3AO3A

Fragment-based approach to the design of ligands targeting a novel site on hiv-1 integrase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
153
structure length
138
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQEESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fragment-based design of ligands targeting a novel site on the integrase enzyme of human immunodeficiency virus 1
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/transferase inhibitor
molecule keywords POL polyprotein
total genus 49
structure length 138
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ao3A00
3AO5A 4EZ9A 2XY5A 1KTQA 4GW6A 4M41A 4FZXC 1JLQA 4DSEA 3HVTA 3WNFA 3ZT2A 3AVNA 2IDOA 4CJKA 3F73A 4E7JA 3ZT0A 4DTNA 3TAFA 1KRPA 3CM6A 4KI6A 1C1CA 3NH2A 3V81A 1VSJA 4KB1A 1RTJA 4M3RA 4CHNA 4XIUA 4MFBA 3DOKA 1A5VA 4DSIA 4KI4A 4OLAA 1X9SA 1ZBIA 3QNNA 1SKWA 4Q5VA 1J9AA 3TAPA 3NF9A 3SJJA 4PY5A 1SL0A 1KLMA 1KVAA 1W9HA 4DWIA 4KTZA 5FDLA 3OYAA 3VQAA 4DFMA 4CHOA 4N56A 4M3TA 5C24A 1VSIA 4LH4A 2EHGA 1QS4A 5KGWA 4R5PA 4CHZA 4E3SA 2HHXA 4H8KA 1HRHA 4E1NA 1Z26A 1T7PA 1HYVA 2DFFA 1XI1A 4DTJA 4E7HA 3U3YA 2RPIA 2QXFA 4DLGA 3AVJA 4FYDA 4O0IA 4FLXA 4EP4A 3RMBA 4LY7A 4CJUA 1CLQA 4F8RA 4E7KA 4CJQA 1QE1A 4HTUA 1NJWA 2LSNA 2IAJA 2Z1HA 2G8VA 4DSJA 3QEPA 4AHVA 1EXQA 3MECA 3QINA 3VN5A 3M8RA 3U3GA 4CEZA 4AHUA 3L2VA 4CCHA 2HHWA 1NKBA 4LH5A 3HPHA 3L2RA 4IKFA 4BWJA 3ASMA 4ICLA 1L3UA 5K14A 2PY5A 3RTVA 4CHPA 1X9WA 1ZYQA 1YT3A 3G0ZA 3ALYA 2YNIA 3DI6A 1RT4A 1S9GA 1ASUA 1WN7A 3C6UA 2GV9A 3NH0A 3SI6A 1WLJA 2XY7A 3VQ8A 3T3FA 1TKDA 3ZSOA 1UA1A 2X74A 4JRQA 3V9XA 3VQBA 2G8WA 5FROA 1NOYA 1KVBA 1TVRA 5HBMA 4PWDA 2YKMA 1J5OA 2P51A 4K8ZA 4G1QA 3WNHA 4ELUA 3WNEA 4KO0A 2B5JA 4FZZA 3NFAA 2VG7A 4CIEA 3ZSZA 1IKVA 4AH9A 3VQ5A 1VSKA 3ZT1A 4CJVA 2HNDA 4DG1A 1T05A 1TK8A 4HVJA 4EZ6A 4CGDA 3TANA 3LAMA 4KHSA 4RW7A 3LANA 4CK3A 2YKNA 3KD1E 4FK2A 3HO1A 4DS5A 3OYGA 3K58A 1RBRA 1C1AA 3EYZA 4DQSA 5I42A 3HJFA 1K6YA 1BCOA 3BDPA 4B8CA 4KAZA 3KTQA 4CGHA 5C25A 1RT7A 4B9VA 2IS3A 3OS0A 4HUFA 3ZSRA 3V9SA 4MQ3A 4YNQA 4CFDA 2A1RA 2P5OA 3JSMA 3ZSWA 3AVLA 4N41A 5FRMA 2QK9A 1WAJA 1QTMA 2DTUA 3RR8A 2R7YA 2XY6A 1G15A 1UAXA 3HVRA 1QSLA 4OPJA 2PYLA 3DLBA 1X9MA 4I9QA 5SWMA 2WONA 4DF8A 2JLEA 3KKRA 1BI4B 1C6VA 3E01A 3LZIA 1ITGA 3QIPA 3SUOA 3SQ1A 2E4LA 3PO5A 3DRRA 4KV8A 5CZ2A 1GOCA 3KLFA 4FJHA 4KHNA 1GOBA 2D0BA 3QEWA 3QEXA 3KKSA 5KI6A 4CEFA 1IO2A 2E6LA 2IOCA 4CFAA 3NDKA 1LWEA 4HHTA 4Q0BA 3NHGA 2ATQA 3NE6A 3B6OA 3K2PA 4FCYA 3M8PA 3CFPA 2DY4A 1DLOA 1RDAA 4I7FA 3L2UA 3QLHA 4BE0A 1CXQA 2O4IA 3OYCA 3AVCA 1RT5A 4RG8A 4C8NA 4FLTA 5CYQA 4OLBA 1U48A 4Z4IA 5HP1A 3AVHA 4ZTJA 3CQ8A 1UOCA 4KKOA 4Z4HA 1VRTA 1YTUA 2HB5A 3SQ4A 4CEBA 3OJSA 2HVHA 3ZSVA 2KFZA 4W5NA 1ZBLA 1ASVA 4Z0UA 3RMAA 3AVIA 4CFCA 3RRHA 4AILC 4FM0A 4M3WA 2PZSA 4KTQA 3JYTA 3TARA 1U45A 1RDDA 3C95A 3L3UA 1TV6A 3LAKA 3UIQA 1L3SA 1JLAA 3K5OA 1JXBA 3P5JA 3AA3A 4H4MA 4JLHA 3VQ4A 1S9EA 5I3UA 4HCCA 4FM2A 1EKEA 3MEGA 4RW9A 4Z4EA 2F8TA 3AVMA 4RW6A 1SV5A 3NCIA 4PQUA 1LW2A 3LP2A 4FJ7A 4Z4FA 1RNHA 2OPRA 3NBPA 5HROA 1KCFA 4DTRA 4OKKA 3V1OA 4DFJA 3EZ5A 2B4JA 4C8LA 1NK9A 2HHSA 4F2RA 2NUBA 2F96A 4C8KA 4FJNA 2X6SA 1RBVA 3BGRA 1RBSA 1LWFA 1S1VA 3DRPA 4FLUA 2XHBA 1VRUA 4DTOA 1LV5A 3ZSYA 3IAYA 4KB0A 1Y97A 1RCHA 2HHVA 2DFHA 3HYFA 4CJ5A 4CEQA 3HT3A 1NJYA 4F3TA 2I5JA 1JLCA 3AA2A 3PUFA 4RW8A 4DU3A 1I39A 4CECA 4O0JA 5HRRA 4DFPA 1NJZA 1RTDA 4DSLA 1LW0A 3V9ZA 2RKIA 4E1MA 1NKEA 1TKTA 2P5GA 4NCGA 1R0AA 1JLBA 1SL2A 1D5AA 5T7BA 5CZ1A 2OZSA 1S1UA 2FBTA 4NYFA 3QERA 1RTHA 1VSEA 4DQRA 3G10A 2PYJA 1TAQA 2YNGA 4DLEA 4CIFA 4PUOA 4LD0A 1TGOA 4CJEA 1T8EA 2YNFA 3PY8A 1J54A 5JS2A 1I3AA 1WSEA 1BIZA 4LSNA 1VSLA 4OKJA 3WNGA 4NYNA 3SV4A 4KREA 2HHUA 1S5JA 2E6MA 3TWHA 3K59A 3A2FA 2YHBA 1SUQA 4CF1A 3ZSQA 4CGGA 3I8DA 2VG5A 3OJUA 4CF8A 4KRFA 4ELVA 4QAGA 4F3OA 1SL1A 1HYZA 3CG7A 3S3MA 4DTMA 1SKSA 2FBYA 2XY8A 1NK8A 4FJIA 2HHQA 1WSIA 4FJ9A 1HYSA 3M8QA 1S1XA 4B9TA 3KK1A 4DF4A 2G8FA 5KRTA 4ELTA 3M8SA 2KTQA 4CJ3A 1FK9A 4DU4A 5J2NA 2RN2A 5C42A 4CJWA 1Z25A 4CHQA 3AA5X 2BE2A 1BL3A 3KJVA 4QOZB 1N6QA 1TL3A 4CFBA 1NOZA 4CHYA 1DTQA 3AVBA 3O4QA 4B08A 3V9UA 3DLHA 4RW4A 4O4GA 3SYZA 4KTWA 4B9LA 2KZZA 1HJRA 4FJKA 4AHTA 2HHTA 3MXIA 3TAGA 1QHTA 1REVA 1TKXA 3NF8A 4B9NA 4CJ4A 3SQ2A 2KZMA 4I2PA 1XHZA 5E41A 2KW4A 4M45A 2OPSA 3AVGA 2FBXA 3V1QA 3K5NA 2VWJA 3OVNA 1JL2A 4IBNA 1GOAA 3VQCA 4E19A 2P1JA 4BE1A 3KLGA 1QSYA 1RBUA 4FW2A 4QCLA 1A5XA 3CYMA 4UQGA 2XO7A 4PA1A 1KFDA 4CGJA 1L3TA 1QQCA 1C0TA 1KLNA 2A1SA 1VSHA 3KLEA 3HK2A 3IG1A 1JLFA 1B92A 3NF7A 1F21A 2D0CA 3O4NA 3OYFA 3K5LA 3K57A 4AHSA 1BIUA 4M3YA 5KRSA 5DMRA 3SZ2A 1VK0A 3AVKA 2Z1IA 3LPUA 1U47A 5HRNA 4C8OA 5D3GA 2FC0A 2ETJA 3EY1A 3VA0A 1Q9XA 1EP4A 1JL1A 4EP5A 3NGYA 1J53A 1UWBA 3LP1A 1ASWA 1S6PA 3ZT3A 3KK3A 3TABA 1HQEA 1HNIA 1KFSA 3LWMA 1JKHA 4IG0A 4ZHRA 4KHUA 4GVMA 4GMJB 4CESA 4FLWA 4AHCA 3VQ9A 5CY4A 3VQDA 4N5SA 1NK0A 4F2SA 1JXEA 3OYEA 4DSFA 3SCXA 4FLVA 3KIOA 1CZ9A 3MEDA 3VQ6A 1MU2A 1EETA 3C6TA 2Q3SA 4OPKA 1D9DA 3VQEA 4CJRA 3VA3A 4B3OA 3QO9A 3DLEA 4ZTFA 4H4OA 4FJJA 4DQPA 2OZMA 3QNOA 2X78A 4J2AA 4E7LA 1O1WA 5J2QA 3V9WA 3DRSA 3SV3A 2EX3A 4DQQA 4J2EA 3B6PA 4KHQA 1BISA 3HL8A 2JGUA 2BANA 3PV8A 1NK7A 3TAQA 4DS4A 3KK2A 2BGGA 3LZJA 3SUQA 4M3ZA 3SPYA 1T03A 3OS2A 3DYAA 3OYLA 4DTPA 5J1EA 2B6AA 3RWUA 3ZSXA 1YVUA 2GUIA 3O3HA 3SQ0A 1JLEA 5KGXA 1L3VA 3QETA 1RT6A 4B8AB 1ZBHA 1RT1A 2YV0X 1FKOA 4CEOA 4CK2A 4CIGA 2G8HA 4DTSA 3TAEA 3OYJA 2VWKA 3L8BA 1VSFA 2F8SA 4E89A 4O44A 5EU7A 2D0AA 3P83D 4CF0A 3THVA 3AA4A 4KPYA 4CEDA 4I9LA 3H08A 3OYIA 3IS9A 4OGCA 4BDZA 1HPZA 1RDCA 1NK6A 1C0MA 3VQ7A 3AVAA 1KVCA 2ZE2A 2HW3A 4L8RB 1Q9YA 4ID5A 3CFOA 1ZBUA 1JLGA 2KQ2A 1IG9A 4B9UA 2OYQA 1CXUA 1EX4A 5SZTA 2X6NA 1VSDA 4HUGA 1S6QA 1NK5A 4CE9A 2OA8A 4FK0A 3NGZA 1RT2A 1U49A 4I2QA 1BQNA 4CEAA 5KTQA 1TK0A 4IFVA 3DM2A 4O55A 3L3VA 1TK5A 4DU1A 3OY9A 4IDKA 4M3XA 3I0RA 5HRPA 2XRIA 3DLGA 4FM1A 3NGIA 3CFRA 4K8XA 3MXJA 3RMDA 3PX4A 3ULDA 4CK1A 3QIOA 2HNZA 3OYDA 1BQMA 2BDPA 3OYNA 4FLZA 2ITGA 4IFYA 4FLYA 3V4IA 4OGEA 1RTIA 3U6FA 3VQQA 3AV9A 3V6DA 5FRNA 5CYMA 3D45A 1U04A 3TR8A 4DMNA 3S9HA 3OYHA 4FJMA 3KLIA 1HNVA 3AO4A 1ZBFA 1IKYA 1FXXA 3S3NA 1LWCA 4Z4CA 1RT3A 4CERA 4IG3A 3HP6A 3HM9A 3VQPA 3L2WA 3SPZA 3OYMA 3DOLA 3FFIA 4LSLA 3SNNA 4Y1DA 4BACA 2ZD1A 3PO4A 4N76A 5J2MA 3PX0A 3RMCA 2KFNA 1WSJA 1UA0A 4FJLA 1WSGA 1XHXA 3PX6A 1NK4A 1SKRA 4CGIA 4ID1A 3K5MA 1WAFA 4C8MA 3T1AA 4W5QA 1DTTA 2G8KA 1C1BA 1A5WA 2QKKA 4CJTA 2RF2A 4YFUA 2VG6A 4OKEA 3TAMA 3AO3A 4Z4GA 4BDYA 3SUPA 1KSPA 3OYKA 3T19A 1S1TA 3P1GA 4FJXA 1FKPA 3V1RA 4W5OA 4NCAA 1NJXA 4CEEA 3OS1A 4CGFA 1WNSA 4HCBA 4N47A 4CJFA 3RRGA 3ZCMA 1Q8IA 3IRXA 4CF9A 2O4GA 1QSSA 1B9DA 2Z1JA 5HLFA 1N5YA 3MXMA 3AVFA 3HPOA 3HSTB 2WOMA 3NH1A 4F4KA 4DTXA 4KHYA 2YHAA 3LP0A 2Y1JA 3ISNC 1CZBA 2ZQBA 2Y1IA 4KHWA 3C94A 4AHRA 1BGXT 2IGIA 4Y1CA 4JS4A 5JS1A 4FVMA 1LAVA 3HPGA 3CM5A 4OJRA 1TAUA 3HXMA 5J2PA 3MEEA 4CJSA 4E0DA 3QESA 2FBVA 1BHLA 3NF6A 4JRPA 2YNHA 1WSFA 1RBTA 3D0PA 3QEIA 4FZYA 3MAQA 3LPTA 1S1WA 2OPPA 3O3GA 3RR7A 4BWMA 3LALA 4M42A 3DLKA 2HNYA 4FJ5A 5HRSA 1RDBA 1VSMA 4TSXA 2W42A 1C0UA 4M3UA 1IH7A 1BI4A 3NAEA 4BDPA 1IKWA 3KD5E 4J2BA 3I0SA 2IC3A 3LP3A 3F9KA 1U4BA 1IKXA 4BE2A 3QEVA 2AJQA 3LWLA 1D9FA 2QKBA 2Z1GA 4CJPA 2G8UA 1XWLA 4B9MA 1HMVA 2HVIA 3DMJA 3DLRA 1YTAA 4CF2A 3LDSA 1WSHA 1L5UA 1B9FA 4FW1A 3ITHA 4DFKA 3OYBA 3O3FA 4WE1A 3SUNA 4DQIA 4DSKA 1BCMA 1LAWA 4FJGA 2DFEA 2HMIA 4E7IA 3AO1A 4JS5A 1TL1A 2GBZA 1D8YA 4J2DA 2OPQA 1TKZA 4OVLA 1NKCA 5DK5A 1W0HA 4NCBA 1RILA 1X1PA 4KFBA 4HUEA 4DTUA 4O5BA 3L2QA 4FK4A 4FXDA 3HP9A 4W5TA 2G8IA 1XC9A 1HQUA 3TI0A 4FJ8A 3KLHA 4CJLA 4B9SA 3AO2A 3S3OA 2D5RA 4W5RA 3ZT4A
chains in the Genus database with same CATH superfamily
3AO5A 1KTQA 4DV1K 5I9EB 4FZXC 4NLBA 3O4WA 2IDOA 3TAFA 1RTJA 3CCLN 4MFBA 3DOKA 3TAPA 5M1QA 4BVPA 4H0VB 2ZJQL 3I55N 3VQAA 4M3TA 5C24A 3WQTA 1BO5O 4JI8K 4JKBA 4H8KA 4JI6K 3O9TA 2O8DB 1JCEA 4I6MA 2HBLA 2QXFA 4O0IA 4FLXA 4EP4A 1BA1A 4CJQA 1NJWA 2LSNA 2Z1HA 1XMOK 3LL3A 4LF7K 3M8RA 2HHWA 2O8CA 5AQIA 5AQWA 4EHTA 1HX1A 1LOTB 1VQ6N 1GLEG 4BRDA 2OTLN 1ZYQA 1NGCA 3ALYA 2YNIA 5E26A 1WN7A 1WBDA 1FW6A 2GV9A 3SI6A 3T3FA 3ZSOA 3MN6A 3V9XA 2VQFK 1KVBA 1J5OA 3VGLA 4K8ZA 4G1QA 4ELUA 4BRNA 3WNEA 2B5JA 3NFAA 1IKVA 3ZT1A 4CJVA 2HNDA 2Q0UA 1KAYA 2QM1A 4FK2A 3WUHA 3OYGA 4DQSA 2QEXN 1K6YA 2NRZA 3THXB 5C25A 3CERA 3ENBA 3QBWA 1E4GT 2P5OA 3RR8A 2R7YA 4I9QA 1NMDA 4DF8A 2JLEA 3LZIA 1ITGA 4JN4A 4KH6A 3PO5A 3DRRA 5LY3A 2Q36A 3KLFA 1D4XA 4WQ4C 3DLLL 5KI6A 4CEFA 1HJOA 1LWEA 4Q0BA 2P9KB 3VETA 5A2QO 4A59A 1VQKN 3NE6A 3EZWA 3W0LA 2DY4A 1DLOA 5LMUK 2P9IB 3OYCA 3AVCA 4C8NA 3O1BA 4Z4IA 3G71N 3HOSA 1UOCA 4B1UB 1VRTA 1YTUA 1JCGA 2HB5A 4JKHA 3ZSVA 2KFZA 3C6HA 4W5NA 5FPDA 4AM7A 1T3VA 3TARA 1RDDA 4JKCA 1NBWA 3LAKA 1ATNA 2KLAA 1JXBA 3VQ4A 2E2PA 1I94K 1HKGA 4HCCA 2FF3B 1KAXA 3A5MC 3PIPL 2F8TA 3NCIA 4GNIA 3LP2A 2BUPA 3EZ5A 5AQHA 4FWKA 5AR0A 1NK9A 4C8KA 2F9WA 4FJNA 1RBSA 4FLUA 1S1VA 1YXQA 1RCHA 2HHVA 3BP8A 4CJ5A 3PUFA 4DR7K 1OH6A 1I39A 1NJZA 3C0BA 2NRWA 1TKTA 1SL2A 1C0GA 2Q1NA 5CZ1A 3H3NO 2FBTA 4NYFA 5GAGP 4DR3K 3A5OC 4DLEA 3HZ6A 3CD6N 4PUOA 3LDQA 3PY8A 2VCPA 4WFAL 3VOVA 1BIZA 1VSLA 3SV4A 1S5JA 4QS9A 1DKGD 2YHBA 1SUQA 1NGIA 4CF1A 4CGGA 4BROA 4CZEA 1NJIO 2ASPA 1SKSA 1NK8A 4FJIA 3WXKA 3ATVA 2HHQA 3M8QA 3QICA 1WUAA 4DF4A 2G8FA 2UUCK 4ELTA 2KTQA 3DXKB 1S72N 1TYQA 1BL3A 4IEEA 3MN5A 3ID8A 4RW4A 2HF4A 2KZZA 1HJRA 4FWNA 3TAGA 1QHTA 3SQ2A 2KZMA 5E41A 3VGMA 4M45A 2O8BA 2ZJPL 3O8MA 4GVEA 3K5NA 4FPAA 2P1JA 4BE1A 3G25A 4FW2A 4BQZA 3CYMA 4PA1A 1KLNA 1QQCA 4YDUA 5FPNA 3HK2A 3NF7A 3ZETA 4M3YA 1U2VB 5DMRA 3ZX3A 3ATUA 3LPUA 4C8OA 3EY1A 1Q9XA 1EP4A 4GKKK 4EP5A 1S6PA 4YY3K 2RE2A 3BUZB 3E9LA 2VWBA 4AHCA 3VQ9A 4PKIA 3ULEB 4AM6A 4CW7B 4DSFA 3SCXA 1TUYA 2D0OA 1CZ9A 4H5VA 3VQ6A 4OPKA 2Q3SA 1D9DA 3D2EB 3HSCA 3VQEA 4JI4K 3DLEA 4A62A 1QVFM 1EWQA 4DQPA 1EO1A 3OBWA 3SV3A 2BANA 3PV8A 2CGLA 4DS4A 4M3ZA 3T7ZA 3MN7A 3OS2A 3DYAA 3OYLA 2B6AA 2GUIA 3O3HA 1JLEA 5KGXA 4U67L 3QETA 2YV0X 4CK2A 4HTLA 3TAEA 4FWPA 2VWKA 2F8SA 3C6AA 4E89A 4CF0A 3LM2A 4DV4K 3A5NC 1HPZA 5AQXA 2E88A 4L8RB 1CXUA 1EX4A 1ZBSA 4HUGA 1S6QA 3CF5L 5IWAK 4CE9A 2OA8A 3G6EN 5F1XA 1U49A 3CJAA 3FZFA 4CEAA 4GY2B 2QWNA 1QVGM 4XEIA 3I0RA 4IXCA 4FM1A 5AQNA 3CFRA 3MXJA 3UKRA 3ULDA 3QIOA 4MDAA 3KHYA 1KC8O 2P9UA 3OYDA 4KH5A 2UXDK 3OYNA 4IFYA 4CVNE 3H3OB 5FRNA 5CYMA 1U04A 3TR8A 4DMNA 3S9HA 3J80O 1ZBFA 3GBTA 3S3NA 5KQDA 1LWCA 4U7BA 4Z4CA 4NO7A 5F0XA 4IG3A 3HP6A 4MLEA 3BF3A 3EN9A 3L2WA 3SPZA 1VQ5N 3EKUA 4IEIA 3DOLA 3FR0A 4Y1DA 4N76A 5J2MA 3HRGA 5BRDA 4FJLA 1WSGA 1XHXA 1NK4A 4MLHA 4CGIA 3K5MA 5M1FA 4YFUA 1GLFO 4FSVA 3SUPA 3O9SA 1MA9B 4FJXA 1FKPA 3V1RA 4W5OA 4CEEA 3OBYA 5AQGA 4FWSA 2Z1JA 1ILYA 3VMFB 2NRVA 4CBXA 1KQSM 2WOMA 4F4KA 3VF6A 4DTXA 1X3MA 2W40A 2Y1JA 1CZBA 1RFQA 4M7XA 4AHRA 3C94A 3K9JA 4Y1CA 2YJFA 4JS4A 3EE9A 3C7NA 3CM5A 3HXMA 5J2PA 3MEEA 4CJSA 4E0DA 3J7AP 1BHLA 2YHWA 3NF6A 2YNHA 3D0PA 3MAQA 3LPTA 4DV3K 1IBLK 1E4FT 1IBMK 2HNYA 1C0UA 4BY9C 1BI4A 3NAEA 3MCAB 5KQ8A 2AP1A 3QEVA 2O8FB 3ZETB 2QKBA 1XWLA 1SZ2A 5AQYA 2AA4A 3DMJA 3LDSA 5BPNA 1WB9A 3SUNA 2IVOA 4IDHA 2P9IA 3L6QA 5BN8A 1VQON 5GIPA 4JS5A 3WEEB 2QI2A 4NCBA 4DTUA 2UUAK 1HUXA 3L2QA 5MLCQ 3ZLJA 4W5TA 2G8IA 1IJJA 1Q18A 4ISFA 4B9SA 5M1KA 1NGEA 2O8CB 2XY5A 1JLQA 3AVNA 4E7JA 3ZT0A 4DTNA 1T6CA 3CM6A 3MMVA 1C1CA 3TPQA 4KI6A 4XIUA 4CHNA 4X66K 4DSIA 3QNNA 3SJJA 1SL0A 5EVZA 4DFMA 3J7YP 2EHGA 4JKDA 1HRHA 1T7PA 1HYVA 2DFFA 3L4IA 4DTJA 1VQPN 5FPMA 3U3YA 3R3LA 3CCSN 3RMBA 3GE1A 4CJUA 1NGGA 3ENOA 4JD2B 4HTUA 3E9OA 4BRFA 3OTOK 2IAJA 2G8VA 4CEZA 2FSNA 4AHUA 3L2VA 3L2RA 3T1HK 3ASMA 5K14A 4JHDB 2PY5A 3RTVA 4CHPA 1X9WA 3M5RA 3FE1A 1RT4A 4NXMK 3O80A 2GELA 3CCEN 3PSIA 1C0FA 3C6UA 2P9SA 2XY7A 3VQ8A 4CZKA 2G8WA 3QFUA 1TVRA 3S41A 2A42A 4FZZA 3TU5A 4CIEA 4K0KK 4DG1A 1T05A 3UKUA 4H5TA 4DV6K 2YKNA 4DS5A 3K58A 1C1AA 4BC5A 2FXUA 4WFNL 3HJFA 1BCOA 5AQOA 1W7AA 1XNRK 4KAZA 5AQZA 2HHHK 1RT7A 3OS0A 3ZSRA 4YNQA 2QK9A 3JSMA 1X3NA 3AVLA 4B3TK 5FRMA 4IWVA 1G15A 3A5LC 4K41A 5SWMA 3KKRA 2VQEK 3LM9A 1DT9A 4KV8A 5CZ2A 4KHNA 1VHXA 1GLLO 2QWQA 3KKSA 1IO2A 1MWKA 1XQSC 4GKJK 3TSUA 3M8PA 3FZHA 4CZIA 3QLHA 3A0IX 1CXQA 1YUWA 3CCRN 4FLTA 5CYQA 4JAXA 3CQ8A 4QS8A 1OVYA 1RDWX 1FJGK 1ASVA 4A57A 4FM0A 4KTQA 3CJ7A 2J4RA 3C95A 3L3UA 1K9MO 4C1NK 3UIQA 3LDPA 3P5JA 4H4MA 1S9EA 5I3UA 1Q86O 1EKEA 1KAZA 2D4WA 4NB4A 1BA0A 2QWMA 4DUYK 4Z4EA 3VF4A 4H5RA 4RW6A 1SV5A 2ZM6K 4LFBK 1LW2A 4FO0A 4Z4FA 3IKMA 1KCFA 4DTRA 4OKKA 2IIRA 1DGKN 2X6SA 3DRPA 3BGRA 3DXMA 2O8FA 4JI7K 1LV5A 2E2NA 3ZSYA 3IAYA 1Y97A 3HYFA 2UXCK 2E8AA 4BRKA 4CECA 4DFPA 1NKEA 1GLBG 4E1MA 5AQTA 5T7BA 5AZIB 2W41A 1HNWK 1RTHA 4DQRA 1EWRA 4CJEA 1T8EA 2YNFA 1J54A 5KPRA 2QWLA 1EQYA 1YAGA 4LSNA 1Z6RA 3TWHA 1YIJN 3OJUA 4JK8A 4ELVA 4F3OA 1SL1A 3IDHA 4YOYA 1U2VA 4FJ9A 1HLUA 5KRTA 4CJ3A 3UKRB 4DU4A 2RN2A 4CHQA 4DV2K 3O08A 3CETA 1TL3A 1DTQA 3V9UA 4B9LA 5FPEA 3P4IA 5DM6L 4FJKA 4R79A 1V4SA 1K73O 4JI3K 1REVA 1TKXA 2QWOA 1YJ9N 1JCFA 2FBXA 3R8EA 3BY5A 5CE3A 1JL2A 4BR5A 4IZ9A 4E19A 2ITMA 5M1NA 4CGJA 3CXCM 4BRGA 3IG1A 1JLFA 5BPMA 1F21A 3K57A 1BIUA 5C2FA 1YJWN 1VK0A 2E2QA 2P9UB 2W6LA 3AVKA 3R6MA 3FZKA 5HRNA 5D3GA 2ETJA 4WFBL 2CH5A 3DXKA 2FLOA 1VQ7N 3KK7A 3TABA 3LP1A 1ASWA 2V7ZA 4KH4A 3LWMA 5GINA 4KHUA 4GVMA 4GMJB 4FLWA 4BREA 1IG8A 2D1KA 5CY4A 3VQDA 1NK0A 1JXEA 3THYB 3TSPA 4FLVA 3KIOA 3JAMO 3VA3A 5AQFA 3QO9A 3C7NB 3WXIA 1OH5A 2OZMA 2X78A 4J2AA 1O1WA 3WXMB 3DJCA 3DRSA 2I7PA 2ZGZA 4DV0K 4DR4K 1G99A 5AFUA 3CQXA 3SUQA 3AGRA 2D0PA 5J1EA 2V7YA 4LFCK 2O8DA 4B8AB 1ZBHA 4CEOA 3OYJA 3G4SN 4ILGB 3L8BA 1VSFA 3GL1A 5EU7A 3CJCA 4BGBA 4JKEA 3AA4A 3NVKA 5ELZA 4CEDA 3OYIA 1RDCA 1NK6A 4C23A 3D2EA 4XH1A 2UU9K 2HW3A 1Z05A 5B8HA 3PSFA 1ATRA 1Q9YA 4OO1J 3PIOL 4NXNK 4FPBA 1ZBUA 1IG9A 5BR9A 2OYQA 2UYTA 4CZGA 1W97L 5LJWA 4FK0A 3NGZA 1RT2A 5GADP 3JXUA 1TK0A 4IFVA 1P8ZA 3DM2A 3MWPA 3L3VA 1TK5A 2ASOA 5HRPA 2A3ZA 2XRIA 3RSEB 5M1OA 1OH7A 3PX4A 1NU0A 1QQOA 4H5WA 1O13A 4J8FA 3WEEA 5JMVA 1XUPO 3V4IA 4OGEA 1RTIA 3V6DA 4YOWA 3D45A 3AO4A 3VEVA 2O8EB 3I8BA 3HM9A 1YITN 3VQPA 2HMPA 3CIPA 3LDNA 3OYMA 4JKGB 5GAEP 4CI6A 1UA0A 1V4TA 3CJ9A 3T1AA 1HNXK 1DTTA 4A61A 2E20A 4Z4GA 4JEPA 1K8KA 3I33A 1KSPA 2WTUA 3WQUA 2UUBK 4IFEA 1NJXA 1WNSA 3RRGA 3ZCMA 4DR2K 1VQLN 1QQMA 1QSSA 2CGKA 3ULEA 3AVFA 4BRPA 3NH1A 4KHYA 1U6ZA 2H3GX 3ISNC 2Y1IA 2IGIA 4FWOA 3HM8A 4FVMA 1LAVA 3OW2M 1QQNA 4JRPA 3SLCA 4FZYA 3HI0A 3BEXA 3RR7A 4BWMA 3LALA 4M42A 2E2OA 3QFPA 4CZJA 1RDBA 1RGIA 4JV5K 1XC3A 4BDPA 3KD5E 4J2BA 3I0SA 1U4BA 2AJQA 3LWLA 1D9FA 4CJPA 4B1XB 3VEZA 2P9PA 3EE8A 3DLRA 2BTFA 4JI2K 3O3FA 4DQIA 1BCMA 1LAWA 1OKJA 2OANA 3CMAN 2DFEA 2HMIA 1M1KO 3HTVA 1HR0K 4RCHA 4OVLA 5DK5A 1W0HA 1RILA 4FK4A 1HQUA 2NRHA 4FJ8A 4CJLA 3AO2A 3RMCA 3ZT4A 2PAVA 4EZ9A 4M41A 4YORA 3IFRA 3HVTA 4JKFA 3ZT2A 1LCUA 4CJKA 3VENA 2IVPA 3NH2A 3V81A 4KB1A 4OX9K 5FLXO 4KI4A 3E1YA 4OLAA 3CJBA 1X9SA 5C2DA 2P9SB 3NF9A 4PY5A 1YI2N 3NVMA 1GLJO 1W9HA 4KTZA 5FDLA 5C10A 4ISGA 4K43A 3O9RA 4CHOA 4N56A 3D7EO 1VSIA 5KGWA 2HHXA 1QS4A 3VEWA 4R5PA 1DEJA 3M6GA 4E1NA 1Z26A 4EFHA 3D2FA 1XI1A 3OHRA 4NLCA 4E7HA 2RPIA 4DLGA 4FYDA 3N4PA 4LY7A 4F8RA 4DSJA 5LMNK 4KHQA 1EXQA 1P90A 4CCHA 3U3GA 3DAWA 1NKBA 3HPHA 4ICLA 5AQRA 4BVOA 1SAZA 2YHXA 3U9DA 5DM7L 5JVGL 2VYPA 3GDQA 3G0ZA 1S9GA 1ASUA 2YJEA 3NH0A 4MO5A 4WQ4A 5ADXH 1WLJA 1TKDA 1ZC6A 2X74A 4JRQA 5HBMA 4DKWA 4PWDA 1QZ6A 3AGKA 3WNHA 3VF2A 2NRXA 3W3DA 2VG7A 2ASMA 4AH9A 3VQ5A 1BG3A 1TK8A 4EZ6A 4BRQA 4CGDA 3KD1E 3LANA 4CK3A 3HO1A 4CD3A 1RBRA 3EYZA 5I42A 2A41A 2E5LK 3BDPA 4B8CA 1VQMN 3E9PA 4CGHA 4K25A 2IS3A 4B9VA 3V9SA 5AQKA 4MQ3A 4DR5K 2A1RA 3ZSWA 1QZ5A 1WAJA 3J7ZO 5GIOA 2XY6A 3C65A 1UAXA 1QSLA 2PYLA 4OPJA 1X9MA 3P31A 1BI4B 3QIPA 2E4LA 4CZFA 3QEWA 3N4QA 4JNEA 2E6LA 2IOCA 4DV5K 5LJVA 3CJ1A 4BC3A 2ATQA 1K8KB 3B6OA 3K2PA 4FCYA 3KZBA 1RDAA 5AFUH 4I7FA 3DXMB 1N8RO 4OLBA 2UXBK 3AAPA 5JLFA 5HP1A 4DHYA 4Z4HA 3SQ4A 1ZBLA 4Z0UA 3AARA 3KWGA 4CFCA 2YHYA 3O9QA 1Q7YO 4M3WA 4JD2A 3JYTA 1U45A 3P39A 2DPNA 3MDQA 1T6DA 1L3SA 3K5OA 4JLHA 2NNWA 3AA3A 4G9ZA 4RW9A 3H1VX 2P9LB 3AVMA 4H03B 3KWIA 4EHUA 1SQKA 3EKSA 4PQUA 2WUSA 4JHDA 4FJ7A 3NBPA 5AQVA 4DFJA 5BN9A 1OH8A 5AZJA 4F2RA 2NUBA 1RBVA 1LWFA 2F4VK 2QTDA 3CCMN 2XHBA 4DTOA 4KB0A 4JI1K 3HT3A 1NJYA 4F3TA 1JLCA 3AA2A 4DU3A 1R59O 4O0JA 5HRRA 4DSLA 1LW0A 3V9ZA 1IBKK 2P5GA 1BUPA 4NCGA 3SAFA 1R0AA 4LF9K 1D5AA 2OZSA 4FWQA 4IJAA 3THWA 1VSEA 2HOEA 3BZCA 2PYJA 2YX6A 2GWKA 3R9PA 2HBKA 4LD0A 5JS2A 5AQUA 1I3AA 1WSEA 3WNGA 4OKJA 4NYNA 4KREA 2V51B 4JK9A 2VGMA 2HHUA 1KXPA 3ZSQA 4CF8A 1H1VA 3CG7A 3S3MA 3GOIA 2XY8A 4FVUA 4O8KA 3TTDA 1WSIA 2JWKA 4BR9A 3UE5A 1S1XA 4PL7A 3KK1A 4FWLA 1FK9A 4M7YA 4CJWA 1Z25A 3O5BA 1N6QA 2NRTA 4CFBA 3AVBA 4B08A 2ZWHA 4O4GA 4H0TB 4BRIA 3VEYA 3MXIA 4WCEL 4JYAK 4EIAA 3NF8A 4CJ4A 1HKBA 1XHZA 2OPSA 1N32K 1SS6A 2NLXA 3V1QA 3OVNA 2GWJA 4IBNA 4A2BA 3VQCA 3KLGA 4QCLA 1A5XA 4UQGA 1L3TA 4A2AA 1C0TA 1VSHA 3U4LA 3O4NA 4AHSA 1ATSA 2Q2RA 4FOIA 3VTIA 2Z1IA 2QWRA 1U47A 5BPLA 2FC0A 3TTCA 4ISEA 3TTFA 5JLHA 3VA0A 3NGYA 3ENHA 1KFSA 1HQEA 1HNIA 4ZHRA 1NGJA 2O8EA 2RHKA 1W2BM 4EAHD 4N5SA 3OYEA 4ILHA 3C6TA 3Q7CA 5HL7L 4FOEA 4CJRA 4BG9A 2YCHA 3SBTA 3MX2A 4FJJA 1MDUB 5BR8K 4LC9B 2IVNA 3V9WA 2A6AA 2EX3A 4DB3A 4DQQA 4J2EA 5TKWA 1NK7A 3TAQA 2FSKA 3KK2A 2BGGA 3LZJA 4UY8O 1CZAN 1YVNA 3CHWA 3RWUA 3ZSXA 1YVUA 1RT6A 4QS7A 3VGKA 2W6KA 1K8AO 3HOTA 4O44A 2D0AA 3THVA 4I9LA 3H08A 1YF5L 3CCVN 4V19S 3IS9A 4OGCA 3VQ7A 3AVAA 2ZE2A 3SBGA 3QBXA 3LDOA 4DR6K 4B1VA 3CFOA 1JLGA 4M63C 2X6NA 4LF5K 2GX9A 3U8XA 1Y64A 4L3QA 1J6ZA 1BQNA 4O55A 4YOXA 4DU1A 3T1YK 2P9LA 4BRCA 3ZEUB 4H0XB 1M90O 1IV0A 4K8XA 3RMDA 1YJNN 5BRFA 3UKUB 4IJNA 3R1XA 1BQMA 2BDPA 2NRRA 3QDKA 4YOUA 3SMPA 3MK6A 3U6FA 3VQQA 4IO8A 3CI5A 4FJMA 3OYHA 3KLIA 1HNVA 5LL6Z 3VEOA 4X65K 5JVHL 3FFKB 4BR7A 4BACA 3PO4A 2ZD1A 4MO4A 3FLCO 1WAFA 2G8KA 1C1BA 4CJTA 2RF2A 3TAMA 4PL8A 3AO3A 3H46O 3ZX0A 3FZLA 4FWRA 3OYKA 3T19A 1S1TA 1WOQA 3P1GA 3CPWM 4Y0WA 3O6WA 2HBJA 1Q8IA 1N36K 3IRXA 2O4GA 3THYA 3HPOA 3HSTB 3DWLA 1NGDA 4OPHA 3J8AA 3LP0A 2ZQBA 4XH5A 4KHWA 2PBDA 4OJRA 1TAUA 3T69A 1WSFA 1RBTA 3I56N 2OPPA 3O3GA 3M1FA 3QMLA 4FJ5A 4IOAL 4TSXA 2E1YA 3AY9A 4M3UA 5H1SQ 1IH7A 3VERA 4LF8K 1N33K 3LP3A 3F9KA 1IKXA 4BE2A 3CPEA 3ZX2A 2Z1GA 4B9MA 4Z94A 2HVIA 1YTAA 3RSEA 1L5UA 1ZXOA 4FW1A 3ITHA 4K42A 3OYBA 4DSKA 4FJGA 5TKYA 3THXA 5AZIA 2ZGYA 3AO1A 1GLDG 1TL1A 2GBZA 4J2DA 2OPQA 5HOOA 5AQJA 4BG8A 1NKCA 1X1PA 4HUEA 4FXDA 2I7NA 2CGJA 3TI0A 4NCAA 4RWTA 3KVGA 1NWKA 4BQLA 4GW6A 2OCEA 3QB0A 4DSEA 4B1ZA 3WNFA 4BR0A 3F73A 4YOVA 1WBBA 1KRPA 1NGHA 1VSJA 4M3RA 1A5VA 4B3RK 4BR4A 1ZBIA 5AQLA 3WXJA 1J9AA 5CR4A 4Q5VA 1SKWA 1KLMA 4GV9A 1KVAA 2WC9A 5EY4A 4KBOA 4DWIA 3OYAA 4ILJA 3L4QA 4CZHA 3CQYA 4LH4A 4BRLA 4E3SA 4CHZA 4B3MK 3O9UA 3SK3A 2E1ZA 3AVJA 2V52B 1CLQA 2NZTA 4E7KA 1QE1A 4KHPK 3QEPA 4AHVA 3MECA 3VN5A 3QINA 2P9NA 4JKGA 3ID6A 3A8YA 2YI1A 4LH5A 5JICA 4IKFA 4LF6K 4BWJA 4DQ8A 1L3UA 3VPZA 1YT3A 2EWSA 3SAHA 3DI6A 5AZJB 1E3MA 4PHTX 3B8AX 3E66A 1NLVA 4AQYK 1UA1A 3VQBA 3H45C 5FROA 1NOYA 1VAZA 2YKMA 2P51A 3F2KA 1NGAA 4KO0A 4BC2A 3IMXA 3ZSZA 2P9PB 1VSKA 3L0QA 4HVJA 1NGFA 3TANA 3LAMA 4KHSA 4RW7A 2HSTA 3FZMA 2JWLA 4CZLA 4AF1A 5KPTA 3SAGA 3KTQA 4HUFA 4CFDA 1S22A 4N41A 1QTMA 2DTUA 4PKHA 2QW9A 5M1PA 3HVRA 3DLBA 4BR2A 2PFUA 2WONA 1C6VA 3E01A 1Q81O 3SUOA 3SQ1A 3Q7BA 1GOCA 3EL2A 4FJHA 1GOBA 2D0BA 3QEXA 3NDKA 4HHTA 4CFAA 4B1WB 1XMQK 3O1WA 4BRHA 3NHGA 3GG4A 4GV3A 5GAHP 2GUPA 3CFPA 4BE0A 3L2UA 2O4IA 4JKAA 4FWMA 1RT5A 4RG8A 1U48A 3AVHA 4ZTJA 3PLAA 2KKZA 4KKOA 4O8UA 4DUZK 4CEBA 3OJSA 2HVHA 2F9TA 2OTJN 4H0PA 4I6MB 3D6RA 3LDLA 3RMAA 3AVIA 3RRHA 4AILC 2PZSA 1TV6A 4CBUA 1JLAA 4FM2A 3MEGA 1ESVA 1BOTO 2VGNA 5F2RA 4A5AA 1RNHA 2OPRA 5HROA 3V1OA 4FL9A 2A5XA 3CCUN 1S3XA 2B4JA 1TUUA 4C8LA 2HHSA 2A40A 2F96A 4CZMA 3WXLA 1VRUA 3H6EA 2DFHA 4CEQA 4CD1A 2I5JA 4RW8A 1RTDA 3ZYYX 2RKIA 4CJ7A 1JLBA 4C1NI 4DCHA 4H0YB 1XNQK 1S1UA 3CC2N 3QERA 1Q82O 3G10A 1TAQA 2YNGA 4CIFA 5BREA 1TGOA 2E6MA 3K59A 3A2FA 2HF3A 3I8DA 2VG5A 3CCQN 4KRFA 4QAGA 3CC7N 1HYZA 4DTMA 1HKCA 2FBYA 4WYBA 4YHHK 1HYSA 4MDBA 3OA9A 3J81O 4B9TA 4WQ5C 3M8SA 5J2NA 5C42A 4A5BA 3AA5X 2BE2A 4WQ5A 5C15A 3KJVA 3MN9A 4QOZB 4H5NA 1NOZA 1NGBA 4CHYA 1JJ2M 3O4QA 3DLHA 4OPAA 3SYZA 4KTWA 3M3ZA 4AHTA 2HHTA 3SMSA 4RTFD 1VQ4N 4B9NA 1NNEA 4I2PA 2KW4A 5E84A 3AVGA 4CBWA 2P9NB 2VWJA 1VQNN 3P38A 1GOAA 1QSYA 1RBUA 5EXWA 2XO7A 1KFDA 3JS6A 2A1SA 3KLEA 3K0SA 2P9KA 1B92A 1HNZK 2D0CA 3OYFA 3K5LA 4BC4A 5KRSA 5IT9O 3SZ2A 2FF6A 2F7TA 1MWMA 3EO3A 3UB5A 1JL1A 1J53A 1UWBA 3ZT3A 3KK3A 5AQQA 1JKHA 4IG0A 1GLCG 5EX5A 3VESA 4CESA 4BRAA 4F2SA 4E1JA 1BWFO 3MEDA 4B3SK 1MU2A 1EETA 2O8BB 4XH4A 3CMEN 4B3OA 3HBTA 4ZTFA 4H4OA 3K9KA 3QNOA 4E7LA 5J2QA 1NM1A 4JI5K 3B6PA 1BISA 3HL8A 2JGUA 4IO9L 3SPYA 1T03A 4DTPA 4X64K 3MWTA 2Q31A 3SQ0A 2Q0RA 1L3VA 4YDUC 3D2FB 1RT1A 1FKOA 3H1QA 4CIGA 2G8HA 4DTSA 3WT0A 2QXLA 3THWB 1GLAG 3P83D 4BRMA 4KPYA 5C12A 1T44A 2QWPA 4BDZA 3AAQA 1C0MA 1BDGA 1KVCA 5AQMA 4ID5A 5AJ3K 2Q97A 4B9UA 2KQ2A 4LFAK 1N34K 4IOCL 5SZTA 4JK7A 1VSDA 1NK5A 4LF4K 2FSJA 4I2QA 5KTQA 4WF9L 3OY9A 4IDKA 3CCJN 3SJHA 2WFBA 3CC4N 4M3XA 3VTHA 3DLGA 3NGIA 3MCPA 2QA4N 1TYQB 1OVQA 4CK1A 2HNZA 5AQPA 2CH6A 4BGAA 4FLZA 4FLYA 2ITGA 3U9ZA 3AV9A 2WBNA 1IKYA 1FXXA 1RT3A 4YOTA 4CERA 1QHAA 3FGUA 3FFIA 4LSLA 3SNNA 3PX0A 2KFNA 1WSJA 3PX6A 1BU6O 1SKRA 3BZKA 4ID1A 4GV6A 5ADXA 4C8MA 4W5QA 2QKKA 4PKGA 1A5WA 3ZEUA 2VG6A 4OKEA 4BDYA 1NMNA 1X9JA 5AQSA 4DV7K 3OS1A 2KHOA 1RDUA 4CGFA 4HCBA 4N47A 4CJFA 4CF9A 1B9DA 2HBMA 4B9QA 5HLFA 1N5YA 3MXMA 5CHIA 4O5FA 1J5EK 5C0YA 2YHAA 3NMUA 3F9MA 1BGXT 5JS1A 3HPGA 5BRHA 3QESA 2FBVA 3VEXA 2ZF5O 3EEQA 3QEIA 5EOYA 3MX5A 4JI0K 1S1WA 3DLKA 5HRSA 2GTDA 4B1YB 1VSMA 2W42A 5KPZA 4IOXA 1IKWA 2IC3A 3F5TA 3TSQA 2G8UA 4H0OA 1HMVA 3IUCA 1HPMA 2GEMA 4X62K 4CF2A 2ZJRL 4HWIA 1WSHA 1B9FA 4DFKA 4WE1A 4F9OA 4E7IA 1KD1O 1NG9A 1D8YA 1VQ9N 1TKZA 3BF1A 1YHQN 1VQ8N 4KFBA 4O5BA 2BH1A 3HP9A 1XC9A 3KLHA 4DR1K 3S3OA 3RVCA 2D5RA 4W5RA
chains in the Genus database with same CATH topology
3AO5A 4EZ9A 2XY5A 1KTQA 4GW6A 4M41A 4FZXC 1JLQA 4DSEA 3HVTA 3WNFA 3ZT2A 3AVNA 2IDOA 4CJKA 3F73A 4E7JA 3ZT0A 4DTNA 3TAFA 1KRPA 3CM6A 4KI6A 1C1CA 3NH2A 3V81A 1VSJA 4KB1A 1RTJA 4M3RA 4CHNA 4XIUA 4MFBA 3DOKA 1A5VA 4DSIA 4KI4A 4OLAA 1X9SA 1ZBIA 3QNNA 1SKWA 4Q5VA 1J9AA 3TAPA 3NF9A 3SJJA 4PY5A 1SL0A 1KLMA 1KVAA 1W9HA 4DWIA 4KTZA 5FDLA 3OYAA 3VQAA 4DFMA 4CHOA 4N56A 4M3TA 5C24A 1VSIA 4LH4A 2EHGA 1QS4A 5KGWA 4R5PA 4CHZA 4E3SA 2HHXA 4H8KA 1HRHA 4E1NA 1Z26A 1T7PA 1HYVA 2DFFA 1XI1A 4DTJA 4E7HA 3U3YA 2RPIA 2QXFA 4DLGA 3AVJA 4FYDA 4O0IA 4FLXA 4EP4A 3RMBA 4LY7A 4CJUA 1CLQA 4F8RA 4E7KA 4CJQA 1QE1A 4HTUA 1NJWA 2LSNA 2IAJA 2Z1HA 2G8VA 4DSJA 3QEPA 4AHVA 1EXQA 3MECA 3QINA 3VN5A 3M8RA 3U3GA 4CEZA 4AHUA 3L2VA 4CCHA 2HHWA 1NKBA 4LH5A 3HPHA 3L2RA 4IKFA 4BWJA 3ASMA 4ICLA 1L3UA 5K14A 2PY5A 3RTVA 4CHPA 1X9WA 1ZYQA 1YT3A 3G0ZA 3ALYA 2YNIA 3DI6A 1RT4A 1S9GA 1ASUA 1WN7A 3C6UA 2GV9A 3NH0A 3SI6A 1WLJA 2XY7A 3VQ8A 3T3FA 1TKDA 3ZSOA 1UA1A 2X74A 4JRQA 3V9XA 3VQBA 2G8WA 5FROA 1NOYA 1KVBA 1TVRA 5HBMA 4PWDA 2YKMA 1J5OA 2P51A 4K8ZA 4G1QA 3WNHA 4ELUA 3WNEA 4KO0A 2B5JA 4FZZA 3NFAA 2VG7A 4CIEA 3ZSZA 1IKVA 4AH9A 3VQ5A 1VSKA 3ZT1A 4CJVA 2HNDA 4DG1A 1T05A 1TK8A 4HVJA 4EZ6A 4CGDA 3TANA 3LAMA 4KHSA 4RW7A 3LANA 4CK3A 2YKNA 3KD1E 4FK2A 3HO1A 4DS5A 3OYGA 3K58A 1RBRA 1C1AA 3EYZA 4DQSA 5I42A 3HJFA 1K6YA 1BCOA 3BDPA 4B8CA 4KAZA 3KTQA 4CGHA 5C25A 1RT7A 4B9VA 2IS3A 3OS0A 4HUFA 3ZSRA 3V9SA 4MQ3A 4YNQA 4CFDA 2A1RA 2P5OA 3JSMA 3ZSWA 3AVLA 4N41A 5FRMA 2QK9A 1WAJA 1QTMA 2DTUA 3RR8A 2R7YA 2XY6A 1G15A 1UAXA 3HVRA 1QSLA 4OPJA 2PYLA 3DLBA 1X9MA 4I9QA 5SWMA 2WONA 4DF8A 2JLEA 3KKRA 1BI4B 1C6VA 3E01A 3LZIA 1ITGA 3QIPA 3SUOA 3SQ1A 2E4LA 3PO5A 3DRRA 4KV8A 5CZ2A 1GOCA 3KLFA 4FJHA 4KHNA 1GOBA 2D0BA 3QEWA 3QEXA 3KKSA 5KI6A 4CEFA 1IO2A 2E6LA 2IOCA 4CFAA 3NDKA 1LWEA 4HHTA 4Q0BA 3NHGA 2ATQA 3NE6A 3B6OA 3K2PA 4FCYA 3M8PA 3CFPA 2DY4A 1DLOA 1RDAA 4I7FA 3L2UA 3QLHA 4BE0A 1CXQA 2O4IA 3OYCA 3AVCA 1RT5A 4RG8A 4C8NA 4FLTA 5CYQA 4OLBA 1U48A 4Z4IA 5HP1A 3AVHA 4ZTJA 3CQ8A 1UOCA 4KKOA 4Z4HA 1VRTA 1YTUA 2HB5A 3SQ4A 4CEBA 3OJSA 2HVHA 3ZSVA 2KFZA 4W5NA 1ZBLA 1ASVA 4Z0UA 3RMAA 3AVIA 4CFCA 3RRHA 4AILC 4FM0A 4M3WA 2PZSA 4KTQA 3JYTA 3TARA 1U45A 1RDDA 3C95A 3L3UA 1TV6A 3LAKA 3UIQA 1L3SA 1JLAA 3K5OA 1JXBA 3P5JA 3AA3A 4H4MA 4JLHA 3VQ4A 1S9EA 5I3UA 4HCCA 4FM2A 1EKEA 3MEGA 4RW9A 4Z4EA 2F8TA 3AVMA 4RW6A 1SV5A 3NCIA 4PQUA 1LW2A 3LP2A 4FJ7A 4Z4FA 1RNHA 2OPRA 3NBPA 5HROA 1KCFA 4DTRA 4OKKA 3V1OA 4DFJA 3EZ5A 2B4JA 4C8LA 1NK9A 2HHSA 4F2RA 2NUBA 2F96A 4C8KA 4FJNA 2X6SA 1RBVA 3BGRA 1RBSA 1LWFA 1S1VA 3DRPA 4FLUA 2XHBA 1VRUA 4DTOA 1LV5A 3ZSYA 3IAYA 4KB0A 1Y97A 1RCHA 2HHVA 2DFHA 3HYFA 4CJ5A 4CEQA 3HT3A 1NJYA 4F3TA 2I5JA 1JLCA 3AA2A 3PUFA 4RW8A 4DU3A 1I39A 4CECA 4O0JA 5HRRA 4DFPA 1NJZA 1RTDA 4DSLA 1LW0A 3V9ZA 2RKIA 4E1MA 1NKEA 1TKTA 2P5GA 4NCGA 1R0AA 1JLBA 1SL2A 1D5AA 5T7BA 5CZ1A 2OZSA 1S1UA 2FBTA 4NYFA 3QERA 1RTHA 1VSEA 4DQRA 3G10A 2PYJA 1TAQA 2YNGA 4DLEA 4CIFA 4PUOA 4LD0A 1TGOA 4CJEA 1T8EA 2YNFA 3PY8A 1J54A 5JS2A 1I3AA 1WSEA 1BIZA 4LSNA 1VSLA 4OKJA 3WNGA 4NYNA 3SV4A 4KREA 2HHUA 1S5JA 2E6MA 3TWHA 3K59A 3A2FA 2YHBA 1SUQA 4CF1A 3ZSQA 4CGGA 3I8DA 2VG5A 3OJUA 4CF8A 4KRFA 4ELVA 4QAGA 4F3OA 1SL1A 1HYZA 3CG7A 3S3MA 4DTMA 1SKSA 2FBYA 2XY8A 1NK8A 4FJIA 2HHQA 1WSIA 4FJ9A 1HYSA 3M8QA 1S1XA 4B9TA 3KK1A 4DF4A 2G8FA 5KRTA 4ELTA 3M8SA 2KTQA 4CJ3A 1FK9A 4DU4A 5J2NA 2RN2A 5C42A 4CJWA 1Z25A 4CHQA 3AA5X 2BE2A 1BL3A 3KJVA 4QOZB 1N6QA 1TL3A 4CFBA 1NOZA 4CHYA 1DTQA 3AVBA 3O4QA 4B08A 3V9UA 3DLHA 4RW4A 4O4GA 3SYZA 4KTWA 4B9LA 2KZZA 1HJRA 4FJKA 4AHTA 2HHTA 3MXIA 3TAGA 1QHTA 1REVA 1TKXA 3NF8A 4B9NA 4CJ4A 3SQ2A 2KZMA 4I2PA 1XHZA 5E41A 2KW4A 4M45A 2OPSA 3AVGA 2FBXA 3V1QA 3K5NA 2VWJA 3OVNA 1JL2A 4IBNA 1GOAA 3VQCA 4E19A 2P1JA 4BE1A 3KLGA 1QSYA 1RBUA 4FW2A 4QCLA 1A5XA 3CYMA 4UQGA 2XO7A 4PA1A 1KFDA 4CGJA 1L3TA 1QQCA 1C0TA 1KLNA 2A1SA 1VSHA 3KLEA 3HK2A 3IG1A 1JLFA 1B92A 3NF7A 1F21A 2D0CA 3O4NA 3OYFA 3K5LA 3K57A 4AHSA 1BIUA 4M3YA 5KRSA 5DMRA 3SZ2A 1VK0A 3AVKA 2Z1IA 3LPUA 1U47A 5HRNA 4C8OA 5D3GA 2FC0A 2ETJA 3EY1A 3VA0A 1Q9XA 1EP4A 1JL1A 4EP5A 3NGYA 1J53A 1UWBA 3LP1A 1ASWA 1S6PA 3ZT3A 3KK3A 3TABA 1HQEA 1HNIA 1KFSA 3LWMA 1JKHA 4IG0A 4ZHRA 4KHUA 4GVMA 4GMJB 4CESA 4FLWA 4AHCA 3VQ9A 5CY4A 3VQDA 4N5SA 1NK0A 4F2SA 1JXEA 3OYEA 4DSFA 3SCXA 4FLVA 3KIOA 1CZ9A 3MEDA 3VQ6A 1MU2A 1EETA 3C6TA 2Q3SA 4OPKA 1D9DA 3VQEA 4CJRA 3VA3A 4B3OA 3QO9A 3DLEA 4ZTFA 4H4OA 4FJJA 4DQPA 2OZMA 3QNOA 2X78A 4J2AA 4E7LA 1O1WA 5J2QA 3V9WA 3DRSA 3SV3A 2EX3A 4DQQA 4J2EA 3B6PA 4KHQA 1BISA 3HL8A 2JGUA 2BANA 3PV8A 1NK7A 3TAQA 4DS4A 3KK2A 2BGGA 3LZJA 3SUQA 4M3ZA 3SPYA 1T03A 3OS2A 3DYAA 3OYLA 4DTPA 5J1EA 2B6AA 3RWUA 3ZSXA 1YVUA 2GUIA 3O3HA 3SQ0A 1JLEA 5KGXA 1L3VA 3QETA 1RT6A 4B8AB 1ZBHA 1RT1A 2YV0X 1FKOA 4CEOA 4CK2A 4CIGA 2G8HA 4DTSA 3TAEA 3OYJA 2VWKA 3L8BA 1VSFA 2F8SA 4E89A 4O44A 5EU7A 2D0AA 3P83D 4CF0A 3THVA 3AA4A 4KPYA 4CEDA 4I9LA 3H08A 3OYIA 3IS9A 4OGCA 4BDZA 1HPZA 1RDCA 1NK6A 1C0MA 3VQ7A 3AVAA 1KVCA 2ZE2A 2HW3A 4L8RB 1Q9YA 4ID5A 3CFOA 1ZBUA 1JLGA 2KQ2A 1IG9A 4B9UA 2OYQA 1CXUA 1EX4A 5SZTA 2X6NA 1VSDA 4HUGA 1S6QA 1NK5A 4CE9A 2OA8A 4FK0A 3NGZA 1RT2A 1U49A 4I2QA 1BQNA 4CEAA 5KTQA 1TK0A 4IFVA 3DM2A 4O55A 3L3VA 1TK5A 4DU1A 3OY9A 4IDKA 4M3XA 3I0RA 5HRPA 2XRIA 3DLGA 4FM1A 3NGIA 3CFRA 4K8XA 3MXJA 3RMDA 3PX4A 3ULDA 4CK1A 3QIOA 2HNZA 3OYDA 1BQMA 2BDPA 3OYNA 4FLZA 2ITGA 4IFYA 4FLYA 3V4IA 4OGEA 1RTIA 3U6FA 3VQQA 3AV9A 3V6DA 5FRNA 5CYMA 3D45A 1U04A 3TR8A 4DMNA 3S9HA 3OYHA 4FJMA 3KLIA 1HNVA 3AO4A 1ZBFA 1IKYA 1FXXA 3S3NA 1LWCA 4Z4CA 1RT3A 4CERA 4IG3A 3HP6A 3HM9A 3VQPA 3L2WA 3SPZA 3OYMA 3DOLA 3FFIA 4LSLA 3SNNA 4Y1DA 4BACA 2ZD1A 3PO4A 4N76A 5J2MA 3PX0A 3RMCA 2KFNA 1WSJA 1UA0A 4FJLA 1WSGA 1XHXA 3PX6A 1NK4A 1SKRA 4CGIA 4ID1A 3K5MA 1WAFA 4C8MA 3T1AA 4W5QA 1DTTA 2G8KA 1C1BA 1A5WA 2QKKA 4CJTA 2RF2A 4YFUA 2VG6A 4OKEA 3TAMA 3AO3A 4Z4GA 4BDYA 3SUPA 1KSPA 3OYKA 3T19A 1S1TA 3P1GA 4FJXA 1FKPA 3V1RA 4W5OA 4NCAA 1NJXA 4CEEA 3OS1A 4CGFA 1WNSA 4HCBA 4N47A 4CJFA 3RRGA 3ZCMA 1Q8IA 3IRXA 4CF9A 2O4GA 1QSSA 1B9DA 2Z1JA 5HLFA 1N5YA 3MXMA 3AVFA 3HPOA 3HSTB 2WOMA 3NH1A 4F4KA 4DTXA 4KHYA 2YHAA 3LP0A 2Y1JA 3ISNC 1CZBA 2ZQBA 2Y1IA 4KHWA 3C94A 4AHRA 1BGXT 2IGIA 4Y1CA 4JS4A 5JS1A 4FVMA 1LAVA 3HPGA 3CM5A 4OJRA 1TAUA 3HXMA 5J2PA 3MEEA 4CJSA 4E0DA 3QESA 2FBVA 1BHLA 3NF6A 4JRPA 2YNHA 1WSFA 1RBTA 3D0PA 3QEIA 4FZYA 3MAQA 3LPTA 1S1WA 2OPPA 3O3GA 3RR7A 4BWMA 3LALA 4M42A 3DLKA 2HNYA 4FJ5A 5HRSA 1RDBA 1VSMA 4TSXA 2W42A 1C0UA 4M3UA 1IH7A 1BI4A 3NAEA 4BDPA 1IKWA 3KD5E 4J2BA 3I0SA 2IC3A 3LP3A 3F9KA 1U4BA 1IKXA 4BE2A 3QEVA 2AJQA 3LWLA 1D9FA 2QKBA 2Z1GA 4CJPA 2G8UA 1XWLA 4B9MA 1HMVA 2HVIA 3DMJA 3DLRA 1YTAA 4CF2A 3LDSA 1WSHA 1L5UA 1B9FA 4FW1A 3ITHA 4DFKA 3OYBA 3O3FA 4WE1A 3SUNA 4DQIA 4DSKA 1BCMA 1LAWA 4FJGA 2DFEA 2HMIA 4E7IA 3AO1A 4JS5A 1TL1A 2GBZA 1D8YA 4J2DA 2OPQA 1TKZA 4OVLA 1NKCA 5DK5A 1W0HA 4NCBA 1RILA 1X1PA 4KFBA 4HUEA 4DTUA 4O5BA 3L2QA 4FK4A 4FXDA 3HP9A 4W5TA 2G8IA 1XC9A 1HQUA 3TI0A 4FJ8A 3KLHA 4CJLA 4B9SA 3AO2A 3S3OA 2D5RA 4W5RA 3ZT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AO5 A;  4EZ9 A;  2XY5 A;  1KTQ A;  4GW6 A;  4M41 A;  4FZX C;  1JLQ A;  4DSE A;  3HVT A;  3WNF A;  3ZT2 A;  3AVN A;  2IDO A;  4CJK A;  3F73 A;  4E7J A;  3ZT0 A;  4DTN A;  3TAF A;  1KRP A;  3CM6 A;  4KI6 A;  1C1C A;  3NH2 A;  3V81 A;  1VSJ A;  4KB1 A;  1RTJ A;  4M3R A;  4CHN A;  4XIU A;  4MFB A;  3DOK A;  1A5V A;  4DSI A;  4KI4 A;  4OLA A;  1X9S A;  1ZBI A;  3QNN A;  1SKW A;  4Q5V A;  1J9A A;  3TAP A;  3NF9 A;  3SJJ A;  4PY5 A;  1SL0 A;  1KLM A;  1KVA A;  1W9H A;  4DWI A;  4KTZ A;  5FDL A;  3OYA A;  3VQA A;  4DFM A;  4CHO A;  4N56 A;  4M3T A;  5C24 A;  1VSI A;  4LH4 A;  2EHG A;  1QS4 A;  5KGW A;  4R5P A;  4CHZ A;  4E3S A;  2HHX A;  4H8K A;  1HRH A;  4E1N A;  1Z26 A;  1T7P A;  1HYV A;  2DFF A;  1XI1 A;  4DTJ A;  4E7H A;  3U3Y A;  2RPI A;  2QXF A;  4DLG A;  3AVJ A;  4FYD A;  4O0I A;  4FLX A;  4EP4 A;  3RMB A;  4LY7 A;  4CJU A;  1CLQ A;  4F8R A;  4E7K A;  4CJQ A;  1QE1 A;  4HTU A;  1NJW A;  2LSN A;  2IAJ A;  2Z1H A;  2G8V A;  4DSJ A;  3QEP A;  4AHV A;  1EXQ A;  3MEC A;  3QIN A;  3VN5 A;  3M8R A;  3U3G A;  4CEZ A;  4AHU A;  3L2V A;  4CCH A;  2HHW A;  1NKB A;  4LH5 A;  3HPH A;  3L2R A;  4IKF A;  4BWJ A;  3ASM A;  4ICL A;  1L3U A;  5K14 A;  2PY5 A;  3RTV A;  4CHP A;  1X9W A;  1ZYQ A;  1YT3 A;  3G0Z A;  3ALY A;  2YNI A;  3DI6 A;  1RT4 A;  1S9G A;  1ASU A;  1WN7 A;  3C6U A;  2GV9 A;  3NH0 A;  3SI6 A;  1WLJ A;  2XY7 A;  3VQ8 A;  3T3F A;  1TKD A;  3ZSO A;  1UA1 A;  2X74 A;  4JRQ A;  3V9X A;  3VQB A;  2G8W A;  5FRO A;  1NOY A;  1KVB A;  1TVR A;  5HBM A;  4PWD A;  2YKM A;  1J5O A;  2P51 A;  4K8Z A;  4G1Q A;  3WNH A;  4ELU A;  3WNE A;  4KO0 A;  2B5J A;  4FZZ A;  3NFA A;  2VG7 A;  4CIE A;  3ZSZ A;  1IKV A;  4AH9 A;  3VQ5 A;  1VSK A;  3ZT1 A;  4CJV A;  2HND A;  4DG1 A;  1T05 A;  1TK8 A;  4HVJ A;  4EZ6 A;  4CGD A;  3TAN A;  3LAM A;  4KHS A;  4RW7 A;  3LAN A;  4CK3 A;  2YKN A;  3KD1 E;  4FK2 A;  3HO1 A;  4DS5 A;  3OYG A;  3K58 A;  1RBR A;  1C1A A;  3EYZ A;  4DQS A;  5I42 A;  3HJF A;  1K6Y A;  1BCO A;  3BDP A;  4B8C A;  4KAZ A;  3KTQ A;  4CGH A;  5C25 A;  1RT7 A;  4B9V A;  2IS3 A;  3OS0 A;  4HUF A;  3ZSR A;  3V9S A;  4MQ3 A;  4YNQ A;  4CFD A;  2A1R A;  2P5O A;  3JSM A;  3ZSW A;  3AVL A;  4N41 A;  5FRM A;  2QK9 A;  1WAJ A;  1QTM A;  2DTU A;  3RR8 A;  2R7Y A;  2XY6 A;  1G15 A;  1UAX A;  3HVR A;  1QSL A;  4OPJ A;  2PYL A;  3DLB A;  1X9M A;  4I9Q A;  5SWM A;  2WON A;  4DF8 A;  2JLE A;  3KKR A;  1BI4 B;  1C6V A;  3E01 A;  3LZI A;  1ITG A;  3QIP A;  3SUO A;  3SQ1 A;  2E4L A;  3PO5 A;  3DRR A;  4KV8 A;  5CZ2 A;  1GOC A;  3KLF A;  4FJH A;  4KHN A;  1GOB A;  2D0B A;  3QEW A;  3QEX A;  3KKS A;  5KI6 A;  4CEF A;  1IO2 A;  2E6L A;  2IOC A;  4CFA A;  3NDK A;  1LWE A;  4HHT A;  4Q0B A;  3NHG A;  2ATQ A;  3NE6 A;  3B6O A;  3K2P A;  4FCY A;  3M8P A;  3CFP A;  2DY4 A;  1DLO A;  1RDA A;  4I7F A;  3L2U A;  3QLH A;  4BE0 A;  1CXQ A;  2O4I A;  3OYC A;  3AVC A;  1RT5 A;  4RG8 A;  4C8N A;  4FLT A;  5CYQ A;  4OLB A;  1U48 A;  4Z4I A;  5HP1 A;  3AVH A;  4ZTJ A;  3CQ8 A;  1UOC A;  4KKO A;  4Z4H A;  1VRT A;  1YTU A;  2HB5 A;  3SQ4 A;  4CEB A;  3OJS A;  2HVH A;  3ZSV A;  2KFZ A;  4W5N A;  1ZBL A;  1ASV A;  4Z0U A;  3RMA A;  3AVI A;  4CFC A;  3RRH A;  4AIL C;  4FM0 A;  4M3W A;  2PZS A;  4KTQ A;  3JYT A;  3TAR A;  1U45 A;  1RDD A;  3C95 A;  3L3U A;  1TV6 A;  3LAK A;  3UIQ A;  1L3S A;  1JLA A;  3K5O A;  1JXB A;  3P5J A;  3AA3 A;  4H4M A;  4JLH A;  3VQ4 A;  1S9E A;  5I3U A;  4HCC A;  4FM2 A;  1EKE A;  3MEG A;  4RW9 A;  4Z4E A;  2F8T A;  3AVM A;  4RW6 A;  1SV5 A;  3NCI A;  4PQU A;  1LW2 A;  3LP2 A;  4FJ7 A;  4Z4F A;  1RNH A;  2OPR A;  3NBP A;  5HRO A;  1KCF A;  4DTR A;  4OKK A;  3V1O A;  4DFJ A;  3EZ5 A;  2B4J A;  4C8L A;  1NK9 A;  2HHS A;  4F2R A;  2NUB A;  2F96 A;  4C8K A;  4FJN A;  2X6S A;  1RBV A;  3BGR A;  1RBS A;  1LWF A;  1S1V A;  3DRP A;  4FLU A;  2XHB A;  1VRU A;  4DTO A;  1LV5 A;  3ZSY A;  3IAY A;  4KB0 A;  1Y97 A;  1RCH A;  2HHV A;  2DFH A;  3HYF A;  4CJ5 A;  4CEQ A;  3HT3 A;  1NJY A;  4F3T A;  2I5J A;  1JLC A;  3AA2 A;  3PUF A;  4RW8 A;  4DU3 A;  1I39 A;  4CEC A;  4O0J A;  5HRR A;  4DFP A;  1NJZ A;  1RTD A;  4DSL A;  1LW0 A;  3V9Z A;  2RKI A;  4E1M A;  1NKE A;  1TKT A;  2P5G A;  4NCG A;  1R0A A;  1JLB A;  1SL2 A;  1D5A A;  5T7B A;  5CZ1 A;  2OZS A;  1S1U A;  2FBT A;  4NYF A;  3QER A;  1RTH A;  1VSE A;  4DQR A;  3G10 A;  2PYJ A;  1TAQ A;  2YNG A;  4DLE A;  4CIF A;  4PUO A;  4LD0 A;  1TGO A;  4CJE A;  1T8E A;  2YNF A;  3PY8 A;  1J54 A;  5JS2 A;  1I3A A;  1WSE A;  1BIZ A;  4LSN A;  1VSL A;  4OKJ A;  3WNG A;  4NYN A;  3SV4 A;  4KRE A;  2HHU A;  1S5J A;  2E6M A;  3TWH A;  3K59 A;  3A2F A;  2YHB A;  1SUQ A;  4CF1 A;  3ZSQ A;  4CGG A;  3I8D A;  2VG5 A;  3OJU A;  4CF8 A;  4KRF A;  4ELV A;  4QAG A;  4F3O A;  1SL1 A;  1HYZ A;  3CG7 A;  3S3M A;  4DTM A;  1SKS A;  2FBY A;  2XY8 A;  1NK8 A;  4FJI A;  2HHQ A;  1WSI A;  4FJ9 A;  1HYS A;  3M8Q A;  1S1X A;  4B9T A;  3KK1 A;  4DF4 A;  2G8F A;  5KRT A;  4ELT A;  3M8S A;  2KTQ A;  4CJ3 A;  1FK9 A;  4DU4 A;  5J2N A;  2RN2 A;  5C42 A;  4CJW A;  1Z25 A;  4CHQ A;  3AA5 X;  2BE2 A;  1BL3 A;  3KJV A;  4QOZ B;  1N6Q A;  1TL3 A;  4CFB A;  1NOZ A;  4CHY A;  1DTQ A;  3AVB A;  3O4Q A;  4B08 A;  3V9U A;  3DLH A;  4RW4 A;  4O4G A;  3SYZ A;  4KTW A;  4B9L A;  2KZZ A;  1HJR A;  4FJK A;  4AHT A;  2HHT A;  3MXI A;  3TAG A;  1QHT A;  1REV A;  1TKX A;  3NF8 A;  4B9N A;  4CJ4 A;  3SQ2 A;  2KZM A;  4I2P A;  1XHZ A;  5E41 A;  2KW4 A;  4M45 A;  2OPS A;  3AVG A;  2FBX A;  3V1Q A;  3K5N A;  2VWJ A;  3OVN A;  1JL2 A;  4IBN A;  1GOA A;  3VQC A;  4E19 A;  2P1J A;  4BE1 A;  3KLG A;  1QSY A;  1RBU A;  4FW2 A;  4QCL A;  1A5X A;  3CYM A;  4UQG A;  2XO7 A;  4PA1 A;  1KFD A;  4CGJ A;  1L3T A;  1QQC A;  1C0T A;  1KLN A;  2A1S A;  1VSH A;  3KLE A;  3HK2 A;  3IG1 A;  1JLF A;  1B92 A;  3NF7 A;  1F21 A;  2D0C A;  3O4N A;  3OYF A;  3K5L A;  3K57 A;  4AHS A;  1BIU A;  4M3Y A;  5KRS A;  5DMR A;  3SZ2 A;  1VK0 A;  3AVK A;  2Z1I A;  3LPU A;  1U47 A;  5HRN A;  4C8O A;  5D3G A;  2FC0 A;  2ETJ A;  3EY1 A;  3VA0 A;  1Q9X A;  1EP4 A;  1JL1 A;  4EP5 A;  3NGY A;  1J53 A;  1UWB A;  3LP1 A;  1ASW A;  1S6P A;  3ZT3 A;  3KK3 A;  3TAB A;  1HQE A;  1HNI A;  1KFS A;  3LWM A;  1JKH A;  4IG0 A;  4ZHR A;  4KHU A;  4GVM A;  4GMJ B;  4CES A;  4FLW A;  4AHC A;  3VQ9 A;  5CY4 A;  3VQD A;  4N5S A;  1NK0 A;  4F2S A;  1JXE A;  3OYE A;  4DSF A;  3SCX A;  4FLV A;  3KIO A;  1CZ9 A;  3MED A;  3VQ6 A;  1MU2 A;  1EET A;  3C6T A;  2Q3S A;  4OPK A;  1D9D A;  3VQE A;  4CJR A;  3VA3 A;  4B3O A;  3QO9 A;  3DLE A;  4ZTF A;  4H4O A;  4FJJ A;  4DQP A;  2OZM A;  3QNO A;  2X78 A;  4J2A A;  4E7L A;  1O1W A;  5J2Q A;  3V9W A;  3DRS A;  3SV3 A;  2EX3 A;  4DQQ A;  4J2E A;  3B6P A;  4KHQ A;  1BIS A;  3HL8 A;  2JGU A;  2BAN A;  3PV8 A;  1NK7 A;  3TAQ A;  4DS4 A;  3KK2 A;  2BGG A;  3LZJ A;  3SUQ A;  4M3Z A;  3SPY A;  1T03 A;  3OS2 A;  3DYA A;  3OYL A;  4DTP A;  5J1E A;  2B6A A;  3RWU A;  3ZSX A;  1YVU A;  2GUI A;  3O3H A;  3SQ0 A;  1JLE A;  5KGX A;  1L3V A;  3QET A;  1RT6 A;  4B8A B;  1ZBH A;  1RT1 A;  2YV0 X;  1FKO A;  4CEO A;  4CK2 A;  4CIG A;  2G8H A;  4DTS A;  3TAE A;  3OYJ A;  2VWK A;  3L8B A;  1VSF A;  2F8S A;  4E89 A;  4O44 A;  5EU7 A;  2D0A A;  3P83 D;  4CF0 A;  3THV A;  3AA4 A;  4KPY A;  4CED A;  4I9L A;  3H08 A;  3OYI A;  3IS9 A;  4OGC A;  4BDZ A;  1HPZ A;  1RDC A;  1NK6 A;  1C0M A;  3VQ7 A;  3AVA A;  1KVC A;  2ZE2 A;  2HW3 A;  4L8R B;  1Q9Y A;  4ID5 A;  3CFO A;  1ZBU A;  1JLG A;  2KQ2 A;  1IG9 A;  4B9U A;  2OYQ A;  1CXU A;  1EX4 A;  5SZT A;  2X6N A;  1VSD A;  4HUG A;  1S6Q A;  1NK5 A;  4CE9 A;  2OA8 A;  4FK0 A;  3NGZ A;  1RT2 A;  1U49 A;  4I2Q A;  1BQN A;  4CEA A;  5KTQ A;  1TK0 A;  4IFV A;  3DM2 A;  4O55 A;  3L3V A;  1TK5 A;  4DU1 A;  3OY9 A;  4IDK A;  4M3X A;  3I0R A;  5HRP A;  2XRI A;  3DLG A;  4FM1 A;  3NGI A;  3CFR A;  4K8X A;  3MXJ A;  3RMD A;  3PX4 A;  3ULD A;  4CK1 A;  3QIO A;  2HNZ A;  3OYD A;  1BQM A;  2BDP A;  3OYN A;  4FLZ A;  2ITG A;  4IFY A;  4FLY A;  3V4I A;  4OGE A;  1RTI A;  3U6F A;  3VQQ A;  3AV9 A;  3V6D A;  5FRN A;  5CYM A;  3D45 A;  1U04 A;  3TR8 A;  4DMN A;  3S9H A;  3OYH A;  4FJM A;  3KLI A;  1HNV A;  3AO4 A;  1ZBF A;  1IKY A;  1FXX A;  3S3N A;  1LWC A;  4Z4C A;  1RT3 A;  4CER A;  4IG3 A;  3HP6 A;  3HM9 A;  3VQP A;  3L2W A;  3SPZ A;  3OYM A;  3DOL A;  3FFI A;  4LSL A;  3SNN A;  4Y1D A;  4BAC A;  2ZD1 A;  3PO4 A;  4N76 A;  5J2M A;  3PX0 A;  3RMC A;  2KFN A;  1WSJ A;  1UA0 A;  4FJL A;  1WSG A;  1XHX A;  3PX6 A;  1NK4 A;  1SKR A;  4CGI A;  4ID1 A;  3K5M A;  1WAF A;  4C8M A;  3T1A A;  4W5Q A;  1DTT A;  2G8K A;  1C1B A;  1A5W A;  2QKK A;  4CJT A;  2RF2 A;  4YFU A;  2VG6 A;  4OKE A;  3TAM A;  3AO3 A;  4Z4G A;  4BDY A;  3SUP A;  1KSP A;  3OYK A;  3T19 A;  1S1T A;  3P1G A;  4FJX A;  1FKP A;  3V1R A;  4W5O A;  4NCA A;  1NJX A;  4CEE A;  3OS1 A;  4CGF A;  1WNS A;  4HCB A;  4N47 A;  4CJF A;  3RRG A;  3ZCM A;  1Q8I A;  3IRX A;  4CF9 A;  2O4G A;  1QSS A;  1B9D A;  2Z1J A;  5HLF A;  1N5Y A;  3MXM A;  3AVF A;  3HPO A;  3HST B;  2WOM A;  3NH1 A;  4F4K A;  4DTX A;  4KHY A;  2YHA A;  3LP0 A;  2Y1J A;  3ISN C;  1CZB A;  2ZQB A;  2Y1I A;  4KHW A;  3C94 A;  4AHR A;  1BGX T;  2IGI A;  4Y1C A;  4JS4 A;  5JS1 A;  4FVM A;  1LAV A;  3HPG A;  3CM5 A;  4OJR A;  1TAU A;  3HXM A;  5J2P A;  3MEE A;  4CJS A;  4E0D A;  3QES A;  2FBV A;  1BHL A;  3NF6 A;  4JRP A;  2YNH A;  1WSF A;  1RBT A;  3D0P A;  3QEI A;  4FZY A;  3MAQ A;  3LPT A;  1S1W A;  2OPP A;  3O3G A;  3RR7 A;  4BWM A;  3LAL A;  4M42 A;  3DLK A;  2HNY A;  4FJ5 A;  5HRS A;  1RDB A;  1VSM A;  4TSX A;  2W42 A;  1C0U A;  4M3U A;  1IH7 A;  1BI4 A;  3NAE A;  4BDP A;  1IKW A;  3KD5 E;  4J2B A;  3I0S A;  2IC3 A;  3LP3 A;  3F9K A;  1U4B A;  1IKX A;  4BE2 A;  3QEV A;  2AJQ A;  3LWL A;  1D9F A;  2QKB A;  2Z1G A;  4CJP A;  2G8U A;  1XWL A;  4B9M A;  1HMV A;  2HVI A;  3DMJ A;  3DLR A;  1YTA A;  4CF2 A;  3LDS A;  1WSH A;  1L5U A;  1B9F A;  4FW1 A;  3ITH A;  4DFK A;  3OYB A;  3O3F A;  4WE1 A;  3SUN A;  4DQI A;  4DSK A;  1BCM A;  1LAW A;  4FJG A;  2DFE A;  2HMI A;  4E7I A;  3AO1 A;  4JS5 A;  1TL1 A;  2GBZ A;  1D8Y A;  4J2D A;  2OPQ A;  1TKZ A;  4OVL A;  1NKC A;  5DK5 A;  1W0H A;  4NCB A;  1RIL A;  1X1P A;  4KFB A;  4HUE A;  4DTU A;  4O5B A;  3L2Q A;  4FK4 A;  4FXD A;  3HP9 A;  4W5T A;  2G8I A;  1XC9 A;  1HQU A;  3TI0 A;  4FJ8 A;  3KLH A;  4CJL A;  4B9S A;  3AO2 A;  3S3O A;  2D5R A;  4W5R A;  3ZT4 A; 
#chains in the Genus database with same CATH topology
 3AO5 A;  1KTQ A;  4DV1 K;  5I9E B;  4FZX C;  4NLB A;  3O4W A;  2IDO A;  3TAF A;  1RTJ A;  3CCL N;  4MFB A;  3DOK A;  3TAP A;  5M1Q A;  4BVP A;  4H0V B;  2ZJQ L;  3I55 N;  3VQA A;  4M3T A;  5C24 A;  3WQT A;  1BO5 O;  4JI8 K;  4JKB A;  4H8K A;  4JI6 K;  3O9T A;  2O8D B;  1JCE A;  4I6M A;  2HBL A;  2QXF A;  4O0I A;  4FLX A;  4EP4 A;  1BA1 A;  4CJQ A;  1NJW A;  2LSN A;  2Z1H A;  1XMO K;  3LL3 A;  4LF7 K;  3M8R A;  2HHW A;  2O8C A;  5AQI A;  5AQW A;  4EHT A;  1HX1 A;  1LOT B;  1VQ6 N;  1GLE G;  4BRD A;  2OTL N;  1ZYQ A;  1NGC A;  3ALY A;  2YNI A;  5E26 A;  1WN7 A;  1WBD A;  1FW6 A;  2GV9 A;  3SI6 A;  3T3F A;  3ZSO A;  3MN6 A;  3V9X A;  2VQF K;  1KVB A;  1J5O A;  3VGL A;  4K8Z A;  4G1Q A;  4ELU A;  4BRN A;  3WNE A;  2B5J A;  3NFA A;  1IKV A;  3ZT1 A;  4CJV A;  2HND A;  2Q0U A;  1KAY A;  2QM1 A;  4FK2 A;  3WUH A;  3OYG A;  4DQS A;  2QEX N;  1K6Y A;  2NRZ A;  3THX B;  5C25 A;  3CER A;  3ENB A;  3QBW A;  1E4G T;  2P5O A;  3RR8 A;  2R7Y A;  4I9Q A;  1NMD A;  4DF8 A;  2JLE A;  3LZI A;  1ITG A;  4JN4 A;  4KH6 A;  3PO5 A;  3DRR A;  5LY3 A;  2Q36 A;  3KLF A;  1D4X A;  4WQ4 C;  3DLL L;  5KI6 A;  4CEF A;  1HJO A;  1LWE A;  4Q0B A;  2P9K B;  3VET A;  5A2Q O;  4A59 A;  1VQK N;  3NE6 A;  3EZW A;  3W0L A;  2DY4 A;  1DLO A;  5LMU K;  2P9I B;  3OYC A;  3AVC A;  4C8N A;  3O1B A;  4Z4I A;  3G71 N;  3HOS A;  1UOC A;  4B1U B;  1VRT A;  1YTU A;  1JCG A;  2HB5 A;  4JKH A;  3ZSV A;  2KFZ A;  3C6H A;  4W5N A;  5FPD A;  4AM7 A;  1T3V A;  3TAR A;  1RDD A;  4JKC A;  1NBW A;  3LAK A;  1ATN A;  2KLA A;  1JXB A;  3VQ4 A;  2E2P A;  1I94 K;  1HKG A;  4HCC A;  2FF3 B;  1KAX A;  3A5M C;  3PIP L;  2F8T A;  3NCI A;  4GNI A;  3LP2 A;  2BUP A;  3EZ5 A;  5AQH A;  4FWK A;  5AR0 A;  1NK9 A;  4C8K A;  2F9W A;  4FJN A;  1RBS A;  4FLU A;  1S1V A;  1YXQ A;  1RCH A;  2HHV A;  3BP8 A;  4CJ5 A;  3PUF A;  4DR7 K;  1OH6 A;  1I39 A;  1NJZ A;  3C0B A;  2NRW A;  1TKT A;  1SL2 A;  1C0G A;  2Q1N A;  5CZ1 A;  3H3N O;  2FBT A;  4NYF A;  5GAG P;  4DR3 K;  3A5O C;  4DLE A;  3HZ6 A;  3CD6 N;  4PUO A;  3LDQ A;  3PY8 A;  2VCP A;  4WFA L;  3VOV A;  1BIZ A;  1VSL A;  3SV4 A;  1S5J A;  4QS9 A;  1DKG D;  2YHB A;  1SUQ A;  1NGI A;  4CF1 A;  4CGG A;  4BRO A;  4CZE A;  1NJI O;  2ASP A;  1SKS A;  1NK8 A;  4FJI A;  3WXK A;  3ATV A;  2HHQ A;  3M8Q A;  3QIC A;  1WUA A;  4DF4 A;  2G8F A;  2UUC K;  4ELT A;  2KTQ A;  3DXK B;  1S72 N;  1TYQ A;  1BL3 A;  4IEE A;  3MN5 A;  3ID8 A;  4RW4 A;  2HF4 A;  2KZZ A;  1HJR A;  4FWN A;  3TAG A;  1QHT A;  3SQ2 A;  2KZM A;  5E41 A;  3VGM A;  4M45 A;  2O8B A;  2ZJP L;  3O8M A;  4GVE A;  3K5N A;  4FPA A;  2P1J A;  4BE1 A;  3G25 A;  4FW2 A;  4BQZ A;  3CYM A;  4PA1 A;  1KLN A;  1QQC A;  4YDU A;  5FPN A;  3HK2 A;  3NF7 A;  3ZET A;  4M3Y A;  1U2V B;  5DMR A;  3ZX3 A;  3ATU A;  3LPU A;  4C8O A;  3EY1 A;  1Q9X A;  1EP4 A;  4GKK K;  4EP5 A;  1S6P A;  4YY3 K;  2RE2 A;  3BUZ B;  3E9L A;  2VWB A;  4AHC A;  3VQ9 A;  4PKI A;  3ULE B;  4AM6 A;  4CW7 B;  4DSF A;  3SCX A;  1TUY A;  2D0O A;  1CZ9 A;  4H5V A;  3VQ6 A;  4OPK A;  2Q3S A;  1D9D A;  3D2E B;  3HSC A;  3VQE A;  4JI4 K;  3DLE A;  4A62 A;  1QVF M;  1EWQ A;  4DQP A;  1EO1 A;  3OBW A;  3SV3 A;  2BAN A;  3PV8 A;  2CGL A;  4DS4 A;  4M3Z A;  3T7Z A;  3MN7 A;  3OS2 A;  3DYA A;  3OYL A;  2B6A A;  2GUI A;  3O3H A;  1JLE A;  5KGX A;  4U67 L;  3QET A;  2YV0 X;  4CK2 A;  4HTL A;  3TAE A;  4FWP A;  2VWK A;  2F8S A;  3C6A A;  4E89 A;  4CF0 A;  3LM2 A;  4DV4 K;  3A5N C;  1HPZ A;  5AQX A;  2E88 A;  4L8R B;  1CXU A;  1EX4 A;  1ZBS A;  4HUG A;  1S6Q A;  3CF5 L;  5IWA K;  4CE9 A;  2OA8 A;  3G6E N;  5F1X A;  1U49 A;  3CJA A;  3FZF A;  4CEA A;  4GY2 B;  2QWN A;  1QVG M;  4XEI A;  3I0R A;  4IXC A;  4FM1 A;  5AQN A;  3CFR A;  3MXJ A;  3UKR A;  3ULD A;  3QIO A;  4MDA A;  3KHY A;  1KC8 O;  2P9U A;  3OYD A;  4KH5 A;  2UXD K;  3OYN A;  4IFY A;  4CVN E;  3H3O B;  5FRN A;  5CYM A;  1U04 A;  3TR8 A;  4DMN A;  3S9H A;  3J80 O;  1ZBF A;  3GBT A;  3S3N A;  5KQD A;  1LWC A;  4U7B A;  4Z4C A;  4NO7 A;  5F0X A;  4IG3 A;  3HP6 A;  4MLE A;  3BF3 A;  3EN9 A;  3L2W A;  3SPZ A;  1VQ5 N;  3EKU A;  4IEI A;  3DOL A;  3FR0 A;  4Y1D A;  4N76 A;  5J2M A;  3HRG A;  5BRD A;  4FJL A;  1WSG A;  1XHX A;  1NK4 A;  4MLH A;  4CGI A;  3K5M A;  5M1F A;  4YFU A;  1GLF O;  4FSV A;  3SUP A;  3O9S A;  1MA9 B;  4FJX A;  1FKP A;  3V1R A;  4W5O A;  4CEE A;  3OBY A;  5AQG A;  4FWS A;  2Z1J A;  1ILY A;  3VMF B;  2NRV A;  4CBX A;  1KQS M;  2WOM A;  4F4K A;  3VF6 A;  4DTX A;  1X3M A;  2W40 A;  2Y1J A;  1CZB A;  1RFQ A;  4M7X A;  4AHR A;  3C94 A;  3K9J A;  4Y1C A;  2YJF A;  4JS4 A;  3EE9 A;  3C7N A;  3CM5 A;  3HXM A;  5J2P A;  3MEE A;  4CJS A;  4E0D A;  3J7A P;  1BHL A;  2YHW A;  3NF6 A;  2YNH A;  3D0P A;  3MAQ A;  3LPT A;  4DV3 K;  1IBL K;  1E4F T;  1IBM K;  2HNY A;  1C0U A;  4BY9 C;  1BI4 A;  3NAE A;  3MCA B;  5KQ8 A;  2AP1 A;  3QEV A;  2O8F B;  3ZET B;  2QKB A;  1XWL A;  1SZ2 A;  5AQY A;  2AA4 A;  3DMJ A;  3LDS A;  5BPN A;  1WB9 A;  3SUN A;  2IVO A;  4IDH A;  2P9I A;  3L6Q A;  5BN8 A;  1VQO N;  5GIP A;  4JS5 A;  3WEE B;  2QI2 A;  4NCB A;  4DTU A;  2UUA K;  1HUX A;  3L2Q A;  5MLC Q;  3ZLJ A;  4W5T A;  2G8I A;  1IJJ A;  1Q18 A;  4ISF A;  4B9S A;  5M1K A;  1NGE A;  2O8C B;  2XY5 A;  1JLQ A;  3AVN A;  4E7J A;  3ZT0 A;  4DTN A;  1T6C A;  3CM6 A;  3MMV A;  1C1C A;  3TPQ A;  4KI6 A;  4XIU A;  4CHN A;  4X66 K;  4DSI A;  3QNN A;  3SJJ A;  1SL0 A;  5EVZ A;  4DFM A;  3J7Y P;  2EHG A;  4JKD A;  1HRH A;  1T7P A;  1HYV A;  2DFF A;  3L4I A;  4DTJ A;  1VQP N;  5FPM A;  3U3Y A;  3R3L A;  3CCS N;  3RMB A;  3GE1 A;  4CJU A;  1NGG A;  3ENO A;  4JD2 B;  4HTU A;  3E9O A;  4BRF A;  3OTO K;  2IAJ A;  2G8V A;  4CEZ A;  2FSN A;  4AHU A;  3L2V A;  3L2R A;  3T1H K;  3ASM A;  5K14 A;  4JHD B;  2PY5 A;  3RTV A;  4CHP A;  1X9W A;  3M5R A;  3FE1 A;  1RT4 A;  4NXM K;  3O80 A;  2GEL A;  3CCE N;  3PSI A;  1C0F A;  3C6U A;  2P9S A;  2XY7 A;  3VQ8 A;  4CZK A;  2G8W A;  3QFU A;  1TVR A;  3S41 A;  2A42 A;  4FZZ A;  3TU5 A;  4CIE A;  4K0K K;  4DG1 A;  1T05 A;  3UKU A;  4H5T A;  4DV6 K;  2YKN A;  4DS5 A;  3K58 A;  1C1A A;  4BC5 A;  2FXU A;  4WFN L;  3HJF A;  1BCO A;  5AQO A;  1W7A A;  1XNR K;  4KAZ A;  5AQZ A;  2HHH K;  1RT7 A;  3OS0 A;  3ZSR A;  4YNQ A;  2QK9 A;  3JSM A;  1X3N A;  3AVL A;  4B3T K;  5FRM A;  4IWV A;  1G15 A;  3A5L C;  4K41 A;  5SWM A;  3KKR A;  2VQE K;  3LM9 A;  1DT9 A;  4KV8 A;  5CZ2 A;  4KHN A;  1VHX A;  1GLL O;  2QWQ A;  3KKS A;  1IO2 A;  1MWK A;  1XQS C;  4GKJ K;  3TSU A;  3M8P A;  3FZH A;  4CZI A;  3QLH A;  3A0I X;  1CXQ A;  1YUW A;  3CCR N;  4FLT A;  5CYQ A;  4JAX A;  3CQ8 A;  4QS8 A;  1OVY A;  1RDW X;  1FJG K;  1ASV A;  4A57 A;  4FM0 A;  4KTQ A;  3CJ7 A;  2J4R A;  3C95 A;  3L3U A;  1K9M O;  4C1N K;  3UIQ A;  3LDP A;  3P5J A;  4H4M A;  1S9E A;  5I3U A;  1Q86 O;  1EKE A;  1KAZ A;  2D4W A;  4NB4 A;  1BA0 A;  2QWM A;  4DUY K;  4Z4E A;  3VF4 A;  4H5R A;  4RW6 A;  1SV5 A;  2ZM6 K;  4LFB K;  1LW2 A;  4FO0 A;  4Z4F A;  3IKM A;  1KCF A;  4DTR A;  4OKK A;  2IIR A;  1DGK N;  2X6S A;  3DRP A;  3BGR A;  3DXM A;  2O8F A;  4JI7 K;  1LV5 A;  2E2N A;  3ZSY A;  3IAY A;  1Y97 A;  3HYF A;  2UXC K;  2E8A A;  4BRK A;  4CEC A;  4DFP A;  1NKE A;  1GLB G;  4E1M A;  5AQT A;  5T7B A;  5AZI B;  2W41 A;  1HNW K;  1RTH A;  4DQR A;  1EWR A;  4CJE A;  1T8E A;  2YNF A;  1J54 A;  5KPR A;  2QWL A;  1EQY A;  1YAG A;  4LSN A;  1Z6R A;  3TWH A;  1YIJ N;  3OJU A;  4JK8 A;  4ELV A;  4F3O A;  1SL1 A;  3IDH A;  4YOY A;  1U2V A;  4FJ9 A;  1HLU A;  5KRT A;  4CJ3 A;  3UKR B;  4DU4 A;  2RN2 A;  4CHQ A;  4DV2 K;  3O08 A;  3CET A;  1TL3 A;  1DTQ A;  3V9U A;  4B9L A;  5FPE A;  3P4I A;  5DM6 L;  4FJK A;  4R79 A;  1V4S A;  1K73 O;  4JI3 K;  1REV A;  1TKX A;  2QWO A;  1YJ9 N;  1JCF A;  2FBX A;  3R8E A;  3BY5 A;  5CE3 A;  1JL2 A;  4BR5 A;  4IZ9 A;  4E19 A;  2ITM A;  5M1N A;  4CGJ A;  3CXC M;  4BRG A;  3IG1 A;  1JLF A;  5BPM A;  1F21 A;  3K57 A;  1BIU A;  5C2F A;  1YJW N;  1VK0 A;  2E2Q A;  2P9U B;  2W6L A;  3AVK A;  3R6M A;  3FZK A;  5HRN A;  5D3G A;  2ETJ A;  4WFB L;  2CH5 A;  3DXK A;  2FLO A;  1VQ7 N;  3KK7 A;  3TAB A;  3LP1 A;  1ASW A;  2V7Z A;  4KH4 A;  3LWM A;  5GIN A;  4KHU A;  4GVM A;  4GMJ B;  4FLW A;  4BRE A;  1IG8 A;  2D1K A;  5CY4 A;  3VQD A;  1NK0 A;  1JXE A;  3THY B;  3TSP A;  4FLV A;  3KIO A;  3JAM O;  3VA3 A;  5AQF A;  3QO9 A;  3C7N B;  3WXI A;  1OH5 A;  2OZM A;  2X78 A;  4J2A A;  1O1W A;  3WXM B;  3DJC A;  3DRS A;  2I7P A;  2ZGZ A;  4DV0 K;  4DR4 K;  1G99 A;  5AFU A;  3CQX A;  3SUQ A;  3AGR A;  2D0P A;  5J1E A;  2V7Y A;  4LFC K;  2O8D A;  4B8A B;  1ZBH A;  4CEO A;  3OYJ A;  3G4S N;  4ILG B;  3L8B A;  1VSF A;  3GL1 A;  5EU7 A;  3CJC A;  4BGB A;  4JKE A;  3AA4 A;  3NVK A;  5ELZ A;  4CED A;  3OYI A;  1RDC A;  1NK6 A;  4C23 A;  3D2E A;  4XH1 A;  2UU9 K;  2HW3 A;  1Z05 A;  5B8H A;  3PSF A;  1ATR A;  1Q9Y A;  4OO1 J;  3PIO L;  4NXN K;  4FPB A;  1ZBU A;  1IG9 A;  5BR9 A;  2OYQ A;  2UYT A;  4CZG A;  1W97 L;  5LJW A;  4FK0 A;  3NGZ A;  1RT2 A;  5GAD P;  3JXU A;  1TK0 A;  4IFV A;  1P8Z A;  3DM2 A;  3MWP A;  3L3V A;  1TK5 A;  2ASO A;  5HRP A;  2A3Z A;  2XRI A;  3RSE B;  5M1O A;  1OH7 A;  3PX4 A;  1NU0 A;  1QQO A;  4H5W A;  1O13 A;  4J8F A;  3WEE A;  5JMV A;  1XUP O;  3V4I A;  4OGE A;  1RTI A;  3V6D A;  4YOW A;  3D45 A;  3AO4 A;  3VEV A;  2O8E B;  3I8B A;  3HM9 A;  1YIT N;  3VQP A;  2HMP A;  3CIP A;  3LDN A;  3OYM A;  4JKG B;  5GAE P;  4CI6 A;  1UA0 A;  1V4T A;  3CJ9 A;  3T1A A;  1HNX K;  1DTT A;  4A61 A;  2E20 A;  4Z4G A;  4JEP A;  1K8K A;  3I33 A;  1KSP A;  2WTU A;  3WQU A;  2UUB K;  4IFE A;  1NJX A;  1WNS A;  3RRG A;  3ZCM A;  4DR2 K;  1VQL N;  1QQM A;  1QSS A;  2CGK A;  3ULE A;  3AVF A;  4BRP A;  3NH1 A;  4KHY A;  1U6Z A;  2H3G X;  3ISN C;  2Y1I A;  2IGI A;  4FWO A;  3HM8 A;  4FVM A;  1LAV A;  3OW2 M;  1QQN A;  4JRP A;  3SLC A;  4FZY A;  3HI0 A;  3BEX A;  3RR7 A;  4BWM A;  3LAL A;  4M42 A;  2E2O A;  3QFP A;  4CZJ A;  1RDB A;  1RGI A;  4JV5 K;  1XC3 A;  4BDP A;  3KD5 E;  4J2B A;  3I0S A;  1U4B A;  2AJQ A;  3LWL A;  1D9F A;  4CJP A;  4B1X B;  3VEZ A;  2P9P A;  3EE8 A;  3DLR A;  2BTF A;  4JI2 K;  3O3F A;  4DQI A;  1BCM A;  1LAW A;  1OKJ A;  2OAN A;  3CMA N;  2DFE A;  2HMI A;  1M1K O;  3HTV A;  1HR0 K;  4RCH A;  4OVL A;  5DK5 A;  1W0H A;  1RIL A;  4FK4 A;  1HQU A;  2NRH A;  4FJ8 A;  4CJL A;  3AO2 A;  3RMC A;  3ZT4 A;  2PAV A;  4EZ9 A;  4M41 A;  4YOR A;  3IFR A;  3HVT A;  4JKF A;  3ZT2 A;  1LCU A;  4CJK A;  3VEN A;  2IVP A;  3NH2 A;  3V81 A;  4KB1 A;  4OX9 K;  5FLX O;  4KI4 A;  3E1Y A;  4OLA A;  3CJB A;  1X9S A;  5C2D A;  2P9S B;  3NF9 A;  4PY5 A;  1YI2 N;  3NVM A;  1GLJ O;  1W9H A;  4KTZ A;  5FDL A;  5C10 A;  4ISG A;  4K43 A;  3O9R A;  4CHO A;  4N56 A;  3D7E O;  1VSI A;  5KGW A;  2HHX A;  1QS4 A;  3VEW A;  4R5P A;  1DEJ A;  3M6G A;  4E1N A;  1Z26 A;  4EFH A;  3D2F A;  1XI1 A;  3OHR A;  4NLC A;  4E7H A;  2RPI A;  4DLG A;  4FYD A;  3N4P A;  4LY7 A;  4F8R A;  4DSJ A;  5LMN K;  4KHQ A;  1EXQ A;  1P90 A;  4CCH A;  3U3G A;  3DAW A;  1NKB A;  3HPH A;  4ICL A;  5AQR A;  4BVO A;  1SAZ A;  2YHX A;  3U9D A;  5DM7 L;  5JVG L;  2VYP A;  3GDQ A;  3G0Z A;  1S9G A;  1ASU A;  2YJE A;  3NH0 A;  4MO5 A;  4WQ4 A;  5ADX H;  1WLJ A;  1TKD A;  1ZC6 A;  2X74 A;  4JRQ A;  5HBM A;  4DKW A;  4PWD A;  1QZ6 A;  3AGK A;  3WNH A;  3VF2 A;  2NRX A;  3W3D A;  2VG7 A;  2ASM A;  4AH9 A;  3VQ5 A;  1BG3 A;  1TK8 A;  4EZ6 A;  4BRQ A;  4CGD A;  3KD1 E;  3LAN A;  4CK3 A;  3HO1 A;  4CD3 A;  1RBR A;  3EYZ A;  5I42 A;  2A41 A;  2E5L K;  3BDP A;  4B8C A;  1VQM N;  3E9P A;  4CGH A;  4K25 A;  2IS3 A;  4B9V A;  3V9S A;  5AQK A;  4MQ3 A;  4DR5 K;  2A1R A;  3ZSW A;  1QZ5 A;  1WAJ A;  3J7Z O;  5GIO A;  2XY6 A;  3C65 A;  1UAX A;  1QSL A;  2PYL A;  4OPJ A;  1X9M A;  3P31 A;  1BI4 B;  3QIP A;  2E4L A;  4CZF A;  3QEW A;  3N4Q A;  4JNE A;  2E6L A;  2IOC A;  4DV5 K;  5LJV A;  3CJ1 A;  4BC3 A;  2ATQ A;  1K8K B;  3B6O A;  3K2P A;  4FCY A;  3KZB A;  1RDA A;  5AFU H;  4I7F A;  3DXM B;  1N8R O;  4OLB A;  2UXB K;  3AAP A;  5JLF A;  5HP1 A;  4DHY A;  4Z4H A;  3SQ4 A;  1ZBL A;  4Z0U A;  3AAR A;  3KWG A;  4CFC A;  2YHY A;  3O9Q A;  1Q7Y O;  4M3W A;  4JD2 A;  3JYT A;  1U45 A;  3P39 A;  2DPN A;  3MDQ A;  1T6D A;  1L3S A;  3K5O A;  4JLH A;  2NNW A;  3AA3 A;  4G9Z A;  4RW9 A;  3H1V X;  2P9L B;  3AVM A;  4H03 B;  3KWI A;  4EHU A;  1SQK A;  3EKS A;  4PQU A;  2WUS A;  4JHD A;  4FJ7 A;  3NBP A;  5AQV A;  4DFJ A;  5BN9 A;  1OH8 A;  5AZJ A;  4F2R A;  2NUB A;  1RBV A;  1LWF A;  2F4V K;  2QTD A;  3CCM N;  2XHB A;  4DTO A;  4KB0 A;  4JI1 K;  3HT3 A;  1NJY A;  4F3T A;  1JLC A;  3AA2 A;  4DU3 A;  1R59 O;  4O0J A;  5HRR A;  4DSL A;  1LW0 A;  3V9Z A;  1IBK K;  2P5G A;  1BUP A;  4NCG A;  3SAF A;  1R0A A;  4LF9 K;  1D5A A;  2OZS A;  4FWQ A;  4IJA A;  3THW A;  1VSE A;  2HOE A;  3BZC A;  2PYJ A;  2YX6 A;  2GWK A;  3R9P A;  2HBK A;  4LD0 A;  5JS2 A;  5AQU A;  1I3A A;  1WSE A;  3WNG A;  4OKJ A;  4NYN A;  4KRE A;  2V51 B;  4JK9 A;  2VGM A;  2HHU A;  1KXP A;  3ZSQ A;  4CF8 A;  1H1V A;  3CG7 A;  3S3M A;  3GOI A;  2XY8 A;  4FVU A;  4O8K A;  3TTD A;  1WSI A;  2JWK A;  4BR9 A;  3UE5 A;  1S1X A;  4PL7 A;  3KK1 A;  4FWL A;  1FK9 A;  4M7Y A;  4CJW A;  1Z25 A;  3O5B A;  1N6Q A;  2NRT A;  4CFB A;  3AVB A;  4B08 A;  2ZWH A;  4O4G A;  4H0T B;  4BRI A;  3VEY A;  3MXI A;  4WCE L;  4JYA K;  4EIA A;  3NF8 A;  4CJ4 A;  1HKB A;  1XHZ A;  2OPS A;  1N32 K;  1SS6 A;  2NLX A;  3V1Q A;  3OVN A;  2GWJ A;  4IBN A;  4A2B A;  3VQC A;  3KLG A;  4QCL A;  1A5X A;  4UQG A;  1L3T A;  4A2A A;  1C0T A;  1VSH A;  3U4L A;  3O4N A;  4AHS A;  1ATS A;  2Q2R A;  4FOI A;  3VTI A;  2Z1I A;  2QWR A;  1U47 A;  5BPL A;  2FC0 A;  3TTC A;  4ISE A;  3TTF A;  5JLH A;  3VA0 A;  3NGY A;  3ENH A;  1KFS A;  1HQE A;  1HNI A;  4ZHR A;  1NGJ A;  2O8E A;  2RHK A;  1W2B M;  4EAH D;  4N5S A;  3OYE A;  4ILH A;  3C6T A;  3Q7C A;  5HL7 L;  4FOE A;  4CJR A;  4BG9 A;  2YCH A;  3SBT A;  3MX2 A;  4FJJ A;  1MDU B;  5BR8 K;  4LC9 B;  2IVN A;  3V9W A;  2A6A A;  2EX3 A;  4DB3 A;  4DQQ A;  4J2E A;  5TKW A;  1NK7 A;  3TAQ A;  2FSK A;  3KK2 A;  2BGG A;  3LZJ A;  4UY8 O;  1CZA N;  1YVN A;  3CHW A;  3RWU A;  3ZSX A;  1YVU A;  1RT6 A;  4QS7 A;  3VGK A;  2W6K A;  1K8A O;  3HOT A;  4O44 A;  2D0A A;  3THV A;  4I9L A;  3H08 A;  1YF5 L;  3CCV N;  4V19 S;  3IS9 A;  4OGC A;  3VQ7 A;  3AVA A;  2ZE2 A;  3SBG A;  3QBX A;  3LDO A;  4DR6 K;  4B1V A;  3CFO A;  1JLG A;  4M63 C;  2X6N A;  4LF5 K;  2GX9 A;  3U8X A;  1Y64 A;  4L3Q A;  1J6Z A;  1BQN A;  4O55 A;  4YOX A;  4DU1 A;  3T1Y K;  2P9L A;  4BRC A;  3ZEU B;  4H0X B;  1M90 O;  1IV0 A;  4K8X A;  3RMD A;  1YJN N;  5BRF A;  3UKU B;  4IJN A;  3R1X A;  1BQM A;  2BDP A;  2NRR A;  3QDK A;  4YOU A;  3SMP A;  3MK6 A;  3U6F A;  3VQQ A;  4IO8 A;  3CI5 A;  4FJM A;  3OYH A;  3KLI A;  1HNV A;  5LL6 Z;  3VEO A;  4X65 K;  5JVH L;  3FFK B;  4BR7 A;  4BAC A;  3PO4 A;  2ZD1 A;  4MO4 A;  3FLC O;  1WAF A;  2G8K A;  1C1B A;  4CJT A;  2RF2 A;  3TAM A;  4PL8 A;  3AO3 A;  3H46 O;  3ZX0 A;  3FZL A;  4FWR A;  3OYK A;  3T19 A;  1S1T A;  1WOQ A;  3P1G A;  3CPW M;  4Y0W A;  3O6W A;  2HBJ A;  1Q8I A;  1N36 K;  3IRX A;  2O4G A;  3THY A;  3HPO A;  3HST B;  3DWL A;  1NGD A;  4OPH A;  3J8A A;  3LP0 A;  2ZQB A;  4XH5 A;  4KHW A;  2PBD A;  4OJR A;  1TAU A;  3T69 A;  1WSF A;  1RBT A;  3I56 N;  2OPP A;  3O3G A;  3M1F A;  3QML A;  4FJ5 A;  4IOA L;  4TSX A;  2E1Y A;  3AY9 A;  4M3U A;  5H1S Q;  1IH7 A;  3VER A;  4LF8 K;  1N33 K;  3LP3 A;  3F9K A;  1IKX A;  4BE2 A;  3CPE A;  3ZX2 A;  2Z1G A;  4B9M A;  4Z94 A;  2HVI A;  1YTA A;  3RSE A;  1L5U A;  1ZXO A;  4FW1 A;  3ITH A;  4K42 A;  3OYB A;  4DSK A;  4FJG A;  5TKY A;  3THX A;  5AZI A;  2ZGY A;  3AO1 A;  1GLD G;  1TL1 A;  2GBZ A;  4J2D A;  2OPQ A;  5HOO A;  5AQJ A;  4BG8 A;  1NKC A;  1X1P A;  4HUE A;  4FXD A;  2I7N A;  2CGJ A;  3TI0 A;  4NCA A;  4RWT A;  3KVG A;  1NWK A;  4BQL A;  4GW6 A;  2OCE A;  3QB0 A;  4DSE A;  4B1Z A;  3WNF A;  4BR0 A;  3F73 A;  4YOV A;  1WBB A;  1KRP A;  1NGH A;  1VSJ A;  4M3R A;  1A5V A;  4B3R K;  4BR4 A;  1ZBI A;  5AQL A;  3WXJ A;  1J9A A;  5CR4 A;  4Q5V A;  1SKW A;  1KLM A;  4GV9 A;  1KVA A;  2WC9 A;  5EY4 A;  4KBO A;  4DWI A;  3OYA A;  4ILJ A;  3L4Q A;  4CZH A;  3CQY A;  4LH4 A;  4BRL A;  4E3S A;  4CHZ A;  4B3M K;  3O9U A;  3SK3 A;  2E1Z A;  3AVJ A;  2V52 B;  1CLQ A;  2NZT A;  4E7K A;  1QE1 A;  4KHP K;  3QEP A;  4AHV A;  3MEC A;  3VN5 A;  3QIN A;  2P9N A;  4JKG A;  3ID6 A;  3A8Y A;  2YI1 A;  4LH5 A;  5JIC A;  4IKF A;  4LF6 K;  4BWJ A;  4DQ8 A;  1L3U A;  3VPZ A;  1YT3 A;  2EWS A;  3SAH A;  3DI6 A;  5AZJ B;  1E3M A;  4PHT X;  3B8A X;  3E66 A;  1NLV A;  4AQY K;  1UA1 A;  3VQB A;  3H45 C;  5FRO A;  1NOY A;  1VAZ A;  2YKM A;  2P51 A;  3F2K A;  1NGA A;  4KO0 A;  4BC2 A;  3IMX A;  3ZSZ A;  2P9P B;  1VSK A;  3L0Q A;  4HVJ A;  1NGF A;  3TAN A;  3LAM A;  4KHS A;  4RW7 A;  2HST A;  3FZM A;  2JWL A;  4CZL A;  4AF1 A;  5KPT A;  3SAG A;  3KTQ A;  4HUF A;  4CFD A;  1S22 A;  4N41 A;  1QTM A;  2DTU A;  4PKH A;  2QW9 A;  5M1P A;  3HVR A;  3DLB A;  4BR2 A;  2PFU A;  2WON A;  1C6V A;  3E01 A;  1Q81 O;  3SUO A;  3SQ1 A;  3Q7B A;  1GOC A;  3EL2 A;  4FJH A;  1GOB A;  2D0B A;  3QEX A;  3NDK A;  4HHT A;  4CFA A;  4B1W B;  1XMQ K;  3O1W A;  4BRH A;  3NHG A;  3GG4 A;  4GV3 A;  5GAH P;  2GUP A;  3CFP A;  4BE0 A;  3L2U A;  2O4I A;  4JKA A;  4FWM A;  1RT5 A;  4RG8 A;  1U48 A;  3AVH A;  4ZTJ A;  3PLA A;  2KKZ A;  4KKO A;  4O8U A;  4DUZ K;  4CEB A;  3OJS A;  2HVH A;  2F9T A;  2OTJ N;  4H0P A;  4I6M B;  3D6R A;  3LDL A;  3RMA A;  3AVI A;  3RRH A;  4AIL C;  2PZS A;  1TV6 A;  4CBU A;  1JLA A;  4FM2 A;  3MEG A;  1ESV A;  1BOT O;  2VGN A;  5F2R A;  4A5A A;  1RNH A;  2OPR A;  5HRO A;  3V1O A;  4FL9 A;  2A5X A;  3CCU N;  1S3X A;  2B4J A;  1TUU A;  4C8L A;  2HHS A;  2A40 A;  2F96 A;  4CZM A;  3WXL A;  1VRU A;  3H6E A;  2DFH A;  4CEQ A;  4CD1 A;  2I5J A;  4RW8 A;  1RTD A;  3ZYY X;  2RKI A;  4CJ7 A;  1JLB A;  4C1N I;  4DCH A;  4H0Y B;  1XNQ K;  1S1U A;  3CC2 N;  3QER A;  1Q82 O;  3G10 A;  1TAQ A;  2YNG A;  4CIF A;  5BRE A;  1TGO A;  2E6M A;  3K59 A;  3A2F A;  2HF3 A;  3I8D A;  2VG5 A;  3CCQ N;  4KRF A;  4QAG A;  3CC7 N;  1HYZ A;  4DTM A;  1HKC A;  2FBY A;  4WYB A;  4YHH K;  1HYS A;  4MDB A;  3OA9 A;  3J81 O;  4B9T A;  4WQ5 C;  3M8S A;  5J2N A;  5C42 A;  4A5B A;  3AA5 X;  2BE2 A;  4WQ5 A;  5C15 A;  3KJV A;  3MN9 A;  4QOZ B;  4H5N A;  1NOZ A;  1NGB A;  4CHY A;  1JJ2 M;  3O4Q A;  3DLH A;  4OPA A;  3SYZ A;  4KTW A;  3M3Z A;  4AHT A;  2HHT A;  3SMS A;  4RTF D;  1VQ4 N;  4B9N A;  1NNE A;  4I2P A;  2KW4 A;  5E84 A;  3AVG A;  4CBW A;  2P9N B;  2VWJ A;  1VQN N;  3P38 A;  1GOA A;  1QSY A;  1RBU A;  5EXW A;  2XO7 A;  1KFD A;  3JS6 A;  2A1S A;  3KLE A;  3K0S A;  2P9K A;  1B92 A;  1HNZ K;  2D0C A;  3OYF A;  3K5L A;  4BC4 A;  5KRS A;  5IT9 O;  3SZ2 A;  2FF6 A;  2F7T A;  1MWM A;  3EO3 A;  3UB5 A;  1JL1 A;  1J53 A;  1UWB A;  3ZT3 A;  3KK3 A;  5AQQ A;  1JKH A;  4IG0 A;  1GLC G;  5EX5 A;  3VES A;  4CES A;  4BRA A;  4F2S A;  4E1J A;  1BWF O;  3MED A;  4B3S K;  1MU2 A;  1EET A;  2O8B B;  4XH4 A;  3CME N;  4B3O A;  3HBT A;  4ZTF A;  4H4O A;  3K9K A;  3QNO A;  4E7L A;  5J2Q A;  1NM1 A;  4JI5 K;  3B6P A;  1BIS A;  3HL8 A;  2JGU A;  4IO9 L;  3SPY A;  1T03 A;  4DTP A;  4X64 K;  3MWT A;  2Q31 A;  3SQ0 A;  2Q0R A;  1L3V A;  4YDU C;  3D2F B;  1RT1 A;  1FKO A;  3H1Q A;  4CIG A;  2G8H A;  4DTS A;  3WT0 A;  2QXL A;  3THW B;  1GLA G;  3P83 D;  4BRM A;  4KPY A;  5C12 A;  1T44 A;  2QWP A;  4BDZ A;  3AAQ A;  1C0M A;  1BDG A;  1KVC A;  5AQM A;  4ID5 A;  5AJ3 K;  2Q97 A;  4B9U A;  2KQ2 A;  4LFA K;  1N34 K;  4IOC L;  5SZT A;  4JK7 A;  1VSD A;  1NK5 A;  4LF4 K;  2FSJ A;  4I2Q A;  5KTQ A;  4WF9 L;  3OY9 A;  4IDK A;  3CCJ N;  3SJH A;  2WFB A;  3CC4 N;  4M3X A;  3VTH A;  3DLG A;  3NGI A;  3MCP A;  2QA4 N;  1TYQ B;  1OVQ A;  4CK1 A;  2HNZ A;  5AQP A;  2CH6 A;  4BGA A;  4FLZ A;  4FLY A;  2ITG A;  3U9Z A;  3AV9 A;  2WBN A;  1IKY A;  1FXX A;  1RT3 A;  4YOT A;  4CER A;  1QHA A;  3FGU A;  3FFI A;  4LSL A;  3SNN A;  3PX0 A;  2KFN A;  1WSJ A;  3PX6 A;  1BU6 O;  1SKR A;  3BZK A;  4ID1 A;  4GV6 A;  5ADX A;  4C8M A;  4W5Q A;  2QKK A;  4PKG A;  1A5W A;  3ZEU A;  2VG6 A;  4OKE A;  4BDY A;  1NMN A;  1X9J A;  5AQS A;  4DV7 K;  3OS1 A;  2KHO A;  1RDU A;  4CGF A;  4HCB A;  4N47 A;  4CJF A;  4CF9 A;  1B9D A;  2HBM A;  4B9Q A;  5HLF A;  1N5Y A;  3MXM A;  5CHI A;  4O5F A;  1J5E K;  5C0Y A;  2YHA A;  3NMU A;  3F9M A;  1BGX T;  5JS1 A;  3HPG A;  5BRH A;  3QES A;  2FBV A;  3VEX A;  2ZF5 O;  3EEQ A;  3QEI A;  5EOY A;  3MX5 A;  4JI0 K;  1S1W A;  3DLK A;  5HRS A;  2GTD A;  4B1Y B;  1VSM A;  2W42 A;  5KPZ A;  4IOX A;  1IKW A;  2IC3 A;  3F5T A;  3TSQ A;  2G8U A;  4H0O A;  1HMV A;  3IUC A;  1HPM A;  2GEM A;  4X62 K;  4CF2 A;  2ZJR L;  4HWI A;  1WSH A;  1B9F A;  4DFK A;  4WE1 A;  4F9O A;  4E7I A;  1KD1 O;  1NG9 A;  1D8Y A;  1VQ9 N;  1TKZ A;  3BF1 A;  1YHQ N;  1VQ8 N;  4KFB A;  4O5B A;  2BH1 A;  3HP9 A;  1XC9 A;  3KLH A;  4DR1 K;  3S3O A;  3RVC A;  2D5R A;  4W5R A; 
#chains in the Genus database with same CATH homology
 3AO5 A;  4EZ9 A;  2XY5 A;  1KTQ A;  4GW6 A;  4M41 A;  4FZX C;  1JLQ A;  4DSE A;  3HVT A;  3WNF A;  3ZT2 A;  3AVN A;  2IDO A;  4CJK A;  3F73 A;  4E7J A;  3ZT0 A;  4DTN A;  3TAF A;  1KRP A;  3CM6 A;  4KI6 A;  1C1C A;  3NH2 A;  3V81 A;  1VSJ A;  4KB1 A;  1RTJ A;  4M3R A;  4CHN A;  4XIU A;  4MFB A;  3DOK A;  1A5V A;  4DSI A;  4KI4 A;  4OLA A;  1X9S A;  1ZBI A;  3QNN A;  1SKW A;  4Q5V A;  1J9A A;  3TAP A;  3NF9 A;  3SJJ A;  4PY5 A;  1SL0 A;  1KLM A;  1KVA A;  1W9H A;  4DWI A;  4KTZ A;  5FDL A;  3OYA A;  3VQA A;  4DFM A;  4CHO A;  4N56 A;  4M3T A;  5C24 A;  1VSI A;  4LH4 A;  2EHG A;  1QS4 A;  5KGW A;  4R5P A;  4CHZ A;  4E3S A;  2HHX A;  4H8K A;  1HRH A;  4E1N A;  1Z26 A;  1T7P A;  1HYV A;  2DFF A;  1XI1 A;  4DTJ A;  4E7H A;  3U3Y A;  2RPI A;  2QXF A;  4DLG A;  3AVJ A;  4FYD A;  4O0I A;  4FLX A;  4EP4 A;  3RMB A;  4LY7 A;  4CJU A;  1CLQ A;  4F8R A;  4E7K A;  4CJQ A;  1QE1 A;  4HTU A;  1NJW A;  2LSN A;  2IAJ A;  2Z1H A;  2G8V A;  4DSJ A;  3QEP A;  4AHV A;  1EXQ A;  3MEC A;  3QIN A;  3VN5 A;  3M8R A;  3U3G A;  4CEZ A;  4AHU A;  3L2V A;  4CCH A;  2HHW A;  1NKB A;  4LH5 A;  3HPH A;  3L2R A;  4IKF A;  4BWJ A;  3ASM A;  4ICL A;  1L3U A;  5K14 A;  2PY5 A;  3RTV A;  4CHP A;  1X9W A;  1ZYQ A;  1YT3 A;  3G0Z A;  3ALY A;  2YNI A;  3DI6 A;  1RT4 A;  1S9G A;  1ASU A;  1WN7 A;  3C6U A;  2GV9 A;  3NH0 A;  3SI6 A;  1WLJ A;  2XY7 A;  3VQ8 A;  3T3F A;  1TKD A;  3ZSO A;  1UA1 A;  2X74 A;  4JRQ A;  3V9X A;  3VQB A;  2G8W A;  5FRO A;  1NOY A;  1KVB A;  1TVR A;  5HBM A;  4PWD A;  2YKM A;  1J5O A;  2P51 A;  4K8Z A;  4G1Q A;  3WNH A;  4ELU A;  3WNE A;  4KO0 A;  2B5J A;  4FZZ A;  3NFA A;  2VG7 A;  4CIE A;  3ZSZ A;  1IKV A;  4AH9 A;  3VQ5 A;  1VSK A;  3ZT1 A;  4CJV A;  2HND A;  4DG1 A;  1T05 A;  1TK8 A;  4HVJ A;  4EZ6 A;  4CGD A;  3TAN A;  3LAM A;  4KHS A;  4RW7 A;  3LAN A;  4CK3 A;  2YKN A;  3KD1 E;  4FK2 A;  3HO1 A;  4DS5 A;  3OYG A;  3K58 A;  1RBR A;  1C1A A;  3EYZ A;  4DQS A;  5I42 A;  3HJF A;  1K6Y A;  1BCO A;  3BDP A;  4B8C A;  4KAZ A;  3KTQ A;  4CGH A;  5C25 A;  1RT7 A;  4B9V A;  2IS3 A;  3OS0 A;  4HUF A;  3ZSR A;  3V9S A;  4MQ3 A;  4YNQ A;  4CFD A;  2A1R A;  2P5O A;  3JSM A;  3ZSW A;  3AVL A;  4N41 A;  5FRM A;  2QK9 A;  1WAJ A;  1QTM A;  2DTU A;  3RR8 A;  2R7Y A;  2XY6 A;  1G15 A;  1UAX A;  3HVR A;  1QSL A;  4OPJ A;  2PYL A;  3DLB A;  1X9M A;  4I9Q A;  5SWM A;  2WON A;  4DF8 A;  2JLE A;  3KKR A;  1BI4 B;  1C6V A;  3E01 A;  3LZI A;  1ITG A;  3QIP A;  3SUO A;  3SQ1 A;  2E4L A;  3PO5 A;  3DRR A;  4KV8 A;  5CZ2 A;  1GOC A;  3KLF A;  4FJH A;  4KHN A;  1GOB A;  2D0B A;  3QEW A;  3QEX A;  3KKS A;  5KI6 A;  4CEF A;  1IO2 A;  2E6L A;  2IOC A;  4CFA A;  3NDK A;  1LWE A;  4HHT A;  4Q0B A;  3NHG A;  2ATQ A;  3NE6 A;  3B6O A;  3K2P A;  4FCY A;  3M8P A;  3CFP A;  2DY4 A;  1DLO A;  1RDA A;  4I7F A;  3L2U A;  3QLH A;  4BE0 A;  1CXQ A;  2O4I A;  3OYC A;  3AVC A;  1RT5 A;  4RG8 A;  4C8N A;  4FLT A;  5CYQ A;  4OLB A;  1U48 A;  4Z4I A;  5HP1 A;  3AVH A;  4ZTJ A;  3CQ8 A;  1UOC A;  4KKO A;  4Z4H A;  1VRT A;  1YTU A;  2HB5 A;  3SQ4 A;  4CEB A;  3OJS A;  2HVH A;  3ZSV A;  2KFZ A;  4W5N A;  1ZBL A;  1ASV A;  4Z0U A;  3RMA A;  3AVI A;  4CFC A;  3RRH A;  4AIL C;  4FM0 A;  4M3W A;  2PZS A;  4KTQ A;  3JYT A;  3TAR A;  1U45 A;  1RDD A;  3C95 A;  3L3U A;  1TV6 A;  3LAK A;  3UIQ A;  1L3S A;  1JLA A;  3K5O A;  1JXB A;  3P5J A;  3AA3 A;  4H4M A;  4JLH A;  3VQ4 A;  1S9E A;  5I3U A;  4HCC A;  4FM2 A;  1EKE A;  3MEG A;  4RW9 A;  4Z4E A;  2F8T A;  3AVM A;  4RW6 A;  1SV5 A;  3NCI A;  4PQU A;  1LW2 A;  3LP2 A;  4FJ7 A;  4Z4F A;  1RNH A;  2OPR A;  3NBP A;  5HRO A;  1KCF A;  4DTR A;  4OKK A;  3V1O A;  4DFJ A;  3EZ5 A;  2B4J A;  4C8L A;  1NK9 A;  2HHS A;  4F2R A;  2NUB A;  2F96 A;  4C8K A;  4FJN A;  2X6S A;  1RBV A;  3BGR A;  1RBS A;  1LWF A;  1S1V A;  3DRP A;  4FLU A;  2XHB A;  1VRU A;  4DTO A;  1LV5 A;  3ZSY A;  3IAY A;  4KB0 A;  1Y97 A;  1RCH A;  2HHV A;  2DFH A;  3HYF A;  4CJ5 A;  4CEQ A;  3HT3 A;  1NJY A;  4F3T A;  2I5J A;  1JLC A;  3AA2 A;  3PUF A;  4RW8 A;  4DU3 A;  1I39 A;  4CEC A;  4O0J A;  5HRR A;  4DFP A;  1NJZ A;  1RTD A;  4DSL A;  1LW0 A;  3V9Z A;  2RKI A;  4E1M A;  1NKE A;  1TKT A;  2P5G A;  4NCG A;  1R0A A;  1JLB A;  1SL2 A;  1D5A A;  5T7B A;  5CZ1 A;  2OZS A;  1S1U A;  2FBT A;  4NYF A;  3QER A;  1RTH A;  1VSE A;  4DQR A;  3G10 A;  2PYJ A;  1TAQ A;  2YNG A;  4DLE A;  4CIF A;  4PUO A;  4LD0 A;  1TGO A;  4CJE A;  1T8E A;  2YNF A;  3PY8 A;  1J54 A;  5JS2 A;  1I3A A;  1WSE A;  1BIZ A;  4LSN A;  1VSL A;  4OKJ A;  3WNG A;  4NYN A;  3SV4 A;  4KRE A;  2HHU A;  1S5J A;  2E6M A;  3TWH A;  3K59 A;  3A2F A;  2YHB A;  1SUQ A;  4CF1 A;  3ZSQ A;  4CGG A;  3I8D A;  2VG5 A;  3OJU A;  4CF8 A;  4KRF A;  4ELV A;  4QAG A;  4F3O A;  1SL1 A;  1HYZ A;  3CG7 A;  3S3M A;  4DTM A;  1SKS A;  2FBY A;  2XY8 A;  1NK8 A;  4FJI A;  2HHQ A;  1WSI A;  4FJ9 A;  1HYS A;  3M8Q A;  1S1X A;  4B9T A;  3KK1 A;  4DF4 A;  2G8F A;  5KRT A;  4ELT A;  3M8S A;  2KTQ A;  4CJ3 A;  1FK9 A;  4DU4 A;  5J2N A;  2RN2 A;  5C42 A;  4CJW A;  1Z25 A;  4CHQ A;  3AA5 X;  2BE2 A;  1BL3 A;  3KJV A;  4QOZ B;  1N6Q A;  1TL3 A;  4CFB A;  1NOZ A;  4CHY A;  1DTQ A;  3AVB A;  3O4Q A;  4B08 A;  3V9U A;  3DLH A;  4RW4 A;  4O4G A;  3SYZ A;  4KTW A;  4B9L A;  2KZZ A;  1HJR A;  4FJK A;  4AHT A;  2HHT A;  3MXI A;  3TAG A;  1QHT A;  1REV A;  1TKX A;  3NF8 A;  4B9N A;  4CJ4 A;  3SQ2 A;  2KZM A;  4I2P A;  1XHZ A;  5E41 A;  2KW4 A;  4M45 A;  2OPS A;  3AVG A;  2FBX A;  3V1Q A;  3K5N A;  2VWJ A;  3OVN A;  1JL2 A;  4IBN A;  1GOA A;  3VQC A;  4E19 A;  2P1J A;  4BE1 A;  3KLG A;  1QSY A;  1RBU A;  4FW2 A;  4QCL A;  1A5X A;  3CYM A;  4UQG A;  2XO7 A;  4PA1 A;  1KFD A;  4CGJ A;  1L3T A;  1QQC A;  1C0T A;  1KLN A;  2A1S A;  1VSH A;  3KLE A;  3HK2 A;  3IG1 A;  1JLF A;  1B92 A;  3NF7 A;  1F21 A;  2D0C A;  3O4N A;  3OYF A;  3K5L A;  3K57 A;  4AHS A;  1BIU A;  4M3Y A;  5KRS A;  5DMR A;  3SZ2 A;  1VK0 A;  3AVK A;  2Z1I A;  3LPU A;  1U47 A;  5HRN A;  4C8O A;  5D3G A;  2FC0 A;  2ETJ A;  3EY1 A;  3VA0 A;  1Q9X A;  1EP4 A;  1JL1 A;  4EP5 A;  3NGY A;  1J53 A;  1UWB A;  3LP1 A;  1ASW A;  1S6P A;  3ZT3 A;  3KK3 A;  3TAB A;  1HQE A;  1HNI A;  1KFS A;  3LWM A;  1JKH A;  4IG0 A;  4ZHR A;  4KHU A;  4GVM A;  4GMJ B;  4CES A;  4FLW A;  4AHC A;  3VQ9 A;  5CY4 A;  3VQD A;  4N5S A;  1NK0 A;  4F2S A;  1JXE A;  3OYE A;  4DSF A;  3SCX A;  4FLV A;  3KIO A;  1CZ9 A;  3MED A;  3VQ6 A;  1MU2 A;  1EET A;  3C6T A;  2Q3S A;  4OPK A;  1D9D A;  3VQE A;  4CJR A;  3VA3 A;  4B3O A;  3QO9 A;  3DLE A;  4ZTF A;  4H4O A;  4FJJ A;  4DQP A;  2OZM A;  3QNO A;  2X78 A;  4J2A A;  4E7L A;  1O1W A;  5J2Q A;  3V9W A;  3DRS A;  3SV3 A;  2EX3 A;  4DQQ A;  4J2E A;  3B6P A;  4KHQ A;  1BIS A;  3HL8 A;  2JGU A;  2BAN A;  3PV8 A;  1NK7 A;  3TAQ A;  4DS4 A;  3KK2 A;  2BGG A;  3LZJ A;  3SUQ A;  4M3Z A;  3SPY A;  1T03 A;  3OS2 A;  3DYA A;  3OYL A;  4DTP A;  5J1E A;  2B6A A;  3RWU A;  3ZSX A;  1YVU A;  2GUI A;  3O3H A;  3SQ0 A;  1JLE A;  5KGX A;  1L3V A;  3QET A;  1RT6 A;  4B8A B;  1ZBH A;  1RT1 A;  2YV0 X;  1FKO A;  4CEO A;  4CK2 A;  4CIG A;  2G8H A;  4DTS A;  3TAE A;  3OYJ A;  2VWK A;  3L8B A;  1VSF A;  2F8S A;  4E89 A;  4O44 A;  5EU7 A;  2D0A A;  3P83 D;  4CF0 A;  3THV A;  3AA4 A;  4KPY A;  4CED A;  4I9L A;  3H08 A;  3OYI A;  3IS9 A;  4OGC A;  4BDZ A;  1HPZ A;  1RDC A;  1NK6 A;  1C0M A;  3VQ7 A;  3AVA A;  1KVC A;  2ZE2 A;  2HW3 A;  4L8R B;  1Q9Y A;  4ID5 A;  3CFO A;  1ZBU A;  1JLG A;  2KQ2 A;  1IG9 A;  4B9U A;  2OYQ A;  1CXU A;  1EX4 A;  5SZT A;  2X6N A;  1VSD A;  4HUG A;  1S6Q A;  1NK5 A;  4CE9 A;  2OA8 A;  4FK0 A;  3NGZ A;  1RT2 A;  1U49 A;  4I2Q A;  1BQN A;  4CEA A;  5KTQ A;  1TK0 A;  4IFV A;  3DM2 A;  4O55 A;  3L3V A;  1TK5 A;  4DU1 A;  3OY9 A;  4IDK A;  4M3X A;  3I0R A;  5HRP A;  2XRI A;  3DLG A;  4FM1 A;  3NGI A;  3CFR A;  4K8X A;  3MXJ A;  3RMD A;  3PX4 A;  3ULD A;  4CK1 A;  3QIO A;  2HNZ A;  3OYD A;  1BQM A;  2BDP A;  3OYN A;  4FLZ A;  2ITG A;  4IFY A;  4FLY A;  3V4I A;  4OGE A;  1RTI A;  3U6F A;  3VQQ A;  3AV9 A;  3V6D A;  5FRN A;  5CYM A;  3D45 A;  1U04 A;  3TR8 A;  4DMN A;  3S9H A;  3OYH A;  4FJM A;  3KLI A;  1HNV A;  3AO4 A;  1ZBF A;  1IKY A;  1FXX A;  3S3N A;  1LWC A;  4Z4C A;  1RT3 A;  4CER A;  4IG3 A;  3HP6 A;  3HM9 A;  3VQP A;  3L2W A;  3SPZ A;  3OYM A;  3DOL A;  3FFI A;  4LSL A;  3SNN A;  4Y1D A;  4BAC A;  2ZD1 A;  3PO4 A;  4N76 A;  5J2M A;  3PX0 A;  3RMC A;  2KFN A;  1WSJ A;  1UA0 A;  4FJL A;  1WSG A;  1XHX A;  3PX6 A;  1NK4 A;  1SKR A;  4CGI A;  4ID1 A;  3K5M A;  1WAF A;  4C8M A;  3T1A A;  4W5Q A;  1DTT A;  2G8K A;  1C1B A;  1A5W A;  2QKK A;  4CJT A;  2RF2 A;  4YFU A;  2VG6 A;  4OKE A;  3TAM A;  3AO3 A;  4Z4G A;  4BDY A;  3SUP A;  1KSP A;  3OYK A;  3T19 A;  1S1T A;  3P1G A;  4FJX A;  1FKP A;  3V1R A;  4W5O A;  4NCA A;  1NJX A;  4CEE A;  3OS1 A;  4CGF A;  1WNS A;  4HCB A;  4N47 A;  4CJF A;  3RRG A;  3ZCM A;  1Q8I A;  3IRX A;  4CF9 A;  2O4G A;  1QSS A;  1B9D A;  2Z1J A;  5HLF A;  1N5Y A;  3MXM A;  3AVF A;  3HPO A;  3HST B;  2WOM A;  3NH1 A;  4F4K A;  4DTX A;  4KHY A;  2YHA A;  3LP0 A;  2Y1J A;  3ISN C;  1CZB A;  2ZQB A;  2Y1I A;  4KHW A;  3C94 A;  4AHR A;  1BGX T;  2IGI A;  4Y1C A;  4JS4 A;  5JS1 A;  4FVM A;  1LAV A;  3HPG A;  3CM5 A;  4OJR A;  1TAU A;  3HXM A;  5J2P A;  3MEE A;  4CJS A;  4E0D A;  3QES A;  2FBV A;  1BHL A;  3NF6 A;  4JRP A;  2YNH A;  1WSF A;  1RBT A;  3D0P A;  3QEI A;  4FZY A;  3MAQ A;  3LPT A;  1S1W A;  2OPP A;  3O3G A;  3RR7 A;  4BWM A;  3LAL A;  4M42 A;  3DLK A;  2HNY A;  4FJ5 A;  5HRS A;  1RDB A;  1VSM A;  4TSX A;  2W42 A;  1C0U A;  4M3U A;  1IH7 A;  1BI4 A;  3NAE A;  4BDP A;  1IKW A;  3KD5 E;  4J2B A;  3I0S A;  2IC3 A;  3LP3 A;  3F9K A;  1U4B A;  1IKX A;  4BE2 A;  3QEV A;  2AJQ A;  3LWL A;  1D9F A;  2QKB A;  2Z1G A;  4CJP A;  2G8U A;  1XWL A;  4B9M A;  1HMV A;  2HVI A;  3DMJ A;  3DLR A;  1YTA A;  4CF2 A;  3LDS A;  1WSH A;  1L5U A;  1B9F A;  4FW1 A;  3ITH A;  4DFK A;  3OYB A;  3O3F A;  4WE1 A;  3SUN A;  4DQI A;  4DSK A;  1BCM A;  1LAW A;  4FJG A;  2DFE A;  2HMI A;  4E7I A;  3AO1 A;  4JS5 A;  1TL1 A;  2GBZ A;  1D8Y A;  4J2D A;  2OPQ A;  1TKZ A;  4OVL A;  1NKC A;  5DK5 A;  1W0H A;  4NCB A;  1RIL A;  1X1P A;  4KFB A;  4HUE A;  4DTU A;  4O5B A;  3L2Q A;  4FK4 A;  4FXD A;  3HP9 A;  4W5T A;  2G8I A;  1XC9 A;  1HQU A;  3TI0 A;  4FJ8 A;  3KLH A;  4CJL A;  4B9S A;  3AO2 A;  3S3O A;  2D5R A;  4W5R A;  3ZT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...