3AO3A

Fragment-based approach to the design of ligands targeting a novel site on hiv-1 integrase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
153
structure length
138
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQEESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein
publication title Fragment-based design of ligands targeting a novel site on the integrase enzyme of human immunodeficiency virus 1
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/transferase inhibitor
total genus 49
structure length 138
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ao3A00
4FK0A 4FK2A 3LPUA 4CJUA 4KV8A 3AO1A 1T03A 2ATQA 1ZBIA 4OKJA 1XI1A 1SKRA 2VWKA 4RW6A 1QHTA 1BIZA 4CF2A 3M8RA 4I9QA 2DFFA 2Q3SA 2EX3A 2QKKA 3QERA 4FZXC 3AVJA 4CHOA 4CJVA 2BANA 4CERA 2HHVA 3VQBA 3VQPA 4CE9A 4FLVA 3S9HA 3P5JA 3RRGA 1BL3A 2YNFA 4CJSA 4ZHRA 5HP1A 3NAEA 1J54A 1L5UA 3S3OA 4C8KA 2VG6A 4KFBA 4KI4A 2XY8A 5J1EA 2X6SA 4Z4GA 5K14A 1T8EA 2PYJA 1LWEA 3KK2A 2F8SA 4CJEA 4KHUA 1SKSA 3OYKA 2KFZA 1O1WA 1YTAA 1KVBA 3I0RA 1WSHA 2D0BA 1VSHA 1RTIA 3MXIA 4EZ6A 4CFBA 1LW0A 4DFKA 3SPZA 4PWDA 3AA5X 1WAFA 2Z1HA 1IO2A 4FJXA 3TAMA 5HRSA 4JS4A 4LD0A 1Y97A 3LAKA 3QLHA 1XC9A 1NKBA 4CJTA 4FLZA 1LWFA 1S6QA 1J9AA 4C8MA 3K59A 3AVNA 1HQUA 4DU4A 4OLAA 4Q5VA 1ASWA 2GBZA 3MEEA 3AO4A 2OPQA 4CEOA 4CFCA 3K5MA 4KAZA 3PY8A 2FBYA 3B6OA 1BIUA 1KLNA 1IKXA 1D5AA 4CGFA 1RBUA 4CEZA 4FLTA 4GMJB 3V9SA 2G8VA 1R0AA 4M3ZA 2RF2A 3MECA 4EZ9A 4I7FA 3DRSA 1U49A 1Q8IA 2QXFA 2A1SA 5CYQA 1IH7A 3DRRA 3OVNA 3PV8A 4DMNA 4CGIA 3OYAA 3K5NA 5HRNA 1RT6A 4B08A 1LW2A 3IG1A 1U45A 3O3HA 2HMIA 2Y1JA 5DMRA 1TAUA 4DFMA 4IBNA 1U04A 3IRXA 4G1QA 5KGWA 4HUGA 2Z1JA 1HYVA 1WLJA 4E3SA 4YNQA 3KKSA 3LP1A 1HYSA 3HP9A 2HNDA 3CG7A 2D5RA 4DU3A 1WAJA 3TI0A 3ZT1A 3O3FA 3DMJA 3SI6A 4O5BA 4DG1A 1RTHA 5JS1A 1SUQA 3SUNA 4CIEA 5FDLA 3SUPA 1YVUA 2ZD1A 5J2PA 3LP0A 4DQQA 1UAXA 3MEDA 5CYMA 4C8NA 3V9WA 3CM6A 4CEFA 4E0DA 1SKWA 3TARA 4FJ7A 3SUQA 1U4BA 1BQNA 4CGDA 2RKIA 1TL3A 3JSMA 2OPSA 4Y1DA 3AVCA 4DSFA 1J5OA 1EP4A 3VQ5A 3L2RA 4BDZA 4FCYA 1TKXA 2OPPA 5CZ2A 4CGJA 2VWJA 4J2EA 2X6NA 1NKEA 5I3UA 4NYFA 4RW7A 3O3GA 4B3OA 5J2NA 4YFUA 4AHVA 3HL8A 4KTZA 4FJ5A 4FW1A 4E7LA 3UIQA 2D0AA 4JLHA 2HHWA 1A5XA 2E6MA 5J2MA 2XY5A 4CHNA 4DTSA 4F2SA 4GVMA 3QIPA 3HT3A 3KK1A 3KTQA 3SPYA 4DTJA 5CZ1A 1NK7A 3DI6A 1KCFA 4KHSA 1J53A 3MXJA 4QCLA 3OYHA 4JS5A 4CCHA 1NK9A 1BCMA 2YNIA 3PX0A 3EY1A 1S5JA 1JKHA 3VQ4A 4W5QA 3ZCMA 4DQSA 1D8YA 1TKZA 2QKBA 4B9VA 3K5LA 3QEVA 2YHAA 1VSEA 1KFSA 4M3WA 3O4NA 2EHGA 4E7KA 2F8TA 1QQCA 1CXUA 2ITGA 4Z4EA 4KHNA 3VQ7A 4HTUA 4BE0A 2QK9A 3C95A 4LY7A 2HB5A 4W5OA 4DLEA 3V81A 4KRFA 1S6PA 4O55A 4FLWA 3V1OA 2XO7A 4O44A 4DTUA 5JS2A 4ICLA 4BWJA 4E7IA 1RT5A 3EZ5A 3RRHA 2KW4A 4F2RA 4IG3A 4H4MA 3OJUA 4FJ9A 3DOKA 2HHXA 4DTMA 2WOMA 4DLGA 4CGGA 4OGCA 3OYJA 2KZZA 2XY6A 1HRHA 3TR8A 4Y1CA 2I5JA 4W5RA 3SV4A 2O4IA 3PO5A 4M3UA 4CF0A 3OY9A 3SQ1A 1RT7A 3LDSA 3MXMA 3KLGA 1CZ9A 1BQMA 4KO0A 1BCOA 4HCCA 4AH9A 3SQ0A 4Z4CA 4FW2A 1JLAA 1KFDA 1ZBUA 3ZSVA 1KRPA 3P1GA 2G8IA 3DLBA 3NDKA 4B9TA 1FXXA 3HP6A 3V9ZA 4DTOA 1REVA 2W42A 3ZT3A 3OS0A 4E89A 4CEAA 3LWMA 2KFNA 1LAVA 4DQRA 4OKKA 1JLEA 4DF8A 1SV5A 2X74A 4OKEA 4RW8A 3PX4A 3ZT4A 3C94A 4DTXA 3L2UA 1CXQA 3B6PA 4I2QA 3NH2A 5KTQA 3HXMA 1U48A 1F21A 3MEGA 3C6TA 1GOBA 3KD5E 2B6AA 3O4QA 5C42A 3KJVA 1EKEA 4CJQA 3M8QA 3M8SA 1TK8A 2IDOA 4CEEA 3AO5A 4CFDA 4CHYA 4DFPA 3NF6A 3RWUA 1WSJA 1B9FA 4CJ5A 3E01A 1ASUA 4FJMA 4TSXA 4AHCA 3ZSYA 3AO3A 1TKDA 4OVLA 3BGRA 2RPIA 4O0IA 2XY7A 3NFAA 3KD1E 2OZSA 4LSNA 3F73A 1D9FA 3VA0A 4B9UA 4BE2A 1JXEA 2DFHA 1C0TA 3THVA 2HVIA 1QE1A 3NGIA 4FM0A 4O4GA 1VRUA 1T05A 4IDKA 3LP3A 4DWIA 4M3TA 1K6YA 1WSFA 4J2DA 1JLCA 3IAYA 5KGXA 4HUFA 3I8DA 1B92A 4FYDA 2F96A 2FBTA 4NCGA 1WSGA 4E1MA 4PY5A 5KI6A 3ULDA 4ID1A 4DFJA 2ZQBA 3SYZA 2YKMA 1BISA 1JL1A 1HQEA 1VSLA 3KLEA 4BDYA 3DRPA 3PX6A 1NK4A 4J2BA 2HHQA 1S1UA 1IKVA 1GOCA 4E1NA 4DQPA 3ASMA 4CHPA 4ELVA 4N76A 2HHUA 4XIUA 4DTNA 4R5PA 4FJJA 2P51A 1Q9XA 3TAGA 3AVBA 3DLHA 3DOLA 3U3GA 4E7HA 4M45A 1JXBA 1WN7A 3ZT0A 1BI4B 4CJPA 1EETA 4FM2A 4N56A 4DQIA 3L2QA 5E41A 4B8AB 1RDDA 1TK5A 4CJKA 1WSEA 2D0CA 4CK3A 4FLYA 3VQDA 4FJNA 1XHXA 2OA8A 2YV0X 4KREA 1G15A 2XHBA 4KTWA 4W5NA 1S1WA 4N41A 3S3NA 3AVMA 5FROA 3FFIA 2ZE2A 4HUEA 1S1VA 1TKTA 1W9HA 4CGHA 3VA3A 1BGXT 3SJJA 2X78A 1TK0A 3AA4A 3LZIA 3QESA 2ETJA 3CFRA 2HVHA 1VRTA 1VSIA 4LSLA 3KLHA 1LAWA 1C0UA 3V1RA 4F8RA 2JGUA 4DTPA 4OPJA 4CIFA 3CYMA 3NE6A 4AHUA 3LZJA 3DLKA 1TV6A 3AVKA 3HYFA 3ISNC 3T3FA 3SQ4A 3SNNA 3EYZA 2B4JA 4KTQA 4B9MA 4QAGA 4DTRA 4J2AA 3L8BA 1HMVA 3I0SA 4BWMA 2B5JA 2VG5A 1Q9YA 1JLFA 3LANA 4RW9A 2G8KA 4FVMA 4PA1A 4Z4IA 2PZSA 1L3TA 2IC3A 3OYBA 3HPGA 4JRQA 1QSYA 1HPZA 1LWCA 3ZT2A 1RDAA 3V6DA 3K57A 4C8OA 1RDBA 4FK4A 5HBMA 1VSJA 1YTUA 1KLMA 1DTQA 1I3AA 3F9KA 1WSIA 3SCXA 5HRPA 3HSTB 1RT1A 2HHTA 1QSSA 3NF7A 4OJRA 3OYLA 4C8LA 3HVTA 3K5OA 3DLEA 3WNHA 4HCBA 1L3UA 1TL1A 3ZSXA 1VSFA 3RR8A 4Z4FA 3RMCA 1NOZA 2GUIA 4MQ3A 4FLUA 3H08A 1RBTA 1IG9A 3QEXA 4B9SA 1QS4A 1W0HA 4FJIA 3HK2A 3ZSWA 4IKFA 4PQUA 3A2FA 4BACA 2NUBA 4CF9A 4IG0A 1X9SA 2G8HA 3VQAA 4CFAA 3AVAA 3HO1A 1WNSA 4KHYA 1RBSA 4CJ4A 2OZMA 2G8UA 4HVJA 4CJFA 1C0MA 4MFBA 3OYEA 4AILC 1C1AA 3WNFA 2YKNA 3NGZA 3TAEA 4CJ3A 4I2PA 1QSLA 1A5WA 1VSMA 1NK5A 4LH5A 2HHSA 2Z1GA 3ZSRA 2G8FA 4B9LA 4CK2A 3QEWA 4KHWA 1Z25A 1HJRA 3NF8A 3OYGA 1D9DA 1JL2A 4CEQA 3TWHA 2KTQA 2GV9A 1DLOA 3NH1A 3CFPA 5HRRA 4I9LA 4PUOA 3OYDA 4NCAA 4FJ8A 3BDPA 1S9GA 1DTTA 3ALYA 3ZSQA 1VSKA 5J2QA 3AVFA 3NBPA 3SQ2A 1UWBA 3KIOA 5C25A 4FZZA 2R7YA 4AHTA 3CM5A 3QINA 3LP2A 1NK8A 5T7BA 4DS4A 2E4LA 1NK6A 4K8XA 4LH4A 2HNZA 3U3YA 4N5SA 1S1TA 4DSJA 3QNOA 1L3VA 3HJFA 1HYZA 3DYAA 2P5OA 3CFOA 3ZSZA 4Z4HA 5KRTA 1X1PA 3DM2A 4M41A 4ZTFA 1RT3A 3NH0A 4CF1A 2KZMA 1YT3A 3D45A 3L3UA 1X9MA 1ZBHA 4DSEA 3KLFA 3AA3A 1UA0A 1CZBA 2JLEA 1N5YA 4NCBA 5FRNA 3RMBA 3VN5A 3WNEA 4WE1A 1NJZA 1X9WA 2P1JA 3AVLA 3QETA 2A1RA 4E7JA 4CHZA 4KHQA 3OS1A 2IAJA 2YNGA 2FBXA 4QOZB 3OS2A 3V1QA 2FBVA 1L3SA 3AVGA 1RT2A 3T1AA 4Z0UA 1ZBFA 3KLIA 4OPKA 3AVIA 3WNGA 1NK0A 1KVCA 3TAFA 1C1CA 3L3VA 4FJKA 2RN2A 3NHGA 1JLQA 1XWLA 3ITHA 3K58A 4CESA 3PO4A 3IS9A 4JRPA 1ASVA 4KI6A 4FJGA 1EXQA 3LAMA 4M3XA 3VQQA 1BI4A 2IS3A 1B9DA 2Z1IA 4O0JA 4IFVA 4DSLA 2Y1IA 2HNYA 1RDCA 4RW4A 3VQ9A 1VSDA 3TAQA 3VQEA 5HLFA 1UOCA 3LALA 3RTVA 3MAQA 1C1BA 3QNNA 4NYNA 1VK0A 4F3OA 1NOYA 3QIOA 5I42A 3TANA 4CJLA 3TABA 2BDPA 4KKOA 2PYLA 4F3TA 4DSIA 2IOCA 5KRSA 3QO9A 4M3RA 1FKPA 1IKWA 2DFEA 1RBRA 5FRMA 3AO2A 3RMAA 1QTMA 3DLGA 5C24A 3P83D 2O4GA 3OYMA 3D0PA 4CJWA 3VQ8A 1RNHA 1RT4A 4KB0A 4M42A 3U6FA 4FLXA 4Q0BA 1NJWA 1NJYA 1I39A 4CF8A 1HNIA 1ZBLA 2YNHA 1UA1A 3SUOA 1N6QA 3AVHA 1S9EA 3QEPA 1TAQA 4UQGA 2PY5A 4FZYA 1EX4A 3QEIA 1BHLA 2IGIA 3V9XA 1RTDA 4DSKA 1JLGA 5DK5A 4CK1A 1C6VA 3OYNA 3NF9A 2FC0A 3SZ2A 5D3GA 4BE1A 3S3MA 1Z26A 2BE2A 4ZTJA 1ITGA 1A5VA 4F4KA 4KPYA 3OJSA 4W5TA 2OYQA 1TVRA 2KQ2A 3LPTA 1TGOA 3NCIA 2BGGA 2HW3A 4DS5A 1ZYQA 1JLBA 4CJRA 3JYTA 3RR7A 3AV9A 1HNVA 4CHQA 3OYIA 3HM9A 5HROA 3KK3A 3V9UA 1KVAA 2WONA 3HPHA 1FK9A 3DLRA 4E19A 1SL0A 4L8RB 1RCHA 1SL1A 4ID5A 3G0ZA 2DTUA 2DY4A 4CECA 3LWLA 4M3YA 3TAPA 1LV5A 4KB1A 4FJLA 3VQ6A 1KTQA 2XRIA 1MU2A 4RG8A 1RILA 4H4OA 3VQCA 4B8CA 4HHTA 3RMDA 3SV3A 4N47A 5SZTA 3L2VA 4EP4A 1S1XA 3T19A 3KKRA 4CEDA 2P5GA 4OGEA 5EU7A 1CLQA 3NGYA 1T7PA 2G8WA 4ELUA 3C6UA 3L2WA 4K8ZA 1NKCA 1FKOA 3G10A 1KSPA 1NJXA 5CY4A 4EP5A 2E6LA 4DU1A 2LSNA 3V4IA 1SL2A 4FXDA 3HPOA 4IFYA 4CIGA 1IKYA 1RBVA 4OLBA 2VG7A 3M8PA 1GOAA 1XHZA 2OPRA 4FM1A 5SWMA 2AJQA 3OYFA 4CEBA 4BDPA 4ELTA 4GW6A 3PUFA 3ZSOA 3OYCA 4DF4A 3AA2A 4AHSA 3CQ8A 1U47A 4B9NA 4H8KA 2YHBA 4FJHA 3HVRA 4AHRA 3K2PA 1RTJA
chains in the Genus database with same CATH superfamily
4FK0A 4MLEA 2ZM6K 1T03A 1BDGA 4OKJA 2VWKA 2ZGZA 2DFFA 2Q3SA 2QKKA 4X66K 4H5WA 4BRKA 4CHOA 4CJVA 4BGAA 3VQPA 3S9HA 3VESA 2YNFA 5HP1A 4CD1A 1J54A 3NAEA 1WBBA 1L5UA 4C8KA 2VG6A 1EWRA 1RGIA 3KK2A 4CBUA 1O1WA 1KVBA 1RTIA 3CC7N 5CHIA 4DFKA 3SPZA 1IBMK 4FJXA 4JS4A 2OTLN 3VEVA 1NKBA 2J4RA 3THYB 4FLZA 1HQUA 4DR1K 3O80A 3MEEA 2OPQA 1NU0A 3ENHA 4CZFA 3PY8A 4KAZA 2OANA 1IKXA 1D5AA 4CGFA 2G8VA 4H5NA 1E3MA 1R0AA 3NVMA 1OH7A 2QM1A 3D6RA 4CW7B 4CGIA 3K5NA 5HRNA 1U45A 1XNQK 4B3SK 5LMUK 1TAUA 1TYQB 2A6AA 4YOYA 3CJ9A 1N33K 1HYVA 4YNQA 3LM2A 3LP1A 2HNDA 1U6ZA 4DU3A 3ZT1A 3H6EA 3SI6A 3H1VX 2WC9A 5FDLA 1YVUA 4C8NA 3V9WA 1Y64A 3G71N 4E0DA 4XEIA 3TARA 4FJ7A 3SUQA 1BQNA 2RKIA 2UXDK 2OPSA 5AQHA 1EP4A 4JK7A 3L2RA 4FCYA 2OPPA 2VWJA 1CZAN 2NNWA 2X6NA 4NYFA 4AHVA 1Z05A 4E7LA 4MO4A 4JLHA 2HHWA 1A5XA 3ZYYX 2XY5A 4CHNA 1VQMN 4GVMA 3HT3A 4DTJA 1NMDA 4QCLA 4JS5A 2PAVA 4FWLA 4ILJA 5DM6L 3ZCMA 3TTDA 4GV9A 4BC2A 4IOCL 3QEVA 5E84A 2QWNA 4IJNA 2A5XA 2JWKA 4HTUA 2QK9A 1YVNA 2XO7A 5JS2A 4BWJA 3RRHA 5FPEA 2KW4A 2UUAK 3OJUA 4KH4A 4DLGA 4OGCA 2O8BA 3QMLA 3TR8A 2F9TA 3PO5A 4CF0A 3UKRA 3SQ1A 1RT7A 3MXMA 1BCOA 4WCEL 2G8IA 3DLBA 4DR4K 2P9NB 1BA1A 3CJCA 2W42A 3JS6A 1HX1A 1ATSA 1P90A 3LWMA 4IEEA 2E2PA 5AQUA 2CGJA 4DF8A 3PX4A 3C94A 4DTXA 3L2UA 1CXQA 1U48A 1ZBSA 3C6TA 5GIPA 3KD5E 2E1ZA 4BR5A 3O08A 4CJQA 3M8QA 4RCHA 3M8SA 1TK8A 2A41A 3AO5A 1N36K 2Q97A 2O8DA 4AHCA 3ZSYA 2W6KA 2XY7A 1D9FA 3VA0A 4DR7K 4YOWA 4BE2A 1GLCG 4CBXA 3THVA 2HVIA 3NGIA 4IDHA 4IDKA 3LP3A 1IJJA 3E9PA 1WSFA 3KZBA 4J2DA 5KGXA 2FBTA 4PY5A 3ULDA 1BISA 3C6HA 4DHYA 4B1XB 2CGLA 4J2BA 1GOCA 4N76A 5H1SQ 4DTNA 4FJJA 4I6MB 1Q9XA 4DQIA 4IXCA 4R79A 3L2QA 4PKIA 4XH1A 3LM9A 4FLYA 3BEXA 2YV0X 4H0XB 1VHXA 4JD2A 1S1VA 1W9HA 1QHAA 1BGXT 2UYTA 2CGKA 4PL8A 3D2FA 3LZIA 3QESA 4B3TK 1NGDA 3OW2M 1LAWA 2QI2A 3AY9A 3PIOL 3IDHA 3CYMA 4IOXA 3AVKA 4KTQA 4B9MA 4DTRA 3PSIA 3GOIA 3QDKA 1JLFA 2ZJQL 4RW9A 5FLXO 2PZSA 1XUPO 3OYBA 5M1FA 3O9TA 3EN9A 4JI1K 5HBMA 1VSJA 3CCJN 1I3AA 3CJAA 3C7NA 1NGJA 3ZX2A 1IBKK 1QSSA 3NF7A 4HCBA 3WNHA 3QBWA 2OTJN 1L3UA 1VSFA 1RBTA 4B9SA 1W0HA 4IKFA 5BRHA 3A2FA 1E4GT 4BACA 4IG0A 1X9SA 3VQAA 3HO1A 2V52B 2O8CB 4AILC 3KVGA 2YKNA 2HHSA 1VSMA 2V7YA 5E26A 3ZSRA 3WXMB 4KHWA 1JL2A 2GV9A 3WXIA 4WQ5C 3NH1A 3LDLA 4I9LA 4NCAA 1S9GA 1VSKA 3SQ2A 1ATRA 3SK3A 3LP2A 1NNEA 1NK8A 2E4LA 4GKKK 4ILHA 1L3VA 3DYAA 2P5OA 2QTDA 1GLLO 3MN9A 3ZSZA 4QS8A 5BPMA 3RSEA 4M41A 3ZX3A 3PSFA 1MDUB 2FF6A 4C23A 2JLEA 3CIPA 1TUYA 4BRCA 2AP1A 4B1WB 3WNEA 4WE1A 3K9KA 4E7JA 1BUPA 5ELZA 3V1QA 3F5TA 1RT2A 4OPKA 3KLIA 3AVIA 1NGAA 4H5TA 3WNGA 4JN4A 1NK0A 1KVCA 4FJKA 4F9OA 2RN2A 3NHGA 1X3MA 4DUYK 3K58A 4CD3A 4KI6A 4JK9A 3VQQA 1B9DA 3MWPA 4DR2K 4FWOA 4IFVA 5GADP 3EE8A 3HOTA 2Y1IA 2HNYA 1NGCA 1VSDA 3RTVA 3VPZA 3ATVA 4HTLA 4Z94A 3ZLJA 2VQFK 2PYLA 2IOCA 5KRSA 3VF4A 1FKPA 1IKWA 2DFEA 1RBRA 1N34K 3RMAA 1M90O 3WXJA 3P83D 2UUCK 3OYMA 1TUUA 4CJWA 4KB0A 4M42A 4Q0BA 4FWQA 3CCSN 1NJWA 5AQLA 1BU6O 4CI6A 1I39A 3LL3A 1ZBLA 1NMNA 2QWOA 1E4FT 2Q31A 1ZXOA 4DSKA 2VCPA 1JLGA 1T6CA 2YX6A 5DK5A 1KXPA 1C6VA 5A2QO 3OYNA 2GWJA 1IV0A 2BE2A 4A61A 4F4KA 4W5TA 3M6GA 4JKAA 2IVOA 3J7AP 1TGOA 2NRWA 3JYTA 3EE9A 3HM9A 2Q0UA 2WONA 1ILYA 4L8RB 3LDOA 2DY4A 3TAPA 2OCEA 3F9MA 4YDUC 2XRIA 3OA9A 3ID6A 5SZTA 3MX5A 1S1XA 2ASMA 3T19A 5F0XA 5TKWA 3CC2N 1XNRK 4CZIA 3C6UA 4K8ZA 1NKCA 2LSNA 3DXMA 3V4IA 4CIGA 4JI4K 3FGUA 2NZTA 1C0GA 3IMXA 4FM1A 4NO7A 2AJQA 4CEBA 4B1YB 1M1KO 3PUFA 3ZSOA 4DF4A 5BR8K 3K2PA 5M1NA 3SBGA 3VEYA 4CJUA 4BRGA 1XI1A 3EKUA 1QHTA 1H1VA 4CF2A 3M8RA 2O8BB 4GV6A 3QERA 4FZXC 4FWSA 2PFUA 4CERA 4FLVA 2HHVA 2VGNA 1BL3A 3CQYA 3T1HK 4QS9A 3CJBA 4DV5K 4KFBA 5K14A 2PYJA 4KHUA 5F1XA 3G25A 2KFZA 3I0RA 4YORA 3UKUA 4J8FA 2Z1HA 1IO2A 1Y97A 3CMEN 1XC9A 4CJTA 3T1YK 1LWFA 4DU4A 1ASWA 3L0QA 3AO4A 3FZFA 4X64K 1X9JA 2FBYA 2VYPA 3B6OA 4XH4A 2HHHK 4CEZA 2O8DB 4GMJB 3V9SA 3NMUA 1K9MO 2GELA 3MECA 4JKFA 1FJGK 4I7FA 3DRSA 2QXFA 5CYQA 4CZHA 3CMAN 3DRRA 4WF9L 3R1XA 2HMIA 3MDQA 4IBNA 4G1QA 3IFRA 5KGWA 1QQMA 4HUGA 4AQYK 1WLJA 3VEXA 4E3SA 5B8HA 2ASPA 2WFBA 1HYSA 4DV1K 3CG7A 1NM1A 2HBLA 1RTHA 5JS1A 3SUNA 2UU9K 1EO1A 3FFKB 1UAXA 4IOAL 3CM6A 5LJWA 3HZ6A 1OH5A 4BQLA 3MN7A 3JSMA 3AVCA 4AM7A 4JD2B 4YY3K 5CZ2A 4CGJA 4J2EA 4BGBA 3OHRA 4RW7A 3O3GA 1D4XA 5J2NA 4V19S 1KAXA 3ATUA 3C6AA 4FW1A 4AF1A 1T6DA 5J2MA 5JMVA 1OH6A 1XMQK 4F2SA 2O8CA 4G9ZA 2HF3A 3KTQA 5EOYA 5AQYA 1NK7A 3DI6A 1J53A 2NLXA 1NK9A 1BCMA 3PX0A 1XMOK 3EY1A 1NGBA 1S5JA 1NG9A 4W5QA 5DM7L 5JVGL 4DV4K 1D8YA 2QKBA 4B9VA 4H5VA 2EHGA 4E7KA 1QQCA 1VAZA 3C7NB 3DAWA 4Z4EA 3I55N 4KHNA 4DLEA 3VEOA 3V81A 1QVFM 4DCHA 3QBXA 1QZ5A 5CR4A 1HKGA 4ICLA 5LMNK 1RT5A 4H4MA 3DOKA 2WOMA 5TKYA 3OYJA 3Q7CA 3CHWA 2I5JA 5FPMA 4BVOA 1CZ9A 1BQMA 3SQ0A 4Z4CA 1KFDA 3ZSVA 1KRPA 2DPNA 3ENOA 3P1GA 1KD1O 2W6LA 4JEPA 5AQVA 1REVA 3ZT3A 3OTOK 4JI6K 2E88A 1LAVA 4YOUA 4OKKA 4BRAA 2X74A 4OKEA 2ITMA 1F21A 1HPMA 4LF6K 3GDQA 2HF4A 4DR3K 1WB9A 2D0PA 4CEEA 1V4SA 4DFPA 3NF6A 5CE3A 4CJ5A 5BREA 3E01A 1V4TA 3RSEB 3JAMO 1TKDA 1NBWA 4OVLA 2ZWHA 3F73A 3L4QA 1SAZA 5F2RA 1VQPN 2DFHA 1C0TA 3VEZA 1VRUA 2P9UA 1T05A 1NGHA 1JLCA 1OVQA 4O5FA 3I8DA 1B92A 4FYDA 1KAYA 4DFJA 3LDNA 4GV3A 3PX6A 3ASMA 3I33A 3MCAB 4R5PA 2UUBK 3TAGA 1HNWK 4E7HA 3ZT0A 1WN7A 2KHOA 3U9ZA 4N56A 3CD6N 1RDDA 1TK5A 3CI5A 2D0CA 4H03B 2XHBA 4N41A 4B1UB 3AVMA 2V51B 4HUEA 4CGHA 1TKTA 3VA3A 3THXA 2X78A 4BR4A 3CFRA 4LSLA 3GBTA 4PL7A 1C0UA 3M5RA 3V1RA 1U2VA 2JGUA 4CIFA 4JNEA 3NE6A 3T3FA 4M3ZA 3HYFA 2UXCK 3SQ4A 3EYZA 1NWKA 2V7ZA 4FPAA 1HMVA 1Q81O 4BWMA 2VG5A 4YDUA 5AZIA 3LANA 4A2BA 1W97L 3CPEA 1L3TA 1XC3A 3HPGA 2CH6A 4JRQA 1EWQA 3SAFA 1RDAA 3A5LC 4FVUA 3GE1A 1RDBA 3U4LA 1MWKA 2O8FB 3SCXA 4EHUA 3VETA 3VF2A 2HHTA 1RT1A 1NGGA 4OPAA 3HVTA 1GLFO 1WOQA 3DLEA 3K5OA 4A59A 4OPHA 1TL1A 3ZSXA 3BUZB 3H08A 3QEXA 1QS4A 1YIJN 3FLCO 2NUBA 5AQKA 3K9JA 4HVJA 2W41A 2P9LB 4MFBA 1X3NA 4IO8A 1QSLA 3TAEA 4CJ3A 4I2PA 1VQ4N 2ZJPL 4CK2A 3QEWA 3SJHA 1HJRA 3NF8A 2WUSA 4CZJA 3DXMB 1DLOA 4FSVA 1C0FA 1JCFA 3GL1A 3WQUA 3ZSQA 4FL9A 2YJFA 5ADXA 1UWBA 3KIOA 3F2KA 3O4WA 2D4WA 3UE5A 4DS4A 4LH4A 1S1TA 1WBDA 3DWLA 3HJFA 3KHYA 3CFOA 3N4PA 2FSKA 3SAGA 3EKSA 2A42A 4WFAL 4LF9K 1HR0K 3D45A 3E66A 1X9MA 2BH1A 4DSEA 3KLFA 4NCBA 2ZGYA 2E5LK 1GLAG 3RMBA 2P9SA 3KWIA 1X9WA 3AVLA 2A1RA 2IAJA 1IBLK 4MDBA 3OS2A 5M1OA 4H0YB 2YHWA 3AVGA 3I56N 1C1CA 3L3VA 3UKUB 5HL7L 1XWLA 3PO4A 4JRPA 1LOTB 4FJGA 5EY4A 2FF3B 2KKZA 4JI7K 4U7BA 1OKJA 1IG8A 1UOCA 3LALA 4K0KK 4IFEA 4XH5A 4OX9K 1NOYA 3OBWA 5AQOA 4YOVA 4CJLA 4DSIA 1NGFA 4YOXA 3ENBA 4H0PA 1YUWA 5C24A 2QWPA 1RT4A 3GG4A 1NJYA 5LY3A 2ZJRL 1UA1A 3SUOA 3AVHA 3QEPA 4LFAK 3VTIA 3SMSA 2IGIA 1RTDA 4MO5A 4CK1A 3NF9A 3SZ2A 3HI0A 3S3MA 1HKCA 1ITGA 3QFUA 5EX5A 3O9UA 3LPTA 2HW3A 4BRQA 5GIOA 2YHXA 3AV9A 1HNVA 4CHQA 3M1FA 1FK9A 1SL0A 3VENA 4BG8A 4RG8A 4H4OA 4B8CA 2GWKA 5KQDA 4CEDA 2QW9A 4K25A 4OGEA 3VF6A 2G8WA 3L2WA 3TSQA 1NJXA 2FLOA 5JLHA 4JYAK 1P8ZA 4CZLA 1RBVA 3M8PA 4CZKA 1XHZA 2QA4N 1QQNA 5SWMA 2D0OA 3BF1A 4BDPA 4ELTA 4FWPA 1U47A 3DJCA 2YHBA 2JWLA 4PKHA 4U67L 1RTJA 1WUAA 2GUPA 4FWMA 3AO1A 4M63C 4RW6A 1BIZA 3T69A 3PIPL 3AVJA 3RRGA 3P5JA 4CJSA 1S72N 3W3DA 5AQRA 3S3OA 3ZX0A 4Z4GA 2XY8A 2X6SA 5M1PA 1T8EA 3WXKA 3LDQA 3CJ7A 4EZ6A 2D0BA 3BZCA 1VSHA 3TSPA 4PWDA 2Q1NA 5GAGP 3AA5X 1WAFA 3TAMA 5HRSA 3J7YP 3UB5A 4LD0A 5MLCQ 3LAKA 1S6QA 4OLAA 2EWSA 2I7PA 4CEOA 4CFCA 1ZC6A 4A57A 2RF2A 5GAEP 1IH7A 3OVNA 4DMNA 3OYAA 1VQKN 2QEXN 1RT6A 4B08A 1LW2A 3D7EO 2P9UB 2Y1JA 4EIAA 1VQ9N 4DFMA 3IRXA 5BN8A 3LDPA 3E9OA 2IIRA 3R6MA 2D5RA 1WAJA 4WYBA 4DG1A 4EFHA 3CCMN 1DGKN 5FPDA 5J2PA 2ZD1A 2GX9A 3LP0A 3QB0A 3MEDA 5CYMA 2O8FA 1U4BA 3FZKA 4CGDA 2E2NA 4Y1DA 3CXCM 4DSFA 3CPWM 1Q18A 3THXB 1NKEA 3A0IX 5I3UA 2QWLA 4LF7K 5IT9O 2GTDA 4YFUA 1U2VB 3O6WA 5AQSA 3M3ZA 4KTZA 4BROA 2D0AA 4QS7A 5BPNA 1ESVA 4DTSA 3QIPA 1LCUA 2Q0RA 4PKGA 2P9LA 3KK1A 3SPYA 5AZIB 5CZ1A 4KHSA 1KCFA 3OYHA 2YNIA 3FR0A 5AQMA 3HTVA 5AQZA 4BC4A 1KFSA 3VQ7A 4KRFA 4LY7A 2QWRA 4W5OA 1S6PA 4O55A 4FLWA 3O8MA 4DTUA 4E7IA 4FJ9A 3EZ5A 4F2RA 1W7AA 2GEMA 4DTMA 4BC5A 4CGGA 3G4SN 1HRHA 1SZ2A 4EHTA 4W5RA 2O4IA 4M3UA 3OY9A 3SBTA 4HCCA 5BN9A 3VOVA 1BWFO 4FW2A 1JLAA 1ZBUA 3H46O 1FXXA 3HP6A 3V9ZA 1VQ6N 4KBOA 4JKDA 4FO0A 4DTOA 4DKWA 4E89A 4CEAA 2KFNA 4JI2K 4DQRA 5GAHP 3QFPA 4RW8A 2P9PA 3ZT4A 3NH2A 3B6PA 3MX2A 3WUHA 5KTQA 3HOSA 3MEGA 5C42A 3O4QA 4FWKA 3TTCA 3WEEB 1BG3A 2HBKA 4CFDA 4KH6A 4CHYA 3RWUA 1WSJA 1B9FA 4ISGA 1J6ZA 4MLHA 5C10A 3BGRA 2RPIA 4O0IA 3NFAA 3KD1E 2OZSA 4B9UA 4BRFA 1JXEA 4H0OA 4JK8A 3TPQA 1QE1A 4O4GA 5ADXH 2P9SB 4B9QA 4M3TA 1K6YA 3IAYA 4HUFA 4YHHK 3VGMA 4NCGA 4E1MA 1BO5O 5KI6A 2ZQBA 3SYZA 1JL1A 1HQEA 1VSLA 1NK4A 3DRPA 1S1UA 1IKVA 4DQPA 4CHPA 4E1JA 2HHUA 2VGMA 2IVPA 4XIUA 1NGIA 2QXLA 3ULEA 3DLHA 3D2EA 3DOLA 1JXBA 4CJPA 4FM2A 4X65K 5BRFA 5E41A 2NRZA 2A3ZA 3VQDA 4FJNA 2OA8A 4KREA 1G15A 4KTWA 4W5NA 3FFIA 2ZE2A 3ID8A 3SJJA 3WQTA 3AA4A 2HVHA 3VMFB 1VRTA 2ASOA 1YHQN 4NLCA 1T44A 4OPJA 4AHUA 3LZJA 3SNNA 3ISNC 1VQ8N 2PBDA 4JAXA 3I0SA 4JKBA 3H45C 4FVMA 2G8KA 4PA1A 1NLVA 4CZGA 2IC3A 1QSYA 1HPZA 1LWCA 3V6DA 4BR7A 1HJOA 1YTUA 3J80O 1WSIA 5HRPA 5BRDA 3VERA 3TTFA 3P31A 5KQ8A 3TSUA 4OJRA 2HBMA 3FZLA 4WQ5A 4Z4FA 3RMCA 2RE2A 1NOZA 3P4IA 4MQ3A 4FLUA 2UXBK 1IG9A 4FJIA 3FE1A 4PQUA 4JHDA 2NRTA 4CJ4A 2OZMA 2G8UA 4BR9A 4CJFA 1C0MA 1C1AA 3WNFA 3NGZA 4O8UA 1A5WA 1W2BM 4LH5A 1BA0A 2Z1GA 5AQNA 3O1BA 4KH5A 1RDWX 2E2OA 2KTQA 3MN5A 5HRRA 3OYDA 5C0YA 4BRHA 4NLBA 3EO3A 2E1YA 5J2QA 1DKGD 3AVFA 3NBPA 3THWA 2E2QA 5C25A 4FZZA 1S22A 4HWIA 4H0VB 3CM5A 3QINA 3IKMA 4FPBA 3C0BA 1NK6A 2HNZA 3J7ZO 3QNOA 1HYZA 1NGEA 4Z4HA 4WQ4C 1X1PA 3EL2A 4ZTFA 4DV0K 4CF1A 1ZBHA 5IWAK 3VTHA 1UA0A 1N5YA 3KWGA 3VN5A 1NJZA 3SLCA 4BRIA 3OS1A 3L4IA 4QOZB 3HSCA 5AZJB 2FBVA 4M7YA 3O1WA 1L3SA 1HUXA 3O9QA 3TAFA 3E1YA 3ITHA 3IS9A 1ASVA 1EXQA 1BI4A 2IS3A 5AFUA 4O0JA 3TAQA 3VQEA 5HLFA 1FW6A 2F7TA 3MAQA 1DT9A 1OVYA 3QIOA 4PHTX 3TANA 2QWQA 3TABA 2BDPA 1HNXK 5C2FA 2BTFA 4M3RA 4C1NI 3AO2A 3DLGA 1VQ5N 2O4GA 4BG9A 3HRGA 3VQ8A 3CCVN 3U6FA 5AR0A 4FLXA 3J8AA 1HNIA 1TAQA 5AQQA 4UQGA 2P9KA 4FZYA 3QEIA 4KHPK 4DV6K 1BHLA 2E8AA 3DLLL 4OO1J 2FC0A 5D3GA 3CCRN 1YITN 4FWRA 3OJSA 1YJWN 1N8RO 3NCIA 4DS5A 1ZYQA 4CJRA 3RR7A 3OYIA 1GLDG 3KK3A 3V9UA 2E20A 1MWMA 3HPHA 1QVGM 3DLRA 1RCHA 4MDAA 1SL1A 3G0ZA 3VGKA 2DTUA 1KAZA 4CECA 2P9IB 3LWLA 3EZWA 1LV5A 4KB1A 4FJLA 1KTQA 1MU2A 4ISEA 3RMDA 5EXWA 4HHTA 1Q86O 4N47A 1GLEG 2P5GA 5EU7A 1CLQA 3NGYA 3FZMA 1FKOA 3G10A 1KSPA 3MWTA 5CY4A 1HKBA 4DU1A 4FXDA 4IFYA 4BQZA 1IKYA 2VG7A 4BRDA 1GOAA 3NVKA 4BRPA 4A5AA 3AA2A 4AHSA 3CQ8A 4JI8K 3CETA 5I9EB 4FK2A 3LPUA 3MK6A 3WEEA 4KV8A 4B1VA 1K8KB 2ATQA 4NXMK 1ZBIA 1SKRA 4H0TB 5BPLA 4I9QA 3H3NO 2EX3A 3O9RA 3ZETA 2BANA 3VQBA 4CE9A 3SAHA 4ZHRA 1R59O 5M1KA 3R9PA 3T7ZA 4KI4A 5J1EA 2F8SA 1LWEA 4CJEA 3BZKA 1SKSA 3OYKA 4WFBL 1YTAA 3MXIA 1WSHA 1SQKA 1S3XA 4CFBA 1LW0A 4ISFA 3CCUN 3P39A 2YCHA 2P9PB 4JKGA 2FSJA 3QLHA 4BRMA 2FSNA 4GY2B 1VQNN 3ZEUA 4C8MA 1J9AA 3K59A 3CC4N 3AVNA 4Q5VA 2GBZA 1Q82O 3K5MA 1KLNA 1BIUA 4ILGB 5AQXA 1RBUA 4X62K 4FLTA 3S41A 4EZ9A 4BVPA 1U49A 1Q8IA 2A1SA 1QZ6A 3PV8A 5AQJA 3IG1A 3O3HA 1JCEA 5DMRA 1U04A 3CCEN 2Z1JA 4BC3A 3KKSA 4B3RK 3HP9A 4JI0K 3TI0A 2WTUA 3E9LA 3O3FA 3DMJA 4O5BA 5GINA 3ULEB 1SUQA 3D2EB 4CIEA 3SUPA 2O8EA 4CBWA 1G99A 4FWNA 4DQQA 4CEFA 1SKWA 5AQTA 3AARA 1TL3A 1J5OA 4JKEA 5AJ3K 3VQ5A 4BDZA 1TKXA 3CCQN 4B3OA 4C1NK 3HL8A 3DXKA 4FJ5A 4NXNK 3UIQA 2E6MA 5C15A 3RVCA 4LFCK 3MXJA 4CCHA 4CZEA 1RDUA 2NRHA 1JKHA 5AQWA 3VQ4A 2FXUA 4RWTA 3JXUA 4DQSA 4UY8O 1TKZA 3K5LA 2YHAA 1VSEA 4M3WA 2F8TA 1JCGA 3O4NA 1Z6RA 1CXUA 1YXQA 1RFQA 2ITGA 4IJAA 3U8XA 4BE0A 3C95A 2HB5A 3H3OB 3MCPA 1VQLN 2NRVA 3V1OA 4O44A 2CH5A 1K8AO 4IG3A 4CJ7A 2HHXA 2KZZA 4JHDB 2XY6A 1GLBG 3C65A 4Y1CA 3SV4A 3LDSA 1SS6A 4KO0A 4NB4A 3SMPA 3KLGA 4LF4K 3MMVA 4WQ4A 4AH9A 3QICA 3AGKA 4DUZK 3NDKA 4DV3K 4B9TA 1T3VA 3OS0A 1MA9B 5AZJA 3BP8A 1JLEA 1SV5A 4CZMA 4B3MK 2ZF5O 3HXMA 2VQEK 3THWB 4I2QA 3THYA 1GOBA 2B6AA 2Q36A 4IO9L 1O13A 4A62A 3KJVA 1EKEA 1YJNN 2IDOA 5AQGA 5HOOA 4BR2A 1ASUA 4FJMA 4TSXA 4LF8K 3AO3A 3BF3A 4LSNA 3J81O 2NRRA 4DV2K 4FM0A 3AAQA 2YHYA 4DWIA 4DR5K 5KPZA 1TYQA 2F96A 4JI5K 1WSGA 4JV5K 4ID1A 3R3LA 2YKMA 3A5OC 5M1QA 3KLEA 4BDYA 3TU5A 2HHQA 4E1NA 4ELVA 2RHKA 2P51A 3AVBA 3U3GA 4M45A 1BI4B 4YOTA 1EETA 5LJVA 3OBYA 4B8AB 4CJKA 1WSEA 4CK3A 4BREA 1YAGA 1XHXA 5AQFA 3Q7BA 1S1WA 3S3NA 5FROA 1TK0A 4GNIA 3CJ1A 2ETJA 4JKHA 1VSIA 5EVZA 3KLHA 2YJEA 4F8RA 4RTFD 2P9IA 4DTPA 1YI2N 3WT0A 3DLKA 1TV6A 4K43A 5AFUH 2B4JA 4J2AA 4QAGA 3A5MC 2QWMA 3L8BA 2IVNA 2B5JA 3W0LA 1Q9YA 3CF5L 2P9KB 3A8YA 4Z4IA 1J5EK 3H1QA 2D1KA 3ZT2A 3K57A 4C8OA 4FK4A 1KLMA 1DTQA 3F9KA 3CQXA 3P38A 1VQ7N 3HSTB 1VQON 4BR0A 3OYLA 4C8LA 4BRNA 3K0SA 3RR8A 2GUIA 1YJ9N 3HK2A 3ZSWA 4CF9A 3A5NC 1Q7YO 2G8HA 1K8KA 4CFAA 3AVAA 1WNSA 1I94K 4KHYA 4O8KA 5BR9A 1RBSA 3OYEA 2WBNA 4DR6K 1NK5A 3IUCA 4K41A 2G8FA 2P9NA 4B9LA 3VEWA 4BRLA 3U9DA 1Z25A 3OYGA 1D9DA 4CEQA 1BOTO 3TWHA 3CFPA 4PUOA 4FJ8A 4LFBK 4DV7K 3BDPA 5JICA 1DTTA 3ALYA 3VGLA 5FPNA 2R7YA 2BUPA 4AHTA 4Y0WA 3B8AX 4K8XA 5T7BA 3U3YA 4EAHD 4N5SA 4DSJA 3CERA 5AQPA 2A40A 3L6QA 1N32K 5KRTA 3G6EN 3DM2A 3I8BA 4A2AA 1RT3A 3NH0A 2I7NA 3UKRB 3MN6A 2KZMA 1YT3A 3L3UA 3ZETB 3AA3A 1CZBA 4GVEA 5FRNA 2P1JA 3QETA 2KLAA 4CHZA 5LL6Z 4KHQA 2YNGA 2FBXA 3T1AA 4Z0UA 1ZBFA 4K42A 4DQ8A 3PLAA 1JLQA 4I6MA 4CESA 2YI1A 4IWVA 3LAMA 2W40A 4JKGB 4M3XA 2Z1IA 4WFNL 2NRXA 2F9WA 2HSTA 4FOIA 4DSLA 4IEIA 1RDCA 4RW4A 3VQ9A 3ZEUB 1C1BA 3QNNA 4NYNA 1VK0A 4H5RA 4F3OA 5I42A 4DB3A 2HMPA 4F3TA 4KKOA 3QO9A 5FRMA 2HOEA 4AM6A 1ATNA 1QTMA 4JKCA 1K73O 3D0PA 4BY9C 1RNHA 4M7XA 4JI3K 3HM8A 4GKJK 4IZ9A 2VWBA 4CF8A 1N6QA 2YNHA 1S9EA 2PY5A 1EX4A 3HBTA 3V9XA 1DEJA 3O9SA 3AGRA 3WXLA 1HNZK 4BE1A 3EEQA 2O8EB 4ZTJA 1Z26A 4KPYA 1A5VA 1HLUA 4B1ZA 2OYQA 5JVHL 1TVRA 2KQ2A 2BGGA 1JLBA 1JJ2M 1KC8O 5HROA 3D2FB 3KK7A 4CVNE 1KVAA 5JLFA 4E19A 4ID5A 2Q2RA 4M3YA 3R8EA 1YF5L 3VQ6A 4LF5K 1RILA 3VQCA 3AAPA 3SV3A 4L3QA 3L2VA 4LC9B 3DXKB 3N4QA 4EP4A 2F4VK 3KKRA 1T7PA 1QQOA 3CCLN 5C12A 1NJIO 4ELUA 2HBJA 3BY5A 4EP5A 2E6LA 5KPTA 1SL2A 5KPRA 1XQSC 5AQIA 3HPOA 1GLJO 4OLBA 3O5BA 1OH8A 2OPRA 3OYFA 4GW6A 1EQYA 4A5BA 4B9NA 3OYCA 4FOEA 3FZHA 2AA4A 4H8KA 1KQSM 4FJHA 2H3GX 5C2DA 3HVRA 4AHRA
chains in the Genus database with same CATH topology
4FK0A 4FK2A 3LPUA 4CJUA 4KV8A 3AO1A 1T03A 2ATQA 1ZBIA 4OKJA 1XI1A 1SKRA 2VWKA 4RW6A 1QHTA 1BIZA 4CF2A 3M8RA 4I9QA 2DFFA 2Q3SA 2EX3A 2QKKA 3QERA 4FZXC 3AVJA 4CHOA 4CJVA 2BANA 4CERA 2HHVA 3VQBA 3VQPA 4CE9A 4FLVA 3S9HA 3P5JA 3RRGA 1BL3A 2YNFA 4CJSA 4ZHRA 5HP1A 3NAEA 1J54A 1L5UA 3S3OA 4C8KA 2VG6A 4KFBA 4KI4A 2XY8A 5J1EA 2X6SA 4Z4GA 5K14A 1T8EA 2PYJA 1LWEA 3KK2A 2F8SA 4CJEA 4KHUA 1SKSA 3OYKA 2KFZA 1O1WA 1YTAA 1KVBA 3I0RA 1WSHA 2D0BA 1VSHA 1RTIA 3MXIA 4EZ6A 4CFBA 1LW0A 4DFKA 3SPZA 4PWDA 3AA5X 1WAFA 2Z1HA 1IO2A 4FJXA 3TAMA 5HRSA 4JS4A 4LD0A 1Y97A 3LAKA 3QLHA 1XC9A 1NKBA 4CJTA 4FLZA 1LWFA 1S6QA 1J9AA 4C8MA 3K59A 3AVNA 1HQUA 4DU4A 4OLAA 4Q5VA 1ASWA 2GBZA 3MEEA 3AO4A 2OPQA 4CEOA 4CFCA 3K5MA 4KAZA 3PY8A 2FBYA 3B6OA 1BIUA 1KLNA 1IKXA 1D5AA 4CGFA 1RBUA 4CEZA 4FLTA 4GMJB 3V9SA 2G8VA 1R0AA 4M3ZA 2RF2A 3MECA 4EZ9A 4I7FA 3DRSA 1U49A 1Q8IA 2QXFA 2A1SA 5CYQA 1IH7A 3DRRA 3OVNA 3PV8A 4DMNA 4CGIA 3OYAA 3K5NA 5HRNA 1RT6A 4B08A 1LW2A 3IG1A 1U45A 3O3HA 2HMIA 2Y1JA 5DMRA 1TAUA 4DFMA 4IBNA 1U04A 3IRXA 4G1QA 5KGWA 4HUGA 2Z1JA 1HYVA 1WLJA 4E3SA 4YNQA 3KKSA 3LP1A 1HYSA 3HP9A 2HNDA 3CG7A 2D5RA 4DU3A 1WAJA 3TI0A 3ZT1A 3O3FA 3DMJA 3SI6A 4O5BA 4DG1A 1RTHA 5JS1A 1SUQA 3SUNA 4CIEA 5FDLA 3SUPA 1YVUA 2ZD1A 5J2PA 3LP0A 4DQQA 1UAXA 3MEDA 5CYMA 4C8NA 3V9WA 3CM6A 4CEFA 4E0DA 1SKWA 3TARA 4FJ7A 3SUQA 1U4BA 1BQNA 4CGDA 2RKIA 1TL3A 3JSMA 2OPSA 4Y1DA 3AVCA 4DSFA 1J5OA 1EP4A 3VQ5A 3L2RA 4BDZA 4FCYA 1TKXA 2OPPA 5CZ2A 4CGJA 2VWJA 4J2EA 2X6NA 1NKEA 5I3UA 4NYFA 4RW7A 3O3GA 4B3OA 5J2NA 4YFUA 4AHVA 3HL8A 4KTZA 4FJ5A 4FW1A 4E7LA 3UIQA 2D0AA 4JLHA 2HHWA 1A5XA 2E6MA 5J2MA 2XY5A 4CHNA 4DTSA 4F2SA 4GVMA 3QIPA 3HT3A 3KK1A 3KTQA 3SPYA 4DTJA 5CZ1A 1NK7A 3DI6A 1KCFA 4KHSA 1J53A 3MXJA 4QCLA 3OYHA 4JS5A 4CCHA 1NK9A 1BCMA 2YNIA 3PX0A 3EY1A 1S5JA 1JKHA 3VQ4A 4W5QA 3ZCMA 4DQSA 1D8YA 1TKZA 2QKBA 4B9VA 3K5LA 3QEVA 2YHAA 1VSEA 1KFSA 4M3WA 3O4NA 2EHGA 4E7KA 2F8TA 1QQCA 1CXUA 2ITGA 4Z4EA 4KHNA 3VQ7A 4HTUA 4BE0A 2QK9A 3C95A 4LY7A 2HB5A 4W5OA 4DLEA 3V81A 4KRFA 1S6PA 4O55A 4FLWA 3V1OA 2XO7A 4O44A 4DTUA 5JS2A 4ICLA 4BWJA 4E7IA 1RT5A 3EZ5A 3RRHA 2KW4A 4F2RA 4IG3A 4H4MA 3OJUA 4FJ9A 3DOKA 2HHXA 4DTMA 2WOMA 4DLGA 4CGGA 4OGCA 3OYJA 2KZZA 2XY6A 1HRHA 3TR8A 4Y1CA 2I5JA 4W5RA 3SV4A 2O4IA 3PO5A 4M3UA 4CF0A 3OY9A 3SQ1A 1RT7A 3LDSA 3MXMA 3KLGA 1CZ9A 1BQMA 4KO0A 1BCOA 4HCCA 4AH9A 3SQ0A 4Z4CA 4FW2A 1JLAA 1KFDA 1ZBUA 3ZSVA 1KRPA 3P1GA 2G8IA 3DLBA 3NDKA 4B9TA 1FXXA 3HP6A 3V9ZA 4DTOA 1REVA 2W42A 3ZT3A 3OS0A 4E89A 4CEAA 3LWMA 2KFNA 1LAVA 4DQRA 4OKKA 1JLEA 4DF8A 1SV5A 2X74A 4OKEA 4RW8A 3PX4A 3ZT4A 3C94A 4DTXA 3L2UA 1CXQA 3B6PA 4I2QA 3NH2A 5KTQA 3HXMA 1U48A 1F21A 3MEGA 3C6TA 1GOBA 3KD5E 2B6AA 3O4QA 5C42A 3KJVA 1EKEA 4CJQA 3M8QA 3M8SA 1TK8A 2IDOA 4CEEA 3AO5A 4CFDA 4CHYA 4DFPA 3NF6A 3RWUA 1WSJA 1B9FA 4CJ5A 3E01A 1ASUA 4FJMA 4TSXA 4AHCA 3ZSYA 3AO3A 1TKDA 4OVLA 3BGRA 2RPIA 4O0IA 2XY7A 3NFAA 3KD1E 2OZSA 4LSNA 3F73A 1D9FA 3VA0A 4B9UA 4BE2A 1JXEA 2DFHA 1C0TA 3THVA 2HVIA 1QE1A 3NGIA 4FM0A 4O4GA 1VRUA 1T05A 4IDKA 3LP3A 4DWIA 4M3TA 1K6YA 1WSFA 4J2DA 1JLCA 3IAYA 5KGXA 4HUFA 3I8DA 1B92A 4FYDA 2F96A 2FBTA 4NCGA 1WSGA 4E1MA 4PY5A 5KI6A 3ULDA 4ID1A 4DFJA 2ZQBA 3SYZA 2YKMA 1BISA 1JL1A 1HQEA 1VSLA 3KLEA 4BDYA 3DRPA 3PX6A 1NK4A 4J2BA 2HHQA 1S1UA 1IKVA 1GOCA 4E1NA 4DQPA 3ASMA 4CHPA 4ELVA 4N76A 2HHUA 4XIUA 4DTNA 4R5PA 4FJJA 2P51A 1Q9XA 3TAGA 3AVBA 3DLHA 3DOLA 3U3GA 4E7HA 4M45A 1JXBA 1WN7A 3ZT0A 1BI4B 4CJPA 1EETA 4FM2A 4N56A 4DQIA 3L2QA 5E41A 4B8AB 1RDDA 1TK5A 4CJKA 1WSEA 2D0CA 4CK3A 4FLYA 3VQDA 4FJNA 1XHXA 2OA8A 2YV0X 4KREA 1G15A 2XHBA 4KTWA 4W5NA 1S1WA 4N41A 3S3NA 3AVMA 5FROA 3FFIA 2ZE2A 4HUEA 1S1VA 1TKTA 1W9HA 4CGHA 3VA3A 1BGXT 3SJJA 2X78A 1TK0A 3AA4A 3LZIA 3QESA 2ETJA 3CFRA 2HVHA 1VRTA 1VSIA 4LSLA 3KLHA 1LAWA 1C0UA 3V1RA 4F8RA 2JGUA 4DTPA 4OPJA 4CIFA 3CYMA 3NE6A 4AHUA 3LZJA 3DLKA 1TV6A 3AVKA 3HYFA 3ISNC 3T3FA 3SQ4A 3SNNA 3EYZA 2B4JA 4KTQA 4B9MA 4QAGA 4DTRA 4J2AA 3L8BA 1HMVA 3I0SA 4BWMA 2B5JA 2VG5A 1Q9YA 1JLFA 3LANA 4RW9A 2G8KA 4FVMA 4PA1A 4Z4IA 2PZSA 1L3TA 2IC3A 3OYBA 3HPGA 4JRQA 1QSYA 1HPZA 1LWCA 3ZT2A 1RDAA 3V6DA 3K57A 4C8OA 1RDBA 4FK4A 5HBMA 1VSJA 1YTUA 1KLMA 1DTQA 1I3AA 3F9KA 1WSIA 3SCXA 5HRPA 3HSTB 1RT1A 2HHTA 1QSSA 3NF7A 4OJRA 3OYLA 4C8LA 3HVTA 3K5OA 3DLEA 3WNHA 4HCBA 1L3UA 1TL1A 3ZSXA 1VSFA 3RR8A 4Z4FA 3RMCA 1NOZA 2GUIA 4MQ3A 4FLUA 3H08A 1RBTA 1IG9A 3QEXA 4B9SA 1QS4A 1W0HA 4FJIA 3HK2A 3ZSWA 4IKFA 4PQUA 3A2FA 4BACA 2NUBA 4CF9A 4IG0A 1X9SA 2G8HA 3VQAA 4CFAA 3AVAA 3HO1A 1WNSA 4KHYA 1RBSA 4CJ4A 2OZMA 2G8UA 4HVJA 4CJFA 1C0MA 4MFBA 3OYEA 4AILC 1C1AA 3WNFA 2YKNA 3NGZA 3TAEA 4CJ3A 4I2PA 1QSLA 1A5WA 1VSMA 1NK5A 4LH5A 2HHSA 2Z1GA 3ZSRA 2G8FA 4B9LA 4CK2A 3QEWA 4KHWA 1Z25A 1HJRA 3NF8A 3OYGA 1D9DA 1JL2A 4CEQA 3TWHA 2KTQA 2GV9A 1DLOA 3NH1A 3CFPA 5HRRA 4I9LA 4PUOA 3OYDA 4NCAA 4FJ8A 3BDPA 1S9GA 1DTTA 3ALYA 3ZSQA 1VSKA 5J2QA 3AVFA 3NBPA 3SQ2A 1UWBA 3KIOA 5C25A 4FZZA 2R7YA 4AHTA 3CM5A 3QINA 3LP2A 1NK8A 5T7BA 4DS4A 2E4LA 1NK6A 4K8XA 4LH4A 2HNZA 3U3YA 4N5SA 1S1TA 4DSJA 3QNOA 1L3VA 3HJFA 1HYZA 3DYAA 2P5OA 3CFOA 3ZSZA 4Z4HA 5KRTA 1X1PA 3DM2A 4M41A 4ZTFA 1RT3A 3NH0A 4CF1A 2KZMA 1YT3A 3D45A 3L3UA 1X9MA 1ZBHA 4DSEA 3KLFA 3AA3A 1UA0A 1CZBA 2JLEA 1N5YA 4NCBA 5FRNA 3RMBA 3VN5A 3WNEA 4WE1A 1NJZA 1X9WA 2P1JA 3AVLA 3QETA 2A1RA 4E7JA 4CHZA 4KHQA 3OS1A 2IAJA 2YNGA 2FBXA 4QOZB 3OS2A 3V1QA 2FBVA 1L3SA 3AVGA 1RT2A 3T1AA 4Z0UA 1ZBFA 3KLIA 4OPKA 3AVIA 3WNGA 1NK0A 1KVCA 3TAFA 1C1CA 3L3VA 4FJKA 2RN2A 3NHGA 1JLQA 1XWLA 3ITHA 3K58A 4CESA 3PO4A 3IS9A 4JRPA 1ASVA 4KI6A 4FJGA 1EXQA 3LAMA 4M3XA 3VQQA 1BI4A 2IS3A 1B9DA 2Z1IA 4O0JA 4IFVA 4DSLA 2Y1IA 2HNYA 1RDCA 4RW4A 3VQ9A 1VSDA 3TAQA 3VQEA 5HLFA 1UOCA 3LALA 3RTVA 3MAQA 1C1BA 3QNNA 4NYNA 1VK0A 4F3OA 1NOYA 3QIOA 5I42A 3TANA 4CJLA 3TABA 2BDPA 4KKOA 2PYLA 4F3TA 4DSIA 2IOCA 5KRSA 3QO9A 4M3RA 1FKPA 1IKWA 2DFEA 1RBRA 5FRMA 3AO2A 3RMAA 1QTMA 3DLGA 5C24A 3P83D 2O4GA 3OYMA 3D0PA 4CJWA 3VQ8A 1RNHA 1RT4A 4KB0A 4M42A 3U6FA 4FLXA 4Q0BA 1NJWA 1NJYA 1I39A 4CF8A 1HNIA 1ZBLA 2YNHA 1UA1A 3SUOA 1N6QA 3AVHA 1S9EA 3QEPA 1TAQA 4UQGA 2PY5A 4FZYA 1EX4A 3QEIA 1BHLA 2IGIA 3V9XA 1RTDA 4DSKA 1JLGA 5DK5A 4CK1A 1C6VA 3OYNA 3NF9A 2FC0A 3SZ2A 5D3GA 4BE1A 3S3MA 1Z26A 2BE2A 4ZTJA 1ITGA 1A5VA 4F4KA 4KPYA 3OJSA 4W5TA 2OYQA 1TVRA 2KQ2A 3LPTA 1TGOA 3NCIA 2BGGA 2HW3A 4DS5A 1ZYQA 1JLBA 4CJRA 3JYTA 3RR7A 3AV9A 1HNVA 4CHQA 3OYIA 3HM9A 5HROA 3KK3A 3V9UA 1KVAA 2WONA 3HPHA 1FK9A 3DLRA 4E19A 1SL0A 4L8RB 1RCHA 1SL1A 4ID5A 3G0ZA 2DTUA 2DY4A 4CECA 3LWLA 4M3YA 3TAPA 1LV5A 4KB1A 4FJLA 3VQ6A 1KTQA 2XRIA 1MU2A 4RG8A 1RILA 4H4OA 3VQCA 4B8CA 4HHTA 3RMDA 3SV3A 4N47A 5SZTA 3L2VA 4EP4A 1S1XA 3T19A 3KKRA 4CEDA 2P5GA 4OGEA 5EU7A 1CLQA 3NGYA 1T7PA 2G8WA 4ELUA 3C6UA 3L2WA 4K8ZA 1NKCA 1FKOA 3G10A 1KSPA 1NJXA 5CY4A 4EP5A 2E6LA 4DU1A 2LSNA 3V4IA 1SL2A 4FXDA 3HPOA 4IFYA 4CIGA 1IKYA 1RBVA 4OLBA 2VG7A 3M8PA 1GOAA 1XHZA 2OPRA 4FM1A 5SWMA 2AJQA 3OYFA 4CEBA 4BDPA 4ELTA 4GW6A 3PUFA 3ZSOA 3OYCA 4DF4A 3AA2A 4AHSA 3CQ8A 1U47A 4B9NA 4H8KA 2YHBA 4FJHA 3HVRA 4AHRA 3K2PA 1RTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FK0 A;  4FK2 A;  3LPU A;  4CJU A;  4KV8 A;  3AO1 A;  1T03 A;  2ATQ A;  1ZBI A;  4OKJ A;  1XI1 A;  1SKR A;  2VWK A;  4RW6 A;  1QHT A;  1BIZ A;  4CF2 A;  3M8R A;  4I9Q A;  2DFF A;  2Q3S A;  2EX3 A;  2QKK A;  3QER A;  4FZX C;  3AVJ A;  4CHO A;  4CJV A;  2BAN A;  4CER A;  2HHV A;  3VQB A;  3VQP A;  4CE9 A;  4FLV A;  3S9H A;  3P5J A;  3RRG A;  1BL3 A;  2YNF A;  4CJS A;  4ZHR A;  5HP1 A;  3NAE A;  1J54 A;  1L5U A;  3S3O A;  4C8K A;  2VG6 A;  4KFB A;  4KI4 A;  2XY8 A;  5J1E A;  2X6S A;  4Z4G A;  5K14 A;  1T8E A;  2PYJ A;  1LWE A;  3KK2 A;  2F8S A;  4CJE A;  4KHU A;  1SKS A;  3OYK A;  2KFZ A;  1O1W A;  1YTA A;  1KVB A;  3I0R A;  1WSH A;  2D0B A;  1VSH A;  1RTI A;  3MXI A;  4EZ6 A;  4CFB A;  1LW0 A;  4DFK A;  3SPZ A;  4PWD A;  3AA5 X;  1WAF A;  2Z1H A;  1IO2 A;  4FJX A;  3TAM A;  5HRS A;  4JS4 A;  4LD0 A;  1Y97 A;  3LAK A;  3QLH A;  1XC9 A;  1NKB A;  4CJT A;  4FLZ A;  1LWF A;  1S6Q A;  1J9A A;  4C8M A;  3K59 A;  3AVN A;  1HQU A;  4DU4 A;  4OLA A;  4Q5V A;  1ASW A;  2GBZ A;  3MEE A;  3AO4 A;  2OPQ A;  4CEO A;  4CFC A;  3K5M A;  4KAZ A;  3PY8 A;  2FBY A;  3B6O A;  1BIU A;  1KLN A;  1IKX A;  1D5A A;  4CGF A;  1RBU A;  4CEZ A;  4FLT A;  4GMJ B;  3V9S A;  2G8V A;  1R0A A;  4M3Z A;  2RF2 A;  3MEC A;  4EZ9 A;  4I7F A;  3DRS A;  1U49 A;  1Q8I A;  2QXF A;  2A1S A;  5CYQ A;  1IH7 A;  3DRR A;  3OVN A;  3PV8 A;  4DMN A;  4CGI A;  3OYA A;  3K5N A;  5HRN A;  1RT6 A;  4B08 A;  1LW2 A;  3IG1 A;  1U45 A;  3O3H A;  2HMI A;  2Y1J A;  5DMR A;  1TAU A;  4DFM A;  4IBN A;  1U04 A;  3IRX A;  4G1Q A;  5KGW A;  4HUG A;  2Z1J A;  1HYV A;  1WLJ A;  4E3S A;  4YNQ A;  3KKS A;  3LP1 A;  1HYS A;  3HP9 A;  2HND A;  3CG7 A;  2D5R A;  4DU3 A;  1WAJ A;  3TI0 A;  3ZT1 A;  3O3F A;  3DMJ A;  3SI6 A;  4O5B A;  4DG1 A;  1RTH A;  5JS1 A;  1SUQ A;  3SUN A;  4CIE A;  5FDL A;  3SUP A;  1YVU A;  2ZD1 A;  5J2P A;  3LP0 A;  4DQQ A;  1UAX A;  3MED A;  5CYM A;  4C8N A;  3V9W A;  3CM6 A;  4CEF A;  4E0D A;  1SKW A;  3TAR A;  4FJ7 A;  3SUQ A;  1U4B A;  1BQN A;  4CGD A;  2RKI A;  1TL3 A;  3JSM A;  2OPS A;  4Y1D A;  3AVC A;  4DSF A;  1J5O A;  1EP4 A;  3VQ5 A;  3L2R A;  4BDZ A;  4FCY A;  1TKX A;  2OPP A;  5CZ2 A;  4CGJ A;  2VWJ A;  4J2E A;  2X6N A;  1NKE A;  5I3U A;  4NYF A;  4RW7 A;  3O3G A;  4B3O A;  5J2N A;  4YFU A;  4AHV A;  3HL8 A;  4KTZ A;  4FJ5 A;  4FW1 A;  4E7L A;  3UIQ A;  2D0A A;  4JLH A;  2HHW A;  1A5X A;  2E6M A;  5J2M A;  2XY5 A;  4CHN A;  4DTS A;  4F2S A;  4GVM A;  3QIP A;  3HT3 A;  3KK1 A;  3KTQ A;  3SPY A;  4DTJ A;  5CZ1 A;  1NK7 A;  3DI6 A;  1KCF A;  4KHS A;  1J53 A;  3MXJ A;  4QCL A;  3OYH A;  4JS5 A;  4CCH A;  1NK9 A;  1BCM A;  2YNI A;  3PX0 A;  3EY1 A;  1S5J A;  1JKH A;  3VQ4 A;  4W5Q A;  3ZCM A;  4DQS A;  1D8Y A;  1TKZ A;  2QKB A;  4B9V A;  3K5L A;  3QEV A;  2YHA A;  1VSE A;  1KFS A;  4M3W A;  3O4N A;  2EHG A;  4E7K A;  2F8T A;  1QQC A;  1CXU A;  2ITG A;  4Z4E A;  4KHN A;  3VQ7 A;  4HTU A;  4BE0 A;  2QK9 A;  3C95 A;  4LY7 A;  2HB5 A;  4W5O A;  4DLE A;  3V81 A;  4KRF A;  1S6P A;  4O55 A;  4FLW A;  3V1O A;  2XO7 A;  4O44 A;  4DTU A;  5JS2 A;  4ICL A;  4BWJ A;  4E7I A;  1RT5 A;  3EZ5 A;  3RRH A;  2KW4 A;  4F2R A;  4IG3 A;  4H4M A;  3OJU A;  4FJ9 A;  3DOK A;  2HHX A;  4DTM A;  2WOM A;  4DLG A;  4CGG A;  4OGC A;  3OYJ A;  2KZZ A;  2XY6 A;  1HRH A;  3TR8 A;  4Y1C A;  2I5J A;  4W5R A;  3SV4 A;  2O4I A;  3PO5 A;  4M3U A;  4CF0 A;  3OY9 A;  3SQ1 A;  1RT7 A;  3LDS A;  3MXM A;  3KLG A;  1CZ9 A;  1BQM A;  4KO0 A;  1BCO A;  4HCC A;  4AH9 A;  3SQ0 A;  4Z4C A;  4FW2 A;  1JLA A;  1KFD A;  1ZBU A;  3ZSV A;  1KRP A;  3P1G A;  2G8I A;  3DLB A;  3NDK A;  4B9T A;  1FXX A;  3HP6 A;  3V9Z A;  4DTO A;  1REV A;  2W42 A;  3ZT3 A;  3OS0 A;  4E89 A;  4CEA A;  3LWM A;  2KFN A;  1LAV A;  4DQR A;  4OKK A;  1JLE A;  4DF8 A;  1SV5 A;  2X74 A;  4OKE A;  4RW8 A;  3PX4 A;  3ZT4 A;  3C94 A;  4DTX A;  3L2U A;  1CXQ A;  3B6P A;  4I2Q A;  3NH2 A;  5KTQ A;  3HXM A;  1U48 A;  1F21 A;  3MEG A;  3C6T A;  1GOB A;  3KD5 E;  2B6A A;  3O4Q A;  5C42 A;  3KJV A;  1EKE A;  4CJQ A;  3M8Q A;  3M8S A;  1TK8 A;  2IDO A;  4CEE A;  3AO5 A;  4CFD A;  4CHY A;  4DFP A;  3NF6 A;  3RWU A;  1WSJ A;  1B9F A;  4CJ5 A;  3E01 A;  1ASU A;  4FJM A;  4TSX A;  4AHC A;  3ZSY A;  3AO3 A;  1TKD A;  4OVL A;  3BGR A;  2RPI A;  4O0I A;  2XY7 A;  3NFA A;  3KD1 E;  2OZS A;  4LSN A;  3F73 A;  1D9F A;  3VA0 A;  4B9U A;  4BE2 A;  1JXE A;  2DFH A;  1C0T A;  3THV A;  2HVI A;  1QE1 A;  3NGI A;  4FM0 A;  4O4G A;  1VRU A;  1T05 A;  4IDK A;  3LP3 A;  4DWI A;  4M3T A;  1K6Y A;  1WSF A;  4J2D A;  1JLC A;  3IAY A;  5KGX A;  4HUF A;  3I8D A;  1B92 A;  4FYD A;  2F96 A;  2FBT A;  4NCG A;  1WSG A;  4E1M A;  4PY5 A;  5KI6 A;  3ULD A;  4ID1 A;  4DFJ A;  2ZQB A;  3SYZ A;  2YKM A;  1BIS A;  1JL1 A;  1HQE A;  1VSL A;  3KLE A;  4BDY A;  3DRP A;  3PX6 A;  1NK4 A;  4J2B A;  2HHQ A;  1S1U A;  1IKV A;  1GOC A;  4E1N A;  4DQP A;  3ASM A;  4CHP A;  4ELV A;  4N76 A;  2HHU A;  4XIU A;  4DTN A;  4R5P A;  4FJJ A;  2P51 A;  1Q9X A;  3TAG A;  3AVB A;  3DLH A;  3DOL A;  3U3G A;  4E7H A;  4M45 A;  1JXB A;  1WN7 A;  3ZT0 A;  1BI4 B;  4CJP A;  1EET A;  4FM2 A;  4N56 A;  4DQI A;  3L2Q A;  5E41 A;  4B8A B;  1RDD A;  1TK5 A;  4CJK A;  1WSE A;  2D0C A;  4CK3 A;  4FLY A;  3VQD A;  4FJN A;  1XHX A;  2OA8 A;  2YV0 X;  4KRE A;  1G15 A;  2XHB A;  4KTW A;  4W5N A;  1S1W A;  4N41 A;  3S3N A;  3AVM A;  5FRO A;  3FFI A;  2ZE2 A;  4HUE A;  1S1V A;  1TKT A;  1W9H A;  4CGH A;  3VA3 A;  1BGX T;  3SJJ A;  2X78 A;  1TK0 A;  3AA4 A;  3LZI A;  3QES A;  2ETJ A;  3CFR A;  2HVH A;  1VRT A;  1VSI A;  4LSL A;  3KLH A;  1LAW A;  1C0U A;  3V1R A;  4F8R A;  2JGU A;  4DTP A;  4OPJ A;  4CIF A;  3CYM A;  3NE6 A;  4AHU A;  3LZJ A;  3DLK A;  1TV6 A;  3AVK A;  3HYF A;  3ISN C;  3T3F A;  3SQ4 A;  3SNN A;  3EYZ A;  2B4J A;  4KTQ A;  4B9M A;  4QAG A;  4DTR A;  4J2A A;  3L8B A;  1HMV A;  3I0S A;  4BWM A;  2B5J A;  2VG5 A;  1Q9Y A;  1JLF A;  3LAN A;  4RW9 A;  2G8K A;  4FVM A;  4PA1 A;  4Z4I A;  2PZS A;  1L3T A;  2IC3 A;  3OYB A;  3HPG A;  4JRQ A;  1QSY A;  1HPZ A;  1LWC A;  3ZT2 A;  1RDA A;  3V6D A;  3K57 A;  4C8O A;  1RDB A;  4FK4 A;  5HBM A;  1VSJ A;  1YTU A;  1KLM A;  1DTQ A;  1I3A A;  3F9K A;  1WSI A;  3SCX A;  5HRP A;  3HST B;  1RT1 A;  2HHT A;  1QSS A;  3NF7 A;  4OJR A;  3OYL A;  4C8L A;  3HVT A;  3K5O A;  3DLE A;  3WNH A;  4HCB A;  1L3U A;  1TL1 A;  3ZSX A;  1VSF A;  3RR8 A;  4Z4F A;  3RMC A;  1NOZ A;  2GUI A;  4MQ3 A;  4FLU A;  3H08 A;  1RBT A;  1IG9 A;  3QEX A;  4B9S A;  1QS4 A;  1W0H A;  4FJI A;  3HK2 A;  3ZSW A;  4IKF A;  4PQU A;  3A2F A;  4BAC A;  2NUB A;  4CF9 A;  4IG0 A;  1X9S A;  2G8H A;  3VQA A;  4CFA A;  3AVA A;  3HO1 A;  1WNS A;  4KHY A;  1RBS A;  4CJ4 A;  2OZM A;  2G8U A;  4HVJ A;  4CJF A;  1C0M A;  4MFB A;  3OYE A;  4AIL C;  1C1A A;  3WNF A;  2YKN A;  3NGZ A;  3TAE A;  4CJ3 A;  4I2P A;  1QSL A;  1A5W A;  1VSM A;  1NK5 A;  4LH5 A;  2HHS A;  2Z1G A;  3ZSR A;  2G8F A;  4B9L A;  4CK2 A;  3QEW A;  4KHW A;  1Z25 A;  1HJR A;  3NF8 A;  3OYG A;  1D9D A;  1JL2 A;  4CEQ A;  3TWH A;  2KTQ A;  2GV9 A;  1DLO A;  3NH1 A;  3CFP A;  5HRR A;  4I9L A;  4PUO A;  3OYD A;  4NCA A;  4FJ8 A;  3BDP A;  1S9G A;  1DTT A;  3ALY A;  3ZSQ A;  1VSK A;  5J2Q A;  3AVF A;  3NBP A;  3SQ2 A;  1UWB A;  3KIO A;  5C25 A;  4FZZ A;  2R7Y A;  4AHT A;  3CM5 A;  3QIN A;  3LP2 A;  1NK8 A;  5T7B A;  4DS4 A;  2E4L A;  1NK6 A;  4K8X A;  4LH4 A;  2HNZ A;  3U3Y A;  4N5S A;  1S1T A;  4DSJ A;  3QNO A;  1L3V A;  3HJF A;  1HYZ A;  3DYA A;  2P5O A;  3CFO A;  3ZSZ A;  4Z4H A;  5KRT A;  1X1P A;  3DM2 A;  4M41 A;  4ZTF A;  1RT3 A;  3NH0 A;  4CF1 A;  2KZM A;  1YT3 A;  3D45 A;  3L3U A;  1X9M A;  1ZBH A;  4DSE A;  3KLF A;  3AA3 A;  1UA0 A;  1CZB A;  2JLE A;  1N5Y A;  4NCB A;  5FRN A;  3RMB A;  3VN5 A;  3WNE A;  4WE1 A;  1NJZ A;  1X9W A;  2P1J A;  3AVL A;  3QET A;  2A1R A;  4E7J A;  4CHZ A;  4KHQ A;  3OS1 A;  2IAJ A;  2YNG A;  2FBX A;  4QOZ B;  3OS2 A;  3V1Q A;  2FBV A;  1L3S A;  3AVG A;  1RT2 A;  3T1A A;  4Z0U A;  1ZBF A;  3KLI A;  4OPK A;  3AVI A;  3WNG A;  1NK0 A;  1KVC A;  3TAF A;  1C1C A;  3L3V A;  4FJK A;  2RN2 A;  3NHG A;  1JLQ A;  1XWL A;  3ITH A;  3K58 A;  4CES A;  3PO4 A;  3IS9 A;  4JRP A;  1ASV A;  4KI6 A;  4FJG A;  1EXQ A;  3LAM A;  4M3X A;  3VQQ A;  1BI4 A;  2IS3 A;  1B9D A;  2Z1I A;  4O0J A;  4IFV A;  4DSL A;  2Y1I A;  2HNY A;  1RDC A;  4RW4 A;  3VQ9 A;  1VSD A;  3TAQ A;  3VQE A;  5HLF A;  1UOC A;  3LAL A;  3RTV A;  3MAQ A;  1C1B A;  3QNN A;  4NYN A;  1VK0 A;  4F3O A;  1NOY A;  3QIO A;  5I42 A;  3TAN A;  4CJL A;  3TAB A;  2BDP A;  4KKO A;  2PYL A;  4F3T A;  4DSI A;  2IOC A;  5KRS A;  3QO9 A;  4M3R A;  1FKP A;  1IKW A;  2DFE A;  1RBR A;  5FRM A;  3AO2 A;  3RMA A;  1QTM A;  3DLG A;  5C24 A;  3P83 D;  2O4G A;  3OYM A;  3D0P A;  4CJW A;  3VQ8 A;  1RNH A;  1RT4 A;  4KB0 A;  4M42 A;  3U6F A;  4FLX A;  4Q0B A;  1NJW A;  1NJY A;  1I39 A;  4CF8 A;  1HNI A;  1ZBL A;  2YNH A;  1UA1 A;  3SUO A;  1N6Q A;  3AVH A;  1S9E A;  3QEP A;  1TAQ A;  4UQG A;  2PY5 A;  4FZY A;  1EX4 A;  3QEI A;  1BHL A;  2IGI A;  3V9X A;  1RTD A;  4DSK A;  1JLG A;  5DK5 A;  4CK1 A;  1C6V A;  3OYN A;  3NF9 A;  2FC0 A;  3SZ2 A;  5D3G A;  4BE1 A;  3S3M A;  1Z26 A;  2BE2 A;  4ZTJ A;  1ITG A;  1A5V A;  4F4K A;  4KPY A;  3OJS A;  4W5T A;  2OYQ A;  1TVR A;  2KQ2 A;  3LPT A;  1TGO A;  3NCI A;  2BGG A;  2HW3 A;  4DS5 A;  1ZYQ A;  1JLB A;  4CJR A;  3JYT A;  3RR7 A;  3AV9 A;  1HNV A;  4CHQ A;  3OYI A;  3HM9 A;  5HRO A;  3KK3 A;  3V9U A;  1KVA A;  2WON A;  3HPH A;  1FK9 A;  3DLR A;  4E19 A;  1SL0 A;  4L8R B;  1RCH A;  1SL1 A;  4ID5 A;  3G0Z A;  2DTU A;  2DY4 A;  4CEC A;  3LWL A;  4M3Y A;  3TAP A;  1LV5 A;  4KB1 A;  4FJL A;  3VQ6 A;  1KTQ A;  2XRI A;  1MU2 A;  4RG8 A;  1RIL A;  4H4O A;  3VQC A;  4B8C A;  4HHT A;  3RMD A;  3SV3 A;  4N47 A;  5SZT A;  3L2V A;  4EP4 A;  1S1X A;  3T19 A;  3KKR A;  4CED A;  2P5G A;  4OGE A;  5EU7 A;  1CLQ A;  3NGY A;  1T7P A;  2G8W A;  4ELU A;  3C6U A;  3L2W A;  4K8Z A;  1NKC A;  1FKO A;  3G10 A;  1KSP A;  1NJX A;  5CY4 A;  4EP5 A;  2E6L A;  4DU1 A;  2LSN A;  3V4I A;  1SL2 A;  4FXD A;  3HPO A;  4IFY A;  4CIG A;  1IKY A;  1RBV A;  4OLB A;  2VG7 A;  3M8P A;  1GOA A;  1XHZ A;  2OPR A;  4FM1 A;  5SWM A;  2AJQ A;  3OYF A;  4CEB A;  4BDP A;  4ELT A;  4GW6 A;  3PUF A;  3ZSO A;  3OYC A;  4DF4 A;  3AA2 A;  4AHS A;  3CQ8 A;  1U47 A;  4B9N A;  4H8K A;  2YHB A;  4FJH A;  3HVR A;  4AHR A;  3K2P A;  1RTJ A; 
#chains in the Genus database with same CATH topology
 4FK0 A;  4MLE A;  2ZM6 K;  1T03 A;  1BDG A;  4OKJ A;  2VWK A;  2ZGZ A;  2DFF A;  2Q3S A;  2QKK A;  4X66 K;  4H5W A;  4BRK A;  4CHO A;  4CJV A;  4BGA A;  3VQP A;  3S9H A;  3VES A;  2YNF A;  5HP1 A;  4CD1 A;  1J54 A;  3NAE A;  1WBB A;  1L5U A;  4C8K A;  2VG6 A;  1EWR A;  1RGI A;  3KK2 A;  4CBU A;  1O1W A;  1KVB A;  1RTI A;  3CC7 N;  5CHI A;  4DFK A;  3SPZ A;  1IBM K;  4FJX A;  4JS4 A;  2OTL N;  3VEV A;  1NKB A;  2J4R A;  3THY B;  4FLZ A;  1HQU A;  4DR1 K;  3O80 A;  3MEE A;  2OPQ A;  1NU0 A;  3ENH A;  4CZF A;  3PY8 A;  4KAZ A;  2OAN A;  1IKX A;  1D5A A;  4CGF A;  2G8V A;  4H5N A;  1E3M A;  1R0A A;  3NVM A;  1OH7 A;  2QM1 A;  3D6R A;  4CW7 B;  4CGI A;  3K5N A;  5HRN A;  1U45 A;  1XNQ K;  4B3S K;  5LMU K;  1TAU A;  1TYQ B;  2A6A A;  4YOY A;  3CJ9 A;  1N33 K;  1HYV A;  4YNQ A;  3LM2 A;  3LP1 A;  2HND A;  1U6Z A;  4DU3 A;  3ZT1 A;  3H6E A;  3SI6 A;  3H1V X;  2WC9 A;  5FDL A;  1YVU A;  4C8N A;  3V9W A;  1Y64 A;  3G71 N;  4E0D A;  4XEI A;  3TAR A;  4FJ7 A;  3SUQ A;  1BQN A;  2RKI A;  2UXD K;  2OPS A;  5AQH A;  1EP4 A;  4JK7 A;  3L2R A;  4FCY A;  2OPP A;  2VWJ A;  1CZA N;  2NNW A;  2X6N A;  4NYF A;  4AHV A;  1Z05 A;  4E7L A;  4MO4 A;  4JLH A;  2HHW A;  1A5X A;  3ZYY X;  2XY5 A;  4CHN A;  1VQM N;  4GVM A;  3HT3 A;  4DTJ A;  1NMD A;  4QCL A;  4JS5 A;  2PAV A;  4FWL A;  4ILJ A;  5DM6 L;  3ZCM A;  3TTD A;  4GV9 A;  4BC2 A;  4IOC L;  3QEV A;  5E84 A;  2QWN A;  4IJN A;  2A5X A;  2JWK A;  4HTU A;  2QK9 A;  1YVN A;  2XO7 A;  5JS2 A;  4BWJ A;  3RRH A;  5FPE A;  2KW4 A;  2UUA K;  3OJU A;  4KH4 A;  4DLG A;  4OGC A;  2O8B A;  3QML A;  3TR8 A;  2F9T A;  3PO5 A;  4CF0 A;  3UKR A;  3SQ1 A;  1RT7 A;  3MXM A;  1BCO A;  4WCE L;  2G8I A;  3DLB A;  4DR4 K;  2P9N B;  1BA1 A;  3CJC A;  2W42 A;  3JS6 A;  1HX1 A;  1ATS A;  1P90 A;  3LWM A;  4IEE A;  2E2P A;  5AQU A;  2CGJ A;  4DF8 A;  3PX4 A;  3C94 A;  4DTX A;  3L2U A;  1CXQ A;  1U48 A;  1ZBS A;  3C6T A;  5GIP A;  3KD5 E;  2E1Z A;  4BR5 A;  3O08 A;  4CJQ A;  3M8Q A;  4RCH A;  3M8S A;  1TK8 A;  2A41 A;  3AO5 A;  1N36 K;  2Q97 A;  2O8D A;  4AHC A;  3ZSY A;  2W6K A;  2XY7 A;  1D9F A;  3VA0 A;  4DR7 K;  4YOW A;  4BE2 A;  1GLC G;  4CBX A;  3THV A;  2HVI A;  3NGI A;  4IDH A;  4IDK A;  3LP3 A;  1IJJ A;  3E9P A;  1WSF A;  3KZB A;  4J2D A;  5KGX A;  2FBT A;  4PY5 A;  3ULD A;  1BIS A;  3C6H A;  4DHY A;  4B1X B;  2CGL A;  4J2B A;  1GOC A;  4N76 A;  5H1S Q;  4DTN A;  4FJJ A;  4I6M B;  1Q9X A;  4DQI A;  4IXC A;  4R79 A;  3L2Q A;  4PKI A;  4XH1 A;  3LM9 A;  4FLY A;  3BEX A;  2YV0 X;  4H0X B;  1VHX A;  4JD2 A;  1S1V A;  1W9H A;  1QHA A;  1BGX T;  2UYT A;  2CGK A;  4PL8 A;  3D2F A;  3LZI A;  3QES A;  4B3T K;  1NGD A;  3OW2 M;  1LAW A;  2QI2 A;  3AY9 A;  3PIO L;  3IDH A;  3CYM A;  4IOX A;  3AVK A;  4KTQ A;  4B9M A;  4DTR A;  3PSI A;  3GOI A;  3QDK A;  1JLF A;  2ZJQ L;  4RW9 A;  5FLX O;  2PZS A;  1XUP O;  3OYB A;  5M1F A;  3O9T A;  3EN9 A;  4JI1 K;  5HBM A;  1VSJ A;  3CCJ N;  1I3A A;  3CJA A;  3C7N A;  1NGJ A;  3ZX2 A;  1IBK K;  1QSS A;  3NF7 A;  4HCB A;  3WNH A;  3QBW A;  2OTJ N;  1L3U A;  1VSF A;  1RBT A;  4B9S A;  1W0H A;  4IKF A;  5BRH A;  3A2F A;  1E4G T;  4BAC A;  4IG0 A;  1X9S A;  3VQA A;  3HO1 A;  2V52 B;  2O8C B;  4AIL C;  3KVG A;  2YKN A;  2HHS A;  1VSM A;  2V7Y A;  5E26 A;  3ZSR A;  3WXM B;  4KHW A;  1JL2 A;  2GV9 A;  3WXI A;  4WQ5 C;  3NH1 A;  3LDL A;  4I9L A;  4NCA A;  1S9G A;  1VSK A;  3SQ2 A;  1ATR A;  3SK3 A;  3LP2 A;  1NNE A;  1NK8 A;  2E4L A;  4GKK K;  4ILH A;  1L3V A;  3DYA A;  2P5O A;  2QTD A;  1GLL O;  3MN9 A;  3ZSZ A;  4QS8 A;  5BPM A;  3RSE A;  4M41 A;  3ZX3 A;  3PSF A;  1MDU B;  2FF6 A;  4C23 A;  2JLE A;  3CIP A;  1TUY A;  4BRC A;  2AP1 A;  4B1W B;  3WNE A;  4WE1 A;  3K9K A;  4E7J A;  1BUP A;  5ELZ A;  3V1Q A;  3F5T A;  1RT2 A;  4OPK A;  3KLI A;  3AVI A;  1NGA A;  4H5T A;  3WNG A;  4JN4 A;  1NK0 A;  1KVC A;  4FJK A;  4F9O A;  2RN2 A;  3NHG A;  1X3M A;  4DUY K;  3K58 A;  4CD3 A;  4KI6 A;  4JK9 A;  3VQQ A;  1B9D A;  3MWP A;  4DR2 K;  4FWO A;  4IFV A;  5GAD P;  3EE8 A;  3HOT A;  2Y1I A;  2HNY A;  1NGC A;  1VSD A;  3RTV A;  3VPZ A;  3ATV A;  4HTL A;  4Z94 A;  3ZLJ A;  2VQF K;  2PYL A;  2IOC A;  5KRS A;  3VF4 A;  1FKP A;  1IKW A;  2DFE A;  1RBR A;  1N34 K;  3RMA A;  1M90 O;  3WXJ A;  3P83 D;  2UUC K;  3OYM A;  1TUU A;  4CJW A;  4KB0 A;  4M42 A;  4Q0B A;  4FWQ A;  3CCS N;  1NJW A;  5AQL A;  1BU6 O;  4CI6 A;  1I39 A;  3LL3 A;  1ZBL A;  1NMN A;  2QWO A;  1E4F T;  2Q31 A;  1ZXO A;  4DSK A;  2VCP A;  1JLG A;  1T6C A;  2YX6 A;  5DK5 A;  1KXP A;  1C6V A;  5A2Q O;  3OYN A;  2GWJ A;  1IV0 A;  2BE2 A;  4A61 A;  4F4K A;  4W5T A;  3M6G A;  4JKA A;  2IVO A;  3J7A P;  1TGO A;  2NRW A;  3JYT A;  3EE9 A;  3HM9 A;  2Q0U A;  2WON A;  1ILY A;  4L8R B;  3LDO A;  2DY4 A;  3TAP A;  2OCE A;  3F9M A;  4YDU C;  2XRI A;  3OA9 A;  3ID6 A;  5SZT A;  3MX5 A;  1S1X A;  2ASM A;  3T19 A;  5F0X A;  5TKW A;  3CC2 N;  1XNR K;  4CZI A;  3C6U A;  4K8Z A;  1NKC A;  2LSN A;  3DXM A;  3V4I A;  4CIG A;  4JI4 K;  3FGU A;  2NZT A;  1C0G A;  3IMX A;  4FM1 A;  4NO7 A;  2AJQ A;  4CEB A;  4B1Y B;  1M1K O;  3PUF A;  3ZSO A;  4DF4 A;  5BR8 K;  3K2P A;  5M1N A;  3SBG A;  3VEY A;  4CJU A;  4BRG A;  1XI1 A;  3EKU A;  1QHT A;  1H1V A;  4CF2 A;  3M8R A;  2O8B B;  4GV6 A;  3QER A;  4FZX C;  4FWS A;  2PFU A;  4CER A;  4FLV A;  2HHV A;  2VGN A;  1BL3 A;  3CQY A;  3T1H K;  4QS9 A;  3CJB A;  4DV5 K;  4KFB A;  5K14 A;  2PYJ A;  4KHU A;  5F1X A;  3G25 A;  2KFZ A;  3I0R A;  4YOR A;  3UKU A;  4J8F A;  2Z1H A;  1IO2 A;  1Y97 A;  3CME N;  1XC9 A;  4CJT A;  3T1Y K;  1LWF A;  4DU4 A;  1ASW A;  3L0Q A;  3AO4 A;  3FZF A;  4X64 K;  1X9J A;  2FBY A;  2VYP A;  3B6O A;  4XH4 A;  2HHH K;  4CEZ A;  2O8D B;  4GMJ B;  3V9S A;  3NMU A;  1K9M O;  2GEL A;  3MEC A;  4JKF A;  1FJG K;  4I7F A;  3DRS A;  2QXF A;  5CYQ A;  4CZH A;  3CMA N;  3DRR A;  4WF9 L;  3R1X A;  2HMI A;  3MDQ A;  4IBN A;  4G1Q A;  3IFR A;  5KGW A;  1QQM A;  4HUG A;  4AQY K;  1WLJ A;  3VEX A;  4E3S A;  5B8H A;  2ASP A;  2WFB A;  1HYS A;  4DV1 K;  3CG7 A;  1NM1 A;  2HBL A;  1RTH A;  5JS1 A;  3SUN A;  2UU9 K;  1EO1 A;  3FFK B;  1UAX A;  4IOA L;  3CM6 A;  5LJW A;  3HZ6 A;  1OH5 A;  4BQL A;  3MN7 A;  3JSM A;  3AVC A;  4AM7 A;  4JD2 B;  4YY3 K;  5CZ2 A;  4CGJ A;  4J2E A;  4BGB A;  3OHR A;  4RW7 A;  3O3G A;  1D4X A;  5J2N A;  4V19 S;  1KAX A;  3ATU A;  3C6A A;  4FW1 A;  4AF1 A;  1T6D A;  5J2M A;  5JMV A;  1OH6 A;  1XMQ K;  4F2S A;  2O8C A;  4G9Z A;  2HF3 A;  3KTQ A;  5EOY A;  5AQY A;  1NK7 A;  3DI6 A;  1J53 A;  2NLX A;  1NK9 A;  1BCM A;  3PX0 A;  1XMO K;  3EY1 A;  1NGB A;  1S5J A;  1NG9 A;  4W5Q A;  5DM7 L;  5JVG L;  4DV4 K;  1D8Y A;  2QKB A;  4B9V A;  4H5V A;  2EHG A;  4E7K A;  1QQC A;  1VAZ A;  3C7N B;  3DAW A;  4Z4E A;  3I55 N;  4KHN A;  4DLE A;  3VEO A;  3V81 A;  1QVF M;  4DCH A;  3QBX A;  1QZ5 A;  5CR4 A;  1HKG A;  4ICL A;  5LMN K;  1RT5 A;  4H4M A;  3DOK A;  2WOM A;  5TKY A;  3OYJ A;  3Q7C A;  3CHW A;  2I5J A;  5FPM A;  4BVO A;  1CZ9 A;  1BQM A;  3SQ0 A;  4Z4C A;  1KFD A;  3ZSV A;  1KRP A;  2DPN A;  3ENO A;  3P1G A;  1KD1 O;  2W6L A;  4JEP A;  5AQV A;  1REV A;  3ZT3 A;  3OTO K;  4JI6 K;  2E88 A;  1LAV A;  4YOU A;  4OKK A;  4BRA A;  2X74 A;  4OKE A;  2ITM A;  1F21 A;  1HPM A;  4LF6 K;  3GDQ A;  2HF4 A;  4DR3 K;  1WB9 A;  2D0P A;  4CEE A;  1V4S A;  4DFP A;  3NF6 A;  5CE3 A;  4CJ5 A;  5BRE A;  3E01 A;  1V4T A;  3RSE B;  3JAM O;  1TKD A;  1NBW A;  4OVL A;  2ZWH A;  3F73 A;  3L4Q A;  1SAZ A;  5F2R A;  1VQP N;  2DFH A;  1C0T A;  3VEZ A;  1VRU A;  2P9U A;  1T05 A;  1NGH A;  1JLC A;  1OVQ A;  4O5F A;  3I8D A;  1B92 A;  4FYD A;  1KAY A;  4DFJ A;  3LDN A;  4GV3 A;  3PX6 A;  3ASM A;  3I33 A;  3MCA B;  4R5P A;  2UUB K;  3TAG A;  1HNW K;  4E7H A;  3ZT0 A;  1WN7 A;  2KHO A;  3U9Z A;  4N56 A;  3CD6 N;  1RDD A;  1TK5 A;  3CI5 A;  2D0C A;  4H03 B;  2XHB A;  4N41 A;  4B1U B;  3AVM A;  2V51 B;  4HUE A;  4CGH A;  1TKT A;  3VA3 A;  3THX A;  2X78 A;  4BR4 A;  3CFR A;  4LSL A;  3GBT A;  4PL7 A;  1C0U A;  3M5R A;  3V1R A;  1U2V A;  2JGU A;  4CIF A;  4JNE A;  3NE6 A;  3T3F A;  4M3Z A;  3HYF A;  2UXC K;  3SQ4 A;  3EYZ A;  1NWK A;  2V7Z A;  4FPA A;  1HMV A;  1Q81 O;  4BWM A;  2VG5 A;  4YDU A;  5AZI A;  3LAN A;  4A2B A;  1W97 L;  3CPE A;  1L3T A;  1XC3 A;  3HPG A;  2CH6 A;  4JRQ A;  1EWQ A;  3SAF A;  1RDA A;  3A5L C;  4FVU A;  3GE1 A;  1RDB A;  3U4L A;  1MWK A;  2O8F B;  3SCX A;  4EHU A;  3VET A;  3VF2 A;  2HHT A;  1RT1 A;  1NGG A;  4OPA A;  3HVT A;  1GLF O;  1WOQ A;  3DLE A;  3K5O A;  4A59 A;  4OPH A;  1TL1 A;  3ZSX A;  3BUZ B;  3H08 A;  3QEX A;  1QS4 A;  1YIJ N;  3FLC O;  2NUB A;  5AQK A;  3K9J A;  4HVJ A;  2W41 A;  2P9L B;  4MFB A;  1X3N A;  4IO8 A;  1QSL A;  3TAE A;  4CJ3 A;  4I2P A;  1VQ4 N;  2ZJP L;  4CK2 A;  3QEW A;  3SJH A;  1HJR A;  3NF8 A;  2WUS A;  4CZJ A;  3DXM B;  1DLO A;  4FSV A;  1C0F A;  1JCF A;  3GL1 A;  3WQU A;  3ZSQ A;  4FL9 A;  2YJF A;  5ADX A;  1UWB A;  3KIO A;  3F2K A;  3O4W A;  2D4W A;  3UE5 A;  4DS4 A;  4LH4 A;  1S1T A;  1WBD A;  3DWL A;  3HJF A;  3KHY A;  3CFO A;  3N4P A;  2FSK A;  3SAG A;  3EKS A;  2A42 A;  4WFA L;  4LF9 K;  1HR0 K;  3D45 A;  3E66 A;  1X9M A;  2BH1 A;  4DSE A;  3KLF A;  4NCB A;  2ZGY A;  2E5L K;  1GLA G;  3RMB A;  2P9S A;  3KWI A;  1X9W A;  3AVL A;  2A1R A;  2IAJ A;  1IBL K;  4MDB A;  3OS2 A;  5M1O A;  4H0Y B;  2YHW A;  3AVG A;  3I56 N;  1C1C A;  3L3V A;  3UKU B;  5HL7 L;  1XWL A;  3PO4 A;  4JRP A;  1LOT B;  4FJG A;  5EY4 A;  2FF3 B;  2KKZ A;  4JI7 K;  4U7B A;  1OKJ A;  1IG8 A;  1UOC A;  3LAL A;  4K0K K;  4IFE A;  4XH5 A;  4OX9 K;  1NOY A;  3OBW A;  5AQO A;  4YOV A;  4CJL A;  4DSI A;  1NGF A;  4YOX A;  3ENB A;  4H0P A;  1YUW A;  5C24 A;  2QWP A;  1RT4 A;  3GG4 A;  1NJY A;  5LY3 A;  2ZJR L;  1UA1 A;  3SUO A;  3AVH A;  3QEP A;  4LFA K;  3VTI A;  3SMS A;  2IGI A;  1RTD A;  4MO5 A;  4CK1 A;  3NF9 A;  3SZ2 A;  3HI0 A;  3S3M A;  1HKC A;  1ITG A;  3QFU A;  5EX5 A;  3O9U A;  3LPT A;  2HW3 A;  4BRQ A;  5GIO A;  2YHX A;  3AV9 A;  1HNV A;  4CHQ A;  3M1F A;  1FK9 A;  1SL0 A;  3VEN A;  4BG8 A;  4RG8 A;  4H4O A;  4B8C A;  2GWK A;  5KQD A;  4CED A;  2QW9 A;  4K25 A;  4OGE A;  3VF6 A;  2G8W A;  3L2W A;  3TSQ A;  1NJX A;  2FLO A;  5JLH A;  4JYA K;  1P8Z A;  4CZL A;  1RBV A;  3M8P A;  4CZK A;  1XHZ A;  2QA4 N;  1QQN A;  5SWM A;  2D0O A;  3BF1 A;  4BDP A;  4ELT A;  4FWP A;  1U47 A;  3DJC A;  2YHB A;  2JWL A;  4PKH A;  4U67 L;  1RTJ A;  1WUA A;  2GUP A;  4FWM A;  3AO1 A;  4M63 C;  4RW6 A;  1BIZ A;  3T69 A;  3PIP L;  3AVJ A;  3RRG A;  3P5J A;  4CJS A;  1S72 N;  3W3D A;  5AQR A;  3S3O A;  3ZX0 A;  4Z4G A;  2XY8 A;  2X6S A;  5M1P A;  1T8E A;  3WXK A;  3LDQ A;  3CJ7 A;  4EZ6 A;  2D0B A;  3BZC A;  1VSH A;  3TSP A;  4PWD A;  2Q1N A;  5GAG P;  3AA5 X;  1WAF A;  3TAM A;  5HRS A;  3J7Y P;  3UB5 A;  4LD0 A;  5MLC Q;  3LAK A;  1S6Q A;  4OLA A;  2EWS A;  2I7P A;  4CEO A;  4CFC A;  1ZC6 A;  4A57 A;  2RF2 A;  5GAE P;  1IH7 A;  3OVN A;  4DMN A;  3OYA A;  1VQK N;  2QEX N;  1RT6 A;  4B08 A;  1LW2 A;  3D7E O;  2P9U B;  2Y1J A;  4EIA A;  1VQ9 N;  4DFM A;  3IRX A;  5BN8 A;  3LDP A;  3E9O A;  2IIR A;  3R6M A;  2D5R A;  1WAJ A;  4WYB A;  4DG1 A;  4EFH A;  3CCM N;  1DGK N;  5FPD A;  5J2P A;  2ZD1 A;  2GX9 A;  3LP0 A;  3QB0 A;  3MED A;  5CYM A;  2O8F A;  1U4B A;  3FZK A;  4CGD A;  2E2N A;  4Y1D A;  3CXC M;  4DSF A;  3CPW M;  1Q18 A;  3THX B;  1NKE A;  3A0I X;  5I3U A;  2QWL A;  4LF7 K;  5IT9 O;  2GTD A;  4YFU A;  1U2V B;  3O6W A;  5AQS A;  3M3Z A;  4KTZ A;  4BRO A;  2D0A A;  4QS7 A;  5BPN A;  1ESV A;  4DTS A;  3QIP A;  1LCU A;  2Q0R A;  4PKG A;  2P9L A;  3KK1 A;  3SPY A;  5AZI B;  5CZ1 A;  4KHS A;  1KCF A;  3OYH A;  2YNI A;  3FR0 A;  5AQM A;  3HTV A;  5AQZ A;  4BC4 A;  1KFS A;  3VQ7 A;  4KRF A;  4LY7 A;  2QWR A;  4W5O A;  1S6P A;  4O55 A;  4FLW A;  3O8M A;  4DTU A;  4E7I A;  4FJ9 A;  3EZ5 A;  4F2R A;  1W7A A;  2GEM A;  4DTM A;  4BC5 A;  4CGG A;  3G4S N;  1HRH A;  1SZ2 A;  4EHT A;  4W5R A;  2O4I A;  4M3U A;  3OY9 A;  3SBT A;  4HCC A;  5BN9 A;  3VOV A;  1BWF O;  4FW2 A;  1JLA A;  1ZBU A;  3H46 O;  1FXX A;  3HP6 A;  3V9Z A;  1VQ6 N;  4KBO A;  4JKD A;  4FO0 A;  4DTO A;  4DKW A;  4E89 A;  4CEA A;  2KFN A;  4JI2 K;  4DQR A;  5GAH P;  3QFP A;  4RW8 A;  2P9P A;  3ZT4 A;  3NH2 A;  3B6P A;  3MX2 A;  3WUH A;  5KTQ A;  3HOS A;  3MEG A;  5C42 A;  3O4Q A;  4FWK A;  3TTC A;  3WEE B;  1BG3 A;  2HBK A;  4CFD A;  4KH6 A;  4CHY A;  3RWU A;  1WSJ A;  1B9F A;  4ISG A;  1J6Z A;  4MLH A;  5C10 A;  3BGR A;  2RPI A;  4O0I A;  3NFA A;  3KD1 E;  2OZS A;  4B9U A;  4BRF A;  1JXE A;  4H0O A;  4JK8 A;  3TPQ A;  1QE1 A;  4O4G A;  5ADX H;  2P9S B;  4B9Q A;  4M3T A;  1K6Y A;  3IAY A;  4HUF A;  4YHH K;  3VGM A;  4NCG A;  4E1M A;  1BO5 O;  5KI6 A;  2ZQB A;  3SYZ A;  1JL1 A;  1HQE A;  1VSL A;  1NK4 A;  3DRP A;  1S1U A;  1IKV A;  4DQP A;  4CHP A;  4E1J A;  2HHU A;  2VGM A;  2IVP A;  4XIU A;  1NGI A;  2QXL A;  3ULE A;  3DLH A;  3D2E A;  3DOL A;  1JXB A;  4CJP A;  4FM2 A;  4X65 K;  5BRF A;  5E41 A;  2NRZ A;  2A3Z A;  3VQD A;  4FJN A;  2OA8 A;  4KRE A;  1G15 A;  4KTW A;  4W5N A;  3FFI A;  2ZE2 A;  3ID8 A;  3SJJ A;  3WQT A;  3AA4 A;  2HVH A;  3VMF B;  1VRT A;  2ASO A;  1YHQ N;  4NLC A;  1T44 A;  4OPJ A;  4AHU A;  3LZJ A;  3SNN A;  3ISN C;  1VQ8 N;  2PBD A;  4JAX A;  3I0S A;  4JKB A;  3H45 C;  4FVM A;  2G8K A;  4PA1 A;  1NLV A;  4CZG A;  2IC3 A;  1QSY A;  1HPZ A;  1LWC A;  3V6D A;  4BR7 A;  1HJO A;  1YTU A;  3J80 O;  1WSI A;  5HRP A;  5BRD A;  3VER A;  3TTF A;  3P31 A;  5KQ8 A;  3TSU A;  4OJR A;  2HBM A;  3FZL A;  4WQ5 A;  4Z4F A;  3RMC A;  2RE2 A;  1NOZ A;  3P4I A;  4MQ3 A;  4FLU A;  2UXB K;  1IG9 A;  4FJI A;  3FE1 A;  4PQU A;  4JHD A;  2NRT A;  4CJ4 A;  2OZM A;  2G8U A;  4BR9 A;  4CJF A;  1C0M A;  1C1A A;  3WNF A;  3NGZ A;  4O8U A;  1A5W A;  1W2B M;  4LH5 A;  1BA0 A;  2Z1G A;  5AQN A;  3O1B A;  4KH5 A;  1RDW X;  2E2O A;  2KTQ A;  3MN5 A;  5HRR A;  3OYD A;  5C0Y A;  4BRH A;  4NLB A;  3EO3 A;  2E1Y A;  5J2Q A;  1DKG D;  3AVF A;  3NBP A;  3THW A;  2E2Q A;  5C25 A;  4FZZ A;  1S22 A;  4HWI A;  4H0V B;  3CM5 A;  3QIN A;  3IKM A;  4FPB A;  3C0B A;  1NK6 A;  2HNZ A;  3J7Z O;  3QNO A;  1HYZ A;  1NGE A;  4Z4H A;  4WQ4 C;  1X1P A;  3EL2 A;  4ZTF A;  4DV0 K;  4CF1 A;  1ZBH A;  5IWA K;  3VTH A;  1UA0 A;  1N5Y A;  3KWG A;  3VN5 A;  1NJZ A;  3SLC A;  4BRI A;  3OS1 A;  3L4I A;  4QOZ B;  3HSC A;  5AZJ B;  2FBV A;  4M7Y A;  3O1W A;  1L3S A;  1HUX A;  3O9Q A;  3TAF A;  3E1Y A;  3ITH A;  3IS9 A;  1ASV A;  1EXQ A;  1BI4 A;  2IS3 A;  5AFU A;  4O0J A;  3TAQ A;  3VQE A;  5HLF A;  1FW6 A;  2F7T A;  3MAQ A;  1DT9 A;  1OVY A;  3QIO A;  4PHT X;  3TAN A;  2QWQ A;  3TAB A;  2BDP A;  1HNX K;  5C2F A;  2BTF A;  4M3R A;  4C1N I;  3AO2 A;  3DLG A;  1VQ5 N;  2O4G A;  4BG9 A;  3HRG A;  3VQ8 A;  3CCV N;  3U6F A;  5AR0 A;  4FLX A;  3J8A A;  1HNI A;  1TAQ A;  5AQQ A;  4UQG A;  2P9K A;  4FZY A;  3QEI A;  4KHP K;  4DV6 K;  1BHL A;  2E8A A;  3DLL L;  4OO1 J;  2FC0 A;  5D3G A;  3CCR N;  1YIT N;  4FWR A;  3OJS A;  1YJW N;  1N8R O;  3NCI A;  4DS5 A;  1ZYQ A;  4CJR A;  3RR7 A;  3OYI A;  1GLD G;  3KK3 A;  3V9U A;  2E20 A;  1MWM A;  3HPH A;  1QVG M;  3DLR A;  1RCH A;  4MDA A;  1SL1 A;  3G0Z A;  3VGK A;  2DTU A;  1KAZ A;  4CEC A;  2P9I B;  3LWL A;  3EZW A;  1LV5 A;  4KB1 A;  4FJL A;  1KTQ A;  1MU2 A;  4ISE A;  3RMD A;  5EXW A;  4HHT A;  1Q86 O;  4N47 A;  1GLE G;  2P5G A;  5EU7 A;  1CLQ A;  3NGY A;  3FZM A;  1FKO A;  3G10 A;  1KSP A;  3MWT A;  5CY4 A;  1HKB A;  4DU1 A;  4FXD A;  4IFY A;  4BQZ A;  1IKY A;  2VG7 A;  4BRD A;  1GOA A;  3NVK A;  4BRP A;  4A5A A;  3AA2 A;  4AHS A;  3CQ8 A;  4JI8 K;  3CET A;  5I9E B;  4FK2 A;  3LPU A;  3MK6 A;  3WEE A;  4KV8 A;  4B1V A;  1K8K B;  2ATQ A;  4NXM K;  1ZBI A;  1SKR A;  4H0T B;  5BPL A;  4I9Q A;  3H3N O;  2EX3 A;  3O9R A;  3ZET A;  2BAN A;  3VQB A;  4CE9 A;  3SAH A;  4ZHR A;  1R59 O;  5M1K A;  3R9P A;  3T7Z A;  4KI4 A;  5J1E A;  2F8S A;  1LWE A;  4CJE A;  3BZK A;  1SKS A;  3OYK A;  4WFB L;  1YTA A;  3MXI A;  1WSH A;  1SQK A;  1S3X A;  4CFB A;  1LW0 A;  4ISF A;  3CCU N;  3P39 A;  2YCH A;  2P9P B;  4JKG A;  2FSJ A;  3QLH A;  4BRM A;  2FSN A;  4GY2 B;  1VQN N;  3ZEU A;  4C8M A;  1J9A A;  3K59 A;  3CC4 N;  3AVN A;  4Q5V A;  2GBZ A;  1Q82 O;  3K5M A;  1KLN A;  1BIU A;  4ILG B;  5AQX A;  1RBU A;  4X62 K;  4FLT A;  3S41 A;  4EZ9 A;  4BVP A;  1U49 A;  1Q8I A;  2A1S A;  1QZ6 A;  3PV8 A;  5AQJ A;  3IG1 A;  3O3H A;  1JCE A;  5DMR A;  1U04 A;  3CCE N;  2Z1J A;  4BC3 A;  3KKS A;  4B3R K;  3HP9 A;  4JI0 K;  3TI0 A;  2WTU A;  3E9L A;  3O3F A;  3DMJ A;  4O5B A;  5GIN A;  3ULE B;  1SUQ A;  3D2E B;  4CIE A;  3SUP A;  2O8E A;  4CBW A;  1G99 A;  4FWN A;  4DQQ A;  4CEF A;  1SKW A;  5AQT A;  3AAR A;  1TL3 A;  1J5O A;  4JKE A;  5AJ3 K;  3VQ5 A;  4BDZ A;  1TKX A;  3CCQ N;  4B3O A;  4C1N K;  3HL8 A;  3DXK A;  4FJ5 A;  4NXN K;  3UIQ A;  2E6M A;  5C15 A;  3RVC A;  4LFC K;  3MXJ A;  4CCH A;  4CZE A;  1RDU A;  2NRH A;  1JKH A;  5AQW A;  3VQ4 A;  2FXU A;  4RWT A;  3JXU A;  4DQS A;  4UY8 O;  1TKZ A;  3K5L A;  2YHA A;  1VSE A;  4M3W A;  2F8T A;  1JCG A;  3O4N A;  1Z6R A;  1CXU A;  1YXQ A;  1RFQ A;  2ITG A;  4IJA A;  3U8X A;  4BE0 A;  3C95 A;  2HB5 A;  3H3O B;  3MCP A;  1VQL N;  2NRV A;  3V1O A;  4O44 A;  2CH5 A;  1K8A O;  4IG3 A;  4CJ7 A;  2HHX A;  2KZZ A;  4JHD B;  2XY6 A;  1GLB G;  3C65 A;  4Y1C A;  3SV4 A;  3LDS A;  1SS6 A;  4KO0 A;  4NB4 A;  3SMP A;  3KLG A;  4LF4 K;  3MMV A;  4WQ4 A;  4AH9 A;  3QIC A;  3AGK A;  4DUZ K;  3NDK A;  4DV3 K;  4B9T A;  1T3V A;  3OS0 A;  1MA9 B;  5AZJ A;  3BP8 A;  1JLE A;  1SV5 A;  4CZM A;  4B3M K;  2ZF5 O;  3HXM A;  2VQE K;  3THW B;  4I2Q A;  3THY A;  1GOB A;  2B6A A;  2Q36 A;  4IO9 L;  1O13 A;  4A62 A;  3KJV A;  1EKE A;  1YJN N;  2IDO A;  5AQG A;  5HOO A;  4BR2 A;  1ASU A;  4FJM A;  4TSX A;  4LF8 K;  3AO3 A;  3BF3 A;  4LSN A;  3J81 O;  2NRR A;  4DV2 K;  4FM0 A;  3AAQ A;  2YHY A;  4DWI A;  4DR5 K;  5KPZ A;  1TYQ A;  2F96 A;  4JI5 K;  1WSG A;  4JV5 K;  4ID1 A;  3R3L A;  2YKM A;  3A5O C;  5M1Q A;  3KLE A;  4BDY A;  3TU5 A;  2HHQ A;  4E1N A;  4ELV A;  2RHK A;  2P51 A;  3AVB A;  3U3G A;  4M45 A;  1BI4 B;  4YOT A;  1EET A;  5LJV A;  3OBY A;  4B8A B;  4CJK A;  1WSE A;  4CK3 A;  4BRE A;  1YAG A;  1XHX A;  5AQF A;  3Q7B A;  1S1W A;  3S3N A;  5FRO A;  1TK0 A;  4GNI A;  3CJ1 A;  2ETJ A;  4JKH A;  1VSI A;  5EVZ A;  3KLH A;  2YJE A;  4F8R A;  4RTF D;  2P9I A;  4DTP A;  1YI2 N;  3WT0 A;  3DLK A;  1TV6 A;  4K43 A;  5AFU H;  2B4J A;  4J2A A;  4QAG A;  3A5M C;  2QWM A;  3L8B A;  2IVN A;  2B5J A;  3W0L A;  1Q9Y A;  3CF5 L;  2P9K B;  3A8Y A;  4Z4I A;  1J5E K;  3H1Q A;  2D1K A;  3ZT2 A;  3K57 A;  4C8O A;  4FK4 A;  1KLM A;  1DTQ A;  3F9K A;  3CQX A;  3P38 A;  1VQ7 N;  3HST B;  1VQO N;  4BR0 A;  3OYL A;  4C8L A;  4BRN A;  3K0S A;  3RR8 A;  2GUI A;  1YJ9 N;  3HK2 A;  3ZSW A;  4CF9 A;  3A5N C;  1Q7Y O;  2G8H A;  1K8K A;  4CFA A;  3AVA A;  1WNS A;  1I94 K;  4KHY A;  4O8K A;  5BR9 A;  1RBS A;  3OYE A;  2WBN A;  4DR6 K;  1NK5 A;  3IUC A;  4K41 A;  2G8F A;  2P9N A;  4B9L A;  3VEW A;  4BRL A;  3U9D A;  1Z25 A;  3OYG A;  1D9D A;  4CEQ A;  1BOT O;  3TWH A;  3CFP A;  4PUO A;  4FJ8 A;  4LFB K;  4DV7 K;  3BDP A;  5JIC A;  1DTT A;  3ALY A;  3VGL A;  5FPN A;  2R7Y A;  2BUP A;  4AHT A;  4Y0W A;  3B8A X;  4K8X A;  5T7B A;  3U3Y A;  4EAH D;  4N5S A;  4DSJ A;  3CER A;  5AQP A;  2A40 A;  3L6Q A;  1N32 K;  5KRT A;  3G6E N;  3DM2 A;  3I8B A;  4A2A A;  1RT3 A;  3NH0 A;  2I7N A;  3UKR B;  3MN6 A;  2KZM A;  1YT3 A;  3L3U A;  3ZET B;  3AA3 A;  1CZB A;  4GVE A;  5FRN A;  2P1J A;  3QET A;  2KLA A;  4CHZ A;  5LL6 Z;  4KHQ A;  2YNG A;  2FBX A;  3T1A A;  4Z0U A;  1ZBF A;  4K42 A;  4DQ8 A;  3PLA A;  1JLQ A;  4I6M A;  4CES A;  2YI1 A;  4IWV A;  3LAM A;  2W40 A;  4JKG B;  4M3X A;  2Z1I A;  4WFN L;  2NRX A;  2F9W A;  2HST A;  4FOI A;  4DSL A;  4IEI A;  1RDC A;  4RW4 A;  3VQ9 A;  3ZEU B;  1C1B A;  3QNN A;  4NYN A;  1VK0 A;  4H5R A;  4F3O A;  5I42 A;  4DB3 A;  2HMP A;  4F3T A;  4KKO A;  3QO9 A;  5FRM A;  2HOE A;  4AM6 A;  1ATN A;  1QTM A;  4JKC A;  1K73 O;  3D0P A;  4BY9 C;  1RNH A;  4M7X A;  4JI3 K;  3HM8 A;  4GKJ K;  4IZ9 A;  2VWB A;  4CF8 A;  1N6Q A;  2YNH A;  1S9E A;  2PY5 A;  1EX4 A;  3HBT A;  3V9X A;  1DEJ A;  3O9S A;  3AGR A;  3WXL A;  1HNZ K;  4BE1 A;  3EEQ A;  2O8E B;  4ZTJ A;  1Z26 A;  4KPY A;  1A5V A;  1HLU A;  4B1Z A;  2OYQ A;  5JVH L;  1TVR A;  2KQ2 A;  2BGG A;  1JLB A;  1JJ2 M;  1KC8 O;  5HRO A;  3D2F B;  3KK7 A;  4CVN E;  1KVA A;  5JLF A;  4E19 A;  4ID5 A;  2Q2R A;  4M3Y A;  3R8E A;  1YF5 L;  3VQ6 A;  4LF5 K;  1RIL A;  3VQC A;  3AAP A;  3SV3 A;  4L3Q A;  3L2V A;  4LC9 B;  3DXK B;  3N4Q A;  4EP4 A;  2F4V K;  3KKR A;  1T7P A;  1QQO A;  3CCL N;  5C12 A;  1NJI O;  4ELU A;  2HBJ A;  3BY5 A;  4EP5 A;  2E6L A;  5KPT A;  1SL2 A;  5KPR A;  1XQS C;  5AQI A;  3HPO A;  1GLJ O;  4OLB A;  3O5B A;  1OH8 A;  2OPR A;  3OYF A;  4GW6 A;  1EQY A;  4A5B A;  4B9N A;  3OYC A;  4FOE A;  3FZH A;  2AA4 A;  4H8K A;  1KQS M;  4FJH A;  2H3G X;  5C2D A;  3HVR A;  4AHR A; 
#chains in the Genus database with same CATH homology
 4FK0 A;  4FK2 A;  3LPU A;  4CJU A;  4KV8 A;  3AO1 A;  1T03 A;  2ATQ A;  1ZBI A;  4OKJ A;  1XI1 A;  1SKR A;  2VWK A;  4RW6 A;  1QHT A;  1BIZ A;  4CF2 A;  3M8R A;  4I9Q A;  2DFF A;  2Q3S A;  2EX3 A;  2QKK A;  3QER A;  4FZX C;  3AVJ A;  4CHO A;  4CJV A;  2BAN A;  4CER A;  2HHV A;  3VQB A;  3VQP A;  4CE9 A;  4FLV A;  3S9H A;  3P5J A;  3RRG A;  1BL3 A;  2YNF A;  4CJS A;  4ZHR A;  5HP1 A;  3NAE A;  1J54 A;  1L5U A;  3S3O A;  4C8K A;  2VG6 A;  4KFB A;  4KI4 A;  2XY8 A;  5J1E A;  2X6S A;  4Z4G A;  5K14 A;  1T8E A;  2PYJ A;  1LWE A;  3KK2 A;  2F8S A;  4CJE A;  4KHU A;  1SKS A;  3OYK A;  2KFZ A;  1O1W A;  1YTA A;  1KVB A;  3I0R A;  1WSH A;  2D0B A;  1VSH A;  1RTI A;  3MXI A;  4EZ6 A;  4CFB A;  1LW0 A;  4DFK A;  3SPZ A;  4PWD A;  3AA5 X;  1WAF A;  2Z1H A;  1IO2 A;  4FJX A;  3TAM A;  5HRS A;  4JS4 A;  4LD0 A;  1Y97 A;  3LAK A;  3QLH A;  1XC9 A;  1NKB A;  4CJT A;  4FLZ A;  1LWF A;  1S6Q A;  1J9A A;  4C8M A;  3K59 A;  3AVN A;  1HQU A;  4DU4 A;  4OLA A;  4Q5V A;  1ASW A;  2GBZ A;  3MEE A;  3AO4 A;  2OPQ A;  4CEO A;  4CFC A;  3K5M A;  4KAZ A;  3PY8 A;  2FBY A;  3B6O A;  1BIU A;  1KLN A;  1IKX A;  1D5A A;  4CGF A;  1RBU A;  4CEZ A;  4FLT A;  4GMJ B;  3V9S A;  2G8V A;  1R0A A;  4M3Z A;  2RF2 A;  3MEC A;  4EZ9 A;  4I7F A;  3DRS A;  1U49 A;  1Q8I A;  2QXF A;  2A1S A;  5CYQ A;  1IH7 A;  3DRR A;  3OVN A;  3PV8 A;  4DMN A;  4CGI A;  3OYA A;  3K5N A;  5HRN A;  1RT6 A;  4B08 A;  1LW2 A;  3IG1 A;  1U45 A;  3O3H A;  2HMI A;  2Y1J A;  5DMR A;  1TAU A;  4DFM A;  4IBN A;  1U04 A;  3IRX A;  4G1Q A;  5KGW A;  4HUG A;  2Z1J A;  1HYV A;  1WLJ A;  4E3S A;  4YNQ A;  3KKS A;  3LP1 A;  1HYS A;  3HP9 A;  2HND A;  3CG7 A;  2D5R A;  4DU3 A;  1WAJ A;  3TI0 A;  3ZT1 A;  3O3F A;  3DMJ A;  3SI6 A;  4O5B A;  4DG1 A;  1RTH A;  5JS1 A;  1SUQ A;  3SUN A;  4CIE A;  5FDL A;  3SUP A;  1YVU A;  2ZD1 A;  5J2P A;  3LP0 A;  4DQQ A;  1UAX A;  3MED A;  5CYM A;  4C8N A;  3V9W A;  3CM6 A;  4CEF A;  4E0D A;  1SKW A;  3TAR A;  4FJ7 A;  3SUQ A;  1U4B A;  1BQN A;  4CGD A;  2RKI A;  1TL3 A;  3JSM A;  2OPS A;  4Y1D A;  3AVC A;  4DSF A;  1J5O A;  1EP4 A;  3VQ5 A;  3L2R A;  4BDZ A;  4FCY A;  1TKX A;  2OPP A;  5CZ2 A;  4CGJ A;  2VWJ A;  4J2E A;  2X6N A;  1NKE A;  5I3U A;  4NYF A;  4RW7 A;  3O3G A;  4B3O A;  5J2N A;  4YFU A;  4AHV A;  3HL8 A;  4KTZ A;  4FJ5 A;  4FW1 A;  4E7L A;  3UIQ A;  2D0A A;  4JLH A;  2HHW A;  1A5X A;  2E6M A;  5J2M A;  2XY5 A;  4CHN A;  4DTS A;  4F2S A;  4GVM A;  3QIP A;  3HT3 A;  3KK1 A;  3KTQ A;  3SPY A;  4DTJ A;  5CZ1 A;  1NK7 A;  3DI6 A;  1KCF A;  4KHS A;  1J53 A;  3MXJ A;  4QCL A;  3OYH A;  4JS5 A;  4CCH A;  1NK9 A;  1BCM A;  2YNI A;  3PX0 A;  3EY1 A;  1S5J A;  1JKH A;  3VQ4 A;  4W5Q A;  3ZCM A;  4DQS A;  1D8Y A;  1TKZ A;  2QKB A;  4B9V A;  3K5L A;  3QEV A;  2YHA A;  1VSE A;  1KFS A;  4M3W A;  3O4N A;  2EHG A;  4E7K A;  2F8T A;  1QQC A;  1CXU A;  2ITG A;  4Z4E A;  4KHN A;  3VQ7 A;  4HTU A;  4BE0 A;  2QK9 A;  3C95 A;  4LY7 A;  2HB5 A;  4W5O A;  4DLE A;  3V81 A;  4KRF A;  1S6P A;  4O55 A;  4FLW A;  3V1O A;  2XO7 A;  4O44 A;  4DTU A;  5JS2 A;  4ICL A;  4BWJ A;  4E7I A;  1RT5 A;  3EZ5 A;  3RRH A;  2KW4 A;  4F2R A;  4IG3 A;  4H4M A;  3OJU A;  4FJ9 A;  3DOK A;  2HHX A;  4DTM A;  2WOM A;  4DLG A;  4CGG A;  4OGC A;  3OYJ A;  2KZZ A;  2XY6 A;  1HRH A;  3TR8 A;  4Y1C A;  2I5J A;  4W5R A;  3SV4 A;  2O4I A;  3PO5 A;  4M3U A;  4CF0 A;  3OY9 A;  3SQ1 A;  1RT7 A;  3LDS A;  3MXM A;  3KLG A;  1CZ9 A;  1BQM A;  4KO0 A;  1BCO A;  4HCC A;  4AH9 A;  3SQ0 A;  4Z4C A;  4FW2 A;  1JLA A;  1KFD A;  1ZBU A;  3ZSV A;  1KRP A;  3P1G A;  2G8I A;  3DLB A;  3NDK A;  4B9T A;  1FXX A;  3HP6 A;  3V9Z A;  4DTO A;  1REV A;  2W42 A;  3ZT3 A;  3OS0 A;  4E89 A;  4CEA A;  3LWM A;  2KFN A;  1LAV A;  4DQR A;  4OKK A;  1JLE A;  4DF8 A;  1SV5 A;  2X74 A;  4OKE A;  4RW8 A;  3PX4 A;  3ZT4 A;  3C94 A;  4DTX A;  3L2U A;  1CXQ A;  3B6P A;  4I2Q A;  3NH2 A;  5KTQ A;  3HXM A;  1U48 A;  1F21 A;  3MEG A;  3C6T A;  1GOB A;  3KD5 E;  2B6A A;  3O4Q A;  5C42 A;  3KJV A;  1EKE A;  4CJQ A;  3M8Q A;  3M8S A;  1TK8 A;  2IDO A;  4CEE A;  3AO5 A;  4CFD A;  4CHY A;  4DFP A;  3NF6 A;  3RWU A;  1WSJ A;  1B9F A;  4CJ5 A;  3E01 A;  1ASU A;  4FJM A;  4TSX A;  4AHC A;  3ZSY A;  3AO3 A;  1TKD A;  4OVL A;  3BGR A;  2RPI A;  4O0I A;  2XY7 A;  3NFA A;  3KD1 E;  2OZS A;  4LSN A;  3F73 A;  1D9F A;  3VA0 A;  4B9U A;  4BE2 A;  1JXE A;  2DFH A;  1C0T A;  3THV A;  2HVI A;  1QE1 A;  3NGI A;  4FM0 A;  4O4G A;  1VRU A;  1T05 A;  4IDK A;  3LP3 A;  4DWI A;  4M3T A;  1K6Y A;  1WSF A;  4J2D A;  1JLC A;  3IAY A;  5KGX A;  4HUF A;  3I8D A;  1B92 A;  4FYD A;  2F96 A;  2FBT A;  4NCG A;  1WSG A;  4E1M A;  4PY5 A;  5KI6 A;  3ULD A;  4ID1 A;  4DFJ A;  2ZQB A;  3SYZ A;  2YKM A;  1BIS A;  1JL1 A;  1HQE A;  1VSL A;  3KLE A;  4BDY A;  3DRP A;  3PX6 A;  1NK4 A;  4J2B A;  2HHQ A;  1S1U A;  1IKV A;  1GOC A;  4E1N A;  4DQP A;  3ASM A;  4CHP A;  4ELV A;  4N76 A;  2HHU A;  4XIU A;  4DTN A;  4R5P A;  4FJJ A;  2P51 A;  1Q9X A;  3TAG A;  3AVB A;  3DLH A;  3DOL A;  3U3G A;  4E7H A;  4M45 A;  1JXB A;  1WN7 A;  3ZT0 A;  1BI4 B;  4CJP A;  1EET A;  4FM2 A;  4N56 A;  4DQI A;  3L2Q A;  5E41 A;  4B8A B;  1RDD A;  1TK5 A;  4CJK A;  1WSE A;  2D0C A;  4CK3 A;  4FLY A;  3VQD A;  4FJN A;  1XHX A;  2OA8 A;  2YV0 X;  4KRE A;  1G15 A;  2XHB A;  4KTW A;  4W5N A;  1S1W A;  4N41 A;  3S3N A;  3AVM A;  5FRO A;  3FFI A;  2ZE2 A;  4HUE A;  1S1V A;  1TKT A;  1W9H A;  4CGH A;  3VA3 A;  1BGX T;  3SJJ A;  2X78 A;  1TK0 A;  3AA4 A;  3LZI A;  3QES A;  2ETJ A;  3CFR A;  2HVH A;  1VRT A;  1VSI A;  4LSL A;  3KLH A;  1LAW A;  1C0U A;  3V1R A;  4F8R A;  2JGU A;  4DTP A;  4OPJ A;  4CIF A;  3CYM A;  3NE6 A;  4AHU A;  3LZJ A;  3DLK A;  1TV6 A;  3AVK A;  3HYF A;  3ISN C;  3T3F A;  3SQ4 A;  3SNN A;  3EYZ A;  2B4J A;  4KTQ A;  4B9M A;  4QAG A;  4DTR A;  4J2A A;  3L8B A;  1HMV A;  3I0S A;  4BWM A;  2B5J A;  2VG5 A;  1Q9Y A;  1JLF A;  3LAN A;  4RW9 A;  2G8K A;  4FVM A;  4PA1 A;  4Z4I A;  2PZS A;  1L3T A;  2IC3 A;  3OYB A;  3HPG A;  4JRQ A;  1QSY A;  1HPZ A;  1LWC A;  3ZT2 A;  1RDA A;  3V6D A;  3K57 A;  4C8O A;  1RDB A;  4FK4 A;  5HBM A;  1VSJ A;  1YTU A;  1KLM A;  1DTQ A;  1I3A A;  3F9K A;  1WSI A;  3SCX A;  5HRP A;  3HST B;  1RT1 A;  2HHT A;  1QSS A;  3NF7 A;  4OJR A;  3OYL A;  4C8L A;  3HVT A;  3K5O A;  3DLE A;  3WNH A;  4HCB A;  1L3U A;  1TL1 A;  3ZSX A;  1VSF A;  3RR8 A;  4Z4F A;  3RMC A;  1NOZ A;  2GUI A;  4MQ3 A;  4FLU A;  3H08 A;  1RBT A;  1IG9 A;  3QEX A;  4B9S A;  1QS4 A;  1W0H A;  4FJI A;  3HK2 A;  3ZSW A;  4IKF A;  4PQU A;  3A2F A;  4BAC A;  2NUB A;  4CF9 A;  4IG0 A;  1X9S A;  2G8H A;  3VQA A;  4CFA A;  3AVA A;  3HO1 A;  1WNS A;  4KHY A;  1RBS A;  4CJ4 A;  2OZM A;  2G8U A;  4HVJ A;  4CJF A;  1C0M A;  4MFB A;  3OYE A;  4AIL C;  1C1A A;  3WNF A;  2YKN A;  3NGZ A;  3TAE A;  4CJ3 A;  4I2P A;  1QSL A;  1A5W A;  1VSM A;  1NK5 A;  4LH5 A;  2HHS A;  2Z1G A;  3ZSR A;  2G8F A;  4B9L A;  4CK2 A;  3QEW A;  4KHW A;  1Z25 A;  1HJR A;  3NF8 A;  3OYG A;  1D9D A;  1JL2 A;  4CEQ A;  3TWH A;  2KTQ A;  2GV9 A;  1DLO A;  3NH1 A;  3CFP A;  5HRR A;  4I9L A;  4PUO A;  3OYD A;  4NCA A;  4FJ8 A;  3BDP A;  1S9G A;  1DTT A;  3ALY A;  3ZSQ A;  1VSK A;  5J2Q A;  3AVF A;  3NBP A;  3SQ2 A;  1UWB A;  3KIO A;  5C25 A;  4FZZ A;  2R7Y A;  4AHT A;  3CM5 A;  3QIN A;  3LP2 A;  1NK8 A;  5T7B A;  4DS4 A;  2E4L A;  1NK6 A;  4K8X A;  4LH4 A;  2HNZ A;  3U3Y A;  4N5S A;  1S1T A;  4DSJ A;  3QNO A;  1L3V A;  3HJF A;  1HYZ A;  3DYA A;  2P5O A;  3CFO A;  3ZSZ A;  4Z4H A;  5KRT A;  1X1P A;  3DM2 A;  4M41 A;  4ZTF A;  1RT3 A;  3NH0 A;  4CF1 A;  2KZM A;  1YT3 A;  3D45 A;  3L3U A;  1X9M A;  1ZBH A;  4DSE A;  3KLF A;  3AA3 A;  1UA0 A;  1CZB A;  2JLE A;  1N5Y A;  4NCB A;  5FRN A;  3RMB A;  3VN5 A;  3WNE A;  4WE1 A;  1NJZ A;  1X9W A;  2P1J A;  3AVL A;  3QET A;  2A1R A;  4E7J A;  4CHZ A;  4KHQ A;  3OS1 A;  2IAJ A;  2YNG A;  2FBX A;  4QOZ B;  3OS2 A;  3V1Q A;  2FBV A;  1L3S A;  3AVG A;  1RT2 A;  3T1A A;  4Z0U A;  1ZBF A;  3KLI A;  4OPK A;  3AVI A;  3WNG A;  1NK0 A;  1KVC A;  3TAF A;  1C1C A;  3L3V A;  4FJK A;  2RN2 A;  3NHG A;  1JLQ A;  1XWL A;  3ITH A;  3K58 A;  4CES A;  3PO4 A;  3IS9 A;  4JRP A;  1ASV A;  4KI6 A;  4FJG A;  1EXQ A;  3LAM A;  4M3X A;  3VQQ A;  1BI4 A;  2IS3 A;  1B9D A;  2Z1I A;  4O0J A;  4IFV A;  4DSL A;  2Y1I A;  2HNY A;  1RDC A;  4RW4 A;  3VQ9 A;  1VSD A;  3TAQ A;  3VQE A;  5HLF A;  1UOC A;  3LAL A;  3RTV A;  3MAQ A;  1C1B A;  3QNN A;  4NYN A;  1VK0 A;  4F3O A;  1NOY A;  3QIO A;  5I42 A;  3TAN A;  4CJL A;  3TAB A;  2BDP A;  4KKO A;  2PYL A;  4F3T A;  4DSI A;  2IOC A;  5KRS A;  3QO9 A;  4M3R A;  1FKP A;  1IKW A;  2DFE A;  1RBR A;  5FRM A;  3AO2 A;  3RMA A;  1QTM A;  3DLG A;  5C24 A;  3P83 D;  2O4G A;  3OYM A;  3D0P A;  4CJW A;  3VQ8 A;  1RNH A;  1RT4 A;  4KB0 A;  4M42 A;  3U6F A;  4FLX A;  4Q0B A;  1NJW A;  1NJY A;  1I39 A;  4CF8 A;  1HNI A;  1ZBL A;  2YNH A;  1UA1 A;  3SUO A;  1N6Q A;  3AVH A;  1S9E A;  3QEP A;  1TAQ A;  4UQG A;  2PY5 A;  4FZY A;  1EX4 A;  3QEI A;  1BHL A;  2IGI A;  3V9X A;  1RTD A;  4DSK A;  1JLG A;  5DK5 A;  4CK1 A;  1C6V A;  3OYN A;  3NF9 A;  2FC0 A;  3SZ2 A;  5D3G A;  4BE1 A;  3S3M A;  1Z26 A;  2BE2 A;  4ZTJ A;  1ITG A;  1A5V A;  4F4K A;  4KPY A;  3OJS A;  4W5T A;  2OYQ A;  1TVR A;  2KQ2 A;  3LPT A;  1TGO A;  3NCI A;  2BGG A;  2HW3 A;  4DS5 A;  1ZYQ A;  1JLB A;  4CJR A;  3JYT A;  3RR7 A;  3AV9 A;  1HNV A;  4CHQ A;  3OYI A;  3HM9 A;  5HRO A;  3KK3 A;  3V9U A;  1KVA A;  2WON A;  3HPH A;  1FK9 A;  3DLR A;  4E19 A;  1SL0 A;  4L8R B;  1RCH A;  1SL1 A;  4ID5 A;  3G0Z A;  2DTU A;  2DY4 A;  4CEC A;  3LWL A;  4M3Y A;  3TAP A;  1LV5 A;  4KB1 A;  4FJL A;  3VQ6 A;  1KTQ A;  2XRI A;  1MU2 A;  4RG8 A;  1RIL A;  4H4O A;  3VQC A;  4B8C A;  4HHT A;  3RMD A;  3SV3 A;  4N47 A;  5SZT A;  3L2V A;  4EP4 A;  1S1X A;  3T19 A;  3KKR A;  4CED A;  2P5G A;  4OGE A;  5EU7 A;  1CLQ A;  3NGY A;  1T7P A;  2G8W A;  4ELU A;  3C6U A;  3L2W A;  4K8Z A;  1NKC A;  1FKO A;  3G10 A;  1KSP A;  1NJX A;  5CY4 A;  4EP5 A;  2E6L A;  4DU1 A;  2LSN A;  3V4I A;  1SL2 A;  4FXD A;  3HPO A;  4IFY A;  4CIG A;  1IKY A;  1RBV A;  4OLB A;  2VG7 A;  3M8P A;  1GOA A;  1XHZ A;  2OPR A;  4FM1 A;  5SWM A;  2AJQ A;  3OYF A;  4CEB A;  4BDP A;  4ELT A;  4GW6 A;  3PUF A;  3ZSO A;  3OYC A;  4DF4 A;  3AA2 A;  4AHS A;  3CQ8 A;  1U47 A;  4B9N A;  4H8K A;  2YHB A;  4FJH A;  3HVR A;  4AHR A;  3K2P A;  1RTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...