3AO3A

Fragment-based approach to the design of ligands targeting a novel site on hiv-1 integrase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
153
structure length
138
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQEESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment-based design of ligands targeting a novel site on the integrase enzyme of human immunodeficiency virus 1
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/transferase inhibitor
molecule keywords POL polyprotein
total genus 49
structure length 138
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ao3A00
1XHXA 2YHAA 4FJ9A 4CJQA 3TAGA 3LAMA 3THVA 3AVBA 1HQUA 5HBMA 1RTJA 4ELUA 3RTVA 4KI4A 4FM1A 4QOZB 3VQ4A 3RMDA 1TKDA 4Q0BA 4N5SA 3NFAA 1VSMA 4FW1A 1BQMA 3ZSRA 4O55A 1SKSA 2I5JA 3RMAA 3OJUA 3KK1A 3CFRA 4JS5A 3P83D 1WSJA 1LWFA 3DYAA 4WE1A 5JS2A 3CFPA 2VG6A 2QKBA 1ZBIA 4FJ8A 1Z26A 5KRTA 3TAFA 3MAQA 1NK4A 3OYNA 3PX0A 3VQ8A 3O4QA 3CQ8A 2VWJA 4W5TA 3HVRA 1IKVA 3LWMA 3DRPA 4HCCA 2F96A 3PX6A 4C8NA 4AHUA 4PQUA 2HHUA 1TAQA 3LWLA 3V9UA 1QQCA 1NKCA 3DI6A 4DU1A 1DTTA 2BDPA 4IFYA 2KTQA 3V4IA 1RT3A 4CJUA 3S3MA 2WOMA 1Q9YA 1CLQA 4Z0UA 2FBXA 2IC3A 4JRPA 3IAYA 1C1AA 3L3UA 3M8PA 3T19A 3OYDA 1C6VA 3O3GA 1BI4A 1IH7A 3KTQA 3DLBA 1HYSA 1TK8A 4OGEA 2FC0A 3NDKA 3K57A 3ZSOA 3SNNA 2YNGA 3OYJA 2OPPA 2B5JA 3SPZA 4RW8A 1NKEA 3DLKA 3ISNC 1RCHA 3F9KA 3AA2A 5DMRA 3SPYA 3VQ6A 1KTQA 2RF2A 4OKKA 4W5OA 4J2DA 3ZT1A 3SCXA 4DFMA 4I9LA 5I3UA 1JLCA 3VQPA 3K2PA 2ETJA 2X78A 3ZSXA 3LPTA 4FLZA 3I0RA 5DK5A 3DRRA 3LPUA 3G10A 4B9MA 3RRHA 1NK7A 3QLHA 4Z4IA 4CJEA 4LH5A 1A5WA 1L3TA 5CZ2A 1NJXA 1VSEA 5EU7A 2ITGA 1S9EA 3DLRA 1RNHA 1VSKA 4DQRA 3U6FA 4M3TA 1TKZA 3O3HA 3SV3A 4DSKA 4DTSA 3OYCA 2D0AA 3E01A 2FBVA 1NK5A 3VQBA 1WAFA 3A2FA 4E3SA 3CFOA 3DLEA 4OVLA 3RR8A 4AHVA 3RMCA 1X1PA 2GBZA 5KRSA 3AVKA 4LY7A 4CECA 3AVMA 3V1QA 5CYMA 4K8XA 1KLNA 2O4IA 1QSLA 2JLEA 4B9SA 5KGXA 4Y1CA 3NE6A 2Y1JA 1QHTA 4O5BA 3QIPA 1LWEA 1NK9A 4KB0A 4CEAA 2DFFA 4CHNA 4DTUA 2OZSA 3TR8A 2HHSA 4CEEA 3V1OA 2G8IA 1Q9XA 5C42A 1S1WA 3OJSA 3RRGA 1KVBA 4B9NA 3V9XA 3RMBA 4CJPA 4OPKA 1JKHA 3AO5A 4DSJA 4M3YA 4CFBA 2KFZA 1IKXA 2XRIA 3AVLA 3VQ9A 1N5YA 4H4OA 2ATQA 1KFDA 1JL1A 3LDSA 3QEVA 3PO4A 2R7YA 4BDPA 4CK2A 2KFNA 4DFPA 3HL8A 1RTIA 1EKEA 1NOZA 1ITGA 1RTHA 4HHTA 3NH1A 2X6SA 4OPJA 1T03A 4E7KA 1NOYA 1C0TA 4B9LA 1A5XA 2G8HA 4FLTA 2AJQA 3QNNA 4FK4A 2EHGA 4KI6A 1RDBA 4Z4FA 3K5MA 4FM2A 1YTAA 1L5UA 4F2RA 4M3ZA 1KVCA 1B9FA 2XY8A 3T1AA 2FBYA 4CGJA 3HXMA 1X9SA 4BDYA 4GW6A 3OVNA 3VQDA 4PWDA 3QIOA 1ZBUA 5CZ1A 2HMIA 3OYGA 4KTZA 3KKSA 1LW2A 1Z25A 1KCFA 2DY4A 1TL1A 1EXQA 2BE2A 3LP3A 3KLEA 2WONA 3NF9A 1FKPA 3VQEA 4E1NA 4C8MA 2XHBA 3ULDA 4DSFA 1ASWA 1RDCA 3NGYA 2HVHA 4NYFA 3QEPA 3B6PA 2XY6A 2EX3A 3V6DA 3HVTA 2QXFA 2FBTA 5J2NA 3VQAA 3TABA 4M42A 4DSEA 1BL3A 3SUOA 4FJ7A 4KHYA 4XIUA 2RKIA 1RT1A 5J2MA 3M8SA 1JL2A 3UIQA 1UWBA 3WNFA 4O0JA 3HPOA 4CJTA 3K58A 1TAUA 3HO1A 3MXIA 1NK8A 4OKJA 4JRQA 4CF0A 4EZ6A 3AVGA 4FJKA 1IKYA 3KIOA 2B6AA 5CYQA 4CHOA 3TANA 4KKOA 2F8SA 3NCIA 5HLFA 1RTDA 3DLHA 4Q5VA 2YKNA 1J5OA 4FZXC 2D0BA 1U49A 1LV5A 1GOAA 4IFVA 4KHQA 1HMVA 4KV8A 4LSLA 2HHQA 1Y97A 4CJRA 4AHRA 4HUFA 3U3GA 3MEEA 3HT3A 1SKWA 4KREA 1WAJA 2XO7A 3M8RA 4DQSA 3SYZA 1WN7A 3KLGA 2IGIA 2Z1IA 1JLQA 4N76A 2KW4A 3NF8A 4AILC 5KI6A 2YKMA 2IS3A 4N56A 3AVHA 4CIFA 3VA3A 1G15A 4B8CA 1WSGA 3DOLA 3CM6A 3NF7A 4EP5A 3L2VA 4FJLA 2HHVA 2OPQA 1ASUA 3K5OA 4EZ9A 2F8TA 4MQ3A 1ZYQA 2D0CA 3LAKA 1U45A 3QINA 1TL3A 4M3XA 3NBPA 4FCYA 3FFIA 3V9SA 1K6YA 1KRPA 3SV4A 3ZSQA 1UAXA 3OYEA 3BDPA 1RBTA 1WSEA 4HUEA 3OYAA 1J53A 4FJMA 3AA4A 4CF2A 4OGCA 1RBRA 3HSTB 4RG8A 4DQQA 3HJFA 4W5RA 3PO5A 4Z4EA 2JGUA 3QEXA 1L3UA 1SKRA 4FLUA 4CJSA 3LZJA 4CEFA 1A5VA 2ZD1A 3O4NA 4M45A 4KTQA 4BE1A 4CIEA 2QKKA 1J9AA 1MU2A 4FLVA 4F3OA 1VSLA 3OS1A 3MEDA 3KKRA 4B8AB 4JS4A 1BISA 4O44A 3ZSVA 3SZ2A 3AVIA 2PYJA 3PX4A 4Z4GA 1R0AA 4FJXA 4O4GA 2QK9A 4E7LA 2Q3SA 4BE0A 1WLJA 2VG7A 4PA1A 4ZTJA 3HM9A 2Z1GA 4KRFA 3L2QA 4FLXA 4CHYA 4CGGA 4DG1A 2Y1IA 4F4KA 4NYNA 3QERA 4J2EA 2KZZA 4W5NA 3PV8A 4I9QA 3CYMA 3ZSYA 4CGIA 3V81A 2E6MA 3AA5X 1N6QA 3ZSWA 1LAWA 4CK3A 1VSDA 2D5RA 3HYFA 4CJ5A 4Z4CA 2G8KA 4OKEA 4TSXA 4C8KA 2PY5A 1KVAA 3HPHA 2OZMA 4KHNA 3P1GA 4CEOA 1RILA 2HVIA 4FLWA 1RDDA 1XHZA 4OLAA 3SQ1A 5J2QA 3ZSZA 3L2RA 1UA0A 2YNIA 4CEBA 3L2WA 3EYZA 4FJHA 3KLIA 3VA0A 1UOCA 1C0UA 3ZCMA 3IS9A 2YNHA 4CJKA 2A1RA 3WNHA 1T8EA 1UA1A 3OS2A 3O3FA 1VK0A 1VSHA 4DU4A 3OYFA 3K5NA 1JXBA 5SWMA 1BGXT 4FYDA 4IDKA 3KJVA 2E6LA 4DS5A 4DTRA 1KSPA 1D8YA 1C1BA 3SQ2A 4FVMA 4CERA 4CCHA 2HHWA 4ID5A 4CK1A 1WSIA 2XY5A 1T7PA 4H8KA 3I8DA 1S1UA 3M8QA 4CFAA 4DTXA 3V1RA 2OA8A 2HHXA 4CEDA 4E89A 4I2QA 1RT7A 4AH9A 4CHQA 1O1WA 3ZT4A 5HRPA 1ASVA 4CJWA 3K5LA 4FW2A 1C0MA 3MXJA 4I7FA 4HTUA 4RW4A 2DTUA 2IAJA 5CY4A 4BACA 4CHZA 3AO3A 4KFBA 3OYBA 2OPSA 1CZBA 3VQQA 4O0IA 3QESA 2A1SA 4GMJB 4JLHA 4CJ4A 3L8BA 3HP6A 2ZE2A 2X74A 1B92A 3SQ0A 2HW3A 3ZT0A 1RBVA 2IOCA 1RBSA 2W42A 3NHGA 1D5AA 4IG3A 1KLMA 3C95A 3LZIA 1SL1A 2OPRA 2RN2A 1HJRA 3C94A 4DTNA 4DF4A 3AVCA 2PZSA 4GVMA 3VQ5A 1VSFA 3QETA 4DTJA 4KHUA 3TAMA 3KK3A 4M3WA 3LANA 4F8RA 5C25A 4FK2A 4FXDA 3PY8A 1VSJA 1IO2A 1QSYA 2ZQBA 4LH4A 1W0HA 1ZBHA 4ZHRA 1RT5A 3KLHA 1S1TA 3QNOA 1D9DA 1JLFA 4KB1A 4M3UA 1HNVA 2HNYA 2HNZA 2LSNA 2YV0X 1FKOA 4ID1A 3PUFA 2NUBA 3MXMA 4DMNA 4CJ3A 5HRRA 5HP1A 1NK0A 3VQCA 2G8WA 3AO2A 3AVAA 2P5GA 3LP0A 3U3YA 4CJFA 2GUIA 4I2PA 4CF8A 1BHLA 1TGOA 4QAGA 3VQ7A 4PUOA 3P5JA 4KHWA 1SUQA 5KGWA 4EP4A 3CG7A 1JLAA 1QS4A 4R5PA 4FLYA 4M41A 1XI1A 2HHTA 3JYTA 3V9ZA 4LD0A 4FJNA 4W5QA 4DTMA 2KZMA 3KLFA 4HUGA 1BQNA 2P51A 5J2PA 1SL2A 4DS4A 4Y1DA 3TAQA 4DSIA 5FRNA 3ZT2A 1F21A 1IG9A 1JLBA 1CXQA 1HNIA 3OYMA 4L8RB 2DFHA 3MEGA 2YNFA 2IDOA 4KO0A 1U4BA 2BANA 1D9FA 4H4MA 3EZ5A 4UQGA 4CGFA 1RT2A 1L3VA 1S6PA 1T05A 1HYVA 2BGGA 2PYLA 4FJIA 1RT6A 3TAEA 4CF1A 1NK6A 3DM2A 1JLGA 3B6OA 1RDAA 3D45A 1DTQA 4Z4HA 1BI4B 1WSFA 5J1EA 5K14A 1SV5A 4N41A 1S1XA 2YHBA 3HP9A 4ELTA 1NJZA 4B3OA 4QCLA 2B4JA 1LWCA 3ZT3A 4CFCA 4CHPA 3TWHA 1U48A 3AO1A 4FJJA 4YFUA 4RW7A 3V9WA 4F3TA 1Q8IA 3AVFA 4MFBA 2G8UA 4HVJA 5T7BA 1REVA 4DFJA 4G1QA 1X9MA 3QEIA 3RR7A 1NJWA 3SI6A 1ZBFA 4DSLA 3AA3A 4ELVA 4DLEA 3ALYA 3I0SA 3KK2A 3D0PA 1S9GA 2KQ2A 3G0ZA 3OY9A 3L2UA 3C6UA 4DQPA 1B9DA 1C1CA 4CFDA 1EX4A 4BE2A 3T3FA 3NH0A 5HROA 4M3RA 4OJRA 1SL0A 1L3SA 4KPYA 4CESA 3S3NA 4FK0A 1HRHA 3KD5E 4FZZA 1TV6A 1HPZA 2X6NA 3L3VA 2DFEA 4FJ5A 1JLEA 4C8LA 4FJGA 3DLGA 1J54A 1GOBA 1LW0A 1XWLA 4E19A 1WNSA 2G8FA 3H08A 3VN5A 4CJLA 4B08A 1X9WA 3WNGA 1KFSA 1YTUA 3K59A 1LAVA 3LALA 4DTPA 1JXEA 1NJYA 1TVRA 3OYKA 3ASMA 1BCOA 3MECA 4NCGA 1I3AA 3S9HA 4DQIA 3DMJA 1RBUA 5D3GA 2Z1JA 3JSMA 4CEQA 4N47A 3SUPA 2HNDA 3TAPA 3AO4A 1VRTA 3LP1A 3AV9A 4J2AA 5C24A 1XC9A 1VSIA 3C6TA 3QEWA 4IBNA 4BWJA 3NGIA 1EETA 3AVJA 3QO9A 4IKFA 4NCAA 1U47A 4NCBA 3HK2A 3EY1A 4LSNA 3NF6A 2G8VA 4ZTFA 4CGHA 4DFKA 3LP2A 2HB5A 2VG5A 4AHCA 4DF8A 1EP4A 3TARA 3SJJA 5E41A 4PY5A 1YT3A 4CE9A 3OYIA 4K8ZA 3TI0A 3NH2A 1FXXA 1TKXA 2VWKA 3SUNA 1QTMA 1GOCA 4DWIA 1I39A 2O4GA 5HRNA 4YNQA 5KTQA 1BIZA 4DU3A 4CGDA 3NGZA 4DTOA 5FRMA 1BCMA 4CF9A 1DLOA 3DRSA 4B9UA 1S6QA 1HQEA 1S1VA 5I42A 3KD1E 4F2SA 4ICLA 4CJVA 4CEZA 4E7JA 4RW6A 4E1MA 1QSSA 4KHSA 1RT4A 1HYZA 3NAEA 4HCBA 3OS0A 4BDZA 1TK5A 2P5OA 3CM5A 3F73A 3ITHA 1U04A 5HRSA 3HPGA 3OYHA 3OYLA 5JS1A 4RW9A 4E7IA 5FROA 1IKWA 3AVNA 3SQ4A 4BWMA 2OYQA 4FZYA 4B9VA 2Z1HA 4B9TA 3RWUA 1QE1A 4FM0A 2GV9A 4DLGA 1CXUA 1FK9A 4AHSA 5SZTA 4E0DA 3SUQA 1BIUA 3IG1A 3S3OA 4OLBA 1WSHA 1W9HA 4J2BA 1CZ9A 4IG0A 4KAZA 3DOKA 1TK0A 3IRXA 2E4LA 1TKTA 1YVUA 3WNEA 3BGRA 2RPIA 4KTWA 1S5JA 4AHTA 4CIGA 4E7HA 1VRUA 1ZBLA 1NKBA 5FDLA 4C8OA 2XY7A 2P1JA
chains in the Genus database with same CATH superfamily
2NRRA 2YHAA 3GOIA 3THVA 1NGFA 5AQJA 3VPZA 4IJNA 3G4SN 4N5SA 2E88A 3NFAA 4OPHA 4BRCA 3KK1A 2VG6A 1ZBIA 2D4WA 5KRTA 3TAFA 1NK4A 3CCJN 3O4QA 3HVRA 3H46O 3DRPA 3SAGA 4GVEA 1NWKA 3DI6A 2BDPA 1C0GA 1RT3A 4JHDB 3T19A 3BF3A 3C6HA 4R79A 2OCEA 2YNGA 2ZF5O 1KD1O 2B5JA 4RW8A 1NKEA 2A41A 3ISNC 3F9KA 3VQ6A 4W5OA 1NGBA 2Q31A 3SCXA 4I9LA 5I3UA 3K2PA 2X78A 4FPBA 3I0RA 4PKGA 3QLHA 4Z4IA 4CJEA 1VSEA 4KBOA 3O3HA 4DSKA 2E8AA 1WBDA 3HI0A 5AQYA 1T6DA 3VQBA 1MA9B 3CETA 4OVLA 3AGKA 3RMCA 1X1PA 5KRSA 3AVKA 5EOYA 1LCUA 2PBDA 4CECA 3AY9A 1KLNA 2O4IA 4LC9B 2Y1JA 3QIPA 1NK9A 3O8MA 4BRNA 1BU6O 3TR8A 2G8IA 3MWPA 5AZIB 4DUZK 4DSJA 2XRIA 3AVLA 1KFDA 3LDSA 1J6ZA 3PO4A 4BY9C 1FW6A 1NOZA 1ITGA 3FLCO 4HHTA 1BG3A 3NH1A 1T03A 4E7KA 3TU5A 1C0TA 5M1KA 4HWIA 4FK4A 3I8BA 4Z4FA 1YTAA 1KVCA 4BDYA 3QDKA 2E2NA 3QIOA 3OYGA 3KKSA 1LW2A 3M1FA 4GNIA 2DY4A 1TL1A 2BE2A 4GKJK 1FKPA 4DSFA 4C8MA 4DR5K 5AQHA 1EO1A 2QXFA 4RTFD 3SUOA 1VQON 4KHYA 4X66K 5AQRA 4O0JA 1XNQK 3HPOA 4JD2A 4B1UB 4JRQA 4CF0A 4FJKA 4JKHA 1IKYA 3TANA 1HJOA 4FWRA 3HZ6A 4CBWA 3MX2A 2YKNA 4FZXC 4JK8A 4IFVA 4KHQA 1HX1A 4LSLA 1Y97A 3MEEA 3HT3A 4FSVA 1WAJA 4BRQA 4KREA 2FSJA 4FWNA 4BR4A 3FZHA 1YVNA 3MCPA 4N76A 4BQLA 5KI6A 2IS3A 4CIFA 4FJLA 4PHTX 2HHVA 2OPQA 5HOOA 3K5OA 3A5MC 2F8TA 4MQ3A 2D0CA 3NBPA 4CVNE 1VQKN 5AQFA 1UAXA 1RBTA 1J53A 4FJMA 3AA4A 4CF2A 5ADXA 4JHDA 4RG8A 3P4IA 1SKRA 4MDBA 3TPQA 3O9SA 4JKGA 4BRAA 4CEFA 1A5VA 4M45A 2UUBK 4BE1A 3G71N 3OS1A 3KKRA 4FJXA 4O4GA 3S41A 2QK9A 5GIOA 4PA1A 1QZ6A 3L2QA 5M1FA 4CHYA 2KZZA 4W5NA 3LDOA 4IOCL 1U6ZA 3ZSYA 3V81A 2P9SB 2HHHK 2EWSA 1KVAA 1XNRK 3R8EA 4O5FA 4WFBL 4A61A 4CEOA 1BDGA 4FLWA 3NMUA 1XHZA 5F2RA 3IMXA 1IG8A 1UA0A 3SBGA 4BR7A 2HBMA 3FR0A 1VHXA 3VA0A 1YAGA 2Q1NA 4PKHA 1HKBA 3WNHA 4DR3K 3AAPA 4CZMA 2QWQA 3VEVA 5SWMA 3WUHA 3SQ2A 4DKWA 4CCHA 4ID5A 1KAZA 4IDHA 4CFAA 3V1RA 4I2QA 1RT7A 4CHQA 4V19S 1O1WA 1N8RO 4H0VB 4JD2B 3ZLJA 2FF3B 4I7FA 5CY4A 2FXUA 4DV7K 3VQQA 4H0XB 5M1PA 3OTOK 2ZE2A 1GLFO 2IOCA 2CGKA 4IG3A 3C95A 5A2QO 4U7BA 3BP8A 2OPRA 2DPNA 3CJ7A 3W0LA 4DTNA 4DF4A 3AVCA 2PZSA 4GVMA 5EXWA 3VQ5A 4GKKK 4IWVA 3WXJA 3G6EN 3C6AA 3LANA 4FK2A 4FXDA 3PY8A 5GAEP 1VSJA 1IO2A 4B3SK 4AM7A 5GIPA 3QNOA 1S1TA 4M3UA 1ZC6A 1JLFA 2HNYA 2YV0X 2LSNA 2KHOA 1FKOA 2NUBA 4CJ3A 5HRRA 5AQUA 3VQCA 2O8DB 2G8WA 2A40A 3FZLA 4FOEA 4CF8A 3VQ7A 3C65A 4KHWA 3J81O 1S22A 1JLAA 4FOIA 3VEYA 4FJNA 4JKAA 2KZMA 5BRDA 1T6CA 3I33A 4B9QA 1SL2A 3E66A 3TAQA 2HBJA 2ASPA 1VQ5N 1HNIA 3OYMA 2VYPA 4ILGB 4B1WB 1BA1A 4X62K 3MEGA 2O8BA 4EHTA 2IDOA 4KO0A 3CMEN 4UQGA 1L3VA 1S6PA 1T05A 1WBBA 4FJIA 4CF1A 1NK6A 4GV9A 4B3RK 3VTHA 1BI4B 4B3MK 1OVYA 1S1XA 2YHBA 4JYAK 4LF8K 3DJCA 4L3QA 5C10A 2B4JA 1DGKN 1LWCA 2E20A 3ZT3A 4CFCA 4K0KK 4QCLA 3WXMB 4YFUA 4HTLA 1Z6RA 4G1QA 2UUCK 3T1HK 3SI6A 4H5RA 2I7NA 2KQ2A 4DQPA 4CZJA 3T7ZA 3UE5A 3NH0A 5HROA 2HMPA 4DV1K 4FK0A 2BTFA 1HRHA 3KD5E 3SMSA 1TV6A 3K9KA 4MLEA 3ZX2A 4FJ5A 4C8LA 3D2FA 3DLGA 3EE9A 2GWKA 4CJLA 4B08A 5KPZA 4JK9A 4WQ5C 2GUPA 1BCOA 3MECA 4NCGA 5F1XA 1I3AA 2O8CA 1Q7YO 5C2DA 4CEQA 2O8BB 3LP1A 4QS9A 4ILHA 4IXCA 3QEWA 1SQKA 4IBNA 3EKUA 3MK6A 4IKFA 1YXQA 3E9OA 4LF9K 4Z94A 2HB5A 1EP4A 4PY5A 4CE9A 2O8FB 4K8ZA 3TI0A 3NH2A 4WFAL 1TKXA 2VQEK 1YHQN 3SUNA 3D2EB 1GOCA 2GTDA 3NGZA 3VENA 5FRMA 1BCMA 2P9SA 3DRSA 1S6QA 4ICLA 3EE8A 3LM9A 1YJNN 4KHSA 4DV2K 3O9TA 3CM5A 1XUPO 3HPGA 3OYHA 3OYLA 4E7IA 3F9MA 2Z1HA 1OH7A 3LDNA 4IOAL 2IVOA 1MWMA 4AHSA 3PSFA 2QW9A 3K0SA 1WSHA 2IIRA 3PIPL 5FLXO 3GBTA 1GLBG 4DQ8A 3WNEA 1MDUB 2RPIA 3AAQA 1DT9A 3U4LA 1NKBA 1GLEG 3E9PA 2XY7A 2V51B 3CJAA 4FJ9A 3AVBA 3LDLA 5HBMA 4CBUA 4FM1A 4M7XA 3OBYA 3ID6A 3KWIA 3RMDA 3NVMA 4Q0BA 1TUUA 2I5JA 5AQNA 3RMAA 4EIAA 4YOYA 4JS5A 3CFPA 5JS2A 3ZETB 3H1QA 1Z26A 2BUPA 3VQ8A 2UYTA 4W5TA 1IKVA 4HCCA 2F96A 2HHUA 1TAQA 3LWLA 4A57A 4WQ5A 2NRXA 4CJUA 2WOMA 1CLQA 2UXBK 3L4IA 1QQOA 4JRPA 3L3UA 4WYBA 5AQWA 3OYDA 1BI4A 3KTQA 1HYSA 1TK8A 3NDKA 3CJ1A 5GADP 2Q2RA 4X64K 3OYJA 3O08A 2OPPA 2QEXN 3DLKA 5GAGP 1RCHA 3GE1A 4OKKA 4J2DA 4DFMA 4FLZA 5AQPA 5DK5A 3CXCM 1XMQK 1NK7A 5JVHL 4LH5A 1TKZA 1YJ9N 4IEEA 4DTSA 4A5BA 3VGKA 4E3SA 3DLEA 2GEMA 4AHVA 3CPEA 5IT9O 4DHYA 1Q81O 2W6KA 3B8AX 3MN6A 3M3ZA 2P9KA 1Z05A 5CYMA 4JI1K 4K8XA 3H1VX 1XC3A 3VF6A 4Y1CA 4PL7A 1QHTA 1LWEA 3EEQA 4YHHK 2HHSA 4K43A 3VESA 5C42A 3WEEA 3OJSA 4A2AA 4DV0K 3RRGA 1KVBA 4H0YB 1ZXOA 3CC4N 1JKHA 2KFZA 2ATQA 3QEVA 4BDPA 4CK2A 4DV4K 5FPDA 3LDPA 2KFNA 3H45C 4DFPA 3HL8A 4DV3K 1RTIA 5BPLA 1RTHA 2X6SA 1NOYA 4B9LA 2G8HA 2AJQA 3K5MA 4FM2A 4F2RA 4M3ZA 4CGJA 2FBYA 4PWDA 4NO7A 4DV6K 3QFPA 2VWBA 4FWKA 4BRPA 3S3NA 4NB4A 1ASWA 1RDCA 4EFHA 2HVHA 3QEPA 2XY6A 3MWTA 2EX3A 3CQXA 1C0FA 2FBTA 5J2NA 4M42A 4DSEA 2YHYA 3O6WA 4FJ7A 1M1KO 3UIQA 3CIPA 1UWBA 4CJTA 3K58A 4YOTA 2PFUA 3KIOA 2B6AA 3FE1A 3FGUA 5CYQA 4CHOA 5HLFA 1RTDA 1HR0K 3C7NB 4Q5VA 1R59O 1J5OA 3HBTA 1GOAA 3LL3A 2HHQA 2F9WA 3VEXA 4GV3A 4HUFA 2GELA 2ASOA 1SKWA 1NM1A 2XO7A 1U2VB 5M1OA 2YHWA 3KLGA 2Z1IA 1BOTO 3EO3A 1JLQA 3THXA 2KW4A 4CZIA 2OTJN 5AFUH 3WT0A 1G15A 3DOLA 3CM6A 3NF7A 4EP5A 2OTLN 1ZYQA 3QINA 1TL3A 5GAHP 4FCYA 3FFIA 1KRPA 1IJJA 3RSEA 1WSEA 4OGCA 5E26A 5AQXA 4W5RA 4XH4A 2ITMA 3DXKB 1NJIO 1L3UA 4CJSA 3LZJA 2ZD1A 4IOXA 2QKKA 1J9AA 4CD1A 4F3OA 4JS4A 4B8AB 1YIJN 4O44A 3ZX0A 2HBKA 2PYJA 3PX4A 4Z4GA 4E7LA 3L6QA 3HM9A 2Z1GA 4KRFA 3CHWA 4FLXA 4G9ZA 4CGGA 4DG1A 2Y1IA 3QERA 4I9QA 4KH4A 3CYMA 4CGIA 5MLCQ 2E6MA 1VQ7N 1W97L 3ZEUB 1LAWA 4CK3A 2D5RA 1Q18A 2PY5A 2OZMA 3P1GA 1RDDA 4RWTA 1RDWX 3ZSZA 5C12A 2YNIA 4CEBA 3KLIA 1DKGD 2W41A 1C0UA 1ATRA 4ISEA 3IS9A 4CJKA 1T8EA 3CCUN 4JK7A 3K5NA 1JXBA 2PAVA 5KPTA 4FYDA 4IDKA 5BRHA 1KSPA 2WBNA 4K41A 4CERA 4CK1A 1WSIA 1S1UA 3FZKA 2A6AA 2HHXA 4E89A 4AH9A 1ASVA 3TSPA 5LL6Z 3K5LA 2WTUA 1YITN 3L0QA 4AM6A 3MXJA 2DTUA 4HTUA 2YHXA 4KFBA 2ZJQL 2CH6A 3DXMB 3I56N 5JMVA 3CF5L 4JLHA 4BROA 2X74A 1B92A 3UKRB 1H1VA 3AARA 2W42A 3WXIA 3LZIA 3KZBA 2RN2A 3C94A 4OPAA 3MN7A 2JWKA 3H3NO 1QSYA 5AZJB 2ZQBA 4ZHRA 3KLHA 3J7YP 4NXMK 5BR8K 3MXMA 1GLDG 3TSQA 2P5GA 3O1BA 3U3YA 2Q0UA 1YF5L 4JKFA 5AQLA 4PUOA 4B1YB 3CG7A 4R5PA 2AP1A 4LD0A 4W5QA 1KAYA 3KLFA 1T44A 2P51A 5J2PA 2O8EB 2F4VK 4DSIA 3F5TA 3O9UA 4WCEL 3O9RA 2HOEA 2AA4A 1CXQA 2E2QA 2FLOA 1ZBSA 2YNFA 4H4MA 3QBXA 3EZ5A 2WUSA 1EWRA 4DUYK 4JEPA 3VF2A 5LJWA 3TAEA 3H6EA 3B6OA 1J5EK 1BUPA 3D45A 5KPRA 1DTQA 1GLJO 3U8XA 4JI2K 5K14A 1SV5A 1QVFM 4ELTA 4FJJA 4CHPA 3AO1A 3V9WA 3AVFA 4MFBA 4EHUA 1REVA 1NJWA 1ZBFA 4DLEA 3I0SA 3SYZA 3D0PA 3G0ZA 1B9DA 4CFDA 1EX4A 4M3RA 4ILJA 5KQ8A 3NVKA 4CESA 2HSTA 1T3VA 3TTFA 2X6NA 2DFEA 1JLEA 4FJGA 1XWLA 4BG9A 2G8FA 1RFQA 3VN5A 1KFSA 3WNGA 2O8DA 1JXEA 1NJYA 3R9PA 3S9HA 3LM2A 3HRGA 3SUPA 2HNDA 1BO5O 3ENOA 2W6LA 3O9QA 4A2BA 1VSIA 4BWJA 1EETA 4NCAA 1U47A 3HK2A 1SZ2A 3NF6A 4BC5A 3QFUA 2E5LK 4DF8A 3LP2A 4AHCA 3OYIA 3LDQA 3FZMA 1QTMA 4YOWA 1NG9A 4DR7K 4YORA 1NGCA 4O8UA 4Y0WA 4BRMA 1HNXK 4LF6K 1DLOA 4B9UA 4LFCK 4CEZA 1TYQB 1VQ6N 3NAEA 3KWGA 4BRDA 3OS0A 4BDZA 3F73A 5AQIA 3ITHA 2VGNA 5HRSA 4CBXA 2NRWA 2OYQA 2IVNA 4B9VA 5AQMA 4LF7K 1VQPN 1QE1A 1EWQA 1FK9A 4E0DA 3SUQA 3IG1A 3S3OA 4OLBA 1W9HA 4J2BA 1CZ9A 4KAZA 1TK0A 2D1KA 1TKTA 2E4LA 4E7HA 4JAXA 4C8OA 2J4RA 5FPEA 2P1JA 1T7PA 1XHXA 4FPAA 1JCFA 4CJQA 5BRFA 3TAGA 4JKDA 3WXKA 1HQUA 4JN4A 3VQ4A 5AJ3K 2UXCK 1VSMA 2VGMA 4CZLA 3P31A 5EX5A 5ELZA 3OJUA 3P83D 1WSJA 3DYAA 1YI2N 4BC2A 2A42A 3BF1A 3VGMA 3PX0A 3CQ8A 2VWJA 3D7EO 3KVGA 4C8NA 4AHUA 1NGJA 3V9UA 1QQCA 1NKCA 1DTTA 4IFYA 4B1VA 2NRTA 1Q9YA 4Z0UA 3IAYA 3M8PA 4FWMA 1C6VA 3O3GA 1IH7A 3A5NC 2FC0A 3BZCA 2V7ZA 4JI8K 3J7AP 3ZSOA 1LOTB 3SPZA 3SPYA 3O5BA 5AQOA 5LJVA 3VQPA 2ETJA 3LPTA 3DRRA 3LPUA 1NLVA 5AQGA 4YOVA 3THWB 5EU7A 1NJXA 1VSKA 1RNHA 1NGHA 3DLRA 3E1YA 4M3TA 1SAZA 1VQ8N 5CHIA 3SV3A 1HUXA 2UU9K 3CC2N 3EZWA 2D0AA 3E01A 3ULEA 1NK5A 3CFOA 5AR0A 3RR8A 3GG4A 4LY7A 3ID8A 2JLEA 4B9SA 3EKSA 5KGXA 3NE6A 5DM6L 1GLLO 4KB0A 3BEXA 4KHPK 2DFFA 4C23A 4CHNA 2OZSA 1NGEA 4CEEA 3V1OA 1N34K 3CERA 4XH5A 3PIOL 4B9NA 4CJPA 2F9TA 4OPKA 3ZETA 4M3YA 4H4OA 2ZGYA 2R7YA 2E2OA 1OH6A 2VCPA 3A0IX 3MX5A 4MO5A 2P9NB 4PKIA 1RDBA 1L5UA 3HXMA 1B9FA 1X9SA 2O8FA 4WQ4C 4GW6A 3OVNA 5LY3A 2CGJA 1ZBUA 5CZ1A 3WQUA 4IO8A 4IJAA 3P38A 1EXQA 4FO0A 2XHBA 2QWRA 3CJCA 3RVCA 2VQFK 3NGYA 4NYFA 1BWFO 3SK3A 1P90A 3M8SA 1JL2A 5AQZA 3WNFA 1VQMN 1TAUA 3HO1A 3MXIA 3CCEN 4OKJA 4EZ6A 3AVGA 1GLAG 4KKOA 1N33K 2F8SA 3NCIA 3SMPA 3DLHA 2D0BA 5KQDA 1U49A 5BN9A 1LV5A 1NGDA 4KV8A 3U3GA 3IFRA 2IGIA 3BY5A 3NF8A 1NNEA 4AILC 2YKMA 4N56A 3AVHA 5AQVA 1WSGA 3L2VA 1ASUA 2RE2A 4JI6K 3A8YA 1U45A 3TTCA 2P9NA 3V9SA 3ZSQA 3BDPA 3OYAA 4H5TA 1NGIA 3HJFA 1RBRA 3HSTB 4DQQA 4Z4EA 2FSKA 2JGUA 3HSCA 3SBTA 4B1ZA 4FLUA 5AFUA 4AQYK 3O4NA 4CIEA 1V4SA 2ASMA 4FLVA 3MEDA 3ZSVA 4BGAA 1XQSC 3SZ2A 4H5WA 2Q3SA 1WLJA 2VG7A 4FWQA 5HL7L 4NYNA 3UB5A 3PV8A 3FFKB 4BRFA 2Q97A 1VSDA 3HYFA 4YOUA 4CJ5A 2G8KA 4OKEA 4TSXA 4JI7K 3JXUA 2P9PA 3HPHA 1RILA 4BR0A 4OLAA 4GY2B 3CI5A 5J2QA 3SQ1A 4JI3K 3L2RA 3EYZA 4FJHA 4YDUC 3H3OB 2OANA 4A59A 1UOCA 3ZCMA 4FVUA 2P9UA 4QS8A 2A5XA 2YNHA 5CR4A 2NRVA 4DU4A 3OYFA 1E3MA 1BGXT 4BR2A 3KJVA 3THXB 4DTRA 4CD3A 1C1BA 3I55N 2E1YA 4BC4A 2XY5A 4H8KA 3I8DA 3M8QA 4CEDA 4JKGB 3ZT4A 4CJWA 4FW2A 2UUAK 4C1NK 2IAJA 4BACA 4CHZA 2P9LA 5F0XA 2A1SA 4GMJB 3O80A 3L8BA 1HPMA 3ZT0A 1RBSA 3NHGA 1OH8A 1D5AA 1SL1A 2NRHA 4YY3K 1HJRA 2H3GX 2HF3A 3QETA 1VSFA 4DTJA 4M3WA 1MWKA 2NNWA 5C25A 4NXNK 4LH4A 1W0HA 5C2FA 1RT5A 1D9DA 3D2EA 2HNZA 3BZKA 3PUFA 1JCEA 3OBWA 3AO2A 2P9UB 1KXPA 5BPNA 3QBWA 4CJFA 2GUIA 4I2PA 1TGOA 4OO1J 4QAGA 3VEOA 3J8AA 1WB9A 3D6RA 5KGWA 1QS4A 4FLYA 1NMDA 3CMAN 3MMVA 4JKEA 1BQNA 1NGAA 3MDQA 5FRNA 3GDQA 1IG9A 1JLBA 4L8RB 2NRZA 3E9LA 2QTDA 3UKUA 1RT2A 4X65K 2QWNA 1RT6A 1RDUA 3DM2A 1JLGA 2YI1A 4N41A 3HP9A 1N36K 3THWA 4F3TA 2G8UA 1S72N 4HVJA 2YX6A 4DFJA 1X9MA 4DSLA 2QWPA 3RR7A 4DR4K 3AA3A 2P9IB 5JICA 3OY9A 4BE2A 1C1CA 3T3FA 3OHRA 3OA9A 3KK7A 4OJRA 1VQ4N 4KPYA 4E1JA 1ATSA 4FZZA 2P9PB 3BUZB 3SAFA 1E4GT 3ENHA 3CJ9A 5LMNK 4MDAA 1YTUA 4DV5K 3W3DA 4DR1K 4DTPA 3OYKA 3ASMA 4DQIA 3AGRA 4UY8O 3DMJA 1RBUA 5D3GA 1OVQA 3AO4A 1VRTA 3A5LC 5C24A 3C6TA 5JLHA 4NCBA 1K8AO 2QWLA 4LSNA 3EY1A 2GX9A 2G8VA 1NGGA 2Q0RA 4CGHA 4DFKA 3CCQN 2VG5A 5BREA 3ZYYX 3TARA 3SJJA 1VAZA 4YOXA 1YT3A 2VWKA 2O8CB 3J80O 4DR2K 3MN9A 1HKCA 4DWIA 5KTQA 1BIZA 4JKCA 4CGDA 4DTOA 3QICA 5I42A 1HQEA 1S1VA 4F2SA 1VQ9N 4RCHA 4XEIA 1E4FT 1QSSA 1HYZA 3KHYA 1U04A 5TKYA 2D0PA 2E2PA 4RW9A 5FROA 3SQ4A 3RSEB 4B9TA 3RWUA 1Y64A 4FM0A 4O8KA 1CXUA 3C0BA 5SZTA 1BIUA 3T1YK 1EQYA 3DOKA 2WFBA 1YVUA 4U67L 4KTWA 4AHTA 1ZBLA 5EVZA 3M6GA 3ATUA 2HF4A 3O1WA 5AZJA 3LAMA 1RTJA 4ELUA 3RTVA 4KI4A 4QOZB 1TKDA 1IV0A 4FW1A 1BQMA 2BH1A 3ZSRA 4OX9K 4O55A 1SKSA 3ZEUA 5LMUK 3CFRA 1LWFA 4WE1A 2QKBA 3SLCA 4FJ8A 3MAQA 3OYNA 1OH5A 3QB0A 3TTDA 1K8KA 3LWMA 3PX6A 4PQUA 4DU1A 1IBMK 2KTQA 1I94K 3V4IA 3S3MA 1X3NA 2FBXA 4BRKA 2IC3A 5CE3A 4DB3A 4H0TB 3VF4A 1C1AA 3D2FB 3SAHA 1YUWA 3DXKA 3DLBA 4JI5K 3QMLA 4OGEA 3TSUA 3VETA 4BREA 3K57A 3SNNA 1OKJA 5DMRA 3AA2A 1KTQA 1TUYA 2RF2A 3IUCA 3ZT1A 2E1ZA 1JLCA 3VGLA 3ZSXA 2QI2A 4FL9A 3G10A 2P9KB 3IKMA 4ISGA 4CW7B 3RRHA 4B9MA 1A5WA 1L3TA 5CZ2A 3CJBA 1Q86O 1S9EA 2ITGA 4DQRA 3U6FA 2IVPA 3HM8A 3OYCA 3UKRA 2FBVA 1WAFA 3A2FA 3R1XA 2GBZA 5JVGL 5IWAK 3AVMA 3V1QA 1QSLA 3U9ZA 3K9JA 2QWMA 5AQSA 4O5BA 2ZWHA 4CZHA 4CEAA 2Q36A 4DTUA 3PSIA 3T69A 1Q9XA 1S1WA 1QHAA 3V9XA 3RMBA 3AO5A 4CFBA 1IKXA 3VQ9A 4XH1A 1N5YA 1QZ5A 1JL1A 4DCHA 5BN8A 3PLAA 2FF6A 1EKEA 4JI4K 3CQYA 4OPJA 3ZX3A 1A5XA 4FLTA 3UKUB 3WEEB 3QNNA 2EHGA 4KI6A 3GL1A 2XY8A 3T1AA 3VQDA 2HMIA 1IBKK 4KTZA 1Z25A 1D4XA 1KCFA 4JKBA 3LP3A 3KLEA 2WONA 3NF9A 3VQEA 4E1NA 3ULDA 1CZAN 5DM7L 3B6PA 3V6DA 3HVTA 4BQZA 3TABA 3VQAA 1DEJA 1BL3A 4XIUA 2WC9A 2RKIA 1RT1A 5J2MA 4I6MB 1K8KB 1NBWA 1NK8A 4IO9L 2D0OA 1WOQA 4BRGA 3SJHA 4WF9L 3DAWA 4JNEA 1HNWK 1HMVA 1ILYA 4H5NA 4CJRA 4AHRA 3R3LA 2UXDK 4BRHA 1JCGA 4CZGA 3M8RA 4DQSA 4B1XB 1WN7A 3VMFB 2V52B 2ZGZA 4IZ9A 3CCRN 4FWSA 3VA3A 4B8CA 4KH6A 3C7NA 4GV6A 1JJ2M 2QXLA 3N4PA 4C1NI 4EZ9A 3EN9A 3LAKA 4CZKA 4M3XA 1K6YA 3SV4A 4H5VA 3OYEA 4HUEA 3MN5A 4LFBK 3THYA 4A5AA 2I7PA 3PO5A 3QEXA 1X9JA 4NLCA 1W2BM 3MCAB 4KTQA 1KAXA 1MU2A 1VSLA 1BISA 3AVIA 3VEWA 1Q82O 4BR5A 1R0AA 2YCHA 4BE0A 5FPNA 4KH5A 4ZTJA 3CCSN 4FWOA 4J2EA 4F4KA 3O4WA 1QVGM 4FWLA 4MO4A 3AA5X 1N6QA 3ZSWA 4Z4CA 1TYQA 4C8KA 4H0PA 5I9EB 4KHNA 1U2VA 3DWLA 4IFEA 2HVIA 1FJGK 1VQNN 1QQNA 1N32K 3L2WA 4QS7A 2F7TA 2A1RA 1UA1A 3OS2A 3O3FA 1VK0A 1VSHA 3HOSA 5C0YA 4LF4K 2E6LA 4DS5A 1D8YA 4FVMA 2HHWA 1G99A 2YJEA 4DTXA 2OA8A 1HLUA 4IEIA 1WUAA 3G25A 5HRPA 2ZJPL 4A62A 1C0MA 4K25A 5EY4A 3R6MA 4BC3A 4RW4A 5AQTA 1KQSM 3AO3A 3OYBA 2OPSA 1CZBA 1IBLK 4O0IA 3QESA 5BPMA 4CJ4A 3HP6A 4LF5K 3SQ0A 2HW3A 1RBVA 1W7AA 2P9IA 2V7YA 1KLMA 4M7YA 5E84A 5BR9A 2QM1A 4KHUA 3TAMA 3KK3A 2KKZA 5GINA 2CH5A 3JAMO 4B3TK 4F8RA 2QA4N 3Q7BA 4WQ4A 1ZBHA 3HTVA 2FSNA 4YDUA 4KB1A 5M1QA 1HNVA 1BA0A 4H0OA 4F9OA 4ID1A 5FPMA 4DMNA 1NK0A 5HP1A 3CCLN 4WFNL 4LFAK 4CJ7A 3AVAA 4BR9A 3LP0A 3WXLA 4EAHD 1BHLA 1VQLN 3HOTA 3JS6A 3P5JA 3OW2M 1SUQA 4BG8A 4EP4A 3VOVA 1XMOK 4M41A 1O13A 1XI1A 2HHTA 3JYTA 3V9ZA 1NU0A 4DTMA 2RHKA 4HUGA 4DS4A 1S3XA 4Y1DA 4BRLA 3WQTA 3ZT2A 4JV5K 1F21A 3VTIA 3VERA 3U9DA 2DFHA 2ZJRL 1U4BA 4J8FA 1D9FA 1P8ZA 2BANA 3EL2A 3VEZA 3L4QA 4AF1A 5JLFA 3THYB 1M90O 4CGFA 4ISFA 1HYVA 2BGGA 2PYLA 4BVPA 1RDAA 2ZM6K 2O8EA 3CC7N 4Z4HA 1WSFA 5J1EA 2P9LB 1V4TA 4B3OA 1NJZA 5C15A 2YJFA 3TWHA 1U48A 4RW7A 1ESVA 1Q8IA 5AQKA 4BVOA 5T7BA 1HKGA 3QEIA 1KC8O 4ELVA 3ALYA 3KK2A 1S9GA 3L2UA 3C6UA 3CCMN 1X3MA 4DR6K 3A5OC 1SL0A 1L3SA 4M63C 1HNZK 3F2KA 1HPZA 3L3VA 2A3ZA 2NZTA 4PL8A 3CCVN 1J54A 1GOBA 1LW0A 2GWJA 4CZEA 3ULEB 4E19A 1WNSA 3H08A 1X9WA 3N4QA 3K59A 1LAVA 3LALA 1TVRA 3CD6N 1SS6A 4MLHA 2Z1JA 3JSMA 4N47A 3TAPA 3AV9A 4J2AA 1GLCG 4FWPA 3FZFA 1XC9A 3NGIA 3AVJA 2KLAA 3QO9A 4K42A 5AZIA 2QWOA 1RGIA 2HBLA 4ZTFA 5AQQA 3J7ZO 5E41A 1ATNA 2CGLA 2W40A 1FXXA 5M1NA 2NLXA 1I39A 2O4GA 5HRNA 4YNQA 1YJWN 3DLLL 3DXMA 4DU3A 3P39A 4H03B 4CF9A 3KD1E 1NMNA 4NLBA 4CJVA 5ADXH 4E7JA 4RW6A 4E1MA 1RT4A 4HCBA 5H1SQ 1TK5A 2P5OA 4I6MA 5JS1A 1IKWA 3AVNA 4BWMA 4FZYA 4CI6A 2GV9A 3CPWM 3ATVA 1K9MO 4DLGA 3Q7CA 4BGBA 4BRIA 4IG0A 2JWLA 3IRXA 3BGRA 1S5JA 5TKWA 4CIGA 3M5RA 1QQMA 1VRUA 5FDLA 4CZFA 3IDHA 4JI0K 3ENBA 5B8HA 1K73O
chains in the Genus database with same CATH topology
1XHXA 2YHAA 4FJ9A 4CJQA 3TAGA 3LAMA 3THVA 3AVBA 1HQUA 5HBMA 1RTJA 4ELUA 3RTVA 4KI4A 4FM1A 4QOZB 3VQ4A 3RMDA 1TKDA 4Q0BA 4N5SA 3NFAA 1VSMA 4FW1A 1BQMA 3ZSRA 4O55A 1SKSA 2I5JA 3RMAA 3OJUA 3KK1A 3CFRA 4JS5A 3P83D 1WSJA 1LWFA 3DYAA 4WE1A 5JS2A 3CFPA 2VG6A 2QKBA 1ZBIA 4FJ8A 1Z26A 5KRTA 3TAFA 3MAQA 1NK4A 3OYNA 3PX0A 3VQ8A 3O4QA 3CQ8A 2VWJA 4W5TA 3HVRA 1IKVA 3LWMA 3DRPA 4HCCA 2F96A 3PX6A 4C8NA 4AHUA 4PQUA 2HHUA 1TAQA 3LWLA 3V9UA 1QQCA 1NKCA 3DI6A 4DU1A 1DTTA 2BDPA 4IFYA 2KTQA 3V4IA 1RT3A 4CJUA 3S3MA 2WOMA 1Q9YA 1CLQA 4Z0UA 2FBXA 2IC3A 4JRPA 3IAYA 1C1AA 3L3UA 3M8PA 3T19A 3OYDA 1C6VA 3O3GA 1BI4A 1IH7A 3KTQA 3DLBA 1HYSA 1TK8A 4OGEA 2FC0A 3NDKA 3K57A 3ZSOA 3SNNA 2YNGA 3OYJA 2OPPA 2B5JA 3SPZA 4RW8A 1NKEA 3DLKA 3ISNC 1RCHA 3F9KA 3AA2A 5DMRA 3SPYA 3VQ6A 1KTQA 2RF2A 4OKKA 4W5OA 4J2DA 3ZT1A 3SCXA 4DFMA 4I9LA 5I3UA 1JLCA 3VQPA 3K2PA 2ETJA 2X78A 3ZSXA 3LPTA 4FLZA 3I0RA 5DK5A 3DRRA 3LPUA 3G10A 4B9MA 3RRHA 1NK7A 3QLHA 4Z4IA 4CJEA 4LH5A 1A5WA 1L3TA 5CZ2A 1NJXA 1VSEA 5EU7A 2ITGA 1S9EA 3DLRA 1RNHA 1VSKA 4DQRA 3U6FA 4M3TA 1TKZA 3O3HA 3SV3A 4DSKA 4DTSA 3OYCA 2D0AA 3E01A 2FBVA 1NK5A 3VQBA 1WAFA 3A2FA 4E3SA 3CFOA 3DLEA 4OVLA 3RR8A 4AHVA 3RMCA 1X1PA 2GBZA 5KRSA 3AVKA 4LY7A 4CECA 3AVMA 3V1QA 5CYMA 4K8XA 1KLNA 2O4IA 1QSLA 2JLEA 4B9SA 5KGXA 4Y1CA 3NE6A 2Y1JA 1QHTA 4O5BA 3QIPA 1LWEA 1NK9A 4KB0A 4CEAA 2DFFA 4CHNA 4DTUA 2OZSA 3TR8A 2HHSA 4CEEA 3V1OA 2G8IA 1Q9XA 5C42A 1S1WA 3OJSA 3RRGA 1KVBA 4B9NA 3V9XA 3RMBA 4CJPA 4OPKA 1JKHA 3AO5A 4DSJA 4M3YA 4CFBA 2KFZA 1IKXA 2XRIA 3AVLA 3VQ9A 1N5YA 4H4OA 2ATQA 1KFDA 1JL1A 3LDSA 3QEVA 3PO4A 2R7YA 4BDPA 4CK2A 2KFNA 4DFPA 3HL8A 1RTIA 1EKEA 1NOZA 1ITGA 1RTHA 4HHTA 3NH1A 2X6SA 4OPJA 1T03A 4E7KA 1NOYA 1C0TA 4B9LA 1A5XA 2G8HA 4FLTA 2AJQA 3QNNA 4FK4A 2EHGA 4KI6A 1RDBA 4Z4FA 3K5MA 4FM2A 1YTAA 1L5UA 4F2RA 4M3ZA 1KVCA 1B9FA 2XY8A 3T1AA 2FBYA 4CGJA 3HXMA 1X9SA 4BDYA 4GW6A 3OVNA 3VQDA 4PWDA 3QIOA 1ZBUA 5CZ1A 2HMIA 3OYGA 4KTZA 3KKSA 1LW2A 1Z25A 1KCFA 2DY4A 1TL1A 1EXQA 2BE2A 3LP3A 3KLEA 2WONA 3NF9A 1FKPA 3VQEA 4E1NA 4C8MA 2XHBA 3ULDA 4DSFA 1ASWA 1RDCA 3NGYA 2HVHA 4NYFA 3QEPA 3B6PA 2XY6A 2EX3A 3V6DA 3HVTA 2QXFA 2FBTA 5J2NA 3VQAA 3TABA 4M42A 4DSEA 1BL3A 3SUOA 4FJ7A 4KHYA 4XIUA 2RKIA 1RT1A 5J2MA 3M8SA 1JL2A 3UIQA 1UWBA 3WNFA 4O0JA 3HPOA 4CJTA 3K58A 1TAUA 3HO1A 3MXIA 1NK8A 4OKJA 4JRQA 4CF0A 4EZ6A 3AVGA 4FJKA 1IKYA 3KIOA 2B6AA 5CYQA 4CHOA 3TANA 4KKOA 2F8SA 3NCIA 5HLFA 1RTDA 3DLHA 4Q5VA 2YKNA 1J5OA 4FZXC 2D0BA 1U49A 1LV5A 1GOAA 4IFVA 4KHQA 1HMVA 4KV8A 4LSLA 2HHQA 1Y97A 4CJRA 4AHRA 4HUFA 3U3GA 3MEEA 3HT3A 1SKWA 4KREA 1WAJA 2XO7A 3M8RA 4DQSA 3SYZA 1WN7A 3KLGA 2IGIA 2Z1IA 1JLQA 4N76A 2KW4A 3NF8A 4AILC 5KI6A 2YKMA 2IS3A 4N56A 3AVHA 4CIFA 3VA3A 1G15A 4B8CA 1WSGA 3DOLA 3CM6A 3NF7A 4EP5A 3L2VA 4FJLA 2HHVA 2OPQA 1ASUA 3K5OA 4EZ9A 2F8TA 4MQ3A 1ZYQA 2D0CA 3LAKA 1U45A 3QINA 1TL3A 4M3XA 3NBPA 4FCYA 3FFIA 3V9SA 1K6YA 1KRPA 3SV4A 3ZSQA 1UAXA 3OYEA 3BDPA 1RBTA 1WSEA 4HUEA 3OYAA 1J53A 4FJMA 3AA4A 4CF2A 4OGCA 1RBRA 3HSTB 4RG8A 4DQQA 3HJFA 4W5RA 3PO5A 4Z4EA 2JGUA 3QEXA 1L3UA 1SKRA 4FLUA 4CJSA 3LZJA 4CEFA 1A5VA 2ZD1A 3O4NA 4M45A 4KTQA 4BE1A 4CIEA 2QKKA 1J9AA 1MU2A 4FLVA 4F3OA 1VSLA 3OS1A 3MEDA 3KKRA 4B8AB 4JS4A 1BISA 4O44A 3ZSVA 3SZ2A 3AVIA 2PYJA 3PX4A 4Z4GA 1R0AA 4FJXA 4O4GA 2QK9A 4E7LA 2Q3SA 4BE0A 1WLJA 2VG7A 4PA1A 4ZTJA 3HM9A 2Z1GA 4KRFA 3L2QA 4FLXA 4CHYA 4CGGA 4DG1A 2Y1IA 4F4KA 4NYNA 3QERA 4J2EA 2KZZA 4W5NA 3PV8A 4I9QA 3CYMA 3ZSYA 4CGIA 3V81A 2E6MA 3AA5X 1N6QA 3ZSWA 1LAWA 4CK3A 1VSDA 2D5RA 3HYFA 4CJ5A 4Z4CA 2G8KA 4OKEA 4TSXA 4C8KA 2PY5A 1KVAA 3HPHA 2OZMA 4KHNA 3P1GA 4CEOA 1RILA 2HVIA 4FLWA 1RDDA 1XHZA 4OLAA 3SQ1A 5J2QA 3ZSZA 3L2RA 1UA0A 2YNIA 4CEBA 3L2WA 3EYZA 4FJHA 3KLIA 3VA0A 1UOCA 1C0UA 3ZCMA 3IS9A 2YNHA 4CJKA 2A1RA 3WNHA 1T8EA 1UA1A 3OS2A 3O3FA 1VK0A 1VSHA 4DU4A 3OYFA 3K5NA 1JXBA 5SWMA 1BGXT 4FYDA 4IDKA 3KJVA 2E6LA 4DS5A 4DTRA 1KSPA 1D8YA 1C1BA 3SQ2A 4FVMA 4CERA 4CCHA 2HHWA 4ID5A 4CK1A 1WSIA 2XY5A 1T7PA 4H8KA 3I8DA 1S1UA 3M8QA 4CFAA 4DTXA 3V1RA 2OA8A 2HHXA 4CEDA 4E89A 4I2QA 1RT7A 4AH9A 4CHQA 1O1WA 3ZT4A 5HRPA 1ASVA 4CJWA 3K5LA 4FW2A 1C0MA 3MXJA 4I7FA 4HTUA 4RW4A 2DTUA 2IAJA 5CY4A 4BACA 4CHZA 3AO3A 4KFBA 3OYBA 2OPSA 1CZBA 3VQQA 4O0IA 3QESA 2A1SA 4GMJB 4JLHA 4CJ4A 3L8BA 3HP6A 2ZE2A 2X74A 1B92A 3SQ0A 2HW3A 3ZT0A 1RBVA 2IOCA 1RBSA 2W42A 3NHGA 1D5AA 4IG3A 1KLMA 3C95A 3LZIA 1SL1A 2OPRA 2RN2A 1HJRA 3C94A 4DTNA 4DF4A 3AVCA 2PZSA 4GVMA 3VQ5A 1VSFA 3QETA 4DTJA 4KHUA 3TAMA 3KK3A 4M3WA 3LANA 4F8RA 5C25A 4FK2A 4FXDA 3PY8A 1VSJA 1IO2A 1QSYA 2ZQBA 4LH4A 1W0HA 1ZBHA 4ZHRA 1RT5A 3KLHA 1S1TA 3QNOA 1D9DA 1JLFA 4KB1A 4M3UA 1HNVA 2HNYA 2HNZA 2LSNA 2YV0X 1FKOA 4ID1A 3PUFA 2NUBA 3MXMA 4DMNA 4CJ3A 5HRRA 5HP1A 1NK0A 3VQCA 2G8WA 3AO2A 3AVAA 2P5GA 3LP0A 3U3YA 4CJFA 2GUIA 4I2PA 4CF8A 1BHLA 1TGOA 4QAGA 3VQ7A 4PUOA 3P5JA 4KHWA 1SUQA 5KGWA 4EP4A 3CG7A 1JLAA 1QS4A 4R5PA 4FLYA 4M41A 1XI1A 2HHTA 3JYTA 3V9ZA 4LD0A 4FJNA 4W5QA 4DTMA 2KZMA 3KLFA 4HUGA 1BQNA 2P51A 5J2PA 1SL2A 4DS4A 4Y1DA 3TAQA 4DSIA 5FRNA 3ZT2A 1F21A 1IG9A 1JLBA 1CXQA 1HNIA 3OYMA 4L8RB 2DFHA 3MEGA 2YNFA 2IDOA 4KO0A 1U4BA 2BANA 1D9FA 4H4MA 3EZ5A 4UQGA 4CGFA 1RT2A 1L3VA 1S6PA 1T05A 1HYVA 2BGGA 2PYLA 4FJIA 1RT6A 3TAEA 4CF1A 1NK6A 3DM2A 1JLGA 3B6OA 1RDAA 3D45A 1DTQA 4Z4HA 1BI4B 1WSFA 5J1EA 5K14A 1SV5A 4N41A 1S1XA 2YHBA 3HP9A 4ELTA 1NJZA 4B3OA 4QCLA 2B4JA 1LWCA 3ZT3A 4CFCA 4CHPA 3TWHA 1U48A 3AO1A 4FJJA 4YFUA 4RW7A 3V9WA 4F3TA 1Q8IA 3AVFA 4MFBA 2G8UA 4HVJA 5T7BA 1REVA 4DFJA 4G1QA 1X9MA 3QEIA 3RR7A 1NJWA 3SI6A 1ZBFA 4DSLA 3AA3A 4ELVA 4DLEA 3ALYA 3I0SA 3KK2A 3D0PA 1S9GA 2KQ2A 3G0ZA 3OY9A 3L2UA 3C6UA 4DQPA 1B9DA 1C1CA 4CFDA 1EX4A 4BE2A 3T3FA 3NH0A 5HROA 4M3RA 4OJRA 1SL0A 1L3SA 4KPYA 4CESA 3S3NA 4FK0A 1HRHA 3KD5E 4FZZA 1TV6A 1HPZA 2X6NA 3L3VA 2DFEA 4FJ5A 1JLEA 4C8LA 4FJGA 3DLGA 1J54A 1GOBA 1LW0A 1XWLA 4E19A 1WNSA 2G8FA 3H08A 3VN5A 4CJLA 4B08A 1X9WA 3WNGA 1KFSA 1YTUA 3K59A 1LAVA 3LALA 4DTPA 1JXEA 1NJYA 1TVRA 3OYKA 3ASMA 1BCOA 3MECA 4NCGA 1I3AA 3S9HA 4DQIA 3DMJA 1RBUA 5D3GA 2Z1JA 3JSMA 4CEQA 4N47A 3SUPA 2HNDA 3TAPA 3AO4A 1VRTA 3LP1A 3AV9A 4J2AA 5C24A 1XC9A 1VSIA 3C6TA 3QEWA 4IBNA 4BWJA 3NGIA 1EETA 3AVJA 3QO9A 4IKFA 4NCAA 1U47A 4NCBA 3HK2A 3EY1A 4LSNA 3NF6A 2G8VA 4ZTFA 4CGHA 4DFKA 3LP2A 2HB5A 2VG5A 4AHCA 4DF8A 1EP4A 3TARA 3SJJA 5E41A 4PY5A 1YT3A 4CE9A 3OYIA 4K8ZA 3TI0A 3NH2A 1FXXA 1TKXA 2VWKA 3SUNA 1QTMA 1GOCA 4DWIA 1I39A 2O4GA 5HRNA 4YNQA 5KTQA 1BIZA 4DU3A 4CGDA 3NGZA 4DTOA 5FRMA 1BCMA 4CF9A 1DLOA 3DRSA 4B9UA 1S6QA 1HQEA 1S1VA 5I42A 3KD1E 4F2SA 4ICLA 4CJVA 4CEZA 4E7JA 4RW6A 4E1MA 1QSSA 4KHSA 1RT4A 1HYZA 3NAEA 4HCBA 3OS0A 4BDZA 1TK5A 2P5OA 3CM5A 3F73A 3ITHA 1U04A 5HRSA 3HPGA 3OYHA 3OYLA 5JS1A 4RW9A 4E7IA 5FROA 1IKWA 3AVNA 3SQ4A 4BWMA 2OYQA 4FZYA 4B9VA 2Z1HA 4B9TA 3RWUA 1QE1A 4FM0A 2GV9A 4DLGA 1CXUA 1FK9A 4AHSA 5SZTA 4E0DA 3SUQA 1BIUA 3IG1A 3S3OA 4OLBA 1WSHA 1W9HA 4J2BA 1CZ9A 4IG0A 4KAZA 3DOKA 1TK0A 3IRXA 2E4LA 1TKTA 1YVUA 3WNEA 3BGRA 2RPIA 4KTWA 1S5JA 4AHTA 4CIGA 4E7HA 1VRUA 1ZBLA 1NKBA 5FDLA 4C8OA 2XY7A 2P1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XHX A;  2YHA A;  4FJ9 A;  4CJQ A;  3TAG A;  3LAM A;  3THV A;  3AVB A;  1HQU A;  5HBM A;  1RTJ A;  4ELU A;  3RTV A;  4KI4 A;  4FM1 A;  4QOZ B;  3VQ4 A;  3RMD A;  1TKD A;  4Q0B A;  4N5S A;  3NFA A;  1VSM A;  4FW1 A;  1BQM A;  3ZSR A;  4O55 A;  1SKS A;  2I5J A;  3RMA A;  3OJU A;  3KK1 A;  3CFR A;  4JS5 A;  3P83 D;  1WSJ A;  1LWF A;  3DYA A;  4WE1 A;  5JS2 A;  3CFP A;  2VG6 A;  2QKB A;  1ZBI A;  4FJ8 A;  1Z26 A;  5KRT A;  3TAF A;  3MAQ A;  1NK4 A;  3OYN A;  3PX0 A;  3VQ8 A;  3O4Q A;  3CQ8 A;  2VWJ A;  4W5T A;  3HVR A;  1IKV A;  3LWM A;  3DRP A;  4HCC A;  2F96 A;  3PX6 A;  4C8N A;  4AHU A;  4PQU A;  2HHU A;  1TAQ A;  3LWL A;  3V9U A;  1QQC A;  1NKC A;  3DI6 A;  4DU1 A;  1DTT A;  2BDP A;  4IFY A;  2KTQ A;  3V4I A;  1RT3 A;  4CJU A;  3S3M A;  2WOM A;  1Q9Y A;  1CLQ A;  4Z0U A;  2FBX A;  2IC3 A;  4JRP A;  3IAY A;  1C1A A;  3L3U A;  3M8P A;  3T19 A;  3OYD A;  1C6V A;  3O3G A;  1BI4 A;  1IH7 A;  3KTQ A;  3DLB A;  1HYS A;  1TK8 A;  4OGE A;  2FC0 A;  3NDK A;  3K57 A;  3ZSO A;  3SNN A;  2YNG A;  3OYJ A;  2OPP A;  2B5J A;  3SPZ A;  4RW8 A;  1NKE A;  3DLK A;  3ISN C;  1RCH A;  3F9K A;  3AA2 A;  5DMR A;  3SPY A;  3VQ6 A;  1KTQ A;  2RF2 A;  4OKK A;  4W5O A;  4J2D A;  3ZT1 A;  3SCX A;  4DFM A;  4I9L A;  5I3U A;  1JLC A;  3VQP A;  3K2P A;  2ETJ A;  2X78 A;  3ZSX A;  3LPT A;  4FLZ A;  3I0R A;  5DK5 A;  3DRR A;  3LPU A;  3G10 A;  4B9M A;  3RRH A;  1NK7 A;  3QLH A;  4Z4I A;  4CJE A;  4LH5 A;  1A5W A;  1L3T A;  5CZ2 A;  1NJX A;  1VSE A;  5EU7 A;  2ITG A;  1S9E A;  3DLR A;  1RNH A;  1VSK A;  4DQR A;  3U6F A;  4M3T A;  1TKZ A;  3O3H A;  3SV3 A;  4DSK A;  4DTS A;  3OYC A;  2D0A A;  3E01 A;  2FBV A;  1NK5 A;  3VQB A;  1WAF A;  3A2F A;  4E3S A;  3CFO A;  3DLE A;  4OVL A;  3RR8 A;  4AHV A;  3RMC A;  1X1P A;  2GBZ A;  5KRS A;  3AVK A;  4LY7 A;  4CEC A;  3AVM A;  3V1Q A;  5CYM A;  4K8X A;  1KLN A;  2O4I A;  1QSL A;  2JLE A;  4B9S A;  5KGX A;  4Y1C A;  3NE6 A;  2Y1J A;  1QHT A;  4O5B A;  3QIP A;  1LWE A;  1NK9 A;  4KB0 A;  4CEA A;  2DFF A;  4CHN A;  4DTU A;  2OZS A;  3TR8 A;  2HHS A;  4CEE A;  3V1O A;  2G8I A;  1Q9X A;  5C42 A;  1S1W A;  3OJS A;  3RRG A;  1KVB A;  4B9N A;  3V9X A;  3RMB A;  4CJP A;  4OPK A;  1JKH A;  3AO5 A;  4DSJ A;  4M3Y A;  4CFB A;  2KFZ A;  1IKX A;  2XRI A;  3AVL A;  3VQ9 A;  1N5Y A;  4H4O A;  2ATQ A;  1KFD A;  1JL1 A;  3LDS A;  3QEV A;  3PO4 A;  2R7Y A;  4BDP A;  4CK2 A;  2KFN A;  4DFP A;  3HL8 A;  1RTI A;  1EKE A;  1NOZ A;  1ITG A;  1RTH A;  4HHT A;  3NH1 A;  2X6S A;  4OPJ A;  1T03 A;  4E7K A;  1NOY A;  1C0T A;  4B9L A;  1A5X A;  2G8H A;  4FLT A;  2AJQ A;  3QNN A;  4FK4 A;  2EHG A;  4KI6 A;  1RDB A;  4Z4F A;  3K5M A;  4FM2 A;  1YTA A;  1L5U A;  4F2R A;  4M3Z A;  1KVC A;  1B9F A;  2XY8 A;  3T1A A;  2FBY A;  4CGJ A;  3HXM A;  1X9S A;  4BDY A;  4GW6 A;  3OVN A;  3VQD A;  4PWD A;  3QIO A;  1ZBU A;  5CZ1 A;  2HMI A;  3OYG A;  4KTZ A;  3KKS A;  1LW2 A;  1Z25 A;  1KCF A;  2DY4 A;  1TL1 A;  1EXQ A;  2BE2 A;  3LP3 A;  3KLE A;  2WON A;  3NF9 A;  1FKP A;  3VQE A;  4E1N A;  4C8M A;  2XHB A;  3ULD A;  4DSF A;  1ASW A;  1RDC A;  3NGY A;  2HVH A;  4NYF A;  3QEP A;  3B6P A;  2XY6 A;  2EX3 A;  3V6D A;  3HVT A;  2QXF A;  2FBT A;  5J2N A;  3VQA A;  3TAB A;  4M42 A;  4DSE A;  1BL3 A;  3SUO A;  4FJ7 A;  4KHY A;  4XIU A;  2RKI A;  1RT1 A;  5J2M A;  3M8S A;  1JL2 A;  3UIQ A;  1UWB A;  3WNF A;  4O0J A;  3HPO A;  4CJT A;  3K58 A;  1TAU A;  3HO1 A;  3MXI A;  1NK8 A;  4OKJ A;  4JRQ A;  4CF0 A;  4EZ6 A;  3AVG A;  4FJK A;  1IKY A;  3KIO A;  2B6A A;  5CYQ A;  4CHO A;  3TAN A;  4KKO A;  2F8S A;  3NCI A;  5HLF A;  1RTD A;  3DLH A;  4Q5V A;  2YKN A;  1J5O A;  4FZX C;  2D0B A;  1U49 A;  1LV5 A;  1GOA A;  4IFV A;  4KHQ A;  1HMV A;  4KV8 A;  4LSL A;  2HHQ A;  1Y97 A;  4CJR A;  4AHR A;  4HUF A;  3U3G A;  3MEE A;  3HT3 A;  1SKW A;  4KRE A;  1WAJ A;  2XO7 A;  3M8R A;  4DQS A;  3SYZ A;  1WN7 A;  3KLG A;  2IGI A;  2Z1I A;  1JLQ A;  4N76 A;  2KW4 A;  3NF8 A;  4AIL C;  5KI6 A;  2YKM A;  2IS3 A;  4N56 A;  3AVH A;  4CIF A;  3VA3 A;  1G15 A;  4B8C A;  1WSG A;  3DOL A;  3CM6 A;  3NF7 A;  4EP5 A;  3L2V A;  4FJL A;  2HHV A;  2OPQ A;  1ASU A;  3K5O A;  4EZ9 A;  2F8T A;  4MQ3 A;  1ZYQ A;  2D0C A;  3LAK A;  1U45 A;  3QIN A;  1TL3 A;  4M3X A;  3NBP A;  4FCY A;  3FFI A;  3V9S A;  1K6Y A;  1KRP A;  3SV4 A;  3ZSQ A;  1UAX A;  3OYE A;  3BDP A;  1RBT A;  1WSE A;  4HUE A;  3OYA A;  1J53 A;  4FJM A;  3AA4 A;  4CF2 A;  4OGC A;  1RBR A;  3HST B;  4RG8 A;  4DQQ A;  3HJF A;  4W5R A;  3PO5 A;  4Z4E A;  2JGU A;  3QEX A;  1L3U A;  1SKR A;  4FLU A;  4CJS A;  3LZJ A;  4CEF A;  1A5V A;  2ZD1 A;  3O4N A;  4M45 A;  4KTQ A;  4BE1 A;  4CIE A;  2QKK A;  1J9A A;  1MU2 A;  4FLV A;  4F3O A;  1VSL A;  3OS1 A;  3MED A;  3KKR A;  4B8A B;  4JS4 A;  1BIS A;  4O44 A;  3ZSV A;  3SZ2 A;  3AVI A;  2PYJ A;  3PX4 A;  4Z4G A;  1R0A A;  4FJX A;  4O4G A;  2QK9 A;  4E7L A;  2Q3S A;  4BE0 A;  1WLJ A;  2VG7 A;  4PA1 A;  4ZTJ A;  3HM9 A;  2Z1G A;  4KRF A;  3L2Q A;  4FLX A;  4CHY A;  4CGG A;  4DG1 A;  2Y1I A;  4F4K A;  4NYN A;  3QER A;  4J2E A;  2KZZ A;  4W5N A;  3PV8 A;  4I9Q A;  3CYM A;  3ZSY A;  4CGI A;  3V81 A;  2E6M A;  3AA5 X;  1N6Q A;  3ZSW A;  1LAW A;  4CK3 A;  1VSD A;  2D5R A;  3HYF A;  4CJ5 A;  4Z4C A;  2G8K A;  4OKE A;  4TSX A;  4C8K A;  2PY5 A;  1KVA A;  3HPH A;  2OZM A;  4KHN A;  3P1G A;  4CEO A;  1RIL A;  2HVI A;  4FLW A;  1RDD A;  1XHZ A;  4OLA A;  3SQ1 A;  5J2Q A;  3ZSZ A;  3L2R A;  1UA0 A;  2YNI A;  4CEB A;  3L2W A;  3EYZ A;  4FJH A;  3KLI A;  3VA0 A;  1UOC A;  1C0U A;  3ZCM A;  3IS9 A;  2YNH A;  4CJK A;  2A1R A;  3WNH A;  1T8E A;  1UA1 A;  3OS2 A;  3O3F A;  1VK0 A;  1VSH A;  4DU4 A;  3OYF A;  3K5N A;  1JXB A;  5SWM A;  1BGX T;  4FYD A;  4IDK A;  3KJV A;  2E6L A;  4DS5 A;  4DTR A;  1KSP A;  1D8Y A;  1C1B A;  3SQ2 A;  4FVM A;  4CER A;  4CCH A;  2HHW A;  4ID5 A;  4CK1 A;  1WSI A;  2XY5 A;  1T7P A;  4H8K A;  3I8D A;  1S1U A;  3M8Q A;  4CFA A;  4DTX A;  3V1R A;  2OA8 A;  2HHX A;  4CED A;  4E89 A;  4I2Q A;  1RT7 A;  4AH9 A;  4CHQ A;  1O1W A;  3ZT4 A;  5HRP A;  1ASV A;  4CJW A;  3K5L A;  4FW2 A;  1C0M A;  3MXJ A;  4I7F A;  4HTU A;  4RW4 A;  2DTU A;  2IAJ A;  5CY4 A;  4BAC A;  4CHZ A;  3AO3 A;  4KFB A;  3OYB A;  2OPS A;  1CZB A;  3VQQ A;  4O0I A;  3QES A;  2A1S A;  4GMJ B;  4JLH A;  4CJ4 A;  3L8B A;  3HP6 A;  2ZE2 A;  2X74 A;  1B92 A;  3SQ0 A;  2HW3 A;  3ZT0 A;  1RBV A;  2IOC A;  1RBS A;  2W42 A;  3NHG A;  1D5A A;  4IG3 A;  1KLM A;  3C95 A;  3LZI A;  1SL1 A;  2OPR A;  2RN2 A;  1HJR A;  3C94 A;  4DTN A;  4DF4 A;  3AVC A;  2PZS A;  4GVM A;  3VQ5 A;  1VSF A;  3QET A;  4DTJ A;  4KHU A;  3TAM A;  3KK3 A;  4M3W A;  3LAN A;  4F8R A;  5C25 A;  4FK2 A;  4FXD A;  3PY8 A;  1VSJ A;  1IO2 A;  1QSY A;  2ZQB A;  4LH4 A;  1W0H A;  1ZBH A;  4ZHR A;  1RT5 A;  3KLH A;  1S1T A;  3QNO A;  1D9D A;  1JLF A;  4KB1 A;  4M3U A;  1HNV A;  2HNY A;  2HNZ A;  2LSN A;  2YV0 X;  1FKO A;  4ID1 A;  3PUF A;  2NUB A;  3MXM A;  4DMN A;  4CJ3 A;  5HRR A;  5HP1 A;  1NK0 A;  3VQC A;  2G8W A;  3AO2 A;  3AVA A;  2P5G A;  3LP0 A;  3U3Y A;  4CJF A;  2GUI A;  4I2P A;  4CF8 A;  1BHL A;  1TGO A;  4QAG A;  3VQ7 A;  4PUO A;  3P5J A;  4KHW A;  1SUQ A;  5KGW A;  4EP4 A;  3CG7 A;  1JLA A;  1QS4 A;  4R5P A;  4FLY A;  4M41 A;  1XI1 A;  2HHT A;  3JYT A;  3V9Z A;  4LD0 A;  4FJN A;  4W5Q A;  4DTM A;  2KZM A;  3KLF A;  4HUG A;  1BQN A;  2P51 A;  5J2P A;  1SL2 A;  4DS4 A;  4Y1D A;  3TAQ A;  4DSI A;  5FRN A;  3ZT2 A;  1F21 A;  1IG9 A;  1JLB A;  1CXQ A;  1HNI A;  3OYM A;  4L8R B;  2DFH A;  3MEG A;  2YNF A;  2IDO A;  4KO0 A;  1U4B A;  2BAN A;  1D9F A;  4H4M A;  3EZ5 A;  4UQG A;  4CGF A;  1RT2 A;  1L3V A;  1S6P A;  1T05 A;  1HYV A;  2BGG A;  2PYL A;  4FJI A;  1RT6 A;  3TAE A;  4CF1 A;  1NK6 A;  3DM2 A;  1JLG A;  3B6O A;  1RDA A;  3D45 A;  1DTQ A;  4Z4H A;  1BI4 B;  1WSF A;  5J1E A;  5K14 A;  1SV5 A;  4N41 A;  1S1X A;  2YHB A;  3HP9 A;  4ELT A;  1NJZ A;  4B3O A;  4QCL A;  2B4J A;  1LWC A;  3ZT3 A;  4CFC A;  4CHP A;  3TWH A;  1U48 A;  3AO1 A;  4FJJ A;  4YFU A;  4RW7 A;  3V9W A;  4F3T A;  1Q8I A;  3AVF A;  4MFB A;  2G8U A;  4HVJ A;  5T7B A;  1REV A;  4DFJ A;  4G1Q A;  1X9M A;  3QEI A;  3RR7 A;  1NJW A;  3SI6 A;  1ZBF A;  4DSL A;  3AA3 A;  4ELV A;  4DLE A;  3ALY A;  3I0S A;  3KK2 A;  3D0P A;  1S9G A;  2KQ2 A;  3G0Z A;  3OY9 A;  3L2U A;  3C6U A;  4DQP A;  1B9D A;  1C1C A;  4CFD A;  1EX4 A;  4BE2 A;  3T3F A;  3NH0 A;  5HRO A;  4M3R A;  4OJR A;  1SL0 A;  1L3S A;  4KPY A;  4CES A;  3S3N A;  4FK0 A;  1HRH A;  3KD5 E;  4FZZ A;  1TV6 A;  1HPZ A;  2X6N A;  3L3V A;  2DFE A;  4FJ5 A;  1JLE A;  4C8L A;  4FJG A;  3DLG A;  1J54 A;  1GOB A;  1LW0 A;  1XWL A;  4E19 A;  1WNS A;  2G8F A;  3H08 A;  3VN5 A;  4CJL A;  4B08 A;  1X9W A;  3WNG A;  1KFS A;  1YTU A;  3K59 A;  1LAV A;  3LAL A;  4DTP A;  1JXE A;  1NJY A;  1TVR A;  3OYK A;  3ASM A;  1BCO A;  3MEC A;  4NCG A;  1I3A A;  3S9H A;  4DQI A;  3DMJ A;  1RBU A;  5D3G A;  2Z1J A;  3JSM A;  4CEQ A;  4N47 A;  3SUP A;  2HND A;  3TAP A;  3AO4 A;  1VRT A;  3LP1 A;  3AV9 A;  4J2A A;  5C24 A;  1XC9 A;  1VSI A;  3C6T A;  3QEW A;  4IBN A;  4BWJ A;  3NGI A;  1EET A;  3AVJ A;  3QO9 A;  4IKF A;  4NCA A;  1U47 A;  4NCB A;  3HK2 A;  3EY1 A;  4LSN A;  3NF6 A;  2G8V A;  4ZTF A;  4CGH A;  4DFK A;  3LP2 A;  2HB5 A;  2VG5 A;  4AHC A;  4DF8 A;  1EP4 A;  3TAR A;  3SJJ A;  5E41 A;  4PY5 A;  1YT3 A;  4CE9 A;  3OYI A;  4K8Z A;  3TI0 A;  3NH2 A;  1FXX A;  1TKX A;  2VWK A;  3SUN A;  1QTM A;  1GOC A;  4DWI A;  1I39 A;  2O4G A;  5HRN A;  4YNQ A;  5KTQ A;  1BIZ A;  4DU3 A;  4CGD A;  3NGZ A;  4DTO A;  5FRM A;  1BCM A;  4CF9 A;  1DLO A;  3DRS A;  4B9U A;  1S6Q A;  1HQE A;  1S1V A;  5I42 A;  3KD1 E;  4F2S A;  4ICL A;  4CJV A;  4CEZ A;  4E7J A;  4RW6 A;  4E1M A;  1QSS A;  4KHS A;  1RT4 A;  1HYZ A;  3NAE A;  4HCB A;  3OS0 A;  4BDZ A;  1TK5 A;  2P5O A;  3CM5 A;  3F73 A;  3ITH A;  1U04 A;  5HRS A;  3HPG A;  3OYH A;  3OYL A;  5JS1 A;  4RW9 A;  4E7I A;  5FRO A;  1IKW A;  3AVN A;  3SQ4 A;  4BWM A;  2OYQ A;  4FZY A;  4B9V A;  2Z1H A;  4B9T A;  3RWU A;  1QE1 A;  4FM0 A;  2GV9 A;  4DLG A;  1CXU A;  1FK9 A;  4AHS A;  5SZT A;  4E0D A;  3SUQ A;  1BIU A;  3IG1 A;  3S3O A;  4OLB A;  1WSH A;  1W9H A;  4J2B A;  1CZ9 A;  4IG0 A;  4KAZ A;  3DOK A;  1TK0 A;  3IRX A;  2E4L A;  1TKT A;  1YVU A;  3WNE A;  3BGR A;  2RPI A;  4KTW A;  1S5J A;  4AHT A;  4CIG A;  4E7H A;  1VRU A;  1ZBL A;  1NKB A;  5FDL A;  4C8O A;  2XY7 A;  2P1J A; 
#chains in the Genus database with same CATH topology
 2NRR A;  2YHA A;  3GOI A;  3THV A;  1NGF A;  5AQJ A;  3VPZ A;  4IJN A;  3G4S N;  4N5S A;  2E88 A;  3NFA A;  4OPH A;  4BRC A;  3KK1 A;  2VG6 A;  1ZBI A;  2D4W A;  5KRT A;  3TAF A;  1NK4 A;  3CCJ N;  3O4Q A;  3HVR A;  3H46 O;  3DRP A;  3SAG A;  4GVE A;  1NWK A;  3DI6 A;  2BDP A;  1C0G A;  1RT3 A;  4JHD B;  3T19 A;  3BF3 A;  3C6H A;  4R79 A;  2OCE A;  2YNG A;  2ZF5 O;  1KD1 O;  2B5J A;  4RW8 A;  1NKE A;  2A41 A;  3ISN C;  3F9K A;  3VQ6 A;  4W5O A;  1NGB A;  2Q31 A;  3SCX A;  4I9L A;  5I3U A;  3K2P A;  2X78 A;  4FPB A;  3I0R A;  4PKG A;  3QLH A;  4Z4I A;  4CJE A;  1VSE A;  4KBO A;  3O3H A;  4DSK A;  2E8A A;  1WBD A;  3HI0 A;  5AQY A;  1T6D A;  3VQB A;  1MA9 B;  3CET A;  4OVL A;  3AGK A;  3RMC A;  1X1P A;  5KRS A;  3AVK A;  5EOY A;  1LCU A;  2PBD A;  4CEC A;  3AY9 A;  1KLN A;  2O4I A;  4LC9 B;  2Y1J A;  3QIP A;  1NK9 A;  3O8M A;  4BRN A;  1BU6 O;  3TR8 A;  2G8I A;  3MWP A;  5AZI B;  4DUZ K;  4DSJ A;  2XRI A;  3AVL A;  1KFD A;  3LDS A;  1J6Z A;  3PO4 A;  4BY9 C;  1FW6 A;  1NOZ A;  1ITG A;  3FLC O;  4HHT A;  1BG3 A;  3NH1 A;  1T03 A;  4E7K A;  3TU5 A;  1C0T A;  5M1K A;  4HWI A;  4FK4 A;  3I8B A;  4Z4F A;  1YTA A;  1KVC A;  4BDY A;  3QDK A;  2E2N A;  3QIO A;  3OYG A;  3KKS A;  1LW2 A;  3M1F A;  4GNI A;  2DY4 A;  1TL1 A;  2BE2 A;  4GKJ K;  1FKP A;  4DSF A;  4C8M A;  4DR5 K;  5AQH A;  1EO1 A;  2QXF A;  4RTF D;  3SUO A;  1VQO N;  4KHY A;  4X66 K;  5AQR A;  4O0J A;  1XNQ K;  3HPO A;  4JD2 A;  4B1U B;  4JRQ A;  4CF0 A;  4FJK A;  4JKH A;  1IKY A;  3TAN A;  1HJO A;  4FWR A;  3HZ6 A;  4CBW A;  3MX2 A;  2YKN A;  4FZX C;  4JK8 A;  4IFV A;  4KHQ A;  1HX1 A;  4LSL A;  1Y97 A;  3MEE A;  3HT3 A;  4FSV A;  1WAJ A;  4BRQ A;  4KRE A;  2FSJ A;  4FWN A;  4BR4 A;  3FZH A;  1YVN A;  3MCP A;  4N76 A;  4BQL A;  5KI6 A;  2IS3 A;  4CIF A;  4FJL A;  4PHT X;  2HHV A;  2OPQ A;  5HOO A;  3K5O A;  3A5M C;  2F8T A;  4MQ3 A;  2D0C A;  3NBP A;  4CVN E;  1VQK N;  5AQF A;  1UAX A;  1RBT A;  1J53 A;  4FJM A;  3AA4 A;  4CF2 A;  5ADX A;  4JHD A;  4RG8 A;  3P4I A;  1SKR A;  4MDB A;  3TPQ A;  3O9S A;  4JKG A;  4BRA A;  4CEF A;  1A5V A;  4M45 A;  2UUB K;  4BE1 A;  3G71 N;  3OS1 A;  3KKR A;  4FJX A;  4O4G A;  3S41 A;  2QK9 A;  5GIO A;  4PA1 A;  1QZ6 A;  3L2Q A;  5M1F A;  4CHY A;  2KZZ A;  4W5N A;  3LDO A;  4IOC L;  1U6Z A;  3ZSY A;  3V81 A;  2P9S B;  2HHH K;  2EWS A;  1KVA A;  1XNR K;  3R8E A;  4O5F A;  4WFB L;  4A61 A;  4CEO A;  1BDG A;  4FLW A;  3NMU A;  1XHZ A;  5F2R A;  3IMX A;  1IG8 A;  1UA0 A;  3SBG A;  4BR7 A;  2HBM A;  3FR0 A;  1VHX A;  3VA0 A;  1YAG A;  2Q1N A;  4PKH A;  1HKB A;  3WNH A;  4DR3 K;  3AAP A;  4CZM A;  2QWQ A;  3VEV A;  5SWM A;  3WUH A;  3SQ2 A;  4DKW A;  4CCH A;  4ID5 A;  1KAZ A;  4IDH A;  4CFA A;  3V1R A;  4I2Q A;  1RT7 A;  4CHQ A;  4V19 S;  1O1W A;  1N8R O;  4H0V B;  4JD2 B;  3ZLJ A;  2FF3 B;  4I7F A;  5CY4 A;  2FXU A;  4DV7 K;  3VQQ A;  4H0X B;  5M1P A;  3OTO K;  2ZE2 A;  1GLF O;  2IOC A;  2CGK A;  4IG3 A;  3C95 A;  5A2Q O;  4U7B A;  3BP8 A;  2OPR A;  2DPN A;  3CJ7 A;  3W0L A;  4DTN A;  4DF4 A;  3AVC A;  2PZS A;  4GVM A;  5EXW A;  3VQ5 A;  4GKK K;  4IWV A;  3WXJ A;  3G6E N;  3C6A A;  3LAN A;  4FK2 A;  4FXD A;  3PY8 A;  5GAE P;  1VSJ A;  1IO2 A;  4B3S K;  4AM7 A;  5GIP A;  3QNO A;  1S1T A;  4M3U A;  1ZC6 A;  1JLF A;  2HNY A;  2YV0 X;  2LSN A;  2KHO A;  1FKO A;  2NUB A;  4CJ3 A;  5HRR A;  5AQU A;  3VQC A;  2O8D B;  2G8W A;  2A40 A;  3FZL A;  4FOE A;  4CF8 A;  3VQ7 A;  3C65 A;  4KHW A;  3J81 O;  1S22 A;  1JLA A;  4FOI A;  3VEY A;  4FJN A;  4JKA A;  2KZM A;  5BRD A;  1T6C A;  3I33 A;  4B9Q A;  1SL2 A;  3E66 A;  3TAQ A;  2HBJ A;  2ASP A;  1VQ5 N;  1HNI A;  3OYM A;  2VYP A;  4ILG B;  4B1W B;  1BA1 A;  4X62 K;  3MEG A;  2O8B A;  4EHT A;  2IDO A;  4KO0 A;  3CME N;  4UQG A;  1L3V A;  1S6P A;  1T05 A;  1WBB A;  4FJI A;  4CF1 A;  1NK6 A;  4GV9 A;  4B3R K;  3VTH A;  1BI4 B;  4B3M K;  1OVY A;  1S1X A;  2YHB A;  4JYA K;  4LF8 K;  3DJC A;  4L3Q A;  5C10 A;  2B4J A;  1DGK N;  1LWC A;  2E20 A;  3ZT3 A;  4CFC A;  4K0K K;  4QCL A;  3WXM B;  4YFU A;  4HTL A;  1Z6R A;  4G1Q A;  2UUC K;  3T1H K;  3SI6 A;  4H5R A;  2I7N A;  2KQ2 A;  4DQP A;  4CZJ A;  3T7Z A;  3UE5 A;  3NH0 A;  5HRO A;  2HMP A;  4DV1 K;  4FK0 A;  2BTF A;  1HRH A;  3KD5 E;  3SMS A;  1TV6 A;  3K9K A;  4MLE A;  3ZX2 A;  4FJ5 A;  4C8L A;  3D2F A;  3DLG A;  3EE9 A;  2GWK A;  4CJL A;  4B08 A;  5KPZ A;  4JK9 A;  4WQ5 C;  2GUP A;  1BCO A;  3MEC A;  4NCG A;  5F1X A;  1I3A A;  2O8C A;  1Q7Y O;  5C2D A;  4CEQ A;  2O8B B;  3LP1 A;  4QS9 A;  4ILH A;  4IXC A;  3QEW A;  1SQK A;  4IBN A;  3EKU A;  3MK6 A;  4IKF A;  1YXQ A;  3E9O A;  4LF9 K;  4Z94 A;  2HB5 A;  1EP4 A;  4PY5 A;  4CE9 A;  2O8F B;  4K8Z A;  3TI0 A;  3NH2 A;  4WFA L;  1TKX A;  2VQE K;  1YHQ N;  3SUN A;  3D2E B;  1GOC A;  2GTD A;  3NGZ A;  3VEN A;  5FRM A;  1BCM A;  2P9S A;  3DRS A;  1S6Q A;  4ICL A;  3EE8 A;  3LM9 A;  1YJN N;  4KHS A;  4DV2 K;  3O9T A;  3CM5 A;  1XUP O;  3HPG A;  3OYH A;  3OYL A;  4E7I A;  3F9M A;  2Z1H A;  1OH7 A;  3LDN A;  4IOA L;  2IVO A;  1MWM A;  4AHS A;  3PSF A;  2QW9 A;  3K0S A;  1WSH A;  2IIR A;  3PIP L;  5FLX O;  3GBT A;  1GLB G;  4DQ8 A;  3WNE A;  1MDU B;  2RPI A;  3AAQ A;  1DT9 A;  3U4L A;  1NKB A;  1GLE G;  3E9P A;  2XY7 A;  2V51 B;  3CJA A;  4FJ9 A;  3AVB A;  3LDL A;  5HBM A;  4CBU A;  4FM1 A;  4M7X A;  3OBY A;  3ID6 A;  3KWI A;  3RMD A;  3NVM A;  4Q0B A;  1TUU A;  2I5J A;  5AQN A;  3RMA A;  4EIA A;  4YOY A;  4JS5 A;  3CFP A;  5JS2 A;  3ZET B;  3H1Q A;  1Z26 A;  2BUP A;  3VQ8 A;  2UYT A;  4W5T A;  1IKV A;  4HCC A;  2F96 A;  2HHU A;  1TAQ A;  3LWL A;  4A57 A;  4WQ5 A;  2NRX A;  4CJU A;  2WOM A;  1CLQ A;  2UXB K;  3L4I A;  1QQO A;  4JRP A;  3L3U A;  4WYB A;  5AQW A;  3OYD A;  1BI4 A;  3KTQ A;  1HYS A;  1TK8 A;  3NDK A;  3CJ1 A;  5GAD P;  2Q2R A;  4X64 K;  3OYJ A;  3O08 A;  2OPP A;  2QEX N;  3DLK A;  5GAG P;  1RCH A;  3GE1 A;  4OKK A;  4J2D A;  4DFM A;  4FLZ A;  5AQP A;  5DK5 A;  3CXC M;  1XMQ K;  1NK7 A;  5JVH L;  4LH5 A;  1TKZ A;  1YJ9 N;  4IEE A;  4DTS A;  4A5B A;  3VGK A;  4E3S A;  3DLE A;  2GEM A;  4AHV A;  3CPE A;  5IT9 O;  4DHY A;  1Q81 O;  2W6K A;  3B8A X;  3MN6 A;  3M3Z A;  2P9K A;  1Z05 A;  5CYM A;  4JI1 K;  4K8X A;  3H1V X;  1XC3 A;  3VF6 A;  4Y1C A;  4PL7 A;  1QHT A;  1LWE A;  3EEQ A;  4YHH K;  2HHS A;  4K43 A;  3VES A;  5C42 A;  3WEE A;  3OJS A;  4A2A A;  4DV0 K;  3RRG A;  1KVB A;  4H0Y B;  1ZXO A;  3CC4 N;  1JKH A;  2KFZ A;  2ATQ A;  3QEV A;  4BDP A;  4CK2 A;  4DV4 K;  5FPD A;  3LDP A;  2KFN A;  3H45 C;  4DFP A;  3HL8 A;  4DV3 K;  1RTI A;  5BPL A;  1RTH A;  2X6S A;  1NOY A;  4B9L A;  2G8H A;  2AJQ A;  3K5M A;  4FM2 A;  4F2R A;  4M3Z A;  4CGJ A;  2FBY A;  4PWD A;  4NO7 A;  4DV6 K;  3QFP A;  2VWB A;  4FWK A;  4BRP A;  3S3N A;  4NB4 A;  1ASW A;  1RDC A;  4EFH A;  2HVH A;  3QEP A;  2XY6 A;  3MWT A;  2EX3 A;  3CQX A;  1C0F A;  2FBT A;  5J2N A;  4M42 A;  4DSE A;  2YHY A;  3O6W A;  4FJ7 A;  1M1K O;  3UIQ A;  3CIP A;  1UWB A;  4CJT A;  3K58 A;  4YOT A;  2PFU A;  3KIO A;  2B6A A;  3FE1 A;  3FGU A;  5CYQ A;  4CHO A;  5HLF A;  1RTD A;  1HR0 K;  3C7N B;  4Q5V A;  1R59 O;  1J5O A;  3HBT A;  1GOA A;  3LL3 A;  2HHQ A;  2F9W A;  3VEX A;  4GV3 A;  4HUF A;  2GEL A;  2ASO A;  1SKW A;  1NM1 A;  2XO7 A;  1U2V B;  5M1O A;  2YHW A;  3KLG A;  2Z1I A;  1BOT O;  3EO3 A;  1JLQ A;  3THX A;  2KW4 A;  4CZI A;  2OTJ N;  5AFU H;  3WT0 A;  1G15 A;  3DOL A;  3CM6 A;  3NF7 A;  4EP5 A;  2OTL N;  1ZYQ A;  3QIN A;  1TL3 A;  5GAH P;  4FCY A;  3FFI A;  1KRP A;  1IJJ A;  3RSE A;  1WSE A;  4OGC A;  5E26 A;  5AQX A;  4W5R A;  4XH4 A;  2ITM A;  3DXK B;  1NJI O;  1L3U A;  4CJS A;  3LZJ A;  2ZD1 A;  4IOX A;  2QKK A;  1J9A A;  4CD1 A;  4F3O A;  4JS4 A;  4B8A B;  1YIJ N;  4O44 A;  3ZX0 A;  2HBK A;  2PYJ A;  3PX4 A;  4Z4G A;  4E7L A;  3L6Q A;  3HM9 A;  2Z1G A;  4KRF A;  3CHW A;  4FLX A;  4G9Z A;  4CGG A;  4DG1 A;  2Y1I A;  3QER A;  4I9Q A;  4KH4 A;  3CYM A;  4CGI A;  5MLC Q;  2E6M A;  1VQ7 N;  1W97 L;  3ZEU B;  1LAW A;  4CK3 A;  2D5R A;  1Q18 A;  2PY5 A;  2OZM A;  3P1G A;  1RDD A;  4RWT A;  1RDW X;  3ZSZ A;  5C12 A;  2YNI A;  4CEB A;  3KLI A;  1DKG D;  2W41 A;  1C0U A;  1ATR A;  4ISE A;  3IS9 A;  4CJK A;  1T8E A;  3CCU N;  4JK7 A;  3K5N A;  1JXB A;  2PAV A;  5KPT A;  4FYD A;  4IDK A;  5BRH A;  1KSP A;  2WBN A;  4K41 A;  4CER A;  4CK1 A;  1WSI A;  1S1U A;  3FZK A;  2A6A A;  2HHX A;  4E89 A;  4AH9 A;  1ASV A;  3TSP A;  5LL6 Z;  3K5L A;  2WTU A;  1YIT N;  3L0Q A;  4AM6 A;  3MXJ A;  2DTU A;  4HTU A;  2YHX A;  4KFB A;  2ZJQ L;  2CH6 A;  3DXM B;  3I56 N;  5JMV A;  3CF5 L;  4JLH A;  4BRO A;  2X74 A;  1B92 A;  3UKR B;  1H1V A;  3AAR A;  2W42 A;  3WXI A;  3LZI A;  3KZB A;  2RN2 A;  3C94 A;  4OPA A;  3MN7 A;  2JWK A;  3H3N O;  1QSY A;  5AZJ B;  2ZQB A;  4ZHR A;  3KLH A;  3J7Y P;  4NXM K;  5BR8 K;  3MXM A;  1GLD G;  3TSQ A;  2P5G A;  3O1B A;  3U3Y A;  2Q0U A;  1YF5 L;  4JKF A;  5AQL A;  4PUO A;  4B1Y B;  3CG7 A;  4R5P A;  2AP1 A;  4LD0 A;  4W5Q A;  1KAY A;  3KLF A;  1T44 A;  2P51 A;  5J2P A;  2O8E B;  2F4V K;  4DSI A;  3F5T A;  3O9U A;  4WCE L;  3O9R A;  2HOE A;  2AA4 A;  1CXQ A;  2E2Q A;  2FLO A;  1ZBS A;  2YNF A;  4H4M A;  3QBX A;  3EZ5 A;  2WUS A;  1EWR A;  4DUY K;  4JEP A;  3VF2 A;  5LJW A;  3TAE A;  3H6E A;  3B6O A;  1J5E K;  1BUP A;  3D45 A;  5KPR A;  1DTQ A;  1GLJ O;  3U8X A;  4JI2 K;  5K14 A;  1SV5 A;  1QVF M;  4ELT A;  4FJJ A;  4CHP A;  3AO1 A;  3V9W A;  3AVF A;  4MFB A;  4EHU A;  1REV A;  1NJW A;  1ZBF A;  4DLE A;  3I0S A;  3SYZ A;  3D0P A;  3G0Z A;  1B9D A;  4CFD A;  1EX4 A;  4M3R A;  4ILJ A;  5KQ8 A;  3NVK A;  4CES A;  2HST A;  1T3V A;  3TTF A;  2X6N A;  2DFE A;  1JLE A;  4FJG A;  1XWL A;  4BG9 A;  2G8F A;  1RFQ A;  3VN5 A;  1KFS A;  3WNG A;  2O8D A;  1JXE A;  1NJY A;  3R9P A;  3S9H A;  3LM2 A;  3HRG A;  3SUP A;  2HND A;  1BO5 O;  3ENO A;  2W6L A;  3O9Q A;  4A2B A;  1VSI A;  4BWJ A;  1EET A;  4NCA A;  1U47 A;  3HK2 A;  1SZ2 A;  3NF6 A;  4BC5 A;  3QFU A;  2E5L K;  4DF8 A;  3LP2 A;  4AHC A;  3OYI A;  3LDQ A;  3FZM A;  1QTM A;  4YOW A;  1NG9 A;  4DR7 K;  4YOR A;  1NGC A;  4O8U A;  4Y0W A;  4BRM A;  1HNX K;  4LF6 K;  1DLO A;  4B9U A;  4LFC K;  4CEZ A;  1TYQ B;  1VQ6 N;  3NAE A;  3KWG A;  4BRD A;  3OS0 A;  4BDZ A;  3F73 A;  5AQI A;  3ITH A;  2VGN A;  5HRS A;  4CBX A;  2NRW A;  2OYQ A;  2IVN A;  4B9V A;  5AQM A;  4LF7 K;  1VQP N;  1QE1 A;  1EWQ A;  1FK9 A;  4E0D A;  3SUQ A;  3IG1 A;  3S3O A;  4OLB A;  1W9H A;  4J2B A;  1CZ9 A;  4KAZ A;  1TK0 A;  2D1K A;  1TKT A;  2E4L A;  4E7H A;  4JAX A;  4C8O A;  2J4R A;  5FPE A;  2P1J A;  1T7P A;  1XHX A;  4FPA A;  1JCF A;  4CJQ A;  5BRF A;  3TAG A;  4JKD A;  3WXK A;  1HQU A;  4JN4 A;  3VQ4 A;  5AJ3 K;  2UXC K;  1VSM A;  2VGM A;  4CZL A;  3P31 A;  5EX5 A;  5ELZ A;  3OJU A;  3P83 D;  1WSJ A;  3DYA A;  1YI2 N;  4BC2 A;  2A42 A;  3BF1 A;  3VGM A;  3PX0 A;  3CQ8 A;  2VWJ A;  3D7E O;  3KVG A;  4C8N A;  4AHU A;  1NGJ A;  3V9U A;  1QQC A;  1NKC A;  1DTT A;  4IFY A;  4B1V A;  2NRT A;  1Q9Y A;  4Z0U A;  3IAY A;  3M8P A;  4FWM A;  1C6V A;  3O3G A;  1IH7 A;  3A5N C;  2FC0 A;  3BZC A;  2V7Z A;  4JI8 K;  3J7A P;  3ZSO A;  1LOT B;  3SPZ A;  3SPY A;  3O5B A;  5AQO A;  5LJV A;  3VQP A;  2ETJ A;  3LPT A;  3DRR A;  3LPU A;  1NLV A;  5AQG A;  4YOV A;  3THW B;  5EU7 A;  1NJX A;  1VSK A;  1RNH A;  1NGH A;  3DLR A;  3E1Y A;  4M3T A;  1SAZ A;  1VQ8 N;  5CHI A;  3SV3 A;  1HUX A;  2UU9 K;  3CC2 N;  3EZW A;  2D0A A;  3E01 A;  3ULE A;  1NK5 A;  3CFO A;  5AR0 A;  3RR8 A;  3GG4 A;  4LY7 A;  3ID8 A;  2JLE A;  4B9S A;  3EKS A;  5KGX A;  3NE6 A;  5DM6 L;  1GLL O;  4KB0 A;  3BEX A;  4KHP K;  2DFF A;  4C23 A;  4CHN A;  2OZS A;  1NGE A;  4CEE A;  3V1O A;  1N34 K;  3CER A;  4XH5 A;  3PIO L;  4B9N A;  4CJP A;  2F9T A;  4OPK A;  3ZET A;  4M3Y A;  4H4O A;  2ZGY A;  2R7Y A;  2E2O A;  1OH6 A;  2VCP A;  3A0I X;  3MX5 A;  4MO5 A;  2P9N B;  4PKI A;  1RDB A;  1L5U A;  3HXM A;  1B9F A;  1X9S A;  2O8F A;  4WQ4 C;  4GW6 A;  3OVN A;  5LY3 A;  2CGJ A;  1ZBU A;  5CZ1 A;  3WQU A;  4IO8 A;  4IJA A;  3P38 A;  1EXQ A;  4FO0 A;  2XHB A;  2QWR A;  3CJC A;  3RVC A;  2VQF K;  3NGY A;  4NYF A;  1BWF O;  3SK3 A;  1P90 A;  3M8S A;  1JL2 A;  5AQZ A;  3WNF A;  1VQM N;  1TAU A;  3HO1 A;  3MXI A;  3CCE N;  4OKJ A;  4EZ6 A;  3AVG A;  1GLA G;  4KKO A;  1N33 K;  2F8S A;  3NCI A;  3SMP A;  3DLH A;  2D0B A;  5KQD A;  1U49 A;  5BN9 A;  1LV5 A;  1NGD A;  4KV8 A;  3U3G A;  3IFR A;  2IGI A;  3BY5 A;  3NF8 A;  1NNE A;  4AIL C;  2YKM A;  4N56 A;  3AVH A;  5AQV A;  1WSG A;  3L2V A;  1ASU A;  2RE2 A;  4JI6 K;  3A8Y A;  1U45 A;  3TTC A;  2P9N A;  3V9S A;  3ZSQ A;  3BDP A;  3OYA A;  4H5T A;  1NGI A;  3HJF A;  1RBR A;  3HST B;  4DQQ A;  4Z4E A;  2FSK A;  2JGU A;  3HSC A;  3SBT A;  4B1Z A;  4FLU A;  5AFU A;  4AQY K;  3O4N A;  4CIE A;  1V4S A;  2ASM A;  4FLV A;  3MED A;  3ZSV A;  4BGA A;  1XQS C;  3SZ2 A;  4H5W A;  2Q3S A;  1WLJ A;  2VG7 A;  4FWQ A;  5HL7 L;  4NYN A;  3UB5 A;  3PV8 A;  3FFK B;  4BRF A;  2Q97 A;  1VSD A;  3HYF A;  4YOU A;  4CJ5 A;  2G8K A;  4OKE A;  4TSX A;  4JI7 K;  3JXU A;  2P9P A;  3HPH A;  1RIL A;  4BR0 A;  4OLA A;  4GY2 B;  3CI5 A;  5J2Q A;  3SQ1 A;  4JI3 K;  3L2R A;  3EYZ A;  4FJH A;  4YDU C;  3H3O B;  2OAN A;  4A59 A;  1UOC A;  3ZCM A;  4FVU A;  2P9U A;  4QS8 A;  2A5X A;  2YNH A;  5CR4 A;  2NRV A;  4DU4 A;  3OYF A;  1E3M A;  1BGX T;  4BR2 A;  3KJV A;  3THX B;  4DTR A;  4CD3 A;  1C1B A;  3I55 N;  2E1Y A;  4BC4 A;  2XY5 A;  4H8K A;  3I8D A;  3M8Q A;  4CED A;  4JKG B;  3ZT4 A;  4CJW A;  4FW2 A;  2UUA K;  4C1N K;  2IAJ A;  4BAC A;  4CHZ A;  2P9L A;  5F0X A;  2A1S A;  4GMJ B;  3O80 A;  3L8B A;  1HPM A;  3ZT0 A;  1RBS A;  3NHG A;  1OH8 A;  1D5A A;  1SL1 A;  2NRH A;  4YY3 K;  1HJR A;  2H3G X;  2HF3 A;  3QET A;  1VSF A;  4DTJ A;  4M3W A;  1MWK A;  2NNW A;  5C25 A;  4NXN K;  4LH4 A;  1W0H A;  5C2F A;  1RT5 A;  1D9D A;  3D2E A;  2HNZ A;  3BZK A;  3PUF A;  1JCE A;  3OBW A;  3AO2 A;  2P9U B;  1KXP A;  5BPN A;  3QBW A;  4CJF A;  2GUI A;  4I2P A;  1TGO A;  4OO1 J;  4QAG A;  3VEO A;  3J8A A;  1WB9 A;  3D6R A;  5KGW A;  1QS4 A;  4FLY A;  1NMD A;  3CMA N;  3MMV A;  4JKE A;  1BQN A;  1NGA A;  3MDQ A;  5FRN A;  3GDQ A;  1IG9 A;  1JLB A;  4L8R B;  2NRZ A;  3E9L A;  2QTD A;  3UKU A;  1RT2 A;  4X65 K;  2QWN A;  1RT6 A;  1RDU A;  3DM2 A;  1JLG A;  2YI1 A;  4N41 A;  3HP9 A;  1N36 K;  3THW A;  4F3T A;  2G8U A;  1S72 N;  4HVJ A;  2YX6 A;  4DFJ A;  1X9M A;  4DSL A;  2QWP A;  3RR7 A;  4DR4 K;  3AA3 A;  2P9I B;  5JIC A;  3OY9 A;  4BE2 A;  1C1C A;  3T3F A;  3OHR A;  3OA9 A;  3KK7 A;  4OJR A;  1VQ4 N;  4KPY A;  4E1J A;  1ATS A;  4FZZ A;  2P9P B;  3BUZ B;  3SAF A;  1E4G T;  3ENH A;  3CJ9 A;  5LMN K;  4MDA A;  1YTU A;  4DV5 K;  3W3D A;  4DR1 K;  4DTP A;  3OYK A;  3ASM A;  4DQI A;  3AGR A;  4UY8 O;  3DMJ A;  1RBU A;  5D3G A;  1OVQ A;  3AO4 A;  1VRT A;  3A5L C;  5C24 A;  3C6T A;  5JLH A;  4NCB A;  1K8A O;  2QWL A;  4LSN A;  3EY1 A;  2GX9 A;  2G8V A;  1NGG A;  2Q0R A;  4CGH A;  4DFK A;  3CCQ N;  2VG5 A;  5BRE A;  3ZYY X;  3TAR A;  3SJJ A;  1VAZ A;  4YOX A;  1YT3 A;  2VWK A;  2O8C B;  3J80 O;  4DR2 K;  3MN9 A;  1HKC A;  4DWI A;  5KTQ A;  1BIZ A;  4JKC A;  4CGD A;  4DTO A;  3QIC A;  5I42 A;  1HQE A;  1S1V A;  4F2S A;  1VQ9 N;  4RCH A;  4XEI A;  1E4F T;  1QSS A;  1HYZ A;  3KHY A;  1U04 A;  5TKY A;  2D0P A;  2E2P A;  4RW9 A;  5FRO A;  3SQ4 A;  3RSE B;  4B9T A;  3RWU A;  1Y64 A;  4FM0 A;  4O8K A;  1CXU A;  3C0B A;  5SZT A;  1BIU A;  3T1Y K;  1EQY A;  3DOK A;  2WFB A;  1YVU A;  4U67 L;  4KTW A;  4AHT A;  1ZBL A;  5EVZ A;  3M6G A;  3ATU A;  2HF4 A;  3O1W A;  5AZJ A;  3LAM A;  1RTJ A;  4ELU A;  3RTV A;  4KI4 A;  4QOZ B;  1TKD A;  1IV0 A;  4FW1 A;  1BQM A;  2BH1 A;  3ZSR A;  4OX9 K;  4O55 A;  1SKS A;  3ZEU A;  5LMU K;  3CFR A;  1LWF A;  4WE1 A;  2QKB A;  3SLC A;  4FJ8 A;  3MAQ A;  3OYN A;  1OH5 A;  3QB0 A;  3TTD A;  1K8K A;  3LWM A;  3PX6 A;  4PQU A;  4DU1 A;  1IBM K;  2KTQ A;  1I94 K;  3V4I A;  3S3M A;  1X3N A;  2FBX A;  4BRK A;  2IC3 A;  5CE3 A;  4DB3 A;  4H0T B;  3VF4 A;  1C1A A;  3D2F B;  3SAH A;  1YUW A;  3DXK A;  3DLB A;  4JI5 K;  3QML A;  4OGE A;  3TSU A;  3VET A;  4BRE A;  3K57 A;  3SNN A;  1OKJ A;  5DMR A;  3AA2 A;  1KTQ A;  1TUY A;  2RF2 A;  3IUC A;  3ZT1 A;  2E1Z A;  1JLC A;  3VGL A;  3ZSX A;  2QI2 A;  4FL9 A;  3G10 A;  2P9K B;  3IKM A;  4ISG A;  4CW7 B;  3RRH A;  4B9M A;  1A5W A;  1L3T A;  5CZ2 A;  3CJB A;  1Q86 O;  1S9E A;  2ITG A;  4DQR A;  3U6F A;  2IVP A;  3HM8 A;  3OYC A;  3UKR A;  2FBV A;  1WAF A;  3A2F A;  3R1X A;  2GBZ A;  5JVG L;  5IWA K;  3AVM A;  3V1Q A;  1QSL A;  3U9Z A;  3K9J A;  2QWM A;  5AQS A;  4O5B A;  2ZWH A;  4CZH A;  4CEA A;  2Q36 A;  4DTU A;  3PSI A;  3T69 A;  1Q9X A;  1S1W A;  1QHA A;  3V9X A;  3RMB A;  3AO5 A;  4CFB A;  1IKX A;  3VQ9 A;  4XH1 A;  1N5Y A;  1QZ5 A;  1JL1 A;  4DCH A;  5BN8 A;  3PLA A;  2FF6 A;  1EKE A;  4JI4 K;  3CQY A;  4OPJ A;  3ZX3 A;  1A5X A;  4FLT A;  3UKU B;  3WEE B;  3QNN A;  2EHG A;  4KI6 A;  3GL1 A;  2XY8 A;  3T1A A;  3VQD A;  2HMI A;  1IBK K;  4KTZ A;  1Z25 A;  1D4X A;  1KCF A;  4JKB A;  3LP3 A;  3KLE A;  2WON A;  3NF9 A;  3VQE A;  4E1N A;  3ULD A;  1CZA N;  5DM7 L;  3B6P A;  3V6D A;  3HVT A;  4BQZ A;  3TAB A;  3VQA A;  1DEJ A;  1BL3 A;  4XIU A;  2WC9 A;  2RKI A;  1RT1 A;  5J2M A;  4I6M B;  1K8K B;  1NBW A;  1NK8 A;  4IO9 L;  2D0O A;  1WOQ A;  4BRG A;  3SJH A;  4WF9 L;  3DAW A;  4JNE A;  1HNW K;  1HMV A;  1ILY A;  4H5N A;  4CJR A;  4AHR A;  3R3L A;  2UXD K;  4BRH A;  1JCG A;  4CZG A;  3M8R A;  4DQS A;  4B1X B;  1WN7 A;  3VMF B;  2V52 B;  2ZGZ A;  4IZ9 A;  3CCR N;  4FWS A;  3VA3 A;  4B8C A;  4KH6 A;  3C7N A;  4GV6 A;  1JJ2 M;  2QXL A;  3N4P A;  4C1N I;  4EZ9 A;  3EN9 A;  3LAK A;  4CZK A;  4M3X A;  1K6Y A;  3SV4 A;  4H5V A;  3OYE A;  4HUE A;  3MN5 A;  4LFB K;  3THY A;  4A5A A;  2I7P A;  3PO5 A;  3QEX A;  1X9J A;  4NLC A;  1W2B M;  3MCA B;  4KTQ A;  1KAX A;  1MU2 A;  1VSL A;  1BIS A;  3AVI A;  3VEW A;  1Q82 O;  4BR5 A;  1R0A A;  2YCH A;  4BE0 A;  5FPN A;  4KH5 A;  4ZTJ A;  3CCS N;  4FWO A;  4J2E A;  4F4K A;  3O4W A;  1QVG M;  4FWL A;  4MO4 A;  3AA5 X;  1N6Q A;  3ZSW A;  4Z4C A;  1TYQ A;  4C8K A;  4H0P A;  5I9E B;  4KHN A;  1U2V A;  3DWL A;  4IFE A;  2HVI A;  1FJG K;  1VQN N;  1QQN A;  1N32 K;  3L2W A;  4QS7 A;  2F7T A;  2A1R A;  1UA1 A;  3OS2 A;  3O3F A;  1VK0 A;  1VSH A;  3HOS A;  5C0Y A;  4LF4 K;  2E6L A;  4DS5 A;  1D8Y A;  4FVM A;  2HHW A;  1G99 A;  2YJE A;  4DTX A;  2OA8 A;  1HLU A;  4IEI A;  1WUA A;  3G25 A;  5HRP A;  2ZJP L;  4A62 A;  1C0M A;  4K25 A;  5EY4 A;  3R6M A;  4BC3 A;  4RW4 A;  5AQT A;  1KQS M;  3AO3 A;  3OYB A;  2OPS A;  1CZB A;  1IBL K;  4O0I A;  3QES A;  5BPM A;  4CJ4 A;  3HP6 A;  4LF5 K;  3SQ0 A;  2HW3 A;  1RBV A;  1W7A A;  2P9I A;  2V7Y A;  1KLM A;  4M7Y A;  5E84 A;  5BR9 A;  2QM1 A;  4KHU A;  3TAM A;  3KK3 A;  2KKZ A;  5GIN A;  2CH5 A;  3JAM O;  4B3T K;  4F8R A;  2QA4 N;  3Q7B A;  4WQ4 A;  1ZBH A;  3HTV A;  2FSN A;  4YDU A;  4KB1 A;  5M1Q A;  1HNV A;  1BA0 A;  4H0O A;  4F9O A;  4ID1 A;  5FPM A;  4DMN A;  1NK0 A;  5HP1 A;  3CCL N;  4WFN L;  4LFA K;  4CJ7 A;  3AVA A;  4BR9 A;  3LP0 A;  3WXL A;  4EAH D;  1BHL A;  1VQL N;  3HOT A;  3JS6 A;  3P5J A;  3OW2 M;  1SUQ A;  4BG8 A;  4EP4 A;  3VOV A;  1XMO K;  4M41 A;  1O13 A;  1XI1 A;  2HHT A;  3JYT A;  3V9Z A;  1NU0 A;  4DTM A;  2RHK A;  4HUG A;  4DS4 A;  1S3X A;  4Y1D A;  4BRL A;  3WQT A;  3ZT2 A;  4JV5 K;  1F21 A;  3VTI A;  3VER A;  3U9D A;  2DFH A;  2ZJR L;  1U4B A;  4J8F A;  1D9F A;  1P8Z A;  2BAN A;  3EL2 A;  3VEZ A;  3L4Q A;  4AF1 A;  5JLF A;  3THY B;  1M90 O;  4CGF A;  4ISF A;  1HYV A;  2BGG A;  2PYL A;  4BVP A;  1RDA A;  2ZM6 K;  2O8E A;  3CC7 N;  4Z4H A;  1WSF A;  5J1E A;  2P9L B;  1V4T A;  4B3O A;  1NJZ A;  5C15 A;  2YJF A;  3TWH A;  1U48 A;  4RW7 A;  1ESV A;  1Q8I A;  5AQK A;  4BVO A;  5T7B A;  1HKG A;  3QEI A;  1KC8 O;  4ELV A;  3ALY A;  3KK2 A;  1S9G A;  3L2U A;  3C6U A;  3CCM N;  1X3M A;  4DR6 K;  3A5O C;  1SL0 A;  1L3S A;  4M63 C;  1HNZ K;  3F2K A;  1HPZ A;  3L3V A;  2A3Z A;  2NZT A;  4PL8 A;  3CCV N;  1J54 A;  1GOB A;  1LW0 A;  2GWJ A;  4CZE A;  3ULE B;  4E19 A;  1WNS A;  3H08 A;  1X9W A;  3N4Q A;  3K59 A;  1LAV A;  3LAL A;  1TVR A;  3CD6 N;  1SS6 A;  4MLH A;  2Z1J A;  3JSM A;  4N47 A;  3TAP A;  3AV9 A;  4J2A A;  1GLC G;  4FWP A;  3FZF A;  1XC9 A;  3NGI A;  3AVJ A;  2KLA A;  3QO9 A;  4K42 A;  5AZI A;  2QWO A;  1RGI A;  2HBL A;  4ZTF A;  5AQQ A;  3J7Z O;  5E41 A;  1ATN A;  2CGL A;  2W40 A;  1FXX A;  5M1N A;  2NLX A;  1I39 A;  2O4G A;  5HRN A;  4YNQ A;  1YJW N;  3DLL L;  3DXM A;  4DU3 A;  3P39 A;  4H03 B;  4CF9 A;  3KD1 E;  1NMN A;  4NLB A;  4CJV A;  5ADX H;  4E7J A;  4RW6 A;  4E1M A;  1RT4 A;  4HCB A;  5H1S Q;  1TK5 A;  2P5O A;  4I6M A;  5JS1 A;  1IKW A;  3AVN A;  4BWM A;  4FZY A;  4CI6 A;  2GV9 A;  3CPW M;  3ATV A;  1K9M O;  4DLG A;  3Q7C A;  4BGB A;  4BRI A;  4IG0 A;  2JWL A;  3IRX A;  3BGR A;  1S5J A;  5TKW A;  4CIG A;  3M5R A;  1QQM A;  1VRU A;  5FDL A;  4CZF A;  3IDH A;  4JI0 K;  3ENB A;  5B8H A;  1K73 O; 
#chains in the Genus database with same CATH homology
 1XHX A;  2YHA A;  4FJ9 A;  4CJQ A;  3TAG A;  3LAM A;  3THV A;  3AVB A;  1HQU A;  5HBM A;  1RTJ A;  4ELU A;  3RTV A;  4KI4 A;  4FM1 A;  4QOZ B;  3VQ4 A;  3RMD A;  1TKD A;  4Q0B A;  4N5S A;  3NFA A;  1VSM A;  4FW1 A;  1BQM A;  3ZSR A;  4O55 A;  1SKS A;  2I5J A;  3RMA A;  3OJU A;  3KK1 A;  3CFR A;  4JS5 A;  3P83 D;  1WSJ A;  1LWF A;  3DYA A;  4WE1 A;  5JS2 A;  3CFP A;  2VG6 A;  2QKB A;  1ZBI A;  4FJ8 A;  1Z26 A;  5KRT A;  3TAF A;  3MAQ A;  1NK4 A;  3OYN A;  3PX0 A;  3VQ8 A;  3O4Q A;  3CQ8 A;  2VWJ A;  4W5T A;  3HVR A;  1IKV A;  3LWM A;  3DRP A;  4HCC A;  2F96 A;  3PX6 A;  4C8N A;  4AHU A;  4PQU A;  2HHU A;  1TAQ A;  3LWL A;  3V9U A;  1QQC A;  1NKC A;  3DI6 A;  4DU1 A;  1DTT A;  2BDP A;  4IFY A;  2KTQ A;  3V4I A;  1RT3 A;  4CJU A;  3S3M A;  2WOM A;  1Q9Y A;  1CLQ A;  4Z0U A;  2FBX A;  2IC3 A;  4JRP A;  3IAY A;  1C1A A;  3L3U A;  3M8P A;  3T19 A;  3OYD A;  1C6V A;  3O3G A;  1BI4 A;  1IH7 A;  3KTQ A;  3DLB A;  1HYS A;  1TK8 A;  4OGE A;  2FC0 A;  3NDK A;  3K57 A;  3ZSO A;  3SNN A;  2YNG A;  3OYJ A;  2OPP A;  2B5J A;  3SPZ A;  4RW8 A;  1NKE A;  3DLK A;  3ISN C;  1RCH A;  3F9K A;  3AA2 A;  5DMR A;  3SPY A;  3VQ6 A;  1KTQ A;  2RF2 A;  4OKK A;  4W5O A;  4J2D A;  3ZT1 A;  3SCX A;  4DFM A;  4I9L A;  5I3U A;  1JLC A;  3VQP A;  3K2P A;  2ETJ A;  2X78 A;  3ZSX A;  3LPT A;  4FLZ A;  3I0R A;  5DK5 A;  3DRR A;  3LPU A;  3G10 A;  4B9M A;  3RRH A;  1NK7 A;  3QLH A;  4Z4I A;  4CJE A;  4LH5 A;  1A5W A;  1L3T A;  5CZ2 A;  1NJX A;  1VSE A;  5EU7 A;  2ITG A;  1S9E A;  3DLR A;  1RNH A;  1VSK A;  4DQR A;  3U6F A;  4M3T A;  1TKZ A;  3O3H A;  3SV3 A;  4DSK A;  4DTS A;  3OYC A;  2D0A A;  3E01 A;  2FBV A;  1NK5 A;  3VQB A;  1WAF A;  3A2F A;  4E3S A;  3CFO A;  3DLE A;  4OVL A;  3RR8 A;  4AHV A;  3RMC A;  1X1P A;  2GBZ A;  5KRS A;  3AVK A;  4LY7 A;  4CEC A;  3AVM A;  3V1Q A;  5CYM A;  4K8X A;  1KLN A;  2O4I A;  1QSL A;  2JLE A;  4B9S A;  5KGX A;  4Y1C A;  3NE6 A;  2Y1J A;  1QHT A;  4O5B A;  3QIP A;  1LWE A;  1NK9 A;  4KB0 A;  4CEA A;  2DFF A;  4CHN A;  4DTU A;  2OZS A;  3TR8 A;  2HHS A;  4CEE A;  3V1O A;  2G8I A;  1Q9X A;  5C42 A;  1S1W A;  3OJS A;  3RRG A;  1KVB A;  4B9N A;  3V9X A;  3RMB A;  4CJP A;  4OPK A;  1JKH A;  3AO5 A;  4DSJ A;  4M3Y A;  4CFB A;  2KFZ A;  1IKX A;  2XRI A;  3AVL A;  3VQ9 A;  1N5Y A;  4H4O A;  2ATQ A;  1KFD A;  1JL1 A;  3LDS A;  3QEV A;  3PO4 A;  2R7Y A;  4BDP A;  4CK2 A;  2KFN A;  4DFP A;  3HL8 A;  1RTI A;  1EKE A;  1NOZ A;  1ITG A;  1RTH A;  4HHT A;  3NH1 A;  2X6S A;  4OPJ A;  1T03 A;  4E7K A;  1NOY A;  1C0T A;  4B9L A;  1A5X A;  2G8H A;  4FLT A;  2AJQ A;  3QNN A;  4FK4 A;  2EHG A;  4KI6 A;  1RDB A;  4Z4F A;  3K5M A;  4FM2 A;  1YTA A;  1L5U A;  4F2R A;  4M3Z A;  1KVC A;  1B9F A;  2XY8 A;  3T1A A;  2FBY A;  4CGJ A;  3HXM A;  1X9S A;  4BDY A;  4GW6 A;  3OVN A;  3VQD A;  4PWD A;  3QIO A;  1ZBU A;  5CZ1 A;  2HMI A;  3OYG A;  4KTZ A;  3KKS A;  1LW2 A;  1Z25 A;  1KCF A;  2DY4 A;  1TL1 A;  1EXQ A;  2BE2 A;  3LP3 A;  3KLE A;  2WON A;  3NF9 A;  1FKP A;  3VQE A;  4E1N A;  4C8M A;  2XHB A;  3ULD A;  4DSF A;  1ASW A;  1RDC A;  3NGY A;  2HVH A;  4NYF A;  3QEP A;  3B6P A;  2XY6 A;  2EX3 A;  3V6D A;  3HVT A;  2QXF A;  2FBT A;  5J2N A;  3VQA A;  3TAB A;  4M42 A;  4DSE A;  1BL3 A;  3SUO A;  4FJ7 A;  4KHY A;  4XIU A;  2RKI A;  1RT1 A;  5J2M A;  3M8S A;  1JL2 A;  3UIQ A;  1UWB A;  3WNF A;  4O0J A;  3HPO A;  4CJT A;  3K58 A;  1TAU A;  3HO1 A;  3MXI A;  1NK8 A;  4OKJ A;  4JRQ A;  4CF0 A;  4EZ6 A;  3AVG A;  4FJK A;  1IKY A;  3KIO A;  2B6A A;  5CYQ A;  4CHO A;  3TAN A;  4KKO A;  2F8S A;  3NCI A;  5HLF A;  1RTD A;  3DLH A;  4Q5V A;  2YKN A;  1J5O A;  4FZX C;  2D0B A;  1U49 A;  1LV5 A;  1GOA A;  4IFV A;  4KHQ A;  1HMV A;  4KV8 A;  4LSL A;  2HHQ A;  1Y97 A;  4CJR A;  4AHR A;  4HUF A;  3U3G A;  3MEE A;  3HT3 A;  1SKW A;  4KRE A;  1WAJ A;  2XO7 A;  3M8R A;  4DQS A;  3SYZ A;  1WN7 A;  3KLG A;  2IGI A;  2Z1I A;  1JLQ A;  4N76 A;  2KW4 A;  3NF8 A;  4AIL C;  5KI6 A;  2YKM A;  2IS3 A;  4N56 A;  3AVH A;  4CIF A;  3VA3 A;  1G15 A;  4B8C A;  1WSG A;  3DOL A;  3CM6 A;  3NF7 A;  4EP5 A;  3L2V A;  4FJL A;  2HHV A;  2OPQ A;  1ASU A;  3K5O A;  4EZ9 A;  2F8T A;  4MQ3 A;  1ZYQ A;  2D0C A;  3LAK A;  1U45 A;  3QIN A;  1TL3 A;  4M3X A;  3NBP A;  4FCY A;  3FFI A;  3V9S A;  1K6Y A;  1KRP A;  3SV4 A;  3ZSQ A;  1UAX A;  3OYE A;  3BDP A;  1RBT A;  1WSE A;  4HUE A;  3OYA A;  1J53 A;  4FJM A;  3AA4 A;  4CF2 A;  4OGC A;  1RBR A;  3HST B;  4RG8 A;  4DQQ A;  3HJF A;  4W5R A;  3PO5 A;  4Z4E A;  2JGU A;  3QEX A;  1L3U A;  1SKR A;  4FLU A;  4CJS A;  3LZJ A;  4CEF A;  1A5V A;  2ZD1 A;  3O4N A;  4M45 A;  4KTQ A;  4BE1 A;  4CIE A;  2QKK A;  1J9A A;  1MU2 A;  4FLV A;  4F3O A;  1VSL A;  3OS1 A;  3MED A;  3KKR A;  4B8A B;  4JS4 A;  1BIS A;  4O44 A;  3ZSV A;  3SZ2 A;  3AVI A;  2PYJ A;  3PX4 A;  4Z4G A;  1R0A A;  4FJX A;  4O4G A;  2QK9 A;  4E7L A;  2Q3S A;  4BE0 A;  1WLJ A;  2VG7 A;  4PA1 A;  4ZTJ A;  3HM9 A;  2Z1G A;  4KRF A;  3L2Q A;  4FLX A;  4CHY A;  4CGG A;  4DG1 A;  2Y1I A;  4F4K A;  4NYN A;  3QER A;  4J2E A;  2KZZ A;  4W5N A;  3PV8 A;  4I9Q A;  3CYM A;  3ZSY A;  4CGI A;  3V81 A;  2E6M A;  3AA5 X;  1N6Q A;  3ZSW A;  1LAW A;  4CK3 A;  1VSD A;  2D5R A;  3HYF A;  4CJ5 A;  4Z4C A;  2G8K A;  4OKE A;  4TSX A;  4C8K A;  2PY5 A;  1KVA A;  3HPH A;  2OZM A;  4KHN A;  3P1G A;  4CEO A;  1RIL A;  2HVI A;  4FLW A;  1RDD A;  1XHZ A;  4OLA A;  3SQ1 A;  5J2Q A;  3ZSZ A;  3L2R A;  1UA0 A;  2YNI A;  4CEB A;  3L2W A;  3EYZ A;  4FJH A;  3KLI A;  3VA0 A;  1UOC A;  1C0U A;  3ZCM A;  3IS9 A;  2YNH A;  4CJK A;  2A1R A;  3WNH A;  1T8E A;  1UA1 A;  3OS2 A;  3O3F A;  1VK0 A;  1VSH A;  4DU4 A;  3OYF A;  3K5N A;  1JXB A;  5SWM A;  1BGX T;  4FYD A;  4IDK A;  3KJV A;  2E6L A;  4DS5 A;  4DTR A;  1KSP A;  1D8Y A;  1C1B A;  3SQ2 A;  4FVM A;  4CER A;  4CCH A;  2HHW A;  4ID5 A;  4CK1 A;  1WSI A;  2XY5 A;  1T7P A;  4H8K A;  3I8D A;  1S1U A;  3M8Q A;  4CFA A;  4DTX A;  3V1R A;  2OA8 A;  2HHX A;  4CED A;  4E89 A;  4I2Q A;  1RT7 A;  4AH9 A;  4CHQ A;  1O1W A;  3ZT4 A;  5HRP A;  1ASV A;  4CJW A;  3K5L A;  4FW2 A;  1C0M A;  3MXJ A;  4I7F A;  4HTU A;  4RW4 A;  2DTU A;  2IAJ A;  5CY4 A;  4BAC A;  4CHZ A;  3AO3 A;  4KFB A;  3OYB A;  2OPS A;  1CZB A;  3VQQ A;  4O0I A;  3QES A;  2A1S A;  4GMJ B;  4JLH A;  4CJ4 A;  3L8B A;  3HP6 A;  2ZE2 A;  2X74 A;  1B92 A;  3SQ0 A;  2HW3 A;  3ZT0 A;  1RBV A;  2IOC A;  1RBS A;  2W42 A;  3NHG A;  1D5A A;  4IG3 A;  1KLM A;  3C95 A;  3LZI A;  1SL1 A;  2OPR A;  2RN2 A;  1HJR A;  3C94 A;  4DTN A;  4DF4 A;  3AVC A;  2PZS A;  4GVM A;  3VQ5 A;  1VSF A;  3QET A;  4DTJ A;  4KHU A;  3TAM A;  3KK3 A;  4M3W A;  3LAN A;  4F8R A;  5C25 A;  4FK2 A;  4FXD A;  3PY8 A;  1VSJ A;  1IO2 A;  1QSY A;  2ZQB A;  4LH4 A;  1W0H A;  1ZBH A;  4ZHR A;  1RT5 A;  3KLH A;  1S1T A;  3QNO A;  1D9D A;  1JLF A;  4KB1 A;  4M3U A;  1HNV A;  2HNY A;  2HNZ A;  2LSN A;  2YV0 X;  1FKO A;  4ID1 A;  3PUF A;  2NUB A;  3MXM A;  4DMN A;  4CJ3 A;  5HRR A;  5HP1 A;  1NK0 A;  3VQC A;  2G8W A;  3AO2 A;  3AVA A;  2P5G A;  3LP0 A;  3U3Y A;  4CJF A;  2GUI A;  4I2P A;  4CF8 A;  1BHL A;  1TGO A;  4QAG A;  3VQ7 A;  4PUO A;  3P5J A;  4KHW A;  1SUQ A;  5KGW A;  4EP4 A;  3CG7 A;  1JLA A;  1QS4 A;  4R5P A;  4FLY A;  4M41 A;  1XI1 A;  2HHT A;  3JYT A;  3V9Z A;  4LD0 A;  4FJN A;  4W5Q A;  4DTM A;  2KZM A;  3KLF A;  4HUG A;  1BQN A;  2P51 A;  5J2P A;  1SL2 A;  4DS4 A;  4Y1D A;  3TAQ A;  4DSI A;  5FRN A;  3ZT2 A;  1F21 A;  1IG9 A;  1JLB A;  1CXQ A;  1HNI A;  3OYM A;  4L8R B;  2DFH A;  3MEG A;  2YNF A;  2IDO A;  4KO0 A;  1U4B A;  2BAN A;  1D9F A;  4H4M A;  3EZ5 A;  4UQG A;  4CGF A;  1RT2 A;  1L3V A;  1S6P A;  1T05 A;  1HYV A;  2BGG A;  2PYL A;  4FJI A;  1RT6 A;  3TAE A;  4CF1 A;  1NK6 A;  3DM2 A;  1JLG A;  3B6O A;  1RDA A;  3D45 A;  1DTQ A;  4Z4H A;  1BI4 B;  1WSF A;  5J1E A;  5K14 A;  1SV5 A;  4N41 A;  1S1X A;  2YHB A;  3HP9 A;  4ELT A;  1NJZ A;  4B3O A;  4QCL A;  2B4J A;  1LWC A;  3ZT3 A;  4CFC A;  4CHP A;  3TWH A;  1U48 A;  3AO1 A;  4FJJ A;  4YFU A;  4RW7 A;  3V9W A;  4F3T A;  1Q8I A;  3AVF A;  4MFB A;  2G8U A;  4HVJ A;  5T7B A;  1REV A;  4DFJ A;  4G1Q A;  1X9M A;  3QEI A;  3RR7 A;  1NJW A;  3SI6 A;  1ZBF A;  4DSL A;  3AA3 A;  4ELV A;  4DLE A;  3ALY A;  3I0S A;  3KK2 A;  3D0P A;  1S9G A;  2KQ2 A;  3G0Z A;  3OY9 A;  3L2U A;  3C6U A;  4DQP A;  1B9D A;  1C1C A;  4CFD A;  1EX4 A;  4BE2 A;  3T3F A;  3NH0 A;  5HRO A;  4M3R A;  4OJR A;  1SL0 A;  1L3S A;  4KPY A;  4CES A;  3S3N A;  4FK0 A;  1HRH A;  3KD5 E;  4FZZ A;  1TV6 A;  1HPZ A;  2X6N A;  3L3V A;  2DFE A;  4FJ5 A;  1JLE A;  4C8L A;  4FJG A;  3DLG A;  1J54 A;  1GOB A;  1LW0 A;  1XWL A;  4E19 A;  1WNS A;  2G8F A;  3H08 A;  3VN5 A;  4CJL A;  4B08 A;  1X9W A;  3WNG A;  1KFS A;  1YTU A;  3K59 A;  1LAV A;  3LAL A;  4DTP A;  1JXE A;  1NJY A;  1TVR A;  3OYK A;  3ASM A;  1BCO A;  3MEC A;  4NCG A;  1I3A A;  3S9H A;  4DQI A;  3DMJ A;  1RBU A;  5D3G A;  2Z1J A;  3JSM A;  4CEQ A;  4N47 A;  3SUP A;  2HND A;  3TAP A;  3AO4 A;  1VRT A;  3LP1 A;  3AV9 A;  4J2A A;  5C24 A;  1XC9 A;  1VSI A;  3C6T A;  3QEW A;  4IBN A;  4BWJ A;  3NGI A;  1EET A;  3AVJ A;  3QO9 A;  4IKF A;  4NCA A;  1U47 A;  4NCB A;  3HK2 A;  3EY1 A;  4LSN A;  3NF6 A;  2G8V A;  4ZTF A;  4CGH A;  4DFK A;  3LP2 A;  2HB5 A;  2VG5 A;  4AHC A;  4DF8 A;  1EP4 A;  3TAR A;  3SJJ A;  5E41 A;  4PY5 A;  1YT3 A;  4CE9 A;  3OYI A;  4K8Z A;  3TI0 A;  3NH2 A;  1FXX A;  1TKX A;  2VWK A;  3SUN A;  1QTM A;  1GOC A;  4DWI A;  1I39 A;  2O4G A;  5HRN A;  4YNQ A;  5KTQ A;  1BIZ A;  4DU3 A;  4CGD A;  3NGZ A;  4DTO A;  5FRM A;  1BCM A;  4CF9 A;  1DLO A;  3DRS A;  4B9U A;  1S6Q A;  1HQE A;  1S1V A;  5I42 A;  3KD1 E;  4F2S A;  4ICL A;  4CJV A;  4CEZ A;  4E7J A;  4RW6 A;  4E1M A;  1QSS A;  4KHS A;  1RT4 A;  1HYZ A;  3NAE A;  4HCB A;  3OS0 A;  4BDZ A;  1TK5 A;  2P5O A;  3CM5 A;  3F73 A;  3ITH A;  1U04 A;  5HRS A;  3HPG A;  3OYH A;  3OYL A;  5JS1 A;  4RW9 A;  4E7I A;  5FRO A;  1IKW A;  3AVN A;  3SQ4 A;  4BWM A;  2OYQ A;  4FZY A;  4B9V A;  2Z1H A;  4B9T A;  3RWU A;  1QE1 A;  4FM0 A;  2GV9 A;  4DLG A;  1CXU A;  1FK9 A;  4AHS A;  5SZT A;  4E0D A;  3SUQ A;  1BIU A;  3IG1 A;  3S3O A;  4OLB A;  1WSH A;  1W9H A;  4J2B A;  1CZ9 A;  4IG0 A;  4KAZ A;  3DOK A;  1TK0 A;  3IRX A;  2E4L A;  1TKT A;  1YVU A;  3WNE A;  3BGR A;  2RPI A;  4KTW A;  1S5J A;  4AHT A;  4CIG A;  4E7H A;  1VRU A;  1ZBL A;  1NKB A;  5FDL A;  4C8O A;  2XY7 A;  2P1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...