3AOEC

Crystal structure of hetero-hexameric glutamate dehydrogenase from thermus thermophilus (leu bound form)
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
417
structure length
417
Chain Sequence
LKAYRPPEDPGLWDTYLEWLERALKVAGVHPTTLEYLAHPKRLVTLSLPVVMDDGKVRIFQGYRVVHDIARGPAKGGVRLDPGVTLGQTAGLAAWMTLKAAVYDLPFGGAAGGIAVDPKGLSPQELERLVRRYTAELVGLIGPDSDILGPDLGADQQVMAWIMDTYSMTVGSTVPGVVTGKPHALGGSEGRDDAAGLGALLVLEALAKRRGLDLRGARVVVQGLGQVGAAVALHAERLGMRVVAVATSMGGMYAPEGLDVAEVLSAYEATGSLPRLDLAPEEVFGLEAEVLVLAAREGALDGDRARQVQAQAVVEVANFGLNPEAEAYLLGKGALVVPDLLSGGGGLLASYLEWVQDLNMFFWSPEEVRERFETRVARVVDAVCRRAERGGLDLRMGALALALERLDEATRLRGVYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Glutamate dehydrogenase
publication title An unique allosteric regulation revealed by hetero-hexameric glutamate dehydrogenase from Thermus thermophilus
rcsb
source organism Thermus thermophilus
total genus 144
structure length 417
sequence length 417
chains with identical sequence D, E, F
ec nomenclature ec 1.4.1.3: Glutamate dehydrogenase (NAD(P)(+)).
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00208 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine dehydrogenase
C PF02812 ELFV_dehydrog_N Glu/Leu/Phe/Val dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1210 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3aoeC01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3aoeC03
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 3aoeC02
3AM4A 1WWKA 2I6TA 4R51A 2ZCUA 2FHSA 3ZU4A 4DLLA 3ZV4A 4DRYA 3MWEB 1NVMB 4OXYA 4JLWA 1BSVA 5JLAA 1Z73A 4CV0A 1V6AA 2P91A 2NLOA 3KVOA 2XXJA 3FBTA 1EE9A 5LDHA 1SBYA 2JFGA 4I5GA 4XYGA 5BT9A 4UVEA 3FTNA 1GCUA 4O59O 2P4HX 4Q3EA 2JJYA 3ETDA 1LLQA 1Y9EA 4MVJM 3IIEA 4OXKA 1LJ8A 1SEVA 3DOJA 3F4LA 1LSUA 4CMHA 3D0OA 4P4NA 6LDHA 3F47A 4DPLA 4CLRA 4DQVA 1YBMA 4HKTA 4PFJA 1PJCA 3AY3A 4D41A 1LSJA 1MFZA 4HFMA 3DHNA 3R0IA 1LRKA 3KSDO 3AUAA 4Z9YA 3EVNA 4N5NA 2GCGA 4RQTA 5JY6A 2D1YA 4E2YA 3FNEA 3M1AA 2VWGA 1WDMA 1SB8A 4OKNA 1HSOA 3WJ7A 5IG2A 1OI7A 2C7VA 3GG9A 2Q45A 2OORA 4IPTA 1KVRA 2PZJA 1VJ0A 2VOEA 4CV3A 1CQJA 3S2EA 2O23A 1SPXA 2OFPA 3PZRA 4XQ9A 1E3JA 5I7EA 1A71A 1DIHA 3DQPA 5FFFA 3ZNQA 1B0AA 2IZ1A 2GN8A 2RHRA 3GNTA 1CWUA 4FB5A 4IQ0A 1SOWA 1DDOA 3RC9A 2OBNA 5JBIA 2NWQA 4WUVA 1IHXA 3JD0A 1N1GA 4IY1A 4LVCA 4Y9DA 2J8ZA 2IODA 4U0JA 2VOJA 3PFWO 1YQGA 3GGGA 4EEZA 4AJEA 3NEPX 4XB1A 1DRVA 4A27A 2W2KA 3N58A 4RJTA 3F46A 4CL3A 3AOGA 1JLLA 4AJKA 1X0XA 4IIVA 1GR0A 2JD2A 3JYNA 4IQ8A 4J4BA 4B7XA 4YAJA 1ONNA 4WPGA 3HUDA 4RDHA 3KYCA 2GASA 2RAFA 1EFKA 4CLRB 1IULA 3JQ8A 1UP7A 1H9AA 1PX0A 2I99A 4CMEC 3KZVA 2C07A 1ORRA 2Y0DA 4RQUA 2HKIA 1NFQA 1NM5A 4EDFA 2ZIZA 4Q9NA 3ROPA 3MTJA 1GCOA 2AXQA 1MLDA 1HWYA 1JVSA 1PR9A 1QKIA 3P5SA 4B7CA 3RBZA 3WGTA 1GQQA 2JCXA 3G49A 5AVOA 3CUKA 3KXDA 2J3HA 3IQDB 3NGXA 4PLZA 3MEQA 4NNJA 3I83A 4XYLA 5BQFA 4N54A 1B8PA 1IY8A 1OMOA 4FQ8A 3UUWA 2FZWA 5A3JA 4ZQGA 4KUHA 3WWZA 1CDOA 1Y5RA 5L9AA 1E92A 3Q6IA 1JKJA 1U2DA 3VZPA 1ADGA 2OMEA 1GZ4A 2HUNA 4XZ3A 4TKMA 1R16A 4LISA 1E1NA 2PFGA 2LDXA 4HFNA 1Q2XA 5DBFA 5A5EA 3QWIA 3M2PA 3ZW8A 2WYWA 1T2FA 4LMRA 3AI1A 2W2KB 2FWMX 4QO7A 4E5PA 1ENYA 1WLYA 2X9NA 3FNGA 1T4BA 4M87A 3PDJA 2Q46A 5TRTA 1B3BA 5G0SA 3VH1A 4WEQA 4BVAA 4YQZA 1JDJA 4S1VA 2X0IA 1F0YA 1UP6A 3JQ6A 2E4AA 4AJOA 3U9LA 2IXAA 4WK6A 1PZGA 3IL2A 2ZYAA 4EEXA 5K0ZA 4BOYA 2AEJA 3HNPA 3JQ8B 3TDKA 3TRIA 1WP4A 1H94A 3JQFC 2NVBA 2B37A 2WYVA 3KETA 2WE8A 4IUYA 4O5OA 4NDNE 1H93A 1BWSA 4PRLA 3PYLA 3TZCA 3HN7A 5F1PA 1OOEA 5EERA 1J6UA 4PZDA 1NQAO 1IHYA 3KHUA 4UEJA 4IS2A 3WGYA 4BQPA 1N5DA 1P77A 4J49A 3PHIA 1B7GO 2GSDA 3PP8A 2X8LA 5COBA 3L0DA 3TN7A 1DRUA 4WASA 5B4TA 1P45A 1N7HA 3VAZA 1U5AA 4L76A 4E5YA 4J0FA 4GKBA 3CSDA 3DZKA 3JQFA 3DZHA 1HE5A 3ETGA 1I0ZA 4GL4A 3KYDB 4UVHA 2CUKA 4WLUA 4WNIA 4HUJA 4J7CA 2OBYA 4AVYA 1NR7A 4Z0TA 3OQBA 1ZJYA 2DFDA 3ST7A 4ND4A 3VKUA 2DPGA 2FRDA 2VHZA 3TFOA 1K6JA 3ZWWA 2PV7A 4TRJA 1U28A 4IINA 4MIOA 4DWVA 2ZQYA 4O63O 5L51A 4BS9A 2UAGA 1NPDA 3ANNA 3ITKA 5TNXA 4L0QA 1B8VA 1YB5A 4A73A 3EK2A 3G79A 1E7YA 1G0OA 4R16A 3NT5A 3RIHA 1T26A 3AJRA 4PZCA 5DULA 2NU6A 2AEMA 3D1LA 3U4DA 4CMAA 4DUPA 1W0CA 3ABIA 4ND2A 2VT2A 3GY0A 2ILTA 3MJSA 3TOZA 4D3SA 3OEYA 2YY7A 2OL4A 4ZU3A 3UN1A 1GYPA 1X7HA 4CLEA 3BMQA 4DQXA 1GY8A 1CQIA 2GGSA 3RVDA 3S2FA 5C7LO 1B26A 4RCVA 4J4HA 1XKQA 2AQKA 2UYYA 3DTTA 3EYWA 3GK3A 4I5DA 5C37A 3WICA 1XCBA 3LT4A 4R69A 2H6EA 1D1TA 2C7GA 3E5MA 4PGFA 2O3UA 3IKVA 4B4OA 3DOCA 2BF7A 5EQFA 3V2HA 3CEAA 5JYEA 4E2ZA 5JCXA 3DHEA 3NTOA 3RKUA 3ZWOA 2QZ9A 4OQZA 1I33A 4BO2A 1LBEA 2VZ8A 3NYWA 1GZ6A 1I3NA 2PD4A 5C5IA 3TSCA 3BTOA 1GUYA 3E5RA 5GY7A 1H9BA 1C0PA 5KJFA 3K31A 3PI7A 4AJ4A 3INGA 5DCUA 1QORA 1E7WA 2PKRA 4XIYA 2WDZA 3PVZA 2FR0A 1F06A 3WGOA 3R6DA 4IGEA 3O8QA 1HYGA 5JDIC 2RCYA 1GL3A 1K6XA 4YB8A 1HL3A 2AEFA 2HK8A 1ZMOA 4ALNA 4GAEA 2ZB8A 4NBTA 1E6WA 2QRLA 4RDIA 2Y1OA 1D3AA 3JQDA 1KYQA 1ARZA 1OZAA 4J16A 5I9MA 3UVEA 1P1JA 2PWZA 3OH8A 1LC3A 4JX8A 1H6CA 4FFNA 1K0UA 1FDSA 3MZ0A 5CHEA 3ULKA 1E3SA 1UZMA 4Z3KA 1T24A 1UXGA 3GFGA 3FBGA 1HDRA 3FPLA 3H3FA 2Q50A 2UUPA 5A05A 3BMQB 4YDRA 3CZMA 3GMDA 5F21A 3W4IA 2GN9A 2B36A 2GRAA 3WNQA 1MP0A 5DP1A 4N18A 3A14A 3QY9A 1B16A 4Y6RA 1F12A 3ONEA 2X5JO 4W9NA 2DBQA 2FP4A 2ZTUA 1R37A 3RCBA 3VDRA 3ZI0A 3HQ4O 4IS3A 4J2OA 2BFOA 5K9ZA 5G0VA 2VYNA 3H3JA 3KBOA 2QQ5A 1XG5A 4NFHA 4XDZA 2I9PA 3VPFA 5C3MA 1C0KA 3MJCA 4MVJD 3VZSA 3A9WA 3PHLA 4AJ2A 1ZK4A 4PCVA 2YV2A 2B69A 2VWPA 4F6LA 4PLWA 4J4TA 1YB1A 3RFTA 1D8AA 2PTGA 1GADO 5JO0A 3RC1A 2DPHA 4R01A 4DYVA 1BMDA 1IUKA 4D44A 5ES3A 2Q3EA 1JQBA 1VC2A 3PEFA 3O8QB 4AFNA 3NTRA 3TZKA 1BVRA 3W1VA 4C7JA 5EINA 3SBOA 1WXDA 3CTMA 3ITDA 4JBHA 4R1TA 5DN9A 4E2XA 4MJLA 5KKAA 2VN8A 1ZMTA 4RO0A 1HYHA 3N74A 3S2IA 4XGIA 4WLVA 5K6AC 1KERA 2ZTLA 4M49A 4DIFA 1GPDG 5H82A 2D2IA 4DC0A 1LX6A 5BSEA 5L45A 3L6EA 4R1SA 4MP6A 4R9RA 4MIYA 1DAPA 1QYCA 4JN6B 5DNAA 4WECA 4DMLA 4BNKA 3OIDA 2BFAA 3NDRA 2VHYA 2QHXA 5FYDA 4CUKA 1VPDA 1U9JA 3A06A 1X15A 1P1KA 3IMFA 1UAGA 2VYVD 2XXBA 3Q0EA 1PJQA 2Y0CA 2JL1A 3HB5X 4JGBA 3X2FA 2J5KA 1T25A 4AJPA 3WMWA 3AFMA 1DB3A 1V3TA 5K6AA 5U1PA 1YOVA 4RF5A 4ZQFA 3U0BA 1NTOA 1E7MA 1FJHA 3F3SA 3H4VA 3V1TC 3WSVA 2FPPA 3FR8A 3IUPA 2NM0A 4MPDA 4FFOA 5L40A 1P0FA 4QFDA 3IKTA 5FI5A 3PGXA 4ZQHA 2DUWA 1LTHR 5CG1A 2CNBA 5I7FA 3GF4A 4YT5A 1TB4A 1GQ2A 2W2LD 2C20A 1YXMA 3F1LA 1IZ9A 2B5WA 4KWIA 5FF9A 3HFSA 1HT0A 3E48A 3CMCO 3GMSA 1HF3A 5IN5A 1O0SA 4YVFA 2B4RO 1C1XA 1TT7A 1IPFA 2POQX 1EMDA 3DO5A 4H7PA 3AOEA 3SLKA 5ICSA 4FJ1A 2Q49A 3GRKA 1CERA 4CR7A 2HLPA 1SEPA 2PGLA 1PGPA 3T4EA 1SB9A 2QX7A 5A9RA 3QJ5A 3OQ1A 3FTPA 3FRJA 1YS4A 4FPXA 5CPFA 3FNFA 3QLJA 2HMWA 4CLDA 4IDGA 3ROMA 3NAQA 1GYQA 2PGJA 3CMMA 1T4DA 4BB6A 1I3LA 3DBVO 3W4JA 3KOUA 2I5PO 3QWHA 3ZU5A 5ENVA 4DPKA 5JPIA 3B6ZA 1HZJA 4NU5A 4PLCA 3ZHBA 1ISJA 4PN3A 3H9JA 3RWBA 3WR5A 4FFRA 4E31A 1A5ZA 2WMDA 1XU7A 3LLSA 5A4DA 4L4XA 1JU9A 1V9LA 3PWKA 4LVUA 3PTZA 4J7UA 2P68A 1XWFA 3QVSA 3RKRA 1ADCA 4EITA 1Y1PA 2HMSA 1AN9A 1VLLA 2Y99A 1Q7CA 4BNHA 3ZDFA 5ADHA 5JAIA 1GPJA 5L3ZA 4CMKA 4A26A 3VH2A 1Q0HA 5A04A 1GV1A 2C54A 4U8GA 1LDBA 4F45A 1LSOA 3GN1A 3WNVA 1UDBA 2G1UA 2DUUA 1FDWA 4BNGA 4IJWA 1UP4A 4NMHA 2DTEA 3BHMA 1UZNA 3C1OA 3JQBC 3BA1A 3QRWA 3ZWBA 4XWYA 1DEHA 2V65A 1EFLA 4UUPA 4DMMA 2IZ0A 3K5PA 2Y1FA 4XGKA 3MJVA 1BDBA 4P4LA 1N92A 2CDAA 1X7DA 4YJFA 4ROSA 5ITVA 4O1MA 1GD1O 1UXHA 1LLUA 1KVQA 1PGQA 1UXKA 3L07A 2HJSA 2O3RA 5CDTA 1BHSA 3I52A 5TLSA 3I3OA 1ZW1A 3VTZA 3ENKA 1ISGA 1LXCA 2FR8A 3JQBA 4PLYA 1HEUA 4YA6A 5IXSA 3GRPA 4MVJA 1WVGA 4J91A 2Z1MA 1P9LA 1T1SA 3AI2A 4O6VA 3DFUA 3NT2A 2UDPA 3I6QA 4YACA 5L4LA 1K2WA 4MVJI 3K6JA 1C0LA 3I4FA 3SC4A 3ZWNA 3UKOA 1RM0A 3Q9NA 3RC2A 2QZZA 3RUCA 4IZHA 3K96A 1I24A 1CEQA 4YBZA 2Y67A 1IZ0A 3BZUA 1PEDA 5A9TA 1C14A 1M76A 4CM8A 2TMGA 1R0SA 1Z7BA 1ZJZA 5TJ9A 1LEHA 5B12A 1TA4A 4AJIA 1PQWA 1JTVA 4IMPA 3E03A 3OIFA 3FPCA 1VL0A 1QP8A 3L6OO 2AE1A 3V8BA 1Y8RA 3ASUA 1QYDA 4OH1A 1I2ZA 4PIVA 4I08A 1C3VA 3Q2KA 4CM7A 1LRLA 3C7CB 2HAEA 1XGKA 2IXBA 1KVTA 2VYVA 1PGNA 3D4PA 4FDAA 1P1HA 1H2BA 1B2LA 4IJUA 1DOHA 1DO8A 4XYEA 5ICMA 2VTDA 4YJFB 4QO8A 5DZSA 3BXXA 2CVQA 1LC0A 2CDBA 4L4RA 2HMUA 1HXHA 1NQOA 1PU2A 3ICCA 4BKQA 2PLAA 5H81A 4HY3A 2VZ9A 3LC1O 2O3QA 2ZYDA 3F5SA 4Q3CA 4WOJA 2VHWA 5EIOA 4ND5A 4IMRA 4Z9FA 1ZK0A 1EVYA 1VSUA 2ZJ1A 4G5HA 2NU8A 4E2WA 1M66A 4DLAA 4INAA 1FDTA 1K3TA 2JCVA 4XCVA 3UH1A 3WYBA 1MFPA 2W2LA 1KVSA 3LF1A 3ZWYA 5IFLA 3OFSA 2PGDA 2CMDA 5IDYA 5KVQA 3C1TA 2GO1A 4NG5A 4BGVA 4YAEA 1YKFA 3KTDA 4DLBA 1QSGA 5ITWA 5DOVA 4CMGA 2IYPA 1R15A 3U4IA 3GLQA 2AQHA 4TZTA 3RBXA 5JNLA 4KOAA 1VE9A 1VKOA 3PYXA 4NR0A 1J49A 3L9XA 4CM8B 5J23A 3ZNNA 3JD3A 3M6IA 5FWNA 2BKAA 3U5TA 4KMSA 4B8ZA 3JCZA 4FFPA 1KETA 3GAFA 3PPIA 3BHJA 1QYWA 2Q2WA 3AW9A 3V5NA 4HXYA 3WS7A 3WTBA 1NAHA 3F9IA 1Y8RB 2WD8A 4OXNA 4Z0HO 3DDNA 1P33A 1TXGA 2XOXA 4P8RA 3DR3A 1NYTA 3DZGA 3OJFA 4BGEA 5A06A 5H83A 4WLFA 2CFCA 1I2BA 1HE4A 2W8ZA 3EY4A 1O9BA 3TZ6A 1M6WA 1EQ2A 2Y66A 4NZ9A 1LSSA 3CPSA 1VJ1A 1AXGA 3WBBA 4Q3AA 1X14A 4JJGA 3L4BC 1HTBA 1PZEA 4K6FA 3I9NA 3QP9A 1E7SA 3ZU2A 3ZV5A 4WOKA 5TS3A 3OJLA 4BQRA 4CL8A 1IL0A 3KRTA 5G0TA 1ZSYA 2FPIA 1DC3A 3WIEA 2EXXA 2YQ4A 3UXYA 4JNKA 1WDLA 3RJ9A 2YFQA 1Y8QB 1U2GA 2Y1GA 5HS6A 3WYCA 2OO5A 3WXBA 5JC8A 5AXDA 3AWDA 4E5MA 1DIBA 1HDGO 2B35A 2IEBA 1O89A 4NJMA 1P1FA 4UULA 2ZK7A 9LDBA 5KVVA 1DIRA 2B0JA 3QWAA 4EYEA 2PNFA 3ZWCA 4D46A 3UICA 3L4BA 2HK9A 4WCDA 3E6AA 4DXHA 3OBBA 3NDIA 4M89A 3B70A 3VVBA 4DBZA 4I9HA 3S55A 2Q4BA 4BNNA 3OEWA 1FMCA 3WB9A 5B1YA 1DJNA 4K1LA 1AUPA 3M2TA 2RH8A 3R3SA 1HDYA 4UEKA 5KVSA 3WJAA 4PVDA 5CAEA 3EGOA 4GSLA 4ZICA 2EW8A 3LT1A 4MDHA 1MG0A 3P7MA 3NUGA 3OM9A 1A9ZA 3VH3A 2X0RA 1PS0A 2PH3A 5KJ6A 3D3EA 4LMPA 4D7AA 1ENZA 1JAXA 1NPTO 2W98A 3EC7A 4GX5A 1R4MA 1ZKMA 1AHHA 1M6HA 4RF4A 3CH6A 3WG9A 5DOZA 2BI8A 3KYDA 2I65A 3T4XA 2G76A 3G3EA 1X0VA 1R4NA 3GNQA 2BELA 3AUUA 3OIGA 3PK0A 4A0SA 3RSHA 4IM7A 4TROA 3V1YA 3A28A 3H2ZA 1KOLA 4D0RA 2D0IA 2E82A 1S6YA 2R00C 2DTXA 2X22A 1ONOA 2YDXA 3JTMA 4YJGA 2CSUA 2X7HA 4NIMA 3CKYA 3K73O 4CQLA 4MO2A 3I9KA 3GN2A 5TQVA 4NJMB 4BB5A 1EBFA 2HQ1A 2PY6A 4ND1A 4DA9A 3W8EA 1QXSA 3STHA 3QA9A 3A1NA 4LW8A 4ND3A 2C82A 2WWRA 4ILKA 5I8WA 5A02A 1XHLA 3SJ7A 3WMXA 4ONEA 4OMUA 3PGJA 2BFMA 4J1NA 1PGJA 2R00A 4JIGA 2DLDA 3A4VA 3K9QO 4GMGA 3TFQA 2CD9A 3GNSA 1LQUA 1UUFA 3GVIA 5G0WA 2PA3A 2O4CA 5F1OA 2GLXA 3IC5A 5KTKA 5L4NA 1RWBA 2QIOA 3H9UA 2Q99A 3HHPA 3RD5A 4OQYA 4CM1A 4OKIA 5CEJA 3X2EA 4BL5A 4AJJA 1R4MB 3C8MA 4L9RA 1YH3A 3F6YA 1BDMA 2HRBA 3E8XA 5CEEA 1ISIA 2NQ8A 5B4VA 4CQMD 3VHRA 2GUGA 1M67A 4AL4A 1PGOA 3GHYA 4RL6A 2YV3A 4B3IA 1TI7A 3JQAD 1R4NB 1V3VA 4FBGA 3SVTA 3LLVA 2Q2QA 2PR2A 3WX0A 5C7IO 4LK3A 1ZK1A 5THQA 2ET6A 4FSHA 4EJ0A 4XR9A 2VHXA 3I5MA 4YJGB 3SXPA 2NSDA 3JYOA 4B8WA 4HBGA 3VPGA 4N5LA 2YJZA 2E6UX 3WYEA 1E6UA 4GI2A 4AG3A 1YBAA 3AUTA 3AFNA 3AU8A 3GAZA 5LDGA 1R0LA 2WJPA 4CQLB 3WGIA 1E0DA 1Z74A 2CVOA 4E4YA 4RPHA 1VKNA 2C29D 2JFFA 4Y6PA 3WGGA 4FC7A 1U3WA 3PJFA 4RVGA 4W7IA 3LDHA 3IS3A 1YRLA 2Y1DA 1E7RA 4WLEA 4RORA 4ALKA 4GX0A 5JE8A 3T7EA 1Y7TA 4ID9A 3V1UA 1PL6A 3O03A 4CLHA 2XPCA 3C85A 3I1JA 4TVOA 4RVFA 3KSUA 4EUHA 1PZHA 1D4FA 4IGFA 5IN4A 2D8AA 1IOLA 5IZ4A 4QT0A 5TX7A 4CM3A 4D45A 4JBIA 1WW8A 3OHSX 1MXFA 2IE0A 5JCJD 1YGYA 2A9FA 3GZNA 3HDYA 4NK4A 2QW8A 4U5QA 5GZ6A 4J6FA 2G17A 4MVJF 1U4SA 4BV9A 3DONA 1J5PA 1PJLA 4KQXA 2DFVA 4IJVA 1KY5A 3F4BA 3IOYA 4GSKA 2W4QA 3P2YA 3FCOA 2NTNA 5JY1A 3E9MA 2C0CA 3RQSA 5IDQA 3HB4X 1HRDA 1U3UA 1XR3A 1U7HA 2D3TA 4IZIA 2QRKA 4ESOA 3OJEA 1E3EA 1EBUA 3HDJA 4FOSA 4UUMA 4KUEA 4QXMA 4D3DA 3TOXA 5G2OA 3I9JA 3ANLA 3IJPA 1U8FO 3ZWMA 1LUAA 4B3HA 3H65A 4BO6A 4AICA 4XX0A 4W9NC 2PH5A 5AXCA 4RPKA 3D64A 1ULSA 1GZ3A 2F00A 1K6IA 4H16A 2I67A 3HN2A 3I6IA 4EZBA 4U6QA 3VPHA 4FJ0A 1MC4A 1EQUA 2V6FA 3NRCA 2OOSA 3VH4A 1BTOA 1CETA 3GG2A 3ZZNA 5I7VA 5JMWA 1PJTA 2V6BA 4JROA 4YAGA 2O2SA 3Q11A 4GWKA 2ZB4A 3GUYA 2EF1A 5KKCA 3LK7A 2X5OA 3GZNB 4FGWA 3Q2IA 3JYQA 3ETEA 1K5HA 3PWZA 1OAAA 3H9GA 3INTA 2Y05A 4ZRMA 3PQEA 4TKLA 3JYLA 4ZRNA 4A03A 2NACA 4CLOB 2Q1WA 1IYZA 4CLXA 2PZMA 3S8MA 1I30A 3PQFA 3JSAA 3L77A 2AA3A 1RJWA 3ASVA 4MVJG 4P38A 4BO1A 4R68A 4NK5A 4W99A 5IF3A 5JYDA 4YJHA 2GR9A 4Y6SA 4CMIA 1BXKA 4ALJA 1DLIA 1QMGA 2LDBA 1W73A 4KUGA 2GERA 3DZBA 4XRRA 5TT0A 3TZQA 1I01A 1V0JA 5DDIP 1W4ZA 4A10A 5C7OO 3LYLA 5MGBA 3P2OA 3QV1A 1B3RA 1T2AA 4TRRA 4ZJUA 2NVUA 1A72A 1LRJA 3HG7A 2VQ3A 1R66A 5B37A 3TJRA 3FR7A 2O7SA 4DIOA 3JQ7A 5CG2A 4P22A 4IXTA 4NI5A 3DEYX 4B3JA 1NASA 4R1NA 2EGGA 3QVWA 4MP3A 1G1AA 2FSVA 1OFGA 3K30A 3AY6A 4EJ6A 1U4OA 1HDZA 5DF1A 2C5AA 2RHCA 3DXFA 5EJ2A 5JXWA 4ALMA 5G0UA 3LF2A 1ZCJA 4E5KA 5B4UA 8LDHA 4YT4A 1EUDA 3C7DB 5GZ1A 2B83A 4J43A 1JKIA 1E3WA 2I76A 4MP8A 4R1UA 4PG6A 2J5QA 3FI9A 5DP2A 2H9IA 3QSGA 1HETA 4RPGA 4GMFA 4CQMA 1WAMA 2P4QA 1W8DA 3AOEC 1KEVA 2HCTA 5JSFA 5HA5A 5CDYA 3ZU3A 3GGOA 4BNXA 2OUIA 3HJAA 3MJEA 3W8DA 3ZHYA 4X54A 3FWNA 3DL2A 3KLMX 5BNTA 1JW9B 1NX6A 4J3FA 3ZH2A 2Q1TA 4RPLA 2Y68A 5TT1A 3NKLA 3ONFA 1N8KA 3PDUA 4YCAA 5IDWA 4YR9A 4YJHB 4CMIB 1I10A 4YTEA 3GR6A 4EI2A 3JQEA 1CYDA 3JD4A 3DZIA 4AJHA 2J3JA 4D79A 1VJTA 3KUXA 5AXBA 2FN7A 3FNHA 5KOIA 5U4QA 3GFBA 1NP3A 2NVUB 3D5QA 2HMTA 2QRJA 5AXAA 1DC4A 4BNZA 5JAQA 1MB4A 2OP1A 3V2GA 5TC4A 3JQ7B 3DFZA 1JWBB 2AQ8A 4HX5A 2IRWA 1PS9A 1U5CA 3L6DA 3OSUA 4ZN6A 4NU6A 1I36A 4BIIA 3ONDA 3NDJA 2IZZA 4R5HA 2A4KA 3UAGA 5IXYA 4Q3DA 5T57A 1DC6A 5JCJA 3DAGA 1O95A 3VPXA 2AG8A 3O26A 1JAYA 5IAAA 3KB6A 5EL0A 4YT8A 4EUFA 3WBFA 2DTDA 1N9GA 1A7AA 4U7WA 4D42A 2X0JA 3O4RA 1FDVA 1Z6ZA 2D5CA 3PJDA 1VL6A 3B20A 1PS8A 1E5LA 2JAPA 1E3WB 1JWAB 1PIWA 4XB2A 4PG4A 1D1SA 5HRUA 4RV9A 3GEDA 4CQMB 5F3RA 4RLHA 3TPCA 3C3XA 3ADOA 3ANMA 4XQCA 4CMBA 5ER6A 2EV9A 4W6ZA 3HDHA 3JQAB 3V2UA 3LSYA 1ULUA 3MOIA 4LSMA 3G0OA 3F5QA 2BH9A 1BXZA 1ZO8A 2PZKA 1WNTA 3LT0A 2Q2VA 4FOOA 3GQVA 3ZHXA 1C1DA 4MOWA 1NVTA 4BO5A 1PSDA 2B4TO 5F5LA 4FW8A 3WQRA 1WZEA 4ZD6A 5MDHA 3LT2A 4GLLA 4OIMA 1G6KA 1YWGO 1H2HA 1NAIA 4GVXA 2X23A 1XA0A 4K6CA 4XRGA 4ZGWA 1DFGA 2DQ4A 4B4VA 3EDMA 1I3KA 3ICPA 3LZ6A 4NH4A 3L4SO 1N1EA 4I5EA 3WLEA 1WMBA 1GU7A 4BO8A 4NQZA 4DVJA 1SZJG 1BRMA 4G65A 2JAHA 2GNAA 4PLFA 2GZ1A 1A4UA 2J3KA 5EN4A 1MA0A 2FR1A 3DOOA 1DXYA 3DB2A 5IZCC 1EUCA 4AJLA 1ZK3A 2ZYGA 3G1TA 1LLDA 3I23A 1W6UA 1KVUA 4IDAA 4NFSA 2I3AA 3GDGA 4YRAA 3GT0A 4JQCA 1N9GB 3WGQA 4DQUA 4E30A 2YHUA 2TMDA 1ZXLA 5AYVA 3TWOA 4DYDA 1SNYA 1A9YA 2P9GA 4FJ2A 4FR5A 1OC2A 2O3JA 4A7PA 4HNHA 2PKQO 1LU9A 4UVIA 4L8VA 3GHHA 3VC7A 2BLLA 1VRWA 2QYTA 2C2YA 4TRNA 5A03A 2VCYA 3GVCA 4BO0A 5IZCA 3PZBA 3AM5A 3EW7A 4EBFA 4R54A 3WGHA 3BTVA 4JCOA 4BNTA 2G0TA 2JHFA 5CEFA 4W7HA 1C1DB 1UDAA 1ZSNA 3RC7A 1O94A 3K2BA 1PJSA 3AI3A 2PD6A 3EHEA 2VUUA 4DTIA 3OECA 4OAQA 3NX4A 4CM9D 5DT9A 1AE1A 1G0NA 1PQPA 3OF2A 4NPCA 1T2EA 4Y67A 4ALLA 3DMYA 2X6TA 4RF2A 5ILGA 1O8CA 4W82A 1FDUA 4BNWA 3NTQA 4U6SA 5CDSA 4FS3A 3TZHA 4BNIA 1FF9A 4YQYA 4FFLA 4ZHSA 3PRJA 5T64A 3RUFA 4DBVO 3DAPA 5JW6A 1EVIA 3T7CA 4DC1A 5EMHA 2EEZA 1H0KA 2NTVA 4R3NA 3QVXA 1ADFA 3KLPX 1XLTA 3PHGA 1ENPA 2YZ7A 3RUIA 1IE3A 4Q39A 3ZNPA 4HNGA 5TIIA 1ZEJA 3QWFA 2P5YA 1VI2A 3AUSA 4GX1A 2JHGA 1QYXA 4KTTE 4KZPA 3PJEA 3WFJA 4DL9A 1ZFNA 5BSHA 1I5RA 3R3JA 4PLHA 1GEEA 4XQEA 1MV8A 4JP3A 2BMAA 5GZ3A 5U9CA 2VRBA 2X5KO 1Y8QA 3PJGA 2WYUA 1EUZA 2J5RA 1RM5A 4E3ZA 2O50A 1NQTA 3TNLA 1BVUA 1Z82A 3GOHA 1HDCA 1ZZEA 3TQHA 2C59A 3RROA 4F6CA 1Y5MA 1NWCA 3MWDB 4YJDA 1A4IA 5T6BA 4OGWA 1Y81A 2QG4A 3QVTA 3RU7A 1N2SA 4YRBA 2AMFA 1MG5A 1U3TA 4DIBA 3OP4A 3CZRA 1TVEA 5L95A 2FPGA 2H63A 5L7YA 4E12A 4QX6A 1Q7BA 5KCZA 4RF3A 3O38A 1QG6A 1BXGA 3FF4A 4ITUA 4A2CA 4CUZA 1I8TA 1XU9A 3P19A 5I8ZA 1PZFA 2E48A 2YYYA 4I1IA 4ZQBA 2X9VA 4CV2A 2SCUA 4MKXA 1EDOA 3RUDA 3VVCA 2R6JA 3OJOA 1HZZA 3QW2A 4AJNA 6ADHA 2RH4A 4PVCA 1IPEA 5HM8A 1PJ4A 2WM3A 4CMCA 3PQDA 2DBRA 4RLSA 4RGBA 5CDGA 3W8FA 3H5AA 3FD8A 4GBJA 1RYEA 2ZKLA 3OICA 2JCYA 1M75A 2BGLA 4TMFA 5BSGA 4WKGA 2PK3A 3M1LA 1GAEO 1QLHA 4Z9XA 4BO4A 5F5NA 1PJ3A 2IEDA 1ZSVA 3EAGA 3PIIA 1YO6A 4L75A 4TQGA 5THKA 3D3WA 3Q1LA 1E3IA 4IIUA 3U3XA 1SAYA 2VTEA 2X9GA 5I9NA 4GX2A 2AQIA 4D3FA 2NUAA 3GA0A 4TWRA 4YWJA 1MC5A 1LDMA 4BO7A 2F1KA 1E5QA 4MVJE 4PLPA 2EIHA 4UVDA 2UV8A 4FN4A 4AJ1A 2EP5A 2GF2A 3EMKA 2VZ0A 3ROQA 3OETA 2FOIA 2VRCD 4L74A 1BW9A 3ENNA 4CM4A 3KEOA 4LSWA 3INRA 5DCWA 5KIAA 3CE6A 3WTCA 1HSZA 4URFA 2J6IA 2J3IA 1P1IA 2C2XA 2NNLD 1YQXA 2D4AA 2FMUA 2WEKA 4BMSA 2DBZA 2DU8A 5A9SA 1UZLA 4MKRA 4ZQEA 1NFFA 3IJRA 5T67A 3HDQA 3JQCA 3LC7O 3JV7A 3QVOA 4GGPA 4GQAA 2ZCVA 2VUSA 4FCCA 4CM5A 4J0EA 2O3SA 5G4KA 2ZATA 1DLJA 1LDEA 4IDEA 4KQWA 4OJNA 1BXGB 3E18A 2BHLA 5CFZA 1WZIA 4R41A 2DT5A 3DMTC 1NVGA 4M1QA 4B7UA 4L73A 3ZGYA 4S3MA 1P74A 1V35A 4N5MA 1DRWA 3I9MA 3NGLA 3S1LA 1B8UA 1AXEA 1GTMA 1Z7EA 5AQ1A 1DIAA 2BFPA 2ZTVA 2CF6A 1TLTA 1LDGA 5BNFA 1HKUA 4DREA 2EG9A 7ADHA 3OA2A 3HE3A 4XDYA 2NQTA 1EVZA 2W90A 2BI7A 4HWKA 1HLPA 1TEHA 1B14A 3DMTA 1ZUD1 3D3WB 3NV9A 1DFIA 4BKRA 1UXIA 5JC1A 1KS9A 3I4CA 1MUUA 1LI4A 2HDHA 4LRTB 4YXFA 3LC2O 3AM3A 4BV8A 4CMEA 4IBOA 3RJ5A 2GDZA 1DJQA 3DBHA 1PR3A 4CM6A 1J0XO 4OSPA 2HK7A 1U3VA 4CR6A 2VYND 2Z95A 1BW9B 4CM9A 4CM4B 2A94A 3UOGA 4RVHA 1HYEA 2RBEA 2GPTA 3OMLA 4LCJA 4WE3A 2NU7A 5DBIA 4XYMA 5EQDA 5LCXA 5JO9A 3IDSA 1JVBA 3ZV6A 4BGUA 3COSA 3ZWXA 2EW2A 4J1QA 5A9SB 3VPSA 1SOVA 1P44A 1DHRA 2NADA 1GV0A 2WSBA 4J1TA 4MINA 2X0NA 3SJUA 2ZJ0A 1E1LA 4G81A 4I9NA 3UCFA 5G4KB 2C5EA 4B4UA 4JJFA 3WIDA 3WWYA 4XYBA 4F46A 4RZHA 3GUCA 3DWFA 2D5AA 3U49A 4UAGA 1F17A 4HFJA 2NVWA 1YONA 3CIFA 3KYCB 4E6PA 3EZYA 4Z3DA 1E77A 4NJOA 3GPIA 3PFFA 1XELA 2EJWA 4H15A 4C4OA 3IUSA 3EVTA 2BD0A 4YAIA 3GDFA 4II2A 1VM6A 2P2SA 3U62A 3KO8A 1LDYA 4J9VA 3D5TA 4XIJA 4CUJA 4MKZA 4XQGA 2JD0A 3TL3A 4BO9A 3C7AA 2A35A 2PD3A 3WOHA 4BHTA 5T8KC 1LQTA 4M86A 3RUEA 1PWXA 1PL8A 1QV6A 2NU9A 3D4OA 3D7LA 3ZWAA 5JS6A 3LVFO 2UUOA 2GZ2A 4CJXA 5DCYA 1DPGA 4UUNA 4BMNA 2V6GA 4IDBA 1NBOA 4XR4A 1Q1NA 1XSEA 3CXRA 4FD3A 3RI3A 3DBHB 3K8ZA 1ZBQA 4RPJA 5COQA 5TJHA 2FY8A 3E1KA 3O9ZA 4MVJH 3FSRA 4M55A 4N7RA 1A7KA 2DC1A 2EKLA 5L7TA 3K2EA 3NJ4A 7MDHA 4A5OA 4I9UA 5KJ1A 3F1KA 5T8KA 1ISHA 2WE7A 4KTVE 3PHHA 4KWHA 4EJMA 4JP2A 1Z45A 2AE2A 4CMJA 1PQUA 3U4CA 4B79A 5HS4A 4BNFA 5ENDA 1KIFA 5KWEA 5JAZA 3H7AA 2DVMA 1Z75A 3IAHA 2Y1EA 2JFHA 1CJCA 4CV1A 4WJZA 1RM4A 3OJ0A 1GYRA 3E9QA 3NT4A 2O2YA 3GDOA 2H5LA 2Z5LA 1NR1A 5JMPA 4FGSA 4Y98A 5LC1A 2Q4EA 3HFGA 1ZH8A 3LU1A 1SCUA 1X1TA 4CLOA 2ZQZA 4O0LA 4WEOA 3WQSB 4QTZA 1LNQA 4Z0PA 3RASA 2OXIA 2B5VA 3ZN2A 4KP7A 4CODB 1VL8A 4L4SA 3GH3A 1ZNQO 3PIDA 4PRKA 4TRMA 1P3DA 2I66A 3PLRA 3Q3CA 1YL5A 2YFHA 1ZEMA 4FFMA 5CDUA 3PLNA 4R9SA 1U8XX 4J7XA 2VRCA 4RZIA 1X1EA 2EGHA 3JQGA 4CR8A 2Y0EA 3UFXA 4OHUA 5KNLA 1KC3A 3G1UA 4Z6KA 2GN6A 3VZRA 4UREA 3I9LA 4RVSA 1UDCA 1D7OA 4WNCA 4PZEA 1XYGA 3RFXA 4KDEA 2DM6A 3H2SA 3FHLA 3BMCA 1ZXBA 1BGVA 1NWHA 3GZ4A 4IDDA 2FZEA 4EGFA 2O7QA 4XA8A 1DIGA 2HJRA 3N7UA 1MGOA 1QYVA 3BAZA 1BG6A 2ZTMA 2D59A 3ZCXA 3E9NA 4U0KA 4J9UE 1F8GA 2CVZA 2ZB3A 5A1TA 3K92A 3DAFA 4OOEA 1ISMA 2AG5A 4R4JA 4E5NA 4GGOA 1PWZA 5JAMA 1QRRA 4GKVA 1MXHA 2X58A 2VWQA 3EUWA 1WMAA 1Q0LA 1HE3A 2EWMA 4WLNA 1KBZA 2R2GA 3FN4A 3GPDG 1CF2O 4K9DA 1GFSA 1GEGA 1YB4A 3W4KA 5JDIA 4BKOA 2Q1SA 4E32A 8ADHA 1YVEI 2EP7A 4E33A 3HZZA 4PLVA 1KEUA 1K89A 3LQFA 4QUKA 5T5QA 5AOVA 4E21A 4HFRA 1ML3A 5TGDA 1P1RA 2Z1NA 4YYZA 4QSMA 2O3TA 3DC2A 4IDFA 4KDFA 3SX2A 2V7PA 4GH5A 3HSKA 4IDCA 2YUTA 5A5FA 3JQGB 3PYMA 3WGZA 2JKVA 4PLGA 3B1JA 3DTYA 4BNUA 3PWSA 4WGGA 3DZJA 1XEAA 5EESA 1H6AA 3RAJA 4IJKA 4QQRA 5G4LA 4II3A 2O48X 1PJ2A 3BMCB 3FWZA 1HDXA 4WLOA 1R12A 1I2CA 3MJ4A 1X7GA 5L7WA 1E3LA 4HADA 4CPDA 5BSFA 5TF4A 3UCEA 2E37A 1Y6JA 4GLOA 1P0CA 2CY0A 1YJ8A 3ADPA 3DBLA 1ENOA 1T2CA 1V3UA 4BKPA 3TL2A 1ADBA 4IXWA 3QQPA 3W6ZA 4MVJP 2XAAA 1OC4A 3NJ8A 3RFVA 4XD2A 3MJTA 5KJEA 2EKPA 4TSKA 2G5CA 4PG5A 3MOGA 2P5UA 3ROKA 5I7SA 3WQQA 1E6EA 3OQ6A 2VWHA 1YQDA 5KVCA 3BHIA 1O6ZA 1EE2A 5F1KA 1KEWA 4OYRA 4GWGA 5IDXA 4NHEA 3BIOA 1ZIDA 3G17A 1NQ5A 1QV7A 3JQAA 1Y9AA 1ZK2A 2IYOA 1HLDA 1NNUA 3DHYA 1NHWA 4R3WA 4UEOA 4G2NA 5CP8A 1H5QA 2PKQP 2EKQA 2OP0A 4J90A 4MIEA 1LDNA 1XIVA 4Y8VA 1YL7A 4Q3NA 1DBVO 3ON5A 3VZQA 2X1HA 3BTSA 2HMVA 1PTJA 1UAYA 3H5NA 2G82A 3OA0A 4FC6A 3UF0A 1AHIA 3VTFA 4PG8A 3RBVA 2B4QA 4XJSA 3UCXA 3KYBA 1DAOA 2IDZA 2RIRA 4H3VA 1EK6A 2OHXA 2UVDA 2I3GA 1CIVA 2GN4A 3IP1A 1B15A 4D43A 4BKUA 1I3MA 3DBLB 3ZW9A 3VOSA 1YDEA 3ZHZA 2VNSA 1T1RA 1C0IA 2EJVA 2EERA 1CRWG 1ID1A 1SO8A 3C1AA 3RU9A 1YDWA 1SC6A 4BMVA 4J1SA 2YHIA 3GEGA 4BNVA 2YV1A 4UUOA 4WCFC 1QR6A 1L7EA 2YQ5A 3QIVA 1GUFA 3S2GA 3VDQA 5HBRA 3GEMA 1EZ4A 3VKVA 3GGPA 2GYYA 2A92A 4ZVVA 3Q9UA 5EPOA 1X13A 2NV6A 4LGVA 5TSDA 1HE2A 1NHGA 2EHDA 3BMOA 3GVXA 1E1MA 3SLGA 1OBFO 2DKNA 5JFOA 1H6DA 2Y93A 1LA2A 3ZWPA 3JQ9C 1PL7A 3UW3A 4JBGA 4EW6A 1FXSA 3E82A 2AHRA 1GUZA 1LLCA 5KJCA 3MTGA 4DGSA 2VT3A 5ER9A 2FSSA 2X86A 1MX3A 1EDZA 2AW5A 4P4GA 1KC1A 4NBRA 1YOVB 4WCFA 1UJMA 1VSVA 4BUCA 1U1IA 4LRSB 1GDHA 5HWSA 4RVDA 1KEPA 2GD1O 3W6UA 1YJQA 2GZ3A 4B4WA 4XJTA 4QFCA 4F3YA 3JYPA 1RKXA 1O5IA 2CDCA 1F8FA 3GC6A 3C24A 1S7CA 3ZWVA 2PZLA 4HP8A 4YEDA 4QEDA 3UGKA 2WD7A 5COAA 1F14A 3JQ9A 3WFIA 1EK5A 3R1IA 2JD1A 3RUHA 4YRDA 5DBGA 4EUEA 3PXXA 4RVUA 3GVHA 3QE3A 4BNLA 1UH5A 2DBVO 2NTJA 2H1SA 2DAPA 1C1XB 3H5RA 3H9EO 1IB6A 3CINA 3MCVA 4TVBA 1AGNA 4I5FA 3BMNA 1YE3A 3B1KA 3BTUA 4XKJA 3DBRA 3DZFA 1TT5A 3UHAA 1EEHA 2YHIB 1PJBA 4ZA2A 3ZV3A 5HTOA 3B1FA 2YDYA 4D0SA 3HADA 2P9CA 5GMOA 1YBVA 2CZCA 2X4GA 4M54A 2VNAA 1H6BA 4BNMA 1DHTA 4NBUA 4R5MA 4YPOA 4JJIA 1QLJA 1ISFA 1NPYA 2QYSA 1YL6A 4YAKA 3BMOB 1Q7GA 5L4SA 4K26A 4OSOA 4IQGA 4M8SA 4GVLA 1KY4A 4PLTA 5CPBA 4PG7A 3ZNOA 2YW9A 4I8XA 4LN1A 2E49A 1JKFA 1UR5A 3WSWA 4C7KA 1DSSG 2VUTA 4NBWA 5FI3A 1R6DA 2XF8A 3KV3O 4K28A 4YT2A 5BR7A 5A3VA 3ORFA 4WCFB 1DC5A 5JDCC 1T2DA 4HV4A 3JD1A 2OGUA 1Q0QA 1FK8A 1ZVMA 3PHJA 2VHVA 4LCEA 5IJZA 3BYZA 3GVPA 3U4HA 1L1FA 4XEHA 1I32A 1V8BA 2HU2A 4E13A 1JN0A 1DFHA 1UXJA 1XQ1A 2Q1UA 2WD7B 3AK4A 3H9QA 3H8VA 3JD2A 5L53A 2ZB7A 1J4AA 1U7TA 3H6KA 3L9WA 4JXKA 2V6MA 1L7DA 2BGKA 4GPD1 1E1KA 1R0KA 4Q3BA 1GQYA 1JA9A 4NBVA 5JDCA 3AY7A 3KM0A 4TZKA 4BNJA 2BRUA 1NXQA 2BGMA 3AU9A 3IP3A 1RM3A 3BMNB 4QECA 1NFRA 3DBRB 4OL9A 4XGNA 3U09A 1TT5B 2OZPA 4NFYA 5I9LA 9LDTA 4UVGA 2P9EA 3QHAA 1RPNA 4W4TA 3I9OA 1HDOA 4ALIA 3SEFA 1N7GA 3TF5A 2Y1CA 2WTBA 4OM8A 1E7QA 1SMKA 2CF5A 2O4UX 3SC6A 3RUAA 4J2HA 4BNYA 3WLFA 1WPQA 2HRZA 1P31A 4JK3A 3WDSA 1XDWA 4OO3A 1A27A 1XQ6A 5ILOA 2HSDA 4E0BA 4BGIA 5BNIA 4OOFA 3EZLA 4DPMA 4BO3A 3HWRA 5FEUA 3KSZO 1EVJA 1M2WA 2HO5A 1RYDA 3QWBA 1WDKA 3D4NA 4FIZA 1ONPA 3KEQA
chains in the Genus database with same CATH superfamily
4JGIA 4FXPA 3OTWA 5ESDA 4H2DA 1AM4D 4H0FA 1JPVA 4JBWA 5AW5A 2JFGA 2ZRBA 4HD8A 1OYVA 5ELXA 2UVPA 2G5TA 2XVZA 3ELYA 3LUDA 5EHZA 1JLRA 4R81A 3ORQA 1LSJA 1MVLA 5I7AA 3BE4A 5IT9S 1JPUA 2PUEA 3BDAA 4LE1A 4E2YA 2C7VA 2IUYA 1Z25A 4LHXA 2IY8A 4X1IB 3OOYA 2Y1LA 2IS1A 1EP3B 5P8WA 3V7WA 1EVLA 2IY7A 1YSYA 4EFLA 5IANA 4IY1A 1P7PA 3QVJA 2FPOA 3PFWO 3NEPX 4AS3A 1IUOA 3KOZE 3SXUA 1K5DA 3GOQA 3EPLA 3TFWA 2DPLA 3AEUB 4RQUA 5KWJA 4F3NA 4X3PA 1QJCA 2IEIA 5AVOA 5DGDA 1US8B 4AWBA 4UPDA 4KUHA 4LECA 3DMFA 2IUUA 2OLEA 5A2GA 1U2DA 4GMXA 5B6JA 3W2GA 1NI4A 3ZW8A 3FYTA 2VK2A 2NW6A 4G1CA 4KQFA 5TPZA 4JB2A 4QO7A 4E5PA 2YYZA 4K81B 5FLXA 2DWOA 4BVAA 1M0WA 3M81A 3VXKA 9MHTA 2GBFA 1NC1A 2PUJA 1A7UA 3HWSA 4IUYA 4O5OA 1NF9A 4DWOA 3NMUF 3BXZA 1RKUA 2TS1A 4J49A 2QVCA 4O4HF 3TN7A 3NG1A 2PKCA 1RD4A 1RQGA 3CSDA 4ZALA 4CIYA 2JY7A 4OKSA 2I8AA 4GL4A 4HUJA 1HNXM 1GN8A 3PF8A 1EE1A 1OLSB 3ZWWA 1U7DA 3IHWA 1P5JA 1NPDA 1KA9H 1P81A 3OZAA 3OZXA 2OAQ1 3TRHA 2K6GA 4R8LA 4AUEA 2C8VA 1KOJA 5DGXA 5FT9A 1KQFA 1MO6A 2C7GA 2YH2A 5CB0A 1CYEA 2YS7A 4H60A 3AF2A 5BQ5A 3AP1A 4WI1A 2B92A 3VR5A 1H9BA 3EUAA 4AJ4A 3I2GA 5DCUA 1N0VC 5DN6D 3RS8A 4PSKA 3DDWA 3R6DA 1CNMA 5CT9A 2AEFA 4NATA 1TCAA 4TLDA 3ND7A 5HCUA 2HRDA 2EYUA 1E5DA 3STXA 3CRRA 3ULKA 5JS7A 5BV2P 1KI9A 1UXGA 3FBGA 4LRQA 4DJAA 3ZKAA 2Q50A 3GJQA 2Z58A 5A05A 3OKFA 2P4UA 3HY5A 4N18A 1R37A 2HTFA 5K9ZA 1DJLA 4LRUA 3VC1A 3RFTA 3V4PB 3TZKA 2TSYB 3RREA 1E0AA 4MJLA 4US2R 2C2KA 2PANA 1HR0M 3ER8A 2B5OA 3RS2A 4PZUA 1PW5A 3UJCA 1EGVB 2QI9F 2YJNA 1NULA 5A6SB 2EIXA 3C4QA 4KPUA 2ZRCA 4JYMA 4FOLA 4KFRA 5JVDB 1E7MA 1RPTA 2SKCA 3EYAA 5CMLA 2W2TA 4FFOA 3RC3A 3TNJA 1PE0A 1GPBA 3BFJA 3GF4A 3A7DA 4AZTA 2L09A 4QASA 3GMSA 4OREX 1TK3A 3ICEA 3WWOA 4LUCA 1IHDA 4C5AA 4UE2A 1JVNA 5B3KA 3UV7A 1T6NA 1SEPA 4GOLD 3UMGA 5HMMA 3DYIA 2CKDA 2F48A 4KAFA 3M6WA 3G2OA 4H7DA 3VR4D 4B43A 2OV8A 3U6PA 2PRJA 1GDDA 4O2BB 3IKMB 4DNOA 2GFIA 5ENVA 1J70A 3U7QB 5BOSA 3ICQB 2AWNA 5FPSA 4EYGA 2XB6A 3SHGB 2AJBA 4GZ6A 2WU8A 3U6CA 1T0UA 4DUZB 5ADHA 4YRZA 5ULLA 1FTGA 5EJ8A 1IQUA 2ID4A 5FWYB 3C0KA 4DSAA 2TYSB 2CBZA 3RNLA 3KDPA 4NBKA 2WA2A 5F73A 1EDBA 1DTWA 3T9AA 2CDAA 1UKYA 4O1MA 3R7LA 2XGJA 2ADMA 4LJ8A 1YRQA 3VTZA 3BOSA 4HNAA 3RYIA 4O6VA 2Q9CA 2H2FA 4MGIR 2V7XA 3RWMB 3VJRA 3BWVA 3KP1E 2ZBEA 1Q0RA 1CEQA 1G2OA 2H1LA 5A9TA 1C14A 1RBMA 3WLAA 1R0SA 4C2UA 4M7RA 1O8BA 1X1AA 3ZBPA 1QYDA 2Y1KA 4OGKA 4I08A 1CY6A 4GE0A 3D4PA 4FDAA 4GYJA 1KY3A 4QYSA 2B7LA 2ZIEA 2PLAA 4ANRA 4DN6A 5EIOA 1JAZA 3FOFC 1MFPA 3F3MA 5IFLA 5ITXA 2D7GA 4LOJA 4L72A 4YAEA 4WZAB 3UT6A 2ECKA 2BOVA 5H7XA 4JI2B 2K9DA 1VE9A 3ORSA 4OHCA 3LXUX 2J4CA 1OTYA 1TGYA 4RADA 3WS7A 3F9IA 2FW1A 4MSUA 1TXGA 2F3SA 1L1EA 3DR3A 1A7JA 3TDMA 3NYQA 5H83A 2W8ZA 3KWLA 3DPIA 4X60A 2PCLA 1NBEA 3UT5B 5JQGB 1HTBA 1PZEA 4K6FA 3PC4A 5HIJA 4GZLA 3Q7IA 1ZSYA 1L4HA 4DUYB 5EZYF 3SQDA 3J7AS 4H4CA 3CS3A 2YMLA 3U60B 4M89A 4DBZA 4MAAA 1ZLYA 4CU5A 1V7ZA 1DJNA 2RH8A 1DGHB 2WFAA 1XWIA 3R6LA 1MG0A 4FHDA 3G2NA 1X8XA 4KV9A 3PB3A 3ZEAA 1FFGA 2ZRDA 2P6OA 3PQ2A 2YWBA 3PTAA 3E05A 1GA6A 3S8YA 1N3IA 2FN4A 5EXDA 4LGMA 2D0IA 2X22A 3N2LA 4EI2A 1U2TA 3MB5A 3OZDA 3TIGA 4AZVA 4DDUA 3MQ2A 2ZYIA 4A0QA 3GJTA 1O6BA 1FJGM 4J1NA 5AVYA 3HJFA 4YP6A 1W59A 1BS9A 1LPMA 4AWAA 5G0WA 3Q7TA 4WVLA 1HNWM 5TDHA 3K9GA 5HGJA 2OB1A 1DC8A 2HQOA 4P4SB 4QWMA 4JV5M 2QLNA 3EOAI 5LMCA 2MU1A 1RJEA 4OY3A 4FU0A 1F0KA 4YJGB 3SXPA 3WYEA 1YBAA 5LBTA 3WGIA 4H3KB 1Q3TA 3FYUB 1G7TA 4DIMA 4MQEB 3LDHA 2A5LA 4CKEA 1M83A 4KW7A 1XZKA 4GDMA 5IM4A 1FCJA 3TAXA 5JCJD 2YHBA 2FFAA 4RMJA 1PJLA 3NHLA 4V3BA 5JY1A 2IEAA 3A3NA 4TWIA 1Z8FA 3GPLA 1EBUA 3CX4A 1TKCA 3UWPA 3ZWMA 2FJPA 4NDZA 1QFSA 3IAM6 2JW5A 5AXCA 4R84A 1ZI6A 3ZXSA 4X65M 1OASA 1OT5A 3PC7A 2E9SA 2I67A 5ERGB 4M1SA 5AI6A 1QHFA 1GKKA 3GG2A 2V6BA 4KREA 3N6VA 1FFAA 2A59A 1ZGAA 1PWHA 3Q2IA 2YUIA 3A1FA 3PQEA 2PZGA 1USGA 1E2QA 2AL7A 2BBSA 4OHRA 3SG0A 3O82A 4RIGA 3KD3A 2IJGX 4JKIA 4R68A 4ND6A 4KUGA 3WISA 4Z4GA 1GUAA 4QU5A 1X7XB 1EXNA 3FR7A 1BVHA 1IAVA 4IXTA 1Z5PA 4R1NA 4UBOA 2NO1A 3KLOA 2MSEB 1M6VA 5LNK1 4IXDA 2B83A 2FFBA 2DWUA 3U1BA 1PG5A 2J5QA 1UM8A 4BCBA 1EH5A 1W8DA 1BMQA 1AQJA 4RLFA 3URMA 5FL3A 1VI6A 4CVNA 3JD4A 1ISSA 3I0ZA 3ONVA 4WFKA 5KOIA 3QLVA 5DO9A 5AW8A 4HX5A 3MCTA 4ZCPA 3NONA 2VRWA 1WW2A 1U3CA 3ONDA 2IZZA 7MHTA 1DC6A 4C05A 5CIWA 3Q7SA 4CIXA 1YMUA 1EUDB 5KNDH 4PYLA 3RFFA 1E3WB 3UA3A 2HLDA 3UMBA 3AI7A 2VXBA 3D2BA 3LT0A 2Q2VA 3ZI7A 3R7BA 1FZQA 2BTEA 2YHSA 4AIIA 2Y0QA 2HDWA 1NAIA 3CLKA 2XTZA 4OQXA 3WB2A 2A58A 3NBAA 4NQZA 3NHZA 4MCIA 1R88A 1DXYA 2BFNA 3DB2A 1IXYA 1Q0UA 1S4QA 4M36A 2TMDA 4FJ2A 3KQYA 1YZKA 4MCJA 3WWCA 4JC0A 2QYTA 3JRWA 2W6QA 4M4SA 4NZZA 5H4HA 3RS0A 3TPZA 3EX7C 3OZCA 3TLGA 4G1MB 1ZSNA 2I87A 3ND5A 1PKEA 1SUPA 2AG6A 4F2DA 3PFNA 3ED5A 5EZ5A 4ARAA 4NPCA 4RF2A 3LIPA 2M6RA 1RRGA 4ZOLA 3O1HB 4YQYA 2COEA 2KPOA 1EVIA 3CKLA 4ZO7A 2EEZA 2XYRA 1NUAA 1ENPA 3JZAA 2DUNA 2ZSDA 4XARA 3HJBA 4J29A 3EZGA 4KZPA 3DMPA 3LSTA 3U0VA 1GEEA 3BFVA 1Y80A 3V4RA 4WUTA 5EQTA 1Y8QA 2QEQA 3CEMA 2QF7A 2CFTA 3NHFA 4OYHA 5K3FA 4X92A 3PIRA 1Y81A 4YRBA 4Q48A 1H69A 1U3TA 1DJMA 3DD5A 2ACEA 3P5BA 2NZUG 4MYHA 5CJJA 4ITUA 2JCBA 3E9CA 2KA6B 1CNFA 4MITA 1ZM2A 4W1QA 2R6JA 4R1QA 3WQHA 2OOAA 2F5QA 1E6LA 4RHUA 3H5AA 5BSGA 2JCYA 2BGLA 2AOTA 2WIFA 4Z9XA 8GPBA 3EAGA 2OQ2A 4OXIA 5THKA 5HYVA 3GQBB 1SAYA 4Y2HA 3V76A 4G0UA 3TI9A 1S8FA 1PWEA 2ODNA 3HHEA 4PLPA 3LYHA 4DZTA 1OFUX 2WSLA 2VDPB 4A8HA 3EMKA 2I33A 4CM4A 2QZPA 3RGWS 5JS1A 2I9KA 4JJ6A 1M72A 1VMEA 1MJNA 4BMYA 2YXBA 3QVOA 1PUIA 4JVMA 3FGZA 4H17A 2BHLA 4Z9BA 2CDNA 2LNHC 1HE1C 1DG1G 1TZMA 1URPA 2R6GA 2BFPA 1LJUA 3M0EA 1HKUA 3MVEA 3G0IA 1BX1A 4NV1A 1ZQ1A 2FW8A 3D6JA 4OMFG 1GRRA 1UJ2A 3DMTA 3LQ4A 1XN1A 5BRAA 3R9IA 4CKBA 3VR2A 5KU7A 4O3FA 4EUNA 3AM3A 4CMEA 1QQWA 1FJGB 4OSPA 1NZDA 3OMLA 5FTLA 1CR2A 4WE3A 3OJCA 5DBIA 4BQQA 5A9SB 2Y3IA 1SOVA 4C0LA 1DHRA 2C2BA 2KM1A 2BDUA 3DWFA 3FOWA 2J07A 4UAGA 4JV5B 3S4YA 2H1CA 3TGPA 5CD9A 3GLGB 2VJOA 3V4ZA 2XEXA 2HV9A 1Z2NX 2DQZA 4YAIA 4TXLA 2A0XA 5AKXA 3T9CA 5KTOA 2PD3A 2B94A 1PWXA 4DIUA 2WIJA 5HIMA 1WSWA 4KE8A 4HZUB 5IBPA 5TJHA 3VHLB 3CLSD 3ZQKA 4YJKA 1SG0A 4NZNA 4ENPA 1FBNA 2ZJBA 1QG2A 1VBMA 5ALYA 1NXXA 3OZIA 4V0KA 5THXA 3L1UA 3F8TA 1EBBA 1SCUA 3T15A 4KPEC 2XA2A 1KI2A 4PNPA 2IYAA 2P11A 4JLMA 2OHOA 4EYSA 4EX7A 3HHZA 3HA5A 2EGHA 3UFXA 2GN6A 3ZDYB 4N4AA 1LF5A 1ZXBA 5LZ4A 4IDDA 1VJCA 1XCPA 3PJRA 2EYQA 3E9NA 3TR0A 3GRUA 5CGQB 3CLVA 2ZCJA 3JWHA 4P33A 4L8WB 1Z5WA 2Q1SA 2FMKA 3HZZA 2GFHA 3X1WA 2JP7A 4MI9A 3WGLA 4D4MA 1RLUA 5CA1F 4B83A 2QMQA 4REQB 1HG1A 4NRVA 2E6KA 3GCZA 1WE2A 5D1HA 4WLOA 4C88A 2OK7A 1QFXA 4QUEA 4R05A 4AKSA 1YJ8A 2WWVD 4G5XA 1N2EA 4BE9A 3ONWA 3K5IA 3L26A 1Y4UA 2XMRA 1OC4A 2I6FA 3P32A 2OILA 5BSUA 4JZYA 1E2FA 2ZPAA 3TLEA 4MVCA 4JT8A 2K7ZA 3TSAA 1ZH6A 1GAWA 1OIVA 1XCMA 3ZDXB 4ER0A 3D7RA 1MV5A 2B30A 4MULA 4Q03A 2J3QA 4OGGA 2G82A 2E18A 3UF0A 5AK6A 2V7EA 1G7CA 1ZN2A 1UKZA 5LQKA 3DBLB 5KWSA 2QORA 1P3QQ 4RFLA 1QCZA 2VDWB 4MEJA 2AT1A 2YV1A 3DT6A 4BJ1A 1U0SY 2LE0A 5AFSA 5TSDA 1HE2A 2IEZA 4F5ZA 1LA2A 4G9GA 2XNDA 3ZW7A 3MTGA 1HQKA 3T7RA 2XUDA 4Q9HA 4WFJA 1U1IA 4G4SO 4KE6A 1M8PA 1OHHD 2I71A 3QU4A 3K05A 2FQQA 1V1RA 4LK2A 4B3RM 4C7XA 3R9WA 1RABA 4PBSA 3QE3A 3KP0E 1YE3A 2X1MA 4EO9A 3JW8A 4H3HB 3VV2A 2RAPA 3V55A 3MK6A 2ZJ7A 5HUHA 2QY6A 2JHPA 3V4VB 4F06A 4C3VA 1F2DA 3T94A 1KY4A 5CPBA 1F3OA 4LN1A 5CLIA 4MEAA 4JI0M 2I3BA 4DR7M 1WVMA 3D8RA 3NW9A 1GTJ1 4AKGA 2H85A 3PPWA 4D6PA 4KXXA 1YZTA 3K1AB 2A9JA 4X6XA 4P34A 3SAVA 5CCDA 3L9WA 3GPYA 2X0EA 3LP6A 2NTEA 3B9BA 2GM4A 1RM3A 2J0UB 1FS6A 1S0UA 4S0XA 3BF8A 5KSOA 3VJMA 2NOAA 4BU1A 4UN2B 1UQRA 5CBKA 2H1IA 3TBFA 2A9QA 3SEFA 1SMKA 2NT3A 3NOXA 1CLUA 1N78A 3GGCA 3K4HA 2GMWA 2Y2UA 4O4IA 4XVCA 3DMDA 3QEOA 2Q8PA 1NNI1 4I1RA 3K8OE 1V6AA 5GIPE 1EK1A 5DSZA 3L0BA 1SBYA 4G09A 4K6KA 3ZS8A 1IAQA 1ZD5A 4N5IX 1RMTA 4YV0A 1OXTA 1SEVA 1FDRA 2RJ3A 5IH3A 1YBMA 3IKJA 4DMFA 1TJ3A 5DGTA 4KNVA 4DABA 3QEAZ 4LIPD 5DYYA 3AUAA 1H0RA 3A8TA 1TLFA 4KV7A 1C3JA 2Q45A 4GPBA 4DEXA 1ULBA 3M3PA 2NP6A 2OFPA 3C6KA 1A71A 1ZGBA 4JKYA 3RAFC 3RYCB 2AOVA 5E6SB 1T36A 2H8KA 1HLFA 3R5KA 1NM5C 4CL3A 1OU0A 3LAWA 2V7UA 1V16B 2JD2A 4IQ8A 3ZK9A 3GFSA 5KTMA 1UBEA 4CLRB 3JQ8A 5GP1A 1Y1RA 4O4JF 3S28A 3NIDB 4LMBA 1VIVA 3T3OA 4PC1A 3QBDA 4N54A 2X1VA 1EIZA 5EP4A 3UUWA 2PV0A 1CDOA 3I9FA 4BASA 1TCUA 2I2AA 3DMNA 2EL9A 4U7TB 1PLKA 3VHXA 3UJ8A 2XOEA 5JSHA 2JZCA 1SURA 3ABQB 3VKGA 4FGKA 2O1WA 1WUHS 3T1HB 1FDOA 3DW3X 3WK4A 4ZGBA 4WFIA 1X9HA 5ITSA 1P5RA 1PZGA 4BOYA 3QUCA 3TRIA 4ARBA 1WP4A 4NEQA 1SA0A 3LW8A 3DKKA 5BSWA 5J2TB 3K8QA 3HV0A 5F1PA 4PZDA 4Q1EA 3C6BA 4UEJA 4ZO8A 4CETA 2GSDA 2X8LA 3ETGA 1YTLA 1NW3A 3BUSA 2OBYA 1T8RA 1UFRA 2WF9A 4YUAA 2VHZA 5CLQA 5FFMA 3UGJA 4L57A 1FYVA 5HJ7A 4MRVA 2AEMA 2P2ZA 4DUPA 1W0CA 3C3EA 3IDQA 1DEAA 2CJXA 3GJ5A 4OW0A 1R00A 3P4UA 3PXEA 3LT4A 2H6EA 3LC0A 1IWPB 2QMYA 4NE9A 3EE6A 4YJ3F 5KYGA 2I1WA 1QFMA 4AG6A 2O5EA 3FGNA 3NETA 5JSQA 1XTIA 3QHQA 1AJEA 1C0PA 3F3KA 4U7FA 4HDNA 3UQZA 3T41A 2WDZA 1HDIA 1AB6A 5HKBA 2HK8A 1NY6A 2XMPA 2QN7A 4F8EA 3CLTC 5I47A 4J16A 3NBMA 4TM8A 2X9LA 1G17A 4EFMA 3HMQA 5AI5A 3EGEA 4LMAA 1TR8A 4FFBA 1V45E 3HHXA 4FUQA 1E98A 5DP1A 1M5RA 2IP1A 3B85A 1NMSA 3FYHA 4Z4CA 4KEAA 2J85A 4NQRA 1EJ0A 3T3DA 1SOUA 1PZNA 2APJA 3PHLA 1SBHA 1ZK4A 1RBZA 2WQ6A 1GADO 121PA 2DPHA 5ES3A 4AFNA 3SBOA 1C9YA 1WXDA 4LDZA 1IBCA 4AZWA 4H31A 4LYGA 1IEWA 1HYHA 3UJHA 5T3YA 4WD3A 5IT9A 4L6V6 1DAPA 5BORA 4BKMA 4WECA 4G25A 2AD5A 5EUBA 2ZZKA 3NTVA 3IO5A 4ZOQI 1DX6A 16PKA 5T6MA 4HVLA 2XZFA 3HUTA 3NHRA 2MHCA 3T6KA 4GZMA 3O75A 3TD6A 1B2RA 4LYAA 1JHQA 4UNSA 1J90A 1G6HA 1HT0A 1YIAA 4NBLA 3WHPA 1N0HA 2WAYA 2BFWA 2WIGA 3RSGA 1MQ9A 4YECA 3MXTA 2BP7B 3AR7A 5CG1A 1SB9A 3OQ1A 4WOPA 4EAQA 1ZRNA 2HMWA 4IDGA 3ZU5A 5HKAA 2OD9A 4DPKA 4PZYA 4LNHA 2C2HA 2CXQA 2Z6UA 2PH1A 4LRWA 2NO6A 4B3RB 3U81A 4BVFA 2WOOA 1X77A 4BNHA 5EWMB 3PUIA 3SQXA 5REQB 4ER6A 4WAUA 3R8CA 2K7FA 2G6BA 4URUR 2DUUA 2IF0A 4W9MC 2WUFA 4WFQA 3EN0A 2VVTA 4IH9A 1OJLA 1XJ5A 3THXB 1LWOA 4JI0B 1N92A 3OLQA 3MCZA 2DSNA 1PGQA 3SS8A 3I52A 4IBDA 1FVXA 1A5TA 2QRNA 5GONB 3Q9NA 3GP1A 2AZXA 2QZZA 3C5WP 4Q00A 4MWCA 4M8LA 1WCIB 4LXXA 1J0CA 2R4JA 3VR6H 2B82A 3HKDB 4MVYA 3KOMA 4IWYA 4L5BA 3KS4A 3IH5A 4IMPA 2OSBA 3FUWA 2C5GA 2AE1A 1I2ZA 4PIVA 3CONA 4MWGA 3I32A 2HA4A 1H2ZA 4Q4JA 1XDBA 1HXHA 2Q8QA 3ICCA 3ZLVA 2Q4TA 5P21A 4ND5A 1KMQA 1XJQA 2JIPA 4H1UA 5KX5F 1HDEA 2IL1A 3HBFA 2GO1A 3K0FA 2ZI6A 4KXYA 4BN5A 3P26A 2IYPA 1G20A 4TT8A 2XKKA 3C6ZA 1S2IA 3ZNNA 5FWNA 2BKAA 1W36C 3QYFA 2YNMD 4JT4A 2VT6A 4KNYA 4UKDA 5IKOA 5EKXA 3V5NA 4ODIA 3LX4A 1LQ2A 4TZ6A 3WTBA 4QBGB 3GT7A 4OXNA 4Z0HO 3VMFA 2W22A 3B1VA 2E2WA 1JXMA 3LUBA 5A06A 4NPAA 1Y8ZA 4OV6B 3W5AA 3M5WA 3M6VA 4IQ4A 4JJGA 5DFAA 3EPJA 3OWHA 2CJWB 2BDEA 3OJLA 3KUUA 2YQ4A 1G55A 4R1MA 5C81A 3SQWA 4E5MA 1DIBA 1O89A 5KVVA 1NC3A 2HGSA 2PNFA 2F43B 2RHOA 4DXHA 1BEEA 3CM0A 2C8LA 2P4SA 4DSTA 4N3GA 4KO1S 1LBQA 4PVDA 1DV1A 4WURA 2JJ2D 4NMWA 5HW0A 1LV8A 1Y3CE 4D8WA 3FZYA 3V1YA 1KYXA 3FKSD 1S6YA 2YDXA 4MA0A 2CSUA 2X7HA 1GABA 3K0BA 5TQVA 4N9WA 3C2QA 3W8EA 1V9CA 2G9VA 1HPLA 1XHLA 4JUAA 5H3CA 1M7HA 4C43A 1RKVA 3LUFA 2XNSA 4IV5A 1Z59A 3P52A 3F6YA 5FSWA 2IQIA 5ALZA 5B4VA 3CNNA 1E3TA 1XP8A 3K1TA 4B3IA 1W9MA 2Q5CA 1TEVA 4CF6A 2VP6A 2NSDA 4AG3A 4B71A 1Q3BA 3W8NA 5HEKA 2DZOB 4Y6PA 1Y7PA 1N4DA 1Y6FA 3A42A 1C9MA 2RGNC 4DLWA 4UHHA 4CW7A 2Z4SA 4JBIA 3OHSX 3ANYB 3B82A 5HK9A 1O95D 1J7KA 1WZNA 1PNVA 3DONA 2BGJA 1NBWB 3IR7A 3GJ3A 1W2GA 2LCQA 2O8EB 2QRKA 4RPCA 4KQKA 4KUEA 4PFKA 3KAKA 3ANLA 3VR6A 2QBYA 2O07A 4P0QB 2W6NA 2C9MA 2IDJA 2PT6A 3CO0S 5BNWA 3NRCA 2LWIA 1O7JA 4I1YA 2EF1A 4TT3A 2X5OA 3EG9B 3PWZA 2AMYA 2QSZA 3GI1A 2BMJA 4ASUD 5AIBA 4RAQA 3EF3A 3HKCA 1MB3A 4BO1A 2IE8A 1DLIA 4LNUA 1C4OA 4M1MA 5DDIP 3OEED 4QOGA 5C7OO 5MGBA 4NZPA 2QUZA 3AZQA 4Y6LA 4EVQA 3IESA 4RJ2A 4BEJA 5CG2A 5EKSA 2OHGA 4LHYA 4LDQA 3QVWA 3BC1A 4ZDJA 2XE4A 2O7NA 1HDZA 3GL9A 1DZIA 2JDID 1TMYA 5E3JA 1QR2A 1JKIA 5FA5A 5K20A 1MN6A 1J8DA 1KO4A 3EY9A 4PBTA 4JLPA 4YP1A 4YTEA 3HXPA 3KUXA 1QK4A 4NYIR 1MB4A 1Z7WA 5TC4A 1JWBB 2EVWX 3L6DA 3OSUA 2C96A 4R5HA 2DR0A 5K8IA 1VG0B 3W5SA 1RC8A 2D5CA 1VL6A 2JLZA 2ICAA 3ADOA 3NVAA 1B00A 1NJ2A 5JI2E 3G0OA 2B1GA 1ZO8A 3CYFA 3IPCA 1WNTA 2PM8A 5AM0A 1D5WA 1IG0A 1FQWA 3DA1A 5JD6A 1FFEA 5CFLA 2P69A 4FHZA 3IOEA 4X90A 3SEZA 2GXQA 3FRHA 5FOVA 2KHHA 1XPJA 8AT1A 5B53A 3KFVA 1O58A 2MR9A 2GZ1A 4RE6A 3VTKA 1PFYA 4S1PA 4LHEA 2WSSA 3TCKA 1ZUWA 1SK8A 4RSMA 2P40A 3B8HA 4LOAA 3JR7A 4L4YA 3B53X 3TWOA 1A9YA 3UNXA 4HDRB 1VHQA 1XTPA 4LXYA 1VRWA 4L0MA 4BO0A 2GPNA 5ES4B 1W49A 4ZVKA 4ARVA 2QTAA 4F2HA 3NRJA 1L7VC 3U48A 1IRXA 2OM6A 2G72A 1EX7A 4HI0E 4CM9D 3VR5H 1BDHA 1W88A 4PCAA 4X8MA 3PEWA 1S1CA 5ED4A 1Z88A 1WPGA 1B43A 1NXOA 3MUFA 3WYGA 3NDBB 1VZ3A 4R3NA 4PIMA 1EG7A 4Q39A 1IM2A 2OZLA 3WFJA 1NXSA 1K4YA 4XQEA 2PYIA 4IILA 2BMAA 2RDMA 2EFHB 1DKLA 2VRBA 3SBJA 4HWTA 3OFND 3UB4A 3CVVA 4OHWA 3MWDB 1JR3A 1OKKA 4DLZA 1D0KA 2EKFA 3F6PA 1MG5A 5BQXA 1Q7BA 5KCZA 3UJAA 1CR1A 5CXQA 1Q3HA 3FF4A 1IATA 1ORVA 4U2DA 4MMZB 3U7JA 5I8ZA 4FVTA 2IOQA 1YIOA 4D8YA 3JWEA 5CLGA 1RYEA 5ARBA 4TMFA 2GKOA 4WKGA 3PGLA 1IOZA 3AIOA 1YO6A 4TQGA 5B1DA 4ZCRA 3W5IA 4GX2A 2NUAA 2MYUA 2H5JA 4HH0A 1RLMA 4BO7A 1E5QA 2XZOA 1JFFA 3PL5A 3WL4A 5IJWA 1HSZA 2R7AA 2D4AA 1UZLA 1X94A 1NLZA 4HAUA 1NFFA 2BN4A 4J0EA 2RKBA 4G0YA 5G4KA 5IKXA 3CVWA 1LDEA 5CFZA 3M6LA 5IK2A 1RLJA 5C8XA 3WMGA 2WKRA 4N5MA 1AXEA 5AQ1A 1SZCA 4TMYA 3W79A 4D9NA 2V8BA 4M0PA 5A4MS 1HLPA 3AVPA 1KIAA 1ABEA 2ZSFA 3SK0A 2BDTA 3QPAA 5EJ6A 1NG9A 1Z22A 2RBEA 3M4XA 2MH8A 1MEJA 4JXXA 4L7VA 3ZWXA 1E32A 4MRMA 3SOPA 4UATA 4UHCA 2GXUA 2WNIA 3KB2A 4NJOA 2YJ5A 1FSGA 1U3FA 1KR2A 5D51S 4OHBA 3GQ4A 1V37A 2XHZA 4CUJA 1JEOA 3C3JA 4DBLE 3UA4A 2C4WA 2GJAA 5T8KC 1Y1QA 1QOQB 4FW9A 2C4HA 4GRAA 3P9CA 1QO7A 2OEPA 3K8ZA 2NVOA 3OE7A 2Z5VA 2I34A 2ZRIA 2WZJA 3NJ4A 4LDNA 1ISHA 3JWJA 2P27A 1Z45A 1Y3BE 2ZM5A 5EJGA 5ENDA 3HR8A 5FXMA 1M1YE 1V1MB 3W7AA 1FQOA 4H6PA 4Y98A 1N0UA 2MDTA 2IYVA 1YFKA 4TMXA 3ZDRA 2Y0PA 2D2EA 5BWNA 3QELA 5B57C 4CODB 1G8MA 4NSNA 3WV5A 4FFMA 2PCJA 2NU9B 4J7XA 2XKJE 4AQDA 3IB3A 4UREA 4Y9UA 3AEYA 4OI1A 1KZ1A 4NF2A 2D59A 3ZCXA 4B7ZA 3GLFE 3DKRA 4OOEA 3MBKA 4OX9M 1N8TA 2XD4A 3LUHA 3BE6A 4QUBA 3ZIAD 4WLNA 3A3OA 4Z1OA 4BDTA 3DT8A 3LA6A 1HQYE 3OM0A 2ZJZA 4NLLA 4RTMA 3T5BA 2ZRFA 1E79D 1K89A 2PT7A 5TGDA 3QW4B 5IJ9A 3IXQA 4IDFA 2B8EA 4B34A 5E1MA 5EESA 3SN6A 5KYKA 5G4LA 2X7XA 1XRQA 5HOEA 5BSFA 3ZVRA 4BKPA 1U31A 5BW8A 5J9FA 2L7IA 3IT3A 3SBDA 1ZIYA 3NJ8A 4URZR 5IHXA 1QTIA 2DUJA 3MOGA 2P5UA 4KMOA 1WA5A 4HNSA 1XTTA 5IRCD 4ZEMA 1O6ZA 4GWGA 5IDXA 5LP6C 1CUVA 2PR7A 3OZBA 3V9PA 4C1NA 4ZVMA 1QGZA 2ZAOA 2PKQP 2PS1A 4WL0A 1KP3A 1WB6A 4TYNA 3T1OA 3VZQA 5FB3A 4XX1A 3ZD6A 1VB3A 1DAMA 4CI9A 2HRCA 4FC6A 5G1PA 3W6PA 5HZKA 1KSFX 4LJAA 3DW1X 1LS1A 3IP1A 4WNAA 1YDEA 2AYZA 3ZHZA 2EJVA 4GXTA 4YDSA 2JFYA 5FLEX 4OLJA 2VA9A 4LZPA 1GUFA 2VQEM 4AAYA 1U04A 5A71A 2I4RA 4OUDA 3HCCA 1VDMA 4XWOA 1LVUA 1PR4A 4F12A 2IW1A 2DKNA 3ZWPA 4AUNA 3L8CA 1XP5A 2FSSA 2HJ9A 1CB0A 1QUEA 2PFKA 3U6BA 1PAUA 1VE5A 3QFFA 5G41A 2CDCA 4AX4A 4KXMA 3OE4A 1T6XA 1W76A 2JD1A 1H0SA 1XHEA 5DWQA 4Q4DA 5DBGA 2E5FA 2HSZA 3FVWA 3VO9A 3TIVA 5KQPA 2Z30A 3H5RA 1IB6A 4DJTA 4KX5A 3U4MA 1EEHA 3BWBA 1E2PA 2QU8A 4LY9A 1DHTA 2PZBA 4JJIA 1QLJA 3L8EA 3BMOB 4M8SA 1LPAB 1J07A 2HJWA 4D02A 4KG7A 2QJWA 2FLWA 2J5BA 5B58C 5A3VA 5EZSA 3D6HA 3PHJA 1T9AA 4MQFB 4V3CA 2J31A 3UHJA 1I32A 2IIBA 2IYXA 2IW3A 6CHYA 1KWKA 5E0OA 2ZUBA 3HM2A 3S1AB 5J4LA 4TLBA 2JDIA 2WSCF 2AN9A 1ZGJA 3FCCA 4NXNM 4OX9Y 4RGYA 5BUZA 1F2VA 2HRZA 1G8PA 4MW7A 3R7WA 1XVIA 1QC5A 5F3WB 1YJXA 1VGQA 1HEIA 2HO5A 4HRXA 1NVDA 3JR3A 1ONPA 2ZSHA 5MN6A 5FJJA 1SZPA 4BUJA 1K3WA 5DX1A 4G8JA 4LKRA 1T15A 2L2DA 1SD5A 5D84A 2V55B 4RC9A 4I55B 2WJHA 3DHNA 2OSVA 4JA2A 4N5NA 4Y7CA 2QX9A 1SPXA 2G63A 3WNBA 4KR6A 2DT8A 3U6EA 4TUWA 4OJTA 1YRWA 4LVCA 2BY4A 4U2CA 2IODA 4U0JA 1YVDA 1OAIA 3QPDA 4K9PA 4EP1A 1Q11A 1FP4A 2UVPB 2NN3C 1BH6A 2RAFA 2ZWIA 3FJYA 2ZI3A 4LF6M 1BQEA 3HJUA 3HGMA 3MTJA 1MLDA 2YC4C 1K9SA 4MV7A 4H7EA 1DDIA 2OTCA 7AT1A 3IBCA 3WA6A 2P2GA 2CJPA 1GZ5A 1AKTA 2OMEA 2HO4A 1R16A 1IVYA 3M4YA 2B99A 5MHTA 2V7VA 1IN5A 2QLLA 3KOOA 2R5NA 3TNYA 4IX9A 2XHEA 1E2JA 5TRTA 4PQEA 3SXUB 1CBUA 1F0YA 2E4AA 4AJOA 3FOCA 3GRVA 5K0ZA 1Y3FE 3ICVA 2WY2D 1G5PA 3DOHA 1H93A 1ST2A 2FETA 3PYLA 2P5TB 3QXXA 1NQAO 3KHUA 1HNXB 1VSBA 2R47A 2QS9A 3A4TA 1I0ZA 1U8EA 3TLZA 2PLNA 3UWOA 2IS6A 4ZAYA 1GGMA 1L5QA 2ZQYA 5L51A 2EW1A 1U81A 2O1EA 1VLHA 1C4XA 1WY5A 1TEXA 3V7NA 2P3SA 1BEUB 4PGHA 4M0EA 3U4DA 4FMDF 3VSDA 4ND2A 4Q9KA 2ILTA 3JQPA 1X7HA 3CH7A 2QUHA 2BCGY 4R2LA 3ORHA 4OF4A 1EX6A 3RGGA 2P1RA 4ZCLA 1Y42X 2QTTA 3QYJA 5FUQA 4BO2A 2G4VA 3K31A 1ZCBA 3OVMA 4KN5A 1QORA 3Q5DA 4IHJB 3QUBA 1PFKA 1IMJA 1V4BA 4GBGA 2NZWA 3IEMA 1PVVA 2FR0A 5LZ5A 1GCGA 2EBHX 5BOVA 4EPXA 3DCYA 3E9RA 3RE8A 3HEMA 3B3JA 2V9PA 3JQDA 4HWPA 2ZANA 1SKYB 2LCFA 1U8ZA 2GRAA 1OIPA 5F35A 2PWYA 4Y6RA 1FFYA 1XROA 1KQNA 2P6RA 3H3JA 3K0AA 1XZGA 3ZD7A 2XUKA 1QFZA 4UE6A 2AZDA 3ZHUA 1VIDA 1YB1A 3Q8LA 4LVOA 4GOMD 4Q05A 1FP7A 5JZ9A 3LPMA 1KIMA 5TF0A 1HR0B 1DARA 2G25A 4G0OA 2L4FA 3E7PA 3WIVA 4XGIA 5K6AC 4M49A 1UJNA 5H82A 3L2OB 3AF1A 3PX2A 4MUIA 3V1KA 3EXHC 3LL4A 4R9RA 3NTXA 2KDLA 4O4JA 2PXCA 4P5PA 1X15A 2XXBA 2E4VA 2JL1A 2VNHA 3C7TA 2VHUA 2O5RA 3LUPA 5KINB 3V1TC 3K9HA 3WSVA 4AM8A 1FA9A 3IUPA 4L16A 3P0FA 1GQSA 2YOHA 1GQ2A 2QTVA 1IZ9A 5LL6P 3OIWA 2VQEB 1H2FA 1O0SA 1V33A 4YVFA 2ZJAA 1OJ7A 1OBOA 4X61A 4EG1A 5BW5A 4EKEA 1D0VA 1D0IA 1NXTA 4CLDA 2XNKA 2PGJA 5CB4F 4E1VA 3L79A 1UWVA 4KPUB 3AJAA 4KAXA 2RH5A 3BPSA 5KWIA 4BIMA 5DN6A 1ADCA 3ILSA 3UB2A 4KIUA 1CF9A 2X13A 1DQNA 3OQVA 2A0UA 1TDJA 2W6CX 4A26A 5A04A 1L8LA 2PKYX 4Z86A 3MGBA 1HNZM 2W42A 3BHMA 4BZPA 3I34X 2A9PA 3QYPA 3NPAA 4E09A 3NC4A 4MV4A 2PBLA 4TMKA 2QTGA 1AA9A 3U5ZB 1AS2A 4KE9A 2HJSA 5TLSA 5BOSB 2OHIA 3RG8A 1PW7A 4PX2A 5IXSA 3CN7A 2D5LA 4Q0MA 5FOTA 3K6JA 4JX9A 3TW6A 3ZWNA 5LR6A 2CZGA 4AQYM 3BSWA 2BE7A 1Z7BA 4OIFA 3DPUA 4HXFB 2XUPA 3F6RA 4PZPA 4CM7A 1DTWB 3KOXA 3V8NA 1MVOA 2YMPA 4XYEA 4ENUA 5ICMA 2AC7A 5FH9A 4UXHA 3RFCA 1JHUA 2CSXA 5HCNA 3E4DA 1WGLA 2BHTA 4ZCSA 1XZAA 4FE3A 1CJKC 2CMGA 3RYIB 1O6CA 1PL0A 1TX4B 1Y4AE 3OFSA 2D00A 3DMGA 3SC2B 4DLBA 2E0IA 4CMGA 3QFTA 5J2UA 3B3AA 4QRIA 2QAJA 3DFIA 1BYUA 4JITA 4FFPA 1KETA 3VR4A 2Q2WA 4G8DA 4V2IA 1ZESA 3N59A 1CDDA 2DHCA 3KQMA 2OO5C 1Z4LA 1M6WA 4YMIA 1TTTA 3GFOA 2Q9AA 2WVAA 4WVFA 3WYDA 3ZXUB 3R8FA 3R6WA 4GVPA 3ZCVA 2QLJA 3VR1A 2EXXA 3OJXA 3AHGA 3HCAA 2SICE 4LF6B 1EXDA 3DQZA 4V2UA 1WF3A 1GARA 2ZP1A 4QD3A 1E2GA 2VHCA 2INGX 3P45A 3LQKA 4QOSA 4I9GA 5KVSA 3K70B 4PBRA 3QTLA 1OX4A 5HNKA 5KJ6A 3PXAA 5SY9A 1WHCA 4REOA 1GCAA 1PNRA 1EAMA 1Q1EA 3N8HA 2R87A 4GZ3A 4UHKA 5U4XA 3A28A 1EM8A 2FA9A 2K4MA 1Q83A 3BRSA 5BWOA 3STHA 2QGFA 1R0RE 3NAGA 5BSTA 1HNWB 1M73E 3EFHA 1RXYA 4EMBA 3OF3A 2ISQA 3WL3A 3IOCA 4HSEA 2BISA 2IOFK 3PQ4A 2H59A 3KPJA 3ER6A 1SVKA 2KYRA 5F2NA 1ATZA 1GZ7A 4R6XA 3Q7RA 2CLOB 3V7YA 5THQA 1RJFA 4XR9A 3K71B 5K4GA 4BBPA 4I50F 2CVOA 3K1JA 1VGVA 1Z74A 1MAUA 4RPHA 4FC7A 4W7IA 3B6IA 4RORA 2Q3DA 1Y7TA 4GXRA 5J4YA 3G2QA 2BTQA 3KSUA 3PSHA 4H1WA 4KR2A 1A5BB 4CM3A 5DPMA 5MFPA 4S2EA 3KQUA 3P2JA 2ZS7A 4ZZ0A 2YINC 3MTIA 4Y1GA 2H7YA 2PO5A 3RAGA 3DXXA 1BNCA 1U3UA 1NYRA 1KMIY 4D9MA 3RTCA 4X65B 1THTA 1ECPA 4GWLA 4P08A 2E87A 3RAEC 4G0XA 4WJLA 3D64A 3WHLA 4RKYA 4M9RA 2ERXA 3F9CA 2F00A 3JQRA 4CKEB 5J5AA 1E2BA 2JANA 3RANA 1LZKA 3CTPA