3AOEC

Crystal structure of hetero-hexameric glutamate dehydrogenase from thermus thermophilus (leu bound form)
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
417
structure length
417
Chain Sequence
LKAYRPPEDPGLWDTYLEWLERALKVAGVHPTTLEYLAHPKRLVTLSLPVVMDDGKVRIFQGYRVVHDIARGPAKGGVRLDPGVTLGQTAGLAAWMTLKAAVYDLPFGGAAGGIAVDPKGLSPQELERLVRRYTAELVGLIGPDSDILGPDLGADQQVMAWIMDTYSMTVGSTVPGVVTGKPHALGGSEGRDDAAGLGALLVLEALAKRRGLDLRGARVVVQGLGQVGAAVALHAERLGMRVVAVATSMGGMYAPEGLDVAEVLSAYEATGSLPRLDLAPEEVFGLEAEVLVLAAREGALDGDRARQVQAQAVVEVANFGLNPEAEAYLLGKGALVVPDLLSGGGGLLASYLEWVQDLNMFFWSPEEVRERFETRVARVVDAVCRRAERGGLDLRMGALALALERLDEATRLRGVYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An unique allosteric regulation revealed by hetero-hexameric glutamate dehydrogenase from Thermus thermophilus
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords Glutamate dehydrogenase
total genus 144
structure length 417
sequence length 417
chains with identical sequence D, E, F
ec nomenclature ec 1.4.1.3: Glutamate dehydrogenase (NAD(P)(+)).
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00208 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine dehydrogenase
C PF02812 ELFV_dehydrog_N Glu/Leu/Phe/Val dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1210 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3aoeC01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3aoeC03
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 3aoeC02
4HFNA 5A3JA 1H9BA 3R6DA 3F46A 2G1UA 2Y1OA 1UXJA 1NX6A 3AI3A 3I4CA 4CLRB 2R6JA 3STHA 2ZCUA 4R68A 3QQPA 5C7IO 3RBXA 3N7UA 4KDEA 4DXHA 2VUSA 4YJHA 1GUZA 1MXFA 2BF7A 5ES3A 1I32A 1YBAA 3V2HA 1C1DA 2PD4A 2VOJA 3SX2A 1K6JA 3GLQA 5HS6A 5GZ1A 5KCZA 4YAJA 1C14A 3WTCA 4F6CA 5CPFA 1RKXA 4EJ0A 3AUUA 4WKGA 4ALJA 3RCBA 4B7UA 2O4UX 3C1AA 3VVCA 1E3JA 3I4FA 3TFOA 5EESA 5DDIP 1CWUA 2NSDA 2RIRA 4C7KA 4I1IA 1DIGA 2D5CA 3DONA 3ADPA 3WFIA 4AJHA 4D3SA 4CM3A 4OXYA 4WNIA 5JAZA 2I5PO 2ZQYA 4FB5A 5JSFA 1DAOA 3E8XA 1R4MB 2GRAA 1O8CA 3H9EO 4A10A 4O59O 3EYWA 3PQFA 4Q9NA 3WYEA 2FZWA 3G3EA 1GD1O 3AY3A 5FYDA 3AWDA 2EJWA 2RBEA 5L53A 2Q45A 1U3UA 1U5CA 2P9EA 4BIIA 3Q2KA 1IYZA 2EHDA 4J3FA 1P1FA 1BDMA 2AEMA 2EKQA 5G4KB 4RPHA 2XF8A 3DHYA 1M6HA 4GX5A 1N5DA 2AG8A 1RM0A 1FDSA 2I9PA 4D0SA 1T2CA 5G0VA 2V6GA 1UXGA 2C54A 5JAQA 5IAAA 3FBGA 3V1YA 3LC2O 3GGGA 2P4QA 2PK3A 3DZJA 4CL3A 1R4MA 4CV3A 1FF9A 2O23A 5KJ6A 3OIFA 2X9NA 4NR0A 2VZ9A 4IQ8A 4Q3EA 2EWMA 4BNVA 3ZWAA 1J49A 4LVCA 1VLLA 4HX5A 2NTJA 1M76A 4FFOA 1X0XA 2IYPA 1LUAA 3E9QA 1EMDA 4YBZA 3RJ5A 4TVBA 3PLRA 1U3WA 4Z9XA 2AE2A 3DFUA 1IZ0A 3UAGA 3PLNA 3OQ1A 1NPDA 2VWPA 2YDYA 3DEYX 3RUCA 4FR5A 1I30A 4OXKA 3WGZA 2Q4BA 3NEPX 2A35A 3FRJA 5B37A 2EJVA 4RVGA 5ADHA 4BMSA 1FMCA 1ENYA 1A7KA 3H5AA 4BVAA 4PLTA 4XYMA 3UOGA 4Y6PA 3PIDA 4N5LA 4WECA 1RM4A 1X13A 4GWKA 5A4DA 3ZN2A 2B83A 5CG2A 4UVGA 2X8LA 4UUMA 1GQQA 2DBRA 4PLVA 4CM9A 1UAGA 3PYLA 3HDHA 3GPIA 2NQ8A 1XU7A 1HDOA 4D45A 1I2CA 5EQDA 4CMIB 1CERA 1ARZA 4MDHA 5AVOA 3OJLA 1LDYA 3QIVA 1DDOA 1DEHA 1PWXA 4DL9A 2X22A 3L4SO 1ULSA 1X7GA 3KBOA 1HDRA 3JYLA 1LNQA 2HK8A 4QSMA 4O1MA 3RVDA 2Q1WA 4HFRA 3L77A 3WBFA 1GR0A 1U3TA 2GZ2A 3O8QB 2P68A 4D3DA 3JQCA 2BRUA 2D3TA 3BYZA 4YDRA 3QWIA 5JCXA 1PX0A 1LA2A 4J7CA 1E7QA 3TQHA 5CDUA 4PVDA 3S55A 2QX7A 3QVTA 1XCBA 4BNYA 5C7OO 5L3ZA 2UUPA 3DAFA 2NVUB 4ONEA 2Q2VA 1ZK3A 3H65A 4TRMA 1PJTA 4XB1A 1E7WA 4F6LA 3WGHA 1BXGA 9LDBA 3KM0A 4KQWA 3VTZA 1HZJA 3MJSA 4U8GA 3TJRA 2RH8A 1WVGA 4ALIA 3TOXA 5I7SA 3DHNA 4Q39A 4JJIA 4JNKA 4QECA 1P77A 1MV8A 4IIUA 4DIFA 3ANMA 2Y93A 5EIOA 3OMLA 2C2YA 2POQX 3AFMA 1V3UA 3L07A 2I76A 1TB4A 4OJNA 3Q0EA 4TZTA 5HRUA 1A9ZA 4RF4A 3F47A 3CMCO 1L1FA 2VUTA 1E3LA 2IEDA 1I0ZA 4I5EA 3DMTC 3ITKA 4B4WA 2VRBA 3AOGA 4Y67A 2NQTA 2Q3EA 2V6MA 3HQ4O 2Q1TA 2FPGA 3H7AA 4BV9A 4G65A 1BXKA 3ONEA 4U6QA 3KYCA 4R16A 4FQ8A 1HDZA 4H15A 4L73A 2VT2A 2XOXA 3U0BA 3ZDFA 3QVXA 2O4CA 2QYTA 5CHEA 4A27A 5JDCC 4K9DA 5ICSA 3B1KA 3HDYA 3ENNA 5KKAA 4BO4A 5BT9A 4XKJA 2PGLA 1E6WA 4JBHA 4L4RA 2CVZA 1NM5A 4TROA 3ZV5A 5T57A 1E3SA 2W90A 3DQPA 4G81A 3EW7A 4QTZA 4CMJA 3ZWPA 1JAYA 4TKMA 1Y1PA 3PGJA 3SJ7A 4CM8B 1XELA 3BHJA 4XIYA 3JQ7B 1E6EA 2AEFA 3RC9A 3C7CB 5BSFA 1RPNA 2Q1UA 2J6IA 4WE3A 4RPGA 4IDCA 1U2DA 5JAMA 3HFSA 2DTDA 4HADA 4WK6A 3EHEA 3NTQA 2I6TA 3B70A 3GZ4A 1PL8A 2YJZA 1XR3A 5BNFA 2VYNA 5TC4A 1T1RA 1XYGA 3ST7A 1WZEA 4EYEA 3NUGA 2HO5A 4I08A 5G0UA 4AJPA 1DC4A 5DNAA 1DIHA 3N74A 4PRLA 3DO5A 1MP0A 1WXDA 1PS8A 3JCZA 3MWDB 4XR9A 5FEUA 1F12A 1K2WA 4BKOA 3NDRA 4IDGA 4CM7A 3PXXA 2J5RA 1H6AA 4PZEA 3JD0A 1EK6A 3VZQA 4D3FA 4NIMA 5JE8A 3CUKA 1YH3A 4MKZA 3D4PA 2JD1A 3SXPA 4BV8A 3S8MA 4HFJA 3ZH2A 2B35A 5DCYA 5DBFA 4K1LA 1BXZA 1Q7BA 4GL4A 4RORA 2RHRA 4FC7A 4CM9D 1SZJG 2XXBA 3KZVA 5AQ1A 4KUEA 5DBIA 4ALLA 2G76A 3D3WB 4CJXA 4XEHA 5A1TA 4UEKA 5B4VA 4DUPA 4XJTA 4Z9YA 5EPOA 5DZSA 4MP6A 3GNSA 2CF6A 4B4OA 2DTXA 3B6ZA 1XKQA 2JKVA 1LDNA 1F06A 5CFZA 2AQIA 3DAPA 3DOCA 3A9WA 3C85A 4UVDA 5ER9A 3ZI0A 5MGBA 1ZCJA 5F5NA 3PYXA 2CDBA 3GHYA 4DVJA 3E5MA 2W2LA 4BNFA 3VDRA 5KJCA 2EW8A 3O38A 3KYDB 4HY3A 3GVHA 1BW9A 4K6CA 1ORRA 2DPGA 3GGPA 4NBTA 1ADFA 4AJKA 3VAZA 1E3IA 4QEDA 1D8AA 3AU8A 1EK5A 1CEQA 1P33A 3HE3A 4K28A 3OA2A 3GG2A 2Y68A 4LRTB 4IS3A 1U8FO 4XIJA 5LDHA 2C5EA 3WNVA 1MG5A 1QLJA 1VJTA 5ITVA 3CIFA 2GGSA 5G0TA 2UAGA 1SBYA 2UYYA 4IS2A 4D42A 3ZGYA 1DSSG 5KVQA 3OEWA 5TNXA 1HLDA 4R1TA 3X2EA 3Q9NA 2X0JA 3EC7A 1LRLA 4PLFA 1DHRA 1H0KA 4E5YA 3ENKA 2CNBA 1R4NB 3KHUA 1RWBA 3DL2A 3VPFA 4A03A 3WGTA 5C5IA 4YT5A 2FPIA 3ZHXA 4KTVE 2NU7A 1SB9A 2AE1A 1UUFA 2AW5A 4BNNA 5IN4A 2FY8A 4BNUA 2B4QA 2HK9A 5JYEA 2B36A 3HN7A 1QYVA 4BMVA 5K6AC 2SCUA 3MJTA 2EIHA 1H2HA 3EZYA 4Q3AA 3JQGA 5DOZA 4FS3A 1A4UA 5CEJA 3E9MA 3TSCA 1HETA 2NVUA 3LT4A 3ZU5A 1Y9AA 1A71A 4GX2A 1N9GB 4R5HA 5CDTA 3CZRA 1U3VA 4ZRNA 2RCYA 1KY5A 4P4GA 4HP8A 4AJNA 4EEXA 4RV9A 4BO0A 3P5SA 1FDVA 2JD0A 4CPDA 1YE3A 4HBGA 5AXBA 4J9UE 1H6CA 3VPGA 4K6FA 4R1UA 1YGYA 1M75A 3W1VA 4W9NA 3FPCA 4YAKA 4JP2A 4GH5A 2HRZA 4NFYA 3ONFA 4PLYA 1IPFA 2HDHA 3DZHA 4WNCA 4D43A 3WGIA 3K5PA 4P4LA 1QSGA 3CTMA 3JQ9A 3PK0A 4WCFB 1QLHA 3GQVA 5JPIA 1FJHA 1HZZA 1T2AA 3U3XA 2IRWA 2Y1DA 2ZB4A 5JYDA 1X15A 1MFZA 1BXGB 2JAHA 4Z0PA 2ZB8A 4OIMA 1MG0A 4PLPA 2VHZA 4XYBA 1U7HA 4BUCA 3OIGA 1E7RA 4CM6A 4GLOA 3C1TA 1U9JA 3AUSA 2PKQO 3DBHB 3DC2A 4BKUA 1EQUA 5IFLA 1WZIA 1ZK1A 2O3SA 3KUXA 5EERA 4B79A 1LTHR 4GSLA 5BSEA 4YQZA 5BSHA 1WPQA 1J4AA 1LU9A 3GFGA 3JD2A 1S7CA 2Q99A 1P1KA 3EZLA 1EFKA 4EJ6A 5B4TA 3FN4A 3SC6A 1EE2A 3S2EA 1N2SA 2FHSA 2I67A 4KWHA 4P22A 3NJ8A 1XHLA 2AEJA 1N1GA 2BFOA 4OL9A 4DMMA 1YBMA 1R0KA 3ITDA 3GVCA 3I9LA 4TSKA 4PN3A 1TXGA 1A7AA 2H6EA 3E9NA 4QT0A 1NAIA 4BGUA 3BMCA 3CPSA 1NR7A 3HUDA 3FTNA 1X1EA 1BWSA 2DQ4A 3G1TA 3K30A 1JN0A 4DQXA 1TI7A 1O6ZA 3AY7A 4YYZA 2NVBA 3WLEA 5LCXA 4E2ZA 5KVCA 4D7AA 4O63O 4JBIA 3BAZA 4Y6RA 2P91A 1SCUA 5G4KA 1CYDA 1QRRA 1GU7A 1SO8A 1KVTA 1DC6A 2Y1EA 4E2WA 3WWZA 3WQRA 1D7OA 4JXKA 4CM8A 1YQGA 5KJEA 2HSDA 4UUPA 2W2KB 3Q3CA 4WCFA 4CV2A 4LRSB 2DAPA 4HV4A 1C0KA 2X58A 5HTOA 3PTZA 4TQGA 3GOHA 4WCDA 2J8ZA 1IHYA 1LSOA 5EQFA 2P2SA 3VPHA 3TF5A 1OC4A 2F00A 5T8KA 1E1MA 1N8KA 2GO1A 1QG6A 3GR6A 2I3AA 3CKYA 4RVSA 2ZTVA 4RJTA 1QYCA 4FOOA 4NU5A 3JQDA 3W4IA 5K6AA 1E1LA 5IJZA 1P44A 4L4SA 4N18A 1AUPA 1PJLA 1ENPA 2ZTUA 3ZU4A 3D3WA 1DIAA 5ENDA 4O0LA 2AXQA 3ETGA 1YO6A 3ZW9A 2NU6A 1E3EA 1B15A 5H81A 4AJEA 5I7VA 2IZZA 4B8ZA 2Y1CA 2C0CA 4ZICA 3WTBA 1AGNA 2W2KA 3FTPA 3IUPA 3QV1A 3NV9A 2Y05A 3GAFA 1UZMA 2WE7A 4XA8A 3MCVA 2HU2A 5DP1A 3BTOA 3VKUA 2VT3A 1I33A 4FFRA 3GFBA 4IJUA 3QRWA 2WJPA 4BKQA 4L8VA 2YHIA 5I7EA 2XXJA 4R1NA 4GGPA 1ZJZA 4IY1A 5JY6A 1I3MA 1ZUD1 3KYBA 3DBRA 1BSVA 1UP7A 3BMCB 1YOVB 4LCJA 1X7HA 1LRKA 3H8VA 3RC7A 2XAAA 5HBRA 5JMPA 4PLZA 4E5MA 2IXBA 3K8ZA 3OJ0A 2P5UA 3ON5A 3D5QA 3DZGA 4DWVA 4EDFA 3H5RA 1JVSA 1LX6A 5F21A 4FGSA 4IDEA 1NNUA 5AYVA 4JP3A 2ZIZA 3OBBA 4MP3A 4C4OA 4FPXA 4E30A 2C5AA 3HDQA 1F8FA 3ADOA 4YT8A 1BRMA 3LZ6A 3F4LA 3OICA 2W8ZA 3NT4A 4AG3A 1YDEA 3KSZO 1EUZA 2G5CA 1LQTA 4FOSA 4DIBA 4AJ4A 5DCUA 1PGOA 4B3IA 2OL4A 4GKBA 3BMQB 4J90A 1VRWA 5L7WA 1LDEA 3CMMA 4ZD6A 2OZPA 1FK8A 3WJAA 2CMDA 1YOVA 4ILKA 1DFGA 1BW9B 1NFQA 3QW2A 5TGDA 3WG9A 3GVXA 3PGXA 4CLOB 4CODB 4R51A 1SB8A 2I99A 2O3UA 4TZKA 3U09A 1WAMA 1O0SA 3DAGA 5MDHA 4LMPA 5IXYA 5JAIA 4FFMA 1F14A 3L0DA 3JD3A 2DFDA 1T2FA 5JNLA 3ABIA 2DFVA 3HN2A 3I9OA 3RQSA 5CDGA 4U0KA 2C59A 3JV7A 2X6TA 1D3AA 1RYDA 4KUHA 3KLMX 3ZWMA 1EVZA 1YKFA 1YB4A 2IODA 2G17A 3ICCA 3AFNA 4U6SA 3UKOA 2WEKA 4JIGA 4UUNA 2X0IA 1ZK0A 4XYLA 3MJVA 4KTTE 1U1IA 3SLKA 1NWCA 1PJQA 1YRLA 2NU8A 3U4IA 1PGJA 2BFPA 3ANLA 3U5TA 2YFHA 5DT9A 4AJLA 3FNGA 3GHHA 3NYWA 3WX0A 1MUUA 3KRTA 5KJ1A 2ZJ0A 1LXCA 5IDYA 2YZ7A 2D5AA 3FNHA 1G1AA 3K96A 3JQGB 4YEDA 2X0RA 3TL2A 4TRNA 3ZCXA 2C2XA 2GYYA 3SBOA 1R37A 1G6KA 4KOAA 4NI5A 3FWNA 1Y8QB 4N7RA 3F4BA 2RHCA 3WS7A 2LDBA 1C1XB 1PJSA 2NWQA 2OGUA 4IXTA 1Q0LA 3WYCA 3Q9UA 5BQFA 1MX3A 2PH3A 1GFSA 3D4OA 4OAQA 3WQQA 2R00C 3JD4A 1KERA 3WGQA 1H93A 5JY1A 3JQ8B 2JHGA 4B4VA 3H9UA 5I8ZA 4AL4A 3OJFA 3GDGA 1XGKA 1YL5A 3UH1A 3DWFA 3RUAA 1LEHA 4A73A 1E7MA 1JKFA 2EGGA 4RF3A 4W9NC 5KKCA 1I10A 1B0AA 1VJ1A 3LC1O 3PEFA 2O3RA 2CF5A 2GASA 1DRUA 2BD0A 3GZNA 3QLJA 2PZKA 3ZV4A 5JO0A 3KTDA 4I5FA 1J6UA 4OYRA 4XB2A 4J2HA 4IJWA 1JAXA 3ETDA 3PJEA 3K9QO 1QXSA 4D46A 1E5QA 1YB5A 3PDUA 2BKAA 3WLFA 1W6UA 2VTDA 1CQJA 4DYVA 1R12A 1EDOA 5B1YA 1TEHA 2DM6A 2FR1A 1ZK2A 2GN9A 4W6ZA 1PGQA 4YAEA 5F1PA 3JQBA 4YRBA 3EY4A 2FMUA 4IXWA 4YJGA 4ND4A 1GEGA 3G17A 3HZZA 1I3KA 2O48X 3D5TA 4CM4B 3PWKA 4M1QA 1KVSA 3GC6A 1LRJA 5AXAA 3GEDA 3L4BC 3NDIA 3OA0A 2WWRA 3OJOA 4EBFA 3HJAA 4B3JA 1E77A 4PG5A 4CR6A 4XWYA 3DBVO 2CUKA 3AY6A 4PRKA 4F3YA 4GAEA 3U9LA 3U62A 2YFQA 1F17A 2VRCA 4MVJF 4RL6A 1YJQA 2Y66A 4RPJA 4BO9A 3MJEA 3QWAA 3LF1A 1C1DB 3VZSA 1HLPA 3PZBA 4PGFA 4BNKA 4IZIA 1ZEJA 1X14A 1ZMOA 1JA9A 3WNQA 2EGHA 1HL3A 3AI1A 4FJ2A 5JW6A 2A4KA 3DOOA 2EKLA 2GERA 2VHVA 4B4UA 4CUJA 4TRRA 1ZKMA 4J9VA 3WB9A 4F45A 3H5NA 4BB6A 4U7WA 2EEZA 1I2ZA 4GBJA 3IKTA 4S1VA 1UJMA 1VSVA 3V1UA 1ISIA 2QYSA 3PJFA 4CMEA 4ZQHA 3ZNQA 3MJCA 4Q3CA 1VE9A 2PLAA 3NT2A 4N5MA 2GUGA 4BO3A 5TIIA 3C7DB 2X9VA 4UULA 1YB1A 1EBUA 2GF2A 3UICA 3ROKA 2WM3A 3QVWA 1R0LA 4C7JA 4BNWA 4XCVA 1M67A 4KMSA 1H2BA 4YT2A 3I3OA 5EL0A 3WIEA 1EE9A 2PV7A 2OOSA 4CMHA 1EEHA 3V2UA 1HDXA 1PS0A 4IDFA 2Q2WA 1H9AA 5TX7A 4IBOA 4LISA 2QIOA 3BMQA 2VYND 5C7LO 4NJMB 4ZU3A 5F3RA 2DBZA 4E5NA 3H2SA 1AXEA 4Z3KA 1L7EA 2B5VA 2Y99A 5ICMA 1GAEO 5L4SA 3NKLA 4EZBA 1PZFA 1VL6A 2PWZA 4ND2A 2ZTLA 5HS4A 1X0VA 4P38A 1W0CA 5JLAA 3IUSA 3JYNA 3TZQA 1KYQA 1TT5A 3OP4A 1SEPA 4II2A 4R69A 1DJNA 2YY7A 3ZU3A 3ZWOA 1IOLA 3QP9A 2EW2A 4XJSA 5KVVA 2OFPA 2FPPA 5JFOA 3AI2A 3RIHA 3BA1A 4M86A 3VHRA 4MVJI 5HWSA 2GD1O 3I1JA 1E1KA 1P1RA 3UF0A 3N58A 1YL6A 1K89A 2D2IA 3PHIA 5A3VA 5L45A 1UH5A 1ISMA 3AM5A 2IZ0A 3B1FA 4NBUA 3UXYA 1DFIA 1NFFA 2NACA 7ADHA 2ZYAA 2GCGA 3T7CA 3P7MA 3WJ7A 3AUTA 3HWRA 1ZBQA 2JFGA 2B4RO 1VL8A 1BG6A 1IY8A 2DUUA 1RM3A 4BOYA 3DMYA 4D79A 4I5GA 2EKPA 2O7SA 5TF4A 1GZ3A 4YB8A 3NGLA 4BNHA 1WW8A 3T4XA 2X86A 3HFGA 1U4SA 4OH1A 3QWFA 1W73A 4DPMA 3HB4X 5ITWA 1PZGA 3C24A 2OORA 2WMDA 1T2DA 1D1SA 5TT0A 3S2FA 3IKVA 1IZ9A 4XYGA 3UCEA 1P9LA 3ASVA 5JXWA 1V3VA 2VNAA 4I9NA 4KQXA 2C07A 4JLWA 3D7LA 2VCYA 3M2PA 4PG7A 2PZJA 2GN8A 3FCOA 4CMCA 4EW6A 3LT2A 3C7AA 2OO5A 5KJFA 2PD6A 3JYQA 2EERA 3GZNB 1GUFA 3LLSA 4DQVA 2A92A 1HSZA 1P1IA 3ZV6A 2NU9A 2UDPA 1ISGA 1O5IA 2Q1SA 3IDSA 3WOHA 4KDFA 3WR5A 2JCYA 3I23A 4K26A 4KZPA 1LLDA 4J4HA 2IE0A 5IXSA 4M89A 1CQIA 3BMOB 2VRCD 3QWHA 2NADA 5JC8A 1WNTA 2YUTA 4GVLA 3WGGA 4BHTA 4TKLA 3BTSA 4OM8A 4A5OA 3U4CA 4R4JA 1AE1A 3CSDA 1ML3A 5G0SA 3RFTA 2NVWA 1T2EA 4ZVVA 1V6AA 4RZHA 1O9BA 2O3TA 5IG2A 2D8AA 1A4IA 1DO8A 1T26A 2YDXA 4G2NA 2OBNA 4DGSA 3GGOA 3BZUA 1SC6A 3JQ8A 3GPDG 4FN4A 4WLVA 5ILGA 3AM4A 1JWAB 1T24A 1LSJA 3K92A 4J1NA 3W8DA 3LQFA 1P0FA 2Y0EA 4AJOA 3R3SA 1E0DA 3VZRA 4YJFA 3PFWO 1I5RA 3GN1A 3RD5A 4BO5A 5CPBA 1PQWA 4CUZA 3WSVA 1KVUA 2QRKA 1P45A 2YQ4A 3WQSB 2VHXA 1GQ2A 3IP1A 4ZA2A 3JYPA 3RU9A 1NYTA 1LI4A 1LSUA 1GPDG 3COSA 1CIVA 1P1JA 1YDWA 4CMBA 4CMAA 3NAQA 1IB6A 3DDNA 4EITA 4E21A 1T25A 1LLUA 1Q1NA 4E0BA 2DLDA 1ISFA 4RO0A 3WSWA 2E49A 3MTJA 4BKRA 2IDZA 1DIBA 4PZDA 1NHGA 2V6FA 3I9NA 1D4FA 4O5OA 5AXCA 5KOIA 1I8TA 5AXDA 1SEVA 3AUAA 1N7GA 4AJJA 4CM4A 2PGJA 3EVTA 3ZNOA 2WDZA 2LDXA 4Q3BA 2FSSA 1N92A 2BH9A 3MWEB 4BB5A 2BFAA 1DLJA 2GDZA 5G0WA 1NXQA 1QR6A 4HUJA 1AHIA 3TRIA 3JSAA 4QFCA 1BTOA 4R1SA 3DBRB 1AHHA 4MVJM 3IOYA 4IDBA 4NU6A 4NZ9A 1C0IA 1B3BA 3PJGA 2QZZA 2GSDA 3BMNB 5FI5A 3CE6A 3K73O 3R3JA 1WMBA 1YL7A 4NNJA 2HMSA 3PJDA 1LLQA 1ULUA 3PWZA 3WIDA 5FFFA 5JDIC 4OSPA 1XQ1A 4R3WA 1ZSNA 1UZLA 1GDHA 4A7PA 2Q4EA 4GQAA 4R54A 1C3VA 1E3WA 2E48A 2Y1GA 1PJ3A 3ZWXA 4J0FA 4OHUA 3O4RA 3G1UA 4MIEA 4A0SA 1OOEA 1WDKA 3ZNPA 1FDWA 5G2OA 2EG9A 4MP8A 4BGEA 4DPKA 3P2YA 4NBVA 3QY9A 4UREA 4ZQFA 4GMGA 4H7PA 3PYMA 4BO1A 2DT5A 4LVUA 1HRDA 3K2BA 4BNJA 1FDUA 1GQYA 1PR3A 1SPXA 4XQ9A 3IL2A 5L4NA 4E12A 3LLVA 1T1SA 3OM9A 3KSDO 1NHWA 4RQUA 1LC3A 3ROPA 3WFJA 1PIWA 1X1TA 4H16A 5F1KA 4AJ2A 2AQHA 1KEPA 2OBYA 3FNFA 1M6WA 2YV1A 5JS6A 2H5LA 5L7YA 3W8EA 1LSSA 3A1NA 3DZBA 2ZB3A 1E5LA 1B14A 5ENVA 1R4NA 1I3LA 4OKNA 2DUWA 4IJKA 2VOEA 2HMWA 2QZ9A 1DXYA 2YW9A 4MIYA 4OO3A 1ZK4A 4IM7A 5B12A 2X5JO 2E37A 4NJMA 3R1IA 4DPLA 2I65A 4R3NA 1JKJA 1RJWA 1KVQA 2JAPA 3T7EA 4ZQBA 1MC5A 3FR7A 1NVTA 3I9MA 4YRAA 5A5EA 5FF9A 1UXIA 1OFGA 2ZJ1A 4ROSA 5COAA 2FOIA 3GNQA 1XSEA 3AW9A 3Q6IA 4J49A 4DLLA 2CSUA 1WDMA 1Q7GA 5H83A 4FFLA 4YA6A 1NTOA 2BFMA 3CINA 1NR1A 3U49A 1HWYA 3UGKA 4CR7A 1B3RA 1EFLA 3VOSA 2FR8A 1WMAA 5TSDA 1ZJYA 3KXDA 1V0JA 4FSHA 3MEQA 1DB3A 3L9WA 4WLFA 4UEJA 4YTEA 2CDCA 5L40A 3PHGA 3WBBA 2ZYDA 5TJ9A 2Q50A 1Y8RA 2H1SA 1NWHA 1XWFA 3SC4A 3TNLA 2J3KA 3PI7A 3DMTA 2B37A 2Q2QA 3GAZA 1HF3A 3H9GA 3PHJA 5DULA 3RFVA 3G79A 3H3FA 4ESOA 5C37A 1ADGA 3DTYA 4ZQEA 4XGNA 4ZJUA 3CZMA 1EDZA 4GI2A 1NP3A 1A9YA 5A03A 3VH1A 1LQUA 1ISHA 1VKOA 4UVHA 5FWNA 4RVUA 1HYHA 4IDDA 3M1AA 3OHSX 3VKVA 4CQMA 4LW8A 5CEFA 1N9GA 1EUCA 1F8GA 2DU8A 2OMEA 3NGXA 5DP2A 2O3QA 1B8UA 4DYDA 3NDJA 4R9RA 2JFFA 2HLPA 5TT1A 5JDCA 3FNEA 3IC5A 4MKRA 3OF2A 3ZV3A 4LCEA 3WMWA 1K3TA 1IPEA 1PWZA 1QP8A 3GH3A 1Y6JA 2JHFA 1EQ2A 1YWGO 2YQ5A 3I52A 5A5FA 2D1YA 3L4BA 1R16A 3AM3A 3X2FA 4J6FA 2RAFA 4XRRA 2HKIA 3F6YA 3JQ9C 5LC1A 4IQ0A 1KS9A 4J0EA 2HCTA 2DVMA 1J0XO 3RBVA 1HKUA 1JQBA 3DFZA 2FSVA 3JQBC 1U7TA 1GZ6A 1PZEA 2JFHA 1U28A 1H6DA 8ADHA 1Q0HA 1TVEA 2Q46A 4OOEA 4YR9A 3W4JA 5KTKA 1KETA 3F3SA 3AOEC 4CUKA 3NRCA 3OFSA 3D3EA 1XLTA 2DTEA 1UXHA 3E82A 5T5QA 3GRPA 3RI3A 1NASA 3IQDB 1Y7TA 4CLEA 1CJCA 1EZ4A 2CFCA 3ROQA 5EJ2A 3GVPA 3JQAB 4II3A 1B26A 1AXGA 2DBQA 4AJ1A 1JVBA 4DBZA 3VDQA 4XGKA 2VYVA 1YQXA 3RU7A 4JJGA 3R0IA 4YVFA 1ADCA 1N1EA 1DRWA 2C7VA 2EF1A 4W4TA 4PFJA 1HDGO 3QHAA 1Z73A 4I5DA 4OOFA 2VN8A 3P2OA 4NPCA 2PD3A 4ALNA 4AICA 4MPDA 1V3TA 1Y5RA 2C7GA 3V5NA 4XGIA 2QW8A 2Q49A 4B7CA 2ZK7A 3INTA 6ADHA 3E48A 1KEUA 3UVEA 1Q2XA 4ND1A 3GVIA 1I01A 2VNSA 4BKPA 1ADBA 1UDAA 1K5HA 1R6DA 2WYVA 2B0JA 4PG6A 3LK7A 2PKRA 1Q0QA 1QORA 2B69A 3DBLB 4YJDA 4CV0A 1JWBB 1XIVA 3L6DA 4PVCA 1VL0A 4ND5A 3MJ4A 3FWZA 4TMFA 4HWKA 4CMKA 1MLDA 1R0SA 2PH5A 3D64A 2PKQP 3GF4A 2JL1A 3RUFA 2QG4A 3DHEA 5THQA 1I3NA 5COBA 4BNIA 4U5QA 1NQOA 3W6UA 2NM0A 2C82A 2VWGA 5B4UA 2HRBA 3KLPX 1ZEMA 4A2CA 2X0NA 3EAGA 3WGOA 1A5ZA 1PGPA 3C8MA 5U4QA 4D0RA 3VZPA 4E31A 3GEMA 2QRLA 4JX8A 4IGFA 1DOHA 2G0TA 1DRVA 3VH3A 4FFPA 4PG4A 3WDSA 2AG5A 1LLCA 1UZNA 2C20A 2X23A 3PIIA 1I36A 2Z1MA 4N5NA 5DBGA 1DLIA 2NLOA 3AK4A 1OMOA 1GZ4A 5L4LA 4PLCA 3ULKA 5IDQA 1GPJA 2RH4A 2ZQZA 2CD9A 1NFRA 3L6EA 7MDHA 1VJ0A 4DC0A 3V2GA 3K6JA 4BNTA 4XZ3A 1E6UA 3KETA 4WLUA 2YHIB 1BHSA 1TLTA 2PZLA 2BGLA 4E2XA 1JLLA 2BI8A 4JROA 4L9RA 1GUYA 4ITUA 5A05A 1ONNA 4LSMA 3OQBA 4PIVA 1PGNA 5IN5A 1A27A 3C1OA 4H3VA 4MIOA 3HNPA 3MZ0A 4QXMA 1IHXA 1Z82A 1GTMA 1DC5A 3UCXA 4ALMA 3UUWA 2WD7B 1Z74A 3QWBA 5J23A 4CLDA 3BIOA 1E1NA 1HT0A 4BO2A 3NTOA 3GK3A 1GYRA 4J2OA 4Q3DA 5G4LA 1U2GA 1DFHA 3SVTA 1YONA 3BMOA 4BQPA 4BO8A 1ZW1A 1OZAA 1GCOA 3S2IA 2EXXA 2OP0A 2D0IA 2PGDA 3O8QA 3MTGA 3LT1A 3ZWYA 2FN7A 3EDMA 5JDIA 1HTBA 3O03A 2HAEA 5L95A 5IZCC 5H82A 3E18A 5I9LA 3I83A 4NDNE 5TRTA 3I6IA 4E32A 5GY7A 3GY0A 4M49A 5COQA 3A06A 3RUIA 3GEGA 4YRDA 3TZ6A 2IXAA 4M87A 4BQRA 4YJFB 1C1XA 4CM1A 2FR0A 1YS4A 4E33A 3GT0A 4Z3DA 1PQUA 2GN4A 5ER6A 1EVYA 4OMUA 3OJEA 5DF1A 1PU2A 2TMDA 4EGFA 4J1QA 1NPTO 4WLEA 4OXNA 1GEEA 1ZVMA 1EBFA 1J5PA 1Y8RB 4PLWA 4XD2A 4ZRMA 1A72A 3FSRA 4BMNA 3QE3A 2HQ1A 2YHUA 2PY6A 1E7SA 1GADO 2JCXA 4MVJE 4Z0TA 3IP3A 4UVEA 1ZH8A 4WOKA 1SOVA 3IJPA 3JD1A 3RASA 5I7FA 4PLGA 4RZIA 3NTRA 4FC6A 3EMKA 2CVOA 3H9QA 3OSUA 5K0ZA 2I66A 1KBZA 4U0JA 2UVDA 5LDGA 2OXIA 3RC1A 4CQMB 1LBEA 1Q7CA 4CL8A 5EMHA 4ALKA 3PQEA 3B1JA 4YJHB 4BO7A 4FJ0A 2F1KA 3JQFC 4R01A 3KYCB 4WJZA 5F1OA 3F5QA 3FR8A 4NFSA 4BNLA 2J3IA 4J7XA 4W82A 3BTUA 3VVBA 3I9KA 2OP1A 4F46A 1GV0A 3DZFA 3JQAA 2ET6A 3LF2A 4HKTA 2V6BA 4RPLA 1XU9A 4WCFC 3HG7A 4WASA 4XDZA 3RFXA 3TFQA 4BS9A 4HNGA 1IUKA 4DMLA 1O89A 5BSGA 5I9NA 1JW9B 2GLXA 5JC1A 1R15A 2HUNA 5L51A 4NH4A 4JK3A 2FWMX 3AU9A 4NQZA 5IZ4A 3I6QA 4WEQA 1P1HA 4J7UA 4YPOA 1EVIA 1PJBA 4YQYA 4RLSA 4UEOA 2E6UX 4BNZA 3Q11A 3Q2IA 4XQGA 3E03A 3WMXA 1HE4A 1RM5A 2JCVA 2A94A 3HSKA 3PRJA 2X1HA 3GMDA 4DRYA 1GL3A 3A4VA 3EK2A 3G0OA 4W7IA 3ZHBA 1DJQA 3NX4A 3F5SA 3RC2A 1KIFA 3LU1A 1BGVA 2X4GA 1H94A 4IDAA 3WGYA 1S6YA 4L4XA 2XPCA 3TWOA 3D0OA 2P9GA 4RPKA 1ZFNA 1UDBA 2X5OA 4YJGB 1ZXLA 2QHXA 3LSYA 4XR4A 2GN6A 1B8PA 5TJHA 2GNAA 3RWBA 4DREA 4XYEA 5EINA 4I9UA 3GUCA 3FI9A 2B5WA 2TMGA 4CLRA 4NHEA 2PZMA 4PCVA 1ZMTA 4CV1A 1E3WB 1OC2A 4RDHA 2Y0CA 4IGEA 4J43A 5GZ3A 2X5KO 1QMGA 4ZQGA 3O26A 4E5KA 2HK7A 4IJVA 3DBHA 3GDFA 3NJ4A 3GDOA 1MGOA 3TDKA 1LDBA 4AVYA 1NPYA 1Y9EA 1E92A 1VM6A 2IEBA 2BGKA 3CEAA 4GLLA 4FCCA 1PJ4A 3CXRA 4RVFA 1C0PA 2NTNA 5T64A 4FFNA 3LT0A 3VH4A 2E82A 1L7DA 3PQDA 2ZATA 4S3MA 1K6XA 1UR5A 4RDIA 4NFHA 3L6OO 4CQLA 2FP4A 1V35A 5IDXA 4HNHA 5EN4A 5KNLA 3ZHZA 2YYYA 2WD8A 2GPTA 1ZO8A 4CMGA 4O6VA 4GVXA 1OI7A 4A26A 2VWQA 1QV7A 2ZTMA 3OQ6A 4CM5A 4IZHA 2PFGA 4KWIA 2J3JA 2UUOA 4N54A 3VTFA 1WLYA 4WPGA 3UCFA 5A9TA 1V9LA 3JQEA 4IQGA 1GCUA 4ZHSA 3KO8A 4MJLA 2VZ0A 2ILTA 2WD7A 3PZRA 1WDLA 1YVEI 1PR9A 1NQ5A 3GRKA 4DBVO 5CDSA 1YXMA 3ETEA 1U5AA 2V65A 2VQ3A 3TZCA 5DOVA 2O2YA 5GZ6A 3ZWVA 4IIVA 3KOUA 4LMRA 1I24A 2ZKLA 5I9MA 3CH6A 4GKVA 3OH8A 2Y1FA 4OQZA 2QRJA 5U9CA 5U1PA 2O3JA 4PG8A 3RBZA 3ZHYA 1MFPA 2HJSA 2P5YA 1KC3A 4J1TA 1JU9A 4RF5A 5L7TA 2D59A 1UP6A 4JBGA 2HJRA 9LDTA 4GWGA 4L74A 1ZIDA 3DR3A 4MVJH 2OHXA 3W6ZA 2AQKA 3P19A 4INAA 1BMDA 2WTBA 4E2YA 1JTVA 5L9AA 3PHHA 5CP8A 3SJUA 3FBTA 4EUHA 1DC3A 4Y6SA 5JBIA 3W8FA 2BGMA 2YV3A 3ZWCA 2H63A 3F1LA 3C3XA 1FDTA 2FZEA 2J5KA 1TA4A 3FPLA 4CLXA 1TT5B 1MXHA 3OIDA 4MKXA 1YBVA 1XG5A 2V7PA 2WSBA 4MVJD 4DLAA 4BGIA 1BVRA 1HDYA 4E5PA 1YJ8A 3DZKA 3V8BA 1BDBA 2VHYA 3TN7A 2NTVA 2R00A 4L75A 4ID9A 2FRDA 3ORFA 4TRJA 3F9IA 8LDHA 4DIOA 1E7YA 3KB6A 4E6PA 3JYOA 2E4AA 1HYGA 4GMFA 5A9RA 1F0YA 1SAYA 4XX0A 2W4QA 3JQAD 2Y67A 3M2TA 1MC4A 4YACA 4HXYA 2BLLA 3KEQA 4DA9A 4B7XA 1PTJA 1KC1A 4RGBA 3LVFO 4R41A 1BVUA 4PLHA 4WGGA 3G49A 1B2LA 3H9JA 4QX6A 1LDMA 3TZHA 4OQYA 5JMWA 2Z1NA 4RVDA 5IZCA 4Z0HO 1SMKA 3UW3A 5IDWA 1U8XX 4Q3NA 4WLOA 3RROA 4D44A 3GMSA 4G5HA 4MVJP 5T67A 2GZ1A 3AJRA 2P9CA 2AHRA 5KIAA 1G0NA 4NK4A 3K2EA 4JGBA 3PP8A 2OUIA 4PZCA 1Z75A 2UV8A 5JCJA 2Z95A 3PPIA 3PFFA 1O95A 3OECA 4EUEA 4Y9DA 4NK5A 4E3ZA 1SNYA 3VC7A 1NAHA 1PSDA 4MO2A 4UAGA 2NUAA 1PS9A 1YQDA 3GA0A 3ZW8A 4BNMA 4MINA 4CLOA 2I3GA 1P0CA 1PJCA 2AQ8A 2HMUA 4QO8A 1D1TA 1P74A 1VC2A 4GPD1 4WLNA 6LDHA 2EP5A 4LGVA 1ZZEA 1W8DA 4BGVA 3KSUA 5BR7A 3SLGA 2DKNA 4AJIA 1Z6ZA 1WP4A 3INRA 2B4TO 2HMVA 3RUDA 3F1KA 1HEUA 4LK3A 3EVNA 2C29D 4J4BA 4MVJG 1U4OA 4TWRA 1CF2O 4J91A 1NVMB 3ICPA 1Z7EA 3PDJA 2GZ3A 3BHIA 4NBRA 4E13A 4RCVA 1W4ZA 1GYPA 3OEYA 1H6BA 1IE3A 3QJ5A 4CQMD 3FD8A 4QFDA 4UUOA 3RKRA 1DHTA 5IF3A 3ROMA 3H2ZA 1PJ2A 3D1LA 5BNTA 3MOIA 2X7HA 4IPTA 2O50A 3QVOA 4I9HA 4M55A 4OSOA 5CG1A 3LC7O 3EUWA 3WWYA 1CETA 1PL7A 1VI2A 4M54A 3RUHA 1LDGA 3W4KA 1KOLA 1ZSYA 2J5QA 3DXFA 3D4NA 1Z45A 3UHAA 4NBWA 1NQTA 4NJOA 4WOJA 4URFA 3JTMA 3UFXA 3ZU2A 1FXSA 2VTEA 1SOWA 3RAJA 2PA3A 4D41A 5CAEA 1RYEA 3BTVA 5T8KC 4FD3A 1M66A 1UP4A 4GX0A 1PQPA 2W2LD 4EEZA 3B20A 4YT4A 3H6KA 5JO9A 4X54A 1QYDA 1ZXBA 3LYLA 4MOWA 1TT7A 3E5RA 3ZNNA 4FDAA 4OKIA 1PEDA 2IYOA 4FW8A 4CQLB 2J3HA 4R9SA 2QQ5A 4W7HA 3DB2A 4R5MA 1R66A 2A9FA 2W98A 4L76A 4JQCA 3V1TC 5THKA 1EUDA 1QYXA 4IMPA 1K6IA 2P4HX 4J16A 4W99A 3JQ6A 3ZZNA 4EJMA 2CY0A 1NQAO 4FBGA 4DLBA 2DC1A 3HB5X 3FHLA 4BL5A 3GN2A 1KEVA 1UAYA 2VYVD 2ZYGA 2NNLD 3KYDA 3MOGA 1ID1A 4TVOA 4KUGA 4EI2A 2GR9A 4OGWA 4LSWA 4DC1A 2JD2A 3L9XA 2DPHA 3IAHA 4RVHA 5DN9A 2Y0DA 1HSOA 3BMNA 4E4YA 2CZCA 1LJ8A 5I8WA 1XA0A 3QSGA 3VH2A 2PTGA 4MVJA 4XQCA 2WYUA 3IMFA 3UN1A 3WYBA 3LDHA 1P3DA 4FIZA 4CR8A 1K0UA 2NV6A 5TLSA 1KY4A 3BXXA 3ANNA 1HE5A 1DPGA 1GV1A 3O9ZA 3K31A 2ZB7A 3KEOA 5FI3A 1Z7BA 4Y8VA 3WXBA 3JQ7A 4J4TA 4DTIA 3GNTA 1T4DA 3HDJA 1GYQA 3KV3O 3M6IA 1NVGA 3E6AA 3S1LA 3HHPA 3QA9A 3RKUA 3TPCA 5A02A 4XQEA 1C0LA 2DBVO 5F5LA 5CEEA 3AOEA 1NBOA 4CLHA 4CMEC 2HMTA 3VPSA 1IL0A 1HDCA 3IS3A 4DQUA 3DBLA 4P4NA 4YCAA 1JKIA 3WICA 3GUYA 1OBFO 1PZHA 3INGA 4BNGA 4CMIA 3SEFA 4BNXA 2BELA 2R2GA 2PR2A 4WEOA 1HE3A 3RSHA 4J1SA 2O2SA 4YAIA 1UDCA 1KEWA 2VHWA 3A14A 3Q1LA 4WUVA 4UVIA 5TQVA 3KVOA 4Z6KA 4XDYA 3PHLA 1T4BA 1DBVO 1XEAA 4IMRA 3VPXA 5C3MA 2Z5LA 3T4EA 1OAAA 1PL6A 3H4VA 3I9JA 3ONDA 2BHLA 3PWSA 5JCJD 1ZSVA 1VPDA 1O94A 3DOJA 5T6BA 1B8VA 2X9GA 2WYWA 3S2GA 5KVSA 2PNFA 1M2WA 3E1KA 3HADA 2AA3A 5TS3A 4YXFA 4QQRA 4RLHA 1V8BA 2EP7A 2G82A 2BMAA 3EGOA 3H3JA 5BNIA 3OETA 3RJ9A 1Y5MA 3IIEA 2O7QA 3JQFA 3BHMA 3GG9A 4Y98A 1LC0A 4HFMA 3NT5A 4RF2A 4KP7A 1ENOA 5A06A 1ONPA 3DZIA 5CDYA 4FJ1A 4B3HA 5ILOA 1G0OA 1Y8QA 2EV9A 2VWHA 1IULA 5A9SA 4ZN6A 1DIRA 1XDWA 4EUFA 4JN6B 4I8XA 3TL3A 1DAPA 1MB4A 4QO7A 1Y81A 4BO6A 1ZNQO 2VZ8A 3TOZA 3U4DA 3ZWBA 5DCWA 2ZCVA 3RUEA 2WE8A 4P8RA 4ZGWA 4JCOA 4RQTA 4FGWA 2D4AA 3DTTA 2VUUA 1QYWA 3TZKA 4NMHA 3QVSA 1X7DA 1HXHA 1WWKA 3PVZA 1HYEA 2YV2A 2CDAA 5K9ZA 4IUYA 4GX1A 4B8WA 1HE2A 5A04A 1QV6A 4GGOA 4JJFA 3FF4A 1N7HA 3ZWNA 3M1LA 5A9SB 2BI7A 4Z9FA 1ONOA 2IZ1A 1B7GO 1GY8A 1CDOA 2CVQA 4GSKA 4LN1A 1H5QA 4YWJA 1CRWG 1QKIA 1VSUA 1AN9A 5GMOA 4ND3A 4M8SA 2AMFA 1B16A 1XQ6A 3IJRA 4IINA 2H9IA 3U4HA 4YAGA 1ISJA 1JDJA 5AOVA 4XRGA 1UXKA 4NG5A 5KWEA 4QUKA 3ASUA 4AFNA 1VKNA 5HA5A 5HM8A 4L0QA 1MA0A 1ENZA 3I5MA 1KVRA 3ZWWA 3A28A 1EVJA 1P31A 2JJYA 1I2BA
chains in the Genus database with same CATH superfamily
3EE6A 3OUUA 4P3PA 5K0SA 5EHIA 2QF7A 1BJKA 2Y1OA 1UXJA 1XQWA 3AI3A 2DPMA 2QT0A 4L5JA 3G7UA 5HCUA 2E4XA 2XNDD 2ZI6A 3OCJA 3SS8A 4D9EA 5DH9A 1JFFA 3GPUA 3N7UA 1FQKA 2NO7A 1GUZA 3OEHD 4XB6B 3FJYA 3DEJA 3UGQA 1LF5A 2OXFA 2O5CA 3ZY3A 2O8FB 1BH2A 1GO5A 2PCJA 2YWFA 3D2CA 3GLQA 1XROA 4ZAVA 1WXHA 3BBLA 3HCCA 1J8VA 2V1CA 1O6FA 4D9IA 1GPUA 3IT0A 5BQXA 5FFNA 3WTCA 1MOPA 2HN9A 4PRZA 2BSQA 3K9FC 4QLOA 2VK8A 2GZSA 2GBLA 4EPWA 3QKSA 3K20A 3OQMA 4O3FA 4HEQA 3I1YA 3VVCA 5B3JC 2ZZKA 4CTJA 2OCIA 3TFOA 3ZYCA 5DDIP 1CWUA 4C7KA 3IKMB 1J7JA 1M5TA 4MZXA 3T7IA 1YK1A 3HKBA 1ZM4A 3R8CA 1L5OA 1NULA 1IAQA 2PGNA 5CNIA 4AJHA 1W2GA 2XTAA 3E3NA 4WNIA 3PPWA 2Z7JA 2I5PO 2LIPA 2PCLA 2RK4A 4FB5A 5JAZA 1R4MB 2WBLC 3BM5A 1O8CA 3MTIA 4ESVA 2BZGA 3WOVA 2GEDA 4Q9NA 1AZSC 3WYEA 5LMCA 2PS3A 3OX1A 4C20A 5SYNA 5A5VA 3QELB 2ALJA 1F4PA 2QYHA 2QOEA 2D13A 2LD4A 4RENA 2RHDA 5L53A 1FPQA 2HEGA 2P9EA 4H77A 3OJXA 1H3NA 1J70A 1GZUA 1GABA 3Q8KA 2EHDA 3RTEA 3NH9A 4EG8A 2EKQA 4YRQA 3R7AA 1SCUB 3PRKE 3TEFA 1XRSB 3OQOA 3TLZA 1CUYA 4IIJB 2KW0A 2W0SA 3D0QA 1RM0A 2HTFA 2I9PA 5G0VA 3AL3A 2O8CA 3EB9A 3T12A 3OPMA 1QGYA 3L1VA 3LC2O 1ZD5A 4BEBA 2P4QA 2PK3A 3L1IA 2FGKA 4CHTA 2O23A 5DNYA 3RGSA 121PA 4K0RA 1TDHA 3G5MA 3CW9A 3PD7A 2X9NA 4KO4S 2VZ9A 5JTUA 3T6KA 3A04A 5EFZA 2EWMA 2VXCA 3NOQA 3WAKA 2X13A 4Z51A 5K8JB 1VP3A 1VLLA 4HX5A 4PAMA 2NTJA 1MDFA 3VDUA 1WCYA 3O83A 4JP1A 2IUEA 1IIBA 1X0XA 4NAUA 4RJKA 4NABA 1EMDA 1H22A 3CW8X 4P82A 4BJ5A 4KMRA 4EECA 1I4WA 2AKAB 1EG2A 1SZCA 3N8GA 4BN0A 2J4FA 3C6MA 2FZGA 3I9FA 5C5CA 2VIIA 1P62B 4CG1A 1X8XA 3PLNA 4CTKA 3ESBA 1JQKA 4I7EA 4X8LA 4ZEXA 5BSVA 2HHLA 2ZYSA 3OQ1A 4R0VA 1UAAA 1I1QB 1DTEA 1E5TA 1NPDA 3EA4A 4HQ6A 3RUCA 5CFQA 3JALB 3PHBE 2F6RA 2Q4BA 3RTCA 3M4ZA 4ZIRB 2PX8A 1G21E 4P3NA 3BXEA 3KIPA 4RVGA 8ABPA 4UNRA 4X1IA 1HR0M 3K0HA 4BMSA 5LIPA 4LBVA 1S9DA 4X20A 4EG3A 4I1YA 4EY5A 3SGLA 2I4MA 1NG1A 5LA6B 4XYMA 4IHJB 5IKOA 1QMPA 3UOGA 4Y6PA 4D4KA 5BN5A 5LLDA 5A4DA 3PUKA 1BE0A 2L7HA 2BC9A 1QIKA 2J67A 1WMDA 5C52B 2X77A 4MW4A 5CFNA 4RTJA 2Y2VA 1E4EB 1A50B 4QBTA 1GQQA 1OE0A 4A5SA 3EIOA 2IYZA 3L8GA 2ZRBA 5KNBH 1UAGA 3IAUA 1A2BA 4HGYA 4GZ3A 3LOUA 4R31A 3HDHA 3QKRA 1DADA 2AB0A 4GXTA 1NMEA 1XU7A 3P8ZA 3QLVC 3TIVA 3V1MA 2FQ1A 4C0BA 4D0LB 1CUXA 3RAGA 5EWLA 1TTEA 2QR2A 4CMIB 4D45A 1TRHA 3WL4A 4LXUA 1FQJA 5EEGA 1ARZA 3QIVA 3ZGLA 1DDOA 3R74A 1PWXA 2ZXUA 3LM8A 1EFDN 1M33A 3OTHA 1W2WB 5EJ9A 1C81A 5KQGA 5T3UA 1IWPB 4L9SA 4DCGA 4ETNA 4LFBB 3PXGA 1FU4A 2HK8A 4O1MA 3SJBA 4DV4B 1Z28A 2XB4A 1RZRD 2EU8A 2Q1WA 2W93A 4TWAA 3CWCA 5A6SA 1GR0A 1M54A 3FOWA 3OLQA 2GZ2A 4ZCPA 2QVCA 2O1XA 3RV3A 5F5XA 1EPUA 3KYJB 5K03A 4KHPB 3U4QA 2JJ1A 5DHUA 4YDRA 1W25A 2ZWMA 3PL5A 4PC6A 3OE5A 1E7QA 1VA5A 3P4XA 1RWMA 5CLQA 1UFRA 2QTHA 3T9AA 3UV3A 2D7CA 3BFPA 3LIPA 5D86A 2HHJA 3CLTC 5CT4A 1YRAA 3COVA 3QVTA 1Q0ZA 3BUSA 4BNYA 2QQGA 5L3ZA 1Z6XA 5LB4A 3DAFA 3NETA 3LCJA 4MR9A 3H65A 4HLDA 4F2DA 1F9EA 1PJTA 1E7WA 3LLCA 2YZNA 1FLVA 3G8YA 2RONA 1OBCA 3S0JA 5FD8A 2YWJA 4YUXA 1Y1TA 1VIDA 2ZBQA 1E1QD 1X6VA 3GJ6A 1JJ7A 4DR7M 3FA2A 3H13A 1WVGA 3UT5A 3FPFA 3CJQA 4IBJA 2O6HA 3RGWS 3VAYA 3RYCB 4JNKA 3J7AS 1P77A 2M1XA 5K0TA 1HR0B 4IWNA 1JTEA 4KPUA 4Q1CA 5ELMA 3VYVA 3H86A 4JL8A 2HSEA 3OMLA 3TW8A 2B7LA 2C2YA 4BVJA 1G41A 5FJIA 1BKDR 2A5JA 4GKJB 3GDWA 1OLUB 5I4IA 1Z59A 1EDDA 5IPFA 1A9ZA 1KK1A 4Y2YA 3UC9A 3X1YA 3F47A 1M2FA 1R27A 1NQWA 2X6RA 5IH3A 2VUTA 1AVTA 1I0ZA 2ZWVA 1GG8A 4H9GA 2R4EA 1MORA 3E5HA 3DMTC 2ASEA 1R5OA 3ITKA 4GGMX 2V3WA 2F17A 4NXMM 4TUWA 3G13A 2WAYA 1U3DA 2YVQA 3KU1A 1IN6A 3NHFA 3W9BA 3WV5A 4B35A 2Z09A 5EKSA 1TMOA 3ELYA 2AJLI 1BXRA 3LTEA 1PR5A 4KN8A 4LOHA 4LY3A 1YB2A 2K9DA 2L2QA 3OLZA 4LHYA 4DV0M 3BREA 1E2KA 5FNVA 3BS4A 1Z56C 3KZKA 3K3PA 1RQRA 1PNOA 1TUGA 3PEVA 4RKFA 4YHBA 3EGXB 3ONEA 5K05A 5K0JA 5DN6D 3AINA 4EMSA 2VT2A 2XOXA 3GUZA 3E7DA 3IBSA 2LIVA 3I9V6 3OPYA 3QVXA 4UPVA 2O4CA 2JRLA 4X6XA 2EUCA 4ZOBA 1P1CA 2BWBA 4K9DA 4HZIA 2VQFB 5FNZA 3HDYA 4FZRA 2W4MA 5BT9A 1XD2B 1W4CA 1U04A 4Q1FA 3AWIA 3VC2A 4JBHA 1GTVA 3O0TA 3O4HA 3G0IA 3JPYA 2W90A 4L50A 3DQPA 4QTZA 4QHTA 1C7ZA 5DWQA 3FTCA 1HY3A 4CE6A 1JAYA 2JFOA 5DM4A 2GAIA 4ZVQA 1Y1PA 2QJOA 4GR5A 2G07A 3SJ7A 4UM8B 2LVPC 2QRMA 4BLVA 5DM0A 2CXRA 4XIYA 1XD8A 4QAJA 2VZLA 3TGLA 2A88A 3V6LA 1E6EA 4JI4M 5AKZA 3LY8A 4ZJZA 3C7CB 1E8MA 5BSFA 1WOMA 3AZPA 4LOIA 5CNKA 2H11A 2UUBM 1QM5A 4NU8X 1J39A 4TLMB 4XPZA 2ZIUB 3NTQA 5F1YA 2ZPTX 4IF6A 4GOOD 2FN9A 3O9VA 4WINA 5JALA 4IJEA 2IP4A 1SC9A 1XR3A 2HNKA 3K0AA 2W2XA 3AG6A 3VLFB 1N6IA 1TPZA 2HRDA 4F3KA 2VYNA 1T1RA 1JP7A 2PBRA 5HJ5A 1YAJA 3WE7A 1UJCA 1V11B 5A1JA 2HV8A 4LV8B 2ERYA 3B1ZA 3NGMA 3UUGA 5EG5A 4HX9A 2Y6VA 3GT3A 721PA 1DIHA 1GG9A 4BZZA 3PJRA 3FB4A 4GYYA 1MP0A 1A9RA 5CXXA 4N8EA 2XUPA 4PQYA 1F12A 1EA5A 2H2WA 5LQAA 4BKOA 5EZYF 1SD1A 3NDRA 4N39A 4KGZA 4CM7A 4UTRA 3B60A 3TX6A 2ZYIA 4PZEA 2H92A 3ODPA 5ED0A 1UT6A 3K7EA 3G68A 1NW5A 3ANSA 4OU4A 2B99A 5GVRA 5LLTA 2VCHA 1R3UA 3HKCA 4UBLA 1B0UA 2FPGB 2VDLB 1BRTA 2DI0A 5AKXA 4FM9A 4DUGD 1JHYA 1SKQA 3S8MA 1ZD8A 2F90A 3ND8A 3ZH2A 5WRFA 4DQKA 1DT3A 4K1LA 2C5RA 1Q7BA 4GL4A 1KTIA 2RHRA 3CN7A 1Z2PX 4W1SA 5AQ1A 2VAMA 4V1CB 3LFHA 4ALLA 1I6MA 4H6XA 1EK1A 5B3LA 5AJWA 2C3YA 3ND9A 4C0LA 4RD3A 4XJTA 1USKA 4DUPA 3IG5A 1N7IA 4RH3A 5CX1A 1P2SA 3GNSA 4RYDA 3KVYA 4NBNA 4X84A 5GGXA 3RRNA 3UK1A 4B4OA 3Q0IA 2DTXA 1YR1A 2ONKA 3KL4A 4TYMA 4OP1A 1F06A 4CKXA 1EJ6A 2W7TA 4HGNA 5ITZA 3MA0A 4D5GA 4UVDA 1QC5B 3SZRA 1W4RA 4GPEA 4ZODA 2CDBA 3GHYA 4DVJA 3E5MA 3BORA 2H5JA 5KJCA 1VA4A 3NAGA 4HY3A 1Z0JA 3GVHA 3FFWA 4HPJB 1X1QA 3BK7A 3IJ5A 3Q1KA 5CR9A 2NMVA 3LHDA 2XCUA 2CXQA 1ADFA 5JYCA 1CVLA 3VR4H 5HYVA 1E3IA 2HGZA 2GPYA 1V6CA 3I8OA 4QEDA 1JECA 4R2LA 1QP7A 4UW9A 5D5PA 3K9OA 1SXQA 4HYEA 2DHQA 2ORIA 2Y68A 3EASA 5DX0A 3T99A 2YNMD 4QM6A 3ZDEA 3B7WA 3A6JA 2ZR9A 5LBUA 2RG7A 2GGSA 1Y5LA 3NHRA 1A04A 1P80A 4M0KA 3S2UA 4LRXA 5LOVF 5GVSA 3QFSA 4QOZC 1HLDA 3OX3A 1BVSA 1MN3A 2H0QA 4N7JA 4WSOA 3F2IA 3Q9NA 4WERA 5EC8A 2FN8A 1OIWA 1K68A 1H0KA 4E5YA 2QA5A 1QAQA 3TXXA 1R4NB 3ZHTA 3NTVA 3UMFA 1KZHA 3V55A 1JG7A 1T6YA 4DMHA 5C5IA 5IJWA 1GNTA 2FPIA 3I05A 2RAUA 1CVIA 4IMIB 1IEVA 4BNNA 5IN4A 4B83A 2PUTA 1JFLA 4KVGA 3W8RA 3OT4A 1WS6A 4M0WA 1OQAA 3M8KA 4UNQA 4BTEA 3LUGA 2P2YA 4MLPA 1FB5A 2BTQA 3U61B 5GIPE 2IOHA 1K86A 2PMDA 3QVJA 4OSEA 3ZK9A 1W2HA 5DTJA 4Q3AA 1M83A 4QNRA 3CUSA 5DOZA 5CEJA 3TSCA 4X8HA 1JBEA 2G5GX 2NVUA 2YMQA 1Q15A 4NJEA 3K2LA 2JLVA 1A71A 3IXQA 5JFGA 2VPZA 3DEIA 3ND7A 3IV7A 2XB6A 2XIJA 4JLNA 3WKEA 2W2VA 3OQJA 3BK2A 1SKUA 3NVAA 1FUKA 4K9PA 3O4VA 4B80A 2XYRA 4NPHA 4I50F 4ZRNA 1JSCA 3KB8A 1U1EA 3S28A 5CB0A 4O1HA 1L8OA 2BM1A 1T1IA 1RZVA 2PGOA 2ZG6A 4HP8A 2H5XA 4MYRA 3UC5A 3H2GA 4BO0A 2Q28A 3KKMA 3R4VA 4NZYA 3KT6A 2JD0A 5C8ZA 2EDCA 2PBFA 2VJDA 3DQZA 4HBGA 4J9UE 4CPDA 1N36B 4L8LA 3UO8B 1YGYA 3BK1A 4LZNA 4F56A 1M75A 2A58A 4F96A 4F3RA 3KQYA 2AK3A 3H2KA 3ND6A 1NLFA 2QD1A 1BGXT 3PTLA 4BNDA 3UA4A 3URMA 4FGKA 4BMDA 4PLYA 4CL0A 2VSFA 2HDHA 3UHJA 1HYQA 2A57A 3RK1A 1NT2A 5KNDD 4L5AA 1QSGA 4DV3B 3JQ9A 4N3AA 2OA0A 1AA6A 5JPIA 2EZ4A 4BFTA 4C78A 5JYDA 3WIUA 1TA0A 3BB4A 4ZZ0A 4X8MA 2VQFM 1PYGA 1T0HB 2WIDA 5IT0A 3A4MA 2HIAA 2WVGA 2ZB8A 4XM1A 1SWWA 4HQNA 4RCZA 1B0ZA 1XAGA 2PPVA 2OXTA 3W7AA 2VHZA 4XYBA 1U7HA 1E7RA 1ZA1A 2X0FA 4CM6A 1U9JA 3DC2A 5FOVA 4AJ9A 4QZVA 1EQUA 5IYZF 4QC2A 3KUXA 4AWXA 2O3SA 3CZ9A 2F9MA 5GJCA 2E89A 4NESA 1KARA 2BM8A 2W2OA 3PITA 4I6EA 4RSGA 1P9RA 2CWWA 4JC8A 1R88A 2HWKA 3A9RA 5CW1A 2LNDA 3ZC7B 3NEJA 3WK4A 1XDSA 2ASVA 1WBBA 2PMWB 2Q99A 1P1KA 1L6IA 3NEYA 1Y4DE 2CLHB 3F6SA 5EKDA 5KB3A 3FN4A 3SC6A 1A7JA 2WJGA 1MB0A 1N2SA 2I33A 4LXGA 1YS7A 4H60A 4A4DA 2Q0HA 1N6KA 3F9CA 1MIOA 3FVRA 4HCJA 4KWHA 2XRFA 4H1TA 1TECE 4BLPA 3FOEC 3SAWA 5KYWB 4P22A 3IBTA 3MJHA 2B25A 1XHLA 4K88A 3RU3A 1RI4A 4G1BA 4MUHA 4O4LA 2PYDA 1SC3A 3GCDA 1N1GA 1BU8A 4OL9A 4DMMA 1S0UA 1SVMA 3PFGA 4ON9A 4ARZA 4YY3B 3GVCA 4PN3A 5K8IA 1TXGA 5AJUA 2IYFA 1YFJA 2I62A 2OC9A 3CF4A 2A1TR 2Q2NA 1NR7A 1Z34A 3KJHA 2VHEA 5A4FS 4DMKA 3SP1A 1P6QA 4R83A 1JN0A 4DQXA 2VEDA 3FMFA 3AY7A 3SS7X 1QTNA 2I6XA 3DT8A 4YYZA 1FP2A 2WJ6A 1IOWA 1GSIA 3L7MA 4TYYA 2WHRA 1UDWA 5G4KA 5C35A 1CYDA 5LU9A 3Q8GA 1O6CA 4I4TB 1KVTA 3SAUA 1DC6A 2C9DA 1R5JA 1CQWA 3OQIB 1T6NA 1MCZA 4WZBA 2JLUA 1D7OA 1J5XA 1D2GA 1FNSA 1P2TA 2JGJA 2PLWA 3AP3A 4CM8A 3B12A 2DHDA 1I3CA 2HSDA 5KJEA 3M6MD 4CV2A 3ZVNA 2KHZA 2JXNA 5F33A 4HV4A 1IJFA 3PX7A 3AHIA 4GVPA 1SH7A 3PU6A 3HDTA 3OVMA 3PTZA 3PUWA 4ZEOA 3RIGA 3ICQB 3H1PA 4UTZA 1JMYA 2XVAA 1PJ8A 1L7NA 3AH8A 1A2OA 1OC4A 1U8YA 2DQKA 3B9RA 3HA2A 3VYSB 5EJ4A 4JVNA 1E2JA 4RV4A 2GCOB 5E1OA 3RKSA 3GFFA 5A2GA 5TPWB 4Y2TA 4UM9D 1YRQA 1U2QA 4N18A 2F1HA 3NHAA 2CP8A 3WBKA 2IYXA 1PJLA 2ZTUA 3ZU4A 4AW9A 1R4ZA 3D3WA 3ZIAD 3L6CA 4KLZA 5ENDA 2GM3A 1NRWA 4GPTA 2ZM6B 2CW5A 4O0LA 4NSOB 4WZBB 3ZW9A 2VPQA 4AKTA 1E3EA 2PXCA 2Z8YA 5H81A 3Q6NA 4AJEA 4RHEA 3BCHA 5KDDA 3GCWA 2OSVA 5JJ5A 4UDOA 1AQUA 3EXHC 1AGNA 4HJRA 4KK3A 1QIIA 3UJNA 4TWIA 4UXIA 5KQSA 1SQ6A 3VR4A 3EWIA 4AP5A 2EX1A 1E20A 1UZMA 1MNQA 3Q40A 2WE7A 2H85A 5HIJA 5JYBA 2O57A 4G63A 4I5SA 2HU2A 3OURA 3BTOA 5DP1A 3VKUA 1I33A 5CTJA 3DD5A 3EZ2A 3HN6A 4ZOLB 5K01A 2C4VA 2C2WA 1V16A 2WJPA 3CG0A 1E5XA 1E89A 3OLYA 4GGPA 4IY1A 2HC9A 1N2BA 4EB3A 4GHAA 3O5AA 2DCUA 4GPZA 1FRVA 4UZSA 2HDWA 5CDFE 1GAWA 1Z29A 3T3GA 1OB5A 1YOVB 1UJ2A 2OZVA 1Z37A 3OD1A 3Q98A 2O20A 3C41J 4PR0A 2DWQA 3FTEA 5ICEA 3RHFA 2BFBA 1MV5A 1J21A 3L1UA 5DIFA 4EZIA 4HDCA 4DDMA 3HCEA 2QX4A 5F21A 3D43A 3QBVA 4X24A 1GNSA 1ZWKA 5I47A 4JELA 1YZGA 4ES6A 1RVDA 1U0TA 3K53A 1MU5A 1AKWA 3LYHA 3DEAA 3H8SA 4JP3A 1VDDA 4ZVNA 3ZXIA 5GTDA 3QYJA 4Z3OA 1F8FA 3GMTA 2JLBA 3M70A 4MRAA 3SOPA 1BRMA 4DUYM 3QOXA 2OZLA 3C70A 2X9QA 2HSJA 2OO5C 3E2MA 4AF6A 2VJKA 2W8ZA 1IZ7A 1V4BA 3PC3A 2Q2EB 1EUZA 5CYOA 2EZTA 2P6OA 4FOSA 4DIBA 1AUXA 5BYKA 1G1MA 3EC1A 4RGQA 5BRNA 3T0FA 5L7WA 3U5ZA 4L6V6 1FK8A 2KHHA 2CMDA 4D8YA 4F1WA 3SARA 3U4GA 3QW2A 3H1FA 4I3GA 5TGDA 1TM4E 3EOAI 3WG9A 3GVXA 4GQIA 4CODB 5KPZA 1KU0A 1RHRA 3KVNA 1WAMA 1O0SA 2VJMB 2B34A 3KWLA 4I36A 4I8IA 4LSGA 3A1CA 1PKEA 5J5AA 2R8OA 4LMPA 2PVPA 2HSWA 2ECQA 1H1DA 2AFIB 2BKUA 2YWGA 2ZTCA 1S4MA 3EVBA 5JNLA 1N77A 2XBMA 3C5HA 1FYEA 4H4DA 1F51E 1QHIA 2IPXA 3DCIA 3WNDA 3PBKA 4GE0A 1RYDA 2P40A 4KUHA 3VX3A 2GNOA 1TDZA 2OO7A 4OYLA 1TM1E 2NX2A 1J24A 4DEYA 1DE0A 3W5IA 2GJ9A 1M5UA 3NFYA 2G17A 3KW6A 1HG0A 3AFNA 3ICCA 4IXMA 1CUWA 4U6SA 4DIKA 1W49A 1IC6A 3FSJX 2X0IA 1Z2DA 2HWWA 5LP6F 1D0IA 4EVSA 1DJMA 1U1IA 1YJ5A 4NENA 4G86A 3D4LA 3R9XA 4MWBA 4QDJA 5SY4A 4ARAA 1WGNA 1OKSA 3TUJC 3U5TA 1B1AA 2H2FA 3FIUA 5DT9A 2RIPA 4RC9A 3S4YA 1SR8A 2BCGY 1NW6A 1CY0A 1NUUA 1QO0D 2OGTA 2YHAA 1XP5A 3AUJB 3GHHA 3KRTA 2ZJ0A 1CB7A 2AFHA 4O4LF 4V39A 4OB6A 3RH0A 1KAMA 4PCUA 5I45A 2XTNA 2MJ5B 3DLCA 3FNHA 3I8XA 3K96A 4URHA 2X0RA 2JFPA 4YCMA 1EFTA 1MH9A 1OYVA 2QY9A 4TV8B 2OYCA 1WQ1R 2Z6QA 3PUXA 2C2XA 3KB2A 3FYHA 1G60A 1VCNA 3HUFA 1Z0UA 3IBFA 2C98A 4G0XA 5AI8A 3SBOA 5J3JA 3AVWA 3GRVA 1MTZA 3WMGA 3F4BA 2RHCA 5I7RA 2LDBA 2FW9A 4IXTA 3KPYA 3SSNA 1V25A 4RK5A 4X1KA 4BQOA 2CHUA 2PH3A 3MQ4A 5I7HA 4B3TB 4KN6A 1PJAA 4H7JA 3WQQA 3QBTA 4BV3A 1Q22A 1APBA 1DT5A 3P0RA 1NC1A 1KERA 5IHPA 1AUVA 1CY8A 3GV0A 1BE8A 1BMFD 3JQ8B 2Q3HA 4KQIA 4OHKA 4B4VA 1JXOA 1CJTC 1P9WA 3H9UA 5HCIA 5BSMA 3ZZTA 2CGEA 3VR5D 3ZUPA 1K8YB 1X9HA 4BYMA 3EXIB 3GDGA 1XGKA 3LECA 4NYJR 2AR9A 2G4CA 4UCWA 4A73A 4W9NC 3A10A 2QX9A 1I10A 2G06A 3EGDA 4DKJA 2R48A 3PEFA 4XUCA 4PPYA 3ZIUA 3UIEA 3B36A 1UKZA 3HYRA 4J03A 1DRUA 4D9FA 4NOLA 3JQQA 2VZEA 2BD0A 3TMYA 1DOAA 2PZKA 3KTDA 4I5FA 1J6UA 5FTJA 1NBMA 3E22A 4OYRA 4RHTA 4AMBA 5C8YF 4R2IA 3PJEA 2JGEA 1QHHB 3M4JA 1CE8A 4P17A 1QXSA 3K9QO 4D46A 1YB5A 4MW0A 5KU7A 2BKAA 1J00A 3M6LA 1AS0A 3GA5A 3GBSA 3WLFA 1WZNA 3IEXA 3ZTTA 4NONA 1HT2E 1R12A 3P32A 3J27B 1S8AA 4MYCA 4XFJA 5HJ2A 4E08A 2O8EB 1L8AA 3WVNA 1TEHA 2HH9A 3C4VA 3HXTA 4YAEA 5F1PA 2XXAA 5A0VA 3SFTA 3HLYA 4YRBA 2YYZA 4IXWA 4QTUB 2HFKA 3G2HA 1X1DA 4KJXA 4G8JA 4PAWA 2ZUTA 1Q3HA 3ML1A 3RSGA 4P3YA 4K46A 2OBMA 5AUOB 1KQPA 1MZPA 4A3VB 3ASZA 1KVSA 1EX1A 1Z5UA 2BFFB 3R7LA 4C2AA 2VF5X 2I4TA 4AZ0B 2BFCB 3O82A 3RTGA 3AYXB 1Y37A 4TGLA 1E61A 2WF9A 4DM7A 3RAFC 2QLNA 3DBVO 1XAIA 1SPBS 2ZT6A 3AY6A 3KHKA 1AB6A 1CSEE 3MCZA 4H17A 5LBIA 3SZMA 2ZRQA 4MK4A 3U9LA 1DEAA 4KV9A 4BBPA 3O91A 3SX0A 2Y66A 4TVSA 4A8JA 2OORC 3QWAA 4G9GA 1ZMXA 2VDWB 4PYKA 3VZSA 2Q7OE 4EJFA 2D5IA 5JD6A 4HEJA 3IVMA 3C6KA 4PGFA 1SK9A 4FE7A 4BNKA 1X14A 1JA9A 3GJSA 4U7GA 3MJFA 2XZOA 3EEYA 3LY7A 1JUDA 3QK7A 4LF6M 3GMIA 2OD2A 3AI1A 1MKYA 1ZIPA 2A4KA 3A4TA 2V96A 2PL9A 2C9CA 2YC4C 1C4KA 2EKLA 3JS5A 3LKZA 1LBTA 2WSSA 1WXWA 4FKMA 5ALNA 5TPZA 4CUJA 1JJVA 4F45A 5K5EA 4KQGA 2XE8A 1WB9A 1ZGGA 5CCDA 1UC4B 3H1EA 5FPPA 5LOVA 4ZT2A 1CRZA 1VMAA 1VSVA 2FMHA 3KTOA 4I3HA 1GM5A 1ISIA 2QYSA 1E69A 4IVPA 5JJLA 1U8UA 1O5TA 3NYQA 4C3ZA 1RYZA 4IIBA 3WL5A 2V9ZA 4OBBA 4Q3CA 1VE9A 3ROXA 3NT2A 4BO3A 2GUGA 2P3OA 4MAMA 3QEBZ 1YZYA 3MUEA 2GUWA 1TQ6A 4R7TA 1CR1A 1EBUA 2GAFA 5IUJC 3ZDYB 1YJXA 4C7JA 4D82A 1DAHA 1KDOA 3HKEA 1UBUS 1II0A 4XCVA 1QUSA 2FN3A 5EL0A 2ZWOA 4EEKA 3A6ZA 1EE9A 4B8ZA 1TAHA 1Y9JA 4DABA 1D03A 4U5XA 4RVCA 2IBSA 4EY3A 2AC7A 2XMBA 3PX2A 5FLKA 3ZHVA 5DM1A 1QOZA 1UKEA 2OOSA 2ZBRA 4FT2A 3WK6A 4K6MA 3P9SA 1C7FA 5LMUM 4IDFA 1DU4A 3CJTA 4L3WA 2C04A 4RF0A 1UWVA 1U0GA 1WKCA 2J85A 4UJ3A 1E60A 3SKVA 1IM8A 1AF7A 3H8WA 5IWAM 3HACA 4LISA 1YZVA 4C5BA 1WUTA 4EVQA 1Z4KA 4Y0NA 5EXDA 3EXHA 1S8FA 2AV6A 1RXEA 3ZVRA 1IHPA 5E4TA 3H2SA 1AXEA 1E5DA 1L7EA 1JYFA 1RPZA 3BWBA 2B8TA 3EQ9A 5HM6A 4TTJA 4IFTA 5DV9A 1ODTC 3EVDA 1T0JB 421PA 4BIMA 1HNWM 3A26A 3G88A 2I34A 3AL0C 2QW1A 3G5AA 4E09A 5FQOA 4RIEA 2UXDB 1NBWB 5E2IA 1PX2A 2VKQA 2QMOA 1TT5A 2P6NA 1SEPA 1IM2A 1RE0A 1YA8A 4INOA 2VP4A 1XRLA 4R69A 1OHHD 3ZU3A 1U90A 5LXTA 2XUAA 3DFKA 1R6UA 2X8BA 1OA1A 5JFOA 1Z7YA 1F8XA 3NIDB 1DARA 6REQA 5ECWA 2OV8A 3I1JA 1E1KA 4KLNA 2VTBA 1HLFA 4LNUA 1UH5A 2OAP1 1ISMA 2RKBA 2MGWA 2ZRNA 3AM5A 2H1HA 3B7GA 4N0QA 4NBUA 3ENZA 4FU0A 4PONA 5IBQA 4E7PA 5I5GA 4HWOA 2GKSA 3ZVLA 1E1CA 1WZ2A 3HKCB 3A2NA 2JFZA 4DV3M 2CK3A 2X1VA 1VKRA 2OAQ1 3KBBA 2KZSA 1PVVA 3KJIA 1PQ4A 3MHPA 1NDQA 1FS6A 2P9FA 1Q83A 2B61A 4MWSA 4YI5A 4M8KA 3L0SA 2Q41A 4L07A 1EDEA 1VL8A 3JTEA 3E4CA 3AJ9A 3DMYA 4D79A 4ZOEA 4JFRA 4X3OA 1PL0A 2O2GA 2XOEA 3HPQA 1CT9A 1M9NA 2IXFA 3BCUA 4QYXA 2LCIA 1YZ3A 1DQYA 2JI7A 4CKCA 4EY7A 2O7SA 3F49S 5TF4A 4U2EA 3ZS8A 2GSWA 2WJYA 1WW8A 3NBKA 3SC2B 4K87A 3H5TA 4YJKA 1JAHA 3T4XA 3ILKA 1YASA 2EL9A 5D5QA 1SKYE 4ZAGA 4DHEA 4YMUA 1RAGA 3O8OB 1W73A 3QWFA 1U9IA 4IOLA 5D3ZA 2NUAB 3FPAA 1PZGA 2DHCA 1XD9A 2G67A 1W1IA 4M53A 4DNFA 1KPHA 1ZNWA 4HQKA 3T5PA 3BXFA 2IITA 2HBRA 4K0KM 1AOXA 3S2FA 2PT6A 3SF0A 3HB0A 2CEAA 3EPJA 1P9LA 1CBUA 3SAJA 5JXWA 5MN5A 4REQB 2VNAA 4PAOA 4I9NA 5CW2A 2C99A 1CG6A 2C07A 4A8HA 1JZQA 1R8JA 3E4DA 4HMQA 4WFQA 2NW6A 2ORED 3NVMB 4Q7EA 4KNYA 2FOXA 5C80A 5BORA 1Z8DA 2PZJA 3B89A 2GN8A 3AEQB 1O4WA 3AVQA 3EGDB 2W4IA 3HZJA 3FCOA 3LGAA 3LT2A 1UMDA 2WR8A 3NASA 4JMLA 4JOSA 2OO5A 4MKFA 4B48A 4CG3A 4FLFA 1T9GS 4FINA 5D3QA 2EERA 3H5IA 3G0CA 1Z5OA 1RI5A 4NCKA 3X1KA 3CG4A 2REQA 4H3HB 4UHCA 5CLLA 4A2WA 3ZDZB 2OHVA 4RPCA 1QWOA 5JMTA 2FEPA 1JPUA 3TRKA 1Z16A 3DP7A 5J43A 1C4XA 2AG6A 3RIMA 4KH0A 3WHIA 3LRPA 5KOJA 4Y7CA 3L40A 3BMOB 3V8MA 2IIPA 2PAFA 2VRCD 2QPLA 2PV0A 1BU5A 2NADA 1G66A 3QWHA 3G7SA 5CJPA 1ZS9A 2I2BA 2YUTA 4Y2SA 2IKQA 1W0KD 3LA8A 4I0WB 3BTSA 1MNAA 3VZDA 1AE1A 5AW8A 2WZDA 1T2EA 4GI3A 1V7ZA 4D3ZA 1SY7A 5AW1A 1YVUA 1O96B 4N82A 1DO8A 1T26A 2GYWA 4DGSA 4OHYA 5C4MA 3BZUA 3N2GB 1WV1A 4FSXA 5KYYB 3NM4A 4WLVA 2WPDD 4NG4A 1EP1B 5ENZA 2IU4A 4WW0A 1EVKA 2H48A 4JJKA 4KFUA 1Z15A 4OXXA 3UB2A 2B1RA 1BH6A 1RXUA 4MQEA 1P0FA 1VLMA 4H27A 2H4XA 1KYYA 3NC0C 2Z43A 5GONA 5HIIA 2Z04A 4FS8A 2RAPA 1E0DA 2FA9A 3JWEA 2CNDA 4NCNA 2XBLA 2TMKA 3E9SA 4EY8A 3U16A 1Y48E 4UARA 4JVLA 1ZM2A 2A0WA 3ZDDA 4N49A 2QMZA 4NL4H 3W3AA 2YQ4A 1RRCA 4LJAA 1N3BA 3CHYA 4HN2A 1GFZA 1GQ2A 2H06A 4FN5A 4LGCA 4ZA2A 3VHXA 1LH0A 3W5SA 2Q29A 3TZBA 4HWSA 1NM5C 13PKA 2HPVA 1LSUA 3HV0A 5DYYA 1DS6A 1G20A 3HBMA 4PPNA 2D00A 1J2TA 2EZ8A 5FPYA 4MR8A 3SR0A 5KVAA 1UOQA 1KGSA 4HLQB 5JQGB 2ZJ2A 3NAQA 3CR8A 2O07A 3EN0A 4B4KA 3EMBA 3PGA1 4B43A 4A6EA 3RM3A 2GJSA 4RO0A 1JEQA 3CONA 2JRCA 3WSWA 2E49A 3OZ7A 1XVTA 4BKRA 8MHTA 1LZKA 1NHGA 2W11A 5T7BA 3HXQA 3ENWA 2NT4A 1B43A 1M8FA 1YQ9A 2YWBA 4HI0E 4S0ZA 2H4JA 1DKOA 1QZMA 4BFVA 2A33A 4UXJA 2IEGA 3OTOB 1N7GA 3HA3A 3IIJA 2IQ5A 3MCUA 1FRZA 4R8RA 1PNVA 2LDXA 3KZ1E 2I7DA 1BX0A 3ELUA 4IHJA 4KYUA 5GV8A 1RPJA 3SMQA 3VX4A 4BC0A 1S2DA 4LZWA 1W46A 4B2YA 4YDHB 2Q5HA 1G20E 3GJ7A 4MUXA 3VNSA 1DLJA 4KQ2A 8OHMA 2ODWA 4J75A 4MUJA 5FOUA 2XMRA 1VG5A 3X1JA 4CIBA 3G2PA 2G77B 4JUBA 2IHJA 2ZT7A 3O74A 3QJGA 1BTOA 5FWAA 4PHTA 3WY9A 5L3QA 4ZAZA 5JS8A 4OV6B 3IOYA 2E4ZA 3C3EA 1NMYA 2GKGA 4RVOA 1S4QA 3PJGA 1BMQA 3BMNB 2XUIA 3GPBA 1IY2A 1N75A 3RTBA 3R3JA 4A8JC 1G9SA 2Z6UA 3SSOA 1CCWA 5IMBA 2HMSA 3LFTA 3PJDA 4C0AC 4DCJA 2G72A 5ALKA 1ULUA 1JIXA 4Z4IA 3WIDA 1E2BA 1H5UA 3TCNA 3FCUB 1UEJA 5JDIC 3L7NA 4OSPA 1TADA 1XQ1A 2PFKA 5L6MB 4KXNA 1LTQA 1MC1A 3CLUC 3DAYA 1RHMA 1HQDA 2ID8A 4R54A 4JIMA 4C1NA 3KFUG 1E3WA 3L26A 3WADA 2XTJA 3JAKA 1HK7A 3G1UA 4LOKA 3AKCA 5BN3A 1MIHA 2V59A 3KJGA 4UNIA 1OOEA 1CEYA 4KQJA 2FW8A 4MHTA 5I7FA 1SOMA 5JT1A 2EG9A 4CQNA 5E6SA 4DPKA 2ENWA 3R6TA 3EQ6A 4UREA 1Q7EA 1VPLA 3GUVA 3SVLA 4EPRA 2W82A 3HRHA 3UMYA 1ES9A 2XLBA 4H7PA 3PYMA 4AM8A 3HI6A 5BYJA 1HRDA 3K2BA 3UEOA 4EK9A 1GQYA 3C58A 5KO2A 1B00A 4DDKA 5GKNA 1SPXA 3V3KA 1AKNA 3BFXA 3W2IA 2OESA 3UOWA 1XNQB 1KFEB 3GLTA 1LC3A 1KRHA 2PS0A 3MVEA 4HC4A 3ROPA 4AJ2A 1G5PA 1KEPA 3FNFA 3Q15C 4LG2A 2WIBA 4O4IF 1DUSA 2YV1A 1CJBA 5FO1A 2BFEB 4FI3C 3ZHOA 5JS6A 3W8EA 1E0SA 5B7GA 3K2QA 2R7LA 3OQIA 2ZB3A 1TKCA 1E5LA 3GGCA 1C4WA 1WD7A 3N28A 3EGWA 4RGYA 4YMGA 3X2SA 3FPJA 2WQZA 3HP1A 4IJKA 2KBEA 4RFVA 2E5FA 2VOEA 4JODA 3NBMA 4N7BA 4B47A 2PXXA 2E0IA 1IXYA 1PD0A 3ILSA 4BWYA 4JI8B 2AN1A 1EI9A 3ZD6A 1D6MA 4IM7A 4TTSA 4X65M 4J0IA 1XNRB 2Y0PA 2ZJ7A 3W2GA 5ECYA 5IASA 1JKJA 1ZD3A 2WK1A 3I2KA 4G67A 4NMWA 1DCFA 3EZ7A 1ABFA 3N75A 1OFTA 2PGXA 4EMTA 4ZQBA 3LCUA 2OTCA 4PAQA 3QAUA 2WVJA 4PC3A 3JWIA 1WMFA 1NVTA 3I9MA 2CKMA 2D2EA 3KR1A 4RK6A 1QVZA 5TQ0B 1OFGA 4C88A 2YMPA 2FOIA 3K0CC 4OGFA 3AW9A 2FAXA 2NIPA 3C5EA 1QE3A 4BX0A 3ZDXB 4G56A 1WDMA 5H83A 5LB2A 5T3YA 2AOVA 4FFLA 4NULA 4PXAA 4YA6A 4D4IA 1YVRA 1XNGA 5ALPA 3ONNA 3CINA 5HF9A 5IP5A 3E7XA 2HWYA 4KO1S 3UGKA 2M9MA 3E81A 3MELA 4A91A 5TSDA 5EZSA 1ZJYA 3KXDA 4YCLA 1XZIA 4ZCLA 3RVNA 5BYAA 2D7EA 2A0XA 4WLFA 3R6WA 4X64B 2FQXA 3A6DA 3E9EA 3FFBA 4EABA 2VRNA 2XF2A 3DEFA 1KMHA 5FP0A 5JHHB 2CWBA 3L7YA 2ZYDA 3RR2A 4H7FA 1Y8RA 5JSZB 4TLBA 5DI3B 4LJ5A 1T9BA 3AEKB 4WZAA 1UPTA 1N6HA 4TLCA 3QNMA 3GB9A 4IW3B 1BJTA 2B37A 2FEAA 2Q2QA 2Q6OA 3H9GA 3PHJA 1Q21A 4EG1A 5ABPA 4HDRB 3FCCA 5IS2A 3G79A 2QL7A 4ZJUA 3GLSA 4M1TA 2QTTA 3CZMA 3SEQA 1NP3A 3DDHA 5F77A 5A03A 1I94B 2MIIA 3DOUA 3GP5A 4RD1A 3DPSA 2WHPB 1ISHA 1RBZA 3U31A 4D56A 3PWTA 3STWA 2KEBA 4JOQA 1XZGA 3M1AA 3NDPA 2KM1A 1N9GA 3G82C 1EUCA 1F8GA 1G21A 1WJGA 2DU8A 3LWBA 2O3QA 2WJZB 2J07A 2F1OA 3NDJA 2JFFA 3CV3A 2CRUA 1JGTA 4OKSA 4R9RA 1NVVR 2A7XA 2GPBA 4HR7A 4BE4A 1OPXA 5KYGA 1DGHA 2V6ZM 1E4OA 3OF2A 5D00A 5FI0B 1V1MB 1W9HA 1JHAA 1O1YA 1DX9A 3WMWA 4DV1B 1P4HA 4MVWA 1Y6JA 1YWGO 2PIAA 2YQ5A 3OQHA 3LXMA 1N33B 1USWA 2D1YA 4OHVA 4MDYA 1Y1KE 5GAJA 2XV1A 1LPBB 3F6YA 1RBYA 4HGQA 4IQ0A 5K8CA 2GEUA 2HCTA 3AETB 1NLMA 2DVMA