3AO3A

Fragment-based approach to the design of ligands targeting a novel site on hiv-1 integrase
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
153
structure length
138
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTGATVRAACDWAGIKQEESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein
publication title Fragment-based design of ligands targeting a novel site on the integrase enzyme of human immunodeficiency virus 1
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/transferase inhibitor
total genus 49
structure length 138
sequence length 153
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ao3A00
3PX6A 5HLFA 3DM2A 3VQ6A 4FJ5A 3QIPA 4KRFA 3M8PA 3QETA 1L3TA 4B9TA 4Z4IA 1NK6A 2YV0X 5CZ1A 4DU4A 3VN5A 3AV9A 1FKOA 1LAWA 4CJ5A 3MEDA 1REVA 3OYBA 4RW7A 3IAYA 4DQIA 1KTQA 3HT3A 1KFDA 1IO2A 4C8OA 1ZYQA 2QKBA 1K6YA 5SWMA 3OJSA 3NGZA 4IG0A 3LPTA 4KI4A 4M3ZA 3KLHA 1KLMA 1D5AA 3MEEA 1I39A 2ETJA 4ZHRA 3HO1A 3ULDA 1XWLA 2QXFA 4CFCA 4CFAA 3KLGA 1L3VA 3HK2A 2FBYA 1YT3A 4RW6A 4CEAA 3OS0A 2WOMA 3ZT0A 3OYAA 2BGGA 3CG7A 1UOCA 4W5RA 2YNHA 1G15A 3LZJA 1X9MA 4KO0A 3TR8A 2RKIA 4N5SA 3V1QA 4OGEA 3SQ0A 3SQ4A 1L3SA 4FZZA 2DFFA 4CJ3A 1Q9YA 1L3UA 2Q3SA 3QEPA 3NF9A 4NCAA 2ZD1A 4CJTA 3O3FA 2OA8A 4FCYA 2XY7A 4AHUA 3T19A 2KZMA 3L8BA 4GW6A 2JLEA 1C1CA 1RBUA 3CFRA 3SQ2A 4F3OA 1SL1A 4KHUA 4YFUA 1RTJA 3TI0A 1EETA 3P5JA 4KTWA 1TKXA 3NHGA 3VQDA 3V9XA 4ZTJA 1BQNA 1HYSA 4E7LA 1RTHA 4O55A 3MECA 3E01A 2PYJA 4DTJA 3SI6A 4E1NA 4ELUA 3KK1A 4DSKA 3B6OA 3DLGA 1IKVA 4KKOA 3AVAA 4OLAA 2G8IA 4O0IA 1RDCA 3JSMA 4B8AB 3LWLA 4KHWA 3CYMA 4E3SA 2KTQA 1WAFA 4LH5A 1QSSA 1DTTA 3TANA 4M3XA 4OGCA 1SL2A 1FKPA 1XI1A 1U47A 4KTQA 4DTRA 3LP2A 4E7JA 1LAVA 4LH4A 1NKBA 4FJGA 3PX4A 4FM0A 2KW4A 1TKZA 1NKEA 1TKTA 1HPZA 4O4GA 4W5TA 1QHTA 1Q8IA 4FLWA 2G8VA 1S6PA 4KAZA 4Z4CA 4C8NA 3AVFA 3K2PA 3QESA 4CEFA 3KTQA 3QEVA 4FYDA 3LP0A 3TARA 4O0JA 2HHQA 4CHNA 3ISNC 1BISA 4FJ7A 4FJIA 1VRTA 3L2UA 1NK9A 2ITGA 1TVRA 1Z25A 2DY4A 3C6UA 4W5QA 5HBMA 3I0SA 3KLEA 1J53A 1HNIA 4FZYA 3OYMA 1QE1A 3DLRA 1U4BA 3OYNA 4BE0A 4B9UA 3CFPA 3K58A 1NK4A 5CY4A 1JXBA 3SUOA 3SV3A 1KVAA 2P5OA 4Z4FA 3SNNA 5KI6A 2AJQA 2A1RA 4CHQA 1SV5A 2HNYA 4IG3A 1KRPA 2PY5A 4QAGA 1T03A 4B9MA 5KTQA 1VSLA 2YHAA 1HMVA 3O4QA 4ZTFA 4Y1DA 3MXJA 2YHBA 3DRRA 3DRSA 3OYFA 4AILC 1F21A 4FLZA 3M8RA 1X9SA 4KB0A 2Z1JA 1JLAA 1S9EA 3B6PA 3F73A 3LANA 4CGHA 1MU2A 1JLFA 2D0BA 3A2FA 3OYKA 1UAXA 3DRPA 3DI6A 2D5RA 3QLHA 3AVGA 3VQ4A 4OKJA 4CF2A 3S3NA 1J54A 4CEOA 3OVNA 3QO9A 1R0AA 4AHRA 4CGIA 5I3UA 4AHSA 4OKKA 5JS2A 3K5NA 4CJPA 4W5NA 3TAGA 4FK0A 1JXEA 4CIEA 5JS1A 2BE2A 3OYLA 1NOZA 1UA0A 1B9DA 1BQMA 2PYLA 4Y1CA 5J2QA 3IG1A 4PWDA 3SUQA 1A5VA 4F4KA 3K5MA 4DQQA 3NF6A 5KRTA 4DFKA 1ZBUA 3VQ5A 4N56A 5J2PA 3QEIA 3PO5A 4KHYA 5CZ2A 4BACA 3VQEA 2O4GA 3S3MA 2X78A 4E1MA 2IS3A 1BIUA 4CGJA 3NH1A 3RMAA 4Z4EA 5KGXA 2BANA 4Z4HA 4IFVA 4CIGA 1EXQA 3SYZA 2IOCA 3ASMA 2RPIA 1ITGA 3KK3A 3KD1E 2HHWA 4ELVA 1D9FA 3HPHA 4C8MA 4CEQA 4CJWA 3KJVA 3V9SA 3OYHA 2E6LA 1L5UA 4DU1A 4DTPA 2YKNA 3KKRA 4CF1A 3KD5E 3DLBA 3QNOA 4M42A 1ZBFA 3O3HA 4IFYA 4HTUA 4DF4A 3V81A 4FJJA 3DLHA 3TAEA 2D0CA 3AO2A 3AVNA 3TAMA 3LZIA 3AVCA 1HYZA 2HHUA 1ZBHA 4XIUA 4B9SA 4CHYA 4DSIA 3OYIA 3CM6A 2GUIA 1DTQA 1X9WA 1LV5A 4RW4A 4LSNA 1WSJA 3VA3A 1TL3A 3NFAA 2EX3A 1SL0A 4HHTA 3LDSA 4CJEA 3TABA 4I9LA 4DQSA 4OJRA 4BDPA 1RDAA 4Q0BA 4DS4A 1NKCA 3T3FA 2QK9A 3C6TA 4O44A 4Z0UA 5CYMA 1TV6A 3SUNA 1NJZA 3P83D 4DLEA 5J2NA 5KRSA 3WNGA 3NCIA 1VSIA 4DFJA 5HRPA 1B9FA 1SKSA 1RCHA 4W5OA 1UWBA 3EY1A 3ZT2A 4CJ4A 4CF9A 3V6DA 4K8ZA 4CEDA 1IKWA 3CM5A 2XY5A 2PZSA 1LW0A 2DFHA 1KLNA 1VSKA 4ICLA 3SCXA 3VQQA 3ZSRA 4CJFA 3NGIA 2XY6A 1D8YA 3IRXA 1CXQA 2RN2A 4JRQA 1TK0A 3L2QA 1BCOA 2I5JA 2XO7A 2OPQA 4CIFA 2KFNA 4FXDA 1HRHA 3RRGA 1EP4A 4PQUA 3LAMA 4H4OA 2OYQA 4CK2A 4LSLA 4CEZA 2A1SA 3SPZA 4FJXA 1GOAA 4E7HA 3QEXA 3CQ8A 3AO1A 3QERA 1JLCA 4OKEA 3ZSZA 3OS2A 3MXMA 4RW8A 3NAEA 3LP3A 1Y97A 1T05A 4C8LA 2O4IA 4DTUA 2X74A 4PUOA 4BWJA 4FZXC 3VQ7A 2X6NA 3LPUA 4FW2A 1IKXA 4I7FA 3C94A 4FJLA 4FJ8A 4QCLA 3OYDA 1BGXT 4M3RA 3QEWA 5FDLA 3S9HA 3TAPA 3AA5X 4M41A 2G8KA 4HUFA 4RG8A 3LAKA 2YKMA 3L3VA 3HPOA 1C0MA 1RTDA 1TK8A 3PO4A 4DTOA 1NK8A 1CZBA 1IH7A 2IAJA 4C8KA 4OPJA 3PY8A 4E19A 3L3UA 1ASUA 3L2VA 1HQUA 1XHZA 3NH0A 2F8TA 3DLKA 3K5LA 4GMJB 4HUGA 3WNFA 1C1AA 3EYZA 4YNQA 4AHVA 1S1VA 1JLBA 3NGYA 5DK5A 2HHTA 4OPKA 1X1PA 4UQGA 5SZTA 2D0AA 4J2BA 2HNZA 3DOKA 1J5OA 1VSEA 2RF2A 3H08A 2HHXA 2GBZA 3ALYA 4CK3A 2ATQA 4CJKA 1EX4A 2E4LA 1DLOA 4DTSA 1Q9XA 4E0DA 2XRIA 3QINA 2IDOA 2P51A 1WSIA 3HSTB 3WNEA 4DMNA 3HVRA 3QNNA 3V9UA 1D9DA 2EHGA 4G1QA 1J9AA 3VQ8A 4DG1A 3BGRA 3PUFA 3HYFA 3M8SA 2XHBA 4I2QA 4FLUA 3U3GA 1SKWA 4M3WA 1S1UA 3NE6A 4KHNA 2KZZA 1VSJA 1I3AA 4PA1A 1VSDA 3KK2A 1U45A 3OY9A 5C25A 3MAQA 4B9NA 3BDPA 3NF8A 4HCCA 3SJJA 4K8XA 4CF8A 1U49A 2YNIA 2VWKA 4CEEA 3KLIA 4CERA 3DLEA 3HXMA 1WSFA 1NJYA 4EP5A 4FW1A 1JLEA 2ZQBA 5E41A 1LWCA 1S1XA 2HVHA 2OZMA 3AVHA 2Z1IA 4IKFA 2BDPA 4FJMA 4FLTA 1RBVA 1BIZA 3FFIA 3ZSXA 4KI6A 4ID5A 1HQEA 4LD0A 1A5XA 1KSPA 4KTZA 5C42A 2OPPA 3OYJA 3G10A 3S3OA 4ID1A 3VQPA 4CJRA 3L2RA 4BE2A 3LP1A 3HM9A 5KGWA 4JRPA 1N6QA 3F9KA 4Q5VA 2F96A 4JLHA 1N5YA 4DSLA 4CJLA 4FJ9A 4TSXA 1BHLA 1TKDA 2HVIA 1CZ9A 3AA3A 1B92A 2QKKA 2WONA 4BE1A 4CJSA 1RT7A 3SPYA 1QSYA 3KIOA 3K5OA 3IS9A 4E89A 3JYTA 5J2MA 3RMDA 1UA1A 4NCBA 2G8FA 3G0ZA 1CXUA 3DYAA 3RMCA 4CECA 2KFZA 3TWHA 4FLYA 3AVLA 3CFOA 2VG6A 4M45A 3V9ZA 1YTUA 1RT3A 1O1WA 4F2RA 1KCFA 2FBXA 2GV9A 3ZT4A 4CESA 4KHSA 1XC9A 1ASVA 4DWIA 4KREA 4HCBA 4DF8A 5K14A 1CLQA 2X6SA 4AHCA 1JLGA 3VQAA 3RWUA 1S9GA 3VQBA 4CGDA 2HHVA 3ITHA 3AA2A 4DTXA 4M3YA 4M3TA 3UIQA 1T7PA 4J2DA 4FM2A 1NK7A 1QS4A 4CHZA 1WN7A 4BWMA 4CFDA 4M3UA 4RW9A 4KB1A 1RT4A 5C24A 4DTMA 2VG5A 1W0HA 1A5WA 3AVIA 2W42A 1IG9A 4I2PA 4B8CA 1T8EA 1FXXA 4FLXA 2HW3A 1U48A 1Z26A 1QSLA 4QOZB 1JL2A 2DFEA 3HVTA 4F3TA 2FC0A 3K57A 4J2AA 1NJWA 1C6VA 3NH2A 1WNSA 3O4NA 1VSMA 3OYEA 1NJXA 4CJVA 4NCGA 3ZSQA 4F2SA 4B3OA 3SV4A 4CHPA 4BDYA 3MXIA 5I42A 1TGOA 4H8KA 3AVJA 1EKEA 1WSHA 1U04A 2YNGA 2JGUA 4FVMA 1TK5A 1NOYA 1C0UA 1RDDA 5T7BA 4KV8A 4BDZA 3ZSWA 2YNFA 4AH9A 3HJFA 1JL1A 4KFBA 1QQCA 2HB5A 1HYVA 4MQ3A 4J2EA 1TL1A 5J1EA 3I8DA 3SUPA 3KLFA 4E7IA 3T1AA 3THVA 3P1GA 2IGIA 2NUBA 3O3GA 3NDKA 3OYCA 3EZ5A 1WSEA 1SKRA 1HNVA 5FROA 3HPGA 4DS5A 3AVMA 2Y1IA 5HROA 3DMJA 2FBTA 4N41A 4N76A 1HJRA 1LWFA 2KQ2A 3HL8A 3SQ1A 2B5JA 4MFBA 3WNHA 3VQ9A 3HP9A 1WLJA 1WAJA 4FM1A 1GOBA 1RT6A 2OPRA 3TAFA 2G8UA 3PX0A 3ZSVA 4B9LA 1YVUA 1SUQA 2LSNA 3D45A 3AVKA 1RNHA 1S1WA 3KKSA 2P1JA 5HRSA 2B6AA 3ZT3A 2P5GA 1FK9A 5EU7A 1QTMA 3AO5A 4ELTA 4L8RB 4OLBA 3M8QA 2DTUA 4DFPA 3AA4A 3ZT1A 3SZ2A 3VA0A 4EZ6A 2E6MA 1ZBLA 4Z4GA 1KFSA 3NBPA 1VK0A 3LWMA 4CFBA 4IDKA 4EP4A 3V1RA 5CYQA 1S6QA 4R5PA 4DTNA 3RTVA 3TAQA 1RTIA 1NK5A 4PY5A 1W9HA 1VSFA 4FJNA 2ZE2A 4B08A 3RRHA 1LWEA 1IKYA 3DOLA 2HMIA 4WE1A 1WSGA 3HP6A 1S1TA 4DSEA 4CGFA 5HP1A 2OZSA 2IC3A 1BCMA 4CCHA 4CJQA 1RDBA 1RBSA 4CJUA 4LY7A 4CHOA 3OS1A 1RILA 2HNDA 1GOCA 4O5BA 3RMBA 4CE9A 3L2WA 4I9QA 4FK2A 2VG7A 3U6FA 4F8RA 4N47A 3U3YA 1C0TA 4FJHA 4H4MA 3OJUA 4CF0A 4DQRA 3LALA 3AO4A 2VWJA 3PV8A 4KPYA 4KHQA 3AO3A 2FBVA 4B9VA 5HRNA 4DQPA 3C95A 1ZBIA 4DU3A 4AHTA 1C1BA 4CGGA 1S5JA 5D3GA 3K59A 3NF7A 1VSHA 4DLGA 3V9WA 4DSJA 1VRUA 2Z1GA 4FLVA 1TAUA 4NYNA 3AVBA 5FRMA 1RT2A 2B4JA 1BI4B 4FJKA 3VQCA 1BL3A 3OYGA 3D0PA 3QIOA 1XHXA 4EZ9A 2F8SA 2R7YA 2Y1JA 3RR8A 2G8WA 3ZCMA 1YTAA 4HVJA 2XY8A 1KVCA 5HRRA 4CK1A 5FRNA 4OVLA 4GVMA 3V4IA 2OPSA 1RT5A 3MEGA 1BI4A 1JKHA 2G8HA 4HUEA 1JLQA 1ASWA 3ZSOA 2HHSA 1NK0A 3RR7A 3ZSYA 4DSFA 1RBRA 4DFMA 1LW2A 5DMRA 3I0RA 4IBNA 1RT1A 4JS4A 2Z1HA 1RBTA 3V1OA 4CEBA 4E7KA 4JS5A 1KVBA 4NYFA 4FK4A 1TAQA
chains in the Genus database with same CATH superfamily
5AQXA 5HLFA 3CQXA 1QVGM 3M8PA 3QETA 1L3TA 4B9TA 3JS6A 4Z4IA 5CZ1A 3G71N 3RWUA 1LAWA 1VQPN 2E2OA 3OYBA 4JI0K 4RW7A 3QDKA 1KTQA 3HT3A 1KFDA 3ZX2A 1K9MO 2QKBA 1K6YA 3NGZA 3TSPA 4DCHA 3LPTA 3U8XA 1D5AA 1I39A 3LM9A 3QB0A 1L3VA 1JJ2M 2FBYA 1YT3A 3OYAA 5C12A 2UU9K 3CC4N 4W5RA 4KO0A 3TR8A 5C15A 1Q9YA 4A61A 1L3UA 3QEPA 4NCAA 3QICA 3CCJN 4CJTA 1SAZA 5AQKA 3RSEB 2DPNA 3T19A 3VEZA 3CD6N 2KZMA 1C1CA 1RBUA 3CFRA 4F3OA 3P31A 1IBMK 3TI0A 1EETA 4ZTJA 1KD1O 4CZEA 3VQDA 3C6AA 3E01A 3RSEA 5AFUH 2PYJA 4OLAA 1TYQB 4O0IA 4ILHA 2FF6A 3PLAA 3CYMA 3VEVA 1H1VA 3J8AA 4LH5A 4M3XA 4B3SK 3MX5A 2NRZA 1TYQA 4CZMA 4KTQA 4E7JA 1LAVA 4FJGA 1U2VB 4O4GA 1QHTA 4PKGA 4Z4CA 3KTQA 4FYDA 5I9EB 3FGUA 4O0JA 2HHQA 1U2VA 5EX5A 1X9JA 3L2UA 2ITGA 4IJNA 1EWRA 3E1YA 4W5QA 5HBMA 4FZYA 3IKMA 3D6RA 1QE1A 1NLVA 3DLRA 4PKHA 1GLJO 3OYNA 3T7ZA 1VAZA 1VQMN 3R9PA 1KVAA 2Q0UA 5KI6A 2AJQA 1BG3A 4KH6A 1T03A 3O4QA 4XH4A 3EZWA 3A5OC 2NRHA 3DRSA 3MXJA 1VQ5N 3OYFA 4AILC 1X9SA 3VPZA 1JLAA 1S9EA 3OYLA 1JLFA 2D0BA 3HK2A 1UAXA 3QLHA 3DI6A 4OKJA 4CF2A 1YJ9N 1I94K 3AAQA 4OKKA 4XH1A 5JS2A 3TAGA 1JXEA 2BE2A 3R6MA 1B9DA 1BQMA 4PWDA 4Y1CA 1YITN 4DQQA 5KRTA 1Q7YO 4IWVA 3PO5A 4DV2K 5HL7L 3VGMA 2CGLA 2A5XA 1RFQA 3AARA 2O4GA 3O9RA 4ILJA 4E1MA 3RMAA 3ENOA 4CIGA 3SYZA 1VQ6N 3ASMA 2RPIA 3EKUA 3SMPA 2H3GX 4C8MA 3KJVA 4BR9A 3RVCA 3O9SA 4DTPA 2YKNA 2QEXN 3QNOA 1ZBFA 2FSNA 4HTUA 4FJJA 2A42A 3BEXA 3AO2A 3KWGA 5LL6Z 3AVCA 4GVEA 3CF5L 3A5LC 1YJWN 1ZBHA 4CHYA 4DSIA 4RW4A 4BVOA 3VA3A 3C65A 3P38A 4DQSA 4LC9B 1RDAA 4Q0BA 3O9QA 4BGAA 4Z0UA 4BR7A 4EHUA 4B9QA 1Q82O 4ILGB 1RCHA 3V6DA 4CJ4A 3SCXA 4F9OA 3ZSRA 4CJFA 1D8YA 3IRXA 1BCOA 2I5JA 2XO7A 3IMXA 2KFNA 3M6GA 2GWJA 4OPHA 2P9LB 3VF2A 4PHTX 4JKDA 3LAMA 1BUPA 4H4OA 1E3MA 2YHXA 3SPZA 4LSLA 5LMUK 2GTDA 4CZJA 4WF9L 2IVPA 3OS2A 1KAXA 1WOQA 5F2RA 3LDQA 4XH5A 4DTUA 5EY4A 3JAMO 3LPUA 4FJ8A 4MLEA 4M3RA 3F5TA 3AA5X 4YOWA 3PO4A 2Q2RA 4JHDB 1VQ7N 5IWAK 4B1ZA 3L3UA 3J7YP 3ZYYX 3K5LA 4GMJB 3KK7A 4DR2K 1HKGA 1DT9A 4AHVA 2HHTA 4A62A 4OPKA 1X1PA 4UQGA 4JHDA 2HNZA 1DKGD 3DOKA 3E9OA 1VSEA 3H08A 2HHXA 4A57A 4E0DA 3WNEA 3HSTB 3QBWA 1TUUA 3PUFA 1WBBA 4I2QA 4KHNA 1I3AA 3MAQA 4B9NA 5KPTA 4CBUA 2QWQA 4CEEA 3KLIA 5M1PA 3A5NC 1WSFA 3HXMA 4EP5A 4KBOA 2ZQBA 4NXMK 1JCFA 2OZMA 3MWTA 2Z1IA 3P39A 4FJMA 4FLTA 3FFIA 4K41A 1A5XA 4YDUC 1KSPA 2OPPA 5CR4A 3FR0A 1EO1A 1N6QA 4Q5VA 4FWLA 3CMAN 4FJ9A 4FWRA 1BHLA 4IEIA 1TKDA 1B92A 3U9DA 2QKKA 3KIOA 3K5OA 3RMDA 4E89A 2G8FA 4UY8O 3VEXA 1R59O 3AVLA 4M45A 2NNWA 1KCFA 2WFBA 4BRPA 3SAGA 4KREA 2X6SA 4FVUA 1MWMA 3CHWA 4M3YA 4M3TA 1T7PA 5GIOA 1QS4A 3U4LA 3MWPA 4CFDA 4RW9A 2VG5A 5ADXH 3AVIA 2BUPA 4BRLA 3PIOL 4EFHA 1FXXA 4FLXA 2WBNA 3VETA 1U48A 1JL2A 1HJOA 4F3TA 2QW9A 3HTVA 4PKIA 2AA4A 1J6ZA 4CJVA 4B3OA 3AVJA 3WEEB 3CJ9A 3HOTA 4CZIA 1TK5A 1NOYA 1RDDA 2YNFA 3WXMB 4KFBA 3I8DA 2PAVA 3WEEA 4DV4K 4E7IA 4DHYA 1IBKK 1SKRA 3R8EA 1QZ5A 2Y1IA 2KKZA 3DMJA 3CPWM 5HROA 1HJRA 3HL8A 3SQ1A 1QQMA 4H5WA 2OPRA 1ESVA 4B9LA 1SUQA 4IO8A 3VTHA 2P9SB 3KKSA 5AFUA 3M8QA 4LF7K 3J81O 3ZT1A 2W40A 4C23A 2P9SA 5CYQA 4R5PA 4DTNA 4H5VA 1K8AO 1RTIA 4PY5A 1W9HA 3VOVA 1W2BM 4B1WB 1HR0K 2ZE2A 4DUZK 5IT9O 1BWFO 3DOLA 1WB9A 1WSGA 1S1TA 5AQNA 4CJQA 4CJUA 2FSKA 4CHOA 4FK2A 2ZM6K 1GOCA 4O5BA 4CE9A 4H4MA 2O8CB 3AO3A 4YOUA 4DQPA 3C95A 4JI8K 2VQEK 1T6CA 3FZHA 3FZMA 3ID8A 4BR4A 2O8CA 5AQPA 4BGBA 3W0LA 3GOIA 1XHXA 5C0YA 3AAPA 2XY8A 4ISEA 3CJCA 4WQ5A 3DJCA 2Q1NA 4GVMA 4OVLA 3MEGA 2G8HA 3QMLA 4EAHD 4YOYA 1JLQA 1ASWA 3ZSOA 4BRKA 3ZSYA 3CCSN 3I33A 4IFEA 1RBRA 3B8AX 4C1NI 4BC4A 4YY3K 4JS4A 5LJWA 4JS5A 1KVBA 4FK4A 1TAQA 3ZLJA 2YI1A 3VQ6A 5M1KA 3QIPA 3T69A 1NK6A 4AF1A 4JI2K 2HHSA 3MEDA 1IO2A 5AZJB 1ZYQA 2P9PB 3OJSA 1M90O 3A5MC 4BR0A 4ZHRA 1XWLA 2QXFA 3MMVA 3KLGA 4RW6A 4JKBA 4CEAA 4CZLA 3ZT0A 5AZJA 2BGGA 2P9PA 2VGMA 5KQ8A 3LZJA 4JN4A 3ATVA 3V1QA 1L3SA 3SQ4A 4FOIA 2ZD1A 3O3FA 3ENHA 3GE1A 1NM1A 4FCYA 4AHUA 5BPLA 4YFUA 1RTJA 4KTWA 1TKXA 3NHGA 3V9XA 5M1NA 2HF4A 1ATNA 1RTHA 1QHAA 3KK1A 5BRFA 4BRAA 3FE1A 2QWPA 3N4PA 4WCEL 3O80A 4FWSA 4HTLA 5BN9A 4B8AB 1J5EK 1DTTA 1SL2A 1U47A 4JKGB 3HI0A 4GKJK 4DTRA 4BR5A 3CERA 2QWLA 4DV7K 1HPZA 3OBYA 4FLWA 1Q8IA 4CW7B 4KAZA 1S6PA 4FWMA 4JKGA 4C8NA 3K2PA 3QESA 3QEVA 4CHNA 3ISNC 1BISA 5F1XA 4FOEA 4FJIA 1VRTA 1NK9A 1Q81O 4PL8A 1ZXOA 4CD1A 3WXIA 3H1VX 3K58A 2KLAA 5DM7L 3LDLA 3THWB 3SNNA 3WXLA 2A1RA 1SV5A 2BTFA 3C6HA 2P9IB 5KTQA 1W97L 1CZAN 2WC9A 3BP8A 3THWA 4Y1DA 1F21A 3ID6A 3M8RA 4FLZA 1N8RO 3F73A 4DSJA 1BU6O 3OYKA 3DRPA 2P9IA 3S3NA 4CEOA 1R0AA 4AHRA 4CGIA 5I3UA 1HLUA 3E9LA 4O5FA 4AHSA 3K5NA 5LMNK 4LFAK 1G99A 1UA0A 2PBDA 5AQGA 3G4SN 5GAHP 4F4KA 4DFKA 4N56A 2KHOA 5J2PA 4KHYA 5CZ2A 4BACA 1BIUA 5A2QO 4Z4HA 4BVPA 3KD1E 4ELVA 4H5TA 3VEYA 4G9ZA 5BN8A 4H0OA 3DLBA 5EOYA 3O3HA 1VQKN 1V4TA 3ULEB 3TAEA 3VMFB 4A2AA 3AVNA 1YIJN 1GLAG 4YDUA 4QS8A 5H1SQ 2HHUA 4B9SA 1Q18A 4K25A 4DR3K 4IXCA 1WSJA 1RGIA 3NFAA 3ULEA 2RE2A 4CJEA 4I9LA 4BDPA 3K9KA 2CH6A 4M63C 2QK9A 3C6TA 3WNGA 1NGDA 1U6ZA 3NCIA 4DFJA 3ZT2A 3TTCA 2YCHA 3CM5A 4BRNA 1LW0A 2DFHA 1VSKA 4ICLA 2FSJA 4YOVA 2XY6A 3VGLA 1CXQA 2VGNA 3QBXA 4CBWA 4CIFA 4FXDA 1HRHA 3BF1A 3RRGA 2ZJQL 1EP4A 4PQUA 3KHYA 3EE9A 5ADXA 3CC2N 3CCRN 3QERA 1JLCA 4OKEA 4X66K 3ZSZA 3MXMA 4YOTA 2VYPA 5E84A 3LP3A 2E2PA 4O8UA 3WQUA 3CCVN 5BRDA 4DV1K 1NGGA 3H6EA 4I7FA 1N33K 1SQKA 4FWNA 3QEWA 5ELZA 4BRGA 3H45C 3TAPA 3TTFA 2G8KA 4HUFA 4RG8A 1TK8A 1NK8A 1CZBA 4C8KA 4OPJA 3L2VA 1ASUA 4E1JA 1NMDA 3MDQA 3WNFA 4JEPA 4YNQA 3SMSA 5SZTA 5GADP 1J5OA 2RF2A 1MA9B 4CK3A 3ALYA 4WQ5C 4H5NA 2CGJA 3THXB 1T3VA 1Q9XA 2XRIA 3HVRA 2IDOA 3GL1A 3QNNA 3V9UA 2EHGA 4DG1A 1J9AA 3BGRA 3GG4A 3U3GA 1S1UA 3THXA 3KZBA 4PA1A 3L0QA 3KK2A 4B1VA 1BO5O 3CIPA 3NF8A 3SJJA 4K8XA 4CF8A 4CZGA 1KAZA 2VWKA 2YNIA 1U49A 2E1ZA 2HOEA 1EQYA 1SS6A 4C1NK 3UKUB 1JLEA 5E41A 2HVHA 2V7ZA 1GLLO 1RBVA 4KI6A 4ID5A 4LD0A 4KTZA 5C42A 3UKUA 4IJAA 4JRPA 3T1YK 4Y0WA 3A0IX 1MWKA 4CJLA 4TSXA 3AA3A 2QWRA 4CJSA 2HBMA 3IS9A 1UA1A 3NMUA 4NCBA 4A59A 3G0ZA 2IIRA 3DYAA 2O8DB 4CECA 2KFZA 3TWHA 2FXUA 4FLYA 1RT3A 2FLOA 2FBXA 2GV9A 3ZT4A 4BRHA 1YI2N 4LFCK 4HCBA 4DF8A 1YF5L 2O8DA 3M1FA 4YOXA 1JLGA 3VQBA 2HHVA 3ITHA 3AA2A 1TUYA 3SLCA 4DTXA 3UIQA 4J2DA 3WUHA 4FM2A 1WN7A 4BRCA 1E4FT 4M3UA 4DTMA 4IO9L 3PIPL 2HBLA 4B8CA 2HW3A 4FWQA 4GV3A 4QOZB 2UUCK 1WUAA 3L6QA 2ASMA 2ZF5O 4CZKA 2ITMA 1C6VA 2JWLA 3NH2A 3O4NA 1VSMA 3MXIA 5I42A 1TGOA 4H8KA 1IV0A 4LF4K 1T44A 1WSHA 2YNGA 2O8BB 3HJFA 2JWKA 5FPDA 4MQ3A 1TL1A 5J1EA 3SAFA 1HNXK 2E2QA 2P9LA 3THVA 2O8BA 3M3ZA 1ILYA 3DWLA 3NDKA 3QFPA 3MCPA 3OYCA 3O5BA 5AZIB 3O1BA 4JD2B 3HPGA 4DS5A 2IVOA 2FBTA 3WNHA 2F9WA 1WLJA 2EWSA 5AZIA 4JNEA 2G8UA 4JD2A 2A6AA 3PX0A 2LSNA 3FZFA 3D45A 4B3MK 5HRSA 2B6AA 3CC7N 3ZT3A 1QTMA 5EU7A 4ELTA 4DFPA 3SZ2A 4EZ6A 4Z4GA 3LWMA 4EP4A 3V1RA 3TSUA 3TAQA 4FSVA 3DXKB 2VCPA 1IKYA 1Y64A 4DSEA 4CGFA 4BRDA 3DXKA 4H0YB 1RILA 3OS1A 3RMBA 3ZX0A 4F8RA 3U3YA 3OJUA 4X62K 4CF0A 4DQRA 2YJEA 3R3LA 2FBVA 4B9VA 2BH1A 4AHTA 1C1BA 3HBTA 4DLGA 3SJHA 2Z1GA 4U67L 5FRMA 1RT2A 3VQCA 1BL3A 3D0PA 4EZ9A 4HVJA 1KVCA 5HRRA 1RT5A 4HUEA 3RR7A 4DSFA 4L3QA 3V1OA 4CEBA 4E7KA 2OANA 4RCHA 4NYFA 5C2DA 3PX6A 3DM2A 3NVKA 5EXWA 1Z05A 3VN5A 4KRFA 2P9NB 4CJ5A 1KXPA 3IAYA 1C0GA 5SWMA 3MN9A 4IG0A 4M3ZA 5E26A 1RDWX 2ETJA 4DV0K 4JI7K 2P9NA 4CFCA 2WOMA 3WT0A 1UOCA 2YNHA 1G15A 4JI4K 1X9MA 4BY9C 4MO5A 2UUBK 4OGEA 3SQ0A 3D2FB 2DFFA 3KWIA 4CJ3A 2Q3SA 3NF9A 2ZWHA 5BR9A 2OA8A 2XY7A 3OTOK 3SAHA 3L8BA 2QA4N 4GW6A 4NLBA 2JLEA 3SQ2A 3D2FA 3O1WA 4KHUA 3P5JA 3G6EN 1HYSA 3MECA 1S22A 4DTJA 3SI6A 4E1NA 2O8FB 4DSKA 3DLGA 1IKVA 3AVAA 2NLXA 3BUZB 1XC3A 1RDCA 2ASPA 3R1XA 3JSMA 4B3RK 2O8FA 1FKPA 1XI1A 1ZC6A 3Q7BA 3W3DA 4LH4A 1NKBA 2I7PA 4OO1J 2KW4A 1NKEA 1TKTA 4W5TA 1VQON 2G8VA 4LF6K 3MX2A 2UXDK 5M1FA 3LP0A 4FJ7A 4GNIA 3UE5A 1Z25A 2GUPA 2DY4A 3C6UA 4J8FA 3I0SA 3KLEA 2NZTA 3CQYA 4QS9A 2W6KA 3A8YA 3HZ6A 4BE0A 1U4BA 4B9UA 3CFPA 1BDGA 2HHHK 5CY4A 2A3ZA 2P5OA 3TSQA 2NRXA 1NGBA 5AR0A 1RDUA 4IG3A 2PY5A 3U9ZA 4B9MA 5AQVA 2ASOA 4ZTFA 2YHBA 4KB0A 5M1QA 4U7BA 2Z1JA 4CGHA 1MU2A 3HSCA 4AM6A 1J54A 3OVNA 4CJPA 4FK0A 5JS1A 5BPMA 3MN6A 1NBWA 3IG1A 4A2BA 1A5VA 3OA9A 3K5MA 1YVNA 3E66A 1ZBUA 3VQ5A 2RHKA 3VQEA 1N34K 3S3MA 2IS3A 3NH1A 4Z4EA 1OVYA 5FPEA 1EXQA 3BF3A 2IOCA 2Q0RA 1S3XA 3KK3A 1ITGA 2HHWA 1K73O 3IDHA 4H0TB 1D9FA 3ATUA 4CJWA 2VQFK 2E1YA 4DU1A 4CF1A 4OX9K 5C10A 1DEJA 4M42A 4IFYA 3V81A 2D0CA 3L4QA 4XIUA 4BC5A 4CJ7A 1DTQA 1X9WA 4Z94A 2O8EB 3EE8A 3VEOA 4HHTA 1LOTB 2QM1A 3S41A 2YJFA 4X64K 3T3FA 4O44A 2O8EA 3P83D 4DLEA 5KRSA 5HRPA 2Q97A 1B9FA 4LF8K 4W5OA 4NXNK 4K8ZA 4KHPK 4WYBA 4CEDA 1IKWA 4PL7A 2PZSA 1KAYA 4WFAL 3CJ1A 1OH6A 2RN2A 4JRQA 3L2QA 4DV5K 5AQFA 5GINA 1VQ9N 2OYQA 4CK2A 4CEZA 2A1SA 1GOAA 3CQ8A 3AO1A 3CCUN 3CJ7A 3LL3A 4RW8A 5KQDA 5AQMA 4C8LA 2X74A 2QWOA 4JKHA 3DLLL 3H3NO 3VQ7A 4FW2A 3C94A 3M5RA 2NRRA 2WTUA 2UUAK 3S9HA 3LAKA 4IZ9A 2E8AA 2YKMA 4CVNE 1HX1A 1NU0A 1RTDA 2E5LK 2IAJA 1YJNN 3CCQN 1S72N 1XHZA 1HQUA 3DLKA 1C1AA 1S1VA 3ENBA 1JLBA 3NGYA 5DK5A 3VF6A 1IJJA 4J2BA 2D0AA 2HMPA 2QWMA 2UXBK 2GBZA 2W6LA 2ATQA 3O9UA 4CJKA 4DTSA 4BC3A 1GLFO 1IG8A 4G1QA 3VQ8A 2OTLN 2XHBA 3HYFA 1SKWA 2NRWA 1VSDA 5BREA 5C25A 3BDPA 4HCCA 4WQ4C 3UKRB 4DV3K 3J7AP 4JKFA 4CERA 3DLEA 1JCGA 1LWCA 1S1XA 1BIZA 3ZSXA 3UKRA 3WXJA 3OYJA 3G10A 2QXLA 5TKYA 3S3OA 4CJRA 4RTFD 4GKKK 3HM9A 1XMQK 3F9KA 5LY3A 2F96A 5C2FA 4JLHA 1OVQA 2HVIA 1CZ9A 4M7XA 4FPBA 4BE1A 3JYTA 5GAGP 1CXUA 4A5AA 2IVNA 3FZKA 3O08A 3CFOA 3V9ZA 3EL2A 1YTUA 1O1WA 4GY2B 4F2RA 1XC9A 4DWIA 3VERA 1CLQA 5AQJA 4AHCA 3CXCM 1S9GA 4A5BA 1ZBSA 3EKSA 5GIPA 2Q36A 4KB1A 1RT4A 4CZHA 1W0HA 4I2PA 5DM6L 1T8EA 1C0FA 2QTDA 3O8MA 1QSLA 2DFEA 2V52B 2FC0A 4J2AA 1NJWA 4K43A 1WNSA 3OYEA 3BZKA 4NCGA 3ZSQA 4F2SA 3SV4A 4CHPA 4BDYA 2CGKA 4DR1K 2F4VK 2QWNA 2YHWA 3F9MA 1C0UA 5T7BA 2QI2A 4BDZA 4DB3A 1QQCA 3LDNA 2HB5A 3O4WA 4WFNL 1HYVA 4J2EA 3SUPA 3KLFA 1HNZK 2IGIA 4IDHA 3O3GA 4B1YB 5AQRA 3ZX3A 5JVHL 2Q31A 1WSEA 2WUSA 1HNVA 1NWKA 1XMOK 4N41A 1Z6RA 1NNEA 4N76A 1LWFA 2KQ2A 4MFBA 1XNRK 3HP9A 1WAJA 4FM1A 3F2KA 3TAFA 3I56N 3ZSVA 4DV6K 1VQ8N 3AVKA 5F0XA 2P1JA 4BRIA 2P5GA 1FK9A 3AO5A 2DTUA 2NRVA 3I8BA 5JLFA 2YX6A 1ZBLA 3NBPA 1VK0A 1X3MA 4CFBA 1NK5A 1S6QA 4O8KA 3RTVA 1MDUB 3O6WA 5M1OA 2D0OA 4GV9A 3RRHA 4B08A 4IOAL 1LWEA 3SBTA 4WE1A 5HP1A 3HP6A 3TPQA 4MLHA 2OZSA 2IC3A 4CCHA 3L2WA 1C0TA 1QQNA 3LALA 2VWJA 4KHQA 4NLCA 5HRNA 1ZBIA 4DU3A 1OH5A 4CGGA 5D3GA 3WQTA 4NB4A 1OKJA 2P9KB 1TAUA 4BROA 4FLVA 4FO0A 3C0BA 4NO7A 2AP1A 3CCLN 4FJKA 4JYAK 2I7NA 3PSFA 2D1KA 2P9KA 1NGAA 3RR8A 3ZCMA 1YTAA 4CK1A 1GLEG 3V4IA 2OPSA 5AQLA 4JK9A 3SBGA 4WFBL 1BA1A 1NK0A 1VQNN 3I0RA 1RT1A 2Z1HA 1QVFM 4CI6A 3VEWA 3GDQA 4FJ5A 5FPMA 2YV0X 4DU4A 3AV9A 1FKOA 4H0PA 4DQIA 1REVA 4C8OA 4JAXA 4FPAA 4KI4A 3KLHA 1KLMA 3MEEA 3HO1A 3ULDA 4CFAA 3OS0A 3JXUA 3CG7A 2P9UB 1ATSA 1W7AA 4N5SA 2RKIA 3EN9A 1WBDA 4FZZA 1Q86O 1K8KB 2GX9A 1HKCA 4OPAA 4BRQA 3CCEN 2CH5A 1YHQN 2P9UA 5AQQA 2NRTA 1GLBG 3VTIA 1K8KA 5JLHA 1SL1A 3HOSA 4XEIA 3THYB 1BQNA 4E7LA 4O55A 4JK7A 4B1XB 4ELUA 3B6OA 1JCEA 4KKOA 5AJ3K 4HWIA 2G8IA 3FZLA 3ZETB 3LWLA 4KHWA 4E3SA 3THYA 2KTQA 1WAFA 4DR4K 1QSSA 4DQ8A 3TANA 4OGCA 2HF3A 1NGFA 3VGKA 3VENA 3ZETA 2HSTA 3LP2A 3K9JA 3VF4A 3PX4A 4FM0A 3MK6A 4DUYK 1TKZA 3CETA 3CMEN 4DR7K 2UYTA 4K42A 3AGRA 4R79A 5TKWA 3AVFA 4CEFA 3TARA 4DR6K 4JKAA 5JVGL 3MCAB 4GV6A 3MN7A 1QQOA 3EEQA 1TVRA 1ATRA 1J53A 1HNIA 2OTJN 3OYMA 2HBJA 2W41A 4ISGA 1NK4A 1JXBA 1QZ6A 3SV3A 3SUOA 4FWKA 4MO4A 4Z4FA 3OHRA 1M1KO 5B8HA 4CHQA 2HNYA 5BR8K 4QAGA 4BC2A 1VSLA 2YHAA 1HMVA 4JKCA 3DRRA 1KRPA 3B6PA 3LANA 5AQHA 3A2FA 4LFBK 1NKCA 2D5RA 1BA0A 3AVGA 3VQ4A 3N4QA 1OH8A 3QO9A 4DR5K 4W5NA 4CIEA 4EHTA 5AQSA 1NOZA 2PYLA 5J2QA 4H0VB 3SUQA 3GBTA 1IBLK 3NF6A 3QEIA 4JKEA 1YAGA 1DGKN 3VESA 2X78A 4EIAA 4CGJA 5KGXA 1GLDG 2BANA 3QFUA 4IFVA 5KPRA 3HPHA 4CEQA 4WQ4A 3V9SA 3OYHA 2E6LA 1L5UA 2GWKA 3KKRA 2J4RA 4BQLA 3KD5E 4JI1K 2D0PA 5AQZA 4DF4A 2V51B 3DLHA 3IUCA 3C7NB 3TAMA 2E2NA 3LZIA 5KPZA 1HYZA 4BREA 3OYIA 3CM6A 2GUIA 1LV5A 4LSNA 1TL3A 2EX3A 1SL0A 3LDSA 3C7NA 3TABA 1NGHA 4OJRA 3J7ZO 4DS4A 3E9PA 4JK8A 5CYMA 1TV6A 3SUNA 1NJZA 4FL9A 4IEEA 5J2NA 2FF3B 4H0XB 1VSIA 1SZ2A 5AQYA 1SKSA 5AQTA 3EY1A 1UWBA 2GELA 1N36K 4CF9A 2XY5A 1KLNA 3VQQA 3NGIA 3H1QA 3FLCO 1TK0A 3K0SA 2OPQA 3FFKB 4MDAA 5AQIA 1NMNA 4FJXA 5CE3A 4E7HA 3QEXA 1FJGK 3D7EO 3LM2A 3NAEA 1T6DA 3BY5A 5FLXO 1Y97A 1T05A 2A41A 4PUOA 2O4IA 4BWJA 4FZXC 2D4WA 2X6NA 4QCLA 1IKXA 4FJLA 4B1UB 3OYDA 1BGXT 5HOOA 5FDLA 5JICA 1NGEA 4M41A 1O13A 3L3VA 3HPOA 1C0MA 3CCMN 4H03B 4DTOA 1IH7A 3BZCA 4MDBA 2GEMA 3PY8A 4E19A 2F8TA 4BRMA 3NH0A 4HUGA 1XQSC 2UXCK 3EYZA 4IOCL 5FPNA 3CJBA 4JI5K 2A40A 2VWBA 1YXQA 1EX4A 2E4LA 1DLOA 4B3TK 3QINA 2P51A 1WSIA 4DMNA 4BG8A 4JI6K 1D9DA 4FLUA 3M8SA 4M3WA 2F9TA 5JMVA 3NE6A 4YHHK 1HNWK 2KZZA 1VSJA 1XNQK 1U45A 3OY9A 5AQUA 3CJAA 3OW2M 1V4SA 5GAEP 1NJYA 4FW1A 2V7YA 3TTDA 3NVMA 4IKFA 3AVHA 2E88A 4BRFA 2BDPA 1E4GT 2PFUA 1HQEA 3HRGA 3P4IA 4ID1A 3VQPA 3L2RA 4BE2A 3LP1A 5CHIA 5KGWA 3H46O 5AQWA 3MN5A 1N5YA 4KH5A 1FW6A 4DSLA 4M7YA 2WONA 1RT7A 3SPYA 1QSYA 1P8ZA 5J2MA 5AQOA 3EO3A 3LDOA 3RMCA 3ZEUB 4CD3A 3IFRA 3AY9A 2E20A 4CBXA 2VG6A 4KH4A 3AGKA 4FWOA 4BG9A 4CESA 4KHSA 1HKBA 1ASVA 1LCUA 3WXKA 5K14A 3ZEUA 4YORA 3VQAA 4CGDA 1KC8O 3J80O 1BOTO 4JI3K 1NK7A 3H3OB 3LDPA 4CHZA 1EWQA 3Q7CA 4BWMA 3I55N 1X3NA 5C24A 1A5WA 2W42A 1IG9A 1Z26A 4BR2A 3HVTA 3K57A 1NGJA 3SK3A 2YHYA 1NJXA 2F7TA 3CPEA 1EKEA 1NJIO 4IOXA 1U04A 4FVMA 2JGUA 1XUPO 3OBWA 4KV8A 3ZSWA 4AH9A 1JL1A 4H5RA 1HPMA 2ZGYA 3T1AA 3P1GA 2NUBA 4FWPA 3EZ5A 4V19S 5FROA 3AVMA 1VQLN 2B5JA 3VQ9A 4LF5K 2ZGZA 3HM8A 1P90A 1GOBA 1RT6A 5LJVA 1YVUA 4K0KK 1RNHA 1S1WA 4L8RB 4OLBA 3TU5A 3AA4A 4I6MB 3VA0A 2E6MA 3DAWA 1KFSA 4ISFA 4IDKA 4AM7A 1VSFA 4FJNA 4AQYK 3CI5A 4I6MA 3UB5A 4X65K 1OH7A 1VHXA 1N32K 2HMIA 3G25A 1BCMA 4JV5K 1NG9A 1RDBA 1RBSA 4LY7A 4I9QA 2HNDA 2VG7A 4QS7A 3D2EB 3U6FA 4N47A 4FJHA 1NGIA 5EVZA 3AO4A 3PV8A 4KPYA 3PSIA 3T1HK 1S5JA 3K59A 3NF7A 1VSHA 3D2EA 3V9WA 1VRUA 1HUXA 4NYNA 4LF9K 1D4XA 3AVBA 1VQ4N 5MLCQ 2B4JA 1BI4B 4BQZA 1GLCG 3OYGA 5BPNA 3L4IA 3QIOA 4RWTA 4DKWA 2F8SA 2R7YA 2Y1JA 2OCEA 2G8WA 2HBKA 3DXMB 5FRNA 1YUWA 1NGCA 3KVGA 1BI4A 1JKHA 3O9TA 2ZJRL 4CZFA 4DFMA 1LW2A 5DMRA 3DXMA 4IBNA 1RBTA 2ZJPL 5BRHA 1KQSM
chains in the Genus database with same CATH topology
3PX6A 5HLFA 3DM2A 3VQ6A 4FJ5A 3QIPA 4KRFA 3M8PA 3QETA 1L3TA 4B9TA 4Z4IA 1NK6A 2YV0X 5CZ1A 4DU4A 3VN5A 3AV9A 1FKOA 1LAWA 4CJ5A 3MEDA 1REVA 3OYBA 4RW7A 3IAYA 4DQIA 1KTQA 3HT3A 1KFDA 1IO2A 4C8OA 1ZYQA 2QKBA 1K6YA 5SWMA 3OJSA 3NGZA 4IG0A 3LPTA 4KI4A 4M3ZA 3KLHA 1KLMA 1D5AA 3MEEA 1I39A 2ETJA 4ZHRA 3HO1A 3ULDA 1XWLA 2QXFA 4CFCA 4CFAA 3KLGA 1L3VA 3HK2A 2FBYA 1YT3A 4RW6A 4CEAA 3OS0A 2WOMA 3ZT0A 3OYAA 2BGGA 3CG7A 1UOCA 4W5RA 2YNHA 1G15A 3LZJA 1X9MA 4KO0A 3TR8A 2RKIA 4N5SA 3V1QA 4OGEA 3SQ0A 3SQ4A 1L3SA 4FZZA 2DFFA 4CJ3A 1Q9YA 1L3UA 2Q3SA 3QEPA 3NF9A 4NCAA 2ZD1A 4CJTA 3O3FA 2OA8A 4FCYA 2XY7A 4AHUA 3T19A 2KZMA 3L8BA 4GW6A 2JLEA 1C1CA 1RBUA 3CFRA 3SQ2A 4F3OA 1SL1A 4KHUA 4YFUA 1RTJA 3TI0A 1EETA 3P5JA 4KTWA 1TKXA 3NHGA 3VQDA 3V9XA 4ZTJA 1BQNA 1HYSA 4E7LA 1RTHA 4O55A 3MECA 3E01A 2PYJA 4DTJA 3SI6A 4E1NA 4ELUA 3KK1A 4DSKA 3B6OA 3DLGA 1IKVA 4KKOA 3AVAA 4OLAA 2G8IA 4O0IA 1RDCA 3JSMA 4B8AB 3LWLA 4KHWA 3CYMA 4E3SA 2KTQA 1WAFA 4LH5A 1QSSA 1DTTA 3TANA 4M3XA 4OGCA 1SL2A 1FKPA 1XI1A 1U47A 4KTQA 4DTRA 3LP2A 4E7JA 1LAVA 4LH4A 1NKBA 4FJGA 3PX4A 4FM0A 2KW4A 1TKZA 1NKEA 1TKTA 1HPZA 4O4GA 4W5TA 1QHTA 1Q8IA 4FLWA 2G8VA 1S6PA 4KAZA 4Z4CA 4C8NA 3AVFA 3K2PA 3QESA 4CEFA 3KTQA 3QEVA 4FYDA 3LP0A 3TARA 4O0JA 2HHQA 4CHNA 3ISNC 1BISA 4FJ7A 4FJIA 1VRTA 3L2UA 1NK9A 2ITGA 1TVRA 1Z25A 2DY4A 3C6UA 4W5QA 5HBMA 3I0SA 3KLEA 1J53A 1HNIA 4FZYA 3OYMA 1QE1A 3DLRA 1U4BA 3OYNA 4BE0A 4B9UA 3CFPA 3K58A 1NK4A 5CY4A 1JXBA 3SUOA 3SV3A 1KVAA 2P5OA 4Z4FA 3SNNA 5KI6A 2AJQA 2A1RA 4CHQA 1SV5A 2HNYA 4IG3A 1KRPA 2PY5A 4QAGA 1T03A 4B9MA 5KTQA 1VSLA 2YHAA 1HMVA 3O4QA 4ZTFA 4Y1DA 3MXJA 2YHBA 3DRRA 3DRSA 3OYFA 4AILC 1F21A 4FLZA 3M8RA 1X9SA 4KB0A 2Z1JA 1JLAA 1S9EA 3B6PA 3F73A 3LANA 4CGHA 1MU2A 1JLFA 2D0BA 3A2FA 3OYKA 1UAXA 3DRPA 3DI6A 2D5RA 3QLHA 3AVGA 3VQ4A 4OKJA 4CF2A 3S3NA 1J54A 4CEOA 3OVNA 3QO9A 1R0AA 4AHRA 4CGIA 5I3UA 4AHSA 4OKKA 5JS2A 3K5NA 4CJPA 4W5NA 3TAGA 4FK0A 1JXEA 4CIEA 5JS1A 2BE2A 3OYLA 1NOZA 1UA0A 1B9DA 1BQMA 2PYLA 4Y1CA 5J2QA 3IG1A 4PWDA 3SUQA 1A5VA 4F4KA 3K5MA 4DQQA 3NF6A 5KRTA 4DFKA 1ZBUA 3VQ5A 4N56A 5J2PA 3QEIA 3PO5A 4KHYA 5CZ2A 4BACA 3VQEA 2O4GA 3S3MA 2X78A 4E1MA 2IS3A 1BIUA 4CGJA 3NH1A 3RMAA 4Z4EA 5KGXA 2BANA 4Z4HA 4IFVA 4CIGA 1EXQA 3SYZA 2IOCA 3ASMA 2RPIA 1ITGA 3KK3A 3KD1E 2HHWA 4ELVA 1D9FA 3HPHA 4C8MA 4CEQA 4CJWA 3KJVA 3V9SA 3OYHA 2E6LA 1L5UA 4DU1A 4DTPA 2YKNA 3KKRA 4CF1A 3KD5E 3DLBA 3QNOA 4M42A 1ZBFA 3O3HA 4IFYA 4HTUA 4DF4A 3V81A 4FJJA 3DLHA 3TAEA 2D0CA 3AO2A 3AVNA 3TAMA 3LZIA 3AVCA 1HYZA 2HHUA 1ZBHA 4XIUA 4B9SA 4CHYA 4DSIA 3OYIA 3CM6A 2GUIA 1DTQA 1X9WA 1LV5A 4RW4A 4LSNA 1WSJA 3VA3A 1TL3A 3NFAA 2EX3A 1SL0A 4HHTA 3LDSA 4CJEA 3TABA 4I9LA 4DQSA 4OJRA 4BDPA 1RDAA 4Q0BA 4DS4A 1NKCA 3T3FA 2QK9A 3C6TA 4O44A 4Z0UA 5CYMA 1TV6A 3SUNA 1NJZA 3P83D 4DLEA 5J2NA 5KRSA 3WNGA 3NCIA 1VSIA 4DFJA 5HRPA 1B9FA 1SKSA 1RCHA 4W5OA 1UWBA 3EY1A 3ZT2A 4CJ4A 4CF9A 3V6DA 4K8ZA 4CEDA 1IKWA 3CM5A 2XY5A 2PZSA 1LW0A 2DFHA 1KLNA 1VSKA 4ICLA 3SCXA 3VQQA 3ZSRA 4CJFA 3NGIA 2XY6A 1D8YA 3IRXA 1CXQA 2RN2A 4JRQA 1TK0A 3L2QA 1BCOA 2I5JA 2XO7A 2OPQA 4CIFA 2KFNA 4FXDA 1HRHA 3RRGA 1EP4A 4PQUA 3LAMA 4H4OA 2OYQA 4CK2A 4LSLA 4CEZA 2A1SA 3SPZA 4FJXA 1GOAA 4E7HA 3QEXA 3CQ8A 3AO1A 3QERA 1JLCA 4OKEA 3ZSZA 3OS2A 3MXMA 4RW8A 3NAEA 3LP3A 1Y97A 1T05A 4C8LA 2O4IA 4DTUA 2X74A 4PUOA 4BWJA 4FZXC 3VQ7A 2X6NA 3LPUA 4FW2A 1IKXA 4I7FA 3C94A 4FJLA 4FJ8A 4QCLA 3OYDA 1BGXT 4M3RA 3QEWA 5FDLA 3S9HA 3TAPA 3AA5X 4M41A 2G8KA 4HUFA 4RG8A 3LAKA 2YKMA 3L3VA 3HPOA 1C0MA 1RTDA 1TK8A 3PO4A 4DTOA 1NK8A 1CZBA 1IH7A 2IAJA 4C8KA 4OPJA 3PY8A 4E19A 3L3UA 1ASUA 3L2VA 1HQUA 1XHZA 3NH0A 2F8TA 3DLKA 3K5LA 4GMJB 4HUGA 3WNFA 1C1AA 3EYZA 4YNQA 4AHVA 1S1VA 1JLBA 3NGYA 5DK5A 2HHTA 4OPKA 1X1PA 4UQGA 5SZTA 2D0AA 4J2BA 2HNZA 3DOKA 1J5OA 1VSEA 2RF2A 3H08A 2HHXA 2GBZA 3ALYA 4CK3A 2ATQA 4CJKA 1EX4A 2E4LA 1DLOA 4DTSA 1Q9XA 4E0DA 2XRIA 3QINA 2IDOA 2P51A 1WSIA 3HSTB 3WNEA 4DMNA 3HVRA 3QNNA 3V9UA 1D9DA 2EHGA 4G1QA 1J9AA 3VQ8A 4DG1A 3BGRA 3PUFA 3HYFA 3M8SA 2XHBA 4I2QA 4FLUA 3U3GA 1SKWA 4M3WA 1S1UA 3NE6A 4KHNA 2KZZA 1VSJA 1I3AA 4PA1A 1VSDA 3KK2A 1U45A 3OY9A 5C25A 3MAQA 4B9NA 3BDPA 3NF8A 4HCCA 3SJJA 4K8XA 4CF8A 1U49A 2YNIA 2VWKA 4CEEA 3KLIA 4CERA 3DLEA 3HXMA 1WSFA 1NJYA 4EP5A 4FW1A 1JLEA 2ZQBA 5E41A 1LWCA 1S1XA 2HVHA 2OZMA 3AVHA 2Z1IA 4IKFA 2BDPA 4FJMA 4FLTA 1RBVA 1BIZA 3FFIA 3ZSXA 4KI6A 4ID5A 1HQEA 4LD0A 1A5XA 1KSPA 4KTZA 5C42A 2OPPA 3OYJA 3G10A 3S3OA 4ID1A 3VQPA 4CJRA 3L2RA 4BE2A 3LP1A 3HM9A 5KGWA 4JRPA 1N6QA 3F9KA 4Q5VA 2F96A 4JLHA 1N5YA 4DSLA 4CJLA 4FJ9A 4TSXA 1BHLA 1TKDA 2HVIA 1CZ9A 3AA3A 1B92A 2QKKA 2WONA 4BE1A 4CJSA 1RT7A 3SPYA 1QSYA 3KIOA 3K5OA 3IS9A 4E89A 3JYTA 5J2MA 3RMDA 1UA1A 4NCBA 2G8FA 3G0ZA 1CXUA 3DYAA 3RMCA 4CECA 2KFZA 3TWHA 4FLYA 3AVLA 3CFOA 2VG6A 4M45A 3V9ZA 1YTUA 1RT3A 1O1WA 4F2RA 1KCFA 2FBXA 2GV9A 3ZT4A 4CESA 4KHSA 1XC9A 1ASVA 4DWIA 4KREA 4HCBA 4DF8A 5K14A 1CLQA 2X6SA 4AHCA 1JLGA 3VQAA 3RWUA 1S9GA 3VQBA 4CGDA 2HHVA 3ITHA 3AA2A 4DTXA 4M3YA 4M3TA 3UIQA 1T7PA 4J2DA 4FM2A 1NK7A 1QS4A 4CHZA 1WN7A 4BWMA 4CFDA 4M3UA 4RW9A 4KB1A 1RT4A 5C24A 4DTMA 2VG5A 1W0HA 1A5WA 3AVIA 2W42A 1IG9A 4I2PA 4B8CA 1T8EA 1FXXA 4FLXA 2HW3A 1U48A 1Z26A 1QSLA 4QOZB 1JL2A 2DFEA 3HVTA 4F3TA 2FC0A 3K57A 4J2AA 1NJWA 1C6VA 3NH2A 1WNSA 3O4NA 1VSMA 3OYEA 1NJXA 4CJVA 4NCGA 3ZSQA 4F2SA 4B3OA 3SV4A 4CHPA 4BDYA 3MXIA 5I42A 1TGOA 4H8KA 3AVJA 1EKEA 1WSHA 1U04A 2YNGA 2JGUA 4FVMA 1TK5A 1NOYA 1C0UA 1RDDA 5T7BA 4KV8A 4BDZA 3ZSWA 2YNFA 4AH9A 3HJFA 1JL1A 4KFBA 1QQCA 2HB5A 1HYVA 4MQ3A 4J2EA 1TL1A 5J1EA 3I8DA 3SUPA 3KLFA 4E7IA 3T1AA 3THVA 3P1GA 2IGIA 2NUBA 3O3GA 3NDKA 3OYCA 3EZ5A 1WSEA 1SKRA 1HNVA 5FROA 3HPGA 4DS5A 3AVMA 2Y1IA 5HROA 3DMJA 2FBTA 4N41A 4N76A 1HJRA 1LWFA 2KQ2A 3HL8A 3SQ1A 2B5JA 4MFBA 3WNHA 3VQ9A 3HP9A 1WLJA 1WAJA 4FM1A 1GOBA 1RT6A 2OPRA 3TAFA 2G8UA 3PX0A 3ZSVA 4B9LA 1YVUA 1SUQA 2LSNA 3D45A 3AVKA 1RNHA 1S1WA 3KKSA 2P1JA 5HRSA 2B6AA 3ZT3A 2P5GA 1FK9A 5EU7A 1QTMA 3AO5A 4ELTA 4L8RB 4OLBA 3M8QA 2DTUA 4DFPA 3AA4A 3ZT1A 3SZ2A 3VA0A 4EZ6A 2E6MA 1ZBLA 4Z4GA 1KFSA 3NBPA 1VK0A 3LWMA 4CFBA 4IDKA 4EP4A 3V1RA 5CYQA 1S6QA 4R5PA 4DTNA 3RTVA 3TAQA 1RTIA 1NK5A 4PY5A 1W9HA 1VSFA 4FJNA 2ZE2A 4B08A 3RRHA 1LWEA 1IKYA 3DOLA 2HMIA 4WE1A 1WSGA 3HP6A 1S1TA 4DSEA 4CGFA 5HP1A 2OZSA 2IC3A 1BCMA 4CCHA 4CJQA 1RDBA 1RBSA 4CJUA 4LY7A 4CHOA 3OS1A 1RILA 2HNDA 1GOCA 4O5BA 3RMBA 4CE9A 3L2WA 4I9QA 4FK2A 2VG7A 3U6FA 4F8RA 4N47A 3U3YA 1C0TA 4FJHA 4H4MA 3OJUA 4CF0A 4DQRA 3LALA 3AO4A 2VWJA 3PV8A 4KPYA 4KHQA 3AO3A 2FBVA 4B9VA 5HRNA 4DQPA 3C95A 1ZBIA 4DU3A 4AHTA 1C1BA 4CGGA 1S5JA 5D3GA 3K59A 3NF7A 1VSHA 4DLGA 3V9WA 4DSJA 1VRUA 2Z1GA 4FLVA 1TAUA 4NYNA 3AVBA 5FRMA 1RT2A 2B4JA 1BI4B 4FJKA 3VQCA 1BL3A 3OYGA 3D0PA 3QIOA 1XHXA 4EZ9A 2F8SA 2R7YA 2Y1JA 3RR8A 2G8WA 3ZCMA 1YTAA 4HVJA 2XY8A 1KVCA 5HRRA 4CK1A 5FRNA 4OVLA 4GVMA 3V4IA 2OPSA 1RT5A 3MEGA 1BI4A 1JKHA 2G8HA 4HUEA 1JLQA 1ASWA 3ZSOA 2HHSA 1NK0A 3RR7A 3ZSYA 4DSFA 1RBRA 4DFMA 1LW2A 5DMRA 3I0RA 4IBNA 1RT1A 4JS4A 2Z1HA 1RBTA 3V1OA 4CEBA 4E7KA 4JS5A 1KVBA 4NYFA 4FK4A 1TAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PX6 A;  5HLF A;  3DM2 A;  3VQ6 A;  4FJ5 A;  3QIP A;  4KRF A;  3M8P A;  3QET A;  1L3T A;  4B9T A;  4Z4I A;  1NK6 A;  2YV0 X;  5CZ1 A;  4DU4 A;  3VN5 A;  3AV9 A;  1FKO A;  1LAW A;  4CJ5 A;  3MED A;  1REV A;  3OYB A;  4RW7 A;  3IAY A;  4DQI A;  1KTQ A;  3HT3 A;  1KFD A;  1IO2 A;  4C8O A;  1ZYQ A;  2QKB A;  1K6Y A;  5SWM A;  3OJS A;  3NGZ A;  4IG0 A;  3LPT A;  4KI4 A;  4M3Z A;  3KLH A;  1KLM A;  1D5A A;  3MEE A;  1I39 A;  2ETJ A;  4ZHR A;  3HO1 A;  3ULD A;  1XWL A;  2QXF A;  4CFC A;  4CFA A;  3KLG A;  1L3V A;  3HK2 A;  2FBY A;  1YT3 A;  4RW6 A;  4CEA A;  3OS0 A;  2WOM A;  3ZT0 A;  3OYA A;  2BGG A;  3CG7 A;  1UOC A;  4W5R A;  2YNH A;  1G15 A;  3LZJ A;  1X9M A;  4KO0 A;  3TR8 A;  2RKI A;  4N5S A;  3V1Q A;  4OGE A;  3SQ0 A;  3SQ4 A;  1L3S A;  4FZZ A;  2DFF A;  4CJ3 A;  1Q9Y A;  1L3U A;  2Q3S A;  3QEP A;  3NF9 A;  4NCA A;  2ZD1 A;  4CJT A;  3O3F A;  2OA8 A;  4FCY A;  2XY7 A;  4AHU A;  3T19 A;  2KZM A;  3L8B A;  4GW6 A;  2JLE A;  1C1C A;  1RBU A;  3CFR A;  3SQ2 A;  4F3O A;  1SL1 A;  4KHU A;  4YFU A;  1RTJ A;  3TI0 A;  1EET A;  3P5J A;  4KTW A;  1TKX A;  3NHG A;  3VQD A;  3V9X A;  4ZTJ A;  1BQN A;  1HYS A;  4E7L A;  1RTH A;  4O55 A;  3MEC A;  3E01 A;  2PYJ A;  4DTJ A;  3SI6 A;  4E1N A;  4ELU A;  3KK1 A;  4DSK A;  3B6O A;  3DLG A;  1IKV A;  4KKO A;  3AVA A;  4OLA A;  2G8I A;  4O0I A;  1RDC A;  3JSM A;  4B8A B;  3LWL A;  4KHW A;  3CYM A;  4E3S A;  2KTQ A;  1WAF A;  4LH5 A;  1QSS A;  1DTT A;  3TAN A;  4M3X A;  4OGC A;  1SL2 A;  1FKP A;  1XI1 A;  1U47 A;  4KTQ A;  4DTR A;  3LP2 A;  4E7J A;  1LAV A;  4LH4 A;  1NKB A;  4FJG A;  3PX4 A;  4FM0 A;  2KW4 A;  1TKZ A;  1NKE A;  1TKT A;  1HPZ A;  4O4G A;  4W5T A;  1QHT A;  1Q8I A;  4FLW A;  2G8V A;  1S6P A;  4KAZ A;  4Z4C A;  4C8N A;  3AVF A;  3K2P A;  3QES A;  4CEF A;  3KTQ A;  3QEV A;  4FYD A;  3LP0 A;  3TAR A;  4O0J A;  2HHQ A;  4CHN A;  3ISN C;  1BIS A;  4FJ7 A;  4FJI A;  1VRT A;  3L2U A;  1NK9 A;  2ITG A;  1TVR A;  1Z25 A;  2DY4 A;  3C6U A;  4W5Q A;  5HBM A;  3I0S A;  3KLE A;  1J53 A;  1HNI A;  4FZY A;  3OYM A;  1QE1 A;  3DLR A;  1U4B A;  3OYN A;  4BE0 A;  4B9U A;  3CFP A;  3K58 A;  1NK4 A;  5CY4 A;  1JXB A;  3SUO A;  3SV3 A;  1KVA A;  2P5O A;  4Z4F A;  3SNN A;  5KI6 A;  2AJQ A;  2A1R A;  4CHQ A;  1SV5 A;  2HNY A;  4IG3 A;  1KRP A;  2PY5 A;  4QAG A;  1T03 A;  4B9M A;  5KTQ A;  1VSL A;  2YHA A;  1HMV A;  3O4Q A;  4ZTF A;  4Y1D A;  3MXJ A;  2YHB A;  3DRR A;  3DRS A;  3OYF A;  4AIL C;  1F21 A;  4FLZ A;  3M8R A;  1X9S A;  4KB0 A;  2Z1J A;  1JLA A;  1S9E A;  3B6P A;  3F73 A;  3LAN A;  4CGH A;  1MU2 A;  1JLF A;  2D0B A;  3A2F A;  3OYK A;  1UAX A;  3DRP A;  3DI6 A;  2D5R A;  3QLH A;  3AVG A;  3VQ4 A;  4OKJ A;  4CF2 A;  3S3N A;  1J54 A;  4CEO A;  3OVN A;  3QO9 A;  1R0A A;  4AHR A;  4CGI A;  5I3U A;  4AHS A;  4OKK A;  5JS2 A;  3K5N A;  4CJP A;  4W5N A;  3TAG A;  4FK0 A;  1JXE A;  4CIE A;  5JS1 A;  2BE2 A;  3OYL A;  1NOZ A;  1UA0 A;  1B9D A;  1BQM A;  2PYL A;  4Y1C A;  5J2Q A;  3IG1 A;  4PWD A;  3SUQ A;  1A5V A;  4F4K A;  3K5M A;  4DQQ A;  3NF6 A;  5KRT A;  4DFK A;  1ZBU A;  3VQ5 A;  4N56 A;  5J2P A;  3QEI A;  3PO5 A;  4KHY A;  5CZ2 A;  4BAC A;  3VQE A;  2O4G A;  3S3M A;  2X78 A;  4E1M A;  2IS3 A;  1BIU A;  4CGJ A;  3NH1 A;  3RMA A;  4Z4E A;  5KGX A;  2BAN A;  4Z4H A;  4IFV A;  4CIG A;  1EXQ A;  3SYZ A;  2IOC A;  3ASM A;  2RPI A;  1ITG A;  3KK3 A;  3KD1 E;  2HHW A;  4ELV A;  1D9F A;  3HPH A;  4C8M A;  4CEQ A;  4CJW A;  3KJV A;  3V9S A;  3OYH A;  2E6L A;  1L5U A;  4DU1 A;  4DTP A;  2YKN A;  3KKR A;  4CF1 A;  3KD5 E;  3DLB A;  3QNO A;  4M42 A;  1ZBF A;  3O3H A;  4IFY A;  4HTU A;  4DF4 A;  3V81 A;  4FJJ A;  3DLH A;  3TAE A;  2D0C A;  3AO2 A;  3AVN A;  3TAM A;  3LZI A;  3AVC A;  1HYZ A;  2HHU A;  1ZBH A;  4XIU A;  4B9S A;  4CHY A;  4DSI A;  3OYI A;  3CM6 A;  2GUI A;  1DTQ A;  1X9W A;  1LV5 A;  4RW4 A;  4LSN A;  1WSJ A;  3VA3 A;  1TL3 A;  3NFA A;  2EX3 A;  1SL0 A;  4HHT A;  3LDS A;  4CJE A;  3TAB A;  4I9L A;  4DQS A;  4OJR A;  4BDP A;  1RDA A;  4Q0B A;  4DS4 A;  1NKC A;  3T3F A;  2QK9 A;  3C6T A;  4O44 A;  4Z0U A;  5CYM A;  1TV6 A;  3SUN A;  1NJZ A;  3P83 D;  4DLE A;  5J2N A;  5KRS A;  3WNG A;  3NCI A;  1VSI A;  4DFJ A;  5HRP A;  1B9F A;  1SKS A;  1RCH A;  4W5O A;  1UWB A;  3EY1 A;  3ZT2 A;  4CJ4 A;  4CF9 A;  3V6D A;  4K8Z A;  4CED A;  1IKW A;  3CM5 A;  2XY5 A;  2PZS A;  1LW0 A;  2DFH A;  1KLN A;  1VSK A;  4ICL A;  3SCX A;  3VQQ A;  3ZSR A;  4CJF A;  3NGI A;  2XY6 A;  1D8Y A;  3IRX A;  1CXQ A;  2RN2 A;  4JRQ A;  1TK0 A;  3L2Q A;  1BCO A;  2I5J A;  2XO7 A;  2OPQ A;  4CIF A;  2KFN A;  4FXD A;  1HRH A;  3RRG A;  1EP4 A;  4PQU A;  3LAM A;  4H4O A;  2OYQ A;  4CK2 A;  4LSL A;  4CEZ A;  2A1S A;  3SPZ A;  4FJX A;  1GOA A;  4E7H A;  3QEX A;  3CQ8 A;  3AO1 A;  3QER A;  1JLC A;  4OKE A;  3ZSZ A;  3OS2 A;  3MXM A;  4RW8 A;  3NAE A;  3LP3 A;  1Y97 A;  1T05 A;  4C8L A;  2O4I A;  4DTU A;  2X74 A;  4PUO A;  4BWJ A;  4FZX C;  3VQ7 A;  2X6N A;  3LPU A;  4FW2 A;  1IKX A;  4I7F A;  3C94 A;  4FJL A;  4FJ8 A;  4QCL A;  3OYD A;  1BGX T;  4M3R A;  3QEW A;  5FDL A;  3S9H A;  3TAP A;  3AA5 X;  4M41 A;  2G8K A;  4HUF A;  4RG8 A;  3LAK A;  2YKM A;  3L3V A;  3HPO A;  1C0M A;  1RTD A;  1TK8 A;  3PO4 A;  4DTO A;  1NK8 A;  1CZB A;  1IH7 A;  2IAJ A;  4C8K A;  4OPJ A;  3PY8 A;  4E19 A;  3L3U A;  1ASU A;  3L2V A;  1HQU A;  1XHZ A;  3NH0 A;  2F8T A;  3DLK A;  3K5L A;  4GMJ B;  4HUG A;  3WNF A;  1C1A A;  3EYZ A;  4YNQ A;  4AHV A;  1S1V A;  1JLB A;  3NGY A;  5DK5 A;  2HHT A;  4OPK A;  1X1P A;  4UQG A;  5SZT A;  2D0A A;  4J2B A;  2HNZ A;  3DOK A;  1J5O A;  1VSE A;  2RF2 A;  3H08 A;  2HHX A;  2GBZ A;  3ALY A;  4CK3 A;  2ATQ A;  4CJK A;  1EX4 A;  2E4L A;  1DLO A;  4DTS A;  1Q9X A;  4E0D A;  2XRI A;  3QIN A;  2IDO A;  2P51 A;  1WSI A;  3HST B;  3WNE A;  4DMN A;  3HVR A;  3QNN A;  3V9U A;  1D9D A;  2EHG A;  4G1Q A;  1J9A A;  3VQ8 A;  4DG1 A;  3BGR A;  3PUF A;  3HYF A;  3M8S A;  2XHB A;  4I2Q A;  4FLU A;  3U3G A;  1SKW A;  4M3W A;  1S1U A;  3NE6 A;  4KHN A;  2KZZ A;  1VSJ A;  1I3A A;  4PA1 A;  1VSD A;  3KK2 A;  1U45 A;  3OY9 A;  5C25 A;  3MAQ A;  4B9N A;  3BDP A;  3NF8 A;  4HCC A;  3SJJ A;  4K8X A;  4CF8 A;  1U49 A;  2YNI A;  2VWK A;  4CEE A;  3KLI A;  4CER A;  3DLE A;  3HXM A;  1WSF A;  1NJY A;  4EP5 A;  4FW1 A;  1JLE A;  2ZQB A;  5E41 A;  1LWC A;  1S1X A;  2HVH A;  2OZM A;  3AVH A;  2Z1I A;  4IKF A;  2BDP A;  4FJM A;  4FLT A;  1RBV A;  1BIZ A;  3FFI A;  3ZSX A;  4KI6 A;  4ID5 A;  1HQE A;  4LD0 A;  1A5X A;  1KSP A;  4KTZ A;  5C42 A;  2OPP A;  3OYJ A;  3G10 A;  3S3O A;  4ID1 A;  3VQP A;  4CJR A;  3L2R A;  4BE2 A;  3LP1 A;  3HM9 A;  5KGW A;  4JRP A;  1N6Q A;  3F9K A;  4Q5V A;  2F96 A;  4JLH A;  1N5Y A;  4DSL A;  4CJL A;  4FJ9 A;  4TSX A;  1BHL A;  1TKD A;  2HVI A;  1CZ9 A;  3AA3 A;  1B92 A;  2QKK A;  2WON A;  4BE1 A;  4CJS A;  1RT7 A;  3SPY A;  1QSY A;  3KIO A;  3K5O A;  3IS9 A;  4E89 A;  3JYT A;  5J2M A;  3RMD A;  1UA1 A;  4NCB A;  2G8F A;  3G0Z A;  1CXU A;  3DYA A;  3RMC A;  4CEC A;  2KFZ A;  3TWH A;  4FLY A;  3AVL A;  3CFO A;  2VG6 A;  4M45 A;  3V9Z A;  1YTU A;  1RT3 A;  1O1W A;  4F2R A;  1KCF A;  2FBX A;  2GV9 A;  3ZT4 A;  4CES A;  4KHS A;  1XC9 A;  1ASV A;  4DWI A;  4KRE A;  4HCB A;  4DF8 A;  5K14 A;  1CLQ A;  2X6S A;  4AHC A;  1JLG A;  3VQA A;  3RWU A;  1S9G A;  3VQB A;  4CGD A;  2HHV A;  3ITH A;  3AA2 A;  4DTX A;  4M3Y A;  4M3T A;  3UIQ A;  1T7P A;  4J2D A;  4FM2 A;  1NK7 A;  1QS4 A;  4CHZ A;  1WN7 A;  4BWM A;  4CFD A;  4M3U A;  4RW9 A;  4KB1 A;  1RT4 A;  5C24 A;  4DTM A;  2VG5 A;  1W0H A;  1A5W A;  3AVI A;  2W42 A;  1IG9 A;  4I2P A;  4B8C A;  1T8E A;  1FXX A;  4FLX A;  2HW3 A;  1U48 A;  1Z26 A;  1QSL A;  4QOZ B;  1JL2 A;  2DFE A;  3HVT A;  4F3T A;  2FC0 A;  3K57 A;  4J2A A;  1NJW A;  1C6V A;  3NH2 A;  1WNS A;  3O4N A;  1VSM A;  3OYE A;  1NJX A;  4CJV A;  4NCG A;  3ZSQ A;  4F2S A;  4B3O A;  3SV4 A;  4CHP A;  4BDY A;  3MXI A;  5I42 A;  1TGO A;  4H8K A;  3AVJ A;  1EKE A;  1WSH A;  1U04 A;  2YNG A;  2JGU A;  4FVM A;  1TK5 A;  1NOY A;  1C0U A;  1RDD A;  5T7B A;  4KV8 A;  4BDZ A;  3ZSW A;  2YNF A;  4AH9 A;  3HJF A;  1JL1 A;  4KFB A;  1QQC A;  2HB5 A;  1HYV A;  4MQ3 A;  4J2E A;  1TL1 A;  5J1E A;  3I8D A;  3SUP A;  3KLF A;  4E7I A;  3T1A A;  3THV A;  3P1G A;  2IGI A;  2NUB A;  3O3G A;  3NDK A;  3OYC A;  3EZ5 A;  1WSE A;  1SKR A;  1HNV A;  5FRO A;  3HPG A;  4DS5 A;  3AVM A;  2Y1I A;  5HRO A;  3DMJ A;  2FBT A;  4N41 A;  4N76 A;  1HJR A;  1LWF A;  2KQ2 A;  3HL8 A;  3SQ1 A;  2B5J A;  4MFB A;  3WNH A;  3VQ9 A;  3HP9 A;  1WLJ A;  1WAJ A;  4FM1 A;  1GOB A;  1RT6 A;  2OPR A;  3TAF A;  2G8U A;  3PX0 A;  3ZSV A;  4B9L A;  1YVU A;  1SUQ A;  2LSN A;  3D45 A;  3AVK A;  1RNH A;  1S1W A;  3KKS A;  2P1J A;  5HRS A;  2B6A A;  3ZT3 A;  2P5G A;  1FK9 A;  5EU7 A;  1QTM A;  3AO5 A;  4ELT A;  4L8R B;  4OLB A;  3M8Q A;  2DTU A;  4DFP A;  3AA4 A;  3ZT1 A;  3SZ2 A;  3VA0 A;  4EZ6 A;  2E6M A;  1ZBL A;  4Z4G A;  1KFS A;  3NBP A;  1VK0 A;  3LWM A;  4CFB A;  4IDK A;  4EP4 A;  3V1R A;  5CYQ A;  1S6Q A;  4R5P A;  4DTN A;  3RTV A;  3TAQ A;  1RTI A;  1NK5 A;  4PY5 A;  1W9H A;  1VSF A;  4FJN A;  2ZE2 A;  4B08 A;  3RRH A;  1LWE A;  1IKY A;  3DOL A;  2HMI A;  4WE1 A;  1WSG A;  3HP6 A;  1S1T A;  4DSE A;  4CGF A;  5HP1 A;  2OZS A;  2IC3 A;  1BCM A;  4CCH A;  4CJQ A;  1RDB A;  1RBS A;  4CJU A;  4LY7 A;  4CHO A;  3OS1 A;  1RIL A;  2HND A;  1GOC A;  4O5B A;  3RMB A;  4CE9 A;  3L2W A;  4I9Q A;  4FK2 A;  2VG7 A;  3U6F A;  4F8R A;  4N47 A;  3U3Y A;  1C0T A;  4FJH A;  4H4M A;  3OJU A;  4CF0 A;  4DQR A;  3LAL A;  3AO4 A;  2VWJ A;  3PV8 A;  4KPY A;  4KHQ A;  3AO3 A;  2FBV A;  4B9V A;  5HRN A;  4DQP A;  3C95 A;  1ZBI A;  4DU3 A;  4AHT A;  1C1B A;  4CGG A;  1S5J A;  5D3G A;  3K59 A;  3NF7 A;  1VSH A;  4DLG A;  3V9W A;  4DSJ A;  1VRU A;  2Z1G A;  4FLV A;  1TAU A;  4NYN A;  3AVB A;  5FRM A;  1RT2 A;  2B4J A;  1BI4 B;  4FJK A;  3VQC A;  1BL3 A;  3OYG A;  3D0P A;  3QIO A;  1XHX A;  4EZ9 A;  2F8S A;  2R7Y A;  2Y1J A;  3RR8 A;  2G8W A;  3ZCM A;  1YTA A;  4HVJ A;  2XY8 A;  1KVC A;  5HRR A;  4CK1 A;  5FRN A;  4OVL A;  4GVM A;  3V4I A;  2OPS A;  1RT5 A;  3MEG A;  1BI4 A;  1JKH A;  2G8H A;  4HUE A;  1JLQ A;  1ASW A;  3ZSO A;  2HHS A;  1NK0 A;  3RR7 A;  3ZSY A;  4DSF A;  1RBR A;  4DFM A;  1LW2 A;  5DMR A;  3I0R A;  4IBN A;  1RT1 A;  4JS4 A;  2Z1H A;  1RBT A;  3V1O A;  4CEB A;  4E7K A;  4JS5 A;  1KVB A;  4NYF A;  4FK4 A;  1TAQ A; 
#chains in the Genus database with same CATH topology
 5AQX A;  5HLF A;  3CQX A;  1QVG M;  3M8P A;  3QET A;  1L3T A;  4B9T A;  3JS6 A;  4Z4I A;  5CZ1 A;  3G71 N;  3RWU A;  1LAW A;  1VQP N;  2E2O A;  3OYB A;  4JI0 K;  4RW7 A;  3QDK A;  1KTQ A;  3HT3 A;  1KFD A;  3ZX2 A;  1K9M O;  2QKB A;  1K6Y A;  3NGZ A;  3TSP A;  4DCH A;  3LPT A;  3U8X A;  1D5A A;  1I39 A;  3LM9 A;  3QB0 A;  1L3V A;  1JJ2 M;  2FBY A;  1YT3 A;  3OYA A;  5C12 A;  2UU9 K;  3CC4 N;  4W5R A;  4KO0 A;  3TR8 A;  5C15 A;  1Q9Y A;  4A61 A;  1L3U A;  3QEP A;  4NCA A;  3QIC A;  3CCJ N;  4CJT A;  1SAZ A;  5AQK A;  3RSE B;  2DPN A;  3T19 A;  3VEZ A;  3CD6 N;  2KZM A;  1C1C A;  1RBU A;  3CFR A;  4F3O A;  3P31 A;  1IBM K;  3TI0 A;  1EET A;  4ZTJ A;  1KD1 O;  4CZE A;  3VQD A;  3C6A A;  3E01 A;  3RSE A;  5AFU H;  2PYJ A;  4OLA A;  1TYQ B;  4O0I A;  4ILH A;  2FF6 A;  3PLA A;  3CYM A;  3VEV A;  1H1V A;  3J8A A;  4LH5 A;  4M3X A;  4B3S K;  3MX5 A;  2NRZ A;  1TYQ A;  4CZM A;  4KTQ A;  4E7J A;  1LAV A;  4FJG A;  1U2V B;  4O4G A;  1QHT A;  4PKG A;  4Z4C A;  3KTQ A;  4FYD A;  5I9E B;  3FGU A;  4O0J A;  2HHQ A;  1U2V A;  5EX5 A;  1X9J A;  3L2U A;  2ITG A;  4IJN A;  1EWR A;  3E1Y A;  4W5Q A;  5HBM A;  4FZY A;  3IKM A;  3D6R A;  1QE1 A;  1NLV A;  3DLR A;  4PKH A;  1GLJ O;  3OYN A;  3T7Z A;  1VAZ A;  1VQM N;  3R9P A;  1KVA A;  2Q0U A;  5KI6 A;  2AJQ A;  1BG3 A;  4KH6 A;  1T03 A;  3O4Q A;  4XH4 A;  3EZW A;  3A5O C;  2NRH A;  3DRS A;  3MXJ A;  1VQ5 N;  3OYF A;  4AIL C;  1X9S A;  3VPZ A;  1JLA A;  1S9E A;  3OYL A;  1JLF A;  2D0B A;  3HK2 A;  1UAX A;  3QLH A;  3DI6 A;  4OKJ A;  4CF2 A;  1YJ9 N;  1I94 K;  3AAQ A;  4OKK A;  4XH1 A;  5JS2 A;  3TAG A;  1JXE A;  2BE2 A;  3R6M A;  1B9D A;  1BQM A;  4PWD A;  4Y1C A;  1YIT N;  4DQQ A;  5KRT A;  1Q7Y O;  4IWV A;  3PO5 A;  4DV2 K;  5HL7 L;  3VGM A;  2CGL A;  2A5X A;  1RFQ A;  3AAR A;  2O4G A;  3O9R A;  4ILJ A;  4E1M A;  3RMA A;  3ENO A;  4CIG A;  3SYZ A;  1VQ6 N;  3ASM A;  2RPI A;  3EKU A;  3SMP A;  2H3G X;  4C8M A;  3KJV A;  4BR9 A;  3RVC A;  3O9S A;  4DTP A;  2YKN A;  2QEX N;  3QNO A;  1ZBF A;  2FSN A;  4HTU A;  4FJJ A;  2A42 A;  3BEX A;  3AO2 A;  3KWG A;  5LL6 Z;  3AVC A;  4GVE A;  3CF5 L;  3A5L C;  1YJW N;  1ZBH A;  4CHY A;  4DSI A;  4RW4 A;  4BVO A;  3VA3 A;  3C65 A;  3P38 A;  4DQS A;  4LC9 B;  1RDA A;  4Q0B A;  3O9Q A;  4BGA A;  4Z0U A;  4BR7 A;  4EHU A;  4B9Q A;  1Q82 O;  4ILG B;  1RCH A;  3V6D A;  4CJ4 A;  3SCX A;  4F9O A;  3ZSR A;  4CJF A;  1D8Y A;  3IRX A;  1BCO A;  2I5J A;  2XO7 A;  3IMX A;  2KFN A;  3M6G A;  2GWJ A;  4OPH A;  2P9L B;  3VF2 A;  4PHT X;  4JKD A;  3LAM A;  1BUP A;  4H4O A;  1E3M A;  2YHX A;  3SPZ A;  4LSL A;  5LMU K;  2GTD A;  4CZJ A;  4WF9 L;  2IVP A;  3OS2 A;  1KAX A;  1WOQ A;  5F2R A;  3LDQ A;  4XH5 A;  4DTU A;  5EY4 A;  3JAM O;  3LPU A;  4FJ8 A;  4MLE A;  4M3R A;  3F5T A;  3AA5 X;  4YOW A;  3PO4 A;  2Q2R A;  4JHD B;  1VQ7 N;  5IWA K;  4B1Z A;  3L3U A;  3J7Y P;  3ZYY X;  3K5L A;  4GMJ B;  3KK7 A;  4DR2 K;  1HKG A;  1DT9 A;  4AHV A;  2HHT A;  4A62 A;  4OPK A;  1X1P A;  4UQG A;  4JHD A;  2HNZ A;  1DKG D;  3DOK A;  3E9O A;  1VSE A;  3H08 A;  2HHX A;  4A57 A;  4E0D A;  3WNE A;  3HST B;  3QBW A;  1TUU A;  3PUF A;  1WBB A;  4I2Q A;  4KHN A;  1I3A A;  3MAQ A;  4B9N A;  5KPT A;  4CBU A;  2QWQ A;  4CEE A;  3KLI A;  5M1P A;  3A5N C;  1WSF A;  3HXM A;  4EP5 A;  4KBO A;  2ZQB A;  4NXM K;  1JCF A;  2OZM A;  3MWT A;  2Z1I A;  3P39 A;  4FJM A;  4FLT A;  3FFI A;  4K41 A;  1A5X A;  4YDU C;  1KSP A;  2OPP A;  5CR4 A;  3FR0 A;  1EO1 A;  1N6Q A;  4Q5V A;  4FWL A;  3CMA N;  4FJ9 A;  4FWR A;  1BHL A;  4IEI A;  1TKD A;  1B92 A;  3U9D A;  2QKK A;  3KIO A;  3K5O A;  3RMD A;  4E89 A;  2G8F A;  4UY8 O;  3VEX A;  1R59 O;  3AVL A;  4M45 A;  2NNW A;  1KCF A;  2WFB A;  4BRP A;  3SAG A;  4KRE A;  2X6S A;  4FVU A;  1MWM A;  3CHW A;  4M3Y A;  4M3T A;  1T7P A;  5GIO A;  1QS4 A;  3U4L A;  3MWP A;  4CFD A;  4RW9 A;  2VG5 A;  5ADX H;  3AVI A;  2BUP A;  4BRL A;  3PIO L;  4EFH A;  1FXX A;  4FLX A;  2WBN A;  3VET A;  1U48 A;  1JL2 A;  1HJO A;  4F3T A;  2QW9 A;  3HTV A;  4PKI A;  2AA4 A;  1J6Z A;  4CJV A;  4B3O A;  3AVJ A;  3WEE B;  3CJ9 A;  3HOT A;  4CZI A;  1TK5 A;  1NOY A;  1RDD A;  2YNF A;  3WXM B;  4KFB A;  3I8D A;  2PAV A;  3WEE A;  4DV4 K;  4E7I A;  4DHY A;  1IBK K;  1SKR A;  3R8E A;  1QZ5 A;  2Y1I A;  2KKZ A;  3DMJ A;  3CPW M;  5HRO A;  1HJR A;  3HL8 A;  3SQ1 A;  1QQM A;  4H5W A;  2OPR A;  1ESV A;  4B9L A;  1SUQ A;  4IO8 A;  3VTH A;  2P9S B;  3KKS A;  5AFU A;  3M8Q A;  4LF7 K;  3J81 O;  3ZT1 A;  2W40 A;  4C23 A;  2P9S A;  5CYQ A;  4R5P A;  4DTN A;  4H5V A;  1K8A O;  1RTI A;  4PY5 A;  1W9H A;  3VOV A;  1W2B M;  4B1W B;  1HR0 K;  2ZE2 A;  4DUZ K;  5IT9 O;  1BWF O;  3DOL A;  1WB9 A;  1WSG A;  1S1T A;  5AQN A;  4CJQ A;  4CJU A;  2FSK A;  4CHO A;  4FK2 A;  2ZM6 K;  1GOC A;  4O5B A;  4CE9 A;  4H4M A;  2O8C B;  3AO3 A;  4YOU A;  4DQP A;  3C95 A;  4JI8 K;  2VQE K;  1T6C A;  3FZH A;  3FZM A;  3ID8 A;  4BR4 A;  2O8C A;  5AQP A;  4BGB A;  3W0L A;  3GOI A;  1XHX A;  5C0Y A;  3AAP A;  2XY8 A;  4ISE A;  3CJC A;  4WQ5 A;  3DJC A;  2Q1N A;  4GVM A;  4OVL A;  3MEG A;  2G8H A;  3QML A;  4EAH D;  4YOY A;  1JLQ A;  1ASW A;  3ZSO A;  4BRK A;  3ZSY A;  3CCS N;  3I33 A;  4IFE A;  1RBR A;  3B8A X;  4C1N I;  4BC4 A;  4YY3 K;  4JS4 A;  5LJW A;  4JS5 A;  1KVB A;  4FK4 A;  1TAQ A;  3ZLJ A;  2YI1 A;  3VQ6 A;  5M1K A;  3QIP A;  3T69 A;  1NK6 A;  4AF1 A;  4JI2 K;  2HHS A;  3MED A;  1IO2 A;  5AZJ B;  1ZYQ A;  2P9P B;  3OJS A;  1M90 O;  3A5M C;  4BR0 A;  4ZHR A;  1XWL A;  2QXF A;  3MMV A;  3KLG A;  4RW6 A;  4JKB A;  4CEA A;  4CZL A;  3ZT0 A;  5AZJ A;  2BGG A;  2P9P A;  2VGM A;  5KQ8 A;  3LZJ A;  4JN4 A;  3ATV A;  3V1Q A;  1L3S A;  3SQ4 A;  4FOI A;  2ZD1 A;  3O3F A;  3ENH A;  3GE1 A;  1NM1 A;  4FCY A;  4AHU A;  5BPL A;  4YFU A;  1RTJ A;  4KTW A;  1TKX A;  3NHG A;  3V9X A;  5M1N A;  2HF4 A;  1ATN A;  1RTH A;  1QHA A;  3KK1 A;  5BRF A;  4BRA A;  3FE1 A;  2QWP A;  3N4P A;  4WCE L;  3O80 A;  4FWS A;  4HTL A;  5BN9 A;  4B8A B;  1J5E K;  1DTT A;  1SL2 A;  1U47 A;  4JKG B;  3HI0 A;  4GKJ K;  4DTR A;  4BR5 A;  3CER A;  2QWL A;  4DV7 K;  1HPZ A;  3OBY A;  4FLW A;  1Q8I A;  4CW7 B;  4KAZ A;  1S6P A;  4FWM A;  4JKG A;  4C8N A;  3K2P A;  3QES A;  3QEV A;  4CHN A;  3ISN C;  1BIS A;  5F1X A;  4FOE A;  4FJI A;  1VRT A;  1NK9 A;  1Q81 O;  4PL8 A;  1ZXO A;  4CD1 A;  3WXI A;  3H1V X;  3K58 A;  2KLA A;  5DM7 L;  3LDL A;  3THW B;  3SNN A;  3WXL A;  2A1R A;  1SV5 A;  2BTF A;  3C6H A;  2P9I B;  5KTQ A;  1W97 L;  1CZA N;  2WC9 A;  3BP8 A;  3THW A;  4Y1D A;  1F21 A;  3ID6 A;  3M8R A;  4FLZ A;  1N8R O;  3F73 A;  4DSJ A;  1BU6 O;  3OYK A;  3DRP A;  2P9I A;  3S3N A;  4CEO A;  1R0A A;  4AHR A;  4CGI A;  5I3U A;  1HLU A;  3E9L A;  4O5F A;  4AHS A;  3K5N A;  5LMN K;  4LFA K;  1G99 A;  1UA0 A;  2PBD A;  5AQG A;  3G4S N;  5GAH P;  4F4K A;  4DFK A;  4N56 A;  2KHO A;  5J2P A;  4KHY A;  5CZ2 A;  4BAC A;  1BIU A;  5A2Q O;  4Z4H A;  4BVP A;  3KD1 E;  4ELV A;  4H5T A;  3VEY A;  4G9Z A;  5BN8 A;  4H0O A;  3DLB A;  5EOY A;  3O3H A;  1VQK N;  1V4T A;  3ULE B;  3TAE A;  3VMF B;  4A2A A;  3AVN A;  1YIJ N;  1GLA G;  4YDU A;  4QS8 A;  5H1S Q;  2HHU A;  4B9S A;  1Q18 A;  4K25 A;  4DR3 K;  4IXC A;  1WSJ A;  1RGI A;  3NFA A;  3ULE A;  2RE2 A;  4CJE A;  4I9L A;  4BDP A;  3K9K A;  2CH6 A;  4M63 C;  2QK9 A;  3C6T A;  3WNG A;  1NGD A;  1U6Z A;  3NCI A;  4DFJ A;  3ZT2 A;  3TTC A;  2YCH A;  3CM5 A;  4BRN A;  1LW0 A;  2DFH A;  1VSK A;  4ICL A;  2FSJ A;  4YOV A;  2XY6 A;  3VGL A;  1CXQ A;  2VGN A;  3QBX A;  4CBW A;  4CIF A;  4FXD A;  1HRH A;  3BF1 A;  3RRG A;  2ZJQ L;  1EP4 A;  4PQU A;  3KHY A;  3EE9 A;  5ADX A;  3CC2 N;  3CCR N;  3QER A;  1JLC A;  4OKE A;  4X66 K;  3ZSZ A;  3MXM A;  4YOT A;  2VYP A;  5E84 A;  3LP3 A;  2E2P A;  4O8U A;  3WQU A;  3CCV N;  5BRD A;  4DV1 K;  1NGG A;  3H6E A;  4I7F A;  1N33 K;  1SQK A;  4FWN A;  3QEW A;  5ELZ A;  4BRG A;  3H45 C;  3TAP A;  3TTF A;  2G8K A;  4HUF A;  4RG8 A;  1TK8 A;  1NK8 A;  1CZB A;  4C8K A;  4OPJ A;  3L2V A;  1ASU A;  4E1J A;  1NMD A;  3MDQ A;  3WNF A;  4JEP A;  4YNQ A;  3SMS A;  5SZT A;  5GAD P;  1J5O A;  2RF2 A;  1MA9 B;  4CK3 A;  3ALY A;  4WQ5 C;  4H5N A;  2CGJ A;  3THX B;  1T3V A;  1Q9X A;  2XRI A;  3HVR A;  2IDO A;  3GL1 A;  3QNN A;  3V9U A;  2EHG A;  4DG1 A;  1J9A A;  3BGR A;  3GG4 A;  3U3G A;  1S1U A;  3THX A;  3KZB A;  4PA1 A;  3L0Q A;  3KK2 A;  4B1V A;  1BO5 O;  3CIP A;  3NF8 A;  3SJJ A;  4K8X A;  4CF8 A;  4CZG A;  1KAZ A;  2VWK A;  2YNI A;  1U49 A;  2E1Z A;  2HOE A;  1EQY A;  1SS6 A;  4C1N K;  3UKU B;  1JLE A;  5E41 A;  2HVH A;  2V7Z A;  1GLL O;  1RBV A;  4KI6 A;  4ID5 A;  4LD0 A;  4KTZ A;  5C42 A;  3UKU A;  4IJA A;  4JRP A;  3T1Y K;  4Y0W A;  3A0I X;  1MWK A;  4CJL A;  4TSX A;  3AA3 A;  2QWR A;  4CJS A;  2HBM A;  3IS9 A;  1UA1 A;  3NMU A;  4NCB A;  4A59 A;  3G0Z A;  2IIR A;  3DYA A;  2O8D B;  4CEC A;  2KFZ A;  3TWH A;  2FXU A;  4FLY A;  1RT3 A;  2FLO A;  2FBX A;  2GV9 A;  3ZT4 A;  4BRH A;  1YI2 N;  4LFC K;  4HCB A;  4DF8 A;  1YF5 L;  2O8D A;  3M1F A;  4YOX A;  1JLG A;  3VQB A;  2HHV A;  3ITH A;  3AA2 A;  1TUY A;  3SLC A;  4DTX A;  3UIQ A;  4J2D A;  3WUH A;  4FM2 A;  1WN7 A;  4BRC A;  1E4F T;  4M3U A;  4DTM A;  4IO9 L;  3PIP L;  2HBL A;  4B8C A;  2HW3 A;  4FWQ A;  4GV3 A;  4QOZ B;  2UUC K;  1WUA A;  3L6Q A;  2ASM A;  2ZF5 O;  4CZK A;  2ITM A;  1C6V A;  2JWL A;  3NH2 A;  3O4N A;  1VSM A;  3MXI A;  5I42 A;  1TGO A;  4H8K A;  1IV0 A;  4LF4 K;  1T44 A;  1WSH A;  2YNG A;  2O8B B;  3HJF A;  2JWK A;  5FPD A;  4MQ3 A;  1TL1 A;  5J1E A;  3SAF A;  1HNX K;  2E2Q A;  2P9L A;  3THV A;  2O8B A;  3M3Z A;  1ILY A;  3DWL A;  3NDK A;  3QFP A;  3MCP A;  3OYC A;  3O5B A;  5AZI B;  3O1B A;  4JD2 B;  3HPG A;  4DS5 A;  2IVO A;  2FBT A;  3WNH A;  2F9W A;  1WLJ A;  2EWS A;  5AZI A;  4JNE A;  2G8U A;  4JD2 A;  2A6A A;  3PX0 A;  2LSN A;  3FZF A;  3D45 A;  4B3M K;  5HRS A;  2B6A A;  3CC7 N;  3ZT3 A;  1QTM A;  5EU7 A;  4ELT A;  4DFP A;  3SZ2 A;  4EZ6 A;  4Z4G A;  3LWM A;  4EP4 A;  3V1R A;  3TSU A;  3TAQ A;  4FSV A;  3DXK B;  2VCP A;  1IKY A;  1Y64 A;  4DSE A;  4CGF A;  4BRD A;  3DXK A;  4H0Y B;  1RIL A;  3OS1 A;  3RMB A;  3ZX0 A;  4F8R A;  3U3Y A;  3OJU A;  4X62 K;  4CF0 A;  4DQR A;  2YJE A;  3R3L A;  2FBV A;  4B9V A;  2BH1 A;  4AHT A;  1C1B A;  3HBT A;  4DLG A;  3SJH A;  2Z1G A;  4U67 L;  5FRM A;  1RT2 A;  3VQC A;  1BL3 A;  3D0P A;  4EZ9 A;  4HVJ A;  1KVC A;  5HRR A;  1RT5 A;  4HUE A;  3RR7 A;  4DSF A;  4L3Q A;  3V1O A;  4CEB A;  4E7K A;  2OAN A;  4RCH A;  4NYF A;  5C2D A;  3PX6 A;  3DM2 A;  3NVK A;  5EXW A;  1Z05 A;  3VN5 A;  4KRF A;  2P9N B;  4CJ5 A;  1KXP A;  3IAY A;  1C0G A;  5SWM A;  3MN9 A;  4IG0 A;  4M3Z A;  5E26 A;  1RDW X;  2ETJ A;  4DV0 K;  4JI7 K;  2P9N A;  4CFC A;  2WOM A;  3WT0 A;  1UOC A;  2YNH A;  1G15 A;  4JI4 K;  1X9M A;  4BY9 C;  4MO5 A;  2UUB K;  4OGE A;  3SQ0 A;  3D2F B;  2DFF A;  3KWI A;  4CJ3 A;  2Q3S A;  3NF9 A;  2ZWH A;  5BR9 A;  2OA8 A;  2XY7 A;  3OTO K;  3SAH A;  3L8B A;  2QA4 N;  4GW6 A;  4NLB A;  2JLE A;  3SQ2 A;  3D2F A;  3O1W A;  4KHU A;  3P5J A;  3G6E N;  1HYS A;  3MEC A;  1S22 A;  4DTJ A;  3SI6 A;  4E1N A;  2O8F B;  4DSK A;  3DLG A;  1IKV A;  3AVA A;  2NLX A;  3BUZ B;  1XC3 A;  1RDC A;  2ASP A;  3R1X A;  3JSM A;  4B3R K;  2O8F A;  1FKP A;  1XI1 A;  1ZC6 A;  3Q7B A;  3W3D A;  4LH4 A;  1NKB A;  2I7P A;  4OO1 J;  2KW4 A;  1NKE A;  1TKT A;  4W5T A;  1VQO N;  2G8V A;  4LF6 K;  3MX2 A;  2UXD K;  5M1F A;  3LP0 A;  4FJ7 A;  4GNI A;  3UE5 A;  1Z25 A;  2GUP A;  2DY4 A;  3C6U A;  4J8F A;  3I0S A;  3KLE A;  2NZT A;  3CQY A;  4QS9 A;  2W6K A;  3A8Y A;  3HZ6 A;  4BE0 A;  1U4B A;  4B9U A;  3CFP A;  1BDG A;  2HHH K;  5CY4 A;  2A3Z A;  2P5O A;  3TSQ A;  2NRX A;  1NGB A;  5AR0 A;  1RDU A;  4IG3 A;  2PY5 A;  3U9Z A;  4B9M A;  5AQV A;  2ASO A;  4ZTF A;  2YHB A;  4KB0 A;  5M1Q A;  4U7B A;  2Z1J A;  4CGH A;  1MU2 A;  3HSC A;  4AM6 A;  1J54 A;  3OVN A;  4CJP A;  4FK0 A;  5JS1 A;  5BPM A;  3MN6 A;  1NBW A;  3IG1 A;  4A2B A;  1A5V A;  3OA9 A;  3K5M A;  1YVN A;  3E66 A;  1ZBU A;  3VQ5 A;  2RHK A;  3VQE A;  1N34 K;  3S3M A;  2IS3 A;  3NH1 A;  4Z4E A;  1OVY A;  5FPE A;  1EXQ A;  3BF3 A;  2IOC A;  2Q0R A;  1S3X A;  3KK3 A;  1ITG A;  2HHW A;  1K73 O;  3IDH A;  4H0T B;  1D9F A;  3ATU A;  4CJW A;  2VQF K;  2E1Y A;  4DU1 A;  4CF1 A;  4OX9 K;  5C10 A;  1DEJ A;  4M42 A;  4IFY A;  3V81 A;  2D0C A;  3L4Q A;  4XIU A;  4BC5 A;  4CJ7 A;  1DTQ A;  1X9W A;  4Z94 A;  2O8E B;  3EE8 A;  3VEO A;  4HHT A;  1LOT B;  2QM1 A;  3S41 A;  2YJF A;  4X64 K;  3T3F A;  4O44 A;  2O8E A;  3P83 D;  4DLE A;  5KRS A;  5HRP A;  2Q97 A;  1B9F A;  4LF8 K;  4W5O A;  4NXN K;  4K8Z A;  4KHP K;  4WYB A;  4CED A;  1IKW A;  4PL7 A;  2PZS A;  1KAY A;  4WFA L;  3CJ1 A;  1OH6 A;  2RN2 A;  4JRQ A;  3L2Q A;  4DV5 K;  5AQF A;  5GIN A;  1VQ9 N;  2OYQ A;  4CK2 A;  4CEZ A;  2A1S A;  1GOA A;  3CQ8 A;  3AO1 A;  3CCU N;  3CJ7 A;  3LL3 A;  4RW8 A;  5KQD A;  5AQM A;  4C8L A;  2X74 A;  2QWO A;  4JKH A;  3DLL L;  3H3N O;  3VQ7 A;  4FW2 A;  3C94 A;  3M5R A;  2NRR A;  2WTU A;  2UUA K;  3S9H A;  3LAK A;  4IZ9 A;  2E8A A;  2YKM A;  4CVN E;  1HX1 A;  1NU0 A;  1RTD A;  2E5L K;  2IAJ A;  1YJN N;  3CCQ N;  1S72 N;  1XHZ A;  1HQU A;  3DLK A;  1C1A A;  1S1V A;  3ENB A;  1JLB A;  3NGY A;  5DK5 A;  3VF6 A;  1IJJ A;  4J2B A;  2D0A A;  2HMP A;  2QWM A;  2UXB K;  2GBZ A;  2W6L A;  2ATQ A;  3O9U A;  4CJK A;  4DTS A;  4BC3 A;  1GLF O;  1IG8 A;  4G1Q A;  3VQ8 A;  2OTL N;  2XHB A;  3HYF A;  1SKW A;  2NRW A;  1VSD A;  5BRE A;  5C25 A;  3BDP A;  4HCC A;  4WQ4 C;  3UKR B;  4DV3 K;  3J7A P;  4JKF A;  4CER A;  3DLE A;  1JCG A;  1LWC A;  1S1X A;  1BIZ A;  3ZSX A;  3UKR A;  3WXJ A;  3OYJ A;  3G10 A;  2QXL A;  5TKY A;  3S3O A;  4CJR A;  4RTF D;  4GKK K;  3HM9 A;  1XMQ K;  3F9K A;  5LY3 A;  2F96 A;  5C2F A;  4JLH A;  1OVQ A;  2HVI A;  1CZ9 A;  4M7X A;  4FPB A;  4BE1 A;  3JYT A;  5GAG P;  1CXU A;  4A5A A;  2IVN A;  3FZK A;  3O08 A;  3CFO A;  3V9Z A;  3EL2 A;  1YTU A;  1O1W A;  4GY2 B;  4F2R A;  1XC9 A;  4DWI A;  3VER A;  1CLQ A;  5AQJ A;  4AHC A;  3CXC M;  1S9G A;  4A5B A;  1ZBS A;  3EKS A;  5GIP A;  2Q36 A;  4KB1 A;  1RT4 A;  4CZH A;  1W0H A;  4I2P A;  5DM6 L;  1T8E A;  1C0F A;  2QTD A;  3O8M A;  1QSL A;  2DFE A;  2V52 B;  2FC0 A;  4J2A A;  1NJW A;  4K43 A;  1WNS A;  3OYE A;  3BZK A;  4NCG A;  3ZSQ A;  4F2S A;  3SV4 A;  4CHP A;  4BDY A;  2CGK A;  4DR1 K;  2F4V K;  2QWN A;  2YHW A;  3F9M A;  1C0U A;  5T7B A;  2QI2 A;  4BDZ A;  4DB3 A;  1QQC A;  3LDN A;  2HB5 A;  3O4W A;  4WFN L;  1HYV A;  4J2E A;  3SUP A;  3KLF A;  1HNZ K;  2IGI A;  4IDH A;  3O3G A;  4B1Y B;  5AQR A;  3ZX3 A;  5JVH L;  2Q31 A;  1WSE A;  2WUS A;  1HNV A;  1NWK A;  1XMO K;  4N41 A;  1Z6R A;  1NNE A;  4N76 A;  1LWF A;  2KQ2 A;  4MFB A;  1XNR K;  3HP9 A;  1WAJ A;  4FM1 A;  3F2K A;  3TAF A;  3I56 N;  3ZSV A;  4DV6 K;  1VQ8 N;  3AVK A;  5F0X A;  2P1J A;  4BRI A;  2P5G A;  1FK9 A;  3AO5 A;  2DTU A;  2NRV A;  3I8B A;  5JLF A;  2YX6 A;  1ZBL A;  3NBP A;  1VK0 A;  1X3M A;  4CFB A;  1NK5 A;  1S6Q A;  4O8K A;  3RTV A;  1MDU B;  3O6W A;  5M1O A;  2D0O A;  4GV9 A;  3RRH A;  4B08 A;  4IOA L;  1LWE A;  3SBT A;  4WE1 A;  5HP1 A;  3HP6 A;  3TPQ A;  4MLH A;  2OZS A;  2IC3 A;  4CCH A;  3L2W A;  1C0T A;  1QQN A;  3LAL A;  2VWJ A;  4KHQ A;  4NLC A;  5HRN A;  1ZBI A;  4DU3 A;  1OH5 A;  4CGG A;  5D3G A;  3WQT A;  4NB4 A;  1OKJ A;  2P9K B;  1TAU A;  4BRO A;  4FLV A;  4FO0 A;  3C0B A;  4NO7 A;  2AP1 A;  3CCL N;  4FJK A;  4JYA K;  2I7N A;  3PSF A;  2D1K A;  2P9K A;  1NGA A;  3RR8 A;  3ZCM A;  1YTA A;  4CK1 A;  1GLE G;  3V4I A;  2OPS A;  5AQL A;  4JK9 A;  3SBG A;  4WFB L;  1BA1 A;  1NK0 A;  1VQN N;  3I0R A;  1RT1 A;  2Z1H A;  1QVF M;  4CI6 A;  3VEW A;  3GDQ A;  4FJ5 A;  5FPM A;  2YV0 X;  4DU4 A;  3AV9 A;  1FKO A;  4H0P A;  4DQI A;  1REV A;  4C8O A;  4JAX A;  4FPA A;  4KI4 A;  3KLH A;  1KLM A;  3MEE A;  3HO1 A;  3ULD A;  4CFA A;  3OS0 A;  3JXU A;  3CG7 A;  2P9U B;  1ATS A;  1W7A A;  4N5S A;  2RKI A;  3EN9 A;  1WBD A;  4FZZ A;  1Q86 O;  1K8K B;  2GX9 A;  1HKC A;  4OPA A;  4BRQ A;  3CCE N;  2CH5 A;  1YHQ N;  2P9U A;  5AQQ A;  2NRT A;  1GLB G;  3VTI A;  1K8K A;  5JLH A;  1SL1 A;  3HOS A;  4XEI A;  3THY B;  1BQN A;  4E7L A;  4O55 A;  4JK7 A;  4B1X B;  4ELU A;  3B6O A;  1JCE A;  4KKO A;  5AJ3 K;  4HWI A;  2G8I A;  3FZL A;  3ZET B;  3LWL A;  4KHW A;  4E3S A;  3THY A;  2KTQ A;  1WAF A;  4DR4 K;  1QSS A;  4DQ8 A;  3TAN A;  4OGC A;  2HF3 A;  1NGF A;  3VGK A;  3VEN A;  3ZET A;  2HST A;  3LP2 A;  3K9J A;  3VF4 A;  3PX4 A;  4FM0 A;  3MK6 A;  4DUY K;  1TKZ A;  3CET A;  3CME N;  4DR7 K;  2UYT A;  4K42 A;  3AGR A;  4R79 A;  5TKW A;  3AVF A;  4CEF A;  3TAR A;  4DR6 K;  4JKA A;  5JVG L;  3MCA B;  4GV6 A;  3MN7 A;  1QQO A;  3EEQ A;  1TVR A;  1ATR A;  1J53 A;  1HNI A;  2OTJ N;  3OYM A;  2HBJ A;  2W41 A;  4ISG A;  1NK4 A;  1JXB A;  1QZ6 A;  3SV3 A;  3SUO A;  4FWK A;  4MO4 A;  4Z4F A;  3OHR A;  1M1K O;  5B8H A;  4CHQ A;  2HNY A;  5BR8 K;  4QAG A;  4BC2 A;  1VSL A;  2YHA A;  1HMV A;  4JKC A;  3DRR A;  1KRP A;  3B6P A;  3LAN A;  5AQH A;  3A2F A;  4LFB K;  1NKC A;  2D5R A;  1BA0 A;  3AVG A;  3VQ4 A;  3N4Q A;  1OH8 A;  3QO9 A;  4DR5 K;  4W5N A;  4CIE A;  4EHT A;  5AQS A;  1NOZ A;  2PYL A;  5J2Q A;  4H0V B;  3SUQ A;  3GBT A;  1IBL K;  3NF6 A;  3QEI A;  4JKE A;  1YAG A;  1DGK N;  3VES A;  2X78 A;  4EIA A;  4CGJ A;  5KGX A;  1GLD G;  2BAN A;  3QFU A;  4IFV A;  5KPR A;  3HPH A;  4CEQ A;  4WQ4 A;  3V9S A;  3OYH A;  2E6L A;  1L5U A;  2GWK A;  3KKR A;  2J4R A;  4BQL A;  3KD5 E;  4JI1 K;  2D0P A;  5AQZ A;  4DF4 A;  2V51 B;  3DLH A;  3IUC A;  3C7N B;  3TAM A;  2E2N A;  3LZI A;  5KPZ A;  1HYZ A;  4BRE A;  3OYI A;  3CM6 A;  2GUI A;  1LV5 A;  4LSN A;  1TL3 A;  2EX3 A;  1SL0 A;  3LDS A;  3C7N A;  3TAB A;  1NGH A;  4OJR A;  3J7Z O;  4DS4 A;  3E9P A;  4JK8 A;  5CYM A;  1TV6 A;  3SUN A;  1NJZ A;  4FL9 A;  4IEE A;  5J2N A;  2FF3 B;  4H0X B;  1VSI A;  1SZ2 A;  5AQY A;  1SKS A;  5AQT A;  3EY1 A;  1UWB A;  2GEL A;  1N36 K;  4CF9 A;  2XY5 A;  1KLN A;  3VQQ A;  3NGI A;  3H1Q A;  3FLC O;  1TK0 A;  3K0S A;  2OPQ A;  3FFK B;  4MDA A;  5AQI A;  1NMN A;  4FJX A;  5CE3 A;  4E7H A;  3QEX A;  1FJG K;  3D7E O;  3LM2 A;  3NAE A;  1T6D A;  3BY5 A;  5FLX O;  1Y97 A;  1T05 A;  2A41 A;  4PUO A;  2O4I A;  4BWJ A;  4FZX C;  2D4W A;  2X6N A;  4QCL A;  1IKX A;  4FJL A;  4B1U B;  3OYD A;  1BGX T;  5HOO A;  5FDL A;  5JIC A;  1NGE A;  4M41 A;  1O13 A;  3L3V A;  3HPO A;  1C0M A;  3CCM N;  4H03 B;  4DTO A;  1IH7 A;  3BZC A;  4MDB A;  2GEM A;  3PY8 A;  4E19 A;  2F8T A;  4BRM A;  3NH0 A;  4HUG A;  1XQS C;  2UXC K;  3EYZ A;  4IOC L;  5FPN A;  3CJB A;  4JI5 K;  2A40 A;  2VWB A;  1YXQ A;  1EX4 A;  2E4L A;  1DLO A;  4B3T K;  3QIN A;  2P51 A;  1WSI A;  4DMN A;  4BG8 A;  4JI6 K;  1D9D A;  4FLU A;  3M8S A;  4M3W A;  2F9T A;  5JMV A;  3NE6 A;  4YHH K;  1HNW K;  2KZZ A;  1VSJ A;  1XNQ K;  1U45 A;  3OY9 A;  5AQU A;  3CJA A;  3OW2 M;  1V4S A;  5GAE P;  1NJY A;  4FW1 A;  2V7Y A;  3TTD A;  3NVM A;  4IKF A;  3AVH A;  2E88 A;  4BRF A;  2BDP A;  1E4G T;  2PFU A;  1HQE A;  3HRG A;  3P4I A;  4ID1 A;  3VQP A;  3L2R A;  4BE2 A;  3LP1 A;  5CHI A;  5KGW A;  3H46 O;  5AQW A;  3MN5 A;  1N5Y A;  4KH5 A;  1FW6 A;  4DSL A;  4M7Y A;  2WON A;  1RT7 A;  3SPY A;  1QSY A;  1P8Z A;  5J2M A;  5AQO A;  3EO3 A;  3LDO A;  3RMC A;  3ZEU B;  4CD3 A;  3IFR A;  3AY9 A;  2E20 A;  4CBX A;  2VG6 A;  4KH4 A;  3AGK A;  4FWO A;  4BG9 A;  4CES A;  4KHS A;  1HKB A;  1ASV A;  1LCU A;  3WXK A;  5K14 A;  3ZEU A;  4YOR A;  3VQA A;  4CGD A;  1KC8 O;  3J80 O;  1BOT O;  4JI3 K;  1NK7 A;  3H3O B;  3LDP A;  4CHZ A;  1EWQ A;  3Q7C A;  4BWM A;  3I55 N;  1X3N A;  5C24 A;  1A5W A;  2W42 A;  1IG9 A;  1Z26 A;  4BR2 A;  3HVT A;  3K57 A;  1NGJ A;  3SK3 A;  2YHY A;  1NJX A;  2F7T A;  3CPE A;  1EKE A;  1NJI O;  4IOX A;  1U04 A;  4FVM A;  2JGU A;  1XUP O;  3OBW A;  4KV8 A;  3ZSW A;  4AH9 A;  1JL1 A;  4H5R A;  1HPM A;  2ZGY A;  3T1A A;  3P1G A;  2NUB A;  4FWP A;  3EZ5 A;  4V19 S;  5FRO A;  3AVM A;  1VQL N;  2B5J A;  3VQ9 A;  4LF5 K;  2ZGZ A;  3HM8 A;  1P90 A;  1GOB A;  1RT6 A;  5LJV A;  1YVU A;  4K0K K;  1RNH A;  1S1W A;  4L8R B;  4OLB A;  3TU5 A;  3AA4 A;  4I6M B;  3VA0 A;  2E6M A;  3DAW A;  1KFS A;  4ISF A;  4IDK A;  4AM7 A;  1VSF A;  4FJN A;  4AQY K;  3CI5 A;  4I6M A;  3UB5 A;  4X65 K;  1OH7 A;  1VHX A;  1N32 K;  2HMI A;  3G25 A;  1BCM A;  4JV5 K;  1NG9 A;  1RDB A;  1RBS A;  4LY7 A;  4I9Q A;  2HND A;  2VG7 A;  4QS7 A;  3D2E B;  3U6F A;  4N47 A;  4FJH A;  1NGI A;  5EVZ A;  3AO4 A;  3PV8 A;  4KPY A;  3PSI A;  3T1H K;  1S5J A;  3K59 A;  3NF7 A;  1VSH A;  3D2E A;  3V9W A;  1VRU A;  1HUX A;  4NYN A;  4LF9 K;  1D4X A;  3AVB A;  1VQ4 N;  5MLC Q;  2B4J A;  1BI4 B;  4BQZ A;  1GLC G;  3OYG A;  5BPN A;  3L4I A;  3QIO A;  4RWT A;  4DKW A;  2F8S A;  2R7Y A;  2Y1J A;  2OCE A;  2G8W A;  2HBK A;  3DXM B;  5FRN A;  1YUW A;  1NGC A;  3KVG A;  1BI4 A;  1JKH A;  3O9T A;  2ZJR L;  4CZF A;  4DFM A;  1LW2 A;  5DMR A;  3DXM A;  4IBN A;  1RBT A;  2ZJP L;  5BRH A;  1KQS M; 
#chains in the Genus database with same CATH homology
 3PX6 A;  5HLF A;  3DM2 A;  3VQ6 A;  4FJ5 A;  3QIP A;  4KRF A;  3M8P A;  3QET A;  1L3T A;  4B9T A;  4Z4I A;  1NK6 A;  2YV0 X;  5CZ1 A;  4DU4 A;  3VN5 A;  3AV9 A;  1FKO A;  1LAW A;  4CJ5 A;  3MED A;  1REV A;  3OYB A;  4RW7 A;  3IAY A;  4DQI A;  1KTQ A;  3HT3 A;  1KFD A;  1IO2 A;  4C8O A;  1ZYQ A;  2QKB A;  1K6Y A;  5SWM A;  3OJS A;  3NGZ A;  4IG0 A;  3LPT A;  4KI4 A;  4M3Z A;  3KLH A;  1KLM A;  1D5A A;  3MEE A;  1I39 A;  2ETJ A;  4ZHR A;  3HO1 A;  3ULD A;  1XWL A;  2QXF A;  4CFC A;  4CFA A;  3KLG A;  1L3V A;  3HK2 A;  2FBY A;  1YT3 A;  4RW6 A;  4CEA A;  3OS0 A;  2WOM A;  3ZT0 A;  3OYA A;  2BGG A;  3CG7 A;  1UOC A;  4W5R A;  2YNH A;  1G15 A;  3LZJ A;  1X9M A;  4KO0 A;  3TR8 A;  2RKI A;  4N5S A;  3V1Q A;  4OGE A;  3SQ0 A;  3SQ4 A;  1L3S A;  4FZZ A;  2DFF A;  4CJ3 A;  1Q9Y A;  1L3U A;  2Q3S A;  3QEP A;  3NF9 A;  4NCA A;  2ZD1 A;  4CJT A;  3O3F A;  2OA8 A;  4FCY A;  2XY7 A;  4AHU A;  3T19 A;  2KZM A;  3L8B A;  4GW6 A;  2JLE A;  1C1C A;  1RBU A;  3CFR A;  3SQ2 A;  4F3O A;  1SL1 A;  4KHU A;  4YFU A;  1RTJ A;  3TI0 A;  1EET A;  3P5J A;  4KTW A;  1TKX A;  3NHG A;  3VQD A;  3V9X A;  4ZTJ A;  1BQN A;  1HYS A;  4E7L A;  1RTH A;  4O55 A;  3MEC A;  3E01 A;  2PYJ A;  4DTJ A;  3SI6 A;  4E1N A;  4ELU A;  3KK1 A;  4DSK A;  3B6O A;  3DLG A;  1IKV A;  4KKO A;  3AVA A;  4OLA A;  2G8I A;  4O0I A;  1RDC A;  3JSM A;  4B8A B;  3LWL A;  4KHW A;  3CYM A;  4E3S A;  2KTQ A;  1WAF A;  4LH5 A;  1QSS A;  1DTT A;  3TAN A;  4M3X A;  4OGC A;  1SL2 A;  1FKP A;  1XI1 A;  1U47 A;  4KTQ A;  4DTR A;  3LP2 A;  4E7J A;  1LAV A;  4LH4 A;  1NKB A;  4FJG A;  3PX4 A;  4FM0 A;  2KW4 A;  1TKZ A;  1NKE A;  1TKT A;  1HPZ A;  4O4G A;  4W5T A;  1QHT A;  1Q8I A;  4FLW A;  2G8V A;  1S6P A;  4KAZ A;  4Z4C A;  4C8N A;  3AVF A;  3K2P A;  3QES A;  4CEF A;  3KTQ A;  3QEV A;  4FYD A;  3LP0 A;  3TAR A;  4O0J A;  2HHQ A;  4CHN A;  3ISN C;  1BIS A;  4FJ7 A;  4FJI A;  1VRT A;  3L2U A;  1NK9 A;  2ITG A;  1TVR A;  1Z25 A;  2DY4 A;  3C6U A;  4W5Q A;  5HBM A;  3I0S A;  3KLE A;  1J53 A;  1HNI A;  4FZY A;  3OYM A;  1QE1 A;  3DLR A;  1U4B A;  3OYN A;  4BE0 A;  4B9U A;  3CFP A;  3K58 A;  1NK4 A;  5CY4 A;  1JXB A;  3SUO A;  3SV3 A;  1KVA A;  2P5O A;  4Z4F A;  3SNN A;  5KI6 A;  2AJQ A;  2A1R A;  4CHQ A;  1SV5 A;  2HNY A;  4IG3 A;  1KRP A;  2PY5 A;  4QAG A;  1T03 A;  4B9M A;  5KTQ A;  1VSL A;  2YHA A;  1HMV A;  3O4Q A;  4ZTF A;  4Y1D A;  3MXJ A;  2YHB A;  3DRR A;  3DRS A;  3OYF A;  4AIL C;  1F21 A;  4FLZ A;  3M8R A;  1X9S A;  4KB0 A;  2Z1J A;  1JLA A;  1S9E A;  3B6P A;  3F73 A;  3LAN A;  4CGH A;  1MU2 A;  1JLF A;  2D0B A;  3A2F A;  3OYK A;  1UAX A;  3DRP A;  3DI6 A;  2D5R A;  3QLH A;  3AVG A;  3VQ4 A;  4OKJ A;  4CF2 A;  3S3N A;  1J54 A;  4CEO A;  3OVN A;  3QO9 A;  1R0A A;  4AHR A;  4CGI A;  5I3U A;  4AHS A;  4OKK A;  5JS2 A;  3K5N A;  4CJP A;  4W5N A;  3TAG A;  4FK0 A;  1JXE A;  4CIE A;  5JS1 A;  2BE2 A;  3OYL A;  1NOZ A;  1UA0 A;  1B9D A;  1BQM A;  2PYL A;  4Y1C A;  5J2Q A;  3IG1 A;  4PWD A;  3SUQ A;  1A5V A;  4F4K A;  3K5M A;  4DQQ A;  3NF6 A;  5KRT A;  4DFK A;  1ZBU A;  3VQ5 A;  4N56 A;  5J2P A;  3QEI A;  3PO5 A;  4KHY A;  5CZ2 A;  4BAC A;  3VQE A;  2O4G A;  3S3M A;  2X78 A;  4E1M A;  2IS3 A;  1BIU A;  4CGJ A;  3NH1 A;  3RMA A;  4Z4E A;  5KGX A;  2BAN A;  4Z4H A;  4IFV A;  4CIG A;  1EXQ A;  3SYZ A;  2IOC A;  3ASM A;  2RPI A;  1ITG A;  3KK3 A;  3KD1 E;  2HHW A;  4ELV A;  1D9F A;  3HPH A;  4C8M A;  4CEQ A;  4CJW A;  3KJV A;  3V9S A;  3OYH A;  2E6L A;  1L5U A;  4DU1 A;  4DTP A;  2YKN A;  3KKR A;  4CF1 A;  3KD5 E;  3DLB A;  3QNO A;  4M42 A;  1ZBF A;  3O3H A;  4IFY A;  4HTU A;  4DF4 A;  3V81 A;  4FJJ A;  3DLH A;  3TAE A;  2D0C A;  3AO2 A;  3AVN A;  3TAM A;  3LZI A;  3AVC A;  1HYZ A;  2HHU A;  1ZBH A;  4XIU A;  4B9S A;  4CHY A;  4DSI A;  3OYI A;  3CM6 A;  2GUI A;  1DTQ A;  1X9W A;  1LV5 A;  4RW4 A;  4LSN A;  1WSJ A;  3VA3 A;  1TL3 A;  3NFA A;  2EX3 A;  1SL0 A;  4HHT A;  3LDS A;  4CJE A;  3TAB A;  4I9L A;  4DQS A;  4OJR A;  4BDP A;  1RDA A;  4Q0B A;  4DS4 A;  1NKC A;  3T3F A;  2QK9 A;  3C6T A;  4O44 A;  4Z0U A;  5CYM A;  1TV6 A;  3SUN A;  1NJZ A;  3P83 D;  4DLE A;  5J2N A;  5KRS A;  3WNG A;  3NCI A;  1VSI A;  4DFJ A;  5HRP A;  1B9F A;  1SKS A;  1RCH A;  4W5O A;  1UWB A;  3EY1 A;  3ZT2 A;  4CJ4 A;  4CF9 A;  3V6D A;  4K8Z A;  4CED A;  1IKW A;  3CM5 A;  2XY5 A;  2PZS A;  1LW0 A;  2DFH A;  1KLN A;  1VSK A;  4ICL A;  3SCX A;  3VQQ A;  3ZSR A;  4CJF A;  3NGI A;  2XY6 A;  1D8Y A;  3IRX A;  1CXQ A;  2RN2 A;  4JRQ A;  1TK0 A;  3L2Q A;  1BCO A;  2I5J A;  2XO7 A;  2OPQ A;  4CIF A;  2KFN A;  4FXD A;  1HRH A;  3RRG A;  1EP4 A;  4PQU A;  3LAM A;  4H4O A;  2OYQ A;  4CK2 A;  4LSL A;  4CEZ A;  2A1S A;  3SPZ A;  4FJX A;  1GOA A;  4E7H A;  3QEX A;  3CQ8 A;  3AO1 A;  3QER A;  1JLC A;  4OKE A;  3ZSZ A;  3OS2 A;  3MXM A;  4RW8 A;  3NAE A;  3LP3 A;  1Y97 A;  1T05 A;  4C8L A;  2O4I A;  4DTU A;  2X74 A;  4PUO A;  4BWJ A;  4FZX C;  3VQ7 A;  2X6N A;  3LPU A;  4FW2 A;  1IKX A;  4I7F A;  3C94 A;  4FJL A;  4FJ8 A;  4QCL A;  3OYD A;  1BGX T;  4M3R A;  3QEW A;  5FDL A;  3S9H A;  3TAP A;  3AA5 X;  4M41 A;  2G8K A;  4HUF A;  4RG8 A;  3LAK A;  2YKM A;  3L3V A;  3HPO A;  1C0M A;  1RTD A;  1TK8 A;  3PO4 A;  4DTO A;  1NK8 A;  1CZB A;  1IH7 A;  2IAJ A;  4C8K A;  4OPJ A;  3PY8 A;  4E19 A;  3L3U A;  1ASU A;  3L2V A;  1HQU A;  1XHZ A;  3NH0 A;  2F8T A;  3DLK A;  3K5L A;  4GMJ B;  4HUG A;  3WNF A;  1C1A A;  3EYZ A;  4YNQ A;  4AHV A;  1S1V A;  1JLB A;  3NGY A;  5DK5 A;  2HHT A;  4OPK A;  1X1P A;  4UQG A;  5SZT A;  2D0A A;  4J2B A;  2HNZ A;  3DOK A;  1J5O A;  1VSE A;  2RF2 A;  3H08 A;  2HHX A;  2GBZ A;  3ALY A;  4CK3 A;  2ATQ A;  4CJK A;  1EX4 A;  2E4L A;  1DLO A;  4DTS A;  1Q9X A;  4E0D A;  2XRI A;  3QIN A;  2IDO A;  2P51 A;  1WSI A;  3HST B;  3WNE A;  4DMN A;  3HVR A;  3QNN A;  3V9U A;  1D9D A;  2EHG A;  4G1Q A;  1J9A A;  3VQ8 A;  4DG1 A;  3BGR A;  3PUF A;  3HYF A;  3M8S A;  2XHB A;  4I2Q A;  4FLU A;  3U3G A;  1SKW A;  4M3W A;  1S1U A;  3NE6 A;  4KHN A;  2KZZ A;  1VSJ A;  1I3A A;  4PA1 A;  1VSD A;  3KK2 A;  1U45 A;  3OY9 A;  5C25 A;  3MAQ A;  4B9N A;  3BDP A;  3NF8 A;  4HCC A;  3SJJ A;  4K8X A;  4CF8 A;  1U49 A;  2YNI A;  2VWK A;  4CEE A;  3KLI A;  4CER A;  3DLE A;  3HXM A;  1WSF A;  1NJY A;  4EP5 A;  4FW1 A;  1JLE A;  2ZQB A;  5E41 A;  1LWC A;  1S1X A;  2HVH A;  2OZM A;  3AVH A;  2Z1I A;  4IKF A;  2BDP A;  4FJM A;  4FLT A;  1RBV A;  1BIZ A;  3FFI A;  3ZSX A;  4KI6 A;  4ID5 A;  1HQE A;  4LD0 A;  1A5X A;  1KSP A;  4KTZ A;  5C42 A;  2OPP A;  3OYJ A;  3G10 A;  3S3O A;  4ID1 A;  3VQP A;  4CJR A;  3L2R A;  4BE2 A;  3LP1 A;  3HM9 A;  5KGW A;  4JRP A;  1N6Q A;  3F9K A;  4Q5V A;  2F96 A;  4JLH A;  1N5Y A;  4DSL A;  4CJL A;  4FJ9 A;  4TSX A;  1BHL A;  1TKD A;  2HVI A;  1CZ9 A;  3AA3 A;  1B92 A;  2QKK A;  2WON A;  4BE1 A;  4CJS A;  1RT7 A;  3SPY A;  1QSY A;  3KIO A;  3K5O A;  3IS9 A;  4E89 A;  3JYT A;  5J2M A;  3RMD A;  1UA1 A;  4NCB A;  2G8F A;  3G0Z A;  1CXU A;  3DYA A;  3RMC A;  4CEC A;  2KFZ A;  3TWH A;  4FLY A;  3AVL A;  3CFO A;  2VG6 A;  4M45 A;  3V9Z A;  1YTU A;  1RT3 A;  1O1W A;  4F2R A;  1KCF A;  2FBX A;  2GV9 A;  3ZT4 A;  4CES A;  4KHS A;  1XC9 A;  1ASV A;  4DWI A;  4KRE A;  4HCB A;  4DF8 A;  5K14 A;  1CLQ A;  2X6S A;  4AHC A;  1JLG A;  3VQA A;  3RWU A;  1S9G A;  3VQB A;  4CGD A;  2HHV A;  3ITH A;  3AA2 A;  4DTX A;  4M3Y A;  4M3T A;  3UIQ A;  1T7P A;  4J2D A;  4FM2 A;  1NK7 A;  1QS4 A;  4CHZ A;  1WN7 A;  4BWM A;  4CFD A;  4M3U A;  4RW9 A;  4KB1 A;  1RT4 A;  5C24 A;  4DTM A;  2VG5 A;  1W0H A;  1A5W A;  3AVI A;  2W42 A;  1IG9 A;  4I2P A;  4B8C A;  1T8E A;  1FXX A;  4FLX A;  2HW3 A;  1U48 A;  1Z26 A;  1QSL A;  4QOZ B;  1JL2 A;  2DFE A;  3HVT A;  4F3T A;  2FC0 A;  3K57 A;  4J2A A;  1NJW A;  1C6V A;  3NH2 A;  1WNS A;  3O4N A;  1VSM A;  3OYE A;  1NJX A;  4CJV A;  4NCG A;  3ZSQ A;  4F2S A;  4B3O A;  3SV4 A;  4CHP A;  4BDY A;  3MXI A;  5I42 A;  1TGO A;  4H8K A;  3AVJ A;  1EKE A;  1WSH A;  1U04 A;  2YNG A;  2JGU A;  4FVM A;  1TK5 A;  1NOY A;  1C0U A;  1RDD A;  5T7B A;  4KV8 A;  4BDZ A;  3ZSW A;  2YNF A;  4AH9 A;  3HJF A;  1JL1 A;  4KFB A;  1QQC A;  2HB5 A;  1HYV A;  4MQ3 A;  4J2E A;  1TL1 A;  5J1E A;  3I8D A;  3SUP A;  3KLF A;  4E7I A;  3T1A A;  3THV A;  3P1G A;  2IGI A;  2NUB A;  3O3G A;  3NDK A;  3OYC A;  3EZ5 A;  1WSE A;  1SKR A;  1HNV A;  5FRO A;  3HPG A;  4DS5 A;  3AVM A;  2Y1I A;  5HRO A;  3DMJ A;  2FBT A;  4N41 A;  4N76 A;  1HJR A;  1LWF A;  2KQ2 A;  3HL8 A;  3SQ1 A;  2B5J A;  4MFB A;  3WNH A;  3VQ9 A;  3HP9 A;  1WLJ A;  1WAJ A;  4FM1 A;  1GOB A;  1RT6 A;  2OPR A;  3TAF A;  2G8U A;  3PX0 A;  3ZSV A;  4B9L A;  1YVU A;  1SUQ A;  2LSN A;  3D45 A;  3AVK A;  1RNH A;  1S1W A;  3KKS A;  2P1J A;  5HRS A;  2B6A A;  3ZT3 A;  2P5G A;  1FK9 A;  5EU7 A;  1QTM A;  3AO5 A;  4ELT A;  4L8R B;  4OLB A;  3M8Q A;  2DTU A;  4DFP A;  3AA4 A;  3ZT1 A;  3SZ2 A;  3VA0 A;  4EZ6 A;  2E6M A;  1ZBL A;  4Z4G A;  1KFS A;  3NBP A;  1VK0 A;  3LWM A;  4CFB A;  4IDK A;  4EP4 A;  3V1R A;  5CYQ A;  1S6Q A;  4R5P A;  4DTN A;  3RTV A;  3TAQ A;  1RTI A;  1NK5 A;  4PY5 A;  1W9H A;  1VSF A;  4FJN A;  2ZE2 A;  4B08 A;  3RRH A;  1LWE A;  1IKY A;  3DOL A;  2HMI A;  4WE1 A;  1WSG A;  3HP6 A;  1S1T A;  4DSE A;  4CGF A;  5HP1 A;  2OZS A;  2IC3 A;  1BCM A;  4CCH A;  4CJQ A;  1RDB A;  1RBS A;  4CJU A;  4LY7 A;  4CHO A;  3OS1 A;  1RIL A;  2HND A;  1GOC A;  4O5B A;  3RMB A;  4CE9 A;  3L2W A;  4I9Q A;  4FK2 A;  2VG7 A;  3U6F A;  4F8R A;  4N47 A;  3U3Y A;  1C0T A;  4FJH A;  4H4M A;  3OJU A;  4CF0 A;  4DQR A;  3LAL A;  3AO4 A;  2VWJ A;  3PV8 A;  4KPY A;  4KHQ A;  3AO3 A;  2FBV A;  4B9V A;  5HRN A;  4DQP A;  3C95 A;  1ZBI A;  4DU3 A;  4AHT A;  1C1B A;  4CGG A;  1S5J A;  5D3G A;  3K59 A;  3NF7 A;  1VSH A;  4DLG A;  3V9W A;  4DSJ A;  1VRU A;  2Z1G A;  4FLV A;  1TAU A;  4NYN A;  3AVB A;  5FRM A;  1RT2 A;  2B4J A;  1BI4 B;  4FJK A;  3VQC A;  1BL3 A;  3OYG A;  3D0P A;  3QIO A;  1XHX A;  4EZ9 A;  2F8S A;  2R7Y A;  2Y1J A;  3RR8 A;  2G8W A;  3ZCM A;  1YTA A;  4HVJ A;  2XY8 A;  1KVC A;  5HRR A;  4CK1 A;  5FRN A;  4OVL A;  4GVM A;  3V4I A;  2OPS A;  1RT5 A;  3MEG A;  1BI4 A;  1JKH A;  2G8H A;  4HUE A;  1JLQ A;  1ASW A;  3ZSO A;  2HHS A;  1NK0 A;  3RR7 A;  3ZSY A;  4DSF A;  1RBR A;  4DFM A;  1LW2 A;  5DMR A;  3I0R A;  4IBN A;  1RT1 A;  4JS4 A;  2Z1H A;  1RBT A;  3V1O A;  4CEB A;  4E7K A;  4JS5 A;  1KVB A;  4NYF A;  4FK4 A;  1TAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...