3AO2A

Fragment-based approach to the design of ligands targeting a novel site on hiv-1 integrase
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
153
structure length
138
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQEESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein
publication title Fragment-based design of ligands targeting a novel site on the integrase enzyme of human immunodeficiency virus 1
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/transferase inhibitor
total genus 51
structure length 138
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ao2A00
3MXMA 3BDPA 3I0RA 3LP3A 3G10A 3K5NA 2JGUA 3HPGA 1HNIA 4O55A 4CK2A 1LW0A 4GW6A 1VRUA 3TWHA 4C8KA 1ASWA 4KREA 3SCXA 4F4KA 4CESA 3CM5A 4FJ8A 4CJLA 3U6FA 4W5NA 2Y1IA 1C6VA 1S9EA 3AA2A 1FKPA 4JLHA 4FZZA 4DTSA 1VK0A 1J53A 2XY7A 1HYVA 3HP6A 4DU4A 4IKFA 4G1QA 4DTJA 4WE1A 1TAQA 1G15A 1NK8A 1RCHA 1EXQA 1HRHA 4OLBA 1T7PA 1Y97A 4CECA 2KQ2A 4HUGA 1REVA 3VQQA 1TV6A 4OKKA 2HVHA 1S1TA 2XY8A 3WNHA 4O5BA 1LWCA 4DSLA 3C94A 3NBPA 4CEQA 4FK4A 1RT1A 1NKEA 2G8VA 1RT2A 4E7JA 2HNYA 1WSJA 3AVCA 2G8FA 4Z4CA 4M41A 4OLAA 5I42A 2BE2A 4KKOA 2QKKA 1JLCA 4Z4EA 3SQ2A 4FLZA 3I0SA 3TAMA 5HP1A 4FJHA 4Z4IA 1X1PA 3B6OA 5FROA 3KIOA 3ZT4A 3RMCA 2OZMA 4FJIA 4KI4A 1SKWA 3HPOA 3ZT1A 4CJWA 4CJ4A 4F3TA 3NHGA 1Q8IA 3SV3A 2FBVA 4B9UA 3DMJA 1BQNA 4CJ3A 3EYZA 5KI6A 3DOKA 1FKOA 1VSFA 1RBTA 2XY5A 4KHQA 4DU3A 3VA0A 1VSMA 3M8SA 1ZBFA 1IH7A 3FFIA 1D9FA 1VSJA 1U4BA 4M3UA 3T19A 3AVIA 2KFZA 3TAEA 4OPKA 3NGIA 4ZHRA 1NK5A 4BDPA 4KTQA 1NOYA 1C1AA 1YTUA 1TVRA 2B6AA 3NH0A 4KHWA 4HVJA 4N76A 1NJWA 4KFBA 4MQ3A 3UIQA 3RTVA 4KHUA 1C1CA 4FM0A 3PX4A 3OYIA 3MECA 3AVJA 1FXXA 1JXEA 4N47A 4DSKA 4F2SA 3QEIA 4CERA 1TKTA 1RT6A 1HMVA 1RTHA 2BGGA 3HP9A 2DTUA 2HMIA 3EZ5A 3CYMA 3U3YA 1S9GA 1A5WA 1WNSA 4DWIA 4I9QA 1DTTA 4KTWA 3ASMA 1ASUA 2OYQA 3SPZA 4K8XA 1TL1A 2DFHA 3L2WA 4M3YA 2IDOA 1RTDA 4OGCA 2I5JA 1JL1A 2VWKA 3MEGA 1I39A 1LAWA 3MEEA 3NF6A 3HT3A 1CZBA 3L2VA 2HNDA 4CJSA 3VQ7A 2XHBA 3OYDA 3AVLA 5HROA 3RR8A 4K8ZA 4Q0BA 4DQRA 3NGYA 1U45A 4CJKA 1IKWA 3RWUA 3K57A 3ULDA 4KRFA 4H4MA 1A5XA 4CIFA 1XHXA 5KRSA 4C8MA 3VA3A 4AHTA 2E4LA 5HRRA 3OS1A 1CZ9A 4CCHA 1A5VA 1BQMA 2HHUA 1HQUA 4CJTA 1GOAA 4N56A 3V1OA 2ZD1A 3QEWA 3IRXA 4ELVA 5KGXA 1C0TA 1WN7A 2ITGA 4DLEA 1SV5A 3P5JA 1QQCA 2GBZA 4FJ7A 3NF9A 4CEAA 5EU7A 3P83D 5CYMA 1X9SA 4QOZB 1B9DA 3HO1A 3TAGA 4FZXC 4E7IA 3AVBA 3NFAA 3TARA 1KLNA 3KLEA 4B3OA 2Z1GA 1S6QA 4B8CA 3OS2A 3SUPA 1ASVA 1QSLA 4Y1DA 2HNZA 3QO9A 1NK7A 1T8EA 4Z4HA 3AVHA 5C25A 4IBNA 2RPIA 1BCMA 1ZBHA 3KKRA 4BWMA 4UQGA 4B08A 4C8LA 3O3GA 3RMDA 1W9HA 3HYFA 1NKBA 4CJFA 1TAUA 1S1UA 3F9KA 4OGEA 4DQSA 4B9SA 5JS1A 3OYFA 3T3FA 3DLBA 1C1BA 3QIOA 2A1SA 3JSMA 4CJPA 1O1WA 4KTZA 3WNGA 4OJRA 5HLFA 5CZ2A 4DLGA 1I3AA 1YVUA 1CLQA 2KZZA 3OJUA 4DQQA 4AHSA 1QSSA 4DTOA 1T03A 1L3VA 4JRPA 3V4IA 4CFAA 2BDPA 1EKEA 3QINA 3RMAA 2YHBA 3D45A 3L3UA 4HUEA 4CGDA 3A2FA 3V9XA 4JS5A 1L3SA 3OYGA 5HRSA 1QHTA 4FLUA 4M3WA 5JS2A 3HXMA 2FBTA 2RKIA 4CJ5A 3OS0A 1ZBLA 4M42A 1KVAA 4E1NA 1IO2A 1JKHA 1C0UA 1LW2A 3NDKA 4B9NA 4DF4A 3KJVA 4GMJB 2P5GA 4NCBA 3NGZA 1WAJA 2Z1JA 3H08A 3I8DA 5HBMA 3PY8A 1RTIA 4FJKA 1TK5A 3L2QA 3SZ2A 1VSEA 3RMBA 3HJFA 1EP4A 2RF2A 4F8RA 3ISNC 4CHNA 5K14A 3ZSQA 3M8QA 3ZSWA 1KVBA 2YV0X 4B9MA 3OYNA 1KSPA 3OYAA 1WSEA 1KRPA 2WONA 4F3OA 4BE2A 5HRNA 1RDAA 1UA0A 4FYDA 3HVRA 4AHCA 3SQ1A 1FK9A 3QETA 3NF8A 4BWJA 1WSHA 2OPSA 4JS4A 1U48A 4ELTA 1KVCA 1VSKA 3VQ9A 3AO5A 1B9FA 1RT7A 3LZIA 1ZYQA 3T1AA 3SV4A 3L2UA 4YFUA 4DSEA 1R0AA 4N41A 3KKSA 3VQ4A 2DFFA 4CHOA 4DTUA 3VQAA 3CQ8A 1LWEA 1ZBIA 3LDSA 3VQDA 4AILC 3QLHA 1QE1A 3WNEA 5CYQA 4CFCA 1NK4A 4FJ9A 5FDLA 4FLVA 5FRMA 4FVMA 3THVA 1IKVA 3AA5X 2D5RA 4EZ9A 3IG1A 2PZSA 3K5OA 4DFJA 3PO5A 3LAMA 4FJ5A 3AO2A 3EY1A 4PUOA 1BL3A 4I2QA 3V9ZA 3S3NA 4HHTA 4KHYA 4DQPA 3HPHA 4C8NA 2HHQA 4DS4A 3HM9A 1J54A 2FBXA 3LZJA 3K58A 4J2DA 1HYSA 4DTRA 4O44A 1VRTA 2FC0A 2JLEA 2KZMA 2D0AA 1D9DA 3OYHA 3O4QA 3SUNA 1IKYA 4CJVA 3KK1A 1L5UA 4CHQA 3V81A 1U04A 4BACA 2E6LA 4CK3A 3OYEA 3KLHA 3TAPA 4CEOA 1S5JA 1HPZA 1VSLA 2B5JA 4FLWA 2OPRA 3ZSRA 2Y1JA 4CEFA 4DTNA 4FW1A 5DK5A 3QNOA 2P5OA 4BE1A 1VSHA 1K6YA 4W5QA 4E3SA 1WLJA 4FM2A 3KD1E 3TR8A 3DLRA 4EP5A 3L2RA 3ZSOA 4CF1A 4FM1A 4DU1A 3MAQA 5J2MA 2DY4A 3AVMA 3O4NA 4NCAA 3VQ6A 3OVNA 3V9SA 5SWMA 3V1QA 1NK6A 1HYZA 4TSXA 3OYMA 1XI1A 1YTAA 2PYJA 1LV5A 4AHRA 4FK2A 3ZCMA 1BIZA 4FCYA 3TABA 1EX4A 1RT4A 4H4OA 4RW6A 4FLXA 2YKMA 3QERA 1SKSA 4CGHA 3KLGA 1GOCA 2HB5A 2NUBA 2VG5A 4LD0A 1Z26A 2ZQBA 3HL8A 4ID5A 4FLYA 5J2NA 3NAEA 2ATQA 2IAJA 2P51A 4CHZA 1HQEA 3NCIA 3F73A 1L3UA 1RBSA 4ID1A 1RDDA 4CF0A 2HHTA 1HNVA 4I9LA 1BI4A 4XIUA 3ZT2A 3U3GA 1BI4B 4RW8A 1KLMA 1S1XA 2LSNA 2G8HA 3DLEA 4CF2A 4M45A 4O4GA 3SPYA 4N5SA 4PA1A 3VN5A 4O0IA 3OYKA 4DSJA 4DTXA 4J2EA 4M3TA 1Z25A 3VQ8A 1BISA 2YNHA 2XO7A 5E41A 3V9UA 4W5OA 3SJJA 3KLFA 3L8BA 2EX3A 4MFBA 3LP1A 4KB1A 5DMRA 4CF8A 2OA8A 4HCCA 2F8TA 3SUOA 3DOLA 3NF7A 4IDKA 3AA3A 5KGWA 1SKRA 3ITHA 1JLBA 3CG7A 3LP0A 4LY7A 4CFBA 3KK2A 5CY4A 3P1GA 2YNFA 1U47A 1TKDA 1UA1A 1NK9A 3AVFA 4CK1A 1X9WA 5KTQA 2IOCA 3C95A 1IG9A 4QCLA 4IG3A 3ZT3A 4CGFA 4M3ZA 1KCFA 3MXJA 2HHWA 3KLIA 2G8UA 1QSYA 2O4IA 3HK2A 2B4JA 3TAQA 4NCGA 2YNIA 4BDZA 1BCOA 3QEVA 4KPYA 2KFNA 4B9LA 5FRNA 2XRIA 3PUFA 1UAXA 4GVMA 5D3GA 4EP4A 2A1RA 4LH4A 3DM2A 4CE9A 4ELUA 2HHXA 1F21A 4CJQA 1BGXT 4J2BA 2P1JA 4O0JA 4E0DA 1RDCA 1QS4A 1KFSA 5I3UA 3CM6A 3V1RA 1T05A 1UWBA 3IS9A 1J9AA 1N6QA 4W5TA 2EHGA 2VWJA 1IKXA 2HHSA 2GUIA 3LAKA 3AVNA 3NH2A 3VQPA 3SYZA 3RRHA 3ZSVA 3PX6A 4ZTJA 3HSTB 4RG8A 1SL1A 3NH1A 3ZSXA 4CEEA 4B8AB 2G8IA 2PY5A 1WSFA 4KHSA 2WOMA 2VG7A 3C6UA 5J2PA 1RBVA 1SL0A 2F8SA 2BANA 2KTQA 3ZSZA 4FZYA 2Q3SA 3B6PA 1ZBUA 4DFMA 3S3MA 1D5AA 3OJSA 4IFYA 4FLTA 2VG6A 1BHLA 1C0MA 1KFDA 3V6DA 2X78A 3K5MA 4KO0A 1VSIA 4M3XA 3OYLA 1YT3A 4I2PA 5C24A 2AJQA 3QNNA 3MEDA 2HVIA 1BIUA 3SQ4A 4B9TA 3AVAA 3ZT0A 3AO4A 2FBYA 4FJMA 3SNNA 1JLEA 4E19A 1WAFA 4OKEA 1NOZA 1RBUA 4DF8A 4YNQA 3PO4A 4Z4GA 1CXQA 4C8OA 4FK0A 3DLKA 4CIGA 3VQ5A 3NE6A 1HJRA 3C6TA 4KI6A 3JYTA 4M3RA 4DQIA 1RDBA 1CXUA 2Z1IA 3S3OA 4KHNA 4Z0UA 2IC3A 2QK9A 4AHUA 4CGJA 3O3HA 1NJXA 3LP2A 1QTMA 1Q9XA 3LALA 1SUQA 3KK3A 3K2PA 1DTQA 3K5LA 2IGIA 4KV8A 3AV9A 4RW9A 1Q9YA 2YKNA 4CHPA 1TK0A 1D8YA 4NYNA 2HHVA 1JL2A 1RNHA 1X9MA 1XWLA 4QAGA 4FW2A 4H8KA 2YHAA 1GOBA 4CEZA 4Q5VA 3V9WA 1KTQA 2X6SA 1NJZA 4FJNA 3BGRA 4EZ6A 4ICLA 2YNGA 1RT5A 2XY6A 3WNFA 4Z4FA 3CFPA 3OY9A 4DG1A 1EETA 4CEBA 4PQUA 3ALYA 2QXFA 1NJYA 4KAZA 4DSIA 4HCBA 3VQEA 2W42A 3MXIA 4NYFA 3PX0A 1S6PA 4FJJA 1MU2A 4OKJA 5SZTA 1S1VA 2D0BA 4IG0A 4FJLA 2IS3A 4CGIA 3OYBA 3ZSYA 1TL3A 3TANA 3DLGA 4W5RA 1L3TA 2X74A 4E1MA 4E7LA 3DRSA 1NKCA 1JLQA 3AA4A 4AHVA 4HUFA 4BDYA 4ZTFA 4CJUA 3KTQA 3OYJA 4I7FA 3SUQA 1RBRA 1WSGA 4BE0A 1TKXA 4E89A 3K59A 3O3FA 3S9HA 4RW7A 1RTJA 4J2AA 1U49A 1JXBA 3M8RA 4DTPA 3AO3A 4DFKA 2ZE2A 4CJEA 4CF9A 1JLFA 4E7HA 3QEXA 4JRQA 3AO1A 3QEPA 1XHZA 3QESA 3QIPA 2ETJA 4CIEA 4AH9A 2OPPA 4E7KA 4HTUA 3M8PA 4R5PA 2O4GA 3DLHA 1RILA 2PYLA 1B92A 2KW4A 3AVKA 5CZ1A 1JLAA 5HRPA 5J2QA 2D0CA 1NK0A 1SL2A 3HVTA 4B9VA 4F2RA 3LPTA 4CFDA 2DFEA 2RN2A 1ITGA 1UOCA 2OPQA 4LSLA 2G8WA 2R7YA 3LWLA 4DTMA 4DFPA 1TGOA 3D0PA 1J5OA 1LWFA 3LWMA 3CFOA 3RRGA 3IAYA 2QKBA 4CEDA 1XC9A 1DLOA 4LSNA 3PV8A 5T7BA 3RR7A 4Y1CA 1RT3A 5J1EA 1VSDA 2F96A 1N5YA 5KRTA 4PY5A 3LANA 5C42A 3VQCA 3VQBA 1TK8A 4IFVA 4DMNA 4FJXA 3AVGA 1S1WA 2X6NA 3DI6A 4LH5A 4PWDA 3E01A 3CFRA 4OPJA 2OZSA 3SQ0A 2G8KA 4FXDA 4L8RB 2Z1HA 3L3VA 1W0HA 3TI0A 1JLGA 2E6MA 3DYAA 1WSIA 3G0ZA 4DS5A 4FJGA 2GV9A 3OYCA 3DRRA 3DRPA 4CHYA 3KD5E 3LPUA 1TKZA 3SI6A 4DSFA 4KB0A 2HW3A 1LAVA 4RW4A 4OVLA 4CGGA 4CJRA 3TAFA
chains in the Genus database with same CATH superfamily
3FZHA 3BDPA 2A3ZA 3MWPA 4O55A 1LW0A 4GW6A 3TWHA 4JAXA 3L4QA 3SCXA 4W5NA 1C6VA 2O8EA 4FZZA 2I7NA 1HYVA 3HP6A 4IKFA 1TAQA 3CCEN 1Y97A 4FL9A 4HUGA 4LC9B 4CEQA 1NGGA 2G8VA 4KH6A 2HNYA 1WSJA 5GAGP 2G8FA 4Z4CA 3D2EB 4JKGB 1DGKN 2QI2A 4CZMA 3ZT4A 4F9OA 2OZMA 3UKUA 3J81O 3ZT1A 3DMJA 4CJ3A 5EY4A 4OPHA 4KHQA 3VA0A 3M8SA 1ZBFA 4M3UA 2KFZA 4JD2A 4ZHRA 4BDPA 5TKWA 2KKZA 1YTUA 1TVRA 2B6AA 3NH0A 3UIQA 3PX4A 4JN4A 4GV3A 4K0KK 4MDAA 3OYIA 3O5BA 1TUUA 3QEIA 4GKJK 4CZHA 4O5FA 1HMVA 5IT9O 3HP9A 4JKEA 3U3YA 1S9GA 1WNSA 4I9QA 3I8BA 3P4IA 4CD3A 1RTDA 2I5JA 1I39A 3MEEA 3HT3A 3L2VA 2XHBA 3RR8A 2VCPA 4DQRA 4CJKA 1IKWA 4DR3K 1KAZA 4CIFA 1XHXA 4C8MA 2O8DA 1YJWN 4JI8K 3ATVA 1V4SA 3VEYA 3OS1A 4CCHA 3O9UA 2E5LK 4N56A 3V1OA 3IRXA 5KGXA 1WN7A 4B1YB 3OW2M 4DLEA 4H5TA 3NF9A 4CEAA 4QOZB 5CYMA 2QWOA 4M63C 4FWNA 4CD1A 4E7IA 3THYA 3TARA 5C2FA 3LDNA 3SUPA 1JJ2M 1QSLA 2F9WA 2CGKA 2RPIA 5LMUK 3G6EN 3TTCA 2E2OA 3O3GA 1NJIO 3CD6N 3QIOA 2YHWA 2ZGYA 1O1WA 2YJFA 5M1OA 5TKYA 3M3ZA 1YVUA 3BZCA 3OJUA 4AHSA 4DTOA 4JRPA 2A42A 1EKEA 4BR5A 2YHBA 3D45A 3V9XA 5HRSA 4FLUA 2RKIA 4DR4K 3I56N 1IO2A 4JI6K 3MX5A 3KJVA 1WAJA 2Z1JA 3PY8A 4FJKA 3EKSA 3L2QA 3SZ2A 3RMBA 4A2BA 4B1ZA 3TSQA 1NM1A 3M8QA 2RHKA 3WEEB 3CXCM 1D4XA 1WSEA 3D2EA 4JKGA 1HKBA 3HVRA 4FYDA 3SQ1A 3K9KA 4A57A 2GUPA 2OPSA 4KH4A 4JS4A 3FGUA 2ITMA 1B9FA 1RT7A 1ZYQA 2BH1A 1ZC6A 4IDHA 2DFFA 1VQLN 5LY3A 3L4IA 3VQAA 3CQ8A 1ZBIA 3CCRN 4WQ5A 3WNEA 4CFCA 3CCJN 3J8AA 4FVMA 3AA5X 2D5RA 3VF4A 4DFJA 3EY1A 3LM2A 4BG9A 3HPHA 4C8NA 1J54A 1NLVA 2FC0A 2D0AA 1D9DA 1BU6O 3O4QA 4EAHD 1GLAG 3ENBA 3WXLA 4BREA 1JCFA 3KK1A 3V81A 4JKCA 3TAPA 4CEOA 1S5JA 1VSLA 3C6AA 4CEFA 1VSHA 4W5QA 3EN9A 4E3SA 4FM2A 1KAYA 2NNWA 1W97L 4CW7B 4FM1A 1VQ9N 1KAXA 3MAQA 1K73O 4B3MK 3VQ6A 3OVNA 1HNWK 1XI1A 4TSXA 1J6ZA 4FLXA 3QERA 2YKMA 3KLGA 4LFAK 1GOCA 2VG5A 4FLYA 3HL8A 4ID5A 1ESVA 3WQTA 3NCIA 1L3UA 1KQSM 1XMOK 3THWA 4M7XA 5AZJA 3GDQA 2HHTA 5MLCQ 1BI4B 1KLMA 2Q0UA 2LSNA 1KC8O 4B1UB 2UUBK 3VN5A 4M3TA 3CC7N 2HBMA 1Z25A 4FWQA 4JK8A 1RFQA 3VQ8A 2YNHA 4BR4A 4A62A 4W5OA 3L8BA 1FJGK 3CI5A 4MFBA 2OTLN 3UKRB 2OA8A 4HCCA 3AAPA 4IDKA 1S3XA 1TUYA 4FWKA 3CG7A 4NLBA 1GLFO 3P1GA 2YNFA 1NK9A 4CK1A 3FFKB 3QBWA 5JLHA 3MCPA 3CCSN 4CGFA 1KCFA 1U2VA 3QEVA 4BGAA 3O1BA 3H46O 4B9LA 5AQTA 2QWRA 4FVUA 3DM2A 3SLCA 2HHXA 1EO1A 4QS8A 3AGRA 4BRMA 5F0XA 3V1RA 3WEEA 2EHGA 3VEXA 1IKXA 3J7AP 2GUIA 2QWNA 3AVNA 3SYZA 3R6MA 5AQVA 3RRHA 3HSTB 4RG8A 4KHSA 2WOMA 1DT9A 3M5RA 5J2PA 1RBVA 3ZSZA 2Q3SA 4DFMA 2Q31A 3NVMA 4IFYA 5LJWA 1C0MA 1VSIA 4M3XA 1YT3A 4OX9K 3MEDA 2HVIA 3SQ4A 4YOUA 3HI0A 3ZT0A 2FBYA 3SNNA 4DF8A 1WAFA 5CR4A 3PO4A 3E9PA 4EHTA 1CXQA 4C8OA 4FK0A 3DLKA 3NE6A 1KD1O 4DQIA 4JI5K 3S3OA 3BZKA 1NJXA 3CERA 1Q9XA 4KV8A 2OTJN 1Y64A 4PL8A 2V52B 4CHPA 1ATRA 2HHVA 4QAGA 2YHAA 4V19S 4K42A 1KTQA 1OH7A 1M90O 2FF6A 3BUZB 2XY6A 5AQOA 1WOQA 4Z4FA 3CFPA 1X3NA 4CEBA 4DUYK 3ALYA 3OHRA 4DSIA 4HCBA 4DHYA 1S6PA 1T6CA 4OKJA 4FJLA 5GIOA 1GLJO 3VEOA 3TANA 4W5RA 4AHVA 4BR9A 4BDYA 3KTQA 2P9SA 5BN9A 4E89A 3K59A 4Y0WA 1JLFA 1QVGM 1O13A 2OPPA 4BRIA 4R5PA 3O9SA 4B1VA 2KW4A 3AVKA 3UKRA 1JLAA 1SL2A 3HVTA 1VQ6N 2DFEA 3R8EA 1ITGA 3A5LC 1GLBG 3LWLA 4H0PA 2R7YA 3LWMA 2QKBA 2FSKA 3RR7A 5C42A 5AQJA 1TK8A 1IV0A 1YITN 4JKAA 1Q81O 4PWDA 4AM6A 1YAGA 5AQGA 3SQ0A 2FXUA 4L8RB 2Z1HA 2E6MA 3CCMN 1YIJN 2UYTA 3G0ZA 3DAWA 3DRPA 2ZJRL 1TKZA 3R9PA 4DSFA 1LAVA 4RW4A 2UXBK 3LP3A 3G10A 3G25A 5AQXA 2JGUA 3HPGA 1ASWA 4KREA 3VGMA 4CESA 3CM5A 4CJLA 3U6FA 2Y1IA 4WFAL 3W3DA 4JLHA 1JCGA 4YORA 1Q82O 2O8EB 1NK8A 1RCHA 1LCUA 1SS6A 4CECA 2KQ2A 5LMNK 1S1TA 4DSLA 4DV3K 1T6DA 1S72N 1NKEA 4E7JA 3THXB 3TTDA 4OLAA 2BE2A 2QKKA 4Z4EA 3R1XA 1ILYA 4Z4IA 1X1PA 3B6OA 3KIOA 4IFEA 4ISGA 3E9OA 1Q18A 1SKWA 2QWLA 3HPOA 4CJWA 4YHHK 4F3TA 1EWQA 3NHGA 1Q8IA 2PBDA 4B9UA 3HRGA 4DV4K 2VQFK 3KVGA 1NGHA 3EYZA 3DOKA 2XY5A 1HKCA 2QM1A 3FFIA 1WB9A 3TAEA 3NGIA 4QS9A 4KHWA 1R59O 1NJWA 4KFBA 4MQ3A 5LL6Z 3VEVA 2UUCK 4YOYA 3SMPA 1JXEA 4DSKA 4CERA 4H0TB 1OH5A 1RT6A 2DTUA 4GNIA 3EZ5A 1IBMK 3WXKA 2GEMA 2P9KA 1GLDG 1NGDA 4LFCK 5KPTA 1VQKN 3SPZA 4K8XA 2DFHA 2WUSA 3L2WA 4OGCA 1N32K 4FXDA 2IIRA 4Q0BA 3P31A 5ELZA 1NGFA 3NGYA 5JLFA 3RWUA 5BN8A 1YHQN 5KRSA 4YOXA 4AHTA 3BP8A 2O8DB 3O9RA 2IVOA 1BQMA 1G99A 2AP1A 3MN5A 2HHHK 2ZD1A 4ELVA 3C6HA 5JICA 3J80O 5GADP 1B9DA 3HO1A 3TAGA 3C0BA 4DV5K 3THYB 2HF3A 1S6QA 5BRHA 3HOTA 1ASVA 2IVNA 2HNZA 3QO9A 1NK7A 4Z4HA 5C25A 4IBNA 4C8LA 3HYFA 1HNZK 4B9SA 1NMNA 1M1KO 5JS1A 4H0XB 2A1SA 4ISEA 3O9QA 1OH6A 4DLGA 4LF6K 3EE9A 4DQQA 1T03A 2P9PA 2UUAK 3CQYA 3WXIA 4CGDA 1L3SA 2ASPA 1QHAA 3HXMA 1E3MA 4E1NA 1LW2A 4BC3A 1XNRK 3L6QA 3S41A 3H08A 3GBTA 3I8DA 1QVFM 1RTIA 1XC3A 4H03B 1EP4A 2RF2A 1YI2N 4F8RA 1N8RO 3ZSQA 1KVBA 3THXA 1E4FT 3GL1A 3OYNA 2HSTA 3CMEN 4F3OA 3U9DA 5HRNA 1RDAA 1FK9A 3D7EO 4K41A 4BWJA 4ELTA 4FWOA 1U48A 1KVCA 4JNEA 4DUZK 4DSEA 1R0AA 1T44A 4N41A 3KKSA 3VQ4A 4CHOA 5GAEP 4FOEA 3VQDA 5DM6L 3CHWA 2UXDK 4CZFA 1NK4A 4KH5A 5FLXO 2Q2RA 3C65A 3K5OA 3PO5A 3LAMA 3AO2A 3BF1A 4PUOA 4I2QA 4KHYA 5GAHP 1ZXOA 3H6EA 3RSEA 3LZJA 4YOTA 2EWSA 4DTRA 5AJ3K 3OYHA 1HPMA 3N4PA 4B1XB 3IFRA 4CJVA 1VQNN 1U04A 4BACA 1XQSC 3FZLA 4HWIA 4MLEA 4CK3A 2B5JA 2JWLA 4CJ7A 3ZSRA 4DTNA 4FW1A 5DK5A 4ILGB 1K6YA 3KD1E 3ENOA 3ZSOA 2V51B 4NCAA 2Q0RA 1QZ6A 3O6WA 3BF3A 3OYMA 1YTAA 2VWBA 2QTDA 3ZCMA 3TABA 1EX4A 1RT4A 4H4OA 4RW6A 1SKSA 3T69A 3H3OB 4LD0A 3EL2A 2ATQA 2P51A 5M1FA 1HQEA 3SAFA 3F73A 4LFBK 3R3LA 1RDDA 1HNVA 3THWB 5AZJB 3U3GA 4RW8A 3SAHA 2G8HA 3DLEA 4BRPA 1RDWX 1QQNA 4PA1A 4O0IA 1CZAN 3ZX3A 4J2EA 3OBYA 2BTFA 2XO7A 3V9UA 1MWMA 3HZ6A 3VGLA 4BROA 5E41A 3CCVN 3SJJA 3VPZA 3KLFA 2EX3A 3QDKA 3LP1A 4KB1A 3MN9A 2UU9K 3NF7A 1HNXK 4LY7A 3KK2A 3LP0A 1U47A 3TPQA 1X9WA 3Q7CA 2IOCA 4WQ4A 5C12A 3C95A 4QCLA 2W6KA 4IG3A 2HHWA 3QFPA 1QSYA 1C0FA 2B4JA 1BCOA 5AQUA 2KFNA 1U2VB 4IZ9A 3OA9A 2XRIA 2A1RA 3DWLA 4CE9A 1F21A 4CJQA 1BGXT 2P1JA 2E88A 5F1XA 1RDCA 1QS4A 1J9AA 4BR0A 1N6QA 3LAKA 3VQPA 3VESA 2NRWA 1XMQK 3ZSVA 3CPWM 1SL1A 1N36K 3NH1A 4BVOA 4RCHA 3PIOL 5HL7L 4B8AB 2G8IA 1WSFA 3AY9A 1SL0A 2KTQA 3A5OC 3S3MA 4WQ5C 4FLTA 4DB3A 3WUHA 4JI3K 4JYAK 2O8FA 3OYLA 5C24A 2O8BB 4X65K 3O80A 4OKEA 1NOZA 1RBUA 4Z4GA 4JKDA 4IOXA 3VQ5A 4XH1A 3C6TA 3JYTA 3W0LA 4YY3K 4WFBL 2IC3A 1X3MA 4CGJA 1VQON 3LALA 4B3RK 3AV9A 1Q9YA 1GLLO 1RNHA 1VQ8N 3HOSA 4O8KA 1GOBA 2YHYA 2X6SA 4U67L 1NJZA 5AQLA 4CZEA 4EZ6A 3ID6A 1YJ9N 1RT5A 2ZJQL 1HLUA 4PQUA 4LF4K 2W40A 2P9IB 3F2KA 3M6GA 1QQOA 2HOEA 4FJJA 1BA0A 5SZTA 2D0BA 5AQQA 2IS3A 5FPMA 5F2RA 3ZSYA 4BR7A 3DLGA 1L3TA 2X74A 4BRQA 4BQLA 1JLQA 3AA4A 4CJUA 2WC9A 4JI7K 2VGNA 2P9SB 1RBRA 1WSGA 4J2AA 4RW7A 1JXBA 3M8RA 3AO3A 4E7HA 1ZBSA 4FWPA 4BQZA 3QEXA 3QEPA 3AO1A 3QESA 3QIPA 2O4GA 1IBKK 2D0CA 1NK0A 4IOAL 2D1KA 3LPTA 2OPQA 2G8WA 2OANA 3N4QA 4DTMA 4ILHA 3ZYYX 1BA1A 3CFOA 1EWRA 2W6LA 3AAQA 3PV8A 4EIAA 5AQHA 1N33K 3CJBA 3T1HK 2PFUA 5AQYA 3DI6A 4BRAA 3CFRA 3L3VA 2FSNA 4FJGA 4CHYA 5AZIB 2Q97A 3LPUA 3Q7BA 3SI6A 4KB0A 2HW3A 3AARA 1MA9B 4CBUA 3I0RA 3K5NA 1HNIA 1Z6RA 1Q7YO 3I33A 4JEPA 1S9EA 3AA2A 4DTSA 3GE1A 2XY7A 4DTJA 1G15A 3U9ZA 1EXQA 1HRHA 2J4RA 4JK9A 4O8UA 3EKUA 1REVA 3VQQA 4GY2B 4JI2K 4OKKA 2XY8A 1LWCA 3NBPA 3G4SN 2YHXA 5KPRA 3TSUA 5M1KA 4M41A 1SQKA 5I42A 2O8BA 2O8CB 3I0SA 3TAMA 2P9NA 4KI4A 2E20A 3EEQA 4E1JA 4BGBA 2ZWHA 4BC4A 4OO1J 4B3SK 1FKOA 1VSFA 3E9LA 4DU3A 1VSMA 1D9FA 3KHYA 4AF1A 1U4BA 3FR0A 5AQSA 3A5NC 1NOYA 1C1AA 4HVJA 4N76A 3SMSA 4KHUA 4IO9L 4FM0A 1X9JA 1FXXA 4F2SA 3LM9A 3O08A 3F5TA 1TKTA 4BRCA 4DV2K 2P9IA 5BRDA 2HMIA 4ISFA 4YDUA 1C0GA 4DWIA 2P9KB 3T7ZA 1NGJA 2QWMA 1TL1A 2HBKA 4R79A 4M3YA 2IDOA 3VMFB 1JL1A 2VWKA 3NF6A 1LAWA 4KTQA 1CZBA 4K8ZA 2HNDA 4CJSA 3VQ7A 4M3ZA 3H45C 2GWJA 4H5NA 3FZKA 5BPNA 1U45A 3O4WA 4I6MA 4H4MA 3WQUA 3VA3A 5JVHL 4CI6A 2E4LA 1HQUA 2VYPA 4CJTA 1GOAA 2GX9A 4FPAA 3QEWA 4FJ7A 1X9SA 4QS7A 4FZXC 3NMUA 3AVBA 4BRKA 1KLNA 4B3OA 4H0OA 3KLEA 1ATSA 5DM7L 2GTDA 4A2AA 4B8CA 2KHOA 4B1WB 4BC2A 4GV6A 4GKKK 3AVHA 3QFUA 1ZBHA 4BWMA 4UQGA 2QEXN 3RMDA 1W9HA 5AQIA 1S1UA 3K9JA 3OYFA 3T3FA 5AQRA 3B8AX 5AZIA 4CJPA 3ZETB 3JSMA 5HLFA 1BUPA 2KZZA 3V4IA 4CFAA 1OH8A 2P9PB 1YJNN 3RMAA 4IO8A 3L3UA 4M3WA 3A2FA 3G71N 4JS5A 3OYGA 1QHTA 2A5XA 3HM8A 1HX1A 3MK6A 1ZBLA 4M42A 1KVAA 1JKHA 4IEIA 1C0UA 3NDKA 2PAVA 4GMJB 2P5GA 3NGZA 3FE1A 3EO3A 3P38A 1TK5A 3TSPA 3HJFA 4CHNA 5K14A 4GVEA 5KQDA 2AA4A 2YV0X 1KSPA 3OYAA 1KRPA 2WONA 4BE2A 1UA0A 2O8CA 1DKGD 1ATNA 4PKGA 3QETA 2ASMA 1HKGA 4X64K 3VF6A 4DTUA 4CZKA 4AILC 1QE1A 5CYQA 4XH4A 1NGIA 4FLVA 5FRMA 3THVA 1IKVA 3IG1A 3LDLA 3MDQA 2PZSA 2OCEA 4FJ5A 3V9ZA 4HHTA 4FWSA 3RSEB 3HM9A 4DS4A 4J2DA 4LF8K 3O1WA 4O44A 3NVKA 2JLEA 4XEIA 3SUNA 1IKYA 3CC4N 3OYEA 3DXKB 1HPZA 1E4GT 2WBNA 3L0QA 4DR6K 2Y1JA 3MN6A 2P5OA 4BG8A 4Z94A 1WLJA 1TYQB 2ASOA 3TR8A 4EP5A 3DLLL 2YI1A 4DU1A 4J8FA 2D4WA 4BRGA 3V1QA 3A8YA 1QQMA 1NK6A 1HYZA 5E26A 5BPLA 4FWRA 5BR9A 2CGLA 5EX5A 4AHRA 4U7BA 4FCYA 1K8KA 2CH5A 1Z05A 4CBXA 4CGHA 2HB5A 5LJVA 5J2NA 3NAEA 2IAJA 3ZEUA 5AQKA 4DV0K 4K43A 2E1YA 4I9LA 1I94K 1S1XA 4JKHA 4CF2A 3MCAB 3O9TA 4IEEA 3SPYA 3OYKA 4DSJA 2QXLA 1BISA 2P9UB 3SBTA 3H1VX 2BUPA 3AGKA 2F8TA 1U6ZA 5AQMA 3AA3A 5KGWA 4JHDA 1RGIA 5EXWA 3ZETA 4KBOA 3CCUN 3LDQA 3D2FB 3ITHA 1JLBA 4DR5K 1SKRA 1QSSA 3CCLN 4FJIA 1TKDA 1UA1A 3ZT3A 3MXJA 4IJNA 2O4IA 2Q1NA 3TAQA 4NCGA 3KZBA 4BDZA 2P9LA 3MMVA 4KPYA 3VGKA 4KHPK 5FRNA 3PUFA 1UAXA 4EP4A 1YVNA 4LH4A 5C10A 4CZJA 4JI1K 4J2BA 4O0JA 3IUCA 1KFSA 1NGAA 2WFBA 5FPEA 5I3UA 3CM6A 4WCEL 3VETA 3H3NO 5I9EB 4W5TA 4AM7A 4DQ8A 2VWJA 2HHSA 2Q36A 1DEJA 4ZTJA 3ZSXA 4CEEA 3J7YP 2VG7A 2E8AA 1BWFO 4G9ZA 2BANA 1D5AA 3EZWA 3TU5A 4IXCA 2VG6A 4JKFA 2E1ZA 2CH6A 2X78A 4KO0A 1QZ5A 1HJOA 4I2PA 2O8FB 2AJQA 3QNNA 4B9TA 3AVAA 3AO4A 4E19A 3WT0A 4H0YB 4KI6A 2YJEA 1CXUA 3K0SA 4Z0UA 3O3HA 3DXKA 3HBTA 1SUQA 3KK3A 2IGIA 3ZX0A 4DR2K 1XUPO 3SAGA 2YKNA 3BEXA 1D8YA 3CJ9A 3VEWA 1JL2A 1TYQA 3ZX2A 4PKIA 1X9MA 1XWLA 4NO7A 3O8MA 4A61A 4H8KA 4Q5VA 4CEZA 3V9WA 3CETA 1JCEA 2YNGA 3WNFA 3U4LA 3UB5A 4KAZA 4MLHA 4C23A 4WYBA 3MXIA 3T1YK 1XNQK 4X66K 3PX0A 1K9MO 1P90A 1MU2A 4CZIA 3IMXA 1VQ7N 4IG0A 3CPEA 5BPMA 1TL3A 5JMVA 1NGCA 2QW9A 3DRSA 1NKCA 4HUFA 4IWVA 1V4TA 3CQXA 4ZTFA 3FLCO 1GLCG 3MX2A 1TKXA 4NB4A 4BE0A 3O3FA 3S9HA 4DTPA 4DFKA 1XHZA 2E2QA 2ETJA 4AH9A 4E7KA 4HTUA 3M8PA 1SAZA 4FPBA 5M1QA 2P9UA 3C7NB 1W7AA 3DLHA 1RILA 1KXPA 5C2DA 1CLQA 5CZ1A 5HRPA 5J2QA 4DV7K 4A5AA 4F2RA 4LSLA 1UOCA 1OVYA 3D2FA 4DFPA 4WQ4C 3D0PA 3LDOA 3RRGA 3IAYA 4CEDA 3LDPA 3PSIA 4JI4K 2ZGZA 1XC9A 1DLOA 5IWAK 3H1QA 5J1EA 1VSDA 1N5YA 3CIPA 5KRTA 3VQBA 2D0PA 4DMNA 3BY5A 4LH5A 3OTOK 4CZGA 2OZSA 2G8KA 4RTFD 4BRDA 1J5EK 3TI0A 3DYAA 4H5WA 2FF3B 3M1FA 2GV9A 3OYCA 3KD5E 1NGEA 4DKWA 2H3GX 4BY9C 4WFNL 3PLAA 1WBBA 4CJRA 1K8AO 2YX6A 3MXMA 4PL7A 4CK2A 1VRUA 4C8KA 2NRTA 4F4KA 4FJ8A 3CJCA 1FKPA 1VK0A 1J53A 5E84A 4ILJA 1H1VA 2YCHA 4DU4A 4G1QA 1YUWA 5AQPA 5ADXH 3JXUA 4WE1A 5ADXA 1VQ5N 4JK7A 4OLBA 1T7PA 1NNEA 1TV6A 3VTHA 3SK3A 3UE5A 2HVHA 3WNHA 4O5BA 3C94A 3IKMA 4FK4A 1RT1A 5EVZA 1RT2A 3AVCA 4KKOA 1JLCA 4XH5A 3SQ2A 5BR8K 4FLZA 5HP1A 4FJHA 5C0YA 2P9NB 5FROA 3CC2N 4L3QA 4H5RA 3RMCA 3JAMO 4CJ4A 4IOCL 3SV3A 2FBVA 1BQNA 5M1NA 3IDHA 1IBLK 3D6RA 3MWTA 5KI6A 4MDBA 1RBTA 2NLXA 1IH7A 1VSJA 3T19A 3AVIA 4OPKA 1NK5A 1S22A 3CCQN 3RTVA 1C1CA 3MECA 3AVJA 3JS6A 4N47A 5AQFA 4CZLA 1RTHA 2A6AA 2CGJA 2BGGA 5BRFA 3GOIA 3CYMA 1A5WA 1DTTA 4KTWA 3ASMA 1ASUA 5M1PA 2OYQA 4JV5K 4LF9K 3MEGA 4BRFA 1OKJA 4H0VB 3OYDA 3AVLA 5HROA 3VENA 3K57A 3ULDA 4KRFA 1A5XA 4I6MB 4EHUA 4CVNE 5HRRA 1CZ9A 1A5VA 1T3VA 3C7NA 4H5VA 4DV1K 2HHUA 1VAZA 2UXCK 1NWKA 3DJCA 1C0TA 2ITGA 1SV5A 3P5JA 1QQCA 2GBZA 5EU7A 3P83D 2NRZA 4A5BA 3FZFA 4NLCA 3NFAA 2Z1GA 4LF7K 3OS2A 4HTLA 5GINA 4Y1DA 1T8EA 4FOIA 1BCMA 1NU0A 1Q86O 3KKRA 4B08A 3HTVA 1MDUB 1TAUA 1NKBA 4CJFA 4JI0K 3F9KA 4OGEA 4DQSA 4JKBA 3DXMB 4AQYK 3VERA 1C1BA 3DLBA 1BG3A 4KTZA 3WNGA 4OJRA 5CZ2A 5AFUH 1I3AA 5AFUA 2HMPA 1L3VA 2BDPA 3VOVA 2HBJA 4A59A 3QINA 3QBXA 4YOWA 4HUEA 2HBLA 1N34K 5JS2A 2FBTA 4CJ5A 3OS0A 1NMDA 4GV9A 2FSJA 1HR0K 4X62K 4B9NA 4DF4A 4NCBA 3A5MC 5HBMA 4EFHA 1VSEA 5B8HA 1FW6A 3CF5L 3ISNC 4PKHA 4BRNA 3ZSWA 3LL3A 5JVGL 4BC5A 4B9MA 4DCHA 3MN7A 4AHCA 4CBWA 3NF8A 1WSHA 1VSKA 3VQ9A 3AO5A 4FO0A 3LZIA 3T1AA 3SV4A 3L2UA 4YFUA 5CE3A 1LWEA 1WUAA 3LDSA 1VHXA 5EOYA 3QLHA 2V7YA 4NXMK 2D0OA 2V7ZA 5H1SQ 5FDLA 4FJ9A 3KK7A 4EZ9A 4UY8O 1P8ZA 1BL3A 3S3NA 3CMAN 4DQPA 2HHQA 1HYSA 2FBXA 3K58A 4BR2A 2A40A 4MO4A 2KZMA 1VRTA 4YDUC 3E1YA 3I55N 1WBDA 3VTIA 1L5UA 4CHQA 4MO5A 2E6LA 3KLHA 4FWMA 2A41A 4FLWA 5C15A 2OPRA 4PHTX 2ZJPL 3QNOA 2DPNA 4BE1A 2GWKA 5FPNA 2NRRA 2NRVA 3DLRA 3L2RA 2QWPA 4CF1A 2ZM6K 5J2MA 2DY4A 2IVPA 3AVMA 3O4NA 4NXNK 2F4VK 4DR7K 3V9SA 5SWMA 2KLAA 5FPDA 2PYJA 4LF5K 1LV5A 4FK2A 3ENHA 1BIZA 3TTFA 1K8KB 5AQNA 2NUBA 3V6DA 1Z26A 2ZQBA 4FWLA 4CHZA 2I7PA 3ZEUB 1RBSA 2GELA 4ID1A 4CF0A 1BI4A 4XIUA 3ZT2A 4DV6K 4FSVA 1BO5O 2NRHA 4M45A 4O4GA 4N5SA 1NGBA 3WXJA 2ZF5O 3VF2A 4DTXA 4BVPA 3U8XA 1NBWA 2QA4N 1VQ4N 3DXMA 5DMRA 4CF8A 3SUOA 3DOLA 1GLEG 4JHDB 4CFBA 2FLOA 5CY4A 1YXQA 4WF9L 3AVFA 3QMLA 5KTQA 1IG9A 3F9MA 2VGMA 3KLIA 5AQZA 2G8UA 3HK2A 2QWQA 2YNIA 1SZ2A 2P9LB 1LOTB 3ULEB 4GVMA 5D3GA 2WTUA 4B9QA 4ELUA 3J7ZO 4E0DA 4C1NK 1T05A 1UWBA 3IS9A 4M7YA 4K25A 3PSFA 3NH2A 1HUXA 1VQPN 3PX6A 1IG8A 3KWGA 2PY5A 3ATUA 3C6UA 5KQ8A 2F8SA 4FZYA 3B6PA 1ZBUA 3GG4A 3OJSA 3ZLJA 1BHLA 1BDGA 1KFDA 3CJAA 3KWIA 3K5MA 3SJHA 3VEZA 4DR1K 1BIUA 4BRLA 4FJMA 1JLEA 3ID8A 5A2QO 3UKUB 3RVCA 4YNQA 3P39A 2E2PA 3QB0A 4CIGA 1HJRA 4OPAA 4M3RA 4KHNA 1RDBA 2Z1IA 2QK9A 4AHUA 3LP2A 1QTMA 5BREA 2E2NA 3K2PA 1DTQA 3K5LA 5HOOA 4IJAA 4RW9A 4JD2B 1TK0A 4NYNA 5KPZA 4FW2A 2VQEK 4FJNA 3BGRA 3CJ1A 4ICLA 1EQYA 3OY9A 4DG1A 1EETA 1NJYA 2QXFA 5CHIA 3VQEA 3A0IX 3WXMB 2W42A 2NZTA 4NYFA 3CJ7A 2F9TA 3OBWA 1S1VA 2F7TA 4CGIA 3OYBA 4E1MA 3SBGA 4E7LA 3QICA 1BOTO 2HF4A 3FZMA 3HSCA 3OYJA 1OVQA 4I7FA 1NG9A 3SUQA 1RTJA 4B3TK 1U49A 2ZE2A 4CJEA 4CF9A 4JRQA 3EE8A 4CIEA 2RE2A 4YOVA 1MWKA 2JWKA 2PYLA 4RWTA 1B92A 4BRHA 4B9VA 4CFDA 2RN2A 1J5OA 1TGOA 2W41A 1LWFA 1W2BM 4LSNA 5T7BA 1VQMN 4Y1CA 1RT3A 2F96A 1YF5L 4PY5A 3LANA 3VQCA 4IFVA 4FJXA 3AVGA 1S1WA 2X6NA 5AR0A 3ULEA 3E01A 2NRXA 4OPJA 5GIPA 1W0HA 3PIPL 1JLGA 5AQWA 1WSIA 1RDUA 4DS5A 3DRRA 1IJJA 4C1NI 3E66A 4OVLA 4CGGA 3TAFA
chains in the Genus database with same CATH topology
3MXMA 3BDPA 3I0RA 3LP3A 3G10A 3K5NA 2JGUA 3HPGA 1HNIA 4O55A 4CK2A 1LW0A 4GW6A 1VRUA 3TWHA 4C8KA 1ASWA 4KREA 3SCXA 4F4KA 4CESA 3CM5A 4FJ8A 4CJLA 3U6FA 4W5NA 2Y1IA 1C6VA 1S9EA 3AA2A 1FKPA 4JLHA 4FZZA 4DTSA 1VK0A 1J53A 2XY7A 1HYVA 3HP6A 4DU4A 4IKFA 4G1QA 4DTJA 4WE1A 1TAQA 1G15A 1NK8A 1RCHA 1EXQA 1HRHA 4OLBA 1T7PA 1Y97A 4CECA 2KQ2A 4HUGA 1REVA 3VQQA 1TV6A 4OKKA 2HVHA 1S1TA 2XY8A 3WNHA 4O5BA 1LWCA 4DSLA 3C94A 3NBPA 4CEQA 4FK4A 1RT1A 1NKEA 2G8VA 1RT2A 4E7JA 2HNYA 1WSJA 3AVCA 2G8FA 4Z4CA 4M41A 4OLAA 5I42A 2BE2A 4KKOA 2QKKA 1JLCA 4Z4EA 3SQ2A 4FLZA 3I0SA 3TAMA 5HP1A 4FJHA 4Z4IA 1X1PA 3B6OA 5FROA 3KIOA 3ZT4A 3RMCA 2OZMA 4FJIA 4KI4A 1SKWA 3HPOA 3ZT1A 4CJWA 4CJ4A 4F3TA 3NHGA 1Q8IA 3SV3A 2FBVA 4B9UA 3DMJA 1BQNA 4CJ3A 3EYZA 5KI6A 3DOKA 1FKOA 1VSFA 1RBTA 2XY5A 4KHQA 4DU3A 3VA0A 1VSMA 3M8SA 1ZBFA 1IH7A 3FFIA 1D9FA 1VSJA 1U4BA 4M3UA 3T19A 3AVIA 2KFZA 3TAEA 4OPKA 3NGIA 4ZHRA 1NK5A 4BDPA 4KTQA 1NOYA 1C1AA 1YTUA 1TVRA 2B6AA 3NH0A 4KHWA 4HVJA 4N76A 1NJWA 4KFBA 4MQ3A 3UIQA 3RTVA 4KHUA 1C1CA 4FM0A 3PX4A 3OYIA 3MECA 3AVJA 1FXXA 1JXEA 4N47A 4DSKA 4F2SA 3QEIA 4CERA 1TKTA 1RT6A 1HMVA 1RTHA 2BGGA 3HP9A 2DTUA 2HMIA 3EZ5A 3CYMA 3U3YA 1S9GA 1A5WA 1WNSA 4DWIA 4I9QA 1DTTA 4KTWA 3ASMA 1ASUA 2OYQA 3SPZA 4K8XA 1TL1A 2DFHA 3L2WA 4M3YA 2IDOA 1RTDA 4OGCA 2I5JA 1JL1A 2VWKA 3MEGA 1I39A 1LAWA 3MEEA 3NF6A 3HT3A 1CZBA 3L2VA 2HNDA 4CJSA 3VQ7A 2XHBA 3OYDA 3AVLA 5HROA 3RR8A 4K8ZA 4Q0BA 4DQRA 3NGYA 1U45A 4CJKA 1IKWA 3RWUA 3K57A 3ULDA 4KRFA 4H4MA 1A5XA 4CIFA 1XHXA 5KRSA 4C8MA 3VA3A 4AHTA 2E4LA 5HRRA 3OS1A 1CZ9A 4CCHA 1A5VA 1BQMA 2HHUA 1HQUA 4CJTA 1GOAA 4N56A 3V1OA 2ZD1A 3QEWA 3IRXA 4ELVA 5KGXA 1C0TA 1WN7A 2ITGA 4DLEA 1SV5A 3P5JA 1QQCA 2GBZA 4FJ7A 3NF9A 4CEAA 5EU7A 3P83D 5CYMA 1X9SA 4QOZB 1B9DA 3HO1A 3TAGA 4FZXC 4E7IA 3AVBA 3NFAA 3TARA 1KLNA 3KLEA 4B3OA 2Z1GA 1S6QA 4B8CA 3OS2A 3SUPA 1ASVA 1QSLA 4Y1DA 2HNZA 3QO9A 1NK7A 1T8EA 4Z4HA 3AVHA 5C25A 4IBNA 2RPIA 1BCMA 1ZBHA 3KKRA 4BWMA 4UQGA 4B08A 4C8LA 3O3GA 3RMDA 1W9HA 3HYFA 1NKBA 4CJFA 1TAUA 1S1UA 3F9KA 4OGEA 4DQSA 4B9SA 5JS1A 3OYFA 3T3FA 3DLBA 1C1BA 3QIOA 2A1SA 3JSMA 4CJPA 1O1WA 4KTZA 3WNGA 4OJRA 5HLFA 5CZ2A 4DLGA 1I3AA 1YVUA 1CLQA 2KZZA 3OJUA 4DQQA 4AHSA 1QSSA 4DTOA 1T03A 1L3VA 4JRPA 3V4IA 4CFAA 2BDPA 1EKEA 3QINA 3RMAA 2YHBA 3D45A 3L3UA 4HUEA 4CGDA 3A2FA 3V9XA 4JS5A 1L3SA 3OYGA 5HRSA 1QHTA 4FLUA 4M3WA 5JS2A 3HXMA 2FBTA 2RKIA 4CJ5A 3OS0A 1ZBLA 4M42A 1KVAA 4E1NA 1IO2A 1JKHA 1C0UA 1LW2A 3NDKA 4B9NA 4DF4A 3KJVA 4GMJB 2P5GA 4NCBA 3NGZA 1WAJA 2Z1JA 3H08A 3I8DA 5HBMA 3PY8A 1RTIA 4FJKA 1TK5A 3L2QA 3SZ2A 1VSEA 3RMBA 3HJFA 1EP4A 2RF2A 4F8RA 3ISNC 4CHNA 5K14A 3ZSQA 3M8QA 3ZSWA 1KVBA 2YV0X 4B9MA 3OYNA 1KSPA 3OYAA 1WSEA 1KRPA 2WONA 4F3OA 4BE2A 5HRNA 1RDAA 1UA0A 4FYDA 3HVRA 4AHCA 3SQ1A 1FK9A 3QETA 3NF8A 4BWJA 1WSHA 2OPSA 4JS4A 1U48A 4ELTA 1KVCA 1VSKA 3VQ9A 3AO5A 1B9FA 1RT7A 3LZIA 1ZYQA 3T1AA 3SV4A 3L2UA 4YFUA 4DSEA 1R0AA 4N41A 3KKSA 3VQ4A 2DFFA 4CHOA 4DTUA 3VQAA 3CQ8A 1LWEA 1ZBIA 3LDSA 3VQDA 4AILC 3QLHA 1QE1A 3WNEA 5CYQA 4CFCA 1NK4A 4FJ9A 5FDLA 4FLVA 5FRMA 4FVMA 3THVA 1IKVA 3AA5X 2D5RA 4EZ9A 3IG1A 2PZSA 3K5OA 4DFJA 3PO5A 3LAMA 4FJ5A 3AO2A 3EY1A 4PUOA 1BL3A 4I2QA 3V9ZA 3S3NA 4HHTA 4KHYA 4DQPA 3HPHA 4C8NA 2HHQA 4DS4A 3HM9A 1J54A 2FBXA 3LZJA 3K58A 4J2DA 1HYSA 4DTRA 4O44A 1VRTA 2FC0A 2JLEA 2KZMA 2D0AA 1D9DA 3OYHA 3O4QA 3SUNA 1IKYA 4CJVA 3KK1A 1L5UA 4CHQA 3V81A 1U04A 4BACA 2E6LA 4CK3A 3OYEA 3KLHA 3TAPA 4CEOA 1S5JA 1HPZA 1VSLA 2B5JA 4FLWA 2OPRA 3ZSRA 2Y1JA 4CEFA 4DTNA 4FW1A 5DK5A 3QNOA 2P5OA 4BE1A 1VSHA 1K6YA 4W5QA 4E3SA 1WLJA 4FM2A 3KD1E 3TR8A 3DLRA 4EP5A 3L2RA 3ZSOA 4CF1A 4FM1A 4DU1A 3MAQA 5J2MA 2DY4A 3AVMA 3O4NA 4NCAA 3VQ6A 3OVNA 3V9SA 5SWMA 3V1QA 1NK6A 1HYZA 4TSXA 3OYMA 1XI1A 1YTAA 2PYJA 1LV5A 4AHRA 4FK2A 3ZCMA 1BIZA 4FCYA 3TABA 1EX4A 1RT4A 4H4OA 4RW6A 4FLXA 2YKMA 3QERA 1SKSA 4CGHA 3KLGA 1GOCA 2HB5A 2NUBA 2VG5A 4LD0A 1Z26A 2ZQBA 3HL8A 4ID5A 4FLYA 5J2NA 3NAEA 2ATQA 2IAJA 2P51A 4CHZA 1HQEA 3NCIA 3F73A 1L3UA 1RBSA 4ID1A 1RDDA 4CF0A 2HHTA 1HNVA 4I9LA 1BI4A 4XIUA 3ZT2A 3U3GA 1BI4B 4RW8A 1KLMA 1S1XA 2LSNA 2G8HA 3DLEA 4CF2A 4M45A 4O4GA 3SPYA 4N5SA 4PA1A 3VN5A 4O0IA 3OYKA 4DSJA 4DTXA 4J2EA 4M3TA 1Z25A 3VQ8A 1BISA 2YNHA 2XO7A 5E41A 3V9UA 4W5OA 3SJJA 3KLFA 3L8BA 2EX3A 4MFBA 3LP1A 4KB1A 5DMRA 4CF8A 2OA8A 4HCCA 2F8TA 3SUOA 3DOLA 3NF7A 4IDKA 3AA3A 5KGWA 1SKRA 3ITHA 1JLBA 3CG7A 3LP0A 4LY7A 4CFBA 3KK2A 5CY4A 3P1GA 2YNFA 1U47A 1TKDA 1UA1A 1NK9A 3AVFA 4CK1A 1X9WA 5KTQA 2IOCA 3C95A 1IG9A 4QCLA 4IG3A 3ZT3A 4CGFA 4M3ZA 1KCFA 3MXJA 2HHWA 3KLIA 2G8UA 1QSYA 2O4IA 3HK2A 2B4JA 3TAQA 4NCGA 2YNIA 4BDZA 1BCOA 3QEVA 4KPYA 2KFNA 4B9LA 5FRNA 2XRIA 3PUFA 1UAXA 4GVMA 5D3GA 4EP4A 2A1RA 4LH4A 3DM2A 4CE9A 4ELUA 2HHXA 1F21A 4CJQA 1BGXT 4J2BA 2P1JA 4O0JA 4E0DA 1RDCA 1QS4A 1KFSA 5I3UA 3CM6A 3V1RA 1T05A 1UWBA 3IS9A 1J9AA 1N6QA 4W5TA 2EHGA 2VWJA 1IKXA 2HHSA 2GUIA 3LAKA 3AVNA 3NH2A 3VQPA 3SYZA 3RRHA 3ZSVA 3PX6A 4ZTJA 3HSTB 4RG8A 1SL1A 3NH1A 3ZSXA 4CEEA 4B8AB 2G8IA 2PY5A 1WSFA 4KHSA 2WOMA 2VG7A 3C6UA 5J2PA 1RBVA 1SL0A 2F8SA 2BANA 2KTQA 3ZSZA 4FZYA 2Q3SA 3B6PA 1ZBUA 4DFMA 3S3MA 1D5AA 3OJSA 4IFYA 4FLTA 2VG6A 1BHLA 1C0MA 1KFDA 3V6DA 2X78A 3K5MA 4KO0A 1VSIA 4M3XA 3OYLA 1YT3A 4I2PA 5C24A 2AJQA 3QNNA 3MEDA 2HVIA 1BIUA 3SQ4A 4B9TA 3AVAA 3ZT0A 3AO4A 2FBYA 4FJMA 3SNNA 1JLEA 4E19A 1WAFA 4OKEA 1NOZA 1RBUA 4DF8A 4YNQA 3PO4A 4Z4GA 1CXQA 4C8OA 4FK0A 3DLKA 4CIGA 3VQ5A 3NE6A 1HJRA 3C6TA 4KI6A 3JYTA 4M3RA 4DQIA 1RDBA 1CXUA 2Z1IA 3S3OA 4KHNA 4Z0UA 2IC3A 2QK9A 4AHUA 4CGJA 3O3HA 1NJXA 3LP2A 1QTMA 1Q9XA 3LALA 1SUQA 3KK3A 3K2PA 1DTQA 3K5LA 2IGIA 4KV8A 3AV9A 4RW9A 1Q9YA 2YKNA 4CHPA 1TK0A 1D8YA 4NYNA 2HHVA 1JL2A 1RNHA 1X9MA 1XWLA 4QAGA 4FW2A 4H8KA 2YHAA 1GOBA 4CEZA 4Q5VA 3V9WA 1KTQA 2X6SA 1NJZA 4FJNA 3BGRA 4EZ6A 4ICLA 2YNGA 1RT5A 2XY6A 3WNFA 4Z4FA 3CFPA 3OY9A 4DG1A 1EETA 4CEBA 4PQUA 3ALYA 2QXFA 1NJYA 4KAZA 4DSIA 4HCBA 3VQEA 2W42A 3MXIA 4NYFA 3PX0A 1S6PA 4FJJA 1MU2A 4OKJA 5SZTA 1S1VA 2D0BA 4IG0A 4FJLA 2IS3A 4CGIA 3OYBA 3ZSYA 1TL3A 3TANA 3DLGA 4W5RA 1L3TA 2X74A 4E1MA 4E7LA 3DRSA 1NKCA 1JLQA 3AA4A 4AHVA 4HUFA 4BDYA 4ZTFA 4CJUA 3KTQA 3OYJA 4I7FA 3SUQA 1RBRA 1WSGA 4BE0A 1TKXA 4E89A 3K59A 3O3FA 3S9HA 4RW7A 1RTJA 4J2AA 1U49A 1JXBA 3M8RA 4DTPA 3AO3A 4DFKA 2ZE2A 4CJEA 4CF9A 1JLFA 4E7HA 3QEXA 4JRQA 3AO1A 3QEPA 1XHZA 3QESA 3QIPA 2ETJA 4CIEA 4AH9A 2OPPA 4E7KA 4HTUA 3M8PA 4R5PA 2O4GA 3DLHA 1RILA 2PYLA 1B92A 2KW4A 3AVKA 5CZ1A 1JLAA 5HRPA 5J2QA 2D0CA 1NK0A 1SL2A 3HVTA 4B9VA 4F2RA 3LPTA 4CFDA 2DFEA 2RN2A 1ITGA 1UOCA 2OPQA 4LSLA 2G8WA 2R7YA 3LWLA 4DTMA 4DFPA 1TGOA 3D0PA 1J5OA 1LWFA 3LWMA 3CFOA 3RRGA 3IAYA 2QKBA 4CEDA 1XC9A 1DLOA 4LSNA 3PV8A 5T7BA 3RR7A 4Y1CA 1RT3A 5J1EA 1VSDA 2F96A 1N5YA 5KRTA 4PY5A 3LANA 5C42A 3VQCA 3VQBA 1TK8A 4IFVA 4DMNA 4FJXA 3AVGA 1S1WA 2X6NA 3DI6A 4LH5A 4PWDA 3E01A 3CFRA 4OPJA 2OZSA 3SQ0A 2G8KA 4FXDA 4L8RB 2Z1HA 3L3VA 1W0HA 3TI0A 1JLGA 2E6MA 3DYAA 1WSIA 3G0ZA 4DS5A 4FJGA 2GV9A 3OYCA 3DRRA 3DRPA 4CHYA 3KD5E 3LPUA 1TKZA 3SI6A 4DSFA 4KB0A 2HW3A 1LAVA 4RW4A 4OVLA 4CGGA 4CJRA 3TAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MXM A;  3BDP A;  3I0R A;  3LP3 A;  3G10 A;  3K5N A;  2JGU A;  3HPG A;  1HNI A;  4O55 A;  4CK2 A;  1LW0 A;  4GW6 A;  1VRU A;  3TWH A;  4C8K A;  1ASW A;  4KRE A;  3SCX A;  4F4K A;  4CES A;  3CM5 A;  4FJ8 A;  4CJL A;  3U6F A;  4W5N A;  2Y1I A;  1C6V A;  1S9E A;  3AA2 A;  1FKP A;  4JLH A;  4FZZ A;  4DTS A;  1VK0 A;  1J53 A;  2XY7 A;  1HYV A;  3HP6 A;  4DU4 A;  4IKF A;  4G1Q A;  4DTJ A;  4WE1 A;  1TAQ A;  1G15 A;  1NK8 A;  1RCH A;  1EXQ A;  1HRH A;  4OLB A;  1T7P A;  1Y97 A;  4CEC A;  2KQ2 A;  4HUG A;  1REV A;  3VQQ A;  1TV6 A;  4OKK A;  2HVH A;  1S1T A;  2XY8 A;  3WNH A;  4O5B A;  1LWC A;  4DSL A;  3C94 A;  3NBP A;  4CEQ A;  4FK4 A;  1RT1 A;  1NKE A;  2G8V A;  1RT2 A;  4E7J A;  2HNY A;  1WSJ A;  3AVC A;  2G8F A;  4Z4C A;  4M41 A;  4OLA A;  5I42 A;  2BE2 A;  4KKO A;  2QKK A;  1JLC A;  4Z4E A;  3SQ2 A;  4FLZ A;  3I0S A;  3TAM A;  5HP1 A;  4FJH A;  4Z4I A;  1X1P A;  3B6O A;  5FRO A;  3KIO A;  3ZT4 A;  3RMC A;  2OZM A;  4FJI A;  4KI4 A;  1SKW A;  3HPO A;  3ZT1 A;  4CJW A;  4CJ4 A;  4F3T A;  3NHG A;  1Q8I A;  3SV3 A;  2FBV A;  4B9U A;  3DMJ A;  1BQN A;  4CJ3 A;  3EYZ A;  5KI6 A;  3DOK A;  1FKO A;  1VSF A;  1RBT A;  2XY5 A;  4KHQ A;  4DU3 A;  3VA0 A;  1VSM A;  3M8S A;  1ZBF A;  1IH7 A;  3FFI A;  1D9F A;  1VSJ A;  1U4B A;  4M3U A;  3T19 A;  3AVI A;  2KFZ A;  3TAE A;  4OPK A;  3NGI A;  4ZHR A;  1NK5 A;  4BDP A;  4KTQ A;  1NOY A;  1C1A A;  1YTU A;  1TVR A;  2B6A A;  3NH0 A;  4KHW A;  4HVJ A;  4N76 A;  1NJW A;  4KFB A;  4MQ3 A;  3UIQ A;  3RTV A;  4KHU A;  1C1C A;  4FM0 A;  3PX4 A;  3OYI A;  3MEC A;  3AVJ A;  1FXX A;  1JXE A;  4N47 A;  4DSK A;  4F2S A;  3QEI A;  4CER A;  1TKT A;  1RT6 A;  1HMV A;  1RTH A;  2BGG A;  3HP9 A;  2DTU A;  2HMI A;  3EZ5 A;  3CYM A;  3U3Y A;  1S9G A;  1A5W A;  1WNS A;  4DWI A;  4I9Q A;  1DTT A;  4KTW A;  3ASM A;  1ASU A;  2OYQ A;  3SPZ A;  4K8X A;  1TL1 A;  2DFH A;  3L2W A;  4M3Y A;  2IDO A;  1RTD A;  4OGC A;  2I5J A;  1JL1 A;  2VWK A;  3MEG A;  1I39 A;  1LAW A;  3MEE A;  3NF6 A;  3HT3 A;  1CZB A;  3L2V A;  2HND A;  4CJS A;  3VQ7 A;  2XHB A;  3OYD A;  3AVL A;  5HRO A;  3RR8 A;  4K8Z A;  4Q0B A;  4DQR A;  3NGY A;  1U45 A;  4CJK A;  1IKW A;  3RWU A;  3K57 A;  3ULD A;  4KRF A;  4H4M A;  1A5X A;  4CIF A;  1XHX A;  5KRS A;  4C8M A;  3VA3 A;  4AHT A;  2E4L A;  5HRR A;  3OS1 A;  1CZ9 A;  4CCH A;  1A5V A;  1BQM A;  2HHU A;  1HQU A;  4CJT A;  1GOA A;  4N56 A;  3V1O A;  2ZD1 A;  3QEW A;  3IRX A;  4ELV A;  5KGX A;  1C0T A;  1WN7 A;  2ITG A;  4DLE A;  1SV5 A;  3P5J A;  1QQC A;  2GBZ A;  4FJ7 A;  3NF9 A;  4CEA A;  5EU7 A;  3P83 D;  5CYM A;  1X9S A;  4QOZ B;  1B9D A;  3HO1 A;  3TAG A;  4FZX C;  4E7I A;  3AVB A;  3NFA A;  3TAR A;  1KLN A;  3KLE A;  4B3O A;  2Z1G A;  1S6Q A;  4B8C A;  3OS2 A;  3SUP A;  1ASV A;  1QSL A;  4Y1D A;  2HNZ A;  3QO9 A;  1NK7 A;  1T8E A;  4Z4H A;  3AVH A;  5C25 A;  4IBN A;  2RPI A;  1BCM A;  1ZBH A;  3KKR A;  4BWM A;  4UQG A;  4B08 A;  4C8L A;  3O3G A;  3RMD A;  1W9H A;  3HYF A;  1NKB A;  4CJF A;  1TAU A;  1S1U A;  3F9K A;  4OGE A;  4DQS A;  4B9S A;  5JS1 A;  3OYF A;  3T3F A;  3DLB A;  1C1B A;  3QIO A;  2A1S A;  3JSM A;  4CJP A;  1O1W A;  4KTZ A;  3WNG A;  4OJR A;  5HLF A;  5CZ2 A;  4DLG A;  1I3A A;  1YVU A;  1CLQ A;  2KZZ A;  3OJU A;  4DQQ A;  4AHS A;  1QSS A;  4DTO A;  1T03 A;  1L3V A;  4JRP A;  3V4I A;  4CFA A;  2BDP A;  1EKE A;  3QIN A;  3RMA A;  2YHB A;  3D45 A;  3L3U A;  4HUE A;  4CGD A;  3A2F A;  3V9X A;  4JS5 A;  1L3S A;  3OYG A;  5HRS A;  1QHT A;  4FLU A;  4M3W A;  5JS2 A;  3HXM A;  2FBT A;  2RKI A;  4CJ5 A;  3OS0 A;  1ZBL A;  4M42 A;  1KVA A;  4E1N A;  1IO2 A;  1JKH A;  1C0U A;  1LW2 A;  3NDK A;  4B9N A;  4DF4 A;  3KJV A;  4GMJ B;  2P5G A;  4NCB A;  3NGZ A;  1WAJ A;  2Z1J A;  3H08 A;  3I8D A;  5HBM A;  3PY8 A;  1RTI A;  4FJK A;  1TK5 A;  3L2Q A;  3SZ2 A;  1VSE A;  3RMB A;  3HJF A;  1EP4 A;  2RF2 A;  4F8R A;  3ISN C;  4CHN A;  5K14 A;  3ZSQ A;  3M8Q A;  3ZSW A;  1KVB A;  2YV0 X;  4B9M A;  3OYN A;  1KSP A;  3OYA A;  1WSE A;  1KRP A;  2WON A;  4F3O A;  4BE2 A;  5HRN A;  1RDA A;  1UA0 A;  4FYD A;  3HVR A;  4AHC A;  3SQ1 A;  1FK9 A;  3QET A;  3NF8 A;  4BWJ A;  1WSH A;  2OPS A;  4JS4 A;  1U48 A;  4ELT A;  1KVC A;  1VSK A;  3VQ9 A;  3AO5 A;  1B9F A;  1RT7 A;  3LZI A;  1ZYQ A;  3T1A A;  3SV4 A;  3L2U A;  4YFU A;  4DSE A;  1R0A A;  4N41 A;  3KKS A;  3VQ4 A;  2DFF A;  4CHO A;  4DTU A;  3VQA A;  3CQ8 A;  1LWE A;  1ZBI A;  3LDS A;  3VQD A;  4AIL C;  3QLH A;  1QE1 A;  3WNE A;  5CYQ A;  4CFC A;  1NK4 A;  4FJ9 A;  5FDL A;  4FLV A;  5FRM A;  4FVM A;  3THV A;  1IKV A;  3AA5 X;  2D5R A;  4EZ9 A;  3IG1 A;  2PZS A;  3K5O A;  4DFJ A;  3PO5 A;  3LAM A;  4FJ5 A;  3AO2 A;  3EY1 A;  4PUO A;  1BL3 A;  4I2Q A;  3V9Z A;  3S3N A;  4HHT A;  4KHY A;  4DQP A;  3HPH A;  4C8N A;  2HHQ A;  4DS4 A;  3HM9 A;  1J54 A;  2FBX A;  3LZJ A;  3K58 A;  4J2D A;  1HYS A;  4DTR A;  4O44 A;  1VRT A;  2FC0 A;  2JLE A;  2KZM A;  2D0A A;  1D9D A;  3OYH A;  3O4Q A;  3SUN A;  1IKY A;  4CJV A;  3KK1 A;  1L5U A;  4CHQ A;  3V81 A;  1U04 A;  4BAC A;  2E6L A;  4CK3 A;  3OYE A;  3KLH A;  3TAP A;  4CEO A;  1S5J A;  1HPZ A;  1VSL A;  2B5J A;  4FLW A;  2OPR A;  3ZSR A;  2Y1J A;  4CEF A;  4DTN A;  4FW1 A;  5DK5 A;  3QNO A;  2P5O A;  4BE1 A;  1VSH A;  1K6Y A;  4W5Q A;  4E3S A;  1WLJ A;  4FM2 A;  3KD1 E;  3TR8 A;  3DLR A;  4EP5 A;  3L2R A;  3ZSO A;  4CF1 A;  4FM1 A;  4DU1 A;  3MAQ A;  5J2M A;  2DY4 A;  3AVM A;  3O4N A;  4NCA A;  3VQ6 A;  3OVN A;  3V9S A;  5SWM A;  3V1Q A;  1NK6 A;  1HYZ A;  4TSX A;  3OYM A;  1XI1 A;  1YTA A;  2PYJ A;  1LV5 A;  4AHR A;  4FK2 A;  3ZCM A;  1BIZ A;  4FCY A;  3TAB A;  1EX4 A;  1RT4 A;  4H4O A;  4RW6 A;  4FLX A;  2YKM A;  3QER A;  1SKS A;  4CGH A;  3KLG A;  1GOC A;  2HB5 A;  2NUB A;  2VG5 A;  4LD0 A;  1Z26 A;  2ZQB A;  3HL8 A;  4ID5 A;  4FLY A;  5J2N A;  3NAE A;  2ATQ A;  2IAJ A;  2P51 A;  4CHZ A;  1HQE A;  3NCI A;  3F73 A;  1L3U A;  1RBS A;  4ID1 A;  1RDD A;  4CF0 A;  2HHT A;  1HNV A;  4I9L A;  1BI4 A;  4XIU A;  3ZT2 A;  3U3G A;  1BI4 B;  4RW8 A;  1KLM A;  1S1X A;  2LSN A;  2G8H A;  3DLE A;  4CF2 A;  4M45 A;  4O4G A;  3SPY A;  4N5S A;  4PA1 A;  3VN5 A;  4O0I A;  3OYK A;  4DSJ A;  4DTX A;  4J2E A;  4M3T A;  1Z25 A;  3VQ8 A;  1BIS A;  2YNH A;  2XO7 A;  5E41 A;  3V9U A;  4W5O A;  3SJJ A;  3KLF A;  3L8B A;  2EX3 A;  4MFB A;  3LP1 A;  4KB1 A;  5DMR A;  4CF8 A;  2OA8 A;  4HCC A;  2F8T A;  3SUO A;  3DOL A;  3NF7 A;  4IDK A;  3AA3 A;  5KGW A;  1SKR A;  3ITH A;  1JLB A;  3CG7 A;  3LP0 A;  4LY7 A;  4CFB A;  3KK2 A;  5CY4 A;  3P1G A;  2YNF A;  1U47 A;  1TKD A;  1UA1 A;  1NK9 A;  3AVF A;  4CK1 A;  1X9W A;  5KTQ A;  2IOC A;  3C95 A;  1IG9 A;  4QCL A;  4IG3 A;  3ZT3 A;  4CGF A;  4M3Z A;  1KCF A;  3MXJ A;  2HHW A;  3KLI A;  2G8U A;  1QSY A;  2O4I A;  3HK2 A;  2B4J A;  3TAQ A;  4NCG A;  2YNI A;  4BDZ A;  1BCO A;  3QEV A;  4KPY A;  2KFN A;  4B9L A;  5FRN A;  2XRI A;  3PUF A;  1UAX A;  4GVM A;  5D3G A;  4EP4 A;  2A1R A;  4LH4 A;  3DM2 A;  4CE9 A;  4ELU A;  2HHX A;  1F21 A;  4CJQ A;  1BGX T;  4J2B A;  2P1J A;  4O0J A;  4E0D A;  1RDC A;  1QS4 A;  1KFS A;  5I3U A;  3CM6 A;  3V1R A;  1T05 A;  1UWB A;  3IS9 A;  1J9A A;  1N6Q A;  4W5T A;  2EHG A;  2VWJ A;  1IKX A;  2HHS A;  2GUI A;  3LAK A;  3AVN A;  3NH2 A;  3VQP A;  3SYZ A;  3RRH A;  3ZSV A;  3PX6 A;  4ZTJ A;  3HST B;  4RG8 A;  1SL1 A;  3NH1 A;  3ZSX A;  4CEE A;  4B8A B;  2G8I A;  2PY5 A;  1WSF A;  4KHS A;  2WOM A;  2VG7 A;  3C6U A;  5J2P A;  1RBV A;  1SL0 A;  2F8S A;  2BAN A;  2KTQ A;  3ZSZ A;  4FZY A;  2Q3S A;  3B6P A;  1ZBU A;  4DFM A;  3S3M A;  1D5A A;  3OJS A;  4IFY A;  4FLT A;  2VG6 A;  1BHL A;  1C0M A;  1KFD A;  3V6D A;  2X78 A;  3K5M A;  4KO0 A;  1VSI A;  4M3X A;  3OYL A;  1YT3 A;  4I2P A;  5C24 A;  2AJQ A;  3QNN A;  3MED A;  2HVI A;  1BIU A;  3SQ4 A;  4B9T A;  3AVA A;  3ZT0 A;  3AO4 A;  2FBY A;  4FJM A;  3SNN A;  1JLE A;  4E19 A;  1WAF A;  4OKE A;  1NOZ A;  1RBU A;  4DF8 A;  4YNQ A;  3PO4 A;  4Z4G A;  1CXQ A;  4C8O A;  4FK0 A;  3DLK A;  4CIG A;  3VQ5 A;  3NE6 A;  1HJR A;  3C6T A;  4KI6 A;  3JYT A;  4M3R A;  4DQI A;  1RDB A;  1CXU A;  2Z1I A;  3S3O A;  4KHN A;  4Z0U A;  2IC3 A;  2QK9 A;  4AHU A;  4CGJ A;  3O3H A;  1NJX A;  3LP2 A;  1QTM A;  1Q9X A;  3LAL A;  1SUQ A;  3KK3 A;  3K2P A;  1DTQ A;  3K5L A;  2IGI A;  4KV8 A;  3AV9 A;  4RW9 A;  1Q9Y A;  2YKN A;  4CHP A;  1TK0 A;  1D8Y A;  4NYN A;  2HHV A;  1JL2 A;  1RNH A;  1X9M A;  1XWL A;  4QAG A;  4FW2 A;  4H8K A;  2YHA A;  1GOB A;  4CEZ A;  4Q5V A;  3V9W A;  1KTQ A;  2X6S A;  1NJZ A;  4FJN A;  3BGR A;  4EZ6 A;  4ICL A;  2YNG A;  1RT5 A;  2XY6 A;  3WNF A;  4Z4F A;  3CFP A;  3OY9 A;  4DG1 A;  1EET A;  4CEB A;  4PQU A;  3ALY A;  2QXF A;  1NJY A;  4KAZ A;  4DSI A;  4HCB A;  3VQE A;  2W42 A;  3MXI A;  4NYF A;  3PX0 A;  1S6P A;  4FJJ A;  1MU2 A;  4OKJ A;  5SZT A;  1S1V A;  2D0B A;  4IG0 A;  4FJL A;  2IS3 A;  4CGI A;  3OYB A;  3ZSY A;  1TL3 A;  3TAN A;  3DLG A;  4W5R A;  1L3T A;  2X74 A;  4E1M A;  4E7L A;  3DRS A;  1NKC A;  1JLQ A;  3AA4 A;  4AHV A;  4HUF A;  4BDY A;  4ZTF A;  4CJU A;  3KTQ A;  3OYJ A;  4I7F A;  3SUQ A;  1RBR A;  1WSG A;  4BE0 A;  1TKX A;  4E89 A;  3K59 A;  3O3F A;  3S9H A;  4RW7 A;  1RTJ A;  4J2A A;  1U49 A;  1JXB A;  3M8R A;  4DTP A;  3AO3 A;  4DFK A;  2ZE2 A;  4CJE A;  4CF9 A;  1JLF A;  4E7H A;  3QEX A;  4JRQ A;  3AO1 A;  3QEP A;  1XHZ A;  3QES A;  3QIP A;  2ETJ A;  4CIE A;  4AH9 A;  2OPP A;  4E7K A;  4HTU A;  3M8P A;  4R5P A;  2O4G A;  3DLH A;  1RIL A;  2PYL A;  1B92 A;  2KW4 A;  3AVK A;  5CZ1 A;  1JLA A;  5HRP A;  5J2Q A;  2D0C A;  1NK0 A;  1SL2 A;  3HVT A;  4B9V A;  4F2R A;  3LPT A;  4CFD A;  2DFE A;  2RN2 A;  1ITG A;  1UOC A;  2OPQ A;  4LSL A;  2G8W A;  2R7Y A;  3LWL A;  4DTM A;  4DFP A;  1TGO A;  3D0P A;  1J5O A;  1LWF A;  3LWM A;  3CFO A;  3RRG A;  3IAY A;  2QKB A;  4CED A;  1XC9 A;  1DLO A;  4LSN A;  3PV8 A;  5T7B A;  3RR7 A;  4Y1C A;  1RT3 A;  5J1E A;  1VSD A;  2F96 A;  1N5Y A;  5KRT A;  4PY5 A;  3LAN A;  5C42 A;  3VQC A;  3VQB A;  1TK8 A;  4IFV A;  4DMN A;  4FJX A;  3AVG A;  1S1W A;  2X6N A;  3DI6 A;  4LH5 A;  4PWD A;  3E01 A;  3CFR A;  4OPJ A;  2OZS A;  3SQ0 A;  2G8K A;  4FXD A;  4L8R B;  2Z1H A;  3L3V A;  1W0H A;  3TI0 A;  1JLG A;  2E6M A;  3DYA A;  1WSI A;  3G0Z A;  4DS5 A;  4FJG A;  2GV9 A;  3OYC A;  3DRR A;  3DRP A;  4CHY A;  3KD5 E;  3LPU A;  1TKZ A;  3SI6 A;  4DSF A;  4KB0 A;  2HW3 A;  1LAV A;  4RW4 A;  4OVL A;  4CGG A;  4CJR A;  3TAF A; 
#chains in the Genus database with same CATH topology
 3FZH A;  3BDP A;  2A3Z A;  3MWP A;  4O55 A;  1LW0 A;  4GW6 A;  3TWH A;  4JAX A;  3L4Q A;  3SCX A;  4W5N A;  1C6V A;  2O8E A;  4FZZ A;  2I7N A;  1HYV A;  3HP6 A;  4IKF A;  1TAQ A;  3CCE N;  1Y97 A;  4FL9 A;  4HUG A;  4LC9 B;  4CEQ A;  1NGG A;  2G8V A;  4KH6 A;  2HNY A;  1WSJ A;  5GAG P;  2G8F A;  4Z4C A;  3D2E B;  4JKG B;  1DGK N;  2QI2 A;  4CZM A;  3ZT4 A;  4F9O A;  2OZM A;  3UKU A;  3J81 O;  3ZT1 A;  3DMJ A;  4CJ3 A;  5EY4 A;  4OPH A;  4KHQ A;  3VA0 A;  3M8S A;  1ZBF A;  4M3U A;  2KFZ A;  4JD2 A;  4ZHR A;  4BDP A;  5TKW A;  2KKZ A;  1YTU A;  1TVR A;  2B6A A;  3NH0 A;  3UIQ A;  3PX4 A;  4JN4 A;  4GV3 A;  4K0K K;  4MDA A;  3OYI A;  3O5B A;  1TUU A;  3QEI A;  4GKJ K;  4CZH A;  4O5F A;  1HMV A;  5IT9 O;  3HP9 A;  4JKE A;  3U3Y A;  1S9G A;  1WNS A;  4I9Q A;  3I8B A;  3P4I A;  4CD3 A;  1RTD A;  2I5J A;  1I39 A;  3MEE A;  3HT3 A;  3L2V A;  2XHB A;  3RR8 A;  2VCP A;  4DQR A;  4CJK A;  1IKW A;  4DR3 K;  1KAZ A;  4CIF A;  1XHX A;  4C8M A;  2O8D A;  1YJW N;  4JI8 K;  3ATV A;  1V4S A;  3VEY A;  3OS1 A;  4CCH A;  3O9U A;  2E5L K;  4N56 A;  3V1O A;  3IRX A;  5KGX A;  1WN7 A;  4B1Y B;  3OW2 M;  4DLE A;  4H5T A;  3NF9 A;  4CEA A;  4QOZ B;  5CYM A;  2QWO A;  4M63 C;  4FWN A;  4CD1 A;  4E7I A;  3THY A;  3TAR A;  5C2F A;  3LDN A;  3SUP A;  1JJ2 M;  1QSL A;  2F9W A;  2CGK A;  2RPI A;  5LMU K;  3G6E N;  3TTC A;  2E2O A;  3O3G A;  1NJI O;  3CD6 N;  3QIO A;  2YHW A;  2ZGY A;  1O1W A;  2YJF A;  5M1O A;  5TKY A;  3M3Z A;  1YVU A;  3BZC A;  3OJU A;  4AHS A;  4DTO A;  4JRP A;  2A42 A;  1EKE A;  4BR5 A;  2YHB A;  3D45 A;  3V9X A;  5HRS A;  4FLU A;  2RKI A;  4DR4 K;  3I56 N;  1IO2 A;  4JI6 K;  3MX5 A;  3KJV A;  1WAJ A;  2Z1J A;  3PY8 A;  4FJK A;  3EKS A;  3L2Q A;  3SZ2 A;  3RMB A;  4A2B A;  4B1Z A;  3TSQ A;  1NM1 A;  3M8Q A;  2RHK A;  3WEE B;  3CXC M;  1D4X A;  1WSE A;  3D2E A;  4JKG A;  1HKB A;  3HVR A;  4FYD A;  3SQ1 A;  3K9K A;  4A57 A;  2GUP A;  2OPS A;  4KH4 A;  4JS4 A;  3FGU A;  2ITM A;  1B9F A;  1RT7 A;  1ZYQ A;  2BH1 A;  1ZC6 A;  4IDH A;  2DFF A;  1VQL N;  5LY3 A;  3L4I A;  3VQA A;  3CQ8 A;  1ZBI A;  3CCR N;  4WQ5 A;  3WNE A;  4CFC A;  3CCJ N;  3J8A A;  4FVM A;  3AA5 X;  2D5R A;  3VF4 A;  4DFJ A;  3EY1 A;  3LM2 A;  4BG9 A;  3HPH A;  4C8N A;  1J54 A;  1NLV A;  2FC0 A;  2D0A A;  1D9D A;  1BU6 O;  3O4Q A;  4EAH D;  1GLA G;  3ENB A;  3WXL A;  4BRE A;  1JCF A;  3KK1 A;  3V81 A;  4JKC A;  3TAP A;  4CEO A;  1S5J A;  1VSL A;  3C6A A;  4CEF A;  1VSH A;  4W5Q A;  3EN9 A;  4E3S A;  4FM2 A;  1KAY A;  2NNW A;  1W97 L;  4CW7 B;  4FM1 A;  1VQ9 N;  1KAX A;  3MAQ A;  1K73 O;  4B3M K;  3VQ6 A;  3OVN A;  1HNW K;  1XI1 A;  4TSX A;  1J6Z A;  4FLX A;  3QER A;  2YKM A;  3KLG A;  4LFA K;  1GOC A;  2VG5 A;  4FLY A;  3HL8 A;  4ID5 A;  1ESV A;  3WQT A;  3NCI A;  1L3U A;  1KQS M;  1XMO K;  3THW A;  4M7X A;  5AZJ A;  3GDQ A;  2HHT A;  5MLC Q;  1BI4 B;  1KLM A;  2Q0U A;  2LSN A;  1KC8 O;  4B1U B;  2UUB K;  3VN5 A;  4M3T A;  3CC7 N;  2HBM A;  1Z25 A;  4FWQ A;  4JK8 A;  1RFQ A;  3VQ8 A;  2YNH A;  4BR4 A;  4A62 A;  4W5O A;  3L8B A;  1FJG K;  3CI5 A;  4MFB A;  2OTL N;  3UKR B;  2OA8 A;  4HCC A;  3AAP A;  4IDK A;  1S3X A;  1TUY A;  4FWK A;  3CG7 A;  4NLB A;  1GLF O;  3P1G A;  2YNF A;  1NK9 A;  4CK1 A;  3FFK B;  3QBW A;  5JLH A;  3MCP A;  3CCS N;  4CGF A;  1KCF A;  1U2V A;  3QEV A;  4BGA A;  3O1B A;  3H46 O;  4B9L A;  5AQT A;  2QWR A;  4FVU A;  3DM2 A;  3SLC A;  2HHX A;  1EO1 A;  4QS8 A;  3AGR A;  4BRM A;  5F0X A;  3V1R A;  3WEE A;  2EHG A;  3VEX A;  1IKX A;  3J7A P;  2GUI A;  2QWN A;  3AVN A;  3SYZ A;  3R6M A;  5AQV A;  3RRH A;  3HST B;  4RG8 A;  4KHS A;  2WOM A;  1DT9 A;  3M5R A;  5J2P A;  1RBV A;  3ZSZ A;  2Q3S A;  4DFM A;  2Q31 A;  3NVM A;  4IFY A;  5LJW A;  1C0M A;  1VSI A;  4M3X A;  1YT3 A;  4OX9 K;  3MED A;  2HVI A;  3SQ4 A;  4YOU A;  3HI0 A;  3ZT0 A;  2FBY A;  3SNN A;  4DF8 A;  1WAF A;  5CR4 A;  3PO4 A;  3E9P A;  4EHT A;  1CXQ A;  4C8O A;  4FK0 A;  3DLK A;  3NE6 A;  1KD1 O;  4DQI A;  4JI5 K;  3S3O A;  3BZK A;  1NJX A;  3CER A;  1Q9X A;  4KV8 A;  2OTJ N;  1Y64 A;  4PL8 A;  2V52 B;  4CHP A;  1ATR A;  2HHV A;  4QAG A;  2YHA A;  4V19 S;  4K42 A;  1KTQ A;  1OH7 A;  1M90 O;  2FF6 A;  3BUZ B;  2XY6 A;  5AQO A;  1WOQ A;  4Z4F A;  3CFP A;  1X3N A;  4CEB A;  4DUY K;  3ALY A;  3OHR A;  4DSI A;  4HCB A;  4DHY A;  1S6P A;  1T6C A;  4OKJ A;  4FJL A;  5GIO A;  1GLJ O;  3VEO A;  3TAN A;  4W5R A;  4AHV A;  4BR9 A;  4BDY A;  3KTQ A;  2P9S A;  5BN9 A;  4E89 A;  3K59 A;  4Y0W A;  1JLF A;  1QVG M;  1O13 A;  2OPP A;  4BRI A;  4R5P A;  3O9S A;  4B1V A;  2KW4 A;  3AVK A;  3UKR A;  1JLA A;  1SL2 A;  3HVT A;  1VQ6 N;  2DFE A;  3R8E A;  1ITG A;  3A5L C;  1GLB G;  3LWL A;  4H0P A;  2R7Y A;  3LWM A;  2QKB A;  2FSK A;  3RR7 A;  5C42 A;  5AQJ A;  1TK8 A;  1IV0 A;  1YIT N;  4JKA A;  1Q81 O;  4PWD A;  4AM6 A;  1YAG A;  5AQG A;  3SQ0 A;  2FXU A;  4L8R B;  2Z1H A;  2E6M A;  3CCM N;  1YIJ N;  2UYT A;  3G0Z A;  3DAW A;  3DRP A;  2ZJR L;  1TKZ A;  3R9P A;  4DSF A;  1LAV A;  4RW4 A;  2UXB K;  3LP3 A;  3G10 A;  3G25 A;  5AQX A;  2JGU A;  3HPG A;  1ASW A;  4KRE A;  3VGM A;  4CES A;  3CM5 A;  4CJL A;  3U6F A;  2Y1I A;  4WFA L;  3W3D A;  4JLH A;  1JCG A;  4YOR A;  1Q82 O;  2O8E B;  1NK8 A;  1RCH A;  1LCU A;  1SS6 A;  4CEC A;  2KQ2 A;  5LMN K;  1S1T A;  4DSL A;  4DV3 K;  1T6D A;  1S72 N;  1NKE A;  4E7J A;  3THX B;  3TTD A;  4OLA A;  2BE2 A;  2QKK A;  4Z4E A;  3R1X A;  1ILY A;  4Z4I A;  1X1P A;  3B6O A;  3KIO A;  4IFE A;  4ISG A;  3E9O A;  1Q18 A;  1SKW A;  2QWL A;  3HPO A;  4CJW A;  4YHH K;  4F3T A;  1EWQ A;  3NHG A;  1Q8I A;  2PBD A;  4B9U A;  3HRG A;  4DV4 K;  2VQF K;  3KVG A;  1NGH A;  3EYZ A;  3DOK A;  2XY5 A;  1HKC A;  2QM1 A;  3FFI A;  1WB9 A;  3TAE A;  3NGI A;  4QS9 A;  4KHW A;  1R59 O;  1NJW A;  4KFB A;  4MQ3 A;  5LL6 Z;  3VEV A;  2UUC K;  4YOY A;  3SMP A;  1JXE A;  4DSK A;  4CER A;  4H0T B;  1OH5 A;  1RT6 A;  2DTU A;  4GNI A;  3EZ5 A;  1IBM K;  3WXK A;  2GEM A;  2P9K A;  1GLD G;  1NGD A;  4LFC K;  5KPT A;  1VQK N;  3SPZ A;  4K8X A;  2DFH A;  2WUS A;  3L2W A;  4OGC A;  1N32 K;  4FXD A;  2IIR A;  4Q0B A;  3P31 A;  5ELZ A;  1NGF A;  3NGY A;  5JLF A;  3RWU A;  5BN8 A;  1YHQ N;  5KRS A;  4YOX A;  4AHT A;  3BP8 A;  2O8D B;  3O9R A;  2IVO A;  1BQM A;  1G99 A;  2AP1 A;  3MN5 A;  2HHH K;  2ZD1 A;  4ELV A;  3C6H A;  5JIC A;  3J80 O;  5GAD P;  1B9D A;  3HO1 A;  3TAG A;  3C0B A;  4DV5 K;  3THY B;  2HF3 A;  1S6Q A;  5BRH A;  3HOT A;  1ASV A;  2IVN A;  2HNZ A;  3QO9 A;  1NK7 A;  4Z4H A;  5C25 A;  4IBN A;  4C8L A;  3HYF A;  1HNZ K;  4B9S A;  1NMN A;  1M1K O;  5JS1 A;  4H0X B;  2A1S A;  4ISE A;  3O9Q A;  1OH6 A;  4DLG A;  4LF6 K;  3EE9 A;  4DQQ A;  1T03 A;  2P9P A;  2UUA K;  3CQY A;  3WXI A;  4CGD A;  1L3S A;  2ASP A;  1QHA A;  3HXM A;  1E3M A;  4E1N A;  1LW2 A;  4BC3 A;  1XNR K;  3L6Q A;  3S41 A;  3H08 A;  3GBT A;  3I8D A;  1QVF M;  1RTI A;  1XC3 A;  4H03 B;  1EP4 A;  2RF2 A;  1YI2 N;  4F8R A;  1N8R O;  3ZSQ A;  1KVB A;  3THX A;  1E4F T;  3GL1 A;  3OYN A;  2HST A;  3CME N;  4F3O A;  3U9D A;  5HRN A;  1RDA A;  1FK9 A;  3D7E O;  4K41 A;  4BWJ A;  4ELT A;  4FWO A;  1U48 A;  1KVC A;  4JNE A;  4DUZ K;  4DSE A;  1R0A A;  1T44 A;  4N41 A;  3KKS A;  3VQ4 A;  4CHO A;  5GAE P;  4FOE A;  3VQD A;  5DM6 L;  3CHW A;  2UXD K;  4CZF A;  1NK4 A;  4KH5 A;  5FLX O;  2Q2R A;  3C65 A;  3K5O A;  3PO5 A;  3LAM A;  3AO2 A;  3BF1 A;  4PUO A;  4I2Q A;  4KHY A;  5GAH P;  1ZXO A;  3H6E A;  3RSE A;  3LZJ A;  4YOT A;  2EWS A;  4DTR A;  5AJ3 K;  3OYH A;  1HPM A;  3N4P A;  4B1X B;  3IFR A;  4CJV A;  1VQN N;  1U04 A;  4BAC A;  1XQS C;  3FZL A;  4HWI A;  4MLE A;  4CK3 A;  2B5J A;  2JWL A;  4CJ7 A;  3ZSR A;  4DTN A;  4FW1 A;  5DK5 A;  4ILG B;  1K6Y A;  3KD1 E;  3ENO A;  3ZSO A;  2V51 B;  4NCA A;  2Q0R A;  1QZ6 A;  3O6W A;  3BF3 A;  3OYM A;  1YTA A;  2VWB A;  2QTD A;  3ZCM A;  3TAB A;  1EX4 A;  1RT4 A;  4H4O A;  4RW6 A;  1SKS A;  3T69 A;  3H3O B;  4LD0 A;  3EL2 A;  2ATQ A;  2P51 A;  5M1F A;  1HQE A;  3SAF A;  3F73 A;  4LFB K;  3R3L A;  1RDD A;  1HNV A;  3THW B;  5AZJ B;  3U3G A;  4RW8 A;  3SAH A;  2G8H A;  3DLE A;  4BRP A;  1RDW X;  1QQN A;  4PA1 A;  4O0I A;  1CZA N;  3ZX3 A;  4J2E A;  3OBY A;  2BTF A;  2XO7 A;  3V9U A;  1MWM A;  3HZ6 A;  3VGL A;  4BRO A;  5E41 A;  3CCV N;  3SJJ A;  3VPZ A;  3KLF A;  2EX3 A;  3QDK A;  3LP1 A;  4KB1 A;  3MN9 A;  2UU9 K;  3NF7 A;  1HNX K;  4LY7 A;  3KK2 A;  3LP0 A;  1U47 A;  3TPQ A;  1X9W A;  3Q7C A;  2IOC A;  4WQ4 A;  5C12 A;  3C95 A;  4QCL A;  2W6K A;  4IG3 A;  2HHW A;  3QFP A;  1QSY A;  1C0F A;  2B4J A;  1BCO A;  5AQU A;  2KFN A;  1U2V B;  4IZ9 A;  3OA9 A;  2XRI A;  2A1R A;  3DWL A;  4CE9 A;  1F21 A;  4CJQ A;  1BGX T;  2P1J A;  2E88 A;  5F1X A;  1RDC A;  1QS4 A;  1J9A A;  4BR0 A;  1N6Q A;  3LAK A;  3VQP A;  3VES A;  2NRW A;  1XMQ K;  3ZSV A;  3CPW M;  1SL1 A;  1N36 K;  3NH1 A;  4BVO A;  4RCH A;  3PIO L;  5HL7 L;  4B8A B;  2G8I A;  1WSF A;  3AY9 A;  1SL0 A;  2KTQ A;  3A5O C;  3S3M A;  4WQ5 C;  4FLT A;  4DB3 A;  3WUH A;  4JI3 K;  4JYA K;  2O8F A;  3OYL A;  5C24 A;  2O8B B;  4X65 K;  3O80 A;  4OKE A;  1NOZ A;  1RBU A;  4Z4G A;  4JKD A;  4IOX A;  3VQ5 A;  4XH1 A;  3C6T A;  3JYT A;  3W0L A;  4YY3 K;  4WFB L;  2IC3 A;  1X3M A;  4CGJ A;  1VQO N;  3LAL A;  4B3R K;  3AV9 A;  1Q9Y A;  1GLL O;  1RNH A;  1VQ8 N;  3HOS A;  4O8K A;  1GOB A;  2YHY A;  2X6S A;  4U67 L;  1NJZ A;  5AQL A;  4CZE A;  4EZ6 A;  3ID6 A;  1YJ9 N;  1RT5 A;  2ZJQ L;  1HLU A;  4PQU A;  4LF4 K;  2W40 A;  2P9I B;  3F2K A;  3M6G A;  1QQO A;  2HOE A;  4FJJ A;  1BA0 A;  5SZT A;  2D0B A;  5AQQ A;  2IS3 A;  5FPM A;  5F2R A;  3ZSY A;  4BR7 A;  3DLG A;  1L3T A;  2X74 A;  4BRQ A;  4BQL A;  1JLQ A;  3AA4 A;  4CJU A;  2WC9 A;  4JI7 K;  2VGN A;  2P9S B;  1RBR A;  1WSG A;  4J2A A;  4RW7 A;  1JXB A;  3M8R A;  3AO3 A;  4E7H A;  1ZBS A;  4FWP A;  4BQZ A;  3QEX A;  3QEP A;  3AO1 A;  3QES A;  3QIP A;  2O4G A;  1IBK K;  2D0C A;  1NK0 A;  4IOA L;  2D1K A;  3LPT A;  2OPQ A;  2G8W A;  2OAN A;  3N4Q A;  4DTM A;  4ILH A;  3ZYY X;  1BA1 A;  3CFO A;  1EWR A;  2W6L A;  3AAQ A;  3PV8 A;  4EIA A;  5AQH A;  1N33 K;  3CJB A;  3T1H K;  2PFU A;  5AQY A;  3DI6 A;  4BRA A;  3CFR A;  3L3V A;  2FSN A;  4FJG A;  4CHY A;  5AZI B;  2Q97 A;  3LPU A;  3Q7B A;  3SI6 A;  4KB0 A;  2HW3 A;  3AAR A;  1MA9 B;  4CBU A;  3I0R A;  3K5N A;  1HNI A;  1Z6R A;  1Q7Y O;  3I33 A;  4JEP A;  1S9E A;  3AA2 A;  4DTS A;  3GE1 A;  2XY7 A;  4DTJ A;  1G15 A;  3U9Z A;  1EXQ A;  1HRH A;  2J4R A;  4JK9 A;  4O8U A;  3EKU A;  1REV A;  3VQQ A;  4GY2 B;  4JI2 K;  4OKK A;  2XY8 A;  1LWC A;  3NBP A;  3G4S N;  2YHX A;  5KPR A;  3TSU A;  5M1K A;  4M41 A;  1SQK A;  5I42 A;  2O8B A;  2O8C B;  3I0S A;  3TAM A;  2P9N A;  4KI4 A;  2E20 A;  3EEQ A;  4E1J A;  4BGB A;  2ZWH A;  4BC4 A;  4OO1 J;  4B3S K;  1FKO A;  1VSF A;  3E9L A;  4DU3 A;  1VSM A;  1D9F A;  3KHY A;  4AF1 A;  1U4B A;  3FR0 A;  5AQS A;  3A5N C;  1NOY A;  1C1A A;  4HVJ A;  4N76 A;  3SMS A;  4KHU A;  4IO9 L;  4FM0 A;  1X9J A;  1FXX A;  4F2S A;  3LM9 A;  3O08 A;  3F5T A;  1TKT A;  4BRC A;  4DV2 K;  2P9I A;  5BRD A;  2HMI A;  4ISF A;  4YDU A;  1C0G A;  4DWI A;  2P9K B;  3T7Z A;  1NGJ A;  2QWM A;  1TL1 A;  2HBK A;  4R79 A;  4M3Y A;  2IDO A;  3VMF B;  1JL1 A;  2VWK A;  3NF6 A;  1LAW A;  4KTQ A;  1CZB A;  4K8Z A;  2HND A;  4CJS A;  3VQ7 A;  4M3Z A;  3H45 C;  2GWJ A;  4H5N A;  3FZK A;  5BPN A;  1U45 A;  3O4W A;  4I6M A;  4H4M A;  3WQU A;  3VA3 A;  5JVH L;  4CI6 A;  2E4L A;  1HQU A;  2VYP A;  4CJT A;  1GOA A;  2GX9 A;  4FPA A;  3QEW A;  4FJ7 A;  1X9S A;  4QS7 A;  4FZX C;  3NMU A;  3AVB A;  4BRK A;  1KLN A;  4B3O A;  4H0O A;  3KLE A;  1ATS A;  5DM7 L;  2GTD A;  4A2A A;  4B8C A;  2KHO A;  4B1W B;  4BC2 A;  4GV6 A;  4GKK K;  3AVH A;  3QFU A;  1ZBH A;  4BWM A;  4UQG A;  2QEX N;  3RMD A;  1W9H A;  5AQI A;  1S1U A;  3K9J A;  3OYF A;  3T3F A;  5AQR A;  3B8A X;  5AZI A;  4CJP A;  3ZET B;  3JSM A;  5HLF A;  1BUP A;  2KZZ A;  3V4I A;  4CFA A;  1OH8 A;  2P9P B;  1YJN N;  3RMA A;  4IO8 A;  3L3U A;  4M3W A;  3A2F A;  3G71 N;  4JS5 A;  3OYG A;  1QHT A;  2A5X A;  3HM8 A;  1HX1 A;  3MK6 A;  1ZBL A;  4M42 A;  1KVA A;  1JKH A;  4IEI A;  1C0U A;  3NDK A;  2PAV A;  4GMJ B;  2P5G A;  3NGZ A;  3FE1 A;  3EO3 A;  3P38 A;  1TK5 A;  3TSP A;  3HJF A;  4CHN A;  5K14 A;  4GVE A;  5KQD A;  2AA4 A;  2YV0 X;  1KSP A;  3OYA A;  1KRP A;  2WON A;  4BE2 A;  1UA0 A;  2O8C A;  1DKG D;  1ATN A;  4PKG A;  3QET A;  2ASM A;  1HKG A;  4X64 K;  3VF6 A;  4DTU A;  4CZK A;  4AIL C;  1QE1 A;  5CYQ A;  4XH4 A;  1NGI A;  4FLV A;  5FRM A;  3THV A;  1IKV A;  3IG1 A;  3LDL A;  3MDQ A;  2PZS A;  2OCE A;  4FJ5 A;  3V9Z A;  4HHT A;  4FWS A;  3RSE B;  3HM9 A;  4DS4 A;  4J2D A;  4LF8 K;  3O1W A;  4O44 A;  3NVK A;  2JLE A;  4XEI A;  3SUN A;  1IKY A;  3CC4 N;  3OYE A;  3DXK B;  1HPZ A;  1E4G T;  2WBN A;  3L0Q A;  4DR6 K;  2Y1J A;  3MN6 A;  2P5O A;  4BG8 A;  4Z94 A;  1WLJ A;  1TYQ B;  2ASO A;  3TR8 A;  4EP5 A;  3DLL L;  2YI1 A;  4DU1 A;  4J8F A;  2D4W A;  4BRG A;  3V1Q A;  3A8Y A;  1QQM A;  1NK6 A;  1HYZ A;  5E26 A;  5BPL A;  4FWR A;  5BR9 A;  2CGL A;  5EX5 A;  4AHR A;  4U7B A;  4FCY A;  1K8K A;  2CH5 A;  1Z05 A;  4CBX A;  4CGH A;  2HB5 A;  5LJV A;  5J2N A;  3NAE A;  2IAJ A;  3ZEU A;  5AQK A;  4DV0 K;  4K43 A;  2E1Y A;  4I9L A;  1I94 K;  1S1X A;  4JKH A;  4CF2 A;  3MCA B;  3O9T A;  4IEE A;  3SPY A;  3OYK A;  4DSJ A;  2QXL A;  1BIS A;  2P9U B;  3SBT A;  3H1V X;  2BUP A;  3AGK A;  2F8T A;  1U6Z A;  5AQM A;  3AA3 A;  5KGW A;  4JHD A;  1RGI A;  5EXW A;  3ZET A;  4KBO A;  3CCU N;  3LDQ A;  3D2F B;  3ITH A;  1JLB A;  4DR5 K;  1SKR A;  1QSS A;  3CCL N;  4FJI A;  1TKD A;  1UA1 A;  3ZT3 A;  3MXJ A;  4IJN A;  2O4I A;  2Q1N A;  3TAQ A;  4NCG A;  3KZB A;  4BDZ A;  2P9L A;  3MMV A;  4KPY A;  3VGK A;  4KHP K;  5FRN A;  3PUF A;  1UAX A;  4EP4 A;  1YVN A;  4LH4 A;  5C10 A;  4CZJ A;  4JI1 K;  4J2B A;  4O0J A;  3IUC A;  1KFS A;  1NGA A;  2WFB A;  5FPE A;  5I3U A;  3CM6 A;  4WCE L;  3VET A;  3H3N O;  5I9E B;  4W5T A;  4AM7 A;  4DQ8 A;  2VWJ A;  2HHS A;  2Q36 A;  1DEJ A;  4ZTJ A;  3ZSX A;  4CEE A;  3J7Y P;  2VG7 A;  2E8A A;  1BWF O;  4G9Z A;  2BAN A;  1D5A A;  3EZW A;  3TU5 A;  4IXC A;  2VG6 A;  4JKF A;  2E1Z A;  2CH6 A;  2X78 A;  4KO0 A;  1QZ5 A;  1HJO A;  4I2P A;  2O8F B;  2AJQ A;  3QNN A;  4B9T A;  3AVA A;  3AO4 A;  4E19 A;  3WT0 A;  4H0Y B;  4KI6 A;  2YJE A;  1CXU A;  3K0S A;  4Z0U A;  3O3H A;  3DXK A;  3HBT A;  1SUQ A;  3KK3 A;  2IGI A;  3ZX0 A;  4DR2 K;  1XUP O;  3SAG A;  2YKN A;  3BEX A;  1D8Y A;  3CJ9 A;  3VEW A;  1JL2 A;  1TYQ A;  3ZX2 A;  4PKI A;  1X9M A;  1XWL A;  4NO7 A;  3O8M A;  4A61 A;  4H8K A;  4Q5V A;  4CEZ A;  3V9W A;  3CET A;  1JCE A;  2YNG A;  3WNF A;  3U4L A;  3UB5 A;  4KAZ A;  4MLH A;  4C23 A;  4WYB A;  3MXI A;  3T1Y K;  1XNQ K;  4X66 K;  3PX0 A;  1K9M O;  1P90 A;  1MU2 A;  4CZI A;  3IMX A;  1VQ7 N;  4IG0 A;  3CPE A;  5BPM A;  1TL3 A;  5JMV A;  1NGC A;  2QW9 A;  3DRS A;  1NKC A;  4HUF A;  4IWV A;  1V4T A;  3CQX A;  4ZTF A;  3FLC O;  1GLC G;  3MX2 A;  1TKX A;  4NB4 A;  4BE0 A;  3O3F A;  3S9H A;  4DTP A;  4DFK A;  1XHZ A;  2E2Q A;  2ETJ A;  4AH9 A;  4E7K A;  4HTU A;  3M8P A;  1SAZ A;  4FPB A;  5M1Q A;  2P9U A;  3C7N B;  1W7A A;  3DLH A;  1RIL A;  1KXP A;  5C2D A;  1CLQ A;  5CZ1 A;  5HRP A;  5J2Q A;  4DV7 K;  4A5A A;  4F2R A;  4LSL A;  1UOC A;  1OVY A;  3D2F A;  4DFP A;  4WQ4 C;  3D0P A;  3LDO A;  3RRG A;  3IAY A;  4CED A;  3LDP A;  3PSI A;  4JI4 K;  2ZGZ A;  1XC9 A;  1DLO A;  5IWA K;  3H1Q A;  5J1E A;  1VSD A;  1N5Y A;  3CIP A;  5KRT A;  3VQB A;  2D0P A;  4DMN A;  3BY5 A;  4LH5 A;  3OTO K;  4CZG A;  2OZS A;  2G8K A;  4RTF D;  4BRD A;  1J5E K;  3TI0 A;  3DYA A;  4H5W A;  2FF3 B;  3M1F A;  2GV9 A;  3OYC A;  3KD5 E;  1NGE A;  4DKW A;  2H3G X;  4BY9 C;  4WFN L;  3PLA A;  1WBB A;  4CJR A;  1K8A O;  2YX6 A;  3MXM A;  4PL7 A;  4CK2 A;  1VRU A;  4C8K A;  2NRT A;  4F4K A;  4FJ8 A;  3CJC A;  1FKP A;  1VK0 A;  1J53 A;  5E84 A;  4ILJ A;  1H1V A;  2YCH A;  4DU4 A;  4G1Q A;  1YUW A;  5AQP A;  5ADX H;  3JXU A;  4WE1 A;  5ADX A;  1VQ5 N;  4JK7 A;  4OLB A;  1T7P A;  1NNE A;  1TV6 A;  3VTH A;  3SK3 A;  3UE5 A;  2HVH A;  3WNH A;  4O5B A;  3C94 A;  3IKM A;  4FK4 A;  1RT1 A;  5EVZ A;  1RT2 A;  3AVC A;  4KKO A;  1JLC A;  4XH5 A;  3SQ2 A;  5BR8 K;  4FLZ A;  5HP1 A;  4FJH A;  5C0Y A;  2P9N B;  5FRO A;  3CC2 N;  4L3Q A;  4H5R A;  3RMC A;  3JAM O;  4CJ4 A;  4IOC L;  3SV3 A;  2FBV A;  1BQN A;  5M1N A;  3IDH A;  1IBL K;  3D6R A;  3MWT A;  5KI6 A;  4MDB A;  1RBT A;  2NLX A;  1IH7 A;  1VSJ A;  3T19 A;  3AVI A;  4OPK A;  1NK5 A;  1S22 A;  3CCQ N;  3RTV A;  1C1C A;  3MEC A;  3AVJ A;  3JS6 A;  4N47 A;  5AQF A;  4CZL A;  1RTH A;  2A6A A;  2CGJ A;  2BGG A;  5BRF A;  3GOI A;  3CYM A;  1A5W A;  1DTT A;  4KTW A;  3ASM A;  1ASU A;  5M1P A;  2OYQ A;  4JV5 K;  4LF9 K;  3MEG A;  4BRF A;  1OKJ A;  4H0V B;  3OYD A;  3AVL A;  5HRO A;  3VEN A;  3K57 A;  3ULD A;  4KRF A;  1A5X A;  4I6M B;  4EHU A;  4CVN E;  5HRR A;  1CZ9 A;  1A5V A;  1T3V A;  3C7N A;  4H5V A;  4DV1 K;  2HHU A;  1VAZ A;  2UXC K;  1NWK A;  3DJC A;  1C0T A;  2ITG A;  1SV5 A;  3P5J A;  1QQC A;  2GBZ A;  5EU7 A;  3P83 D;  2NRZ A;  4A5B A;  3FZF A;  4NLC A;  3NFA A;  2Z1G A;  4LF7 K;  3OS2 A;  4HTL A;  5GIN A;  4Y1D A;  1T8E A;  4FOI A;  1BCM A;  1NU0 A;  1Q86 O;  3KKR A;  4B08 A;  3HTV A;  1MDU B;  1TAU A;  1NKB A;  4CJF A;  4JI0 K;  3F9K A;  4OGE A;  4DQS A;  4JKB A;  3DXM B;  4AQY K;  3VER A;  1C1B A;  3DLB A;  1BG3 A;  4KTZ A;  3WNG A;  4OJR A;  5CZ2 A;  5AFU H;  1I3A A;  5AFU A;  2HMP A;  1L3V A;  2BDP A;  3VOV A;  2HBJ A;  4A59 A;  3QIN A;  3QBX A;  4YOW A;  4HUE A;  2HBL A;  1N34 K;  5JS2 A;  2FBT A;  4CJ5 A;  3OS0 A;  1NMD A;  4GV9 A;  2FSJ A;  1HR0 K;  4X62 K;  4B9N A;  4DF4 A;  4NCB A;  3A5M C;  5HBM A;  4EFH A;  1VSE A;  5B8H A;  1FW6 A;  3CF5 L;  3ISN C;  4PKH A;  4BRN A;  3ZSW A;  3LL3 A;  5JVG L;  4BC5 A;  4B9M A;  4DCH A;  3MN7 A;  4AHC A;  4CBW A;  3NF8 A;  1WSH A;  1VSK A;  3VQ9 A;  3AO5 A;  4FO0 A;  3LZI A;  3T1A A;  3SV4 A;  3L2U A;  4YFU A;  5CE3 A;  1LWE A;  1WUA A;  3LDS A;  1VHX A;  5EOY A;  3QLH A;  2V7Y A;  4NXM K;  2D0O A;  2V7Z A;  5H1S Q;  5FDL A;  4FJ9 A;  3KK7 A;  4EZ9 A;  4UY8 O;  1P8Z A;  1BL3 A;  3S3N A;  3CMA N;  4DQP A;  2HHQ A;  1HYS A;  2FBX A;  3K58 A;  4BR2 A;  2A40 A;  4MO4 A;  2KZM A;  1VRT A;  4YDU C;  3E1Y A;  3I55 N;  1WBD A;  3VTI A;  1L5U A;  4CHQ A;  4MO5 A;  2E6L A;  3KLH A;  4FWM A;  2A41 A;  4FLW A;  5C15 A;  2OPR A;  4PHT X;  2ZJP L;  3QNO A;  2DPN A;  4BE1 A;  2GWK A;  5FPN A;  2NRR A;  2NRV A;  3DLR A;  3L2R A;  2QWP A;  4CF1 A;  2ZM6 K;  5J2M A;  2DY4 A;  2IVP A;  3AVM A;  3O4N A;  4NXN K;  2F4V K;  4DR7 K;  3V9S A;  5SWM A;  2KLA A;  5FPD A;  2PYJ A;  4LF5 K;  1LV5 A;  4FK2 A;  3ENH A;  1BIZ A;  3TTF A;  1K8K B;  5AQN A;  2NUB A;  3V6D A;  1Z26 A;  2ZQB A;  4FWL A;  4CHZ A;  2I7P A;  3ZEU B;  1RBS A;  2GEL A;  4ID1 A;  4CF0 A;  1BI4 A;  4XIU A;  3ZT2 A;  4DV6 K;  4FSV A;  1BO5 O;  2NRH A;  4M45 A;  4O4G A;  4N5S A;  1NGB A;  3WXJ A;  2ZF5 O;  3VF2 A;  4DTX A;  4BVP A;  3U8X A;  1NBW A;  2QA4 N;  1VQ4 N;  3DXM A;  5DMR A;  4CF8 A;  3SUO A;  3DOL A;  1GLE G;  4JHD B;  4CFB A;  2FLO A;  5CY4 A;  1YXQ A;  4WF9 L;  3AVF A;  3QML A;  5KTQ A;  1IG9 A;  3F9M A;  2VGM A;  3KLI A;  5AQZ A;  2G8U A;  3HK2 A;  2QWQ A;  2YNI A;  1SZ2 A;  2P9L B;  1LOT B;  3ULE B;  4GVM A;  5D3G A;  2WTU A;  4B9Q A;  4ELU A;  3J7Z O;  4E0D A;  4C1N K;  1T05 A;  1UWB A;  3IS9 A;  4M7Y A;  4K25 A;  3PSF A;  3NH2 A;  1HUX A;  1VQP N;  3PX6 A;  1IG8 A;  3KWG A;  2PY5 A;  3ATU A;  3C6U A;  5KQ8 A;  2F8S A;  4FZY A;  3B6P A;  1ZBU A;  3GG4 A;  3OJS A;  3ZLJ A;  1BHL A;  1BDG A;  1KFD A;  3CJA A;  3KWI A;  3K5M A;  3SJH A;  3VEZ A;  4DR1 K;  1BIU A;  4BRL A;  4FJM A;  1JLE A;  3ID8 A;  5A2Q O;  3UKU B;  3RVC A;  4YNQ A;  3P39 A;  2E2P A;  3QB0 A;  4CIG A;  1HJR A;  4OPA A;  4M3R A;  4KHN A;  1RDB A;  2Z1I A;  2QK9 A;  4AHU A;  3LP2 A;  1QTM A;  5BRE A;  2E2N A;  3K2P A;  1DTQ A;  3K5L A;  5HOO A;  4IJA A;  4RW9 A;  4JD2 B;  1TK0 A;  4NYN A;  5KPZ A;  4FW2 A;  2VQE K;  4FJN A;  3BGR A;  3CJ1 A;  4ICL A;  1EQY A;  3OY9 A;  4DG1 A;  1EET A;  1NJY A;  2QXF A;  5CHI A;  3VQE A;  3A0I X;  3WXM B;  2W42 A;  2NZT A;  4NYF A;  3CJ7 A;  2F9T A;  3OBW A;  1S1V A;  2F7T A;  4CGI A;  3OYB A;  4E1M A;  3SBG A;  4E7L A;  3QIC A;  1BOT O;  2HF4 A;  3FZM A;  3HSC A;  3OYJ A;  1OVQ A;  4I7F A;  1NG9 A;  3SUQ A;  1RTJ A;  4B3T K;  1U49 A;  2ZE2 A;  4CJE A;  4CF9 A;  4JRQ A;  3EE8 A;  4CIE A;  2RE2 A;  4YOV A;  1MWK A;  2JWK A;  2PYL A;  4RWT A;  1B92 A;  4BRH A;  4B9V A;  4CFD A;  2RN2 A;  1J5O A;  1TGO A;  2W41 A;  1LWF A;  1W2B M;  4LSN A;  5T7B A;  1VQM N;  4Y1C A;  1RT3 A;  2F96 A;  1YF5 L;  4PY5 A;  3LAN A;  3VQC A;  4IFV A;  4FJX A;  3AVG A;  1S1W A;  2X6N A;  5AR0 A;  3ULE A;  3E01 A;  2NRX A;  4OPJ A;  5GIP A;  1W0H A;  3PIP L;  1JLG A;  5AQW A;  1WSI A;  1RDU A;  4DS5 A;  3DRR A;  1IJJ A;  4C1N I;  3E66 A;  4OVL A;  4CGG A;  3TAF A; 
#chains in the Genus database with same CATH homology
 3MXM A;  3BDP A;  3I0R A;  3LP3 A;  3G10 A;  3K5N A;  2JGU A;  3HPG A;  1HNI A;  4O55 A;  4CK2 A;  1LW0 A;  4GW6 A;  1VRU A;  3TWH A;  4C8K A;  1ASW A;  4KRE A;  3SCX A;  4F4K A;  4CES A;  3CM5 A;  4FJ8 A;  4CJL A;  3U6F A;  4W5N A;  2Y1I A;  1C6V A;  1S9E A;  3AA2 A;  1FKP A;  4JLH A;  4FZZ A;  4DTS A;  1VK0 A;  1J53 A;  2XY7 A;  1HYV A;  3HP6 A;  4DU4 A;  4IKF A;  4G1Q A;  4DTJ A;  4WE1 A;  1TAQ A;  1G15 A;  1NK8 A;  1RCH A;  1EXQ A;  1HRH A;  4OLB A;  1T7P A;  1Y97 A;  4CEC A;  2KQ2 A;  4HUG A;  1REV A;  3VQQ A;  1TV6 A;  4OKK A;  2HVH A;  1S1T A;  2XY8 A;  3WNH A;  4O5B A;  1LWC A;  4DSL A;  3C94 A;  3NBP A;  4CEQ A;  4FK4 A;  1RT1 A;  1NKE A;  2G8V A;  1RT2 A;  4E7J A;  2HNY A;  1WSJ A;  3AVC A;  2G8F A;  4Z4C A;  4M41 A;  4OLA A;  5I42 A;  2BE2 A;  4KKO A;  2QKK A;  1JLC A;  4Z4E A;  3SQ2 A;  4FLZ A;  3I0S A;  3TAM A;  5HP1 A;  4FJH A;  4Z4I A;  1X1P A;  3B6O A;  5FRO A;  3KIO A;  3ZT4 A;  3RMC A;  2OZM A;  4FJI A;  4KI4 A;  1SKW A;  3HPO A;  3ZT1 A;  4CJW A;  4CJ4 A;  4F3T A;  3NHG A;  1Q8I A;  3SV3 A;  2FBV A;  4B9U A;  3DMJ A;  1BQN A;  4CJ3 A;  3EYZ A;  5KI6 A;  3DOK A;  1FKO A;  1VSF A;  1RBT A;  2XY5 A;  4KHQ A;  4DU3 A;  3VA0 A;  1VSM A;  3M8S A;  1ZBF A;  1IH7 A;  3FFI A;  1D9F A;  1VSJ A;  1U4B A;  4M3U A;  3T19 A;  3AVI A;  2KFZ A;  3TAE A;  4OPK A;  3NGI A;  4ZHR A;  1NK5 A;  4BDP A;  4KTQ A;  1NOY A;  1C1A A;  1YTU A;  1TVR A;  2B6A A;  3NH0 A;  4KHW A;  4HVJ A;  4N76 A;  1NJW A;  4KFB A;  4MQ3 A;  3UIQ A;  3RTV A;  4KHU A;  1C1C A;  4FM0 A;  3PX4 A;  3OYI A;  3MEC A;  3AVJ A;  1FXX A;  1JXE A;  4N47 A;  4DSK A;  4F2S A;  3QEI A;  4CER A;  1TKT A;  1RT6 A;  1HMV A;  1RTH A;  2BGG A;  3HP9 A;  2DTU A;  2HMI A;  3EZ5 A;  3CYM A;  3U3Y A;  1S9G A;  1A5W A;  1WNS A;  4DWI A;  4I9Q A;  1DTT A;  4KTW A;  3ASM A;  1ASU A;  2OYQ A;  3SPZ A;  4K8X A;  1TL1 A;  2DFH A;  3L2W A;  4M3Y A;  2IDO A;  1RTD A;  4OGC A;  2I5J A;  1JL1 A;  2VWK A;  3MEG A;  1I39 A;  1LAW A;  3MEE A;  3NF6 A;  3HT3 A;  1CZB A;  3L2V A;  2HND A;  4CJS A;  3VQ7 A;  2XHB A;  3OYD A;  3AVL A;  5HRO A;  3RR8 A;  4K8Z A;  4Q0B A;  4DQR A;  3NGY A;  1U45 A;  4CJK A;  1IKW A;  3RWU A;  3K57 A;  3ULD A;  4KRF A;  4H4M A;  1A5X A;  4CIF A;  1XHX A;  5KRS A;  4C8M A;  3VA3 A;  4AHT A;  2E4L A;  5HRR A;  3OS1 A;  1CZ9 A;  4CCH A;  1A5V A;  1BQM A;  2HHU A;  1HQU A;  4CJT A;  1GOA A;  4N56 A;  3V1O A;  2ZD1 A;  3QEW A;  3IRX A;  4ELV A;  5KGX A;  1C0T A;  1WN7 A;  2ITG A;  4DLE A;  1SV5 A;  3P5J A;  1QQC A;  2GBZ A;  4FJ7 A;  3NF9 A;  4CEA A;  5EU7 A;  3P83 D;  5CYM A;  1X9S A;  4QOZ B;  1B9D A;  3HO1 A;  3TAG A;  4FZX C;  4E7I A;  3AVB A;  3NFA A;  3TAR A;  1KLN A;  3KLE A;  4B3O A;  2Z1G A;  1S6Q A;  4B8C A;  3OS2 A;  3SUP A;  1ASV A;  1QSL A;  4Y1D A;  2HNZ A;  3QO9 A;  1NK7 A;  1T8E A;  4Z4H A;  3AVH A;  5C25 A;  4IBN A;  2RPI A;  1BCM A;  1ZBH A;  3KKR A;  4BWM A;  4UQG A;  4B08 A;  4C8L A;  3O3G A;  3RMD A;  1W9H A;  3HYF A;  1NKB A;  4CJF A;  1TAU A;  1S1U A;  3F9K A;  4OGE A;  4DQS A;  4B9S A;  5JS1 A;  3OYF A;  3T3F A;  3DLB A;  1C1B A;  3QIO A;  2A1S A;  3JSM A;  4CJP A;  1O1W A;  4KTZ A;  3WNG A;  4OJR A;  5HLF A;  5CZ2 A;  4DLG A;  1I3A A;  1YVU A;  1CLQ A;  2KZZ A;  3OJU A;  4DQQ A;  4AHS A;  1QSS A;  4DTO A;  1T03 A;  1L3V A;  4JRP A;  3V4I A;  4CFA A;  2BDP A;  1EKE A;  3QIN A;  3RMA A;  2YHB A;  3D45 A;  3L3U A;  4HUE A;  4CGD A;  3A2F A;  3V9X A;  4JS5 A;  1L3S A;  3OYG A;  5HRS A;  1QHT A;  4FLU A;  4M3W A;  5JS2 A;  3HXM A;  2FBT A;  2RKI A;  4CJ5 A;  3OS0 A;  1ZBL A;  4M42 A;  1KVA A;  4E1N A;  1IO2 A;  1JKH A;  1C0U A;  1LW2 A;  3NDK A;  4B9N A;  4DF4 A;  3KJV A;  4GMJ B;  2P5G A;  4NCB A;  3NGZ A;  1WAJ A;  2Z1J A;  3H08 A;  3I8D A;  5HBM A;  3PY8 A;  1RTI A;  4FJK A;  1TK5 A;  3L2Q A;  3SZ2 A;  1VSE A;  3RMB A;  3HJF A;  1EP4 A;  2RF2 A;  4F8R A;  3ISN C;  4CHN A;  5K14 A;  3ZSQ A;  3M8Q A;  3ZSW A;  1KVB A;  2YV0 X;  4B9M A;  3OYN A;  1KSP A;  3OYA A;  1WSE A;  1KRP A;  2WON A;  4F3O A;  4BE2 A;  5HRN A;  1RDA A;  1UA0 A;  4FYD A;  3HVR A;  4AHC A;  3SQ1 A;  1FK9 A;  3QET A;  3NF8 A;  4BWJ A;  1WSH A;  2OPS A;  4JS4 A;  1U48 A;  4ELT A;  1KVC A;  1VSK A;  3VQ9 A;  3AO5 A;  1B9F A;  1RT7 A;  3LZI A;  1ZYQ A;  3T1A A;  3SV4 A;  3L2U A;  4YFU A;  4DSE A;  1R0A A;  4N41 A;  3KKS A;  3VQ4 A;  2DFF A;  4CHO A;  4DTU A;  3VQA A;  3CQ8 A;  1LWE A;  1ZBI A;  3LDS A;  3VQD A;  4AIL C;  3QLH A;  1QE1 A;  3WNE A;  5CYQ A;  4CFC A;  1NK4 A;  4FJ9 A;  5FDL A;  4FLV A;  5FRM A;  4FVM A;  3THV A;  1IKV A;  3AA5 X;  2D5R A;  4EZ9 A;  3IG1 A;  2PZS A;  3K5O A;  4DFJ A;  3PO5 A;  3LAM A;  4FJ5 A;  3AO2 A;  3EY1 A;  4PUO A;  1BL3 A;  4I2Q A;  3V9Z A;  3S3N A;  4HHT A;  4KHY A;  4DQP A;  3HPH A;  4C8N A;  2HHQ A;  4DS4 A;  3HM9 A;  1J54 A;  2FBX A;  3LZJ A;  3K58 A;  4J2D A;  1HYS A;  4DTR A;  4O44 A;  1VRT A;  2FC0 A;  2JLE A;  2KZM A;  2D0A A;  1D9D A;  3OYH A;  3O4Q A;  3SUN A;  1IKY A;  4CJV A;  3KK1 A;  1L5U A;  4CHQ A;  3V81 A;  1U04 A;  4BAC A;  2E6L A;  4CK3 A;  3OYE A;  3KLH A;  3TAP A;  4CEO A;  1S5J A;  1HPZ A;  1VSL A;  2B5J A;  4FLW A;  2OPR A;  3ZSR A;  2Y1J A;  4CEF A;  4DTN A;  4FW1 A;  5DK5 A;  3QNO A;  2P5O A;  4BE1 A;  1VSH A;  1K6Y A;  4W5Q A;  4E3S A;  1WLJ A;  4FM2 A;  3KD1 E;  3TR8 A;  3DLR A;  4EP5 A;  3L2R A;  3ZSO A;  4CF1 A;  4FM1 A;  4DU1 A;  3MAQ A;  5J2M A;  2DY4 A;  3AVM A;  3O4N A;  4NCA A;  3VQ6 A;  3OVN A;  3V9S A;  5SWM A;  3V1Q A;  1NK6 A;  1HYZ A;  4TSX A;  3OYM A;  1XI1 A;  1YTA A;  2PYJ A;  1LV5 A;  4AHR A;  4FK2 A;  3ZCM A;  1BIZ A;  4FCY A;  3TAB A;  1EX4 A;  1RT4 A;  4H4O A;  4RW6 A;  4FLX A;  2YKM A;  3QER A;  1SKS A;  4CGH A;  3KLG A;  1GOC A;  2HB5 A;  2NUB A;  2VG5 A;  4LD0 A;  1Z26 A;  2ZQB A;  3HL8 A;  4ID5 A;  4FLY A;  5J2N A;  3NAE A;  2ATQ A;  2IAJ A;  2P51 A;  4CHZ A;  1HQE A;  3NCI A;  3F73 A;  1L3U A;  1RBS A;  4ID1 A;  1RDD A;  4CF0 A;  2HHT A;  1HNV A;  4I9L A;  1BI4 A;  4XIU A;  3ZT2 A;  3U3G A;  1BI4 B;  4RW8 A;  1KLM A;  1S1X A;  2LSN A;  2G8H A;  3DLE A;  4CF2 A;  4M45 A;  4O4G A;  3SPY A;  4N5S A;  4PA1 A;  3VN5 A;  4O0I A;  3OYK A;  4DSJ A;  4DTX A;  4J2E A;  4M3T A;  1Z25 A;  3VQ8 A;  1BIS A;  2YNH A;  2XO7 A;  5E41 A;  3V9U A;  4W5O A;  3SJJ A;  3KLF A;  3L8B A;  2EX3 A;  4MFB A;  3LP1 A;  4KB1 A;  5DMR A;  4CF8 A;  2OA8 A;  4HCC A;  2F8T A;  3SUO A;  3DOL A;  3NF7 A;  4IDK A;  3AA3 A;  5KGW A;  1SKR A;  3ITH A;  1JLB A;  3CG7 A;  3LP0 A;  4LY7 A;  4CFB A;  3KK2 A;  5CY4 A;  3P1G A;  2YNF A;  1U47 A;  1TKD A;  1UA1 A;  1NK9 A;  3AVF A;  4CK1 A;  1X9W A;  5KTQ A;  2IOC A;  3C95 A;  1IG9 A;  4QCL A;  4IG3 A;  3ZT3 A;  4CGF A;  4M3Z A;  1KCF A;  3MXJ A;  2HHW A;  3KLI A;  2G8U A;  1QSY A;  2O4I A;  3HK2 A;  2B4J A;  3TAQ A;  4NCG A;  2YNI A;  4BDZ A;  1BCO A;  3QEV A;  4KPY A;  2KFN A;  4B9L A;  5FRN A;  2XRI A;  3PUF A;  1UAX A;  4GVM A;  5D3G A;  4EP4 A;  2A1R A;  4LH4 A;  3DM2 A;  4CE9 A;  4ELU A;  2HHX A;  1F21 A;  4CJQ A;  1BGX T;  4J2B A;  2P1J A;  4O0J A;  4E0D A;  1RDC A;  1QS4 A;  1KFS A;  5I3U A;  3CM6 A;  3V1R A;  1T05 A;  1UWB A;  3IS9 A;  1J9A A;  1N6Q A;  4W5T A;  2EHG A;  2VWJ A;  1IKX A;  2HHS A;  2GUI A;  3LAK A;  3AVN A;  3NH2 A;  3VQP A;  3SYZ A;  3RRH A;  3ZSV A;  3PX6 A;  4ZTJ A;  3HST B;  4RG8 A;  1SL1 A;  3NH1 A;  3ZSX A;  4CEE A;  4B8A B;  2G8I A;  2PY5 A;  1WSF A;  4KHS A;  2WOM A;  2VG7 A;  3C6U A;  5J2P A;  1RBV A;  1SL0 A;  2F8S A;  2BAN A;  2KTQ A;  3ZSZ A;  4FZY A;  2Q3S A;  3B6P A;  1ZBU A;  4DFM A;  3S3M A;  1D5A A;  3OJS A;  4IFY A;  4FLT A;  2VG6 A;  1BHL A;  1C0M A;  1KFD A;  3V6D A;  2X78 A;  3K5M A;  4KO0 A;  1VSI A;  4M3X A;  3OYL A;  1YT3 A;  4I2P A;  5C24 A;  2AJQ A;  3QNN A;  3MED A;  2HVI A;  1BIU A;  3SQ4 A;  4B9T A;  3AVA A;  3ZT0 A;  3AO4 A;  2FBY A;  4FJM A;  3SNN A;  1JLE A;  4E19 A;  1WAF A;  4OKE A;  1NOZ A;  1RBU A;  4DF8 A;  4YNQ A;  3PO4 A;  4Z4G A;  1CXQ A;  4C8O A;  4FK0 A;  3DLK A;  4CIG A;  3VQ5 A;  3NE6 A;  1HJR A;  3C6T A;  4KI6 A;  3JYT A;  4M3R A;  4DQI A;  1RDB A;  1CXU A;  2Z1I A;  3S3O A;  4KHN A;  4Z0U A;  2IC3 A;  2QK9 A;  4AHU A;  4CGJ A;  3O3H A;  1NJX A;  3LP2 A;  1QTM A;  1Q9X A;  3LAL A;  1SUQ A;  3KK3 A;  3K2P A;  1DTQ A;  3K5L A;  2IGI A;  4KV8 A;  3AV9 A;  4RW9 A;  1Q9Y A;  2YKN A;  4CHP A;  1TK0 A;  1D8Y A;  4NYN A;  2HHV A;  1JL2 A;  1RNH A;  1X9M A;  1XWL A;  4QAG A;  4FW2 A;  4H8K A;  2YHA A;  1GOB A;  4CEZ A;  4Q5V A;  3V9W A;  1KTQ A;  2X6S A;  1NJZ A;  4FJN A;  3BGR A;  4EZ6 A;  4ICL A;  2YNG A;  1RT5 A;  2XY6 A;  3WNF A;  4Z4F A;  3CFP A;  3OY9 A;  4DG1 A;  1EET A;  4CEB A;  4PQU A;  3ALY A;  2QXF A;  1NJY A;  4KAZ A;  4DSI A;  4HCB A;  3VQE A;  2W42 A;  3MXI A;  4NYF A;  3PX0 A;  1S6P A;  4FJJ A;  1MU2 A;  4OKJ A;  5SZT A;  1S1V A;  2D0B A;  4IG0 A;  4FJL A;  2IS3 A;  4CGI A;  3OYB A;  3ZSY A;  1TL3 A;  3TAN A;  3DLG A;  4W5R A;  1L3T A;  2X74 A;  4E1M A;  4E7L A;  3DRS A;  1NKC A;  1JLQ A;  3AA4 A;  4AHV A;  4HUF A;  4BDY A;  4ZTF A;  4CJU A;  3KTQ A;  3OYJ A;  4I7F A;  3SUQ A;  1RBR A;  1WSG A;  4BE0 A;  1TKX A;  4E89 A;  3K59 A;  3O3F A;  3S9H A;  4RW7 A;  1RTJ A;  4J2A A;  1U49 A;  1JXB A;  3M8R A;  4DTP A;  3AO3 A;  4DFK A;  2ZE2 A;  4CJE A;  4CF9 A;  1JLF A;  4E7H A;  3QEX A;  4JRQ A;  3AO1 A;  3QEP A;  1XHZ A;  3QES A;  3QIP A;  2ETJ A;  4CIE A;  4AH9 A;  2OPP A;  4E7K A;  4HTU A;  3M8P A;  4R5P A;  2O4G A;  3DLH A;  1RIL A;  2PYL A;  1B92 A;  2KW4 A;  3AVK A;  5CZ1 A;  1JLA A;  5HRP A;  5J2Q A;  2D0C A;  1NK0 A;  1SL2 A;  3HVT A;  4B9V A;  4F2R A;  3LPT A;  4CFD A;  2DFE A;  2RN2 A;  1ITG A;  1UOC A;  2OPQ A;  4LSL A;  2G8W A;  2R7Y A;  3LWL A;  4DTM A;  4DFP A;  1TGO A;  3D0P A;  1J5O A;  1LWF A;  3LWM A;  3CFO A;  3RRG A;  3IAY A;  2QKB A;  4CED A;  1XC9 A;  1DLO A;  4LSN A;  3PV8 A;  5T7B A;  3RR7 A;  4Y1C A;  1RT3 A;  5J1E A;  1VSD A;  2F96 A;  1N5Y A;  5KRT A;  4PY5 A;  3LAN A;  5C42 A;  3VQC A;  3VQB A;  1TK8 A;  4IFV A;  4DMN A;  4FJX A;  3AVG A;  1S1W A;  2X6N A;  3DI6 A;  4LH5 A;  4PWD A;  3E01 A;  3CFR A;  4OPJ A;  2OZS A;  3SQ0 A;  2G8K A;  4FXD A;  4L8R B;  2Z1H A;  3L3V A;  1W0H A;  3TI0 A;  1JLG A;  2E6M A;  3DYA A;  1WSI A;  3G0Z A;  4DS5 A;  4FJG A;  2GV9 A;  3OYC A;  3DRR A;  3DRP A;  4CHY A;  3KD5 E;  3LPU A;  1TKZ A;  3SI6 A;  4DSF A;  4KB0 A;  2HW3 A;  1LAV A;  4RW4 A;  4OVL A;  4CGG A;  4CJR A;  3TAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...