3AO3A

Fragment-based approach to the design of ligands targeting a novel site on hiv-1 integrase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
153
structure length
138
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQEESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein
publication title Fragment-based design of ligands targeting a novel site on the integrase enzyme of human immunodeficiency virus 1
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/transferase inhibitor
total genus 49
structure length 138
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ao3A00
3TAFA 1RTDA 4JS4A 3AA2A 3O3FA 1QS4A 4CK1A 2GV9A 3SV3A 3P83D 1A5WA 3M8RA 4F8RA 5T7BA 3HPHA 4J2AA 3RR8A 3OYIA 1T7PA 1ZBHA 3L2WA 4YFUA 4O55A 5CY4A 3B6OA 2RPIA 1W9HA 1N5YA 2IOCA 3CM5A 1C6VA 3HL8A 3LP1A 3KLFA 4LSLA 1I39A 2I5JA 2Z1IA 4DQIA 2R7YA 3TANA 4KTQA 2KFNA 1A5VA 4OJRA 3MXJA 1VRTA 4ID1A 5KGXA 4CK3A 1HNIA 3NHGA 3AO5A 2DFEA 3CM6A 1FKPA 3DLRA 3NF8A 4CHYA 3VQ9A 4DU1A 5SZTA 1XHZA 4OLBA 2OZMA 4CGJA 1RT2A 4B9SA 3A2FA 1UA0A 4EZ6A 4FJJA 2DTUA 4HTUA 2WONA 1HYVA 1IKXA 4FLVA 2P5GA 1WSHA 2XY6A 3RMCA 1U45A 1RT4A 1RILA 4KHUA 1QQCA 1XWLA 1QSYA 4J2DA 1IKWA 4LSNA 4FK2A 1W0HA 1NK6A 4IG0A 4Q0BA 2PY5A 4M3RA 1TKZA 1LAVA 2YNGA 3V6DA 1YT3A 3KLEA 3MXMA 3K58A 4FJMA 4KHNA 4CECA 1TV6A 3IG1A 1QHTA 4I2QA 3RMDA 4NCBA 3OYDA 3I8DA 3KD5E 2XHBA 3ZT3A 3AVFA 4B8AB 2B4JA 1HQEA 4BDYA 4DSEA 3HP6A 4Z4GA 4FLWA 4N56A 1KRPA 1B92A 3WNHA 4KKOA 4FZYA 4Z4FA 1KFDA 3V9UA 1S1WA 3OJUA 5DMRA 3PUFA 5HRNA 3TAPA 2G8IA 3LWLA 2IDOA 3LZJA 3RTVA 1TK8A 1CXUA 4HUEA 3CFPA 4CFAA 3PX6A 1JLBA 1RT7A 1X9WA 1TAUA 1J5OA 4B08A 1HNVA 1VSIA 3QO9A 4KO0A 3K59A 1SL0A 2HVIA 3AVKA 4B9MA 4FJHA 4FK0A 4FK4A 1LWEA 3MEDA 4IBNA 2Z1HA 1KVCA 4OLAA 2HVHA 4IKFA 4B9TA 3DLHA 3AA4A 5JS1A 3RRHA 5C42A 4NCAA 1RT5A 4H4OA 4AHSA 2DFHA 4FCYA 2OZSA 3KD1E 4CHNA 3V9WA 1KCFA 1VSMA 1VRUA 4KHQA 4FLTA 3ZT2A 1JLAA 3KKRA 3O4NA 3MEEA 4CHPA 1D8YA 1KLNA 4W5NA 3P1GA 3VQCA 3L2VA 5J2NA 2ZE2A 3WNGA 1SKRA 3AO3A 1D9DA 3S3MA 3KKSA 1WAFA 2E6LA 2P51A 4FLYA 2BE2A 4GVMA 4AHCA 4DS4A 1JL1A 2OPRA 2DFFA 4M3XA 4C8OA 2DY4A 4CGFA 4R5PA 3WNFA 2RN2A 1I3AA 1EX4A 3NAEA 1S9EA 4DQQA 3AO1A 4I7FA 1DTTA 1RBTA 3MXIA 3WNEA 3S3OA 2G8KA 3VQ8A 2YKMA 4KTZA 4OKJA 4DMNA 4KI4A 2VG5A 4DTPA 4E3SA 3NF9A 1S5JA 5D3GA 1JKHA 5HROA 2X6SA 4DFJA 3K5NA 2G8UA 3RR7A 4DSLA 2HNZA 2Z1JA 1VSHA 3B6PA 4CHQA 3KLIA 4M3YA 2F8TA 5I3UA 4M42A 3NH0A 2FBTA 2HB5A 4CHZA 3ZSXA 3O3HA 3KK3A 5CYMA 3ZSWA 4BDPA 4B9VA 2KZZA 1WSGA 3C6TA 3DLKA 4BE0A 1HYZA 1L3TA 4Z4EA 4OPKA 2RKIA 1NK9A 3HP9A 1J53A 4CJVA 3OYEA 2XY5A 2QK9A 3DLGA 3NBPA 3EYZA 1WSFA 3L2QA 3OYCA 3DLEA 4JRQA 3PO5A 3OYHA 4FM1A 1ASUA 4E1MA 4CF2A 4Z4CA 5KTQA 2RF2A 4M45A 3SQ2A 4KB0A 1TGOA 4CJ3A 4PA1A 1IG9A 5FRMA 3PY8A 4EP5A 3NF6A 1D5AA 3DRPA 4CJUA 4O0IA 4AHUA 4C8LA 3QINA 2YNFA 1VSEA 3VQAA 3VQPA 4FJ8A 4E19A 3KK2A 2FBXA 1RTHA 1JLGA 1ZBIA 1RDAA 1S1TA 4KREA 4HHTA 5FDLA 3VQEA 1NK0A 2FC0A 4GW6A 2FBVA 1KFSA 4W5RA 4F2RA 5EU7A 2QKKA 4RW4A 4CESA 3HVRA 3V9SA 4CHOA 4CEEA 4DFMA 4CGDA 1U47A 2G8HA 3CYMA 1EKEA 3OYJA 2F8SA 4CEDA 2KW4A 3KJVA 2YHAA 4F2SA 3U6FA 3FFIA 4CGHA 1QE1A 2AJQA 5J2MA 3ZCMA 1CXQA 1EXQA 3KLGA 5KI6A 2QXFA 4CJRA 3SCXA 4EZ9A 4BE2A 3TAEA 2EX3A 4FJGA 2GBZA 1LWFA 4CGIA 4DTUA 1NJZA 2P5OA 1MU2A 3ALYA 1UWBA 4FW1A 4MFBA 1T8EA 5C25A 3SZ2A 2Q3SA 3TAGA 1U04A 3VQBA 2Z1GA 3VQQA 5HRSA 2PYLA 5I42A 1XI1A 2KFZA 3OYNA 4J2EA 3KIOA 1VK0A 3IRXA 3SPZA 3DRSA 3F73A 4CIEA 1X9MA 3V81A 1HYSA 3TABA 3MAQA 1NK4A 1XC9A 2HHSA 4XIUA 4CJ5A 3ZT1A 2YKNA 4E89A 2ATQA 3CFRA 1RBVA 4BWJA 4RW8A 3TI0A 2BANA 4FJXA 3JSMA 4FVMA 3K57A 1NK5A 3VA0A 3MEGA 2ITGA 3H08A 2VG7A 3SUQA 3ZSVA 4M41A 3VQ7A 2OPPA 1BI4A 4KAZA 1BIZA 4BE1A 5CZ1A 1JLEA 4I9QA 1JLCA 2KTQA 1HRHA 4KI6A 3HVTA 4IG3A 3DM2A 3K5MA 3D0PA 1XHXA 3L3UA 2X78A 3VQ4A 3HXMA 3S9HA 1EP4A 2PYJA 3LAKA 1BCMA 4CJSA 3OYFA 4DS5A 2NUBA 4CJKA 2JGUA 1C0TA 1FK9A 3V1OA 3AV9A 1S6PA 1X9SA 3IAYA 3OJSA 3QEXA 3ZSZA 3O3GA 3RRGA 4FJ7A 1GOBA 4FLUA 4E7JA 4CIGA 4OKKA 4CJFA 1VSDA 1TKXA 3I0SA 3QEVA 4N76A 3OYGA 3CQ8A 3F9KA 4IDKA 4AH9A 3KK1A 4M3ZA 2BGGA 1WNSA 1NOZA 1KSPA 4RW6A 3ZT0A 5K14A 3OYMA 2HNYA 4ZTFA 4HCCA 3NE6A 4KHSA 3K2PA 4JLHA 1REVA 3O4QA 4AHRA 1G15A 5JS2A 4KHWA 2O4GA 1SKWA 4AHVA 3AVCA 4LH5A 3LDSA 3RMAA 3LP3A 1IKYA 4PUOA 3SUNA 4IFVA 3LAMA 3QNOA 4OGCA 2F96A 2G8VA 4WE1A 4CJ4A 4FW2A 1JLFA 3M8SA 3VA3A 1BHLA 1SL1A 4FM2A 4E0DA 4FJ9A 4CIFA 4F3TA 3NH1A 2YNIA 3HSTB 2XRIA 3T19A 1UA1A 3ZSYA 4QCLA 1S1XA 2YNHA 4ID5A 4N47A 3OS1A 2Y1IA 3EZ5A 4J2BA 1VSKA 1ZBFA 3NGYA 4CEAA 5J1EA 3P5JA 3G10A 3OYKA 1WN7A 1KVAA 1X1PA 4YNQA 3PV8A 4Z0UA 2X6NA 4BACA 3AO2A 3NCIA 1CLQA 2JLEA 3ZSRA 1TK0A 1LW0A 3OYBA 3LP2A 4DQPA 3VQ6A 3OS0A 5HRRA 1BQNA 3VN5A 1WSJA 4CJQA 4DTNA 4C8MA 1KLMA 4DQSA 4CJWA 1ZBUA 3S3NA 1SUQA 3SQ0A 1VSLA 3AVAA 3LPUA 1YTUA 4RW7A 3SUPA 3ITHA 3SQ1A 3AVIA 2HHVA 1C1AA 5CYQA 3DMJA 3U3GA 3OVNA 1TVRA 1IKVA 4FM0A 4FYDA 2VG6A 1C1BA 2D0AA 4BWMA 2A1RA 4OPJA 1HPZA 4B3OA 4NYFA 1RCHA 4HVJA 3QESA 4DSFA 1Q8IA 1JLQA 3HPGA 3LP0A 3AVLA 3NFAA 1L5UA 1J9AA 3RWUA 3HK2A 2ZQBA 4UQGA 2GUIA 4O4GA 1RDBA 3M8QA 4CF8A 5HLFA 3OY9A 1WAJA 1CZBA 3DYAA 4H8KA 3ZSQA 3OS2A 4DLGA 5HBMA 4F4KA 3VQDA 4C8KA 1BIUA 2P1JA 4OKEA 4CJTA 3KLHA 4DFPA 4KV8A 3VQ5A 3SPYA 3NDKA 4DLEA 3AVBA 1DTQA 1GOAA 1TL1A 1A5XA 4E1NA 3QLHA 3RMBA 1O1WA 3TAMA 4OVLA 4DG1A 1QTMA 4E7IA 2EHGA 3BDPA 1NK8A 3C6UA 1K6YA 4FZXC 4ELVA 3L3VA 3LPTA 4CCHA 4M3TA 3HT3A 4K8ZA 1L3SA 4FJNA 3UIQA 4FXDA 4CJPA 1Y97A 2ZD1A 1RNHA 4W5QA 1RT6A 3SYZA 2X74A 3AO4A 3NF7A 1B9DA 4CEBA 1J54A 4H4MA 4CJLA 3EY1A 4G1QA 3NGIA 4FJLA 4EP4A 3QERA 4KPYA 3LALA 3K5OA 4DF4A 3V4IA 4ELUA 4DSIA 4L8RB 3HM9A 2OYQA 4E7KA 3AVJA 4N41A 4K8XA 1WSEA 4Y1DA 3SNNA 3QEWA 1NJYA 2KQ2A 2Y1JA 2IAJA 3SJJA 1BCOA 4CFCA 4ICLA 1QSLA 5DK5A 1YVUA 4I2PA 4NCGA 4TSXA 1TKDA 4AHTA 2D0CA 1NJXA 1RDDA 1RTJA 2A1SA 1RTIA 3DI6A 4QOZB 3ASMA 1RDCA 3KTQA 4Z4IA 3V9ZA 5KRSA 3IS9A 5SWMA 4W5OA 2HHWA 1JXBA 4FJIA 3HO1A 2FBYA 1UOCA 3QNNA 4DWIA 1RBSA 1Z26A 3TAQA 3AVGA 5FROA 1S1VA 3U3YA 1Q9YA 1WSIA 3AA5X 4QAGA 3ISNC 2XY7A 3C94A 3D45A 1TK5A 3HJFA 4C8NA 5HP1A 3C95A 3JYTA 4RW9A 3CG7A 2XO7A 4DFKA 5J2QA 1SL2A 4DU3A 4M3WA 4NYNA 4AILC 2B5JA 1IO2A 2OPQA 1BISA 4CEOA 1NOYA 2IS3A 2HW3A 1RBUA 4OGEA 3PX0A 1RBRA 4FZZA 2E6MA 2XY8A 3T1AA 4JS5A 1ZYQA 1JL2A 4I9LA 3SV4A 4DTXA 3HPOA 2QKBA 3PX4A 1BGXT 1ZBLA 1C0MA 3ULDA 4B9UA 4E7HA 1U49A 4KFBA 1BQMA 3T3FA 3OYLA 1N6QA 1S1UA 2G8WA 5FRNA 4FLXA 3I0RA 1IH7A 4N5SA 3NH2A 1WLJA 3HYFA 1BI4B 4W5TA 4F3OA 2HHTA 1TL3A 4CFDA 4CEFA 2HNDA 1C1CA 3L8BA 2BDPA 3L2RA 4B9NA 1DLOA 1UAXA 3V9XA 1KTQA 4PY5A 1T05A 3SQ4A 1SKSA 3DOKA 1NJWA 3K5LA 1FKOA 2YHBA 3DOLA 4RG8A 3LZIA 4CF1A 1NKCA 1D9FA 3DLBA 4KB1A 3TR8A 4JRPA 4PQUA 1QSSA 1RT3A 4ZTJA 4CF9A 4DTRA 2LSNA 3QIPA 1NKEA 4CGGA 4B8CA 4CJEA 1VSFA 3E01A 1NKBA 4LD0A 1LAWA 4ELTA 4DSJA 1CZ9A 4PWDA 2KZMA 3AVMA 3OYAA 3G0ZA 4M3UA 1NK7A 2IC3A 3LANA 1GOCA 5C24A 1RT1A 2YV0X 1BL3A 4CFBA 4CF0A 1LWCA 1LW2A 4LH4A 3AVNA 3AVHA 1Z25A 4O44A 2OPSA 4E7LA 4BDZA 1LV5A 4CEQA 1L3VA 2D0BA 3DRRA 5E41A 3QEIA 1HJRA 4DF8A 4Z4HA 2WOMA 4DQRA 2HMIA 4KHYA 3AA3A 4DTMA 3SUOA 4HCBA 4HUFA 3CFOA 4Q5VA 2E4LA 2IGIA 1ASVA 2VWKA 2O4IA 4MQ3A 4FLZA 4CE9A 3QEPA 1TKTA 1L3UA 3NGZA 4DTOA 4IFYA 5CZ2A 1B9FA 4LY7A 1ASWA 3TWHA 2HHQA 1F21A 3MECA 4FJ5A 3QIOA 2HHUA 1JXEA 4CERA 3QETA 4HUGA 4GMJB 5KRTA 2HHXA 4CK2A 3L2UA 4ZHRA 3ZT4A 1TAQA 4CEZA 4DTJA 3SI6A 4B9LA 4DU4A 2D5RA 1VSJA 1C0UA 1SV5A 2W42A 3TARA 1R0AA 1HQUA 1U4BA 1T03A 1Q9XA 3PO4A 3LWMA 5J2PA 3M8PA 1U48A 3BGRA 4O5BA 3V1QA 3ZSOA 4KTWA 1KVBA 1S9GA 2G8FA 4KRFA 1HMVA 4DSKA 1ITGA 4FJKA 5HRPA 2VWJA 2ETJA 3V1RA 2B6AA 2OA8A 1FXXA 4O0JA 5KGWA 1EETA 1YTAA 2PZSA 3THVA 4DTSA 1S6QA 4Y1CA
chains in the Genus database with same CATH superfamily
4FSVA 4BRDA 1RTDA 3SV3A 4EHUA 2P9KB 4J2AA 4F8RA 1ZBHA 3BP8A 3FE1A 3FZLA 4Y0WA 3RR8A 1K8AO 4O8KA 3UKUA 4B1XB 4JKCA 1NM1A 2Z1IA 2I5JA 3AGKA 3MXJA 5KGXA 3CM6A 2DFEA 3DLRA 1HYSA 4AM6A 4DU1A 1XHZA 3VERA 2OZMA 1OH6A 4EZ6A 4CZGA 4KBOA 3P38A 2O8FB 3CC7N 1HYVA 4C1NI 4FLVA 1WSHA 2XY6A 3VF2A 1XWLA 3ZX0A 4H5RA 1IKWA 1Q86O 4M3RA 3V6DA 1LAVA 1KXPA 3KLEA 3MXMA 3K58A 3CCJN 4CECA 3IG1A 1QHTA 3RMDA 3OYDA 2XHBA 4DSEA 4BDYA 4FLWA 1N36K 4Z4FA 3V9UA 1S1WA 1HLUA 3TAPA 1E3MA 3LWLA 4OO1J 4YOUA 1TK8A 1CXUA 1NBWA 3CFPA 1RT7A 1YI2N 1VSIA 4FK4A 4B9TA 3DLHA 3AA4A 4C23A 1RT5A 2QI2A 4AHSA 5H1SQ 1KCFA 1K8KA 1VSMA 1HNXK 1HPMA 3ZT2A 3H46O 4J8FA 5AQSA 1KLNA 2P9SB 3S3MA 1WAFA 2E6LA 4WQ5C 3HOTA 4M3XA 4V19S 4R5PA 1ZC6A 1EX4A 4NB4A 1NU0A 3AO1A 4I7FA 3CCEN 1SQKA 2YKMA 4KTZA 3OBWA 1S5JA 5D3GA 1JKHA 4IO9L 4DUZK 5HROA 1HNWK 3B6PA 2F8TA 3I55N 4GNIA 3WXMB 3H1QA 3E9OA 2KZZA 1U6ZA 1HYZA 4Z4EA 4OPKA 3HP9A 1J53A 4CJVA 3OYEA 2RHKA 3EYZA 4JKGA 4NLBA 5BN8A 4IOAL 4FM1A 1NGFA 1Q18A 4H0TB 4CF2A 5KTQA 2RF2A 3SQ2A 1IG9A 2J4RA 1WBBA 5AQXA 1VSEA 4BR4A 3VQPA 2FBXA 5JLHA 1JLGA 3OHRA 3A8YA 2HHHK 1HX1A 4H5VA 2OTJN 1NK0A 2FC0A 1KFSA 5EVZA 3A5LC 5EU7A 4CESA 3V9SA 4CHOA 1ZBSA 3CYMA 3OYJA 3QFPA 3FLCO 5KPTA 2KW4A 2YHAA 3U6FA 2AJQA 5J2MA 4LF9K 2O8EA 3KLGA 3H1VX 5KI6A 1QQOA 3BF3A 3TAEA 5JVGL 3M1FA 2P5OA 3ALYA 1T44A 2Z1GA 5KPZA 2FXUA 2PYLA 5I42A 3KIOA 3DRSA 3TABA 2UU9K 3UKUB 1NWKA 3ZT1A 4E89A 1X9JA 3CFRA 4DR5K 4AQYK 3O9UA 3D7EO 2JWLA 4FO0A 2BANA 1EWQA 1NK5A 2ITGA 4BQZA 4IOCL 4KAZA 3VQ7A 1BI4A 4BQLA 1BIZA 4BE1A 1JLCA 3D0PA 4FL9A 3FZMA 2X78A 3HXMA 5C12A 4CJSA 3OYFA 4DS5A 3R6MA 3LDOA 4CJKA 1S6PA 3ZSZA 4FLUA 2BTFA 4OKKA 1VSDA 2WUSA 1TKXA 4BRHA 3OYGA 3CQ8A 1IBLK 3HM8A 3ZT0A 5EX5A 3MWTA 3K2PA 4JLHA 4AHRA 4KHWA 3AVCA 3VOVA 5AFUH 3SUNA 3FZKA 1MA9B 3LAMA 4IFVA 3TSQA 4WE1A 1JLFA 3M8SA 2KKZA 3D2FB 4FWRA 1IV0A 4CIFA 4B1YB 4F3TA 4ILJA 3ZSYA 5BR9A 3J7ZO 4B3TK 1BA0A 1E4GT 4ILGB 3OS1A 3CCRN 3DAWA 4CEAA 5J1EA 3P5JA 3PV8A 2X6NA 3MCPA 3O5BA 3ZSRA 1TK0A 1LW0A 1S22A 3VQ6A 3O4WA 3CD6N 5AQQA 2QXLA 1K8KB 4CJQA 1QZ5A 4DTNA 4BC3A 1KLMA 4CJWA 3THYB 1VSLA 1YTUA 3AVIA 3TTDA 2HHVA 4KHPK 5CYQA 3L4IA 1NGDA 4IEIA 4JK7A 3VMFB 4FYDA 2VG6A 2A1RA 1GLFO 4NYFA 1RCHA 5AQGA 4DSFA 1Q8IA 2IIRA 2Q1NA 1L5UA 3LP0A 3AVLA 2E1YA 2ZQBA 4BRCA 1RDBA 2I7PA 1WB9A 4RWTA 4YOTA 1BIUA 3FZHA 3EEQA 4JI6K 5JICA 3AVBA 1NOYA 1QTMA 3QLHA 4E7IA 3BDPA 4JKGB 3C6UA 4FZXC 4ELVA 3L3VA 4CCHA 1L3SA 4FJNA 3UIQA 4CJPA 2ZD1A 3FZFA 4CEBA 3MN9A 4CD1A 4KPYA 3LALA 3V4IA 4ELUA 4L8RB 1YUWA 1VQLN 5M1NA 3SNNA 1VQON 5LL6Z 2V52B 4AHTA 2YX6A 4CI6A 2A1SA 2QWOA 3IS9A 4BY9C 1YHQN 4FJIA 4WQ4A 3VGMA 5AQIA 1X3NA 2D4WA 3AA5X 1P90A 3C94A 1YJNN 4YOWA 1ATRA 4C8NA 4YORA 3CG7A 2XO7A 5J2QA 4M3WA 5GAHP 2OPQA 2V7YA 1X3MA 3PX0A 3PIOL 3UKRA 3T1AA 1JL2A 5AQHA 2QKBA 4BG8A 3PX4A 1BGXT 1BU6O 1C0MA 3MN7A 4E7HA 3THXB 1BQMA 1N6QA 4F3OA 2HHTA 4W5TA 1BI4B 3PLAA 4CEFA 3L8BA 1UAXA 1T05A 1SKSA 3CJ1A 5JLFA 3TR8A 1JCGA 2VQEK 1RT3A 3VGKA 2LSNA 3O6WA 2UUCK 5GAGP 5CR4A 5M1QA 4LD0A 1LAWA 3BF1A 3I33A 3OYAA 1NK7A 2QWLA 1XC3A 1BL3A 1LWCA 4LFAK 3CQYA 2F9TA 4E7LA 2ZJPL 2HMPA 5KQ8A 2GWKA 4YDUA 5E41A 4DF8A 2WOMA 3KWIA 1U2VB 4HCBA 3CFOA 3UE5A 4Q5VA 2PAVA 1VHXA 4FLZA 4BVOA 3NGZA 5E26A 4IFYA 3MECA 1YF5L 2HHUA 1NGEA 2HHXA 1FJGK 2NLXA 4B9LA 3SI6A 2D5RA 1SV5A 1HQUA 1T03A 3PO4A 2HBJA 4BRAA 1NMDA 5J2PA 1U48A 2G8FA 4KRFA 1HMVA 1RDUA 1SAZA 4K0KK 4YOYA 2P9PA 5KGWA 1YTAA 4NLCA 1S6QA 3CMEN 2KLAA 1JCEA 3AGRA 1S72N 1QS4A 4CK1A 3LM2A 3W0LA 1NLVA 3HPHA 4MO5A 1VAZA 3OYIA 5CY4A 2RPIA 1W9HA 4B3MK 3CM5A 3HL8A 3KLFA 4DQIA 3GDQA 2YI1A 4JI5K 2KFNA 1A5VA 1GLAG 4PHTX 3QICA 2HSTA 3NHGA 3NF8A 2QWMA 3TU5A 1RT2A 4DQ8A 1UA0A 4IJNA 2WONA 4JKHA 1IKXA 1BOTO 2P5GA 3VPZA 2HBKA 1RT4A 1QQCA 1QSYA 3C7NA 3H3NO 2O8DA 1W0HA 3CETA 3QBWA 1NK6A 2HF3A 4Q0BA 2PY5A 3EE9A 2YNGA 2Q0RA 5M1PA 3G71N 4PKIA 4NCBA 3AAQA 3ZT3A 4Z4GA 2NRRA 4JD2A 4N56A 3CI5A 3WNHA 3E9LA 5LY3A 3OJUA 4JK9A 5DMRA 3PUFA 5HRNA 4M7XA 4CFAA 3PX6A 2E2PA 3ENBA 3DJCA 4CVNE 1J5OA 3O9RA 1HNVA 3F5TA 3U4LA 4BRQA 3QO9A 3K59A 1SL0A 4FJHA 4FK0A 3MEDA 5C2FA 4OLAA 3ZETA 3NMUA 4UY8O 1NGHA 4KH6A 2DFHA 3KD1E 3F9MA 4CHNA 2HBMA 4HWIA 3PSFA 1VRUA 3PIPL 1JLAA 2Q97A 3MEEA 1D8YA 5LMUK 3VQCA 1OKJA 3WNGA 4DB3A 3GBTA 5AZJA 2P51A 4GVMA 2OPRA 1GLDG 4C8OA 4CGFA 1I3AA 2E1ZA 3NAEA 3LDPA 1DTTA 3MXIA 4ISEA 3S3OA 2G8KA 3VQ8A 4DMNA 4KI4A 4OKJA 4DV2K 2A42A 4E3SA 3KZBA 3O9TA 3K5NA 4DSLA 1VSHA 4GVEA 4CHQA 4CZLA 5I3UA 5MLCQ 2HB5A 3KK3A 5CYMA 3ZSWA 4BDPA 1WSGA 1L3TA 1XNRK 3DLLL 3J80O 1NK9A 2VWBA 4CZMA 2FSNA 3L2QA 3OYCA 4JRQA 4YOVA 4IJAA 4M45A 4KB0A 3IFRA 4CJ3A 4JI3K 4EP5A 1D5AA 3QINA 2RE2A 2YNFA 4FJ8A 1RTHA 4FOIA 1ZBIA 1RDAA 4KREA 3J7YP 4HHTA 4GW6A 5EXWA 4CEEA 3CCMN 2G8HA 1EKEA 3ID6A 1C0GA 4CEDA 3KJVA 4U7BA 3FFIA 1QE1A 3SMPA 2O8BA 4CJRA 2NRXA 2EX3A 1NJZA 1NGCA 4FW1A 2P9PB 4PKHA 5C25A 3TAGA 4FWQA 5BRDA 4E1JA 4BR2A 4BC5A 3G25A 1XI1A 2KFZA 3OYNA 3AY9A 3ENOA 4J2EA 2IVNA 1VK0A 3SPZA 3CHWA 1OH8A 4K41A 3NVKA 2ATQA 4BWJA 4RW8A 4IFEA 1KD1O 1IJJA 3IDHA 5M1FA 3CJCA 2OCEA 3H08A 2VG7A 1HUXA 3ZSVA 4M41A 4K43A 4I9QA 2UUAK 5ADXH 2ZGYA 3L3UA 3VQ4A 2PYJA 3BZKA 3LAKA 2YJFA 2YHXA 3CPEA 2A6AA 2JGUA 3V1OA 3RRGA 4FJ7A 4E7JA 4CIGA 3IKMA 4JKBA 3I0SA 4FWKA 3WT0A 4AH9A 1WNSA 1KSPA 5K14A 4HCCA 2HNYA 4KHSA 3NE6A 2IVOA 4BRGA 1REVA 2V51B 3O4QA 3WEEA 2O4GA 4YY3K 3LP3A 1IKYA 3R1XA 3QNOA 4OGCA 1MDUB 3ZLJA 1SL1A 2P9NA 3NH1A 5C0YA 1JJ2M 1ZXOA 1VSKA 4IO8A 3G10A 3OYKA 1WN7A 3OTOK 3LDNA 3AO2A 1GLBG 2JLEA 4EFHA 3OYBA 3LP2A 4DQPA 5AQWA 1Z6RA 1BQNA 4KH5A 1WSJA 1ZBUA 3S3NA 4DV6K 3AVAA 3LPUA 3VETA 5AZJB 3SUPA 2F4VK 2E8AA 1NMNA 3DMJA 1V4SA 3OVNA 4OPAA 5AQMA 2D0AA 5BPMA 1RFQA 4OPJA 1T3VA 1HPZA 3QESA 3VEVA 1JLQA 5LJWA 3HK2A 1J9AA 1ATNA 4DV7K 3HRGA 5HOOA 2ZJRL 1CZBA 3ZSQA 3S41A 3VQDA 4OKEA 4EHTA 3JS6A 3NDKA 4DLEA 1DTQA 1O1WA 4DG1A 4OVLA 5BR8K 2EHGA 1K73O 3LL3A 1H1VA 3HT3A 4K8ZA 1P8ZA 5AFUA 5GIOA 4FXDA 3HSCA 1RT6A 2X74A 4CJLA 4FJLA 3QERA 5AQKA 4DSIA 4N41A 3O8MA 2QTDA 3CJ7A 2KQ2A 1BCOA 4ICLA 2UXBK 5DK5A 1YVUA 4I2PA 3HBTA 3DXMA 4TSXA 3MDQA 1NJXA 1RTJA 5AJ3K 1V4TA 4QOZB 3ASMA 5SWMA 3I56N 2O8CA 3E66A 2O8BB 1UOCA 2GX9A 3QNNA 4ISGA 1Z26A 3G4SN 1S1VA 5AQFA 3U3YA 1Q9YA 1WSIA 4M63C 2VCPA 2XY7A 4H5WA 3D45A 1TK5A 4JAXA 3J81O 5HP1A 4RW9A 1SL2A 4DU3A 4NYNA 4AILC 1IO2A 3A0IX 4JKEA 4CEOA 4FWPA 2HW3A 2CGLA 1G99A 4OGEA 1VQ5N 4FZZA 3RVCA 3CJBA 3EZWA 3THWA 3SV4A 3HPOA 1ZBLA 5AQUA 3CERA 3MK6A 3T3FA 1DGKN 3I0RA 4N5SA 3NH2A 2VYPA 1TL3A 4CFDA 2HNDA 4B9NA 1DLOA 1NJWA 3K5LA 4RG8A 3DOLA 3WQUA 1NKCA 1VQMN 1D9FA 3DLBA 4KB1A 1HJOA 4JRPA 1HR0K 1ESVA 3M5RA 3QIPA 3FR0A 4CGGA 4B8CA 4CJEA 1NKBA 3GL1A 4PWDA 5AQJA 3AVMA 3G0ZA 4B1UB 2IC3A 5BRFA 4QS7A 2YV0X 5FPDA 1LW2A 3AVNA 3AVHA 4CJ7A 1LV5A 1JCFA 4JNEA 4IDHA 4CEQA 1HJRA 2A3ZA 4Z4HA 4DQRA 2HMIA 4B1ZA 3AA3A 3SUOA 2P9NB 4HUFA 4MQ3A 3QEPA 2DPNA 1TKTA 4FPBA 2GWJA 5CZ2A 2YJEA 1E4FT 3ZYYX 4LY7A 3TWHA 1F21A 4FJ5A 3QETA 2E2OA 2ZF5O 3Q7CA 4ZHRA 3ZT4A 1TAQA 2E20A 3WXLA 1VSJA 2W42A 3TARA 1Q9XA 1U4BA 5AQZA 2E88A 3TSUA 3LWMA 5F1XA 3ZSOA 4KTWA 4LFCK 1S9GA 3GE1A 4PL8A 4DSKA 1ITGA 4FJKA 5HRPA 1XNQK 2VWJA 1VQNN 1VQ6N 2PZSA 1J5EK 1TUUA 5GINA 3TAFA 3WXJA 4GY2B 3EO3A 3P83D 1A5WA 5T7BA 3C65A 1XMQK 4WQ4C 4O55A 2W40A 2IOCA 1C6VA 1I39A 1KAYA 3CPWM 4KTQA 4JI8K 1EWRA 1J6ZA 2NNWA 3K9KA 1K9MO 1HNIA 5AQVA 2O8EB 3SAGA 3AO5A 4CHYA 3VQ9A 1NG9A 4OLBA 3HTVA 2Q0UA 4B9SA 4FJJA 3A5NC 1NJIO 2DTUA 2NRHA 3DWLA 4HTUA 3L6QA 3RMCA 1U45A 4B3RK 3MN5A 4KHUA 1DKGD 4NXNK 3D2EA 4U67L 4J2DA 1YIJN 5FPMA 2V7ZA 2FF3B 4LSNA 4FK2A 1TKZA 1YT3A 2W41A 4KHNA 4FJMA 3RSEA 4I2QA 3U8XA 4K25A 1GLCG 2I7NA 3Q7BA 3KD5E 4B8AB 1HQEA 4G9ZA 2O8CB 2D0OA 4KKOA 4FZYA 1N8RO 2QW9A 3EN9A 3LZJA 3RTVA 2P9UA 1NNEA 2GEMA 3OW2M 4CW7B 1TAUA 4B08A 3T1HK 2NZTA 1LCUA 4KO0A 3LDLA 2D0PA 3AVKA 1MWKA 1LWEA 3R3LA 4IBNA 2WC9A 3BY5A 5EOYA 2Z1HA 1RDWX 4YDUC 4BR7A 3L0QA 4QS8A 3O1BA 5JS1A 1RGIA 4NCAA 4H4OA 3V9WA 4KHQA 5AQRA 3O4NA 4CHPA 4W5NA 3P1GA 4B3SK 3L2VA 5J2NA 4O8UA 1SKRA 1D9DA 3KKSA 4CBXA 3BZCA 4FLYA 2BE2A 4AHCA 1JL1A 2GELA 5FPEA 4ILHA 1ILYA 2KHOA 2DY4A 3WNFA 3DXKA 2VGNA 2VG5A 4F9OA 4DTPA 1YJ9N 4DFJA 1CZAN 4JKAA 2Z1JA 4M3YA 1Y64A 3KLIA 2QEXN 4M42A 2P9LA 4CHZA 3O3HA 2QWPA 3DLKA 4BE0A 4IXCA 5GAEP 1NGAA 3IUCA 3O9SA 2QK9A 4LF5K 5HL7L 3DLEA 3PO5A 3OYHA 1QVGM 4E1MA 4BR5A 2YCHA 3PY8A 4EIAA 3NF6A 3ENHA 5BPNA 4CJUA 4O0IA 4AHUA 4A2BA 4MDBA 4E19A 3KK2A 1HKGA 4JI7K 5FPNA 3VF4A 1S1TA 2E2NA 5FDLA 3VQEA 5KQDA 4F2RA 3OBYA 4W5RA 2QKKA 4RW4A 4DFMA 1U47A 2F8SA 4CGHA 2ITMA 1CXQA 3SCXA 4EZ9A 4BE2A 2VGMA 4WFBL 1HNZK 1XUPO 4H0YB 3ATVA 2NRWA 1Z05A 3M3ZA 5HRSA 4JI1K 4WCEL 2Q36A 5LJVA 1X9MA 2HHSA 3MAQA 1GLEG 4XIUA 3T7ZA 4CJ5A 2YKNA 5ELZA 1RBVA 2A40A 4FVMA 3ZEUA 3K57A 3VA0A 1QQMA 3P31A 4BR9A 3JAMO 2KTQA 1HRHA 3VEOA 4KI6A 3HVTA 3DM2A 1HKBA 4JHDA 1BCMA 2CGJA 4O5FA 3O9QA 4LF7K 4FWNA 3CC4N 3D2EB 3J7AP 1FK9A 1X9SA 3IAYA 2IVPA 3O3GA 3QEXA 1N32K 1GOBA 4CZKA 3CXCM 4N76A 3RSEB 4IDKA 3KK1A 4A61A 4H0OA 1NOZA 1KAZA 4RW6A 3F2KA 3UKRB 2P9SA 5AR0A 1Q81O 5JS2A 4M7YA 4PKGA 1XQSC 2ZWHA 3LDSA 3RMAA 5IT9O 3AAPA 4BRFA 4FW2A 3VA3A 3H45C 4FM2A 2ZGZA 4FJ9A 2YNIA 3HSTB 2XRIA 3T19A 1UA1A 3QMLA 2YNHA 4ID5A 5AQLA 3EZ5A 4MDAA 1ZBFA 4A59A 3CCLN 2F9WA 3C6HA 2W6KA 4YNQA 1KVAA 1VQ4N 2JWKA 5HRRA 4C8MA 4JI2K 1SUQA 3SQ0A 4BRIA 1SZ2A 4A5AA 1NGJA 4LF8K 4DV5K 3DXKB 5ADXA 2ASOA 3TSPA 4H0XB 4HVJA 1GLJO 4IEEA 3HPGA 3RWUA 2NRVA 5TKYA 4I6MA 5HLFA 3OY9A 4WFAL 4H8KA 3K9JA 4DLGA 2P9LB 4A57A 4JEPA 4CJTA 4DFPA 4KV8A 5LMNK 3SPYA 4H5TA 1OVYA 4E1NA 1GOAA 1TL1A 1A5XA 4BGBA 3RMBA 4H0VB 3TAMA 4OX9K 4BROA 1NK8A 2EWSA 1DEJA 1K6YA 3LPTA 1OVQA 4WFNL 1Y97A 4W5QA 1RNHA 3SYZA 4DTUA 3EY1A 5AQYA 1B9DA 2AA4A 4H4MA 4IWVA 3NGIA 2G8IA 4G1QA 4MLHA 4DF4A 3HM9A 4K8XA 4Y1DA 2GUPA 3O80A 4H5NA 3QEWA 2Y1JA 4CFCA 3FFKB 4X64K 1RDDA 1SS6A 1RTIA 3DI6A 4Z4IA 1RDCA 2VQFK 4W5OA 1NGBA 2FBYA 1W2BM 4DWIA 3TAQA 1BO5O 3AVGA 5FROA 1NGIA 4QS9A 3ISNC 3HJFA 1BA1A 1KC8O 3GOIA 2YHWA 3C95A 3JYTA 3I8BA 2W6LA 4DR2K 2F7TA 2P9IA 2NRTA 1GLLO 3C7NB 4JI0K 1BISA 2O8DB 4BRLA 1RBRA 4I9LA 4DTXA 3CCQN 3ULDA 3ZEUB 4KFBA 1S1UA 2PBDA 4FLXA 4JD2B 3HYFA 3D2FA 4DHYA 1C1CA 1N34K 5EY4A 4GV3A 4HTLA 3V9XA 1KTQA 4PY5A 4JHDB 3SQ4A 1EQYA 2YHBA 1YVNA 4CF1A 5M1OA 4PQUA 3VENA 1TYQA 4CZEA 1VSFA 3T1YK 3TPQA 1CZ9A 4BR0A 4M3UA 4FWSA 3LANA 5C24A 3ZETB 1RT1A 3THYA 4CFBA 4CF0A 4XH5A 5AZIA 4LH4A 1W7AA 2OPSA 4CBWA 2D0BA 3A5MC 3QEIA 3O1WA 2D1KA 4A5BA 3CCVN 2E4LA 4DV1K 1ASVA 2ZJQL 2VWKA 3CQXA 3WQTA 3P39A 4DR4K 4WQ5A 1ASWA 3W3DA 3QIOA 1JXEA 3R9PA 5KRTA 4CK2A 3L2UA 4CEZA 4DTJA 3H6EA 2Q31A 1C0UA 3MCAB 4DV0K 4LF6K 4QCLA 5DM7L 3KHYA 1BUPA 3M8PA 3BGRA 4O5BA 2QWRA 1KVBA 4JYAK 4DV3K 2ETJA 3V1RA 3E9PA 2OA8A 4O0JA 1R59O 4DTSA 4GV9A 4Y1CA 4B9QA 1EO1A 4JS4A 3AA2A 3O3FA 2GV9A 4A62A 4I6MB 5M1KA 2H3GX 3M8RA 3JXUA 3CCUN 1OH7A 1T7PA 3L2WA 4YFUA 3LM9A 3B6OA 3EKUA 1N5YA 3LP1A 4LSLA 2R7YA 3TANA 2UUBK 4OJRA 1VRTA 2CGKA 4ID1A 4CK3A 1T6DA 3VEXA 1FKPA 1MWMA 5SZTA 4CGJA 5DM6L 3A2FA 1KQSM 4NXMK 3BUZB 3ULEA 4Z94A 4H0PA 1RILA 2FSKA 5JMVA 4DR7K 4FPAA 4RCHA 4IG0A 3T69A 3K0SA 3WXKA 5F2RA 1TV6A 4JK8A 3THXA 3I8DA 1Q7YO 1WUAA 3AVFA 2B4JA 5BN9A 5B8HA 3HP6A 4FVUA 5AQNA 1KRPA 1B92A 1KFDA 1QVFM 3C0BA 3PSIA 2IDOA 5CE3A 5BRHA 4HUEA 1JLBA 1X9WA 5AQPA 2HVIA 4BRKA 4B9MA 1T6CA 5C2DA 5AQOA 2P9IB 4H03B 1KVCA 3VEWA 2HVHA 4IKFA 3VEYA 1VQ9N 3RRHA 5C42A 4DR3K 4FCYA 2OZSA 3CC2N 1VQKN 2FSJA 4FLTA 1YAGA 3KKRA 3FGUA 2PFUA 1VQ8N 2ZE2A 4KH4A 4GV6A 3AO3A 3P4IA 3WEEB 1U2VA 4DS4A 1D4XA 3CMAN 2DFFA 1QHAA 1NGGA 2RN2A 3KVGA 1S9EA 4BC2A 4DQQA 1QSLA 1RBTA 3WNEA 5CHIA 5JVHL 2FF6A 1TYQB 2FLOA 3NF9A 4RTFD 2X6SA 2G8UA 3RR7A 3SMSA 2HNZA 4C1NK 2UXDK 1IBKK 3NH0A 2FBTA 3O08A 4XH1A 3ZSXA 4B9VA 1BWFO 5AZIB 3C6TA 4B1WB 2GTDA 4NO7A 4R79A 5I9EB 2RKIA 3L4QA 4CZJA 3ZX2A 2XY5A 3EL2A 3DLGA 3NBPA 1WSFA 4DCHA 3MX5A 2A41A 1N33K 4X65K 3WUHA 1QQNA 1ASUA 4Z4CA 5FRMA 3HI0A 1TGOA 4PA1A 5FLXO 3DRPA 4C8LA 2ASMA 3VQAA 3SAFA 5BPLA 3CIPA 1YXQA 3VF6A 2FBVA 3HVRA 1S3XA 3SBTA 4CGDA 2QWQA 5C10A 4F2SA 2YHYA 3VEZA 3ZCMA 1EXQA 1W97L 2UXCK 5E84A 3TTCA 2QXFA 4DV4K 4LF4K 3KWGA 4FJGA 2GBZA 1LWFA 4CGIA 1MU2A 1UWBA 4MFBA 1O13A 1T8EA 3SZ2A 2Q3SA 1U04A 5GIPA 3VQBA 3SAHA 3VQQA 1LOTB 3IRXA 4JKFA 3F73A 4CIEA 1BG3A 3V81A 1NK4A 1XC9A 4XH4A 5GADP 4WF9L 3DXMB 3TI0A 3MMVA 4XEIA 3VTIA 4FJXA 3D6RA 3JSMA 3U9DA 3MEGA 3SUQA 2OPPA 4BVPA 3TTFA 5CZ1A 1JLEA 3WXIA 4L3QA 4IG3A 3K5MA 1XHXA 2ZM6K 3ULEB 4FWLA 3CF5L 1EP4A 3S9HA 3CCSN 2NUBA 2OTLN 3B8AX 4LC9B 1C0TA 3AV9A 3OJSA 4CZHA 1QZ6A 1DT9A 2Q2RA 4CJFA 1KAXA 3QEVA 4M3ZA 3F9KA 3R8EA 4YOXA 2BGGA 3THWB 3OYMA 4ZTFA 3SK3A 1G15A 3OA9A 4FWMA 1SKWA 4AHVA 4LH5A 4PUOA 2F96A 2WBNA 2G8VA 4CJ4A 2E2QA 1BHLA 1M90O 3QB0A 2CH5A 4E0DA 4B1VA 3MN6A 4BRPA 1S1XA 4MO4A 4N47A 2Y1IA 4J2BA 3SJHA 4X62K 3NGYA 4CBUA 4JV5K 1X1PA 4Z0UA 4BACA 3C6AA 3NCIA 1CLQA 3OS0A 3VN5A 4BRNA 4DQSA 3N4PA 3VTHA 4RW7A 1VQPN 3ITHA 3SQ1A 1YITN 1C1AA 4FOEA 4EAHD 3U3GA 4A2AA 2E5LK 1TVRA 1IKVA 4FM0A 3IMXA 4YHHK 2AP1A 1C1BA 4BWMA 4CZIA 4B3OA 3NVMA 3NFAA 2HBLA 2A5XA 4UQGA 3BEXA 2GUIA 3QDKA 4O4GA 2P9KA 3M8QA 4CF8A 1WAJA 4AM7A 3DYAA 3OS2A 3J8AA 4JI4K 5HBMA 4F4KA 4CD3A 4C8KA 2P1JA 2WFBA 3KLHA 3VQ5A 4CZFA 2HF4A 3GG4A 4GKJK 4M3TA 2QM1A 3HOSA 3NF7A 3AO4A 1J54A 5IWAK 4DR1K 2O8FA 4EP4A 3K5OA 1VQ7N 1XMOK 4X66K 1HKCA 2OYQA 4E7KA 3AVJA 4LFBK 1WSEA 1NJYA 1IBMK 2IAJA 3SJJA 1I94K 2BUPA 5TKWA 2OANA 4NCGA 1TKDA 1IG8A 2D0CA 4FWOA 3KTQA 3V9ZA 4K42A 5KRSA 2HHWA 1JXBA 3AARA 4AF1A 3HO1A 1RBSA 5KPRA 4JKDA 3N4QA 4QAGA 3KK7A 3ATUA 3CJAA 3VESA 2HOEA 1TUYA 3E1YA 3H3OB 4DFKA 4BC4A 2B5JA 1WBDA 3MWPA 2IS3A 4OPHA 1RBUA 2E6MA 2XY8A 4IZ9A 3ZX3A 4JS5A 1ZYQA 4DUYK 4IOXA 5AQTA 4B9UA 3ID8A 1U49A 3CJ9A 1M1KO 3OYLA 3VGLA 5F0XA 2G8WA 5FRNA 4BREA 1IH7A 1WLJA 2BDPA 4JN4A 3L2RA 3DOKA 1FKOA 1WOQA 3LZIA 2P9UB 1QSSA 4ZTJA 4CF9A 4DTRA 1NKEA 4ISFA 4BG9A 5BREA 3A5OC 3E01A 3QFUA 4BRMA 4ELTA 4DSJA 5A2QO 2KZMA 1GOCA 3MX2A 1FW6A 3EKSA 1Z25A 4O44A 4BDZA 2QWNA 3QBXA 3SLCA 1L3VA 4DR6K 3DRRA 4KHYA 2CH6A 4DTMA 4WYBA 1ATSA 4BGAA 2UYTA 1YJWN 2IGIA 4GKKK 4DKWA 3LDQA 2O4IA 4CE9A 2WTUA 1L3UA 4DTOA 1B9FA 1BDGA 3SBGA 2HHQA 1OH5A 4CERA 3G6EN 4HUGA 4GMJB 4PL7A 3U9ZA 3EE8A 3HZ6A 4DU4A 1C0FA 1R0AA 4MLEA 2BH1A 5C15A 3V1QA 2NRZA 1Q82O 2B6AA 3M6GA 1FXXA 2ASPA 3UB5A 1EETA 2QA4N 3THVA
chains in the Genus database with same CATH topology
3TAFA 1RTDA 4JS4A 3AA2A 3O3FA 1QS4A 4CK1A 2GV9A 3SV3A 3P83D 1A5WA 3M8RA 4F8RA 5T7BA 3HPHA 4J2AA 3RR8A 3OYIA 1T7PA 1ZBHA 3L2WA 4YFUA 4O55A 5CY4A 3B6OA 2RPIA 1W9HA 1N5YA 2IOCA 3CM5A 1C6VA 3HL8A 3LP1A 3KLFA 4LSLA 1I39A 2I5JA 2Z1IA 4DQIA 2R7YA 3TANA 4KTQA 2KFNA 1A5VA 4OJRA 3MXJA 1VRTA 4ID1A 5KGXA 4CK3A 1HNIA 3NHGA 3AO5A 2DFEA 3CM6A 1FKPA 3DLRA 3NF8A 4CHYA 3VQ9A 4DU1A 5SZTA 1XHZA 4OLBA 2OZMA 4CGJA 1RT2A 4B9SA 3A2FA 1UA0A 4EZ6A 4FJJA 2DTUA 4HTUA 2WONA 1HYVA 1IKXA 4FLVA 2P5GA 1WSHA 2XY6A 3RMCA 1U45A 1RT4A 1RILA 4KHUA 1QQCA 1XWLA 1QSYA 4J2DA 1IKWA 4LSNA 4FK2A 1W0HA 1NK6A 4IG0A 4Q0BA 2PY5A 4M3RA 1TKZA 1LAVA 2YNGA 3V6DA 1YT3A 3KLEA 3MXMA 3K58A 4FJMA 4KHNA 4CECA 1TV6A 3IG1A 1QHTA 4I2QA 3RMDA 4NCBA 3OYDA 3I8DA 3KD5E 2XHBA 3ZT3A 3AVFA 4B8AB 2B4JA 1HQEA 4BDYA 4DSEA 3HP6A 4Z4GA 4FLWA 4N56A 1KRPA 1B92A 3WNHA 4KKOA 4FZYA 4Z4FA 1KFDA 3V9UA 1S1WA 3OJUA 5DMRA 3PUFA 5HRNA 3TAPA 2G8IA 3LWLA 2IDOA 3LZJA 3RTVA 1TK8A 1CXUA 4HUEA 3CFPA 4CFAA 3PX6A 1JLBA 1RT7A 1X9WA 1TAUA 1J5OA 4B08A 1HNVA 1VSIA 3QO9A 4KO0A 3K59A 1SL0A 2HVIA 3AVKA 4B9MA 4FJHA 4FK0A 4FK4A 1LWEA 3MEDA 4IBNA 2Z1HA 1KVCA 4OLAA 2HVHA 4IKFA 4B9TA 3DLHA 3AA4A 5JS1A 3RRHA 5C42A 4NCAA 1RT5A 4H4OA 4AHSA 2DFHA 4FCYA 2OZSA 3KD1E 4CHNA 3V9WA 1KCFA 1VSMA 1VRUA 4KHQA 4FLTA 3ZT2A 1JLAA 3KKRA 3O4NA 3MEEA 4CHPA 1D8YA 1KLNA 4W5NA 3P1GA 3VQCA 3L2VA 5J2NA 2ZE2A 3WNGA 1SKRA 3AO3A 1D9DA 3S3MA 3KKSA 1WAFA 2E6LA 2P51A 4FLYA 2BE2A 4GVMA 4AHCA 4DS4A 1JL1A 2OPRA 2DFFA 4M3XA 4C8OA 2DY4A 4CGFA 4R5PA 3WNFA 2RN2A 1I3AA 1EX4A 3NAEA 1S9EA 4DQQA 3AO1A 4I7FA 1DTTA 1RBTA 3MXIA 3WNEA 3S3OA 2G8KA 3VQ8A 2YKMA 4KTZA 4OKJA 4DMNA 4KI4A 2VG5A 4DTPA 4E3SA 3NF9A 1S5JA 5D3GA 1JKHA 5HROA 2X6SA 4DFJA 3K5NA 2G8UA 3RR7A 4DSLA 2HNZA 2Z1JA 1VSHA 3B6PA 4CHQA 3KLIA 4M3YA 2F8TA 5I3UA 4M42A 3NH0A 2FBTA 2HB5A 4CHZA 3ZSXA 3O3HA 3KK3A 5CYMA 3ZSWA 4BDPA 4B9VA 2KZZA 1WSGA 3C6TA 3DLKA 4BE0A 1HYZA 1L3TA 4Z4EA 4OPKA 2RKIA 1NK9A 3HP9A 1J53A 4CJVA 3OYEA 2XY5A 2QK9A 3DLGA 3NBPA 3EYZA 1WSFA 3L2QA 3OYCA 3DLEA 4JRQA 3PO5A 3OYHA 4FM1A 1ASUA 4E1MA 4CF2A 4Z4CA 5KTQA 2RF2A 4M45A 3SQ2A 4KB0A 1TGOA 4CJ3A 4PA1A 1IG9A 5FRMA 3PY8A 4EP5A 3NF6A 1D5AA 3DRPA 4CJUA 4O0IA 4AHUA 4C8LA 3QINA 2YNFA 1VSEA 3VQAA 3VQPA 4FJ8A 4E19A 3KK2A 2FBXA 1RTHA 1JLGA 1ZBIA 1RDAA 1S1TA 4KREA 4HHTA 5FDLA 3VQEA 1NK0A 2FC0A 4GW6A 2FBVA 1KFSA 4W5RA 4F2RA 5EU7A 2QKKA 4RW4A 4CESA 3HVRA 3V9SA 4CHOA 4CEEA 4DFMA 4CGDA 1U47A 2G8HA 3CYMA 1EKEA 3OYJA 2F8SA 4CEDA 2KW4A 3KJVA 2YHAA 4F2SA 3U6FA 3FFIA 4CGHA 1QE1A 2AJQA 5J2MA 3ZCMA 1CXQA 1EXQA 3KLGA 5KI6A 2QXFA 4CJRA 3SCXA 4EZ9A 4BE2A 3TAEA 2EX3A 4FJGA 2GBZA 1LWFA 4CGIA 4DTUA 1NJZA 2P5OA 1MU2A 3ALYA 1UWBA 4FW1A 4MFBA 1T8EA 5C25A 3SZ2A 2Q3SA 3TAGA 1U04A 3VQBA 2Z1GA 3VQQA 5HRSA 2PYLA 5I42A 1XI1A 2KFZA 3OYNA 4J2EA 3KIOA 1VK0A 3IRXA 3SPZA 3DRSA 3F73A 4CIEA 1X9MA 3V81A 1HYSA 3TABA 3MAQA 1NK4A 1XC9A 2HHSA 4XIUA 4CJ5A 3ZT1A 2YKNA 4E89A 2ATQA 3CFRA 1RBVA 4BWJA 4RW8A 3TI0A 2BANA 4FJXA 3JSMA 4FVMA 3K57A 1NK5A 3VA0A 3MEGA 2ITGA 3H08A 2VG7A 3SUQA 3ZSVA 4M41A 3VQ7A 2OPPA 1BI4A 4KAZA 1BIZA 4BE1A 5CZ1A 1JLEA 4I9QA 1JLCA 2KTQA 1HRHA 4KI6A 3HVTA 4IG3A 3DM2A 3K5MA 3D0PA 1XHXA 3L3UA 2X78A 3VQ4A 3HXMA 3S9HA 1EP4A 2PYJA 3LAKA 1BCMA 4CJSA 3OYFA 4DS5A 2NUBA 4CJKA 2JGUA 1C0TA 1FK9A 3V1OA 3AV9A 1S6PA 1X9SA 3IAYA 3OJSA 3QEXA 3ZSZA 3O3GA 3RRGA 4FJ7A 1GOBA 4FLUA 4E7JA 4CIGA 4OKKA 4CJFA 1VSDA 1TKXA 3I0SA 3QEVA 4N76A 3OYGA 3CQ8A 3F9KA 4IDKA 4AH9A 3KK1A 4M3ZA 2BGGA 1WNSA 1NOZA 1KSPA 4RW6A 3ZT0A 5K14A 3OYMA 2HNYA 4ZTFA 4HCCA 3NE6A 4KHSA 3K2PA 4JLHA 1REVA 3O4QA 4AHRA 1G15A 5JS2A 4KHWA 2O4GA 1SKWA 4AHVA 3AVCA 4LH5A 3LDSA 3RMAA 3LP3A 1IKYA 4PUOA 3SUNA 4IFVA 3LAMA 3QNOA 4OGCA 2F96A 2G8VA 4WE1A 4CJ4A 4FW2A 1JLFA 3M8SA 3VA3A 1BHLA 1SL1A 4FM2A 4E0DA 4FJ9A 4CIFA 4F3TA 3NH1A 2YNIA 3HSTB 2XRIA 3T19A 1UA1A 3ZSYA 4QCLA 1S1XA 2YNHA 4ID5A 4N47A 3OS1A 2Y1IA 3EZ5A 4J2BA 1VSKA 1ZBFA 3NGYA 4CEAA 5J1EA 3P5JA 3G10A 3OYKA 1WN7A 1KVAA 1X1PA 4YNQA 3PV8A 4Z0UA 2X6NA 4BACA 3AO2A 3NCIA 1CLQA 2JLEA 3ZSRA 1TK0A 1LW0A 3OYBA 3LP2A 4DQPA 3VQ6A 3OS0A 5HRRA 1BQNA 3VN5A 1WSJA 4CJQA 4DTNA 4C8MA 1KLMA 4DQSA 4CJWA 1ZBUA 3S3NA 1SUQA 3SQ0A 1VSLA 3AVAA 3LPUA 1YTUA 4RW7A 3SUPA 3ITHA 3SQ1A 3AVIA 2HHVA 1C1AA 5CYQA 3DMJA 3U3GA 3OVNA 1TVRA 1IKVA 4FM0A 4FYDA 2VG6A 1C1BA 2D0AA 4BWMA 2A1RA 4OPJA 1HPZA 4B3OA 4NYFA 1RCHA 4HVJA 3QESA 4DSFA 1Q8IA 1JLQA 3HPGA 3LP0A 3AVLA 3NFAA 1L5UA 1J9AA 3RWUA 3HK2A 2ZQBA 4UQGA 2GUIA 4O4GA 1RDBA 3M8QA 4CF8A 5HLFA 3OY9A 1WAJA 1CZBA 3DYAA 4H8KA 3ZSQA 3OS2A 4DLGA 5HBMA 4F4KA 3VQDA 4C8KA 1BIUA 2P1JA 4OKEA 4CJTA 3KLHA 4DFPA 4KV8A 3VQ5A 3SPYA 3NDKA 4DLEA 3AVBA 1DTQA 1GOAA 1TL1A 1A5XA 4E1NA 3QLHA 3RMBA 1O1WA 3TAMA 4OVLA 4DG1A 1QTMA 4E7IA 2EHGA 3BDPA 1NK8A 3C6UA 1K6YA 4FZXC 4ELVA 3L3VA 3LPTA 4CCHA 4M3TA 3HT3A 4K8ZA 1L3SA 4FJNA 3UIQA 4FXDA 4CJPA 1Y97A 2ZD1A 1RNHA 4W5QA 1RT6A 3SYZA 2X74A 3AO4A 3NF7A 1B9DA 4CEBA 1J54A 4H4MA 4CJLA 3EY1A 4G1QA 3NGIA 4FJLA 4EP4A 3QERA 4KPYA 3LALA 3K5OA 4DF4A 3V4IA 4ELUA 4DSIA 4L8RB 3HM9A 2OYQA 4E7KA 3AVJA 4N41A 4K8XA 1WSEA 4Y1DA 3SNNA 3QEWA 1NJYA 2KQ2A 2Y1JA 2IAJA 3SJJA 1BCOA 4CFCA 4ICLA 1QSLA 5DK5A 1YVUA 4I2PA 4NCGA 4TSXA 1TKDA 4AHTA 2D0CA 1NJXA 1RDDA 1RTJA 2A1SA 1RTIA 3DI6A 4QOZB 3ASMA 1RDCA 3KTQA 4Z4IA 3V9ZA 5KRSA 3IS9A 5SWMA 4W5OA 2HHWA 1JXBA 4FJIA 3HO1A 2FBYA 1UOCA 3QNNA 4DWIA 1RBSA 1Z26A 3TAQA 3AVGA 5FROA 1S1VA 3U3YA 1Q9YA 1WSIA 3AA5X 4QAGA 3ISNC 2XY7A 3C94A 3D45A 1TK5A 3HJFA 4C8NA 5HP1A 3C95A 3JYTA 4RW9A 3CG7A 2XO7A 4DFKA 5J2QA 1SL2A 4DU3A 4M3WA 4NYNA 4AILC 2B5JA 1IO2A 2OPQA 1BISA 4CEOA 1NOYA 2IS3A 2HW3A 1RBUA 4OGEA 3PX0A 1RBRA 4FZZA 2E6MA 2XY8A 3T1AA 4JS5A 1ZYQA 1JL2A 4I9LA 3SV4A 4DTXA 3HPOA 2QKBA 3PX4A 1BGXT 1ZBLA 1C0MA 3ULDA 4B9UA 4E7HA 1U49A 4KFBA 1BQMA 3T3FA 3OYLA 1N6QA 1S1UA 2G8WA 5FRNA 4FLXA 3I0RA 1IH7A 4N5SA 3NH2A 1WLJA 3HYFA 1BI4B 4W5TA 4F3OA 2HHTA 1TL3A 4CFDA 4CEFA 2HNDA 1C1CA 3L8BA 2BDPA 3L2RA 4B9NA 1DLOA 1UAXA 3V9XA 1KTQA 4PY5A 1T05A 3SQ4A 1SKSA 3DOKA 1NJWA 3K5LA 1FKOA 2YHBA 3DOLA 4RG8A 3LZIA 4CF1A 1NKCA 1D9FA 3DLBA 4KB1A 3TR8A 4JRPA 4PQUA 1QSSA 1RT3A 4ZTJA 4CF9A 4DTRA 2LSNA 3QIPA 1NKEA 4CGGA 4B8CA 4CJEA 1VSFA 3E01A 1NKBA 4LD0A 1LAWA 4ELTA 4DSJA 1CZ9A 4PWDA 2KZMA 3AVMA 3OYAA 3G0ZA 4M3UA 1NK7A 2IC3A 3LANA 1GOCA 5C24A 1RT1A 2YV0X 1BL3A 4CFBA 4CF0A 1LWCA 1LW2A 4LH4A 3AVNA 3AVHA 1Z25A 4O44A 2OPSA 4E7LA 4BDZA 1LV5A 4CEQA 1L3VA 2D0BA 3DRRA 5E41A 3QEIA 1HJRA 4DF8A 4Z4HA 2WOMA 4DQRA 2HMIA 4KHYA 3AA3A 4DTMA 3SUOA 4HCBA 4HUFA 3CFOA 4Q5VA 2E4LA 2IGIA 1ASVA 2VWKA 2O4IA 4MQ3A 4FLZA 4CE9A 3QEPA 1TKTA 1L3UA 3NGZA 4DTOA 4IFYA 5CZ2A 1B9FA 4LY7A 1ASWA 3TWHA 2HHQA 1F21A 3MECA 4FJ5A 3QIOA 2HHUA 1JXEA 4CERA 3QETA 4HUGA 4GMJB 5KRTA 2HHXA 4CK2A 3L2UA 4ZHRA 3ZT4A 1TAQA 4CEZA 4DTJA 3SI6A 4B9LA 4DU4A 2D5RA 1VSJA 1C0UA 1SV5A 2W42A 3TARA 1R0AA 1HQUA 1U4BA 1T03A 1Q9XA 3PO4A 3LWMA 5J2PA 3M8PA 1U48A 3BGRA 4O5BA 3V1QA 3ZSOA 4KTWA 1KVBA 1S9GA 2G8FA 4KRFA 1HMVA 4DSKA 1ITGA 4FJKA 5HRPA 2VWJA 2ETJA 3V1RA 2B6AA 2OA8A 1FXXA 4O0JA 5KGWA 1EETA 1YTAA 2PZSA 3THVA 4DTSA 1S6QA 4Y1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TAF A;  1RTD A;  4JS4 A;  3AA2 A;  3O3F A;  1QS4 A;  4CK1 A;  2GV9 A;  3SV3 A;  3P83 D;  1A5W A;  3M8R A;  4F8R A;  5T7B A;  3HPH A;  4J2A A;  3RR8 A;  3OYI A;  1T7P A;  1ZBH A;  3L2W A;  4YFU A;  4O55 A;  5CY4 A;  3B6O A;  2RPI A;  1W9H A;  1N5Y A;  2IOC A;  3CM5 A;  1C6V A;  3HL8 A;  3LP1 A;  3KLF A;  4LSL A;  1I39 A;  2I5J A;  2Z1I A;  4DQI A;  2R7Y A;  3TAN A;  4KTQ A;  2KFN A;  1A5V A;  4OJR A;  3MXJ A;  1VRT A;  4ID1 A;  5KGX A;  4CK3 A;  1HNI A;  3NHG A;  3AO5 A;  2DFE A;  3CM6 A;  1FKP A;  3DLR A;  3NF8 A;  4CHY A;  3VQ9 A;  4DU1 A;  5SZT A;  1XHZ A;  4OLB A;  2OZM A;  4CGJ A;  1RT2 A;  4B9S A;  3A2F A;  1UA0 A;  4EZ6 A;  4FJJ A;  2DTU A;  4HTU A;  2WON A;  1HYV A;  1IKX A;  4FLV A;  2P5G A;  1WSH A;  2XY6 A;  3RMC A;  1U45 A;  1RT4 A;  1RIL A;  4KHU A;  1QQC A;  1XWL A;  1QSY A;  4J2D A;  1IKW A;  4LSN A;  4FK2 A;  1W0H A;  1NK6 A;  4IG0 A;  4Q0B A;  2PY5 A;  4M3R A;  1TKZ A;  1LAV A;  2YNG A;  3V6D A;  1YT3 A;  3KLE A;  3MXM A;  3K58 A;  4FJM A;  4KHN A;  4CEC A;  1TV6 A;  3IG1 A;  1QHT A;  4I2Q A;  3RMD A;  4NCB A;  3OYD A;  3I8D A;  3KD5 E;  2XHB A;  3ZT3 A;  3AVF A;  4B8A B;  2B4J A;  1HQE A;  4BDY A;  4DSE A;  3HP6 A;  4Z4G A;  4FLW A;  4N56 A;  1KRP A;  1B92 A;  3WNH A;  4KKO A;  4FZY A;  4Z4F A;  1KFD A;  3V9U A;  1S1W A;  3OJU A;  5DMR A;  3PUF A;  5HRN A;  3TAP A;  2G8I A;  3LWL A;  2IDO A;  3LZJ A;  3RTV A;  1TK8 A;  1CXU A;  4HUE A;  3CFP A;  4CFA A;  3PX6 A;  1JLB A;  1RT7 A;  1X9W A;  1TAU A;  1J5O A;  4B08 A;  1HNV A;  1VSI A;  3QO9 A;  4KO0 A;  3K59 A;  1SL0 A;  2HVI A;  3AVK A;  4B9M A;  4FJH A;  4FK0 A;  4FK4 A;  1LWE A;  3MED A;  4IBN A;  2Z1H A;  1KVC A;  4OLA A;  2HVH A;  4IKF A;  4B9T A;  3DLH A;  3AA4 A;  5JS1 A;  3RRH A;  5C42 A;  4NCA A;  1RT5 A;  4H4O A;  4AHS A;  2DFH A;  4FCY A;  2OZS A;  3KD1 E;  4CHN A;  3V9W A;  1KCF A;  1VSM A;  1VRU A;  4KHQ A;  4FLT A;  3ZT2 A;  1JLA A;  3KKR A;  3O4N A;  3MEE A;  4CHP A;  1D8Y A;  1KLN A;  4W5N A;  3P1G A;  3VQC A;  3L2V A;  5J2N A;  2ZE2 A;  3WNG A;  1SKR A;  3AO3 A;  1D9D A;  3S3M A;  3KKS A;  1WAF A;  2E6L A;  2P51 A;  4FLY A;  2BE2 A;  4GVM A;  4AHC A;  4DS4 A;  1JL1 A;  2OPR A;  2DFF A;  4M3X A;  4C8O A;  2DY4 A;  4CGF A;  4R5P A;  3WNF A;  2RN2 A;  1I3A A;  1EX4 A;  3NAE A;  1S9E A;  4DQQ A;  3AO1 A;  4I7F A;  1DTT A;  1RBT A;  3MXI A;  3WNE A;  3S3O A;  2G8K A;  3VQ8 A;  2YKM A;  4KTZ A;  4OKJ A;  4DMN A;  4KI4 A;  2VG5 A;  4DTP A;  4E3S A;  3NF9 A;  1S5J A;  5D3G A;  1JKH A;  5HRO A;  2X6S A;  4DFJ A;  3K5N A;  2G8U A;  3RR7 A;  4DSL A;  2HNZ A;  2Z1J A;  1VSH A;  3B6P A;  4CHQ A;  3KLI A;  4M3Y A;  2F8T A;  5I3U A;  4M42 A;  3NH0 A;  2FBT A;  2HB5 A;  4CHZ A;  3ZSX A;  3O3H A;  3KK3 A;  5CYM A;  3ZSW A;  4BDP A;  4B9V A;  2KZZ A;  1WSG A;  3C6T A;  3DLK A;  4BE0 A;  1HYZ A;  1L3T A;  4Z4E A;  4OPK A;  2RKI A;  1NK9 A;  3HP9 A;  1J53 A;  4CJV A;  3OYE A;  2XY5 A;  2QK9 A;  3DLG A;  3NBP A;  3EYZ A;  1WSF A;  3L2Q A;  3OYC A;  3DLE A;  4JRQ A;  3PO5 A;  3OYH A;  4FM1 A;  1ASU A;  4E1M A;  4CF2 A;  4Z4C A;  5KTQ A;  2RF2 A;  4M45 A;  3SQ2 A;  4KB0 A;  1TGO A;  4CJ3 A;  4PA1 A;  1IG9 A;  5FRM A;  3PY8 A;  4EP5 A;  3NF6 A;  1D5A A;  3DRP A;  4CJU A;  4O0I A;  4AHU A;  4C8L A;  3QIN A;  2YNF A;  1VSE A;  3VQA A;  3VQP A;  4FJ8 A;  4E19 A;  3KK2 A;  2FBX A;  1RTH A;  1JLG A;  1ZBI A;  1RDA A;  1S1T A;  4KRE A;  4HHT A;  5FDL A;  3VQE A;  1NK0 A;  2FC0 A;  4GW6 A;  2FBV A;  1KFS A;  4W5R A;  4F2R A;  5EU7 A;  2QKK A;  4RW4 A;  4CES A;  3HVR A;  3V9S A;  4CHO A;  4CEE A;  4DFM A;  4CGD A;  1U47 A;  2G8H A;  3CYM A;  1EKE A;  3OYJ A;  2F8S A;  4CED A;  2KW4 A;  3KJV A;  2YHA A;  4F2S A;  3U6F A;  3FFI A;  4CGH A;  1QE1 A;  2AJQ A;  5J2M A;  3ZCM A;  1CXQ A;  1EXQ A;  3KLG A;  5KI6 A;  2QXF A;  4CJR A;  3SCX A;  4EZ9 A;  4BE2 A;  3TAE A;  2EX3 A;  4FJG A;  2GBZ A;  1LWF A;  4CGI A;  4DTU A;  1NJZ A;  2P5O A;  1MU2 A;  3ALY A;  1UWB A;  4FW1 A;  4MFB A;  1T8E A;  5C25 A;  3SZ2 A;  2Q3S A;  3TAG A;  1U04 A;  3VQB A;  2Z1G A;  3VQQ A;  5HRS A;  2PYL A;  5I42 A;  1XI1 A;  2KFZ A;  3OYN A;  4J2E A;  3KIO A;  1VK0 A;  3IRX A;  3SPZ A;  3DRS A;  3F73 A;  4CIE A;  1X9M A;  3V81 A;  1HYS A;  3TAB A;  3MAQ A;  1NK4 A;  1XC9 A;  2HHS A;  4XIU A;  4CJ5 A;  3ZT1 A;  2YKN A;  4E89 A;  2ATQ A;  3CFR A;  1RBV A;  4BWJ A;  4RW8 A;  3TI0 A;  2BAN A;  4FJX A;  3JSM A;  4FVM A;  3K57 A;  1NK5 A;  3VA0 A;  3MEG A;  2ITG A;  3H08 A;  2VG7 A;  3SUQ A;  3ZSV A;  4M41 A;  3VQ7 A;  2OPP A;  1BI4 A;  4KAZ A;  1BIZ A;  4BE1 A;  5CZ1 A;  1JLE A;  4I9Q A;  1JLC A;  2KTQ A;  1HRH A;  4KI6 A;  3HVT A;  4IG3 A;  3DM2 A;  3K5M A;  3D0P A;  1XHX A;  3L3U A;  2X78 A;  3VQ4 A;  3HXM A;  3S9H A;  1EP4 A;  2PYJ A;  3LAK A;  1BCM A;  4CJS A;  3OYF A;  4DS5 A;  2NUB A;  4CJK A;  2JGU A;  1C0T A;  1FK9 A;  3V1O A;  3AV9 A;  1S6P A;  1X9S A;  3IAY A;  3OJS A;  3QEX A;  3ZSZ A;  3O3G A;  3RRG A;  4FJ7 A;  1GOB A;  4FLU A;  4E7J A;  4CIG A;  4OKK A;  4CJF A;  1VSD A;  1TKX A;  3I0S A;  3QEV A;  4N76 A;  3OYG A;  3CQ8 A;  3F9K A;  4IDK A;  4AH9 A;  3KK1 A;  4M3Z A;  2BGG A;  1WNS A;  1NOZ A;  1KSP A;  4RW6 A;  3ZT0 A;  5K14 A;  3OYM A;  2HNY A;  4ZTF A;  4HCC A;  3NE6 A;  4KHS A;  3K2P A;  4JLH A;  1REV A;  3O4Q A;  4AHR A;  1G15 A;  5JS2 A;  4KHW A;  2O4G A;  1SKW A;  4AHV A;  3AVC A;  4LH5 A;  3LDS A;  3RMA A;  3LP3 A;  1IKY A;  4PUO A;  3SUN A;  4IFV A;  3LAM A;  3QNO A;  4OGC A;  2F96 A;  2G8V A;  4WE1 A;  4CJ4 A;  4FW2 A;  1JLF A;  3M8S A;  3VA3 A;  1BHL A;  1SL1 A;  4FM2 A;  4E0D A;  4FJ9 A;  4CIF A;  4F3T A;  3NH1 A;  2YNI A;  3HST B;  2XRI A;  3T19 A;  1UA1 A;  3ZSY A;  4QCL A;  1S1X A;  2YNH A;  4ID5 A;  4N47 A;  3OS1 A;  2Y1I A;  3EZ5 A;  4J2B A;  1VSK A;  1ZBF A;  3NGY A;  4CEA A;  5J1E A;  3P5J A;  3G10 A;  3OYK A;  1WN7 A;  1KVA A;  1X1P A;  4YNQ A;  3PV8 A;  4Z0U A;  2X6N A;  4BAC A;  3AO2 A;  3NCI A;  1CLQ A;  2JLE A;  3ZSR A;  1TK0 A;  1LW0 A;  3OYB A;  3LP2 A;  4DQP A;  3VQ6 A;  3OS0 A;  5HRR A;  1BQN A;  3VN5 A;  1WSJ A;  4CJQ A;  4DTN A;  4C8M A;  1KLM A;  4DQS A;  4CJW A;  1ZBU A;  3S3N A;  1SUQ A;  3SQ0 A;  1VSL A;  3AVA A;  3LPU A;  1YTU A;  4RW7 A;  3SUP A;  3ITH A;  3SQ1 A;  3AVI A;  2HHV A;  1C1A A;  5CYQ A;  3DMJ A;  3U3G A;  3OVN A;  1TVR A;  1IKV A;  4FM0 A;  4FYD A;  2VG6 A;  1C1B A;  2D0A A;  4BWM A;  2A1R A;  4OPJ A;  1HPZ A;  4B3O A;  4NYF A;  1RCH A;  4HVJ A;  3QES A;  4DSF A;  1Q8I A;  1JLQ A;  3HPG A;  3LP0 A;  3AVL A;  3NFA A;  1L5U A;  1J9A A;  3RWU A;  3HK2 A;  2ZQB A;  4UQG A;  2GUI A;  4O4G A;  1RDB A;  3M8Q A;  4CF8 A;  5HLF A;  3OY9 A;  1WAJ A;  1CZB A;  3DYA A;  4H8K A;  3ZSQ A;  3OS2 A;  4DLG A;  5HBM A;  4F4K A;  3VQD A;  4C8K A;  1BIU A;  2P1J A;  4OKE A;  4CJT A;  3KLH A;  4DFP A;  4KV8 A;  3VQ5 A;  3SPY A;  3NDK A;  4DLE A;  3AVB A;  1DTQ A;  1GOA A;  1TL1 A;  1A5X A;  4E1N A;  3QLH A;  3RMB A;  1O1W A;  3TAM A;  4OVL A;  4DG1 A;  1QTM A;  4E7I A;  2EHG A;  3BDP A;  1NK8 A;  3C6U A;  1K6Y A;  4FZX C;  4ELV A;  3L3V A;  3LPT A;  4CCH A;  4M3T A;  3HT3 A;  4K8Z A;  1L3S A;  4FJN A;  3UIQ A;  4FXD A;  4CJP A;  1Y97 A;  2ZD1 A;  1RNH A;  4W5Q A;  1RT6 A;  3SYZ A;  2X74 A;  3AO4 A;  3NF7 A;  1B9D A;  4CEB A;  1J54 A;  4H4M A;  4CJL A;  3EY1 A;  4G1Q A;  3NGI A;  4FJL A;  4EP4 A;  3QER A;  4KPY A;  3LAL A;  3K5O A;  4DF4 A;  3V4I A;  4ELU A;  4DSI A;  4L8R B;  3HM9 A;  2OYQ A;  4E7K A;  3AVJ A;  4N41 A;  4K8X A;  1WSE A;  4Y1D A;  3SNN A;  3QEW A;  1NJY A;  2KQ2 A;  2Y1J A;  2IAJ A;  3SJJ A;  1BCO A;  4CFC A;  4ICL A;  1QSL A;  5DK5 A;  1YVU A;  4I2P A;  4NCG A;  4TSX A;  1TKD A;  4AHT A;  2D0C A;  1NJX A;  1RDD A;  1RTJ A;  2A1S A;  1RTI A;  3DI6 A;  4QOZ B;  3ASM A;  1RDC A;  3KTQ A;  4Z4I A;  3V9Z A;  5KRS A;  3IS9 A;  5SWM A;  4W5O A;  2HHW A;  1JXB A;  4FJI A;  3HO1 A;  2FBY A;  1UOC A;  3QNN A;  4DWI A;  1RBS A;  1Z26 A;  3TAQ A;  3AVG A;  5FRO A;  1S1V A;  3U3Y A;  1Q9Y A;  1WSI A;  3AA5 X;  4QAG A;  3ISN C;  2XY7 A;  3C94 A;  3D45 A;  1TK5 A;  3HJF A;  4C8N A;  5HP1 A;  3C95 A;  3JYT A;  4RW9 A;  3CG7 A;  2XO7 A;  4DFK A;  5J2Q A;  1SL2 A;  4DU3 A;  4M3W A;  4NYN A;  4AIL C;  2B5J A;  1IO2 A;  2OPQ A;  1BIS A;  4CEO A;  1NOY A;  2IS3 A;  2HW3 A;  1RBU A;  4OGE A;  3PX0 A;  1RBR A;  4FZZ A;  2E6M A;  2XY8 A;  3T1A A;  4JS5 A;  1ZYQ A;  1JL2 A;  4I9L A;  3SV4 A;  4DTX A;  3HPO A;  2QKB A;  3PX4 A;  1BGX T;  1ZBL A;  1C0M A;  3ULD A;  4B9U A;  4E7H A;  1U49 A;  4KFB A;  1BQM A;  3T3F A;  3OYL A;  1N6Q A;  1S1U A;  2G8W A;  5FRN A;  4FLX A;  3I0R A;  1IH7 A;  4N5S A;  3NH2 A;  1WLJ A;  3HYF A;  1BI4 B;  4W5T A;  4F3O A;  2HHT A;  1TL3 A;  4CFD A;  4CEF A;  2HND A;  1C1C A;  3L8B A;  2BDP A;  3L2R A;  4B9N A;  1DLO A;  1UAX A;  3V9X A;  1KTQ A;  4PY5 A;  1T05 A;  3SQ4 A;  1SKS A;  3DOK A;  1NJW A;  3K5L A;  1FKO A;  2YHB A;  3DOL A;  4RG8 A;  3LZI A;  4CF1 A;  1NKC A;  1D9F A;  3DLB A;  4KB1 A;  3TR8 A;  4JRP A;  4PQU A;  1QSS A;  1RT3 A;  4ZTJ A;  4CF9 A;  4DTR A;  2LSN A;  3QIP A;  1NKE A;  4CGG A;  4B8C A;  4CJE A;  1VSF A;  3E01 A;  1NKB A;  4LD0 A;  1LAW A;  4ELT A;  4DSJ A;  1CZ9 A;  4PWD A;  2KZM A;  3AVM A;  3OYA A;  3G0Z A;  4M3U A;  1NK7 A;  2IC3 A;  3LAN A;  1GOC A;  5C24 A;  1RT1 A;  2YV0 X;  1BL3 A;  4CFB A;  4CF0 A;  1LWC A;  1LW2 A;  4LH4 A;  3AVN A;  3AVH A;  1Z25 A;  4O44 A;  2OPS A;  4E7L A;  4BDZ A;  1LV5 A;  4CEQ A;  1L3V A;  2D0B A;  3DRR A;  5E41 A;  3QEI A;  1HJR A;  4DF8 A;  4Z4H A;  2WOM A;  4DQR A;  2HMI A;  4KHY A;  3AA3 A;  4DTM A;  3SUO A;  4HCB A;  4HUF A;  3CFO A;  4Q5V A;  2E4L A;  2IGI A;  1ASV A;  2VWK A;  2O4I A;  4MQ3 A;  4FLZ A;  4CE9 A;  3QEP A;  1TKT A;  1L3U A;  3NGZ A;  4DTO A;  4IFY A;  5CZ2 A;  1B9F A;  4LY7 A;  1ASW A;  3TWH A;  2HHQ A;  1F21 A;  3MEC A;  4FJ5 A;  3QIO A;  2HHU A;  1JXE A;  4CER A;  3QET A;  4HUG A;  4GMJ B;  5KRT A;  2HHX A;  4CK2 A;  3L2U A;  4ZHR A;  3ZT4 A;  1TAQ A;  4CEZ A;  4DTJ A;  3SI6 A;  4B9L A;  4DU4 A;  2D5R A;  1VSJ A;  1C0U A;  1SV5 A;  2W42 A;  3TAR A;  1R0A A;  1HQU A;  1U4B A;  1T03 A;  1Q9X A;  3PO4 A;  3LWM A;  5J2P A;  3M8P A;  1U48 A;  3BGR A;  4O5B A;  3V1Q A;  3ZSO A;  4KTW A;  1KVB A;  1S9G A;  2G8F A;  4KRF A;  1HMV A;  4DSK A;  1ITG A;  4FJK A;  5HRP A;  2VWJ A;  2ETJ A;  3V1R A;  2B6A A;  2OA8 A;  1FXX A;  4O0J A;  5KGW A;  1EET A;  1YTA A;  2PZS A;  3THV A;  4DTS A;  1S6Q A;  4Y1C A; 
#chains in the Genus database with same CATH topology
 4FSV A;  4BRD A;  1RTD A;  3SV3 A;  4EHU A;  2P9K B;  4J2A A;  4F8R A;  1ZBH A;  3BP8 A;  3FE1 A;  3FZL A;  4Y0W A;  3RR8 A;  1K8A O;  4O8K A;  3UKU A;  4B1X B;  4JKC A;  1NM1 A;  2Z1I A;  2I5J A;  3AGK A;  3MXJ A;  5KGX A;  3CM6 A;  2DFE A;  3DLR A;  1HYS A;  4AM6 A;  4DU1 A;  1XHZ A;  3VER A;  2OZM A;  1OH6 A;  4EZ6 A;  4CZG A;  4KBO A;  3P38 A;  2O8F B;  3CC7 N;  1HYV A;  4C1N I;  4FLV A;  1WSH A;  2XY6 A;  3VF2 A;  1XWL A;  3ZX0 A;  4H5R A;  1IKW A;  1Q86 O;  4M3R A;  3V6D A;  1LAV A;  1KXP A;  3KLE A;  3MXM A;  3K58 A;  3CCJ N;  4CEC A;  3IG1 A;  1QHT A;  3RMD A;  3OYD A;  2XHB A;  4DSE A;  4BDY A;  4FLW A;  1N36 K;  4Z4F A;  3V9U A;  1S1W A;  1HLU A;  3TAP A;  1E3M A;  3LWL A;  4OO1 J;  4YOU A;  1TK8 A;  1CXU A;  1NBW A;  3CFP A;  1RT7 A;  1YI2 N;  1VSI A;  4FK4 A;  4B9T A;  3DLH A;  3AA4 A;  4C23 A;  1RT5 A;  2QI2 A;  4AHS A;  5H1S Q;  1KCF A;  1K8K A;  1VSM A;  1HNX K;  1HPM A;  3ZT2 A;  3H46 O;  4J8F A;  5AQS A;  1KLN A;  2P9S B;  3S3M A;  1WAF A;  2E6L A;  4WQ5 C;  3HOT A;  4M3X A;  4V19 S;  4R5P A;  1ZC6 A;  1EX4 A;  4NB4 A;  1NU0 A;  3AO1 A;  4I7F A;  3CCE N;  1SQK A;  2YKM A;  4KTZ A;  3OBW A;  1S5J A;  5D3G A;  1JKH A;  4IO9 L;  4DUZ K;  5HRO A;  1HNW K;  3B6P A;  2F8T A;  3I55 N;  4GNI A;  3WXM B;  3H1Q A;  3E9O A;  2KZZ A;  1U6Z A;  1HYZ A;  4Z4E A;  4OPK A;  3HP9 A;  1J53 A;  4CJV A;  3OYE A;  2RHK A;  3EYZ A;  4JKG A;  4NLB A;  5BN8 A;  4IOA L;  4FM1 A;  1NGF A;  1Q18 A;  4H0T B;  4CF2 A;  5KTQ A;  2RF2 A;  3SQ2 A;  1IG9 A;  2J4R A;  1WBB A;  5AQX A;  1VSE A;  4BR4 A;  3VQP A;  2FBX A;  5JLH A;  1JLG A;  3OHR A;  3A8Y A;  2HHH K;  1HX1 A;  4H5V A;  2OTJ N;  1NK0 A;  2FC0 A;  1KFS A;  5EVZ A;  3A5L C;  5EU7 A;  4CES A;  3V9S A;  4CHO A;  1ZBS A;  3CYM A;  3OYJ A;  3QFP A;  3FLC O;  5KPT A;  2KW4 A;  2YHA A;  3U6F A;  2AJQ A;  5J2M A;  4LF9 K;  2O8E A;  3KLG A;  3H1V X;  5KI6 A;  1QQO A;  3BF3 A;  3TAE A;  5JVG L;  3M1F A;  2P5O A;  3ALY A;  1T44 A;  2Z1G A;  5KPZ A;  2FXU A;  2PYL A;  5I42 A;  3KIO A;  3DRS A;  3TAB A;  2UU9 K;  3UKU B;  1NWK A;  3ZT1 A;  4E89 A;  1X9J A;  3CFR A;  4DR5 K;  4AQY K;  3O9U A;  3D7E O;  2JWL A;  4FO0 A;  2BAN A;  1EWQ A;  1NK5 A;  2ITG A;  4BQZ A;  4IOC L;  4KAZ A;  3VQ7 A;  1BI4 A;  4BQL A;  1BIZ A;  4BE1 A;  1JLC A;  3D0P A;  4FL9 A;  3FZM A;  2X78 A;  3HXM A;  5C12 A;  4CJS A;  3OYF A;  4DS5 A;  3R6M A;  3LDO A;  4CJK A;  1S6P A;  3ZSZ A;  4FLU A;  2BTF A;  4OKK A;  1VSD A;  2WUS A;  1TKX A;  4BRH A;  3OYG A;  3CQ8 A;  1IBL K;  3HM8 A;  3ZT0 A;  5EX5 A;  3MWT A;  3K2P A;  4JLH A;  4AHR A;  4KHW A;  3AVC A;  3VOV A;  5AFU H;  3SUN A;  3FZK A;  1MA9 B;  3LAM A;  4IFV A;  3TSQ A;  4WE1 A;  1JLF A;  3M8S A;  2KKZ A;  3D2F B;  4FWR A;  1IV0 A;  4CIF A;  4B1Y B;  4F3T A;  4ILJ A;  3ZSY A;  5BR9 A;  3J7Z O;  4B3T K;  1BA0 A;  1E4G T;  4ILG B;  3OS1 A;  3CCR N;  3DAW A;  4CEA A;  5J1E A;  3P5J A;  3PV8 A;  2X6N A;  3MCP A;  3O5B A;  3ZSR A;  1TK0 A;  1LW0 A;  1S22 A;  3VQ6 A;  3O4W A;  3CD6 N;  5AQQ A;  2QXL A;  1K8K B;  4CJQ A;  1QZ5 A;  4DTN A;  4BC3 A;  1KLM A;  4CJW A;  3THY B;  1VSL A;  1YTU A;  3AVI A;  3TTD A;  2HHV A;  4KHP K;  5CYQ A;  3L4I A;  1NGD A;  4IEI A;  4JK7 A;  3VMF B;  4FYD A;  2VG6 A;  2A1R A;  1GLF O;  4NYF A;  1RCH A;  5AQG A;  4DSF A;  1Q8I A;  2IIR A;  2Q1N A;  1L5U A;  3LP0 A;  3AVL A;  2E1Y A;  2ZQB A;  4BRC A;  1RDB A;  2I7P A;  1WB9 A;  4RWT A;  4YOT A;  1BIU A;  3FZH A;  3EEQ A;  4JI6 K;  5JIC A;  3AVB A;  1NOY A;  1QTM A;  3QLH A;  4E7I A;  3BDP A;  4JKG B;  3C6U A;  4FZX C;  4ELV A;  3L3V A;  4CCH A;  1L3S A;  4FJN A;  3UIQ A;  4CJP A;  2ZD1 A;  3FZF A;  4CEB A;  3MN9 A;  4CD1 A;  4KPY A;  3LAL A;  3V4I A;  4ELU A;  4L8R B;  1YUW A;  1VQL N;  5M1N A;  3SNN A;  1VQO N;  5LL6 Z;  2V52 B;  4AHT A;  2YX6 A;  4CI6 A;  2A1S A;  2QWO A;  3IS9 A;  4BY9 C;  1YHQ N;  4FJI A;  4WQ4 A;  3VGM A;  5AQI A;  1X3N A;  2D4W A;  3AA5 X;  1P90 A;  3C94 A;  1YJN N;  4YOW A;  1ATR A;  4C8N A;  4YOR A;  3CG7 A;  2XO7 A;  5J2Q A;  4M3W A;  5GAH P;  2OPQ A;  2V7Y A;  1X3M A;  3PX0 A;  3PIO L;  3UKR A;  3T1A A;  1JL2 A;  5AQH A;  2QKB A;  4BG8 A;  3PX4 A;  1BGX T;  1BU6 O;  1C0M A;  3MN7 A;  4E7H A;  3THX B;  1BQM A;  1N6Q A;  4F3O A;  2HHT A;  4W5T A;  1BI4 B;  3PLA A;  4CEF A;  3L8B A;  1UAX A;  1T05 A;  1SKS A;  3CJ1 A;  5JLF A;  3TR8 A;  1JCG A;  2VQE K;  1RT3 A;  3VGK A;  2LSN A;  3O6W A;  2UUC K;  5GAG P;  5CR4 A;  5M1Q A;  4LD0 A;  1LAW A;  3BF1 A;  3I33 A;  3OYA A;  1NK7 A;  2QWL A;  1XC3 A;  1BL3 A;  1LWC A;  4LFA K;  3CQY A;  2F9T A;  4E7L A;  2ZJP L;  2HMP A;  5KQ8 A;  2GWK A;  4YDU A;  5E41 A;  4DF8 A;  2WOM A;  3KWI A;  1U2V B;  4HCB A;  3CFO A;  3UE5 A;  4Q5V A;  2PAV A;  1VHX A;  4FLZ A;  4BVO A;  3NGZ A;  5E26 A;  4IFY A;  3MEC A;  1YF5 L;  2HHU A;  1NGE A;  2HHX A;  1FJG K;  2NLX A;  4B9L A;  3SI6 A;  2D5R A;  1SV5 A;  1HQU A;  1T03 A;  3PO4 A;  2HBJ A;  4BRA A;  1NMD A;  5J2P A;  1U48 A;  2G8F A;  4KRF A;  1HMV A;  1RDU A;  1SAZ A;  4K0K K;  4YOY A;  2P9P A;  5KGW A;  1YTA A;  4NLC A;  1S6Q A;  3CME N;  2KLA A;  1JCE A;  3AGR A;  1S72 N;  1QS4 A;  4CK1 A;  3LM2 A;  3W0L A;  1NLV A;  3HPH A;  4MO5 A;  1VAZ A;  3OYI A;  5CY4 A;  2RPI A;  1W9H A;  4B3M K;  3CM5 A;  3HL8 A;  3KLF A;  4DQI A;  3GDQ A;  2YI1 A;  4JI5 K;  2KFN A;  1A5V A;  1GLA G;  4PHT X;  3QIC A;  2HST A;  3NHG A;  3NF8 A;  2QWM A;  3TU5 A;  1RT2 A;  4DQ8 A;  1UA0 A;  4IJN A;  2WON A;  4JKH A;  1IKX A;  1BOT O;  2P5G A;  3VPZ A;  2HBK A;  1RT4 A;  1QQC A;  1QSY A;  3C7N A;  3H3N O;  2O8D A;  1W0H A;  3CET A;  3QBW A;  1NK6 A;  2HF3 A;  4Q0B A;  2PY5 A;  3EE9 A;  2YNG A;  2Q0R A;  5M1P A;  3G71 N;  4PKI A;  4NCB A;  3AAQ A;  3ZT3 A;  4Z4G A;  2NRR A;  4JD2 A;  4N56 A;  3CI5 A;  3WNH A;  3E9L A;  5LY3 A;  3OJU A;  4JK9 A;  5DMR A;  3PUF A;  5HRN A;  4M7X A;  4CFA A;  3PX6 A;  2E2P A;  3ENB A;  3DJC A;  4CVN E;  1J5O A;  3O9R A;  1HNV A;  3F5T A;  3U4L A;  4BRQ A;  3QO9 A;  3K59 A;  1SL0 A;  4FJH A;  4FK0 A;  3MED A;  5C2F A;  4OLA A;  3ZET A;  3NMU A;  4UY8 O;  1NGH A;  4KH6 A;  2DFH A;  3KD1 E;  3F9M A;  4CHN A;  2HBM A;  4HWI A;  3PSF A;  1VRU A;  3PIP L;  1JLA A;  2Q97 A;  3MEE A;  1D8Y A;  5LMU K;  3VQC A;  1OKJ A;  3WNG A;  4DB3 A;  3GBT A;  5AZJ A;  2P51 A;  4GVM A;  2OPR A;  1GLD G;  4C8O A;  4CGF A;  1I3A A;  2E1Z A;  3NAE A;  3LDP A;  1DTT A;  3MXI A;  4ISE A;  3S3O A;  2G8K A;  3VQ8 A;  4DMN A;  4KI4 A;  4OKJ A;  4DV2 K;  2A42 A;  4E3S A;  3KZB A;  3O9T A;  3K5N A;  4DSL A;  1VSH A;  4GVE A;  4CHQ A;  4CZL A;  5I3U A;  5MLC Q;  2HB5 A;  3KK3 A;  5CYM A;  3ZSW A;  4BDP A;  1WSG A;  1L3T A;  1XNR K;  3DLL L;  3J80 O;  1NK9 A;  2VWB A;  4CZM A;  2FSN A;  3L2Q A;  3OYC A;  4JRQ A;  4YOV A;  4IJA A;  4M45 A;  4KB0 A;  3IFR A;  4CJ3 A;  4JI3 K;  4EP5 A;  1D5A A;  3QIN A;  2RE2 A;  2YNF A;  4FJ8 A;  1RTH A;  4FOI A;  1ZBI A;  1RDA A;  4KRE A;  3J7Y P;  4HHT A;  4GW6 A;  5EXW A;  4CEE A;  3CCM N;  2G8H A;  1EKE A;  3ID6 A;  1C0G A;  4CED A;  3KJV A;  4U7B A;  3FFI A;  1QE1 A;  3SMP A;  2O8B A;  4CJR A;  2NRX A;  2EX3 A;  1NJZ A;  1NGC A;  4FW1 A;  2P9P B;  4PKH A;  5C25 A;  3TAG A;  4FWQ A;  5BRD A;  4E1J A;  4BR2 A;  4BC5 A;  3G25 A;  1XI1 A;  2KFZ A;  3OYN A;  3AY9 A;  3ENO A;  4J2E A;  2IVN A;  1VK0 A;  3SPZ A;  3CHW A;  1OH8 A;  4K41 A;  3NVK A;  2ATQ A;  4BWJ A;  4RW8 A;  4IFE A;  1KD1 O;  1IJJ A;  3IDH A;  5M1F A;  3CJC A;  2OCE A;  3H08 A;  2VG7 A;  1HUX A;  3ZSV A;  4M41 A;  4K43 A;  4I9Q A;  2UUA K;  5ADX H;  2ZGY A;  3L3U A;  3VQ4 A;  2PYJ A;  3BZK A;  3LAK A;  2YJF A;  2YHX A;  3CPE A;  2A6A A;  2JGU A;  3V1O A;  3RRG A;  4FJ7 A;  4E7J A;  4CIG A;  3IKM A;  4JKB A;  3I0S A;  4FWK A;  3WT0 A;  4AH9 A;  1WNS A;  1KSP A;  5K14 A;  4HCC A;  2HNY A;  4KHS A;  3NE6 A;  2IVO A;  4BRG A;  1REV A;  2V51 B;  3O4Q A;  3WEE A;  2O4G A;  4YY3 K;  3LP3 A;  1IKY A;  3R1X A;  3QNO A;  4OGC A;  1MDU B;  3ZLJ A;  1SL1 A;  2P9N A;  3NH1 A;  5C0Y A;  1JJ2 M;  1ZXO A;  1VSK A;  4IO8 A;  3G10 A;  3OYK A;  1WN7 A;  3OTO K;  3LDN A;  3AO2 A;  1GLB G;  2JLE A;  4EFH A;  3OYB A;  3LP2 A;  4DQP A;  5AQW A;  1Z6R A;  1BQN A;  4KH5 A;  1WSJ A;  1ZBU A;  3S3N A;  4DV6 K;  3AVA A;  3LPU A;  3VET A;  5AZJ B;  3SUP A;  2F4V K;  2E8A A;  1NMN A;  3DMJ A;  1V4S A;  3OVN A;  4OPA A;  5AQM A;  2D0A A;  5BPM A;  1RFQ A;  4OPJ A;  1T3V A;  1HPZ A;  3QES A;  3VEV A;  1JLQ A;  5LJW A;  3HK2 A;  1J9A A;  1ATN A;  4DV7 K;  3HRG A;  5HOO A;  2ZJR L;  1CZB A;  3ZSQ A;  3S41 A;  3VQD A;  4OKE A;  4EHT A;  3JS6 A;  3NDK A;  4DLE A;  1DTQ A;  1O1W A;  4DG1 A;  4OVL A;  5BR8 K;  2EHG A;  1K73 O;  3LL3 A;  1H1V A;  3HT3 A;  4K8Z A;  1P8Z A;  5AFU A;  5GIO A;  4FXD A;  3HSC A;  1RT6 A;  2X74 A;  4CJL A;  4FJL A;  3QER A;  5AQK A;  4DSI A;  4N41 A;  3O8M A;  2QTD A;  3CJ7 A;  2KQ2 A;  1BCO A;  4ICL A;  2UXB K;  5DK5 A;  1YVU A;  4I2P A;  3HBT A;  3DXM A;  4TSX A;  3MDQ A;  1NJX A;  1RTJ A;  5AJ3 K;  1V4T A;  4QOZ B;  3ASM A;  5SWM A;  3I56 N;  2O8C A;  3E66 A;  2O8B B;  1UOC A;  2GX9 A;  3QNN A;  4ISG A;  1Z26 A;  3G4S N;  1S1V A;  5AQF A;  3U3Y A;  1Q9Y A;  1WSI A;  4M63 C;  2VCP A;  2XY7 A;  4H5W A;  3D45 A;  1TK5 A;  4JAX A;  3J81 O;  5HP1 A;  4RW9 A;  1SL2 A;  4DU3 A;  4NYN A;  4AIL C;  1IO2 A;  3A0I X;  4JKE A;  4CEO A;  4FWP A;  2HW3 A;  2CGL A;  1G99 A;  4OGE A;  1VQ5 N;  4FZZ A;  3RVC A;  3CJB A;  3EZW A;  3THW A;  3SV4 A;  3HPO A;  1ZBL A;  5AQU A;  3CER A;  3MK6 A;  3T3F A;  1DGK N;  3I0R A;  4N5S A;  3NH2 A;  2VYP A;  1TL3 A;  4CFD A;  2HND A;  4B9N A;  1DLO A;  1NJW A;  3K5L A;  4RG8 A;  3DOL A;  3WQU A;  1NKC A;  1VQM N;  1D9F A;  3DLB A;  4KB1 A;  1HJO A;  4JRP A;  1HR0 K;  1ESV A;  3M5R A;  3QIP A;  3FR0 A;  4CGG A;  4B8C A;  4CJE A;  1NKB A;  3GL1 A;  4PWD A;  5AQJ A;  3AVM A;  3G0Z A;  4B1U B;  2IC3 A;  5BRF A;  4QS7 A;  2YV0 X;  5FPD A;  1LW2 A;  3AVN A;  3AVH A;  4CJ7 A;  1LV5 A;  1JCF A;  4JNE A;  4IDH A;  4CEQ A;  1HJR A;  2A3Z A;  4Z4H A;  4DQR A;  2HMI A;  4B1Z A;  3AA3 A;  3SUO A;  2P9N B;  4HUF A;  4MQ3 A;  3QEP A;  2DPN A;  1TKT A;  4FPB A;  2GWJ A;  5CZ2 A;  2YJE A;  1E4F T;  3ZYY X;  4LY7 A;  3TWH A;  1F21 A;  4FJ5 A;  3QET A;  2E2O A;  2ZF5 O;  3Q7C A;  4ZHR A;  3ZT4 A;  1TAQ A;  2E20 A;  3WXL A;  1VSJ A;  2W42 A;  3TAR A;  1Q9X A;  1U4B A;  5AQZ A;  2E88 A;  3TSU A;  3LWM A;  5F1X A;  3ZSO A;  4KTW A;  4LFC K;  1S9G A;  3GE1 A;  4PL8 A;  4DSK A;  1ITG A;  4FJK A;  5HRP A;  1XNQ K;  2VWJ A;  1VQN N;  1VQ6 N;  2PZS A;  1J5E K;  1TUU A;  5GIN A;  3TAF A;  3WXJ A;  4GY2 B;  3EO3 A;  3P83 D;  1A5W A;  5T7B A;  3C65 A;  1XMQ K;  4WQ4 C;  4O55 A;  2W40 A;  2IOC A;  1C6V A;  1I39 A;  1KAY A;  3CPW M;  4KTQ A;  4JI8 K;  1EWR A;  1J6Z A;  2NNW A;  3K9K A;  1K9M O;  1HNI A;  5AQV A;  2O8E B;  3SAG A;  3AO5 A;  4CHY A;  3VQ9 A;  1NG9 A;  4OLB A;  3HTV A;  2Q0U A;  4B9S A;  4FJJ A;  3A5N C;  1NJI O;  2DTU A;  2NRH A;  3DWL A;  4HTU A;  3L6Q A;  3RMC A;  1U45 A;  4B3R K;  3MN5 A;  4KHU A;  1DKG D;  4NXN K;  3D2E A;  4U67 L;  4J2D A;  1YIJ N;  5FPM A;  2V7Z A;  2FF3 B;  4LSN A;  4FK2 A;  1TKZ A;  1YT3 A;  2W41 A;  4KHN A;  4FJM A;  3RSE A;  4I2Q A;  3U8X A;  4K25 A;  1GLC G;  2I7N A;  3Q7B A;  3KD5 E;  4B8A B;  1HQE A;  4G9Z A;  2O8C B;  2D0O A;  4KKO A;  4FZY A;  1N8R O;  2QW9 A;  3EN9 A;  3LZJ A;  3RTV A;  2P9U A;  1NNE A;  2GEM A;  3OW2 M;  4CW7 B;  1TAU A;  4B08 A;  3T1H K;  2NZT A;  1LCU A;  4KO0 A;  3LDL A;  2D0P A;  3AVK A;  1MWK A;  1LWE A;  3R3L A;  4IBN A;  2WC9 A;  3BY5 A;  5EOY A;  2Z1H A;  1RDW X;  4YDU C;  4BR7 A;  3L0Q A;  4QS8 A;  3O1B A;  5JS1 A;  1RGI A;  4NCA A;  4H4O A;  3V9W A;  4KHQ A;  5AQR A;  3O4N A;  4CHP A;  4W5N A;  3P1G A;  4B3S K;  3L2V A;  5J2N A;  4O8U A;  1SKR A;  1D9D A;  3KKS A;  4CBX A;  3BZC A;  4FLY A;  2BE2 A;  4AHC A;  1JL1 A;  2GEL A;  5FPE A;  4ILH A;  1ILY A;  2KHO A;  2DY4 A;  3WNF A;  3DXK A;  2VGN A;  2VG5 A;  4F9O A;  4DTP A;  1YJ9 N;  4DFJ A;  1CZA N;  4JKA A;  2Z1J A;  4M3Y A;  1Y64 A;  3KLI A;  2QEX N;  4M42 A;  2P9L A;  4CHZ A;  3O3H A;  2QWP A;  3DLK A;  4BE0 A;  4IXC A;  5GAE P;  1NGA A;  3IUC A;  3O9S A;  2QK9 A;  4LF5 K;  5HL7 L;  3DLE A;  3PO5 A;  3OYH A;  1QVG M;  4E1M A;  4BR5 A;  2YCH A;  3PY8 A;  4EIA A;  3NF6 A;  3ENH A;  5BPN A;  4CJU A;  4O0I A;  4AHU A;  4A2B A;  4MDB A;  4E19 A;  3KK2 A;  1HKG A;  4JI7 K;  5FPN A;  3VF4 A;  1S1T A;  2E2N A;  5FDL A;  3VQE A;  5KQD A;  4F2R A;  3OBY A;  4W5R A;  2QKK A;  4RW4 A;  4DFM A;  1U47 A;  2F8S A;  4CGH A;  2ITM A;  1CXQ A;  3SCX A;  4EZ9 A;  4BE2 A;  2VGM A;  4WFB L;  1HNZ K;  1XUP O;  4H0Y B;  3ATV A;  2NRW A;  1Z05 A;  3M3Z A;  5HRS A;  4JI1 K;  4WCE L;  2Q36 A;  5LJV A;  1X9M A;  2HHS A;  3MAQ A;  1GLE G;  4XIU A;  3T7Z A;  4CJ5 A;  2YKN A;  5ELZ A;  1RBV A;  2A40 A;  4FVM A;  3ZEU A;  3K57 A;  3VA0 A;  1QQM A;  3P31 A;  4BR9 A;  3JAM O;  2KTQ A;  1HRH A;  3VEO A;  4KI6 A;  3HVT A;  3DM2 A;  1HKB A;  4JHD A;  1BCM A;  2CGJ A;  4O5F A;  3O9Q A;  4LF7 K;  4FWN A;  3CC4 N;  3D2E B;  3J7A P;  1FK9 A;  1X9S A;  3IAY A;  2IVP A;  3O3G A;  3QEX A;  1N32 K;  1GOB A;  4CZK A;  3CXC M;  4N76 A;  3RSE B;  4IDK A;  3KK1 A;  4A61 A;  4H0O A;  1NOZ A;  1KAZ A;  4RW6 A;  3F2K A;  3UKR B;  2P9S A;  5AR0 A;  1Q81 O;  5JS2 A;  4M7Y A;  4PKG A;  1XQS C;  2ZWH A;  3LDS A;  3RMA A;  5IT9 O;  3AAP A;  4BRF A;  4FW2 A;  3VA3 A;  3H45 C;  4FM2 A;  2ZGZ A;  4FJ9 A;  2YNI A;  3HST B;  2XRI A;  3T19 A;  1UA1 A;  3QML A;  2YNH A;  4ID5 A;  5AQL A;  3EZ5 A;  4MDA A;  1ZBF A;  4A59 A;  3CCL N;  2F9W A;  3C6H A;  2W6K A;  4YNQ A;  1KVA A;  1VQ4 N;  2JWK A;  5HRR A;  4C8M A;  4JI2 K;  1SUQ A;  3SQ0 A;  4BRI A;  1SZ2 A;  4A5A A;  1NGJ A;  4LF8 K;  4DV5 K;  3DXK B;  5ADX A;  2ASO A;  3TSP A;  4H0X B;  4HVJ A;  1GLJ O;  4IEE A;  3HPG A;  3RWU A;  2NRV A;  5TKY A;  4I6M A;  5HLF A;  3OY9 A;  4WFA L;  4H8K A;  3K9J A;  4DLG A;  2P9L B;  4A57 A;  4JEP A;  4CJT A;  4DFP A;  4KV8 A;  5LMN K;  3SPY A;  4H5T A;  1OVY A;  4E1N A;  1GOA A;  1TL1 A;  1A5X A;  4BGB A;  3RMB A;  4H0V B;  3TAM A;  4OX9 K;  4BRO A;  1NK8 A;  2EWS A;  1DEJ A;  1K6Y A;  3LPT A;  1OVQ A;  4WFN L;  1Y97 A;  4W5Q A;  1RNH A;  3SYZ A;  4DTU A;  3EY1 A;  5AQY A;  1B9D A;  2AA4 A;  4H4M A;  4IWV A;  3NGI A;  2G8I A;  4G1Q A;  4MLH A;  4DF4 A;  3HM9 A;  4K8X A;  4Y1D A;  2GUP A;  3O80 A;  4H5N A;  3QEW A;  2Y1J A;  4CFC A;  3FFK B;  4X64 K;  1RDD A;  1SS6 A;  1RTI A;  3DI6 A;  4Z4I A;  1RDC A;  2VQF K;  4W5O A;  1NGB A;  2FBY A;  1W2B M;  4DWI A;  3TAQ A;  1BO5 O;  3AVG A;  5FRO A;  1NGI A;  4QS9 A;  3ISN C;  3HJF A;  1BA1 A;  1KC8 O;  3GOI A;  2YHW A;  3C95 A;  3JYT A;  3I8B A;  2W6L A;  4DR2 K;  2F7T A;  2P9I A;  2NRT A;  1GLL O;  3C7N B;  4JI0 K;  1BIS A;  2O8D B;  4BRL A;  1RBR A;  4I9L A;  4DTX A;  3CCQ N;  3ULD A;  3ZEU B;  4KFB A;  1S1U A;  2PBD A;  4FLX A;  4JD2 B;  3HYF A;  3D2F A;  4DHY A;  1C1C A;  1N34 K;  5EY4 A;  4GV3 A;  4HTL A;  3V9X A;  1KTQ A;  4PY5 A;  4JHD B;  3SQ4 A;  1EQY A;  2YHB A;  1YVN A;  4CF1 A;  5M1O A;  4PQU A;  3VEN A;  1TYQ A;  4CZE A;  1VSF A;  3T1Y K;  3TPQ A;  1CZ9 A;  4BR0 A;  4M3U A;  4FWS A;  3LAN A;  5C24 A;  3ZET B;  1RT1 A;  3THY A;  4CFB A;  4CF0 A;  4XH5 A;  5AZI A;  4LH4 A;  1W7A A;  2OPS A;  4CBW A;  2D0B A;  3A5M C;  3QEI A;  3O1W A;  2D1K A;  4A5B A;  3CCV N;  2E4L A;  4DV1 K;  1ASV A;  2ZJQ L;  2VWK A;  3CQX A;  3WQT A;  3P39 A;  4DR4 K;  4WQ5 A;  1ASW A;  3W3D A;  3QIO A;  1JXE A;  3R9P A;  5KRT A;  4CK2 A;  3L2U A;  4CEZ A;  4DTJ A;  3H6E A;  2Q31 A;  1C0U A;  3MCA B;  4DV0 K;  4LF6 K;  4QCL A;  5DM7 L;  3KHY A;  1BUP A;  3M8P A;  3BGR A;  4O5B A;  2QWR A;  1KVB A;  4JYA K;  4DV3 K;  2ETJ A;  3V1R A;  3E9P A;  2OA8 A;  4O0J A;  1R59 O;  4DTS A;  4GV9 A;  4Y1C A;  4B9Q A;  1EO1 A;  4JS4 A;  3AA2 A;  3O3F A;  2GV9 A;  4A62 A;  4I6M B;  5M1K A;  2H3G X;  3M8R A;  3JXU A;  3CCU N;  1OH7 A;  1T7P A;  3L2W A;  4YFU A;  3LM9 A;  3B6O A;  3EKU A;  1N5Y A;  3LP1 A;  4LSL A;  2R7Y A;  3TAN A;  2UUB K;  4OJR A;  1VRT A;  2CGK A;  4ID1 A;  4CK3 A;  1T6D A;  3VEX A;  1FKP A;  1MWM A;  5SZT A;  4CGJ A;  5DM6 L;  3A2F A;  1KQS M;  4NXM K;  3BUZ B;  3ULE A;  4Z94 A;  4H0P A;  1RIL A;  2FSK A;  5JMV A;  4DR7 K;  4FPA A;  4RCH A;  4IG0 A;  3T69 A;  3K0S A;  3WXK A;  5F2R A;  1TV6 A;  4JK8 A;  3THX A;  3I8D A;  1Q7Y O;  1WUA A;  3AVF A;  2B4J A;  5BN9 A;  5B8H A;  3HP6 A;  4FVU A;  5AQN A;  1KRP A;  1B92 A;  1KFD A;  1QVF M;  3C0B A;  3PSI A;  2IDO A;  5CE3 A;  5BRH A;  4HUE A;  1JLB A;  1X9W A;  5AQP A;  2HVI A;  4BRK A;  4B9M A;  1T6C A;  5C2D A;  5AQO A;  2P9I B;  4H03 B;  1KVC A;  3VEW A;  2HVH A;  4IKF A;  3VEY A;  1VQ9 N;  3RRH A;  5C42 A;  4DR3 K;  4FCY A;  2OZS A;  3CC2 N;  1VQK N;  2FSJ A;  4FLT A;  1YAG A;  3KKR A;  3FGU A;  2PFU A;  1VQ8 N;  2ZE2 A;  4KH4 A;  4GV6 A;  3AO3 A;  3P4I A;  3WEE B;  1U2V A;  4DS4 A;  1D4X A;  3CMA N;  2DFF A;  1QHA A;  1NGG A;  2RN2 A;  3KVG A;  1S9E A;  4BC2 A;  4DQQ A;  1QSL A;  1RBT A;  3WNE A;  5CHI A;  5JVH L;  2FF6 A;  1TYQ B;  2FLO A;  3NF9 A;  4RTF D;  2X6S A;  2G8U A;  3RR7 A;  3SMS A;  2HNZ A;  4C1N K;  2UXD K;  1IBK K;  3NH0 A;  2FBT A;  3O08 A;  4XH1 A;  3ZSX A;  4B9V A;  1BWF O;  5AZI B;  3C6T A;  4B1W B;  2GTD A;  4NO7 A;  4R79 A;  5I9E B;  2RKI A;  3L4Q A;  4CZJ A;  3ZX2 A;  2XY5 A;  3EL2 A;  3DLG A;  3NBP A;  1WSF A;  4DCH A;  3MX5 A;  2A41 A;  1N33 K;  4X65 K;  3WUH A;  1QQN A;  1ASU A;  4Z4C A;  5FRM A;  3HI0 A;  1TGO A;  4PA1 A;  5FLX O;  3DRP A;  4C8L A;  2ASM A;  3VQA A;  3SAF A;  5BPL A;  3CIP A;  1YXQ A;  3VF6 A;  2FBV A;  3HVR A;  1S3X A;  3SBT A;  4CGD A;  2QWQ A;  5C10 A;  4F2S A;  2YHY A;  3VEZ A;  3ZCM A;  1EXQ A;  1W97 L;  2UXC K;  5E84 A;  3TTC A;  2QXF A;  4DV4 K;  4LF4 K;  3KWG A;  4FJG A;  2GBZ A;  1LWF A;  4CGI A;  1MU2 A;  1UWB A;  4MFB A;  1O13 A;  1T8E A;  3SZ2 A;  2Q3S A;  1U04 A;  5GIP A;  3VQB A;  3SAH A;  3VQQ A;  1LOT B;  3IRX A;  4JKF A;  3F73 A;  4CIE A;  1BG3 A;  3V81 A;  1NK4 A;  1XC9 A;  4XH4 A;  5GAD P;  4WF9 L;  3DXM B;  3TI0 A;  3MMV A;  4XEI A;  3VTI A;  4FJX A;  3D6R A;  3JSM A;  3U9D A;  3MEG A;  3SUQ A;  2OPP A;  4BVP A;  3TTF A;  5CZ1 A;  1JLE A;  3WXI A;  4L3Q A;  4IG3 A;  3K5M A;  1XHX A;  2ZM6 K;  3ULE B;  4FWL A;  3CF5 L;  1EP4 A;  3S9H A;  3CCS N;  2NUB A;  2OTL N;  3B8A X;  4LC9 B;  1C0T A;  3AV9 A;  3OJS A;  4CZH A;  1QZ6 A;  1DT9 A;  2Q2R A;  4CJF A;  1KAX A;  3QEV A;  4M3Z A;  3F9K A;  3R8E A;  4YOX A;  2BGG A;  3THW B;  3OYM A;  4ZTF A;  3SK3 A;  1G15 A;  3OA9 A;  4FWM A;  1SKW A;  4AHV A;  4LH5 A;  4PUO A;  2F96 A;  2WBN A;  2G8V A;  4CJ4 A;  2E2Q A;  1BHL A;  1M90 O;  3QB0 A;  2CH5 A;  4E0D A;  4B1V A;  3MN6 A;  4BRP A;  1S1X A;  4MO4 A;  4N47 A;  2Y1I A;  4J2B A;  3SJH A;  4X62 K;  3NGY A;  4CBU A;  4JV5 K;  1X1P A;  4Z0U A;  4BAC A;  3C6A A;  3NCI A;  1CLQ A;  3OS0 A;  3VN5 A;  4BRN A;  4DQS A;  3N4P A;  3VTH A;  4RW7 A;  1VQP N;  3ITH A;  3SQ1 A;  1YIT N;  1C1A A;  4FOE A;  4EAH D;  3U3G A;  4A2A A;  2E5L K;  1TVR A;  1IKV A;  4FM0 A;  3IMX A;  4YHH K;  2AP1 A;  1C1B A;  4BWM A;  4CZI A;  4B3O A;  3NVM A;  3NFA A;  2HBL A;  2A5X A;  4UQG A;  3BEX A;  2GUI A;  3QDK A;  4O4G A;  2P9K A;  3M8Q A;  4CF8 A;  1WAJ A;  4AM7 A;  3DYA A;  3OS2 A;  3J8A A;  4JI4 K;  5HBM A;  4F4K A;  4CD3 A;  4C8K A;  2P1J A;  2WFB A;  3KLH A;  3VQ5 A;  4CZF A;  2HF4 A;  3GG4 A;  4GKJ K;  4M3T A;  2QM1 A;  3HOS A;  3NF7 A;  3AO4 A;  1J54 A;  5IWA K;  4DR1 K;  2O8F A;  4EP4 A;  3K5O A;  1VQ7 N;  1XMO K;  4X66 K;  1HKC A;  2OYQ A;  4E7K A;  3AVJ A;  4LFB K;  1WSE A;  1NJY A;  1IBM K;  2IAJ A;  3SJJ A;  1I94 K;  2BUP A;  5TKW A;  2OAN A;  4NCG A;  1TKD A;  1IG8 A;  2D0C A;  4FWO A;  3KTQ A;  3V9Z A;  4K42 A;  5KRS A;  2HHW A;  1JXB A;  3AAR A;  4AF1 A;  3HO1 A;  1RBS A;  5KPR A;  4JKD A;  3N4Q A;  4QAG A;  3KK7 A;  3ATU A;  3CJA A;  3VES A;  2HOE A;  1TUY A;  3E1Y A;  3H3O B;  4DFK A;  4BC4 A;  2B5J A;  1WBD A;  3MWP A;  2IS3 A;  4OPH A;  1RBU A;  2E6M A;  2XY8 A;  4IZ9 A;  3ZX3 A;  4JS5 A;  1ZYQ A;  4DUY K;  4IOX A;  5AQT A;  4B9U A;  3ID8 A;  1U49 A;  3CJ9 A;  1M1K O;  3OYL A;  3VGL A;  5F0X A;  2G8W A;  5FRN A;  4BRE A;  1IH7 A;  1WLJ A;  2BDP A;  4JN4 A;  3L2R A;  3DOK A;  1FKO A;  1WOQ A;  3LZI A;  2P9U B;  1QSS A;  4ZTJ A;  4CF9 A;  4DTR A;  1NKE A;  4ISF A;  4BG9 A;  5BRE A;  3A5O C;  3E01 A;  3QFU A;  4BRM A;  4ELT A;  4DSJ A;  5A2Q O;  2KZM A;  1GOC A;  3MX2 A;  1FW6 A;  3EKS A;  1Z25 A;  4O44 A;  4BDZ A;  2QWN A;  3QBX A;  3SLC A;  1L3V A;  4DR6 K;  3DRR A;  4KHY A;  2CH6 A;  4DTM A;  4WYB A;  1ATS A;  4BGA A;  2UYT A;  1YJW N;  2IGI A;  4GKK K;  4DKW A;  3LDQ A;  2O4I A;  4CE9 A;  2WTU A;  1L3U A;  4DTO A;  1B9F A;  1BDG A;  3SBG A;  2HHQ A;  1OH5 A;  4CER A;  3G6E N;  4HUG A;  4GMJ B;  4PL7 A;  3U9Z A;  3EE8 A;  3HZ6 A;  4DU4 A;  1C0F A;  1R0A A;  4MLE A;  2BH1 A;  5C15 A;  3V1Q A;  2NRZ A;  1Q82 O;  2B6A A;  3M6G A;  1FXX A;  2ASP A;  3UB5 A;  1EET A;  2QA4 N;  3THV A; 
#chains in the Genus database with same CATH homology
 3TAF A;  1RTD A;  4JS4 A;  3AA2 A;  3O3F A;  1QS4 A;  4CK1 A;  2GV9 A;  3SV3 A;  3P83 D;  1A5W A;  3M8R A;  4F8R A;  5T7B A;  3HPH A;  4J2A A;  3RR8 A;  3OYI A;  1T7P A;  1ZBH A;  3L2W A;  4YFU A;  4O55 A;  5CY4 A;  3B6O A;  2RPI A;  1W9H A;  1N5Y A;  2IOC A;  3CM5 A;  1C6V A;  3HL8 A;  3LP1 A;  3KLF A;  4LSL A;  1I39 A;  2I5J A;  2Z1I A;  4DQI A;  2R7Y A;  3TAN A;  4KTQ A;  2KFN A;  1A5V A;  4OJR A;  3MXJ A;  1VRT A;  4ID1 A;  5KGX A;  4CK3 A;  1HNI A;  3NHG A;  3AO5 A;  2DFE A;  3CM6 A;  1FKP A;  3DLR A;  3NF8 A;  4CHY A;  3VQ9 A;  4DU1 A;  5SZT A;  1XHZ A;  4OLB A;  2OZM A;  4CGJ A;  1RT2 A;  4B9S A;  3A2F A;  1UA0 A;  4EZ6 A;  4FJJ A;  2DTU A;  4HTU A;  2WON A;  1HYV A;  1IKX A;  4FLV A;  2P5G A;  1WSH A;  2XY6 A;  3RMC A;  1U45 A;  1RT4 A;  1RIL A;  4KHU A;  1QQC A;  1XWL A;  1QSY A;  4J2D A;  1IKW A;  4LSN A;  4FK2 A;  1W0H A;  1NK6 A;  4IG0 A;  4Q0B A;  2PY5 A;  4M3R A;  1TKZ A;  1LAV A;  2YNG A;  3V6D A;  1YT3 A;  3KLE A;  3MXM A;  3K58 A;  4FJM A;  4KHN A;  4CEC A;  1TV6 A;  3IG1 A;  1QHT A;  4I2Q A;  3RMD A;  4NCB A;  3OYD A;  3I8D A;  3KD5 E;  2XHB A;  3ZT3 A;  3AVF A;  4B8A B;  2B4J A;  1HQE A;  4BDY A;  4DSE A;  3HP6 A;  4Z4G A;  4FLW A;  4N56 A;  1KRP A;  1B92 A;  3WNH A;  4KKO A;  4FZY A;  4Z4F A;  1KFD A;  3V9U A;  1S1W A;  3OJU A;  5DMR A;  3PUF A;  5HRN A;  3TAP A;  2G8I A;  3LWL A;  2IDO A;  3LZJ A;  3RTV A;  1TK8 A;  1CXU A;  4HUE A;  3CFP A;  4CFA A;  3PX6 A;  1JLB A;  1RT7 A;  1X9W A;  1TAU A;  1J5O A;  4B08 A;  1HNV A;  1VSI A;  3QO9 A;  4KO0 A;  3K59 A;  1SL0 A;  2HVI A;  3AVK A;  4B9M A;  4FJH A;  4FK0 A;  4FK4 A;  1LWE A;  3MED A;  4IBN A;  2Z1H A;  1KVC A;  4OLA A;  2HVH A;  4IKF A;  4B9T A;  3DLH A;  3AA4 A;  5JS1 A;  3RRH A;  5C42 A;  4NCA A;  1RT5 A;  4H4O A;  4AHS A;  2DFH A;  4FCY A;  2OZS A;  3KD1 E;  4CHN A;  3V9W A;  1KCF A;  1VSM A;  1VRU A;  4KHQ A;  4FLT A;  3ZT2 A;  1JLA A;  3KKR A;  3O4N A;  3MEE A;  4CHP A;  1D8Y A;  1KLN A;  4W5N A;  3P1G A;  3VQC A;  3L2V A;  5J2N A;  2ZE2 A;  3WNG A;  1SKR A;  3AO3 A;  1D9D A;  3S3M A;  3KKS A;  1WAF A;  2E6L A;  2P51 A;  4FLY A;  2BE2 A;  4GVM A;  4AHC A;  4DS4 A;  1JL1 A;  2OPR A;  2DFF A;  4M3X A;  4C8O A;  2DY4 A;  4CGF A;  4R5P A;  3WNF A;  2RN2 A;  1I3A A;  1EX4 A;  3NAE A;  1S9E A;  4DQQ A;  3AO1 A;  4I7F A;  1DTT A;  1RBT A;  3MXI A;  3WNE A;  3S3O A;  2G8K A;  3VQ8 A;  2YKM A;  4KTZ A;  4OKJ A;  4DMN A;  4KI4 A;  2VG5 A;  4DTP A;  4E3S A;  3NF9 A;  1S5J A;  5D3G A;  1JKH A;  5HRO A;  2X6S A;  4DFJ A;  3K5N A;  2G8U A;  3RR7 A;  4DSL A;  2HNZ A;  2Z1J A;  1VSH A;  3B6P A;  4CHQ A;  3KLI A;  4M3Y A;  2F8T A;  5I3U A;  4M42 A;  3NH0 A;  2FBT A;  2HB5 A;  4CHZ A;  3ZSX A;  3O3H A;  3KK3 A;  5CYM A;  3ZSW A;  4BDP A;  4B9V A;  2KZZ A;  1WSG A;  3C6T A;  3DLK A;  4BE0 A;  1HYZ A;  1L3T A;  4Z4E A;  4OPK A;  2RKI A;  1NK9 A;  3HP9 A;  1J53 A;  4CJV A;  3OYE A;  2XY5 A;  2QK9 A;  3DLG A;  3NBP A;  3EYZ A;  1WSF A;  3L2Q A;  3OYC A;  3DLE A;  4JRQ A;  3PO5 A;  3OYH A;  4FM1 A;  1ASU A;  4E1M A;  4CF2 A;  4Z4C A;  5KTQ A;  2RF2 A;  4M45 A;  3SQ2 A;  4KB0 A;  1TGO A;  4CJ3 A;  4PA1 A;  1IG9 A;  5FRM A;  3PY8 A;  4EP5 A;  3NF6 A;  1D5A A;  3DRP A;  4CJU A;  4O0I A;  4AHU A;  4C8L A;  3QIN A;  2YNF A;  1VSE A;  3VQA A;  3VQP A;  4FJ8 A;  4E19 A;  3KK2 A;  2FBX A;  1RTH A;  1JLG A;  1ZBI A;  1RDA A;  1S1T A;  4KRE A;  4HHT A;  5FDL A;  3VQE A;  1NK0 A;  2FC0 A;  4GW6 A;  2FBV A;  1KFS A;  4W5R A;  4F2R A;  5EU7 A;  2QKK A;  4RW4 A;  4CES A;  3HVR A;  3V9S A;  4CHO A;  4CEE A;  4DFM A;  4CGD A;  1U47 A;  2G8H A;  3CYM A;  1EKE A;  3OYJ A;  2F8S A;  4CED A;  2KW4 A;  3KJV A;  2YHA A;  4F2S A;  3U6F A;  3FFI A;  4CGH A;  1QE1 A;  2AJQ A;  5J2M A;  3ZCM A;  1CXQ A;  1EXQ A;  3KLG A;  5KI6 A;  2QXF A;  4CJR A;  3SCX A;  4EZ9 A;  4BE2 A;  3TAE A;  2EX3 A;  4FJG A;  2GBZ A;  1LWF A;  4CGI A;  4DTU A;  1NJZ A;  2P5O A;  1MU2 A;  3ALY A;  1UWB A;  4FW1 A;  4MFB A;  1T8E A;  5C25 A;  3SZ2 A;  2Q3S A;  3TAG A;  1U04 A;  3VQB A;  2Z1G A;  3VQQ A;  5HRS A;  2PYL A;  5I42 A;  1XI1 A;  2KFZ A;  3OYN A;  4J2E A;  3KIO A;  1VK0 A;  3IRX A;  3SPZ A;  3DRS A;  3F73 A;  4CIE A;  1X9M A;  3V81 A;  1HYS A;  3TAB A;  3MAQ A;  1NK4 A;  1XC9 A;  2HHS A;  4XIU A;  4CJ5 A;  3ZT1 A;  2YKN A;  4E89 A;  2ATQ A;  3CFR A;  1RBV A;  4BWJ A;  4RW8 A;  3TI0 A;  2BAN A;  4FJX A;  3JSM A;  4FVM A;  3K57 A;  1NK5 A;  3VA0 A;  3MEG A;  2ITG A;  3H08 A;  2VG7 A;  3SUQ A;  3ZSV A;  4M41 A;  3VQ7 A;  2OPP A;  1BI4 A;  4KAZ A;  1BIZ A;  4BE1 A;  5CZ1 A;  1JLE A;  4I9Q A;  1JLC A;  2KTQ A;  1HRH A;  4KI6 A;  3HVT A;  4IG3 A;  3DM2 A;  3K5M A;  3D0P A;  1XHX A;  3L3U A;  2X78 A;  3VQ4 A;  3HXM A;  3S9H A;  1EP4 A;  2PYJ A;  3LAK A;  1BCM A;  4CJS A;  3OYF A;  4DS5 A;  2NUB A;  4CJK A;  2JGU A;  1C0T A;  1FK9 A;  3V1O A;  3AV9 A;  1S6P A;  1X9S A;  3IAY A;  3OJS A;  3QEX A;  3ZSZ A;  3O3G A;  3RRG A;  4FJ7 A;  1GOB A;  4FLU A;  4E7J A;  4CIG A;  4OKK A;  4CJF A;  1VSD A;  1TKX A;  3I0S A;  3QEV A;  4N76 A;  3OYG A;  3CQ8 A;  3F9K A;  4IDK A;  4AH9 A;  3KK1 A;  4M3Z A;  2BGG A;  1WNS A;  1NOZ A;  1KSP A;  4RW6 A;  3ZT0 A;  5K14 A;  3OYM A;  2HNY A;  4ZTF A;  4HCC A;  3NE6 A;  4KHS A;  3K2P A;  4JLH A;  1REV A;  3O4Q A;  4AHR A;  1G15 A;  5JS2 A;  4KHW A;  2O4G A;  1SKW A;  4AHV A;  3AVC A;  4LH5 A;  3LDS A;  3RMA A;  3LP3 A;  1IKY A;  4PUO A;  3SUN A;  4IFV A;  3LAM A;  3QNO A;  4OGC A;  2F96 A;  2G8V A;  4WE1 A;  4CJ4 A;  4FW2 A;  1JLF A;  3M8S A;  3VA3 A;  1BHL A;  1SL1 A;  4FM2 A;  4E0D A;  4FJ9 A;  4CIF A;  4F3T A;  3NH1 A;  2YNI A;  3HST B;  2XRI A;  3T19 A;  1UA1 A;  3ZSY A;  4QCL A;  1S1X A;  2YNH A;  4ID5 A;  4N47 A;  3OS1 A;  2Y1I A;  3EZ5 A;  4J2B A;  1VSK A;  1ZBF A;  3NGY A;  4CEA A;  5J1E A;  3P5J A;  3G10 A;  3OYK A;  1WN7 A;  1KVA A;  1X1P A;  4YNQ A;  3PV8 A;  4Z0U A;  2X6N A;  4BAC A;  3AO2 A;  3NCI A;  1CLQ A;  2JLE A;  3ZSR A;  1TK0 A;  1LW0 A;  3OYB A;  3LP2 A;  4DQP A;  3VQ6 A;  3OS0 A;  5HRR A;  1BQN A;  3VN5 A;  1WSJ A;  4CJQ A;  4DTN A;  4C8M A;  1KLM A;  4DQS A;  4CJW A;  1ZBU A;  3S3N A;  1SUQ A;  3SQ0 A;  1VSL A;  3AVA A;  3LPU A;  1YTU A;  4RW7 A;  3SUP A;  3ITH A;  3SQ1 A;  3AVI A;  2HHV A;  1C1A A;  5CYQ A;  3DMJ A;  3U3G A;  3OVN A;  1TVR A;  1IKV A;  4FM0 A;  4FYD A;  2VG6 A;  1C1B A;  2D0A A;  4BWM A;  2A1R A;  4OPJ A;  1HPZ A;  4B3O A;  4NYF A;  1RCH A;  4HVJ A;  3QES A;  4DSF A;  1Q8I A;  1JLQ A;  3HPG A;  3LP0 A;  3AVL A;  3NFA A;  1L5U A;  1J9A A;  3RWU A;  3HK2 A;  2ZQB A;  4UQG A;  2GUI A;  4O4G A;  1RDB A;  3M8Q A;  4CF8 A;  5HLF A;  3OY9 A;  1WAJ A;  1CZB A;  3DYA A;  4H8K A;  3ZSQ A;  3OS2 A;  4DLG A;  5HBM A;  4F4K A;  3VQD A;  4C8K A;  1BIU A;  2P1J A;  4OKE A;  4CJT A;  3KLH A;  4DFP A;  4KV8 A;  3VQ5 A;  3SPY A;  3NDK A;  4DLE A;  3AVB A;  1DTQ A;  1GOA A;  1TL1 A;  1A5X A;  4E1N A;  3QLH A;  3RMB A;  1O1W A;  3TAM A;  4OVL A;  4DG1 A;  1QTM A;  4E7I A;  2EHG A;  3BDP A;  1NK8 A;  3C6U A;  1K6Y A;  4FZX C;  4ELV A;  3L3V A;  3LPT A;  4CCH A;  4M3T A;  3HT3 A;  4K8Z A;  1L3S A;  4FJN A;  3UIQ A;  4FXD A;  4CJP A;  1Y97 A;  2ZD1 A;  1RNH A;  4W5Q A;  1RT6 A;  3SYZ A;  2X74 A;  3AO4 A;  3NF7 A;  1B9D A;  4CEB A;  1J54 A;  4H4M A;  4CJL A;  3EY1 A;  4G1Q A;  3NGI A;  4FJL A;  4EP4 A;  3QER A;  4KPY A;  3LAL A;  3K5O A;  4DF4 A;  3V4I A;  4ELU A;  4DSI A;  4L8R B;  3HM9 A;  2OYQ A;  4E7K A;  3AVJ A;  4N41 A;  4K8X A;  1WSE A;  4Y1D A;  3SNN A;  3QEW A;  1NJY A;  2KQ2 A;  2Y1J A;  2IAJ A;  3SJJ A;  1BCO A;  4CFC A;  4ICL A;  1QSL A;  5DK5 A;  1YVU A;  4I2P A;  4NCG A;  4TSX A;  1TKD A;  4AHT A;  2D0C A;  1NJX A;  1RDD A;  1RTJ A;  2A1S A;  1RTI A;  3DI6 A;  4QOZ B;  3ASM A;  1RDC A;  3KTQ A;  4Z4I A;  3V9Z A;  5KRS A;  3IS9 A;  5SWM A;  4W5O A;  2HHW A;  1JXB A;  4FJI A;  3HO1 A;  2FBY A;  1UOC A;  3QNN A;  4DWI A;  1RBS A;  1Z26 A;  3TAQ A;  3AVG A;  5FRO A;  1S1V A;  3U3Y A;  1Q9Y A;  1WSI A;  3AA5 X;  4QAG A;  3ISN C;  2XY7 A;  3C94 A;  3D45 A;  1TK5 A;  3HJF A;  4C8N A;  5HP1 A;  3C95 A;  3JYT A;  4RW9 A;  3CG7 A;  2XO7 A;  4DFK A;  5J2Q A;  1SL2 A;  4DU3 A;  4M3W A;  4NYN A;  4AIL C;  2B5J A;  1IO2 A;  2OPQ A;  1BIS A;  4CEO A;  1NOY A;  2IS3 A;  2HW3 A;  1RBU A;  4OGE A;  3PX0 A;  1RBR A;  4FZZ A;  2E6M A;  2XY8 A;  3T1A A;  4JS5 A;  1ZYQ A;  1JL2 A;  4I9L A;  3SV4 A;  4DTX A;  3HPO A;  2QKB A;  3PX4 A;  1BGX T;  1ZBL A;  1C0M A;  3ULD A;  4B9U A;  4E7H A;  1U49 A;  4KFB A;  1BQM A;  3T3F A;  3OYL A;  1N6Q A;  1S1U A;  2G8W A;  5FRN A;  4FLX A;  3I0R A;  1IH7 A;  4N5S A;  3NH2 A;  1WLJ A;  3HYF A;  1BI4 B;  4W5T A;  4F3O A;  2HHT A;  1TL3 A;  4CFD A;  4CEF A;  2HND A;  1C1C A;  3L8B A;  2BDP A;  3L2R A;  4B9N A;  1DLO A;  1UAX A;  3V9X A;  1KTQ A;  4PY5 A;  1T05 A;  3SQ4 A;  1SKS A;  3DOK A;  1NJW A;  3K5L A;  1FKO A;  2YHB A;  3DOL A;  4RG8 A;  3LZI A;  4CF1 A;  1NKC A;  1D9F A;  3DLB A;  4KB1 A;  3TR8 A;  4JRP A;  4PQU A;  1QSS A;  1RT3 A;  4ZTJ A;  4CF9 A;  4DTR A;  2LSN A;  3QIP A;  1NKE A;  4CGG A;  4B8C A;  4CJE A;  1VSF A;  3E01 A;  1NKB A;  4LD0 A;  1LAW A;  4ELT A;  4DSJ A;  1CZ9 A;  4PWD A;  2KZM A;  3AVM A;  3OYA A;  3G0Z A;  4M3U A;  1NK7 A;  2IC3 A;  3LAN A;  1GOC A;  5C24 A;  1RT1 A;  2YV0 X;  1BL3 A;  4CFB A;  4CF0 A;  1LWC A;  1LW2 A;  4LH4 A;  3AVN A;  3AVH A;  1Z25 A;  4O44 A;  2OPS A;  4E7L A;  4BDZ A;  1LV5 A;  4CEQ A;  1L3V A;  2D0B A;  3DRR A;  5E41 A;  3QEI A;  1HJR A;  4DF8 A;  4Z4H A;  2WOM A;  4DQR A;  2HMI A;  4KHY A;  3AA3 A;  4DTM A;  3SUO A;  4HCB A;  4HUF A;  3CFO A;  4Q5V A;  2E4L A;  2IGI A;  1ASV A;  2VWK A;  2O4I A;  4MQ3 A;  4FLZ A;  4CE9 A;  3QEP A;  1TKT A;  1L3U A;  3NGZ A;  4DTO A;  4IFY A;  5CZ2 A;  1B9F A;  4LY7 A;  1ASW A;  3TWH A;  2HHQ A;  1F21 A;  3MEC A;  4FJ5 A;  3QIO A;  2HHU A;  1JXE A;  4CER A;  3QET A;  4HUG A;  4GMJ B;  5KRT A;  2HHX A;  4CK2 A;  3L2U A;  4ZHR A;  3ZT4 A;  1TAQ A;  4CEZ A;  4DTJ A;  3SI6 A;  4B9L A;  4DU4 A;  2D5R A;  1VSJ A;  1C0U A;  1SV5 A;  2W42 A;  3TAR A;  1R0A A;  1HQU A;  1U4B A;  1T03 A;  1Q9X A;  3PO4 A;  3LWM A;  5J2P A;  3M8P A;  1U48 A;  3BGR A;  4O5B A;  3V1Q A;  3ZSO A;  4KTW A;  1KVB A;  1S9G A;  2G8F A;  4KRF A;  1HMV A;  4DSK A;  1ITG A;  4FJK A;  5HRP A;  2VWJ A;  2ETJ A;  3V1R A;  2B6A A;  2OA8 A;  1FXX A;  4O0J A;  5KGW A;  1EET A;  1YTA A;  2PZS A;  3THV A;  4DTS A;  1S6Q A;  4Y1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...