ2A 4U67L 3SAHA 1C6VA 4B1WB 2ASMA 3TSQA 3L4IA 3VQDA 2GUIA 3VQ4A 3NH1A 3T19A 2PYJA 1IG8A 4FJMA 1YIJN 1ESVA 3TWHA 2P9IB 1S6QA 1U2VB 4CJUA 2HHXA 3UKRA 1NGJA 2VCPA 2J4RA 4JKCA 5M1QA 3N4PA 3HM9A 3SYZA 5DMRA 1TAQA 3L2WA 4WF9L 1V4SA 2P9SB 3V9XA 4BWMA 1IKVA 4FWRA 4IZ9A 1BOTO 4GKJK 4B9SA 3SAFA 1X1PA 4DFMA 4ELUA 3HP6A 4E7KA 2DPNA 1RT6A 1J9AA 5LMNK 2KFZA 4JD2A 3CG7A 3VQBA 2HSTA 4OPAA 3WUHA 5FPMA 2XY5A 4BACA 1K73O 3OW2M 4BQZA 4FOIA 1DLOA 4CJQA 2NRXA 3LAMA 2ZGYA 4ID5A 1VSMA 4B08A 4YFUA 3V6DA 2G8IA 3IRXA 2OA8A 1IKXA 4CJLA 3CFOA 4DFJA 1TK0A 2E88A 1X9SA 2HOEA 2P9PA 1XI1A 1P8ZA 1A5XA 2ASOA 4CJSA 4W5RA 5BRDA 4C8KA 2VWJA 2IGIA 3BF3A 4JI6K 3WNHA 3SMPA 1JCEA 4CCHA 3QIPA 3O3HA 5C2FA 2JGUA 2OPPA 1S1XA 4JV5K 3J7AP 1Y64A 3LDPA 4IO9L 1SUQA 1NK5A 1RT4A 4E0DA 1VSDA 2HNDA 4FCYA 2YHYA 1NGDA 4JNEA 4DLGA 1NJZA 4CZJA 3N4QA 2PBDA 4ICLA 2HBMA 3LM2A 4BWJA 3AGKA 1FW6A 1J53A 1WSHA 1EO1A 3QETA 1SV5A 4N5SA 3AVNA 1NK4A 4BQLA 4X62K 3KZBA 4R5PA 2P9UB 1VRUA 4AHSA 5BPMA 1BGXT 1G99A 3CQYA 1IBLK 1BI4A 4DSKA 3JAMO 3O4NA 4A62A 1HYZA 1W2BM 5TKWA 1EX4A 4A57A 5CY4A 3SUOA 3TAGA 3OYMA 4LH5A 1VQ9N 1M90O 1J54A 4JD2B 4BY9C 1NK6A 3THVA 4M3UA 4FJ8A 3U9ZA 4BE0A 3WEEB 4O55A 5BR8K 1U49A 3KK3A 2VQEK 1A5VA 3L8BA 3QBWA 5CHIA 1HJOA 1S9GA 1JL1A 1OVYA 3ZX3A 3HT3A 3EYZA 1IJJA 2FBVA 4HUFA 4FK0A 3HOSA 4N76A 1SL0A 3GBTA 1RDCA 4BR2A 3TSUA 1JL2A 3THYA 4OKEA 1T8EA 4FXDA 1X3NA 1RT1A 2HHHK 5GAGP 3KKSA 3FFKB 4FVUA 2X78A 3HPOA 4C8MA 2BANA 5CYQA 1HYSA 4Y0WA 4BRPA 1WSIA 4YORA 3E66A 1EETA 3MK6A 4O8UA 4MDBA 1RTDA 5DK5A 3LWLA 3DXKA 3AO5A 1VRTA 5AQRA 3UKUA 4K8XA 4CI6A 3IFRA 3TTDA 3CC7N 1RDUA 1QQCA 4IG3A 3S3MA 3AARA 2P1JA 3BGRA 5AQWA 4KTQA 4CZEA 2QWMA 3F9KA 2HF4A 5EOYA 4PL8A 3G0ZA 4EHUA 1ZBUA 2E6LA 4DWIA 4KREA 4TSXA 3ZT0A 1BIUA 1HUXA 4CFCA 4DQPA 2Q0RA 3QLHA 4J2DA 5HBMA 3IDHA 1HKBA 4KO0A 4FJXA 3PLAA 3NHGA 1ZXOA 2E6MA 3ZETA 3O3FA 4AHTA 2FLOA 4JKDA 3T69A 4K0KK 2NLXA 3THXA 2ZJPL 3ZX2A 3I0SA 3DJCA 4DV3K 2FXUA 3CETA 4BREA 3AVAA 3B6OA 1YI2N 1N34K 3SV3A 1HQUA 3K57A 3F5TA 3MN5A 4LF9K 3H1VX 1VQON 5M1KA 3VF6A 4DSJA 4O44A 4H4OA 4EZ9A 3TAQA 4OPHA 3AAPA 3O80A 4RWTA 4ZHRA 4FL9A 3CI5A 1X9MA 4Z4HA 1VQ4N 2I5JA 1D9FA 3AO3A 3ZT1A 1RTIA 5JICA 4M45A 2P9NA 1HX1A 3ZX0A 2QTDA 2O4IA 1VQ6N 3I33A 3KWIA 3ZLJA 4JHDA 1WSJA 1QVFM 1HYVA 5BPLA 1VQMN 4ISGA 5C24A 3NBPA 1WB9A 3T1YK 4NYFA 1ZBSA 3BP8A 2UXDK 1MU2A 3M6GA 4DR2K 4M3XA 1R59O 4CZGA 4CK3A 4NXNK 4G1QA 4H5VA 1EQYA 4YOUA 1BL3A 3VEWA 3WXJA 2HBJA 2E4LA 3CYMA 4IJAA 2GBZA 1D8YA 5BPNA 4BR0A 1K6YA 3SQ1A 1WBDA 1TL1A 3A0IX 3OYIA 1I39A 4FM0A 3IMXA 4JKBA 4B8CA 1NJYA 4DF4A 3LL3A 1QS4A 2QWRA 2P5OA 1WUAA 2X6NA 3PO4A 4R79A 4CECA 3CM5A 2KTQA 2Q2RA 3K9KA 3C6HA 2IOCA 4WQ5C 3VQPA 3J7YP 3NFAA 3TPQA 1FK9A 4J2AA 3RSEA 4JS4A 3FZMA 1NKBA 4WE1A 1Q9YA 3EEQA 2XRIA 3C6AA 4IG0A 2ASPA 5MLCQ 1VHXA 3T1HK 2Q0UA 4IWVA 5JVGL 2ZD1A 3CCLN 2OZSA 3A2FA 4JKHA 4IOXA 1EWRA 1C0FA 4JKFA 4JEPA 3EZ5A 4HUGA 3DLKA 3KLEA 2IC3A 2B4JA 5C15A 1U04A 1SL1A 4CHPA 4F4KA 2RHKA 4YDUA 3QNNA 4OLBA 1B9FA 3CMAN 2O8BB 1Z6RA 1YJNN 4KHYA 3WT0A 4DR6K 3VGKA 1KFSA 4BRLA 3VMFB 3CM6A 1TYQB 3NGIA 2NUBA 3H6EA 3C65A 4XH4A 3L2RA 3V4IA 4PY5A 2FSJA 4JI2K 1DT9A 4EHTA 4FJKA 2W40A 1S5JA 3DXMB 2OZMA 1Z26A 1C0UA 5GADP 1OH6A 4BR4A 2WONA 4JKAA 4JLHA 1DGKN 2UYTA 3FGUA 3G4SN 2YHBA 4AQYK 1JXBA 3VQEA 3HSTB 4FJNA 3WXMB 3NCIA 1WBBA 1S1UA 2AJQA 1LCUA 4BRCA 4FSVA 5KI6A 4CJVA 1RGIA 2HHWA 1L3SA 3L4QA 1GOAA 3CMEN 2EX3A 1I94K 4CF9A 4BVPA 4DSLA 4O5FA 1JLFA 2YJEA 3LDNA 3A5MC 3OS2A 3MCAB 5GAEP 3VQ5A 1IV0A 4OKJA 5FDLA 5KPZA 4FZZA 5HRNA 4KRFA 1HRHA 4MO5A 3VETA 4JI5K 3DXKB 2YHAA 4RTFD 4IOAL 4DV2K 3T1AA 2Q31A 1NGFA 1DTTA 4CZIA 3QB0A 3HL8A 4DS4A 2HB5A 5ELZA 3PO5A 3PSIA 4KTZA 3M8QA 1YF5L 4MLHA 2F9TA 2QA4N 4Z4CA 3MEDA 5HRRA 3PX4A 1U47A 3V1OA 3RRGA 1RDWX 5CE3A 3D2EA 2O8EB 1JLAA 4CHQA 2ZGZA 4JAXA 4F8RA 4W5TA 5KPRA 3GL1A 3LPUA 3KHYA 3ZSZA 4CZKA 4BDYA 1GOBA 1VQNN 4WFAL 3MCPA 1RT5A 2VWBA 4M7XA 3RVCA 3MX5A 3MXMA 4YOTA 1U48A 3IKMA 2O8DA 1WSEA 1TV6A 1ZBIA 5FPEA 1W97L 1RCHA 3SBTA 1HQEA 2PAVA 2ZWHA 1OH5A 1MWKA 4IBNA 3VQ7A 3DLEA 2Z1IA 4GW6A 3NDKA 2XO7A 1RBSA 5LJVA 3O1WA 2NRRA 4KHPK 4DQRA 2V7ZA 4B3OA 4RCHA 4H4MA 5D3GA 5JS2A 3CFRA 1Q8IA 1KLMA 1QSLA 4CIEA 1WOQA 3ID6A 4GNIA 1XWLA 4GVEA 2E5LK 4HTLA 3DRRA 4LFCK 3RTVA 3OBWA 4FYDA 3AVGA 4O4GA 4WFNL 2Q36A 2P9SA 3EY1A 1NNEA 4Z4EA 4DS5A 2B6AA 1QQNA 2GWJA 3SUNA 2P51A 3MXIA 3DAWA 4Y1CA 3LP0A 3FFIA 3JSMA 4BDPA 3QERA 3SQ0A 4CHZA 4DCHA 4E3SA 4RW6A 3C7NB 5EX5A 3ATVA 4FM1A 1YUWA 3KWGA 4FWNA 5J2QA 2VQFK 3ZSYA 3HYFA 4CGDA 3ID8A 2E2NA 5JVHL 3NMUA 4PKHA 1TL3A 4GVMA 2Z1JA 2UXBK 2YNHA 4MQ3A 2E2QA 4DR5K 3LDQA 4HTUA 1ATNA 2CH5A 4FLZA 3FE1A 3G10A 4KPYA 4B3TK 4I9QA 3S9HA 1TGOA 1GLEG 3RWUA 1T44A 5AQMA 1T6DA 3OVNA 2Z1GA 3LP1A 4QS8A 3I55N 3ENBA 4KHQA 2GEMA 3FZHA 4BRAA 4FJJA 3ZSXA 2Y1JA 2I7NA 4RW7A 4WQ5A 5C2DA 2YV0X 5CYMA 1N8RO 4I6MB 4BC4A 1NJIO 4GV6A 5KQDA 1YTUA 1VSIA 4KTWA 4HVJA 4BRHA 3QEXA 5KPTA 3TAFA 3AV9A 3S3NA 5AQNA 3JYTA 2YCHA 3UE5A 2ZF5O 3PIOL 5C25A 3CFPA 3OYKA 1T03A 3I0RA 4BC3A 5AFUH 3F9MA 4DTPA 2GELA 3BZCA 3DM2A 1LWEA 3AO2A 1MA9B 3FZLA 3C0BA 3ZSVA 3ALYA 4DSFA 1KVAA 3KVGA 1U45A 4DUYK 4FWQA 4BE2A 4CIFA 4CBXA 4BG8A 4PWDA 4PUOA 1DKGD 4E1JA 1A5WA 2O8FB 4OGCA 3P38A 4ELVA 1HJRA 2HHTA 1U4BA 4JN4A 2A6AA 5FPNA 3SQ4A 1CXQA 3BZKA 4CGGA 2QWLA 4IDHA 3TR8A 4UY8O 4B3SK 4JI1K 3JS6A 3OA9A 1UA0A 5C12A 1WAFA 4F2SA 1TVRA 1NGEA 4FLYA 3TTFA 4M3WA 1X9JA 1XMOK 2DFHA 4KHWA 3RR7A 4NCAA 4E1MA 4RW4A 2D1KA 2W42A 3VTIA 5AR0A 4M63C 4EP5A 3O1BA 5TKYA 3UIQA 1QSSA 4DFPA 5AZIB 1L3TA 3NH2A 4B9VA 2EWSA 2Y1IA 4CGHA 1VSKA 4M3YA 5M1FA 1B92A 3VESA 2P9LB 4CGIA 3O8MA 3UKRB 1VSLA 4MLEA 1MDUB 4AF1A 1Q18A 5I3UA 3ITHA 2VG7A 4KH6A 2X74A 2VWKA 4OJRA 2F8SA 1NOZA 3NGYA 2ZM6K 1FJGK 4WQ4A 1JLGA 4ILHA 4N47A 5C10A 3L0QA 1NK9A 3LANA 5KGXA 2HNZA 3KLIA 3ZT2A 5IWAK 2HHSA 3OYCA 5CZ1A 4Z4IA 4QAGA 2LSNA 1SS6A 3DOKA 1QSYA 2IAJA 4ISEA 3NH0A 3CCJN 1OH7A 4GY2B 5T7BA 3NVMA 3NE6A 5M1NA 4XH5A 4B1XB 4BRKA 1VK0A 2HMPA 1ZBFA 3DWLA 4M3ZA 1C0MA 1K8KB 1KFDA 1RBUA 3VEOA 1TKDA 3KD5E 3CJBA 2QXLA 2FF6A 1NOYA 3VQ8A 1CZBA 4A61A 1VQ7N 2KW4A 1XC9A 5FLXO 4GV3A 4H5WA 4DB3A 3ULEB 4C8OA 1VQLN 3R8EA 1KQSM 4FJGA 4CJPA 3C7NA 3SJJA 4BRQA 1D5AA 5F2RA 3V9WA 1T7PA 1KVCA 3K0SA 1GLAG 1C0GA 4H0TB 4B8AB 4FWMA 4H5RA 3P5JA 1HKCA 3K58A 3EN9A 3S41A 3SNNA 4CERA 4BE1A 5AQZA 4IO8A 1IKWA 5C42A 4DLEA 4CJEA 3Q7CA 3CJAA 4FJ5A 2UUBK 3CC2N 2WBNA 4KI6A 3H1QA 3LZIA 2I7PA 4H0YB 2V52B 2V7YA 4BRIA 5I42A 3CCEN 1MWMA 3QDKA 2JLEA 4JRQA 5DM6L 2IVOA 3WQTA 4QOZB 4CGFA 2YHXA 1YAGA 3AVHA 3QNOA 1VSJA 1NGAA 2GTDA 3DLGA 2G8VA 2DFFA 3NVKA 1JLCA 4PL7A 4E7LA 4DU1A 3CIPA 1Q86O 3A5LC 1NGCA 4AM6A 4PHTX 1YXQA 5EY4A 3K59A 4NLCA 3HO1A 1XC3A 1NKCA 4DQQA 2HVHA 4FW2A 1HNIA 2HF3A 3V1RA 3AA3A 2P5GA 2QWPA 1QTMA 2HMIA 3VEXA 1BA0A 4YNQA 4GV9A 4OVLA 1L3VA 2R7YA 3SK3A 4LC9B 3OYFA 4DTSA 3OHRA 3D6RA 1SAZA 4LF7K 4BR7A 3LDSA 1VQ8N 3AA2A 2O8CA 3MMVA 5JLFA 2A1RA 3OJUA 4BG9A 3D2FB 1LW2A 4KHNA 3MECA 2IDOA 4DR4K 2O8EA 1JCGA 5AQSA 4CVNE 2A41A 3P31A 3VGLA 1RT2A 4CJKA 3WNFA 4PKIA 3GOIA 4B9MA 2G8KA 4OPJA 2QXFA 3D45A 1NK7A 3FZFA 3DRSA 5AQQA 1QZ5A 1Q9XA 4K43A 2NRWA 1OKJA 2W41A 1OVQA 3GDQA 1QE1A 2RN2A 4X64K 2F8TA 4WYBA 5J2NA 4OX9K 1RT3A 1FKPA 4E89A 4JKEA 4W5OA 3MWPA 3EKUA 3IS9A 3EE9A 1J6ZA 5GIOA 2KFNA 4FW1A 3LZJA 4CZFA 3BY5A 1ATSA 2V51B 3U8XA 3ZT3A 4BDZA 4LY7A 3MN6A 4IXCA 3U6FA 3CD6N 2HBLA 3NF6A 5LMUK 2NRZA 3QEPA 3MEEA 5FRNA 3VEYA 4WCEL 4H8KA 2Z1HA 2O8CB 5AQLA 3VGMA 3O9TA 3VQ6A 1O1WA 1QQMA 1IBMK 4QCLA 3TAMA 3WXLA 3UKUB 4EP4A 3DXMA 3ZSOA 5I9EB 4JI4K 1TKZA 4CJTA 1VSEA 5CR4A 4HUEA 5F1XA 4NCGA 4DTNA 2E1YA 1BIZA 5AJ3K 3OYBA 3WNEA 3CHWA 4IFEA 4ILGB 4B1VA 1TUYA 1GLLO 4CHNA 3MX2A 1WNSA 2Q97A 4FWPA 3O5BA 5M1PA 2OTJN 3DOLA 2JWKA 4K25A 2O8DB 2HHVA 1C1BA 3LDOA 5J2PA 4A5AA 3D7EO 3QO9A 1BDGA 1RDDA 3MXJA 2DFEA 2OYQA 1FKOA 5EU7A 1IBKK 4CEOA 1QVGM 3F73A 1BHLA 1KAZA 3I56N 3SUQA 4DTMA 1BUPA 2HBKA 3WEEA 4E1NA 2UU9K 1GLCG 1WN7A 4CD3A 1K8AO 3PSFA 5EXWA 3RMAA 3NF9A 5FRMA 1LOTB 2D0AA 3CJ9A 1LAWA 2BTFA 2QEXN 1TKTA 4BRDA 5BN8A 3T3FA 1C0TA 2HNYA 4FLXA 3AVFA 4EZ6A 1BI4B 4YOXA 1XMQK 4CF8A 1VQ5N 4O5BA 4HCCA 1KAXA 3ZEUB 4E7HA 1BQMA 5BRHA 4LF4K 2G8UA 5LL6Z 1P90A 4CJWA 4C1NI 2P9NB 1SKWA 1EXQA 3AGRA 4JK7A 3KK1A 4L8RB 1X9WA 3V1QA 5LJWA 5AQJA 3SQ2A 3NGZA 3O9QA 3QIOA 5KGWA 4CEQA 1HKGA 1ASWA 3A5OC 1Y97A 3FLCO 4B9NA 4FJLA 5KQ8A 3KJVA 1RFQA 4FPAA 1FXXA 5DM7L 3U3GA 4JHDB 4Z4FA 3M1FA 4KHSA 3SV4A 3A8YA 3ULEA 3VEZA 4C8NA 1JXEA 3VF4A 4DV4K 3OY9A 3AO4A 2GV9A 3MWTA 2XY8A 5SWMA 4DFKA 4K8ZA 4NXMK 4X65K 2QKKA 3BDPA 5M1OA 3THXB 4A5BA 1N5YA 4FJHA 1K9MO 2GWKA 3VENA 3NAEA 2QK9A 5KTQA 3CJCA
chains in the Genus database with same CATH topology
3ZSVA 4K8XA 3ALYA 4DSFA 1KVAA 3VA3A 3V81A 3RMBA 1U45A 4B9TA 1QQCA 4IG3A 3S3MA 4FLVA 4BE2A 4FJ7A 3OYHA 2PZSA 1VSFA 2P1JA 4CIFA 2VG6A 4I9LA 3BGRA 4KTQA 1I3AA 4PWDA 4DQSA 4CE9A 1S1TA 4UQGA 3F9KA 4PUOA 1YT3A 3G0ZA 4FZYA 3HJFA 3MAQA 1A5WA 1ZBUA 1RTHA 3ZSQA 4OGCA 4ELVA 2HHTA 1HJRA 2E6LA 1U4BA 4DWIA 4KREA 4TSXA 3ZT0A 1BIUA 4CEDA 3TARA 4CFCA 4DQPA 2A1SA 4W5NA 4CHOA 4CEFA 3QLHA 4CF0A 3SQ4A 1CXQA 4HCBA 1CXUA 1HMVA 1W9HA 5HBMA 4CGGA 1XHZA 4J2DA 1KSPA 3TR8A 4KO0A 4FJXA 4XIUA 3NHGA 3AVLA 4ELTA 3KTQA 2E6MA 2ZQBA 1CZ9A 5J2MA 2G8HA 3O3FA 3KLFA 2PYLA 4AHTA 3TAEA 4ID1A 3I0SA 1UA0A 1HNVA 4LSNA 1WAFA 4CF2A 1KLNA 4F2SA 3RMDA 3SPZA 5E41A 2G8FA 1ASVA 4M41A 1TVRA 3AVAA 4FLYA 4M3WA 2Q3SA 3B6OA 4FK2A 2DFHA 4KHWA 3RR7A 3SV3A 1RBVA 3ULDA 1L3UA 1HQUA 3K57A 4AHRA 4NCAA 4E1MA 3OYDA 4FM2A 4RW4A 3TAPA 2BE2A 2W42A 4Q5VA 4FLWA 4DSJA 4DSEA 4O44A 3AVCA 4EP5A 4H4OA 4RG8A 2G8WA 3K5OA 1IH7A 4FLTA 4DQIA 4EZ9A 1UA1A 3UIQA 3TAQA 1QSSA 4DFPA 1L3TA 3NH2A 3KLHA 4DMNA 4ZHRA 3V9SA 3KK2A 3QEIA 2Y1IA 1UAXA 1VSKA 4CGHA 4B9VA 1WLJA 4FJ9A 4M3YA 1X9MA 4RW9A 1B92A 4I7FA 4Z4HA 3I8DA 4FLUA 1G15A 2FBTA 1ASUA 2I5JA 4CGIA 3AA5X 1D9FA 4OGEA 1C1AA 3AO3A 3ZSRA 3ZT1A 4B9UA 1RTIA 1VSLA 4Q0BA 4M45A 3KIOA 2O4IA 5I3UA 3AVBA 3ITHA 3LWMA 1LWCA 2VG7A 4CEAA 2X74A 1WSJA 3O3GA 2VWKA 4OJRA 1HYVA 4PA1A 1BCOA 2F8SA 5C24A 1NOZA 3LPTA 3NBPA 3NGYA 3DLBA 3C95A 3AVMA 4J2BA 4NYFA 2KZZA 1JLGA 5KRTA 4N47A 4W5QA 1MU2A 1NK9A 1IG9A 4DSIA 3LP3A 4LH4A 3LANA 5KGXA 2HNZA 4M3XA 3KLIA 3ZT2A 4AHVA 4CK3A 4G1QA 3SZ2A 2HHSA 3OYCA 5CZ1A 4Z4IA 4QAGA 3E01A 2LSNA 3DOKA 3AA4A 2PY5A 3ZCMA 2IAJA 1QSYA 4IDKA 2HW3A 3VQ9A 3NH0A 2BGGA 5T7BA 3NE6A 1BL3A 1WSGA 4GMJB 2YNFA 2DTUA 2E4LA 3CYMA 5HRSA 3QEWA 4N41A 1UOCA 3DRPA 1VK0A 3M8PA 3VQQA 4CEEA 3OYJA 1ZBFA 2GBZA 1D8YA 4M3ZA 1C0MA 1KFDA 2D5RA 2ZE2A 1RBUA 1TKDA 3VQCA 1K6YA 4CFDA 3DYAA 3SQ1A 4DF8A 1B9DA 2BDPA 2YKMA 3KD5E 1TL1A 3OYIA 1I39A 4FM0A 4B8CA 1NJYA 4DF4A 1LAVA 1NOYA 1QS4A 2P5OA 3VQ8A 1CZBA 2YKNA 2X6NA 3PO4A 3TANA 2KW4A 3HPHA 2HHQA 1XC9A 3HVTA 1REVA 4C8OA 1WAJA 4CECA 4CJ3A 3ZSWA 4MFBA 3CM5A 3HXMA 2KTQA 3LALA 4FJGA 1KTQA 1RBTA 2IOCA 4CJPA 3VQPA 4CFBA 3NFAA 4F3TA 3SJJA 1FK9A 3IG1A 3VN5A 1SL2A 1D5AA 3V9ZA 2ATQA 3QEVA 3V9WA 1KVBA 5HP1A 1LV5A 1T7PA 1KVCA 3OYEA 4F3OA 4J2AA 4CHYA 1NKBA 4JS4A 4CESA 3CQ8A 4B8AB 4B9LA 4WE1A 3P5JA 1Q9YA 1LWFA 4DG1A 3ZT4A 3OS1A 3O4QA 2XHBA 4JS5A 2XRIA 4IG0A 3K58A 3SNNA 4CERA 4BE1A 4AHUA 3PV8A 3RRHA 3OYLA 2OPSA 1RT7A 1IKWA 5C42A 4HHTA 2ZD1A 4CJEA 4DLEA 2OZSA 4FZXC 3A2FA 4FJ5A 2HVIA 4HUGA 3EZ5A 4CEZA 4E7IA 4DTXA 3PUFA 3MEGA 4KI6A 3DLKA 3LZIA 4E7JA 3AVIA 3QESA 4Z0UA 3KLEA 3OS0A 5I42A 2IC3A 3OYGA 3K5LA 2B4JA 1SL1A 1C1CA 1U04A 2JLEA 4CHPA 1JLEA 4OPKA 4JRQA 3QNNA 1J5OA 4F4KA 4OLBA 4DU3A 1B9FA 1BCMA 4QOZB 4CGFA 4LD0A 4ZTFA 1RNHA 4KHYA 3HP9A 4CIGA 4FVMA 3AVHA 3QNOA 1VSJA 4IFVA 1T05A 4OLAA 1KFSA 3IAYA 3DLGA 3V9UA 2G8VA 2DFFA 3L2QA 3SI6A 1JLCA 3CM6A 1ZBHA 4E7LA 4JRPA 1HPZA 3NGIA 4DU1A 2NUBA 1TAUA 4M3TA 3L2RA 3V4IA 4O0IA 4PY5A 4AH9A 4KB0A 3HPGA 3NF8A 1NK0A 2QKBA 4FJKA 2DY4A 1S1WA 3K59A 4LSLA 3HO1A 1NKCA 1S5JA 2OZMA 1Z26A 3B6PA 4DQQA 3NF7A 2HVHA 4FW2A 1ZYQA 2KZMA 1EKEA 1C0UA 3C94A 1RDBA 1HNIA 2WONA 4Y1DA 4JLHA 3V1RA 3AA3A 1BQNA 2YHBA 2IS3A 1JXBA 2P5GA 3VQEA 3HSTB 3OJSA 1R0AA 1QTMA 2HMIA 3ASMA 1S1VA 3DI6A 4N56A 4I2PA 4YNQA 4FJNA 4OVLA 1L3VA 2R7YA 3NCIA 4IKFA 1S1UA 2AJQA 5K14A 3OYFA 4DTSA 4RW8A 5KI6A 2ETJA 4KV8A 4CJVA 1NJWA 1L3SA 2HHWA 1GOAA 3TI0A 3L2VA 2EX3A 2FC0A 4AHCA 3HVRA 4CF9A 1XHXA 3VA0A 4DSLA 1JLFA 1YVUA 3DLRA 1QHTA 3LDSA 3AA2A 1SKSA 3OS2A 4IFYA 2A1RA 3VQ5A 3OJUA 5HLFA 4OKKA 1CLQA 3LAKA 1LW2A 4O0JA 4OKJA 3DLHA 5FDLA 4KHNA 3MECA 3C6UA 2IDOA 1N6QA 4FZZA 3KD1E 5HRNA 4NYNA 4KRFA 3RMCA 1HRHA 2VG5A 2RPIA 2D0BA 3P83D 4CGJA 1LW0A 4Z4GA 2YHAA 1RT2A 3P1GA 4CJKA 3T1AA 3WNFA 5JS1A 3HK2A 1DTTA 4CJ4A 1SKRA 2G8KA 4B9MA 4F2RA 3D0PA 3TABA 3HL8A 4DS4A 4OPJA 2HB5A 2QXFA 3D45A 4CJRA 1NK7A 3PO5A 3DRSA 3AVKA 3OYNA 2XY7A 4KTZA 3M8QA 4FK4A 4Z4CA 3MEDA 5HRRA 3SPYA 4E19A 1L5UA 4NCBA 3PX4A 2KQ2A 1U47A 1RTJA 1D9DA 3V1OA 3RRGA 1Q9XA 4KHUA 1C6VA 4CF1A 1JLAA 4CFAA 4CHQA 3VQDA 2GUIA 2F96A 2FBYA 5FROA 3VQ4A 1QE1A 3NH1A 3T19A 2RN2A 4F8RA 2PYJA 3AVJA 4W5TA 5J2NA 2F8TA 4FJMA 1RT3A 1FKPA 4E89A 1ITGA 3SCXA 3TWHA 3LPUA 4W5OA 1S6QA 4CJUA 2HHXA 3AO1A 2RKIA 3ZSZA 1KCFA 3IS9A 1EP4A 3KLGA 4BDYA 3L3VA 1GOBA 2EHGA 3HM9A 1RBRA 3SYZA 5DMRA 1TAQA 1RT5A 3L2UA 3L2WA 1F21A 2KFNA 3V9XA 4FW1A 3LZJA 4BWMA 5CZ2A 4CEBA 1IKVA 1DTQA 5KRSA 3ZT3A 4BDZA 2RF2A 3MXMA 1TKXA 4LY7A 5HRPA 4B9SA 3U6FA 1Z25A 1U48A 3ISNC 4DTOA 1X1PA 3NF6A 4DFMA 3QEPA 1WSEA 3MEEA 1TV6A 5FRNA 4H8KA 1ZBIA 2Z1HA 3C6TA 3WNGA 3HP6A 4E7KA 1RCHA 4ELUA 1HQEA 1RT6A 3VQ6A 1ZBLA 1J9AA 1WSFA 1O1WA 3DMJA 2KFZA 4IBNA 4QCLA 3VQ7A 3DLEA 2Z1IA 3CG7A 3TAMA 4I2QA 4GW6A 3VQAA 3VQBA 4EP4A 3NDKA 4FJJA 2XO7A 4BACA 1RBSA 1S9EA 3ZSOA 2XY5A 1TKZA 4DQRA 4CJTA 1VSEA 3PX6A 4B3OA 4HUEA 1DLOA 4NCGA 4CJQA 4DTNA 1BIZA 3LAMA 2YNIA 3OYBA 4H4MA 3WNEA 5D3GA 2OPQA 4ID5A 5JS2A 2O4GA 1VSMA 4B08A 4YFUA 3V6DA 2G8IA 1NK8A 3IRXA 3QINA 2OA8A 1IKXA 4M42A 4CJLA 4CHNA 5J1EA 3M8RA 3CFRA 4FJIA 1WNSA 1Q8IA 3CFOA 4DFJA 4DTRA 1KLMA 1TK0A 1QSLA 2X6SA 1X9SA 4CIEA 5HROA 1XI1A 3DOLA 1A5XA 4CJSA 4W5RA 4C8KA 1XWLA 2VWJA 2HHVA 2IGIA 3WNHA 1IKYA 3K5NA 1C1BA 3S3OA 4CCHA 3QIPA 3O3HA 5J2PA 2JGUA 2OPPA 1S1XA 3DRRA 3QO9A 3RTVA 1RDDA 3MXJA 1NJXA 3AVGA 4O4GA 1SUQA 2DFEA 4FYDA 1NK5A 1RT4A 1FKOA 4CJFA 5EU7A 3M8SA 1TK5A 2OYQA 2D0CA 1VSDA 2HNDA 3EY1A 4E0DA 4CEOA 1JLQA 3OYAA 3F73A 4FCYA 1BHLA 3SUQA 2HHUA 4DLGA 1NJZA 4Z4EA 4DTMA 4DS5A 4ICLA 2B6AA 4E1NA 3SUNA 2P51A 3K5MA 3MXIA 4BWJA 4Y1CA 4DTJA 4CK2A 1WN7A 1J53A 3LP0A 4M3RA 1WSHA 3FFIA 3JSMA 3QETA 1SV5A 3QERA 3RMAA 3SQ0A 4N5SA 3NF9A 4CHZA 2XY6A 4BDPA 3AVNA 1RILA 5FRMA 2D0AA 4E3SA 1LAWA 4RW6A 1NK4A 4CJ5A 1RDAA 4R5PA 1TKTA 1VRUA 4AHSA 4FM1A 3T3FA 1BGXT 5J2QA 1C0TA 3HYFA 3ZSYA 3H08A 2HNYA 4FLXA 1NKEA 4CGDA 3AVFA 4EZ6A 4PQUA 1BI4B 1BI4A 4CF8A 4DSKA 4O5BA 3O4NA 1HYZA 1EX4A 4HCCA 4C8LA 3U3YA 1S6PA 5CY4A 3SUOA 3KKRA 4E7HA 1TL3A 1W0HA 4GVMA 3TAGA 4KI4A 2Z1JA 3OYMA 1BQMA 2YNHA 4LH5A 4MQ3A 1J54A 1BISA 2G8UA 4HTUA 1NK6A 3L3UA 3THVA 4CJWA 4M3UA 3PX0A 4FJ8A 4KB1A 4FLZA 3G10A 1SKWA 4KPYA 1EXQA 3KK1A 4L8RB 1X9WA 1UWBA 3V1QA 4BE0A 4I9QA 5SZTA 4O55A 2OPRA 3S9HA 1TGOA 3SQ2A 1U49A 3KK3A 3NGZA 1A5VA 3QIOA 1KRPA 5KGWA 4CEQA 3RWUA 1ASWA 3L8BA 4DTUA 3OVNA 2Z1GA 3LP1A 4KHQA 1S9GA 1JL1A 1Y97A 3HT3A 4DU4A 3EYZA 2FBVA 4KKOA 3LP2A 3ZSXA 4HUFA 4B9NA 1SL0A 3KJVA 2Y1JA 4FJLA 4FK0A 4N76A 4RW7A 1RDCA 4CK1A 1FXXA 4ZTJA 1GOCA 1JL2A 2YV0X 3U3GA 1TK8A 1IO2A 3RR8A 1T8EA 4OKEA 5CYMA 4FXDA 2ITGA 1RT1A 4AILC 4Z4FA 4KHSA 3SV4A 2B5JA 1YTUA 1VSIA 4KTWA 1YTAA 4HVJA 3KKSA 3QEXA 1JLBA 2X78A 3HPOA 4C8MA 2BANA 1JXEA 2YNGA 4C8NA 5CYQA 3AV9A 3OY9A 4KFBA 3TAFA 3AO4A 3SUPA 3S3NA 3K2PA 3JYTA 1HYSA 1WSIA 3PY8A 2GV9A 5C25A 3CFPA 3OYKA 4KAZA 1T03A 1EETA 2XY8A 3I0RA 5SWMA 4DFKA 1RTDA 4K8ZA 2FBXA 5DK5A 4DTPA 2QKKA 3BDPA 4J2EA 3DM2A 3LWLA 1N5YA 3AO5A 4FJHA 1JKHA 1LWEA 1VRTA 3AO2A 2WOMA 1VSHA 3NAEA 2QK9A 5KTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZSV A;  4K8X A;  3ALY A;  4DSF A;  1KVA A;  3VA3 A;  3V81 A;  3RMB A;  1U45 A;  4B9T A;  1QQC A;  4IG3 A;  3S3M A;  4FLV A;  4BE2 A;  4FJ7 A;  3OYH A;  2PZS A;  1VSF A;  2P1J A;  4CIF A;  2VG6 A;  4I9L A;  3BGR A;  4KTQ A;  1I3A A;  4PWD A;  4DQS A;  4CE9 A;  1S1T A;  4UQG A;  3F9K A;  4PUO A;  1YT3 A;  3G0Z A;  4FZY A;  3HJF A;  3MAQ A;  1A5W A;  1ZBU A;  1RTH A;  3ZSQ A;  4OGC A;  4ELV A;  2HHT A;  1HJR A;  2E6L A;  1U4B A;  4DWI A;  4KRE A;  4TSX A;  3ZT0 A;  1BIU A;  4CED A;  3TAR A;  4CFC A;  4DQP A;  2A1S A;  4W5N A;  4CHO A;  4CEF A;  3QLH A;  4CF0 A;  3SQ4 A;  1CXQ A;  4HCB A;  1CXU A;  1HMV A;  1W9H A;  5HBM A;  4CGG A;  1XHZ A;  4J2D A;  1KSP A;  3TR8 A;  4KO0 A;  4FJX A;  4XIU A;  3NHG A;  3AVL A;  4ELT A;  3KTQ A;  2E6M A;  2ZQB A;  1CZ9 A;  5J2M A;  2G8H A;  3O3F A;  3KLF A;  2PYL A;  4AHT A;  3TAE A;  4ID1 A;  3I0S A;  1UA0 A;  1HNV A;  4LSN A;  1WAF A;  4CF2 A;  1KLN A;  4F2S A;  3RMD A;  3SPZ A;  5E41 A;  2G8F A;  1ASV A;  4M41 A;  1TVR A;  3AVA A;  4FLY A;  4M3W A;  2Q3S A;  3B6O A;  4FK2 A;  2DFH A;  4KHW A;  3RR7 A;  3SV3 A;  1RBV A;  3ULD A;  1L3U A;  1HQU A;  3K57 A;  4AHR A;  4NCA A;  4E1M A;  3OYD A;  4FM2 A;  4RW4 A;  3TAP A;  2BE2 A;  2W42 A;  4Q5V A;  4FLW A;  4DSJ A;  4DSE A;  4O44 A;  3AVC A;  4EP5 A;  4H4O A;  4RG8 A;  2G8W A;  3K5O A;  1IH7 A;  4FLT A;  4DQI A;  4EZ9 A;  1UA1 A;  3UIQ A;  3TAQ A;  1QSS A;  4DFP A;  1L3T A;  3NH2 A;  3KLH A;  4DMN A;  4ZHR A;  3V9S A;  3KK2 A;  3QEI A;  2Y1I A;  1UAX A;  1VSK A;  4CGH A;  4B9V A;  1WLJ A;  4FJ9 A;  4M3Y A;  1X9M A;  4RW9 A;  1B92 A;  4I7F A;  4Z4H A;  3I8D A;  4FLU A;  1G15 A;  2FBT A;  1ASU A;  2I5J A;  4CGI A;  3AA5 X;  1D9F A;  4OGE A;  1C1A A;  3AO3 A;  3ZSR A;  3ZT1 A;  4B9U A;  1RTI A;  1VSL A;  4Q0B A;  4M45 A;  3KIO A;  2O4I A;  5I3U A;  3AVB A;  3ITH A;  3LWM A;  1LWC A;  2VG7 A;  4CEA A;  2X74 A;  1WSJ A;  3O3G A;  2VWK A;  4OJR A;  1HYV A;  4PA1 A;  1BCO A;  2F8S A;  5C24 A;  1NOZ A;  3LPT A;  3NBP A;  3NGY A;  3DLB A;  3C95 A;  3AVM A;  4J2B A;  4NYF A;  2KZZ A;  1JLG A;  5KRT A;  4N47 A;  4W5Q A;  1MU2 A;  1NK9 A;  1IG9 A;  4DSI A;  3LP3 A;  4LH4 A;  3LAN A;  5KGX A;  2HNZ A;  4M3X A;  3KLI A;  3ZT2 A;  4AHV A;  4CK3 A;  4G1Q A;  3SZ2 A;  2HHS A;  3OYC A;  5CZ1 A;  4Z4I A;  4QAG A;  3E01 A;  2LSN A;  3DOK A;  3AA4 A;  2PY5 A;  3ZCM A;  2IAJ A;  1QSY A;  4IDK A;  2HW3 A;  3VQ9 A;  3NH0 A;  2BGG A;  5T7B A;  3NE6 A;  1BL3 A;  1WSG A;  4GMJ B;  2YNF A;  2DTU A;  2E4L A;  3CYM A;  5HRS A;  3QEW A;  4N41 A;  1UOC A;  3DRP A;  1VK0 A;  3M8P A;  3VQQ A;  4CEE A;  3OYJ A;  1ZBF A;  2GBZ A;  1D8Y A;  4M3Z A;  1C0M A;  1KFD A;  2D5R A;  2ZE2 A;  1RBU A;  1TKD A;  3VQC A;  1K6Y A;  4CFD A;  3DYA A;  3SQ1 A;  4DF8 A;  1B9D A;  2BDP A;  2YKM A;  3KD5 E;  1TL1 A;  3OYI A;  1I39 A;  4FM0 A;  4B8C A;  1NJY A;  4DF4 A;  1LAV A;  1NOY A;  1QS4 A;  2P5O A;  3VQ8 A;  1CZB A;  2YKN A;  2X6N A;  3PO4 A;  3TAN A;  2KW4 A;  3HPH A;  2HHQ A;  1XC9 A;  3HVT A;  1REV A;  4C8O A;  1WAJ A;  4CEC A;  4CJ3 A;  3ZSW A;  4MFB A;  3CM5 A;  3HXM A;  2KTQ A;  3LAL A;  4FJG A;  1KTQ A;  1RBT A;  2IOC A;  4CJP A;  3VQP A;  4CFB A;  3NFA A;  4F3T A;  3SJJ A;  1FK9 A;  3IG1 A;  3VN5 A;  1SL2 A;  1D5A A;  3V9Z A;  2ATQ A;  3QEV A;  3V9W A;  1KVB A;  5HP1 A;  1LV5 A;  1T7P A;  1KVC A;  3OYE A;  4F3O A;  4J2A A;  4CHY A;  1NKB A;  4JS4 A;  4CES A;  3CQ8 A;  4B8A B;  4B9L A;  4WE1 A;  3P5J A;  1Q9Y A;  1LWF A;  4DG1 A;  3ZT4 A;  3OS1 A;  3O4Q A;  2XHB A;  4JS5 A;  2XRI A;  4IG0 A;  3K58 A;  3SNN A;  4CER A;  4BE1 A;  4AHU A;  3PV8 A;  3RRH A;  3OYL A;  2OPS A;  1RT7 A;  1IKW A;  5C42 A;  4HHT A;  2ZD1 A;  4CJE A;  4DLE A;  2OZS A;  4FZX C;  3A2F A;  4FJ5 A;  2HVI A;  4HUG A;  3EZ5 A;  4CEZ A;  4E7I A;  4DTX A;  3PUF A;  3MEG A;  4KI6 A;  3DLK A;  3LZI A;  4E7J A;  3AVI A;  3QES A;  4Z0U A;  3KLE A;  3OS0 A;  5I42 A;  2IC3 A;  3OYG A;  3K5L A;  2B4J A;  1SL1 A;  1C1C A;  1U04 A;  2JLE A;  4CHP A;  1JLE A;  4OPK A;  4JRQ A;  3QNN A;  1J5O A;  4F4K A;  4OLB A;  4DU3 A;  1B9F A;  1BCM A;  4QOZ B;  4CGF A;  4LD0 A;  4ZTF A;  1RNH A;  4KHY A;  3HP9 A;  4CIG A;  4FVM A;  3AVH A;  3QNO A;  1VSJ A;  4IFV A;  1T05 A;  4OLA A;  1KFS A;  3IAY A;  3DLG A;  3V9U A;  2G8V A;  2DFF A;  3L2Q A;  3SI6 A;  1JLC A;  3CM6 A;  1ZBH A;  4E7L A;  4JRP A;  1HPZ A;  3NGI A;  4DU1 A;  2NUB A;  1TAU A;  4M3T A;  3L2R A;  3V4I A;  4O0I A;  4PY5 A;  4AH9 A;  4KB0 A;  3HPG A;  3NF8 A;  1NK0 A;  2QKB A;  4FJK A;  2DY4 A;  1S1W A;  3K59 A;  4LSL A;  3HO1 A;  1NKC A;  1S5J A;  2OZM A;  1Z26 A;  3B6P A;  4DQQ A;  3NF7 A;  2HVH A;  4FW2 A;  1ZYQ A;  2KZM A;  1EKE A;  1C0U A;  3C94 A;  1RDB A;  1HNI A;  2WON A;  4Y1D A;  4JLH A;  3V1R A;  3AA3 A;  1BQN A;  2YHB A;  2IS3 A;  1JXB A;  2P5G A;  3VQE A;  3HST B;  3OJS A;  1R0A A;  1QTM A;  2HMI A;  3ASM A;  1S1V A;  3DI6 A;  4N56 A;  4I2P A;  4YNQ A;  4FJN A;  4OVL A;  1L3V A;  2R7Y A;  3NCI A;  4IKF A;  1S1U A;  2AJQ A;  5K14 A;  3OYF A;  4DTS A;  4RW8 A;  5KI6 A;  2ETJ A;  4KV8 A;  4CJV A;  1NJW A;  1L3S A;  2HHW A;  1GOA A;  3TI0 A;  3L2V A;  2EX3 A;  2FC0 A;  4AHC A;  3HVR A;  4CF9 A;  1XHX A;  3VA0 A;  4DSL A;  1JLF A;  1YVU A;  3DLR A;  1QHT A;  3LDS A;  3AA2 A;  1SKS A;  3OS2 A;  4IFY A;  2A1R A;  3VQ5 A;  3OJU A;  5HLF A;  4OKK A;  1CLQ A;  3LAK A;  1LW2 A;  4O0J A;  4OKJ A;  3DLH A;  5FDL A;  4KHN A;  3MEC A;  3C6U A;  2IDO A;  1N6Q A;  4FZZ A;  3KD1 E;  5HRN A;  4NYN A;  4KRF A;  3RMC A;  1HRH A;  2VG5 A;  2RPI A;  2D0B A;  3P83 D;  4CGJ A;  1LW0 A;  4Z4G A;  2YHA A;  1RT2 A;  3P1G A;  4CJK A;  3T1A A;  3WNF A;  5JS1 A;  3HK2 A;  1DTT A;  4CJ4 A;  1SKR A;  2G8K A;  4B9M A;  4F2R A;  3D0P A;  3TAB A;  3HL8 A;  4DS4 A;  4OPJ A;  2HB5 A;  2QXF A;  3D45 A;  4CJR A;  1NK7 A;  3PO5 A;  3DRS A;  3AVK A;  3OYN A;  2XY7 A;  4KTZ A;  3M8Q A;  4FK4 A;  4Z4C A;  3MED A;  5HRR A;  3SPY A;  4E19 A;  1L5U A;  4NCB A;  3PX4 A;  2KQ2 A;  1U47 A;  1RTJ A;  1D9D A;  3V1O A;  3RRG A;  1Q9X A;  4KHU A;  1C6V A;  4CF1 A;  1JLA A;  4CFA A;  4CHQ A;  3VQD A;  2GUI A;  2F96 A;  2FBY A;  5FRO A;  3VQ4 A;  1QE1 A;  3NH1 A;  3T19 A;  2RN2 A;  4F8R A;  2PYJ A;  3AVJ A;  4W5T A;  5J2N A;  2F8T A;  4FJM A;  1RT3 A;  1FKP A;  4E89 A;  1ITG A;  3SCX A;  3TWH A;  3LPU A;  4W5O A;  1S6Q A;  4CJU A;  2HHX A;  3AO1 A;  2RKI A;  3ZSZ A;  1KCF A;  3IS9 A;  1EP4 A;  3KLG A;  4BDY A;  3L3V A;  1GOB A;  2EHG A;  3HM9 A;  1RBR A;  3SYZ A;  5DMR A;  1TAQ A;  1RT5 A;  3L2U A;  3L2W A;  1F21 A;  2KFN A;  3V9X A;  4FW1 A;  3LZJ A;  4BWM A;  5CZ2 A;  4CEB A;  1IKV A;  1DTQ A;  5KRS A;  3ZT3 A;  4BDZ A;  2RF2 A;  3MXM A;  1TKX A;  4LY7 A;  5HRP A;  4B9S A;  3U6F A;  1Z25 A;  1U48 A;  3ISN C;  4DTO A;  1X1P A;  3NF6 A;  4DFM A;  3QEP A;  1WSE A;  3MEE A;  1TV6 A;  5FRN A;  4H8K A;  1ZBI A;  2Z1H A;  3C6T A;  3WNG A;  3HP6 A;  4E7K A;  1RCH A;  4ELU A;  1HQE A;  1RT6 A;  3VQ6 A;  1ZBL A;  1J9A A;  1WSF A;  1O1W A;  3DMJ A;  2KFZ A;  4IBN A;  4QCL A;  3VQ7 A;  3DLE A;  2Z1I A;  3CG7 A;  3TAM A;  4I2Q A;  4GW6 A;  3VQA A;  3VQB A;  4EP4 A;  3NDK A;  4FJJ A;  2XO7 A;  4BAC A;  1RBS A;  1S9E A;  3ZSO A;  2XY5 A;  1TKZ A;  4DQR A;  4CJT A;  1VSE A;  3PX6 A;  4B3O A;  4HUE A;  1DLO A;  4NCG A;  4CJQ A;  4DTN A;  1BIZ A;  3LAM A;  2YNI A;  3OYB A;  4H4M A;  3WNE A;  5D3G A;  2OPQ A;  4ID5 A;  5JS2 A;  2O4G A;  1VSM A;  4B08 A;  4YFU A;  3V6D A;  2G8I A;  1NK8 A;  3IRX A;  3QIN A;  2OA8 A;  1IKX A;  4M42 A;  4CJL A;  4CHN A;  5J1E A;  3M8R A;  3CFR A;  4FJI A;  1WNS A;  1Q8I A;  3CFO A;  4DFJ A;  4DTR A;  1KLM A;  1TK0 A;  1QSL A;  2X6S A;  1X9S A;  4CIE A;  5HRO A;  1XI1 A;  3DOL A;  1A5X A;  4CJS A;  4W5R A;  4C8K A;  1XWL A;  2VWJ A;  2HHV A;  2IGI A;  3WNH A;  1IKY A;  3K5N A;  1C1B A;  3S3O A;  4CCH A;  3QIP A;  3O3H A;  5J2P A;  2JGU A;  2OPP A;  1S1X A;  3DRR A;  3QO9 A;  3RTV A;  1RDD A;  3MXJ A;  1NJX A;  3AVG A;  4O4G A;  1SUQ A;  2DFE A;  4FYD A;  1NK5 A;  1RT4 A;  1FKO A;  4CJF A;  5EU7 A;  3M8S A;  1TK5 A;  2OYQ A;  2D0C A;  1VSD A;  2HND A;  3EY1 A;  4E0D A;  4CEO A;  1JLQ A;  3OYA A;  3F73 A;  4FCY A;  1BHL A;  3SUQ A;  2HHU A;  4DLG A;  1NJZ A;  4Z4E A;  4DTM A;  4DS5 A;  4ICL A;  2B6A A;  4E1N A;  3SUN A;  2P51 A;  3K5M A;  3MXI A;  4BWJ A;  4Y1C A;  4DTJ A;  4CK2 A;  1WN7 A;  1J53 A;  3LP0 A;  4M3R A;  1WSH A;  3FFI A;  3JSM A;  3QET A;  1SV5 A;  3QER A;  3RMA A;  3SQ0 A;  4N5S A;  3NF9 A;  4CHZ A;  2XY6 A;  4BDP A;  3AVN A;  1RIL A;  5FRM A;  2D0A A;  4E3S A;  1LAW A;  4RW6 A;  1NK4 A;  4CJ5 A;  1RDA A;  4R5P A;  1TKT A;  1VRU A;  4AHS A;  4FM1 A;  3T3F A;  1BGX T;  5J2Q A;  1C0T A;  3HYF A;  3ZSY A;  3H08 A;  2HNY A;  4FLX A;  1NKE A;  4CGD A;  3AVF A;  4EZ6 A;  4PQU A;  1BI4 B;  1BI4 A;  4CF8 A;  4DSK A;  4O5B A;  3O4N A;  1HYZ A;  1EX4 A;  4HCC A;  4C8L A;  3U3Y A;  1S6P A;  5CY4 A;  3SUO A;  3KKR A;  4E7H A;  1TL3 A;  1W0H A;  4GVM A;  3TAG A;  4KI4 A;  2Z1J A;  3OYM A;  1BQM A;  2YNH A;  4LH5 A;  4MQ3 A;  1J54 A;  1BIS A;  2G8U A;  4HTU A;  1NK6 A;  3L3U A;  3THV A;  4CJW A;  4M3U A;  3PX0 A;  4FJ8 A;  4KB1 A;  4FLZ A;  3G10 A;  1SKW A;  4KPY A;  1EXQ A;  3KK1 A;  4L8R B;  1X9W A;  1UWB A;  3V1Q A;  4BE0 A;  4I9Q A;  5SZT A;  4O55 A;  2OPR A;  3S9H A;  1TGO A;  3SQ2 A;  1U49 A;  3KK3 A;  3NGZ A;  1A5V A;  3QIO A;  1KRP A;  5KGW A;  4CEQ A;  3RWU A;  1ASW A;  3L8B A;  4DTU A;  3OVN A;  2Z1G A;  3LP1 A;  4KHQ A;  1S9G A;  1JL1 A;  1Y97 A;  3HT3 A;  4DU4 A;  3EYZ A;  2FBV A;  4KKO A;  3LP2 A;  3ZSX A;  4HUF A;  4B9N A;  1SL0 A;  3KJV A;  2Y1J A;  4FJL A;  4FK0 A;  4N76 A;  4RW7 A;  1RDC A;  4CK1 A;  1FXX A;  4ZTJ A;  1GOC A;  1JL2 A;  2YV0 X;  3U3G A;  1TK8 A;  1IO2 A;  3RR8 A;  1T8E A;  4OKE A;  5CYM A;  4FXD A;  2ITG A;  1RT1 A;  4AIL C;  4Z4F A;  4KHS A;  3SV4 A;  2B5J A;  1YTU A;  1VSI A;  4KTW A;  1YTA A;  4HVJ A;  3KKS A;  3QEX A;  1JLB A;  2X78 A;  3HPO A;  4C8M A;  2BAN A;  1JXE A;  2YNG A;  4C8N A;  5CYQ A;  3AV9 A;  3OY9 A;  4KFB A;  3TAF A;  3AO4 A;  3SUP A;  3S3N A;  3K2P A;  3JYT A;  1HYS A;  1WSI A;  3PY8 A;  2GV9 A;  5C25 A;  3CFP A;  3OYK A;  4KAZ A;  1T03 A;  1EET A;  2XY8 A;  3I0R A;  5SWM A;  4DFK A;  1RTD A;  4K8Z A;  2FBX A;  5DK5 A;  4DTP A;  2QKK A;  3BDP A;  4J2E A;  3DM2 A;  3LWL A;  1N5Y A;  3AO5 A;  4FJH A;  1JKH A;  1LWE A;  1VRT A;  3AO2 A;  2WOM A;  1VSH A;  3NAE A;  2QK9 A;  5KTQ A; 
#chains in the Genus database with same CATH topology
 2E20 A;  3E9L A;  4H5N A;  4B9T A;  3J80 O;  4BRO A;  2JWL A;  2PZS A;  2VG6 A;  4I9L A;  3BF1 A;  1I3A A;  1S1T A;  4UQG A;  2P9L A;  3HJF A;  3ZSQ A;  3M5R A;  3EZW A;  4CF0 A;  4YOV A;  1HMV A;  1W9H A;  4C1N K;  3AVL A;  3KTQ A;  1U2V A;  3J8A A;  2ZQB A;  4JK9 A;  2VGM A;  3KLF A;  1BO5 O;  2PYL A;  3TAE A;  4JI8 K;  2QWO A;  4BGA A;  4ID1 A;  4LSN A;  1GLD G;  3RMD A;  3SPZ A;  5E41 A;  1ASV A;  3HM8 A;  2Q3S A;  4C23 A;  3R1X A;  3L6Q A;  1RBV A;  3ULD A;  3CF5 L;  1NU0 A;  5BRE A;  3OYD A;  4FM2 A;  1NMN A;  2BE2 A;  5AQH A;  3U4L A;  4Q5V A;  2YX6 A;  1KD1 O;  3AVC A;  4RG8 A;  2G8W A;  3CCV N;  4DR3 K;  4FLT A;  4DV6 K;  4DQI A;  1T3V A;  2GX9 A;  2Q1N A;  3O9R A;  3KLH A;  4DMN A;  3V9S A;  2W6L A;  3VER A;  1WLJ A;  3R9P A;  3I8D A;  4I7F A;  2IVP A;  1G15 A;  4OGE A;  3U9D A;  1CZA N;  5BRF A;  2QM1 A;  2VGN A;  3CPE A;  4LFA K;  4KH4 A;  3LWM A;  2KKZ A;  1LWC A;  4CEA A;  4B1Z A;  1BCO A;  3BUZ B;  3P39 A;  3LPT A;  4O8K A;  3C95 A;  4KH5 A;  2ITM A;  4LF5 K;  1NBW A;  4KBO A;  4W5Q A;  3LP3 A;  4LH4 A;  1E4F T;  4QS9 A;  4AHV A;  3CJ7 A;  4H03 B;  3HSC A;  1QZ6 A;  2HW3 A;  3VQ9 A;  2BGG A;  4GMJ B;  2YNF A;  3VTH A;  2DTU A;  3QEW A;  4N41 A;  3M8P A;  4HWI A;  3OYJ A;  2ZE2 A;  4DF8 A;  1B9D A;  2YKM A;  1BU6 O;  1LAV A;  2CGL A;  4CJ7 A;  3TAN A;  4LF8 K;  5EVZ A;  2HHQ A;  3HVT A;  2QWQ A;  3HXM A;  5GAH P;  1KTQ A;  4CFB A;  3HTV A;  3QIC A;  1SL2 A;  1S72 N;  3V9Z A;  1N32 K;  5HP1 A;  4JI7 K;  3OYE A;  1DEJ A;  3I8B A;  3CQ8 A;  4FPB A;  4DG1 A;  3ZT4 A;  3OS1 A;  3O4Q A;  3AY9 A;  1RT7 A;  4HHT A;  2HVI A;  1ZC6 A;  4DR7 K;  3WXI A;  5AQX A;  3MEG A;  4DUZ K;  4E7J A;  3AVI A;  4L3Q A;  3OYG A;  3K5L A;  1N33 K;  2CH6 A;  1J5O A;  1GLB G;  1BCM A;  1GLF O;  2NRV A;  2P9P B;  4EIA A;  1RNH A;  1YHQ N;  1T05 A;  3IAY A;  3L2Q A;  1S22 A;  1ZBH A;  4QS7 A;  1HPZ A;  5AZI A;  1NLV A;  4M3T A;  4O0I A;  4CBW A;  3QFU A;  4CZH A;  4KB0 A;  1NK0 A;  2DY4 A;  1S1W A;  5GIN A;  4LSL A;  1XNR K;  4NO7 A;  4NLB A;  3EL2 A;  4JK8 A;  2UUC K;  3MN7 A;  2KZM A;  1EKE A;  1RDB A;  3AAQ A;  4Y1D A;  1BQN A;  4IJN A;  4B3M K;  1SZ2 A;  5H1S Q;  1NM1 A;  2VYP A;  1HNW K;  1YVN A;  3ASM A;  1S1V A;  5AQT A;  2KHO A;  3E1Y A;  4IKF A;  5K14 A;  5BR9 A;  2ETJ A;  5E84 A;  3L2V A;  2FC0 A;  4AHC A;  3HVR A;  1XHX A;  3KK7 A;  3VA0 A;  3DLR A;  1SKS A;  5HLF A;  4OKK A;  4PKG A;  2YI1 A;  1W7A A;  3PIP L;  3C6U A;  1N6Q A;  3KD1 E;  4BRN A;  3RMC A;  2UUA K;  3FZK A;  3CCU N;  4CGJ A;  2ZJQ L;  1LW0 A;  4Z4G A;  3P1G A;  1BG3 A;  3HBT A;  4H0X B;  3ZYY X;  4CJ4 A;  1SKR A;  3D0P A;  3TAB A;  1HPM A;  1HR0 K;  3EO3 A;  4H0V B;  2E2P A;  3J81 O;  2XY7 A;  3SPY A;  5AZJ A;  1O13 A;  4E19 A;  1L5U A;  4NCB A;  1D9D A;  1RTJ A;  4KHU A;  3T7Z A;  4CF1 A;  1VAZ A;  4CFA A;  2F9W A;  2GUP A;  3CCM N;  5FRO A;  2F96 A;  2FBY A;  4B3R K;  2O8F A;  2FF3 B;  3AVJ A;  1KXP A;  1N36 K;  2NRH A;  1YIT N;  4G9Z A;  1ITG A;  1HLU A;  3SCX A;  3K9J A;  3AO1 A;  2RKI A;  1KCF A;  1TUU A;  3KLG A;  1EP4 A;  3R3L A;  3L3V A;  2EHG A;  1RBR A;  3L2U A;  1F21 A;  4CEB A;  2P9K B;  5CZ2 A;  1DTQ A;  4BRG A;  5KRS A;  2RF2 A;  1OH8 A;  1TKX A;  5HRP A;  1Z05 A;  1Z25 A;  3ISN C;  4DTO A;  1Q82 O;  4B9Q A;  4BR5 A;  3C6T A;  3WNG A;  1NGG A;  4Z94 A;  1ZBL A;  1WSF A;  3W0L A;  3DMJ A;  3UB5 A;  4N56 A;  1ILY A;  4M42 A;  3O6W A;  4I2Q A;  3VQA A;  3QBX A;  3CCQ N;  4I6M A;  1S9E A;  3D2E B;  3PX6 A;  1NGB A;  4ILJ A;  2YNI A;  2YJF A;  3OBY A;  2OPQ A;  3F2K A;  2O4G A;  3SMS A;  5AQI A;  2NZT A;  1NK8 A;  3QIN A;  4XEI A;  5J1E A;  3M8R A;  4FJI A;  4DTR A;  4MO4 A;  2X6S A;  5HRO A;  2W6K A;  4MDA A;  5AQY A;  2E2O A;  4A2A A;  3VF2 A;  1Q81 O;  1IKY A;  3K5N A;  3HZ6 A;  3S3O A;  2WUS A;  2OTL N;  4BC2 A;  3ENH A;  1NJX A;  4CJF A;  3M8S A;  1TK5 A;  2D0C A;  3CXC M;  1E4G T;  2E1Z A;  1JLQ A;  3OYA A;  2HHU A;  1KC8 O;  5GIP A;  1J5E K;  1XQS C;  3J7Z O;  3K5M A;  4DTJ A;  4CK2 A;  4M3R A;  1M1K O;  3FR0 A;  2XY6 A;  1RIL A;  4JKG A;  4CZM A;  3R6M A;  2FSN A;  2WFB A;  3SLC A;  1RDA A;  4CJ5 A;  4DKW A;  3THW A;  2NRT A;  3GG4 A;  2YHW A;  1H1V A;  1NKE A;  3H08 A;  2F4V K;  1NGI A;  4PQU A;  3LM9 A;  4C8L A;  3U3Y A;  1S6P A;  3KKR A;  1W0H A;  4KI4 A;  1BIS A;  2OAN A;  5AFU A;  3LDL A;  3L3U A;  3PX0 A;  1Q7Y O;  3H3N O;  3WXK A;  4KB1 A;  2BH1 A;  3QFP A;  1S3X A;  2O8B A;  1UWB A;  5SZT A;  1BWF O;  2OPR A;  1EWQ A;  3HOT A;  4IEE A;  1KRP A;  3O9S A;  4DTU A;  3HI0 A;  2PFU A;  2RE2 A;  4DU4 A;  5ADX A;  4KKO A;  3LP2 A;  4B1Y B;  4CK1 A;  4ZTJ A;  3CCS N;  4YDU C;  1GOC A;  3E9P A;  1TK8 A;  1IO2 A;  3RR8 A;  2ITG A;  4AIL C;  2UXC K;  2B5J A;  5ADX H;  1YTA A;  4CBU A;  1JLB A;  4K42 A;  1NWK A;  2YNG A;  4KFB A;  3SUP A;  3K2P A;  4JI0 K;  3PY8 A;  4KAZ A;  2QW9 A;  2FBX A;  4DQ8 A;  5B8H A;  4J2E A;  4WQ4 C;  1JKH A;  3W3D A;  1V4T A;  2WOM A;  1VSH A;  3O4W A;  3OTO K;  3VA3 A;  1XUP O;  3V81 A;  3RMB A;  1JCF A;  4FLV A;  4FJ7 A;  3OYH A;  3G25 A;  1VSF A;  5JMV A;  4DQS A;  4CE9 A;  3M3Z A;  1ATR A;  1YT3 A;  4M7Y A;  4FWS A;  4FZY A;  3MAQ A;  1RTH A;  1SQK A;  4WFB L;  3GE1 A;  4CED A;  4W5N A;  3TAR A;  2A1S A;  3EKS A;  3ZEU A;  4CHO A;  4CEF A;  3B8A X;  3CER A;  4HCB A;  1CXU A;  1XHZ A;  1KSP A;  4XIU A;  3O9U A;  4ELT A;  1CZ9 A;  5J2M A;  3EE8 A;  2G8H A;  1HNV A;  4CF2 A;  4H5T A;  3H46 O;  1KLN A;  2G8F A;  3VEV A;  2H3G X;  4M41 A;  4DV5 K;  4FK2 A;  5AZJ B;  3CQX A;  1L3U A;  4AHR A;  4FOE A;  2AP1 A;  4K41 A;  4BC5 A;  3TAP A;  3ATU A;  4FLW A;  3ENO A;  4DSE A;  4FO0 A;  4BRM A;  3K5O A;  1IH7 A;  1UA1 A;  3H45 C;  1K8K A;  5HL7 L;  4XH1 A;  2E8A A;  4B1U B;  3QEI A;  3KK2 A;  1VQK N;  1UAX A;  5AQK A;  4FJ9 A;  3CJ1 A;  4RW9 A;  4BRF A;  4FLU A;  4ISF A;  1NG9 A;  2FBT A;  4F9O A;  1ASU A;  3AA5 X;  4DHY A;  1C1A A;  3ZSR A;  4B9U A;  5AQU A;  3SJH A;  4Q0B A;  3IUC A;  1E3M A;  5E26 A;  3KIO A;  4BGB A;  4JYA K;  2A3Z A;  3AVB A;  1T6C A;  4CD1 A;  4FWL A;  3O3G A;  4PA1 A;  5LY3 A;  4V19 S;  3DLB A;  3AVM A;  4J2B A;  3P4I A;  5AQO A;  3THW B;  4YY3 K;  2KZZ A;  3ZET B;  1TYQ A;  4A59 A;  3G71 N;  4H0P A;  5KRT A;  4DV0 K;  5AQG A;  4AM7 A;  1IG9 A;  4DSI A;  3RSE B;  2D4W A;  4U7B A;  2KLA A;  4BR9 A;  3SZ2 A;  4OO1 J;  3MDQ A;  2CGJ A;  3E01 A;  1QHA A;  3THY B;  3AA4 A;  1NGH A;  3ZCM A;  2PY5 A;  4IDK A;  4JKG B;  2ZJR L;  3A5N C;  1BA1 A;  4LFB K;  1WSG A;  4GKK K;  5HRS A;  3D2F A;  1UOC A;  3DRP A;  3VQQ A;  4CEE A;  2D5R A;  3CCR N;  1YJW N;  3VQC A;  4CFD A;  1JJ2 M;  3DYA A;  2BDP A;  5C0Y A;  4FWO A;  5F0X A;  2A42 A;  2YKN A;  2WTU A;  4DR1 K;  1D4X A;  5BN9 A;  3HPH A;  5A2Q O;  1QQO A;  4CZL A;  1REV A;  1KAY A;  1WAJ A;  1U6Z A;  4CJ3 A;  3ZSW A;  4MFB A;  3LAL A;  4NB4 A;  1RBT A;  3TU5 A;  4F3T A;  5FPD A;  3IG1 A;  3Q7B A;  3VN5 A;  2ATQ A;  3QEV A;  1LV5 A;  1KVB A;  5AQV A;  4F3O A;  4DV7 K;  4CHY A;  4B9L A;  4CES A;  1LWF A;  2XHB A;  4JS5 A;  2QI2 A;  4AHU A;  3TSP A;  3RRH A;  3PV8 A;  3OYL A;  2OPS A;  4FWK A;  3MN9 A;  3E9O A;  4FZX C;  3CPW M;  3H3O B;  4CEZ A;  4E7I A;  4DTX A;  3PUF A;  4JI3 K;  3QES A;  4LF6 K;  2CGK A;  4Z0U A;  2A40 A;  5HOO A;  5AQP A;  3OS0 A;  4H0O A;  1C1C A;  1JLE A;  2P9K A;  4OPK A;  1YJ9 N;  3JXU A;  4DU3 A;  3WQU A;  4LD0 A;  4IOC L;  4ZTF A;  3HP9 A;  4CIG A;  4FVM A;  4OLA A;  4IFV A;  3O08 A;  3V9U A;  3QML A;  3SI6 A;  2AA4 A;  4JRP A;  4IEI A;  1TAU A;  1VQP N;  4AH9 A;  3HPG A;  3NF8 A;  2QKB A;  2P9U A;  3B6P A;  3NF7 A;  4BVO A;  1ZYQ A;  3C94 A;  3G6E N;  3SAG A;  2IS3 A;  2D0O A;  3OJS A;  1R0A A;  2OCE A;  2IIR A;  3DI6 A;  4I2P A;  2QWN A;  4J8F A;  2WC9 A;  4A2B A;  3BEX A;  1HNZ K;  4RW8 A;  1NJW A;  4KV8 A;  3DLL L;  1HNX K;  3TI0 A;  5AQF A;  4X66 K;  3VOV A;  3CC4 N;  5JLH A;  1YVU A;  1QHT A;  2BUP A;  3SBG A;  1NMD A;  4YHH K;  4IFY A;  5IT9 O;  2FSK A;  1CLQ A;  2F7T A;  2A5X A;  3LAK A;  4O0J A;  3VPZ A;  3DLH A;  2IVN A;  4EFH A;  2D0P A;  4NYN A;  2VG5 A;  4DV1 K;  2RPI A;  2D0B A;  3P83 D;  2NNW A;  3HRG A;  1X3M A;  5JS1 A;  3HK2 A;  4F2R A;  4YOY A;  4CJR A;  3TTC A;  3AVK A;  3OYN A;  4EAH D;  2P9I A;  1XNQ K;  1GLJ O;  4FK4 A;  4YOW A;  4CW7 B;  2KQ2 A;  4U67 L;  3SAH A;  1C6V A;  4B1W B;  2ASM A;  3TSQ A;  3L4I A;  3VQD A;  2GUI A;  3VQ4 A;  3NH1 A;  3T19 A;  2PYJ A;  1IG8 A;  4FJM A;  1YIJ N;  1ESV A;  3TWH A;  2P9I B;  1S6Q A;  1U2V B;  4CJU A;  2HHX A;  3UKR A;  1NGJ A;  2VCP A;  2J4R A;  4JKC A;  5M1Q A;  3N4P A;  3HM9 A;  3SYZ A;  5DMR A;  1TAQ A;  3L2W A;  4WF9 L;  1V4S A;  2P9S B;  3V9X A;  4BWM A;  1IKV A;  4FWR A;  4IZ9 A;  1BOT O;  4GKJ K;  4B9S A;  3SAF A;  1X1P A;  4DFM A;  4ELU A;  3HP6 A;  4E7K A;  2DPN A;  1RT6 A;  1J9A A;  5LMN K;  2KFZ A;  4JD2 A;  3CG7 A;  3VQB A;  2HST A;  4OPA A;  3WUH A;  5FPM A;  2XY5 A;  4BAC A;  1K73 O;  3OW2 M;  4BQZ A;  4FOI A;  1DLO A;  4CJQ A;  2NRX A;  3LAM A;  2ZGY A;  4ID5 A;  1VSM A;  4B08 A;  4YFU A;  3V6D A;  2G8I A;  3IRX A;  2OA8 A;  1IKX A;  4CJL A;  3CFO A;  4DFJ A;  1TK0 A;  2E88 A;  1X9S A;  2HOE A;  2P9P A;  1XI1 A;  1P8Z A;  1A5X A;  2ASO A;  4CJS A;  4W5R A;  5BRD A;  4C8K A;  2VWJ A;  2IGI A;  3BF3 A;  4JI6 K;  3WNH A;  3SMP A;  1JCE A;  4CCH A;  3QIP A;  3O3H A;  5C2F A;  2JGU A;  2OPP A;  1S1X A;  4JV5 K;  3J7A P;  1Y64 A;  3LDP A;  4IO9 L;  1SUQ A;  1NK5 A;  1RT4 A;  4E0D A;  1VSD A;  2HND A;  4FCY A;  2YHY A;  1NGD A;  4JNE A;  4DLG A;  1NJZ A;  4CZJ A;  3N4Q A;  2PBD A;  4ICL A;  2HBM A;  3LM2 A;  4BWJ A;  3AGK A;  1FW6 A;  1J53 A;  1WSH A;  1EO1 A;  3QET A;  1SV5 A;  4N5S A;  3AVN A;  1NK4 A;  4BQL A;  4X62 K;  3KZB A;  4R5P A;  2P9U B;  1VRU A;  4AHS A;  5BPM A;  1BGX T;  1G99 A;  3CQY A;  1IBL K;  1BI4 A;  4DSK A;  3JAM O;  3O4N A;  4A62 A;  1HYZ A;  1W2B M;  5TKW A;  1EX4 A;  4A57 A;  5CY4 A;  3SUO A;  3TAG A;  3OYM A;  4LH5 A;  1VQ9 N;  1M90 O;  1J54 A;  4JD2 B;  4BY9 C;  1NK6 A;  3THV A;  4M3U A;  4FJ8 A;  3U9Z A;  4BE0 A;  3WEE B;  4O55 A;  5BR8 K;  1U49 A;  3KK3 A;  2VQE K;  1A5V A;  3L8B A;  3QBW A;  5CHI A;  1HJO A;  1S9G A;  1JL1 A;  1OVY A;  3ZX3 A;  3HT3 A;  3EYZ A;  1IJJ A;  2FBV A;  4HUF A;  4FK0 A;  3HOS A;  4N76 A;  1SL0 A;  3GBT A;  1RDC A;  4BR2 A;  3TSU A;  1JL2 A;  3THY A;  4OKE A;  1T8E A;  4FXD A;  1X3N A;  1RT1 A;  2HHH K;  5GAG P;  3KKS A;  3FFK B;  4FVU A;  2X78 A;  3HPO A;  4C8M A;  2BAN A;  5CYQ A;  1HYS A;  4Y0W A;  4BRP A;  1WSI A;  4YOR A;  3E66 A;  1EET A;  3MK6 A;  4O8U A;  4MDB A;  1RTD A;  5DK5 A;  3LWL A;  3DXK A;  3AO5 A;  1VRT A;  5AQR A;  3UKU A;  4K8X A;  4CI6 A;  3IFR A;  3TTD A;  3CC7 N;  1RDU A;  1QQC A;  4IG3 A;  3S3M A;  3AAR A;  2P1J A;  3BGR A;  5AQW A;  4KTQ A;  4CZE A;  2QWM A;  3F9K A;  2HF4 A;  5EOY A;  4PL8 A;  3G0Z A;  4EHU A;  1ZBU A;  2E6L A;  4DWI A;  4KRE A;  4TSX A;  3ZT0 A;  1BIU A;  1HUX A;  4CFC A;  4DQP A;  2Q0R A;  3QLH A;  4J2D A;  5HBM A;  3IDH A;  1HKB A;  4KO0 A;  4FJX A;  3PLA A;  3NHG A;  1ZXO A;  2E6M A;  3ZET A;  3O3F A;  4AHT A;  2FLO A;  4JKD A;  3T69 A;  4K0K K;  2NLX A;  3THX A;  2ZJP L;  3ZX2 A;  3I0S A;  3DJC A;  4DV3 K;  2FXU A;  3CET A;  4BRE A;  3AVA A;  3B6O A;  1YI2 N;  1N34 K;  3SV3 A;  1HQU A;  3K57 A;  3F5T A;  3MN5 A;  4LF9 K;  3H1V X;  1VQO N;  5M1K A;  3VF6 A;  4DSJ A;  4O44 A;  4H4O A;  4EZ9 A;  3TAQ A;  4OPH A;  3AAP A;  3O80 A;  4RWT A;  4ZHR A;  4FL9 A;  3CI5 A;  1X9M A;  4Z4H A;  1VQ4 N;  2I5J A;  1D9F A;  3AO3 A;  3ZT1 A;  1RTI A;  5JIC A;  4M45 A;  2P9N A;  1HX1 A;  3ZX0 A;  2QTD A;  2O4I A;  1VQ6 N;  3I33 A;  3KWI A;  3ZLJ A;  4JHD A;  1WSJ A;  1QVF M;  1HYV A;  5BPL A;  1VQM N;  4ISG A;  5C24 A;  3NBP A;  1WB9 A;  3T1Y K;  4NYF A;  1ZBS A;  3BP8 A;  2UXD K;  1MU2 A;  3M6G A;  4DR2 K;  4M3X A;  1R59 O;  4CZG A;  4CK3 A;  4NXN K;  4G1Q A;  4H5V A;  1EQY A;  4YOU A;  1BL3 A;  3VEW A;  3WXJ A;  2HBJ A;  2E4L A;  3CYM A;  4IJA A;  2GBZ A;  1D8Y A;  5BPN A;  4BR0 A;  1K6Y A;  3SQ1 A;  1WBD A;  1TL1 A;  3A0I X;  3OYI A;  1I39 A;  4FM0 A;  3IMX A;  4JKB A;  4B8C A;  1NJY A;  4DF4 A;  3LL3 A;  1QS4 A;  2QWR A;  2P5O A;  1WUA A;  2X6N A;  3PO4 A;  4R79 A;  4CEC A;  3CM5 A;  2KTQ A;  2Q2R A;  3K9K A;  3C6H A;  2IOC A;  4WQ5 C;  3VQP A;  3J7Y P;  3NFA A;  3TPQ A;  1FK9 A;  4J2A A;  3RSE A;  4JS4 A;  3FZM A;  1NKB A;  4WE1 A;  1Q9Y A;  3EEQ A;  2XRI A;  3C6A A;  4IG0 A;  2ASP A;  5MLC Q;  1VHX A;  3T1H K;  2Q0U A;  4IWV A;  5JVG L;  2ZD1 A;  3CCL N;  2OZS A;  3A2F A;  4JKH A;  4IOX A;  1EWR A;  1C0F A;  4JKF A;  4JEP A;  3EZ5 A;  4HUG A;  3DLK A;  3KLE A;  2IC3 A;  2B4J A;  5C15 A;  1U04 A;  1SL1 A;  4CHP A;  4F4K A;  2RHK A;  4YDU A;  3QNN A;  4OLB A;  1B9F A;  3CMA N;  2O8B B;  1Z6R A;  1YJN N;  4KHY A;  3WT0 A;  4DR6 K;  3VGK A;  1KFS A;  4BRL A;  3VMF B;  3CM6 A;  1TYQ B;  3NGI A;  2NUB A;  3H6E A;  3C65 A;  4XH4 A;  3L2R A;  3V4I A;  4PY5 A;  2FSJ A;  4JI2 K;  1DT9 A;  4EHT A;  4FJK A;  2W40 A;  1S5J A;  3DXM B;  2OZM A;  1Z26 A;  1C0U A;  5GAD P;  1OH6 A;  4BR4 A;  2WON A;  4JKA A;  4JLH A;  1DGK N;  2UYT A;  3FGU A;  3G4S N;  2YHB A;  4AQY K;  1JXB A;  3VQE A;  3HST B;  4FJN A;  3WXM B;  3NCI A;  1WBB A;  1S1U A;  2AJQ A;  1LCU A;  4BRC A;  4FSV A;  5KI6 A;  4CJV A;  1RGI A;  2HHW A;  1L3S A;  3L4Q A;  1GOA A;  3CME N;  2EX3 A;  1I94 K;  4CF9 A;  4BVP A;  4DSL A;  4O5F A;  1JLF A;  2YJE A;  3LDN A;  3A5M C;  3OS2 A;  3MCA B;  5GAE P;  3VQ5 A;  1IV0 A;  4OKJ A;  5FDL A;  5KPZ A;  4FZZ A;  5HRN A;  4KRF A;  1HRH A;  4MO5 A;  3VET A;  4JI5 K;  3DXK B;  2YHA A;  4RTF D;  4IOA L;  4DV2 K;  3T1A A;  2Q31 A;  1NGF A;  1DTT A;  4CZI A;  3QB0 A;  3HL8 A;  4DS4 A;  2HB5 A;  5ELZ A;  3PO5 A;  3PSI A;  4KTZ A;  3M8Q A;  1YF5 L;  4MLH A;  2F9T A;  2QA4 N;  4Z4C A;  3MED A;  5HRR A;  3PX4 A;  1U47 A;  3V1O A;  3RRG A;  1RDW X;  5CE3 A;  3D2E A;  2O8E B;  1JLA A;  4CHQ A;  2ZGZ A;  4JAX A;  4F8R A;  4W5T A;  5KPR A;  3GL1 A;  3LPU A;  3KHY A;  3ZSZ A;  4CZK A;  4BDY A;  1GOB A;  1VQN N;  4WFA L;  3MCP A;  1RT5 A;  2VWB A;  4M7X A;  3RVC A;  3MX5 A;  3MXM A;  4YOT A;  1U48 A;  3IKM A;  2O8D A;  1WSE A;  1TV6 A;  1ZBI A;  5FPE A;  1W97 L;  1RCH A;  3SBT A;  1HQE A;  2PAV A;  2ZWH A;  1OH5 A;  1MWK A;  4IBN A;  3VQ7 A;  3DLE A;  2Z1I A;  4GW6 A;  3NDK A;  2XO7 A;  1RBS A;  5LJV A;  3O1W A;  2NRR A;  4KHP K;  4DQR A;  2V7Z A;  4B3O A;  4RCH A;  4H4M A;  5D3G A;  5JS2 A;  3CFR A;  1Q8I A;  1KLM A;  1QSL A;  4CIE A;  1WOQ A;  3ID6 A;  4GNI A;  1XWL A;  4GVE A;  2E5L K;  4HTL A;  3DRR A;  4LFC K;  3RTV A;  3OBW A;  4FYD A;  3AVG A;  4O4G A;  4WFN L;  2Q36 A;  2P9S A;  3EY1 A;  1NNE A;  4Z4E A;  4DS5 A;  2B6A A;  1QQN A;  2GWJ A;  3SUN A;  2P51 A;  3MXI A;  3DAW A;  4Y1C A;  3LP0 A;  3FFI A;  3JSM A;  4BDP A;  3QER A;  3SQ0 A;  4CHZ A;  4DCH A;  4E3S A;  4RW6 A;  3C7N B;  5EX5 A;  3ATV A;  4FM1 A;  1YUW A;  3KWG A;  4FWN A;  5J2Q A;  2VQF K;  3ZSY A;  3HYF A;  4CGD A;  3ID8 A;  2E2N A;  5JVH L;  3NMU A;  4PKH A;  1TL3 A;  4GVM A;  2Z1J A;  2UXB K;  2YNH A;  4MQ3 A;  2E2Q A;  4DR5 K;  3LDQ A;  4HTU A;  1ATN A;  2CH5 A;  4FLZ A;  3FE1 A;  3G10 A;  4KPY A;  4B3T K;  4I9Q A;  3S9H A;  1TGO A;  1GLE G;  3RWU A;  1T44 A;  5AQM A;  1T6D A;  3OVN A;  2Z1G A;  3LP1 A;  4QS8 A;  3I55 N;  3ENB A;  4KHQ A;  2GEM A;  3FZH A;  4BRA A;  4FJJ A;  3ZSX A;  2Y1J A;  2I7N A;  4RW7 A;  4WQ5 A;  5C2D A;  2YV0 X;  5CYM A;  1N8R O;  4I6M B;  4BC4 A;  1NJI O;  4GV6 A;  5KQD A;  1YTU A;  1VSI A;  4KTW A;  4HVJ A;  4BRH A;  3QEX A;  5KPT A;  3TAF A;  3AV9 A;  3S3N A;  5AQN A;  3JYT A;  2YCH A;  3UE5 A;  2ZF5 O;  3PIO L;  5C25 A;  3CFP A;  3OYK A;  1T03 A;  3I0R A;  4BC3 A;  5AFU H;  3F9M A;  4DTP A;  2GEL A;  3BZC A;  3DM2 A;  1LWE A;  3AO2 A;  1MA9 B;  3FZL A;  3C0B A;  3ZSV A;  3ALY A;  4DSF A;  1KVA A;  3KVG A;  1U45 A;  4DUY K;  4FWQ A;  4BE2 A;  4CIF A;  4CBX A;  4BG8 A;  4PWD A;  4PUO A;  1DKG D;  4E1J A;  1A5W A;  2O8F B;  4OGC A;  3P38 A;  4ELV A;  1HJR A;  2HHT A;  1U4B A;  4JN4 A;  2A6A A;  5FPN A;  3SQ4 A;  1CXQ A;  3BZK A;  4CGG A;  2QWL A;  4IDH A;  3TR8 A;  4UY8 O;  4B3S K;  4JI1 K;  3JS6 A;  3OA9 A;  1UA0 A;  5C12 A;  1WAF A;  4F2S A;  1TVR A;  1NGE A;  4FLY A;  3TTF A;  4M3W A;  1X9J A;  1XMO K;  2DFH A;  4KHW A;  3RR7 A;  4NCA A;  4E1M A;  4RW4 A;  2D1K A;  2W42 A;  3VTI A;  5AR0 A;  4M63 C;  4EP5 A;  3O1B A;  5TKY A;  3UIQ A;  1QSS A;  4DFP A;  5AZI B;  1L3T A;  3NH2 A;  4B9V A;  2EWS A;  2Y1I A;  4CGH A;  1VSK A;  4M3Y A;  5M1F A;  1B92 A;  3VES A;  2P9L B;  4CGI A;  3O8M A;  3UKR B;  1VSL A;  4MLE A;  1MDU B;  4AF1 A;  1Q18 A;  5I3U A;  3ITH A;  2VG7 A;  4KH6 A;  2X74 A;  2VWK A;  4OJR A;  2F8S A;  1NOZ A;  3NGY A;  2ZM6 K;  1FJG K;  4WQ4 A;  1JLG A;  4ILH A;  4N47 A;  5C10 A;  3L0Q A;  1NK9 A;  3LAN A;  5KGX A;  2HNZ A;  3KLI A;  3ZT2 A;  5IWA K;  2HHS A;  3OYC A;  5CZ1 A;  4Z4I A;  4QAG A;  2LSN A;  1SS6 A;  3DOK A;  1QSY A;  2IAJ A;  4ISE A;  3NH0 A;  3CCJ N;  1OH7 A;  4GY2 B;  5T7B A;  3NVM A;  3NE6 A;  5M1N A;  4XH5 A;  4B1X B;  4BRK A;  1VK0 A;  2HMP A;  1ZBF A;  3DWL A;  4M3Z A;  1C0M A;  1K8K B;  1KFD A;  1RBU A;  3VEO A;  1TKD A;  3KD5 E;  3CJB A;  2QXL A;  2FF6 A;  1NOY A;  3VQ8 A;  1CZB A;  4A61 A;  1VQ7 N;  2KW4 A;  1XC9 A;  5FLX O;  4GV3 A;  4H5W A;  4DB3 A;  3ULE B;  4C8O A;  1VQL N;  3R8E A;  1KQS M;  4FJG A;  4CJP A;  3C7N A;  3SJJ A;  4BRQ A;  1D5A A;  5F2R A;  3V9W A;  1T7P A;  1KVC A;  3K0S A;  1GLA G;  1C0G A;  4H0T B;  4B8A B;  4FWM A;  4H5R A;  3P5J A;  1HKC A;  3K58 A;  3EN9 A;  3S41 A;  3SNN A;  4CER A;  4BE1 A;  5AQZ A;  4IO8 A;  1IKW A;  5C42 A;  4DLE A;  4CJE A;  3Q7C A;  3CJA A;  4FJ5 A;  2UUB K;  3CC2 N;  2WBN A;  4KI6 A;  3H1Q A;  3LZI A;  2I7P A;  4H0Y B;  2V52 B;  2V7Y A;  4BRI A;  5I42 A;  3CCE N;  1MWM A;  3QDK A;  2JLE A;  4JRQ A;  5DM6 L;  2IVO A;  3WQT A;  4QOZ B;  4CGF A;  2YHX A;  1YAG A;  3AVH A;  3QNO A;  1VSJ A;  1NGA A;  2GTD A;  3DLG A;  2G8V A;  2DFF A;  3NVK A;  1JLC A;  4PL7 A;  4E7L A;  4DU1 A;  3CIP A;  1Q86 O;  3A5L C;  1NGC A;  4AM6 A;  4PHT X;  1YXQ A;  5EY4 A;  3K59 A;  4NLC A;  3HO1 A;  1XC3 A;  1NKC A;  4DQQ A;  2HVH A;  4FW2 A;  1HNI A;  2HF3 A;  3V1R A;  3AA3 A;  2P5G A;  2QWP A;  1QTM A;  2HMI A;  3VEX A;  1BA0 A;  4YNQ A;  4GV9 A;  4OVL A;  1L3V A;  2R7Y A;  3SK3 A;  4LC9 B;  3OYF A;  4DTS A;  3OHR A;  3D6R A;  1SAZ A;  4LF7 K;  4BR7 A;  3LDS A;  1VQ8 N;  3AA2 A;  2O8C A;  3MMV A;  5JLF A;  2A1R A;  3OJU A;  4BG9 A;  3D2F B;  1LW2 A;  4KHN A;  3MEC A;  2IDO A;  4DR4 K;  2O8E A;  1JCG A;  5AQS A;  4CVN E;  2A41 A;  3P31 A;  3VGL A;  1RT2 A;  4CJK A;  3WNF A;  4PKI A;  3GOI A;  4B9M A;  2G8K A;  4OPJ A;  2QXF A;  3D45 A;  1NK7 A;  3FZF A;  3DRS A;  5AQQ A;  1QZ5 A;  1Q9X A;  4K43 A;  2NRW A;  1OKJ A;  2W41 A;  1OVQ A;  3GDQ A;  1QE1 A;  2RN2 A;  4X64 K;  2F8T A;  4WYB A;  5J2N A;  4OX9 K;  1RT3 A;  1FKP A;  4E89 A;  4JKE A;  4W5O A;  3MWP A;  3EKU A;  3IS9 A;  3EE9 A;  1J6Z A;  5GIO A;  2KFN A;  4FW1 A;  3LZJ A;  4CZF A;  3BY5 A;  1ATS A;  2V51 B;  3U8X A;  3ZT3 A;  4BDZ A;  4LY7 A;  3MN6 A;  4IXC A;  3U6F A;  3CD6 N;  2HBL A;  3NF6 A;  5LMU K;  2NRZ A;  3QEP A;  3MEE A;  5FRN A;  3VEY A;  4WCE L;  4H8K A;  2Z1H A;  2O8C B;  5AQL A;  3VGM A;  3O9T A;  3VQ6 A;  1O1W A;  1QQM A;  1IBM K;  4QCL A;  3TAM A;  3WXL A;  3UKU B;  4EP4 A;  3DXM A;  3ZSO A;  5I9E B;  4JI4 K;  1TKZ A;  4CJT A;  1VSE A;  5CR4 A;  4HUE A;  5F1X A;  4NCG A;  4DTN A;  2E1Y A;  1BIZ A;  5AJ3 K;  3OYB A;  3WNE A;  3CHW A;  4IFE A;  4ILG B;  4B1V A;  1TUY A;  1GLL O;  4CHN A;  3MX2 A;  1WNS A;  2Q97 A;  4FWP A;  3O5B A;  5M1P A;  2OTJ N;  3DOL A;  2JWK A;  4K25 A;  2O8D B;  2HHV A;  1C1B A;  3LDO A;  5J2P A;  4A5A A;  3D7E O;  3QO9 A;  1BDG A;  1RDD A;  3MXJ A;  2DFE A;  2OYQ A;  1FKO A;  5EU7 A;  1IBK K;  4CEO A;  1QVG M;  3F73 A;  1BHL A;  1KAZ A;  3I56 N;  3SUQ A;  4DTM A;  1BUP A;  2HBK A;  3WEE A;  4E1N A;  2UU9 K;  1GLC G;  1WN7 A;  4CD3 A;  1K8A O;  3PSF A;  5EXW A;  3RMA A;  3NF9 A;  5FRM A;  1LOT B;  2D0A A;  3CJ9 A;  1LAW A;  2BTF A;  2QEX N;  1TKT A;  4BRD A;  5BN8 A;  3T3F A;  1C0T A;  2HNY A;  4FLX A;  3AVF A;  4EZ6 A;  1BI4 B;  4YOX A;  1XMQ K;  4CF8 A;  1VQ5 N;  4O5B A;  4HCC A;  1KAX A;  3ZEU B;  4E7H A;  1BQM A;  5BRH A;  4LF4 K;  2G8U A;  5LL6 Z;  1P90 A;  4CJW A;  4C1N I;  2P9N B;  1SKW A;  1EXQ A;  3AGR A;  4JK7 A;  3KK1 A;  4L8R B;  1X9W A;  3V1Q A;  5LJW A;  5AQJ A;  3SQ2 A;  3NGZ A;  3O9Q A;  3QIO A;  5KGW A;  4CEQ A;  1HKG A;  1ASW A;  3A5O C;  1Y97 A;  3FLC O;  4B9N A;  4FJL A;  5KQ8 A;  3KJV A;  1RFQ A;  4FPA A;  1FXX A;  5DM7 L;  3U3G A;  4JHD B;  4Z4F A;  3M1F A;  4KHS A;  3SV4 A;  3A8Y A;  3ULE A;  3VEZ A;  4C8N A;  1JXE A;  3VF4 A;  4DV4 K;  3OY9 A;  3AO4 A;  2GV9 A;  3MWT A;  2XY8 A;  5SWM A;  4DFK A;  4K8Z A;  4NXM K;  4X65 K;  2QKK A;  3BDP A;  5M1O A;  3THX B;  4A5B A;  1N5Y A;  4FJH A;  1K9M O;  2GWK A;  3VEN A;  3NAE A;  2QK9 A;  5KTQ A;  3CJC A; 
#chains in the Genus database with same CATH homology
 3ZSV A;  4K8X A;  3ALY A;  4DSF A;  1KVA A;  3VA3 A;  3V81 A;  3RMB A;  1U45 A;  4B9T A;  1QQC A;  4IG3 A;  3S3M A;  4FLV A;  4BE2 A;  4FJ7 A;  3OYH A;  2PZS A;  1VSF A;  2P1J A;  4CIF A;  2VG6 A;  4I9L A;  3BGR A;  4KTQ A;  1I3A A;  4PWD A;  4DQS A;  4CE9 A;  1S1T A;  4UQG A;  3F9K A;  4PUO A;  1YT3 A;  3G0Z A;  4FZY A;  3HJF A;  3MAQ A;  1A5W A;  1ZBU A;  1RTH A;  3ZSQ A;  4OGC A;  4ELV A;  2HHT A;  1HJR A;  2E6L A;  1U4B A;  4DWI A;  4KRE A;  4TSX A;  3ZT0 A;  1BIU A;  4CED A;  3TAR A;  4CFC A;  4DQP A;  2A1S A;  4W5N A;  4CHO A;  4CEF A;  3QLH A;  4CF0 A;  3SQ4 A;  1CXQ A;  4HCB A;  1CXU A;  1HMV A;  1W9H A;  5HBM A;  4CGG A;  1XHZ A;  4J2D A;  1KSP A;  3TR8 A;  4KO0 A;  4FJX A;  4XIU A;  3NHG A;  3AVL A;  4ELT A;  3KTQ A;  2E6M A;  2ZQB A;  1CZ9 A;  5J2M A;  2G8H A;  3O3F A;  3KLF A;  2PYL A;  4AHT A;  3TAE A;  4ID1 A;  3I0S A;  1UA0 A;  1HNV A;  4LSN A;  1WAF A;  4CF2 A;  1KLN A;  4F2S A;  3RMD A;  3SPZ A;  5E41 A;  2G8F A;  1ASV A;  4M41 A;  1TVR A;  3AVA A;  4FLY A;  4M3W A;  2Q3S A;  3B6O A;  4FK2 A;  2DFH A;  4KHW A;  3RR7 A;  3SV3 A;  1RBV A;  3ULD A;  1L3U A;  1HQU A;  3K57 A;  4AHR A;  4NCA A;  4E1M A;  3OYD A;  4FM2 A;  4RW4 A;  3TAP A;  2BE2 A;  2W42 A;  4Q5V A;  4FLW A;  4DSJ A;  4DSE A;  4O44 A;  3AVC A;  4EP5 A;  4H4O A;  4RG8 A;  2G8W A;  3K5O A;  1IH7 A;  4FLT A;  4DQI A;  4EZ9 A;  1UA1 A;  3UIQ A;  3TAQ A;  1QSS A;  4DFP A;  1L3T A;  3NH2 A;  3KLH A;  4DMN A;  4ZHR A;  3V9S A;  3KK2 A;  3QEI A;  2Y1I A;  1UAX A;  1VSK A;  4CGH A;  4B9V A;  1WLJ A;  4FJ9 A;  4M3Y A;  1X9M A;  4RW9 A;  1B92 A;  4I7F A;  4Z4H A;  3I8D A;  4FLU A;  1G15 A;  2FBT A;  1ASU A;  2I5J A;  4CGI A;  3AA5 X;  1D9F A;  4OGE A;  1C1A A;  3AO3 A;  3ZSR A;  3ZT1 A;  4B9U A;  1RTI A;  1VSL A;  4Q0B A;  4M45 A;  3KIO A;  2O4I A;  5I3U A;  3AVB A;  3ITH A;  3LWM A;  1LWC A;  2VG7 A;  4CEA A;  2X74 A;  1WSJ A;  3O3G A;  2VWK A;  4OJR A;  1HYV A;  4PA1 A;  1BCO A;  2F8S A;  5C24 A;  1NOZ A;  3LPT A;  3NBP A;  3NGY A;  3DLB A;  3C95 A;  3AVM A;  4J2B A;  4NYF A;  2KZZ A;  1JLG A;  5KRT A;  4N47 A;  4W5Q A;  1MU2 A;  1NK9 A;  1IG9 A;  4DSI A;  3LP3 A;  4LH4 A;  3LAN A;  5KGX A;  2HNZ A;  4M3X A;  3KLI A;  3ZT2 A;  4AHV A;  4CK3 A;  4G1Q A;  3SZ2 A;  2HHS A;  3OYC A;  5CZ1 A;  4Z4I A;  4QAG A;  3E01 A;  2LSN A;  3DOK A;  3AA4 A;  2PY5 A;  3ZCM A;  2IAJ A;  1QSY A;  4IDK A;  2HW3 A;  3VQ9 A;  3NH0 A;  2BGG A;  5T7B A;  3NE6 A;  1BL3 A;  1WSG A;  4GMJ B;  2YNF A;  2DTU A;  2E4L A;  3CYM A;  5HRS A;  3QEW A;  4N41 A;  1UOC A;  3DRP A;  1VK0 A;  3M8P A;  3VQQ A;  4CEE A;  3OYJ A;  1ZBF A;  2GBZ A;  1D8Y A;  4M3Z A;  1C0M A;  1KFD A;  2D5R A;  2ZE2 A;  1RBU A;  1TKD A;  3VQC A;  1K6Y A;  4CFD A;  3DYA A;  3SQ1 A;  4DF8 A;  1B9D A;  2BDP A;  2YKM A;  3KD5 E;  1TL1 A;  3OYI A;  1I39 A;  4FM0 A;  4B8C A;  1NJY A;  4DF4 A;  1LAV A;  1NOY A;  1QS4 A;  2P5O A;  3VQ8 A;  1CZB A;  2YKN A;  2X6N A;  3PO4 A;  3TAN A;  2KW4 A;  3HPH A;  2HHQ A;  1XC9 A;  3HVT A;  1REV A;  4C8O A;  1WAJ A;  4CEC A;  4CJ3 A;  3ZSW A;  4MFB A;  3CM5 A;  3HXM A;  2KTQ A;  3LAL A;  4FJG A;  1KTQ A;  1RBT A;  2IOC A;  4CJP A;  3VQP A;  4CFB A;  3NFA A;  4F3T A;  3SJJ A;  1FK9 A;  3IG1 A;  3VN5 A;  1SL2 A;  1D5A A;  3V9Z A;  2ATQ A;  3QEV A;  3V9W A;  1KVB A;  5HP1 A;  1LV5 A;  1T7P A;  1KVC A;  3OYE A;  4F3O A;  4J2A A;  4CHY A;  1NKB A;  4JS4 A;  4CES A;  3CQ8 A;  4B8A B;  4B9L A;  4WE1 A;  3P5J A;  1Q9Y A;  1LWF A;  4DG1 A;  3ZT4 A;  3OS1 A;  3O4Q A;  2XHB A;  4JS5 A;  2XRI A;  4IG0 A;  3K58 A;  3SNN A;  4CER A;  4BE1 A;  4AHU A;  3PV8 A;  3RRH A;  3OYL A;  2OPS A;  1RT7 A;  1IKW A;  5C42 A;  4HHT A;  2ZD1 A;  4CJE A;  4DLE A;  2OZS A;  4FZX C;  3A2F A;  4FJ5 A;  2HVI A;  4HUG A;  3EZ5 A;  4CEZ A;  4E7I A;  4DTX A;  3PUF A;  3MEG A;  4KI6 A;  3DLK A;  3LZI A;  4E7J A;  3AVI A;  3QES A;  4Z0U A;  3KLE A;  3OS0 A;  5I42 A;  2IC3 A;  3OYG A;  3K5L A;  2B4J A;  1SL1 A;  1C1C A;  1U04 A;  2JLE A;  4CHP A;  1JLE A;  4OPK A;  4JRQ A;  3QNN A;  1J5O A;  4F4K A;  4OLB A;  4DU3 A;  1B9F A;  1BCM A;  4QOZ B;  4CGF A;  4LD0 A;  4ZTF A;  1RNH A;  4KHY A;  3HP9 A;  4CIG A;  4FVM A;  3AVH A;  3QNO A;  1VSJ A;  4IFV A;  1T05 A;  4OLA A;  1KFS A;  3IAY A;  3DLG A;  3V9U A;  2G8V A;  2DFF A;  3L2Q A;  3SI6 A;  1JLC A;  3CM6 A;  1ZBH A;  4E7L A;  4JRP A;  1HPZ A;  3NGI A;  4DU1 A;  2NUB A;  1TAU A;  4M3T A;  3L2R A;  3V4I A;  4O0I A;  4PY5 A;  4AH9 A;  4KB0 A;  3HPG A;  3NF8 A;  1NK0 A;  2QKB A;  4FJK A;  2DY4 A;  1S1W A;  3K59 A;  4LSL A;  3HO1 A;  1NKC A;  1S5J A;  2OZM A;  1Z26 A;  3B6P A;  4DQQ A;  3NF7 A;  2HVH A;  4FW2 A;  1ZYQ A;  2KZM A;  1EKE A;  1C0U A;  3C94 A;  1RDB A;  1HNI A;  2WON A;  4Y1D A;  4JLH A;  3V1R A;  3AA3 A;  1BQN A;  2YHB A;  2IS3 A;  1JXB A;  2P5G A;  3VQE A;  3HST B;  3OJS A;  1R0A A;  1QTM A;  2HMI A;  3ASM A;  1S1V A;  3DI6 A;  4N56 A;  4I2P A;  4YNQ A;  4FJN A;  4OVL A;  1L3V A;  2R7Y A;  3NCI A;  4IKF A;  1S1U A;  2AJQ A;  5K14 A;  3OYF A;  4DTS A;  4RW8 A;  5KI6 A;  2ETJ A;  4KV8 A;  4CJV A;  1NJW A;  1L3S A;  2HHW A;  1GOA A;  3TI0 A;  3L2V A;  2EX3 A;  2FC0 A;  4AHC A;  3HVR A;  4CF9 A;  1XHX A;  3VA0 A;  4DSL A;  1JLF A;  1YVU A;  3DLR A;  1QHT A;  3LDS A;  3AA2 A;  1SKS A;  3OS2 A;  4IFY A;  2A1R A;  3VQ5 A;  3OJU A;  5HLF A;  4OKK A;  1CLQ A;  3LAK A;  1LW2 A;  4O0J A;  4OKJ A;  3DLH A;  5FDL A;  4KHN A;  3MEC A;  3C6U A;  2IDO A;  1N6Q A;  4FZZ A;  3KD1 E;  5HRN A;  4NYN A;  4KRF A;  3RMC A;  1HRH A;  2VG5 A;  2RPI A;  2D0B A;  3P83 D;  4CGJ A;  1LW0 A;  4Z4G A;  2YHA A;  1RT2 A;  3P1G A;  4CJK A;  3T1A A;  3WNF A;  5JS1 A;  3HK2 A;  1DTT A;  4CJ4 A;  1SKR A;  2G8K A;  4B9M A;  4F2R A;  3D0P A;  3TAB A;  3HL8 A;  4DS4 A;  4OPJ A;  2HB5 A;  2QXF A;  3D45 A;  4CJR A;  1NK7 A;  3PO5 A;  3DRS A;  3AVK A;  3OYN A;  2XY7 A;  4KTZ A;  3M8Q A;  4FK4 A;  4Z4C A;  3MED A;  5HRR A;  3SPY A;  4E19 A;  1L5U A;  4NCB A;  3PX4 A;  2KQ2 A;  1U47 A;  1RTJ A;  1D9D A;  3V1O A;  3RRG A;  1Q9X A;  4KHU A;  1C6V A;  4CF1 A;  1JLA A;  4CFA A;  4CHQ A;  3VQD A;  2GUI A;  2F96 A;  2FBY A;  5FRO A;  3VQ4 A;  1QE1 A;  3NH1 A;  3T19 A;  2RN2 A;  4F8R A;  2PYJ A;  3AVJ A;  4W5T A;  5J2N A;  2F8T A;  4FJM A;  1RT3 A;  1FKP A;  4E89 A;  1ITG A;  3SCX A;  3TWH A;  3LPU A;  4W5O A;  1S6Q A;  4CJU A;  2HHX A;  3AO1 A;  2RKI A;  3ZSZ A;  1KCF A;  3IS9 A;  1EP4 A;  3KLG A;  4BDY A;  3L3V A;  1GOB A;  2EHG A;  3HM9 A;  1RBR A;  3SYZ A;  5DMR A;  1TAQ A;  1RT5 A;  3L2U A;  3L2W A;  1F21 A;  2KFN A;  3V9X A;  4FW1 A;  3LZJ A;  4BWM A;  5CZ2 A;  4CEB A;  1IKV A;  1DTQ A;  5KRS A;  3ZT3 A;  4BDZ A;  2RF2 A;  3MXM A;  1TKX A;  4LY7 A;  5HRP A;  4B9S A;  3U6F A;  1Z25 A;  1U48 A;  3ISN C;  4DTO A;  1X1P A;  3NF6 A;  4DFM A;  3QEP A;  1WSE A;  3MEE A;  1TV6 A;  5FRN A;  4H8K A;  1ZBI A;  2Z1H A;  3C6T A;  3WNG A;  3HP6 A;  4E7K A;  1RCH A;  4ELU A;  1HQE A;  1RT6 A;  3VQ6 A;  1ZBL A;  1J9A A;  1WSF A;  1O1W A;  3DMJ A;  2KFZ A;  4IBN A;  4QCL A;  3VQ7 A;  3DLE A;  2Z1I A;  3CG7 A;  3TAM A;  4I2Q A;  4GW6 A;  3VQA A;  3VQB A;  4EP4 A;  3NDK A;  4FJJ A;  2XO7 A;  4BAC A;  1RBS A;  1S9E A;  3ZSO A;  2XY5 A;  1TKZ A;  4DQR A;  4CJT A;  1VSE A;  3PX6 A;  4B3O A;  4HUE A;  1DLO A;  4NCG A;  4CJQ A;  4DTN A;  1BIZ A;  3LAM A;  2YNI A;  3OYB A;  4H4M A;  3WNE A;  5D3G A;  2OPQ A;  4ID5 A;  5JS2 A;  2O4G A;  1VSM A;  4B08 A;  4YFU A;  3V6D A;  2G8I A;  1NK8 A;  3IRX A;  3QIN A;  2OA8 A;  1IKX A;  4M42 A;  4CJL A;  4CHN A;  5J1E A;  3M8R A;  3CFR A;  4FJI A;  1WNS A;  1Q8I A;  3CFO A;  4DFJ A;  4DTR A;  1KLM A;  1TK0 A;  1QSL A;  2X6S A;  1X9S A;  4CIE A;  5HRO A;  1XI1 A;  3DOL A;  1A5X A;  4CJS A;  4W5R A;  4C8K A;  1XWL A;  2VWJ A;  2HHV A;  2IGI A;  3WNH A;  1IKY A;  3K5N A;  1C1B A;  3S3O A;  4CCH A;  3QIP A;  3O3H A;  5J2P A;  2JGU A;  2OPP A;  1S1X A;  3DRR A;  3QO9 A;  3RTV A;  1RDD A;  3MXJ A;  1NJX A;  3AVG A;  4O4G A;  1SUQ A;  2DFE A;  4FYD A;  1NK5 A;  1RT4 A;  1FKO A;  4CJF A;  5EU7 A;  3M8S A;  1TK5 A;  2OYQ A;  2D0C A;  1VSD A;  2HND A;  3EY1 A;  4E0D A;  4CEO A;  1JLQ A;  3OYA A;  3F73 A;  4FCY A;  1BHL A;  3SUQ A;  2HHU A;  4DLG A;  1NJZ A;  4Z4E A;  4DTM A;  4DS5 A;  4ICL A;  2B6A A;  4E1N A;  3SUN A;  2P51 A;  3K5M A;  3MXI A;  4BWJ A;  4Y1C A;  4DTJ A;  4CK2 A;  1WN7 A;  1J53 A;  3LP0 A;  4M3R A;  1WSH A;  3FFI A;  3JSM A;  3QET A;  1SV5 A;  3QER A;  3RMA A;  3SQ0 A;  4N5S A;  3NF9 A;  4CHZ A;  2XY6 A;  4BDP A;  3AVN A;  1RIL A;  5FRM A;  2D0A A;  4E3S A;  1LAW A;  4RW6 A;  1NK4 A;  4CJ5 A;  1RDA A;  4R5P A;  1TKT A;  1VRU A;  4AHS A;  4FM1 A;  3T3F A;  1BGX T;  5J2Q A;  1C0T A;  3HYF A;  3ZSY A;  3H08 A;  2HNY A;  4FLX A;  1NKE A;  4CGD A;  3AVF A;  4EZ6 A;  4PQU A;  1BI4 B;  1BI4 A;  4CF8 A;  4DSK A;  4O5B A;  3O4N A;  1HYZ A;  1EX4 A;  4HCC A;  4C8L A;  3U3Y A;  1S6P A;  5CY4 A;  3SUO A;  3KKR A;  4E7H A;  1TL3 A;  1W0H A;  4GVM A;  3TAG A;  4KI4 A;  2Z1J A;  3OYM A;  1BQM A;  2YNH A;  4LH5 A;  4MQ3 A;  1J54 A;  1BIS A;  2G8U A;  4HTU A;  1NK6 A;  3L3U A;  3THV A;  4CJW A;  4M3U A;  3PX0 A;  4FJ8 A;  4KB1 A;  4FLZ A;  3G10 A;  1SKW A;  4KPY A;  1EXQ A;  3KK1 A;  4L8R B;  1X9W A;  1UWB A;  3V1Q A;  4BE0 A;  4I9Q A;  5SZT A;  4O55 A;  2OPR A;  3S9H A;  1TGO A;  3SQ2 A;  1U49 A;  3KK3 A;  3NGZ A;  1A5V A;  3QIO A;  1KRP A;  5KGW A;  4CEQ A;  3RWU A;  1ASW A;  3L8B A;  4DTU A;  3OVN A;  2Z1G A;  3LP1 A;  4KHQ A;  1S9G A;  1JL1 A;  1Y97 A;  3HT3 A;  4DU4 A;  3EYZ A;  2FBV A;  4KKO A;  3LP2 A;  3ZSX A;  4HUF A;  4B9N A;  1SL0 A;  3KJV A;  2Y1J A;  4FJL A;  4FK0 A;  4N76 A;  4RW7 A;  1RDC A;  4CK1 A;  1FXX A;  4ZTJ A;  1GOC A;  1JL2 A;  2YV0 X;  3U3G A;  1TK8 A;  1IO2 A;  3RR8 A;  1T8E A;  4OKE A;  5CYM A;  4FXD A;  2ITG A;  1RT1 A;  4AIL C;  4Z4F A;  4KHS A;  3SV4 A;  2B5J A;  1YTU A;  1VSI A;  4KTW A;  1YTA A;  4HVJ A;  3KKS A;  3QEX A;  1JLB A;  2X78 A;  3HPO A;  4C8M A;  2BAN A;  1JXE A;  2YNG A;  4C8N A;  5CYQ A;  3AV9 A;  3OY9 A;  4KFB A;  3TAF A;  3AO4 A;  3SUP A;  3S3N A;  3K2P A;  3JYT A;  1HYS A;  1WSI A;  3PY8 A;  2GV9 A;  5C25 A;  3CFP A;  3OYK A;  4KAZ A;  1T03 A;  1EET A;  2XY8 A;  3I0R A;  5SWM A;  4DFK A;  1RTD A;  4K8Z A;  2FBX A;  5DK5 A;  4DTP A;  2QKK A;  3BDP A;  4J2E A;  3DM2 A;  3LWL A;  1N5Y A;  3AO5 A;  4FJH A;  1JKH A;  1LWE A;  1VRT A;  3AO2 A;  2WOM A;  1VSH A;  3NAE A;  2QK9 A;  5KTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...