3AOEC

Crystal structure of hetero-hexameric glutamate dehydrogenase from thermus thermophilus (leu bound form)
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
417
structure length
417
Chain Sequence
LKAYRPPEDPGLWDTYLEWLERALKVAGVHPTTLEYLAHPKRLVTLSLPVVMDDGKVRIFQGYRVVHDIARGPAKGGVRLDPGVTLGQTAGLAAWMTLKAAVYDLPFGGAAGGIAVDPKGLSPQELERLVRRYTAELVGLIGPDSDILGPDLGADQQVMAWIMDTYSMTVGSTVPGVVTGKPHALGGSEGRDDAAGLGALLVLEALAKRRGLDLRGARVVVQGLGQVGAAVALHAERLGMRVVAVATSMGGMYAPEGLDVAEVLSAYEATGSLPRLDLAPEEVFGLEAEVLVLAAREGALDGDRARQVQAQAVVEVANFGLNPEAEAYLLGKGALVVPDLLSGGGGLLASYLEWVQDLNMFFWSPEEVRERFETRVARVVDAVCRRAERGGLDLRMGALALALERLDEATRLRGVYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An unique allosteric regulation revealed by hetero-hexameric glutamate dehydrogenase from Thermus thermophilus
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords Glutamate dehydrogenase
total genus 144
structure length 417
sequence length 417
chains with identical sequence D, E, F
ec nomenclature ec 1.4.1.3: Glutamate dehydrogenase (NAD(P)(+)).
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00208 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine dehydrogenase
C PF02812 ELFV_dehydrog_N Glu/Leu/Phe/Val dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1210 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3aoeC01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3aoeC03
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 3aoeC02
1YBMA 4A26A 5JAZA 4IXWA 4BNUA 2HMVA 3H7AA 4NU5A 2OP1A 5IN5A 3TZ6A 1QG6A 1GV1A 5A9SA 1AHHA 5BSEA 9LDTA 2GN4A 1X7GA 2FSVA 1SO8A 2DFVA 1C3VA 1GV0A 1HT0A 1U28A 2RBEA 1ZVMA 3D5TA 4UREA 5I9LA 1PGNA 3KBOA 5KTKA 1KVQA 1N5DA 4PN3A 4RPGA 1R4NB 3DR3A 1LRKA 3HFGA 2IODA 3F1KA 3DHYA 3JD2A 4RVDA 4U5QA 1H6DA 3CSDA 5EJ2A 1VL0A 3FRJA 3BMNA 3AK4A 3O26A 2AEMA 3PHGA 4PLFA 1LU9A 4ZQGA 3RUDA 4YJGA 5JCJA 1KEUA 1O6ZA 2BFAA 5TT1A 3WBFA 1AXGA 3ONDA 1E1LA 1HDCA 1MUUA 1GFSA 1WP4A 2DC1A 4J2OA 3S8MA 4H16A 3VAZA 2NTVA 3G0OA 4WCDA 5J23A 1YVEI 1LSSA 3CUKA 4J3FA 1UXJA 4PG4A 2D4AA 2Y05A 2O2SA 3ZCXA 4E13A 5A02A 2HMSA 4LGVA 2JHFA 3LF1A 2ZB3A 2JJYA 1NQ5A 4NHEA 4ZQHA 1GCUA 3RUHA 1A4UA 2VTDA 1Y7TA 4IPTA 4K6CA 1U7TA 2FSSA 2NU9A 3GN1A 4DLLA 2P9GA 3W4JA 5K6AA 3GHHA 4BKQA 3KHUA 2VNAA 3KLPX 5BSGA 3JQEA 4GWGA 4LISA 4Y9DA 5GZ1A 1EFKA 4BKUA 2GRAA 4GLLA 1QR6A 3OETA 3OH8A 1PGPA 2PFGA 4HWKA 1TXGA 4ALLA 5KKCA 4MIOA 1PZHA 3KB6A 3KYCA 4Z3KA 2X58A 1QYXA 1MG0A 3MJTA 5I7EA 1E7WA 4PLZA 3PWSA 3KV3O 4EGFA 4B7UA 1M6WA 4GX2A 5G4KB 4RVSA 3FTPA 4WOJA 4NNJA 5TX7A 2QRJA 3PDUA 4JGBA 4AICA 4F3YA 1SEPA 3KOUA 2IE0A 4DQUA 1SPXA 4XD2A 2ZB8A 3TZQA 3MOIA 3RC9A 1LLUA 4CR8A 3V1UA 4DYVA 2W4QA 3GZNB 1BHSA 3O38A 2LDXA 3WGOA 1LEHA 2X0JA 4QT0A 2NU7A 4YTEA 2GPTA 1DIBA 4YJHB 4ND2A 3GA0A 5A9RA 3OP4A 1SOWA 2NU8A 3QHAA 4Q3CA 4YT5A 3RFVA 5DDIP 4FJ2A 5JXWA 5ILGA 2F1KA 3GDOA 3K8ZA 3PGJA 2WYVA 5DN9A 3RC2A 2DUUA 4WEQA 3I9OA 3OM9A 3MTJA 3NTRA 4IIUA 1HDOA 3PQDA 4WCFB 5LC1A 3WNQA 4E33A 1QMGA 1LBEA 5TGDA 5A9SB 4TKMA 2VYNA 1VE9A 4MIYA 2UAGA 5C3MA 1B3RA 1EVZA 4GQAA 4J9UE 3L77A 2O23A 3PHIA 2CUKA 3KSUA 4PLYA 3NT2A 5IZCA 3WB9A 5CG1A 1WPQA 4R9RA 1DIAA 5G0UA 1G0NA 3Q9UA 4B8WA 4C7KA 1HE4A 1JDJA 2Y1GA 1IZ9A 4HXYA 5IZ4A 4OAQA 1J4AA 4RO0A 3V5NA 5T5QA 1P1RA 5AXDA 1CERA 4GBJA 4RJTA 3R0IA 2VHWA 4YJGB 4G81A 3ONEA 4Z0HO 4OKIA 5I8WA 3ROPA 1DHTA 1LLCA 3FTNA 3QV1A 2Q3EA 1L7DA 3TZHA 1RM3A 3RUCA 1H6AA 4O63O 1UXHA 5L3ZA 1I2BA 4W9NC 2WM3A 3TZCA 1ZK2A 2ZQYA 3H5RA 4BMVA 2YV1A 1LDGA 2FMUA 4CMCA 5L4LA 4BNTA 3HE3A 2NADA 4IINA 5A9TA 3TQHA 4XQ9A 4TROA 4PRLA 4NFHA 1KY5A 4CM1A 4ZVVA 2ZQZA 5HS6A 1HKUA 4XRRA 4BB5A 1VSVA 3V1YA 2VN8A 4S1VA 2A92A 4QFDA 3TDKA 3L9XA 3GPIA 4YXFA 2W98A 3KYCB 3OQBA 4XQEA 3DBLB 4D7AA 4KQXA 3IP1A 2I5PO 2HK9A 3GVXA 3CMCO 2O3QA 3KRTA 4IJUA 3UF0A 2O4UX 1HLDA 4IUYA 4CM4B 2NVWA 3ITKA 4J7XA 1Z75A 1PJ3A 2YHIA 1VJTA 3MJ4A 1DRUA 4I5GA 1MC4A 4YR9A 3KSZO 2WEKA 3W4KA 3M2PA 4HFRA 3H2ZA 4BO8A 4RF3A 1ZSYA 1Y5RA 1ZO8A 4XX0A 3UW3A 1K6JA 3CE6A 5FI5A 4PLPA 3GHYA 1EK5A 1ZKMA 1GU7A 4E5NA 2Q99A 3D4NA 5H83A 4CUJA 3ON5A 5I9NA 1I24A 3GAFA 3VPHA 4GVXA 1KYQA 4RF2A 1N1EA 1ZEJA 3BHMA 3AU9A 3F9IA 1Z6ZA 1WW8A 2J3JA 1I30A 2PR2A 3T4EA 3ROKA 4NBVA 4L75A 4PLGA 4I08A 4N5MA 3RKRA 1I8TA 3WR5A 3TJRA 3K30A 4NBWA 3U62A 4CM3A 4H3VA 4FGSA 1UAGA 2EV9A 1GZ6A 1PS9A 2EXXA 3G1UA 1XU7A 5JLAA 3JQAD 4Y8VA 1WDMA 1YL6A 4M54A 4A27A 4A7PA 3S2IA 4I5EA 3L6DA 3X2EA 3GLQA 3LSYA 3M2TA 4DREA 2C7VA 4NDNE 1S6YA 3O8QA 2VUUA 1QV7A 3JQ7A 2NTNA 4FW8A 1IL0A 2DBZA 5B4VA 1HETA 1BW9A 3QVSA 3QVTA 2I3AA 4MKXA 3SLGA 5FI3A 2Z95A 3WOHA 3IOYA 1Z82A 1LTHR 4MJLA 5IFLA 2JL1A 4LVUA 1BGVA 4J91A 4XR4A 3RBVA 1TVEA 3QWAA 2EGHA 5ITVA 4WCFC 1DO8A 3JQ8A 2GASA 5BSHA 2FRDA 2GF2A 4UUMA 3ETDA 2XF8A 5A06A 2JAHA 2PKQO 4OIMA 4QECA 3DOJA 1M75A 1S7CA 1XELA 4NI5A 5A5EA 4IZIA 5CEEA 4QFCA 3Q0EA 4MVJD 4AJJA 4WKGA 1W8DA 3IMFA 1T2DA 4B3IA 3HNPA 1HXHA 4P4NA 1I2ZA 2XXJA 5ADHA 5IDXA 5JW6A 1CRWG 4BQPA 2CDBA 1WDKA 3P5SA 3ZV4A 2XPCA 1PS0A 3BMOB 1T2FA 3IDSA 4YEDA 5C37A 4IQ8A 4IGFA 1LSUA 5TC4A 2ZYAA 1ENZA 4J43A 2UUOA 2GLXA 2V6MA 3QE3A 2YZ7A 1X13A 4CLOA 1ADFA 2ZTMA 1ZXLA 1H93A 4R5MA 2NWQA 3GRKA 1R12A 3KYBA 1GQ2A 3ASUA 2AG5A 3FN4A 2CDAA 1OZAA 1UZMA 4ESOA 4MVJE 2X22A 4J6FA 3U0BA 3L6OO 2NU6A 3RU9A 1FDWA 4RPJA 1ZNQO 2EF1A 5C7IO 4RF5A 3ZU2A 3JQBA 5F1KA 1T26A 1N92A 2VRBA 5A4DA 1LRLA 2PGDA 3STHA 4CM4A 3GUCA 3GRPA 1X14A 2VWGA 3HZZA 3DZIA 2C0CA 1LC3A 5F1OA 5FYDA 4DIOA 1YXMA 3AOEC 1K0UA 2X5JO 4I5FA 1LX6A 4E32A 2WE8A 3LVFO 4BHTA 4PLVA 2EG9A 1A27A 5IN4A 1HZZA 2BLLA 2PGLA 1DIGA 3ZI0A 5B4TA 4HNHA 1BWSA 3WSWA 3RUFA 3ZWNA 4YJDA 2C7GA 3CZRA 2J5QA 3HDJA 1XR3A 2JHGA 4H7PA 2B0JA 4MOWA 4J1TA 4GGOA 4Z9YA 4WLOA 4HFMA 1LDBA 1T24A 1OBFO 3F47A 4O59O 4YBZA 3OMLA 1E7QA 1WXDA 3INTA 1YBVA 3I6IA 1YB4A 4F6CA 4MP8A 1C1XB 2AA3A 4XWYA 1YS4A 1NYTA 3UGKA 1H5QA 3NDJA 1ZK4A 4A2CA 3H9GA 3E18A 4ALNA 3ONFA 2AW5A 4XB1A 4CQMD 3HFSA 4D45A 1Y81A 5JYDA 3B1KA 2JD0A 1MG5A 4WASA 4MP6A 3HSKA 4BGEA 1V0JA 5A3VA 1GZ3A 2XOXA 4B4OA 4BV9A 3WYEA 3AY3A 4TQGA 3DBHB 4FIZA 2Q2WA 5JAQA 1PWXA 2ZIZA 2P5YA 5L4NA 3ORFA 4U7WA 3ZH2A 4LVCA 3PJFA 5KJ6A 2NQTA 2OUIA 4DBZA 1AUPA 1I3MA 4NFSA 5BNTA 1PZFA 5KNLA 4M87A 3I5MA 1HDGO 1JVSA 5DCWA 4IS3A 1E3EA 1E7MA 2Q2VA 3CTMA 3F4LA 3I9LA 3K31A 3LT1A 4CLDA 4BNZA 1O89A 2RHRA 1ONNA 1F17A 2TMGA 1UDCA 4JIGA 4WEOA 3C7CB 3VPFA 1EQ2A 3ABIA 1GYRA 4M86A 2I65A 3GMDA 1EBUA 3QJ5A 3OEWA 2QG4A 3GT0A 4RCVA 2QW8A 3X2FA 4UULA 3GC6A 4FB5A 1ISIA 3OA2A 4LCJA 4GPD1 1VL8A 1VRWA 2UYYA 3GEGA 4KZPA 5I7VA 2H6EA 4XA8A 4PZDA 4Y67A 4CMAA 1YQXA 4D46A 3ICPA 4WNIA 1CWUA 1G0OA 1ISJA 1T1RA 2B83A 4E30A 3ITDA 4ZA2A 1NAIA 4IXTA 4YCAA 3WICA 4EBFA 3DTYA 5CFZA 2HCTA 4BB6A 2Y1OA 3I3OA 4E2YA 1RYEA 3IUPA 4IDGA 1OFGA 4CUKA 3FSRA 1XSEA 4OOEA 1MFZA 2DPGA 4Z0TA 1F12A 1KEVA 4CMEC 3V2HA 1H2HA 1O5IA 4TVOA 2JKVA 1K5HA 5JYEA 5CP8A 1ZK0A 2Q46A 5TRTA 3PYXA 3OICA 4ONEA 1Q1NA 3ANMA 3JQGA 2P4QA 3Q3CA 4CLHA 4OMUA 3ZV5A 4B7CA 4DVJA 2QHXA 2NSDA 4RL6A 2DLDA 2EEZA 3SJ7A 1H94A 1YRLA 1P1IA 1PSDA 2NM0A 4BOYA 1QYCA 4BNYA 2ZYDA 4LMPA 3OEYA 5JDCC 4DLBA 3GOHA 3ZNOA 3E82A 1ADCA 3AUSA 4B4WA 4BKOA 4ROSA 2C5AA 1L1FA 2X9GA 3CPSA 4YQZA 1TT5B 1E3LA 1ZUD1 2A4KA 3GUYA 3LLSA 4WJZA 5COAA 4Q3NA 4J0FA 4RPHA 1BDBA 3MJVA 4DLAA 1ENYA 3JQ7B 4HFNA 3U5TA 2D1YA 1LDYA 5DCUA 4AG3A 3SEFA 3OBBA 3N7UA 1QXSA 2C29D 3VZRA 2P5UA 5JY6A 4RQUA 4XJTA 4XB2A 5ENVA 1UUFA 3I9KA 5CG2A 3H9QA 4E4YA 5TQVA 1YB5A 2WTBA 4HADA 1EMDA 3JQ8B 4O0LA 1ISGA 2FR1A 3NEPX 3RC7A 4ZJUA 4BNHA 4M8SA 3PJGA 3ZWMA 4E5PA 4OJNA 4R3NA 7ADHA 2Q2QA 3WS7A 1P3DA 3PFWO 4BL5A 5LDHA 4WOKA 3WSVA 5KJEA 3KYDA 3LC7O 2E6UX 2RHCA 1HRDA 3GF4A 4W7IA 4GGPA 4RV9A 3Q1LA 3R6DA 1NAHA 4L76A 4ZU3A 3WQRA 6ADHA 2F00A 3ZWOA 2VYVD 4ZQEA 3ZNQA 3I52A 2O3TA 1OMOA 2Y0DA 4DPKA 2DT5A 1QLJA 5EMHA 3C7DB 2HK7A 4J1QA 3WIEA 3DXFA 4TSKA 3MJEA 1F14A 3NGXA 4LSMA 5KVCA 3G49A 1KVRA 4HNGA 5ICMA 4OH1A 3H5NA 3H9JA 4HBGA 2X4GA 4ZRMA 1PR9A 2D3TA 4YT8A 2G0TA 4K1LA 2BGLA 1WWKA 2B5WA 2PGJA 1JKIA 1Y8RB 4WLEA 1H6BA 1B3BA 1NPDA 1TT7A 4XGNA 5DZSA 1E1MA 1T2EA 1EE2A 4BQRA 3C3XA 2OBNA 4YACA 9LDBA 3KXDA 1YONA 3NDRA 4TZTA 4R5HA 1JAYA 4KTTE 2X1HA 2NVBA 2BGKA 3ROQA 2IXBA 4K26A 4J1NA 2W2LA 2C20A 5LCXA 2O3UA 2X5KO 4HFJA 1WVGA 4JCOA 4DXHA 1OAAA 2BFMA 4MINA 3T4XA 4KWHA 5G4LA 1GTMA 4A10A 1EVYA 5ER9A 1P31A 4GX5A 1VL6A 3G1TA 3G79A 5BR7A 1FK8A 3AU8A 3VZQA 3BYZA 1U1IA 4QSMA 2YY7A 4R54A 4TWRA 2YQ5A 1Q0HA 3S2EA 3VPGA 4L0QA 1DRWA 2ZB7A 1LLQA 4DWVA 1ISHA 1SAYA 2DU8A 1UP7A 3PYLA 4N5NA 3VVCA 2DUWA 5HRUA 3ADPA 3JD0A 4J1SA 4YVFA 3JTMA 3ZU4A 1CDOA 3QIVA 2NVUB 3HB5X 3I23A 2E4AA 3NYWA 4IBOA 1W73A 2YDYA 3A06A 3PWZA 1DHRA 3RWBA 3GVPA 1U2DA 1G1AA 3NKLA 1QORA 1FDSA 1NX6A 4BO3A 2VT3A 4J49A 5TSDA 3GGPA 2IZZA 4GKBA 3WNVA 1B16A 3WFJA 3CH6A 1KETA 3TSCA 1IUKA 4IMPA 4XYLA 1W0CA 4L4SA 1D1TA 1V35A 3DBLA 1DPGA 4BO5A 5F3RA 3FHLA 1E5LA 3PEFA 1PJQA 3NX4A 5AXBA 2HMWA 5T8KC 3WGTA 3KEQA 4Q9NA 3LU1A 1EQUA 1FF9A 5EESA 4E31A 2OGUA 3MJCA 3GH3A 4UUNA 3TPCA 3KLMX 3L9WA 2VT2A 1OOEA 3DHNA 5EPOA 1TI7A 5A03A 4AL4A 4MPDA 3ST7A 3UOGA 3FNFA 1LC0A 1PQPA 4II2A 1E1NA 1N8KA 3RBXA 5TF4A 5BNFA 3TZKA 5IZCC 1XDWA 3RUIA 1ZIDA 3Q6IA 5JNLA 3LC1O 3HN2A 3HQ4O 3NUGA 3TFOA 3GGOA 4A03A 2OMEA 5DP2A 2OL4A 3H5AA 1NQAO 4XR9A 4XQGA 3HN7A 3INGA 4XJSA 5CEJA 2JCVA 3F4BA 2PD4A 4H15A 3TOXA 2O7QA 2P9EA 4CM8A 4W7HA 4YT2A 2V6BA 3PFFA 3OJLA 1DFGA 4KMSA 3SC4A 4AJIA 1X0XA 5JO0A 4UEOA 4B3HA 4AJPA 4AJLA 2G1UA 4FCCA 4OSPA 4KTVE 1F8GA 1NVGA 2X8LA 1N9GA 1UDAA 4MIEA 3T7EA 4EDFA 1N2SA 4EUFA 3E48A 3JQDA 4GAEA 1LXCA 5CPFA 3GFBA 2BF7A 4W82A 1JLLA 4AJOA 4EZBA 1MFPA 1YDEA 2DTXA 2H1SA 2A9FA 2X9NA 2ZK7A 3K2EA 1PGOA 4IDDA 4D42A 3GEDA 3ZU5A 4JX8A 1NTOA 2BRUA 3WGYA 2OORA 1WNTA 1R0KA 3KO8A 3PZBA 4P8RA 5EINA 3ZGYA 4QQRA 1X0VA 4BMNA 3OQ6A 1DBVO 1DRVA 2JD1A 1IE3A 2CD9A 2W2KA 3IL2A 4B4UA 3PHJA 3HADA 2JFFA 3AOGA 2ZTVA 4YRDA 5TJHA 3RCBA 3D64A 3ZHBA 1YOVA 1GYQA 4KP7A 1PL7A 5DBIA 1K3TA 1H2BA 3LT2A 1U3VA 4J4TA 3E5RA 4J16A 5I8ZA 2XXBA 1NHGA 1LI4A 3U4CA 2I76A 4RDIA 4NIMA 4TRJA 2RH4A 2PD6A 3VKVA 2DAPA 3RIHA 5L7TA 4PG7A 2Z1NA 2HRZA 4CJXA 2EGGA 2ZJ0A 3R3JA 3TN7A 4QEDA 4YYZA 3NJ4A 5C7LO 1U8FO 4DYDA 4GX0A 4N18A 1TT5A 2FPPA 3DTTA 4FBGA 4Z6KA 2P91A 4INAA 2O7SA 1J0XO 1IYZA 2VRCA 1YB1A 4TVBA 2C82A 1ZH8A 4BKRA 3D3WA 2B4QA 3UHAA 3D7LA 4A73A 4EJ0A 3DMTA 1R6DA 1U9JA 3BHJA 3FPLA 2ZKLA 4MVJP 3RROA 3IUSA 1E3IA 3PJEA 2IZ1A 2W8ZA 3WX0A 3UVEA 1HYGA 1K6IA 3IKTA 2GDZA 2PNFA 2LDBA 3I4CA 1I10A 1E5QA 1B8UA 3E9QA 2ZB4A 2CY0A 4N5LA 3MEQA 2VWQA 4CQMB 5U4QA 4XDYA 5L7YA 1T2AA 5DCYA 3O9ZA 3QLJA 5L9AA 4MVJM 1VJ1A 4LRTB 1MC5A 4NMHA 1BXGA 2FZWA 4ID9A 3I9JA 5B1YA 5CAEA 4CLRA 1RPNA 3RD5A 1NWCA 4IZHA 3WWZA 1EEHA 2I99A 3PIIA 4XIJA 5T64A 1K6XA 4DC1A 4IJWA 1VPDA 3M1AA 3B70A 4MKRA 1G6KA 2R00A 1I3KA 1MX3A 1V8BA 3PGXA 2WMDA 3GAZA 5K0ZA 3DBVO 3F3SA 2Y66A 4P4LA 5JPIA 3RUEA 3ZHXA 1KERA 3Q9NA 2Q4EA 3AY7A 3E03A 3JSAA 1T2CA 2P68A 1BVUA 1Q0LA 4OQYA 4AVYA 4DC0A 5C5IA 4P4GA 4PCVA 5TT0A 2CVZA 4YWJA 3HB4X 3EK2A 3S1LA 3PYMA 1PJ4A 3ENKA 1FXSA 4JP3A 1WZEA 3DAPA 2Q1UA 4E21A 4PZEA 2AEJA 2ZTUA 2EERA 1NFFA 1JKJA 3HG7A 3RUAA 2JCYA 3FD8A 2OP0A 4OYRA 5JY1A 3V2UA 5KJCA 2HDHA 4RDHA 2C59A 4BO4A 2VYVA 4UUOA 3KETA 2Y1EA 4I8XA 5H82A 1U5CA 3F1LA 3KZVA 3BHIA 3RFXA 3FCOA 4CM7A 1D1SA 1SZJG 3INRA 4E5YA 2X5OA 1SOVA 3KVOA 2QZZA 1CQIA 1YOVB 1GADO 2VZ9A 5JSFA 3ZW9A 2FR8A 4J4HA 3PQEA 2VHVA 1BTOA 1HDRA 3RVDA 4K6FA 4XKJA 2FP4A 1MA0A 1P74A 4YDRA 5FEUA 3GDGA 1PGJA 4LK3A 5THQA 2PKRA 2AQKA 3H6KA 4E5MA 3DAGA 3A9WA 4CLXA 1XHLA 2E37A 5K9ZA 5HBRA 3GN2A 5COQA 5DP1A 4Z9FA 3WDSA 4J90A 5KVVA 4B79A 1ISMA 5ITWA 3GVCA 3W6ZA 1C14A 1NQTA 1E77A 3JCZA 2J3KA 1FDTA 3EYWA 5IAAA 3MCVA 1M6HA 2Q4BA 5EQFA 3OHSX 2HLPA 3VOSA 3MTGA 2QX7A 4CL8A 2YHUA 1CJCA 2DBRA 3W6UA 3MJSA 3GEMA 2W2LD 3K6JA 3PLNA 4OHUA 4TRNA 1MXHA 2WYUA 4XZ3A 4EJMA 3ADOA 2BFOA 5AXCA 1W4ZA 4CR6A 2OBYA 1NWHA 3H9UA 5T6BA 1BRMA 3IC5A 3DZFA 5FWNA 3DZHA 4WLVA 3SC6A 1UXIA 5F5LA 5IG2A 4CM8B 1HEUA 2AE2A 5DT9A 1UAYA 3LQFA 5L7WA 2CMDA 1IHYA 1KBZA 3JD4A 3PWKA 2W2KB 1LDNA 1GUZA 1U8XX 2JFGA 4WLUA 2OXIA 1AN9A 1LNQA 1Q7CA 2Q1SA 3BMNB 3ENNA 3QVOA 3W8DA 3OFSA 3WGQA 2VCYA 3BXXA 3OIDA 4FFLA 1ONPA 3C1TA 3AOEA 4PRKA 1A5ZA 1C1DA 2VOEA 1XCBA 3ZWCA 1H6CA 2J5KA 4Z3DA 3CZMA 3GDFA 1IB6A 5JDIA 2PV7A 4C7JA 4EI2A 3ZN2A 1DEHA 3CINA 3ICCA 1HTBA 5B4UA 4E0BA 5CEFA 3LK7A 1E3WA 1ZJZA 1RM0A 1LDEA 4IQ0A 4WLNA 3LYLA 5TIIA 3BMQA 1GL3A 3ZWWA 3U9LA 1R4NA 1XLTA 1LJ8A 3ZU3A 1Q7GA 3QA9A 1DC5A 2EJWA 3DFZA 4CPDA 4E2WA 3BMCB 2PH5A 4NZ9A 4DIBA 2V65A 2FOIA 3D4OA 1U5AA 1U3WA 2J8ZA 2YFHA 3JYQA 4RZIA 3RJ5A 4CM9A 4EW6A 1BDMA 2VNSA 2C54A 5A1TA 3AJRA 3PVZA 2E49A 4J7CA 3OF2A 4RLSA 5FFFA 4UVDA 3FNHA 3WLEA 4GSKA 2BFPA 4UVEA 4YJHA 3JQ9A 3CEAA 4GX1A 4NPCA 1VJ0A 2YW9A 3CKYA 4NH4A 4ZHSA 3EC7A 1BXZA 3CXRA 1Z7EA 2VYND 4FFPA 1NR7A 4HP8A 4JBIA 4FJ0A 4IY1A 3NTOA 1QSGA 1NR1A 1PJBA 4DUPA 2WYWA 5KVQA 4OSOA 1SMKA 2D8AA 4MP3A 4NJMA 4BNKA 1BXGB 3GFGA 3FNEA 2GO1A 3VTZA 4CMIB 7MDHA 3JQCA 1ORRA 4PG5A 5K6AC 3H8VA 3AI3A 4F46A 3JYNA 1UR5A 4TRMA 2FHSA 2FPGA 2GUGA 5EN4A 2FN7A 1PZEA 3O4RA 4R69A 3IKVA 4GWKA 4JP2A 1K2WA 2BD0A 4DTIA 4CV3A 5KCZA 4ND4A 1TB4A 4R51A 4E3ZA 1NVMB 1A4IA 4EJ6A 4YAIA 4NR0A 1V6AA 2SCUA 3HWRA 3N74A 1ZSVA 1NPTO 1IULA 1GY8A 1LRJA 1PJCA 1PWZA 2A35A 2FY8A 4AJ1A 2AQHA 2H5LA 3AM3A 4B7XA 1Y8RA 3DAFA 5DOVA 3DMYA 3JQAB 1BMDA 1PJ2A 4IJVA 4JBGA 5G4KA 5CDYA 1PJLA 2YJZA 4RPLA 4DMMA 4NFYA 3EY4A 1GPDG 5TS3A 3PPIA 3GNQA 4R1UA 4HY3A 3G3EA 4R3WA 1U4SA 4R41A 1A72A 4FPXA 4W9NA 3SX2A 4M55A 4D3FA 3WGGA 1KY4A 3ZWBA 1Y9EA 4NBRA 2CVQA 3F6YA 1YQGA 4XYBA 2Y68A 3JD3A 1HWYA 1CF2O 1H9BA 4BO2A 4UVIA 1NHWA 4PLWA 1UJMA 2QYSA 4D3DA 4R1NA 1D3AA 2GR9A 4Q3AA 5EIOA 3Q11A 4BO1A 2IEDA 2GYYA 2BGMA 4IJKA 2I66A 3VPXA 3RI3A 1DLIA 2H63A 4OKNA 4XYGA 5JE8A 3ZHYA 3DZBA 3DZJA 3Q2KA 3QVWA 1A71A 3ETGA 3W1VA 2EWMA 3UCEA 3IAHA 4DQVA 3SLKA 2JAPA 4JROA 5U9CA 1ENOA 1D4FA 1GR0A 4PVDA 4XCVA 4CR7A 3UCFA 5DF1A 1GPJA 1ZW1A 4ITUA 3QY9A 1MXFA 4OXYA 1ML3A 2OZPA 1R37A 4R16A 4YRBA 2Y1DA 2X9VA 3HDYA 4NK4A 4LRSB 4URFA 8ADHA 2DTDA 4W6ZA 5AXAA 3VDRA 1XQ6A 1Y6JA 1ZBQA 1NXQA 4DQXA 3JQ6A 3AM5A 2D0IA 2ZATA 4UUPA 1P1JA 3S55A 5JFOA 5L4SA 1KC3A 1HYEA 3BTSA 2HRBA 3C1OA 3VHRA 1AHIA 1ZXBA 3PRJA 1YDWA 1U2GA 1LDMA 2C07A 2X0RA 3BZUA 4I9HA 1DIRA 4JBHA 1BG6A 2PKQP 4PFJA 1B14A 3GG2A 3QQPA 1TLTA 3ZV3A 1QYWA 1SCUA 4IDBA 3UH1A 1M67A 4YQYA 1O0SA 4LCEA 3UFXA 2ZCUA 1N9GB 1ZSNA 1WAMA 1B8PA 2GN8A 4ZQFA 2GZ3A 1M66A 4U8GA 4BV8A 3T7CA 1ZMTA 5G0TA 1ENPA 3FR8A 3JYPA 4UVGA 1QKIA 4BNFA 3KM0A 4Y6SA 1M76A 3VZPA 1BXKA 1J49A 1DOHA 4IIVA 3AUTA 4JLWA 4QX6A 2OO5A 4C4OA 5KIAA 1YJ8A 2OFPA 2QQ5A 3DOOA 1LUAA 1GEGA 1YO6A 2NV6A 3LLVA 1IPEA 5JCJD 3I83A 3D4PA 3A28A 3U4DA 4AJ2A 2GD1O 4G2NA 1HE2A 3EAGA 5A04A 1WZIA 2HAEA 1R66A 2B35A 3D5QA 1T4DA 1I36A 4ZQBA 3UAGA 1QYVA 2VQ3A 1HYHA 1R0LA 3AUAA 3GNTA 4CMBA 1AGNA 1EFLA 1T25A 2ZCVA 3ZNNA 4K28A 4IDEA 1FMCA 1UP4A 4OOFA 1YQDA 3UXYA 2YQ4A 2IXAA 3LT0A 3O8QB 3QWIA 4L4RA 5HS4A 1KC1A 3C8MA 3D1LA 4GLOA 1SBYA 2VHZA 4ZD6A 3AM4A 3NTQA 5AVOA 3PZRA 1BW9B 1QV6A 1Z74A 1SEVA 3WTCA 3WQQA 1MP0A 4X54A 5T8KA 4ALKA 2X7HA 3GZ4A 4KWIA 5L40A 3EZLA 5KJ1A 1KVUA 3WGHA 1TA4A 5IXYA 2XAAA 2TMDA 4L9RA 3IP3A 3PXXA 4CV0A 2HQ1A 2GGSA 4IDFA 3M6IA 1KEWA 2DTEA 4IQGA 4BGVA 4YA6A 1P1KA 2O3SA 1HE5A 1B26A 2AG8A 4LMRA 1JWBB 4XQCA 5JDIC 1D8AA 1WMAA 1YH3A 4D0RA 4KQWA 2PLAA 2C2YA 2PA3A 3BMOA 3QWFA 4WGGA 3K92A 4I9UA 2VZ8A 4R1SA 3RBZA 4MO2A 3VH2A 3GR6A 3NJ8A 4BNMA 2CSUA 4R4JA 1VKNA 4FFRA 2O3RA 2PY6A 4WE3A 2IRWA 3E9NA 3B6ZA 4N54A 1IHXA 1CYDA 3K96A 2B69A 2X23A 3IJPA 2HSDA 1YGYA 1UP6A 3L4BC 3W8FA 4FQ8A 2QZ9A 1GQYA 3I6QA 4QO8A 5JO9A 1HZJA 1YBAA 1PJSA 1E7RA 2DPHA 2YUTA 4O1MA 4CMGA 5CDSA 5HM8A 2EKQA 4MVJA 1DB3A 2PZMA 3EVTA 3GVHA 3VH3A 3KYDB 1ID1A 2VUTA 4L8VA 2EP5A 4MVJG 3UICA 4TRRA 2DFDA 4WLFA 1IZ0A 5L95A 1IY8A 1NNUA 3OIGA 4M1QA 4I9NA 2G17A 3VTFA 1NASA 4ALMA 4BNNA 2X86A 3ZWXA 2E82A 2J6IA 1P9LA 1DC4A 3ULKA 3QSGA 1EK6A 3U4IA 2VHYA 4NJMB 5GZ6A 4RGBA 2AQIA 2I67A 1PZGA 3GQVA 1PTJA 1XA0A 2NLOA 3TOZA 3VH1A 4OGWA 4IDAA 3JQGB 4CODB 4JJFA 3FBTA 3VH4A 1UDBA 2PTGA 1XQ1A 3WLFA 3W8EA 2NUAA 3DZGA 5IF3A 4L73A 3PHLA 4HV4A 1C1DB 1LSOA 1YWGO 1C1XA 3ZDFA 4EITA 2GSDA 3AY6A 2R6JA 3S2FA 3ANNA 3AW9A 4II3A 3U49A 4EUEA 2GCGA 2EW2A 4I5DA 4PLHA 4CM5A 1PQWA 3H4VA 1GAEO 1Y5MA 3P2OA 2D5AA 1EVJA 2H9IA 1Z73A 1R16A 1X7HA 2Y99A 5AQ1A 5ER6A 3ZWVA 1HSOA 3DQPA 2C2XA 2D59A 5DBGA 3PHHA 1CEQA 3TL2A 3PI7A 4BS9A 3JD1A 3JQFA 4FC7A 4ZRNA 4W4TA 2D2IA 1R15A 3BA1A 4YJFB 3WXBA 1B2LA 1VM6A 1Q2XA 1E92A 2BI7A 4FGWA 4XDZA 4TMFA 5CPBA 4BO9A 4DRYA 4JJIA 1DJQA 1JKFA 5HWSA 2WD7A 4NQZA 2QRKA 2EJVA 2HMTA 5JC8A 1RM4A 3ANLA 2EP7A 1A9ZA 4QO7A 2O50A 2Q45A 4EEXA 1N7GA 4DL9A 1NVTA 2O2YA 3QP9A 4Q39A 1ISFA 3UCXA 1KVSA 1DJNA 4GMGA 2NQ8A 3L0DA 2PK3A 2Q49A 2CVOA 2HMUA 4CLEA 4GVLA 2C5EA 3C24A 1RKXA 3D3WB 2P2SA 3VVBA 4BIIA 3DFUA 3U09A 1FDVA 2J3IA 4DIFA 4XGIA 3WTBA 3RJ9A 3SBOA 1GUYA 4ZICA 3L07A 3G17A 4FOOA 1VI2A 4NJOA 4RF4A 1U3UA 5KWEA 2WDZA 3KUXA 3U3XA 3PQFA 3VKUA 4NBTA 1UXKA 1MGOA 4B3JA 5L51A 4DPLA 4D0SA 1X7DA 2PZKA 4BNIA 4IS2A 2JFHA 3JYLA 3HHPA 4AJNA 4BNXA 2UUPA 2ZTLA 1B7GO 3FR7A 4J7UA 3K9QO 3OJOA 4E6PA 1ULUA 1KVTA 3DDNA 1WMBA 3PIDA 4KUGA 5I9MA 1EDZA 1KEPA 4IM7A 1XIVA 1O94A 3WGIA 3K2BA 4MKZA 3Q2IA 4R68A 5DNAA 3FBGA 4BGUA 1H9AA 1R4MA 4J4BA 4XIYA 4YB8A 4E2XA 4IMRA 4ZGWA 5JCXA 1C0IA 3JV7A 2RAFA 3BMQB 1SB9A 3C1AA 3JQAA 1C0LA 2YDXA 3DL2A 4RPKA 4Z0PA 4AJEA 4BMSA 5IJZA 1WDLA 2GNAA 1EUZA 3BTVA 3TF5A 2Y1FA 2HJSA 2YV3A 1LA2A 3DBHA 1AE1A 2HKIA 2Y93A 4HKTA 4ALIA 4CUZA 2R2GA 4CV2A 4F45A 1UH5A 3E6AA 4RQTA 5DOZA 4D44A 1SC6A 3QVXA 1X1TA 4RZHA 3EVNA 4U0JA 2PZLA 3BTUA 3HDQA 4ZN6A 5DBFA 4GSLA 1P33A 1XG5A 2GN9A 5MGBA 5ILOA 1HL3A 1NQOA 1E6WA 3UUWA 1JA9A 3NRCA 2VRCD 1QLHA 5ICSA 3SVTA 1QYDA 2DVMA 2YFQA 1UZNA 2J3HA 2VTEA 2X0IA 3AI1A 4EUHA 5HTOA 1RYDA 3DBRB 1X15A 3MOGA 1E7YA 3UN1A 3EZYA 1XEAA 4CV1A 1I5RA 3NT4A 4J2HA 4JNKA 1E1KA 1LSJA 3A1NA 3IS3A 5CHEA 4XGKA 1YL7A 5B12A 3LF2A 3QW2A 3RKUA 2EKPA 3H2SA 2Q1WA 3MZ0A 4JN6B 5JDCA 3ZWAA 1ARZA 4KUHA 4Q3DA 4FC6A 3OA0A 5CDGA 4FD3A 2O4CA 5JMWA 1ZCJA 3RC1A 1YJQA 5BT9A 4D43A 1QP8A 1W6UA 1O95A 3QRWA 1UXGA 2PZJA 4D3SA 2X6TA 4YAKA 2IZ0A 5JBIA 4RVHA 5FF9A 2IYPA 2V6FA 1GD1O 2Y0EA 1YKFA 4CMIA 4A5OA 1PL8A 1GQQA 1LQUA 4P22A 1WLYA 3AFNA 1ZK1A 5G2OA 2RH8A 4B8ZA 3FF4A 4PG8A 4AJHA 3AUUA 1CETA 3OQ1A 1V3VA 6LDHA 1P45A 1JN0A 5F1PA 4CQLB 1RM5A 2DM6A 4PLCA 4BNGA 5I7SA 4IDCA 2G82A 5AOVA 2O48X 4YRAA 3GPDG 3OIFA 4YPOA 1U4OA 4U0KA 3I9NA 2VWHA 4U6QA 4FJ1A 4RLHA 2OHXA 1Y8QB 2WSBA 1I33A 3RSHA 1XU9A 1DAPA 1PJTA 3TL3A 5CDTA 1GZ4A 2BHLA 4R1TA 2GN6A 2WJPA 3GZNA 4WCFA 1JVBA 4AJ4A 1BVRA 1C0KA 4CLRB 5COBA 5BNIA 5L53A 5JS6A 2UV8A 1ONOA 3PDJA 3WJAA 2GZ1A 3D0OA 3WMWA 2B4RO 3H65A 4IGEA 1KS9A 5L45A 4BNJA 5A05A 1AXEA 2YV2A 1YE3A 4L4XA 2HO5A 5G0VA 4XRGA 2FWMX 2I6TA 4Y6PA 2JCXA 4DMLA 4MVJF 2ZJ1A 1F06A 2G5CA 3CMMA 1KIFA 4WUVA 4I1IA 5A3JA 2B5VA 4BKPA 1VSUA 1NP3A 4RORA 3VPSA 2Q50A 1DC6A 1H0KA 3TWOA 4DA9A 1U3TA 3GG9A 1F8FA 1FDUA 1I32A 4E5KA 2CZCA 1E3WB 2UDPA 1VC2A 2AEFA 3ASVA 4FOSA 4CMKA 3GGGA 3B20A 2PD3A 1PQUA 3K73O 1FJHA 5T57A 4LN1A 3H3FA 4OM8A 3AWDA 1PU2A 2AXQA 1HE3A 4E12A 4U6SA 4MVJH 1A7KA 2ZYGA 5JAMA 1Y9AA 1E6EA 1N1GA 3BMCA 3R3SA 4BVAA 2JD2A 4O6VA 2VWPA 2A94A 3EDMA 1VKOA 1X1EA 3ZV6A 1J5PA 1JU9A 2QYTA 4A0SA 1QRRA 3JQBC 4MDHA 1YL5A 4PLTA 2NNLD 4FR5A 4WK6A 5HA5A 4CM9D 1DFHA 5IDYA 2IDZA 3UKOA 3WGZA 3B1JA 3TRIA 1Q0QA 4WNCA 4Y98A 3NV9A 4D79A 3IQDB 1P0CA 4P38A 4RVFA 4JK3A 3KEOA 3MWEB 3VZSA 1MV8A 2Y67A 1P1HA 5AYVA 1I0ZA 1NM5A 5GZ3A 4Q3BA 3WFIA 4O5OA 4GH5A 1B0AA 1PEDA 2EHDA 3DWFA 3IJRA 3HDHA 5JMPA 2AE1A 3NAQA 2EKLA 5JC1A 1UZLA 4KOAA 5CDUA 1ADBA 4TZKA 4YAGA 2AQ8A 1NPYA 3JQFC 4OL9A 2CFCA 3A14A 2BI8A 2YYYA 2V6GA 4GL4A 3O03A 1V3UA 1HF3A 3OECA 3P7MA 1P1FA 3F5QA 4CMJA 1KOLA 2PH3A 4JXKA 1CQJA 2HJRA 2FR0A 4QUKA 4NG5A 2BMAA 2WD7B 4FFMA 2IEBA 1T4BA 4ND1A 3RFTA 8LDHA 3JQ9C 4UEJA 1R0SA 2CNBA 1B8VA 4BNWA 1PS8A 3ZW8A 1PR3A 1ULSA 5IXSA 1DXYA 1Z45A 2VUSA 1E3JA 3FI9A 4FSHA 4J9VA 1N7HA 2QIOA 1PGQA 2E48A 1J6UA 2ET6A 3ETEA 1XKQA 4FS3A 1EDOA 3WBBA 4FFOA 4NK5A 3H9EO 3ZHZA 2GZ2A 3NT5A 4DPMA 4AFNA 2HU2A 4PIVA 3SJUA 2EIHA 2FPIA 4GKVA 4PVCA 4UAGA 1P0FA 2VHXA 3ROMA 3E1KA 4TKLA 3EW7A 3GMSA 3MWDB 4M89A 5KVSA 5MDHA 1R4MB 3OJ0A 1E7SA 3QWHA 3F5SA 3BIOA 3L4SO 5G0SA 3ZZNA 1DC3A 4BGIA 3DBRA 2FZEA 1D7OA 4AJKA 1Y1PA 4XYEA 3FWNA 4LW8A 2OOSA 1L7EA 3I1JA 5EQDA 2QRLA 4N7RA 1NFQA 4QXMA 2WWRA 1OC4A 1EUCA 4BNLA 2DKNA 2B4TO 2P4HX 1DLJA 3I9MA 4R9SA 2D5CA 1ZJYA 2RIRA 1Z7BA 4KDFA 4ND3A 2AHRA 4FDAA 1CIVA 3DHEA 1BSVA 3CIFA 3AI2A 2WE7A 3NDIA 3VC7A 2B36A 3QWBA 3C85A 2W90A 3E9MA 3OSUA 3ZWPA 4G5HA 1RWBA 5A5FA 4M49A 3GK3A 3AFMA 3LZ6A 3H3JA 2O3JA 3W4IA 1IPFA 1GEEA 3GY0A 4KDEA 3RU7A 5TLSA 3EGOA 3DO5A 3N58A 3WJ7A 1JQBA 1NFRA 3WWYA 1GCOA 4CMHA 1ZMOA 3P19A 1A9YA 3PP8A 4GMFA 4YAJA 5DULA 3DZKA 1ZFNA 1ZZEA 2B37A 3KSDO 5TNXA 4BO0A 2NTJA 3WQSB 4BUCA 4CQLA 2P9CA 1SB8A 1ADGA 2EW8A 4MVJI 2DBVO 4RVUA 3E5MA 1HLPA 3HJAA 1MLDA 5G0WA 3DEYX 4R01A 4J0EA 3VDQA 2Y0CA 3KTDA 1DFIA 3DC2A 5IDQA 1EUDA 3F46A 2I9PA 1DDOA 5IDWA 2CF6A 1Y8QA 1JTVA 1VLLA 3E8XA 3TFQA 2POQX 5BQFA 2Z1MA 2V7PA 1V9LA 3FPCA 4XEHA 4W99A 1XYGA 4CMEA 3V1TC 3BTOA 2WD8A 4EYEA 2UVDA 1M2WA 4HX5A 3TNLA 4YT4A 1EVIA 4DBVO 2J5RA 1E0DA 1DAOA 4Y6RA 3HUDA 3U4HA 2NACA 1OI7A 4OO3A 1DSSG 3LDHA 3DONA 5EL0A 4CLOB 5KOIA 3ZWYA 3JYOA 3K5PA 3FWZA 4FN4A 3ZNPA 2BH9A 3A4VA 5THKA 3WG9A 3LC2O 4BO7A 4WPGA 3R1IA 2VZ0A 3DOCA 1ZK3A 2PWZA 3DMTC 4YAEA 2AMFA 4CQMA 3DB2A 1EBFA 3BAZA 1LQTA 1HDZA 1I2CA 4GI2A 3D3EA 3EUWA 4NBUA 4ND5A 5F5NA 1F0YA 1GDHA 3V2GA 4D41A 3WYBA 4ILKA 4F6LA 3L6EA 2ILTA 4FFNA 3GVIA 1EZ4A 5ENDA 1P44A 1XGKA 3M1LA 2GERA 1O9BA 4JJGA 4QTZA 1K89A 2Q1TA 2DQ4A 1PL6A 2HUNA 1XWFA 4XYMA 1TEHA 5ES3A 4YJFA 2BKAA 5B37A 3SXPA 3COSA 1DIHA 4UEKA 5BSFA 1OC2A 2X0NA 4S3MA 3B1FA 4PGFA 5TJ9A 2NVUA 3PLRA 2Y1CA 3V8BA 4CL3A 1PIWA 1HSZA 3WIDA 1HDYA 2BELA 1B15A 2Z5LA 1MB4A 4OXNA 4BNVA 5JAIA 2R00C 5GY7A 5C7OO 4WECA 3RQSA 2YHIB 5U1PA 3GNSA 3WYCA 1I3NA 4PG6A 3L4BA 4CM6A 3IIEA 1E3SA 3FNGA 3OJFA 3PK0A 4OQZA 5H81A 2IYOA 3EHEA 1JAXA 3OJEA 2RCYA 1Q7BA 4RVGA 2G76A 3RASA 3LT4A 5KJFA 1JWAB 5EERA 5T67A 1IOLA 3NGLA 1JW9B 3WMXA 3S2GA 1PX0A 1NBOA 4KUEA 1LLDA 1EE9A 1I3LA 1P77A 5KKAA 1T1SA 1C0PA 5I7FA 4LSWA 3PJDA 5F21A 1GYPA 1I01A 4PZCA 2DBQA 4G65A 4B4VA 4DGSA 1A7AA 4NU6A 1HDXA 1O8CA 2I3GA 3PTZA 4EEZA 1E6UA 3RAJA 4BO6A 1GUFA 3C7AA 4L74A 5GMOA 2CDCA 3P2YA 5LDGA 4JQCA 4ALJA 3I4FA 1SNYA 4E2ZA 1V3TA 4Z9XA 4UVHA 4K9DA 1ZEMA 2CF5A 1RJWA 4HUJA 4OXKA 2VOJA 2HK8A 4Q3EA 1U7HA 3EMKA
chains in the Genus database with same CATH superfamily
1YBMA 4A26A 1NJ6A 1U7WA 1QCYA 4I14A 3S29A 1UBFA 1M7BA 1XRQA 2XIQA 1FNSA 1R8SA 2HMVA 1F20A 3JAWA 3LKZA 4F8JA 4NXMM 4OP1A 1PG2A 3LP8A 3D2AA 1E58A 5BSEA 2XY4A 5T3YA 1IUPA 4I4LA 1THGA 1GAJA 2RBEA 4NOJA 4DLTA 3LW5F 1OREA 1PGNA 5KTKA 1KVQA 1SZPA 1RC1A 1XMXA 2C2HA 4JC8A 4TWIA 4MRVA 5FO1A 1K06A 2VO1A 2IODA 3B78A 3F1KA 4DDTA 1YQQA 4RA9B 2ZXFA 1QE0A 2WWXA 3DHYA 3O95A 5JZBA 3LBHA 1H6DA 4U5QA 4RMGA 5DO9A 3UGKA 1EIZA 1Y4SA 2C92A 4DQKA 5H59A 3OLXA 1QB7A 1WPRA 3KKZA 1LU9A 4ZQGA 3GLFA 1UPFA 2KNZA 1RADA 4CHTB 2QG6A 2OFFA 5LL6P 1KEUA 1FRNA 1O6ZA 5FNVA 4N9QA 1HDCA 2OHHA 4WAUA 1WP4A 4LGMA 4XBOA 1LPPA 3G2OA 4BRUA 5JS7A 2YJ3A 4H16A 4WXPA 3DZDA 1GR1A 3VAZA 4KGZA 1RC8A 4WCDA 2QR5A 3THGA 1MZVA 2WVAA 4HAOA 1E1YA 4I3FA 4X7BA 1W8IA 3KJNA 2WICA 2XGSA 3CUKA 3BIFA 4J3FA 4JX9A 1P0MA 1MVNA 1WOYA 4PG4A 4O2BB 5FR2A 3ZCXA 5K4GA 3X0DA 2GETA 4QQNA 2GPWA 1TDJA 1B43A 2IE8A 5KMGB 4KIWA 2QHOB 1XNQB 1A4UA 1ZJ6A 3ETLA 3IUJA 3EPJA 2CL5A 3SMQA 1NUTA 4D9BA 1ACLA 2IP4A 3PENA 1OAOA 1U7TA 5A5DA 3GN1A 4Y2RA 3BRQA 2M1ZA 4LOJA 3AF1A 3FJOA 5FV7A 2VSOA 3KNZA 3W4JA 4B44A 4POOA 3HM2A 5IHPA 3NLLA 4F9FA 1RU3A 5BSGA 3NKVA 4GWGA 5GZ1A 3AC0A 3Q8KA 3AEKB 3K6SB 1QR6A 3OETA 2PFGA 2DF8A 3LO8A 3EDQA 2GCEA 2ZW9A 1N4AA 3OCWA 3KHKA 3TKLA 1U99A 1TA9A 1M1NA 4WOBA 3OCJA 3DF9A 4I3HA 1F9EA 1TECE 3PWSA 4LKRA 1DG1G 2BWJA 4PC3A 2WSLA 1ZY2A 4LFBB 3PEYA 4KAJA 1CNMA 4M8LA 4WK4B 2ZI6A 5BSUA 2BBTA 3I4LA 4UZFA 5G4KB 4WOJA 2ZPAA 5LMUM 1S9HA 1TNDA 2A0YA 2AUNA 3P96A 4GO1A 4HRAA 4JGBA 4MQ5A 1SEPA 3UAXA 4DQUA 1SPXA 4WACA 3TZQA 4L4UA 4XEUA 3OJXA 3KBBA 1LLUA 2CZGA 4LWQA 1U2SA 1D4OA 2Q7DA 4EG1A 5I7OA 1CUAA 1BHSA 2RMKA 4FHZA 4G36A 3VLFB 1GAQA 5KAMA 4IR7A 3P9SA 5HQ3B 2X0JA 1FFCA 1VLQA 2A59A 2GPTA 4G63A 1YZYA 5IT4A 4KB5A 3OP4A 3KCNA 4ZMSA 5KWIA 1DBRA 2GH1A 3U3KA 4YT5A 2UUBB 4FJ2A 2YHAA 1CK4A 3K53A 4O4IA 3T54A 1YCDA 2ZE6A 1E0AA 1ESNA 1T4MA 3AP3A 3GDOA 5LA6F 3PGJA 5DN9A 3WYFA 5IKMA 2DUUA 4FXPA 2OD9A 3GLGE 1IHOA 3LY9A 4JL6A 5IANA 3V9AA 3AO0B 4IV5A 2O52A 4QSHA 5LC1A 2B9EA 1QMGA 1AK1A 2FWAA 1VPWA 2J4DA 5A9SB 4XWOA 4RCYA 4IHAA 1E94E 2XT0A 3GRZA 4M7OA 3JPYA 1GRNA 2XDAA 4RPIA 2XMBA 1JLLB 1AQUA 2MYUA 3EEBA 3R0QA 4R9RA 4TVKA 4XWGA 3MTBA 5G0UA 3UAOA 4B8WA 1PHRA 1HE4A 2JEZA 1JDJA 1X7YA 1C8KA 1K4KA 3K8OE 4UNPA 2PJRA 1TCUA 1FJXA 1WUKS 1IN5A 4W9MC 1CERA 3CLTC 1CY0A 2WWHA 4MKFA 4B17A 1XMOM 3R0IA 4RJTA 5JSZB 1I1QB 5T4HA 2WINI 2ZP1A 1E63A 3QEMB 3PNPA 1LVHA 1N8SA 4RD4A 5EE9A 3ROPA 2H54A 3O0DA 4BLQA 1AMOA 2QNBA 1HGXA 1T0HB 4M8IA 4CISA 3QNWA 5CFQA 4KXYA 3THOA 2H2FA 1KSHA 3L1KA 3RUCA 1CV2A 1SC4A 2R6R1 1W96A 2WAXA 1WR8A 1R18A 3EFHA 4O63O 4P3KA 1ETUA 2O0JA 2QVZX 2SKEA 4M9QA 4W9NC 2WM9B 3HZJA 4OHWA 2WM3A 5JXGA 2PX3A 4LJ9A 1W87A 1JZQA 3BULA 4A0FA 2YV1A 2CLHB 4DMUB 5E0KB 1OGYA 1PJRA 2JFUA 2PKYX 2WUEA 1UBUS 2C95A 3BE5A 1LK7A 3GEBA 4G8BA 4AKTA 5IEJA 5L4LA 2D6FA 3INYA 4F6RA 3AJIB 1N0HA 1P0PA 2H08A 1NSFA 5FNVF 3TQHA 4NFHA 3CUYA 5D7BA 3TR6A 3THWA 1VPVA 4I1VA 1AKTA 2G9ZA 3FDFA 2ZQZA 1RI2A 3TQQA 3RS3A 4CM1A 3PNQA 5IYZA 1VSVA 2C5RA 1GPMA 2WDPA 2A92A 3RAGA 2P3QA 4GGMX 2ADFA 2CE7A 3BMXA 2EWVA 2KSQA 4FKZA 4UBKA 3L1IA 4A92A 4DCCA 2QKYA 4UNQA 3TCNA 2CNKA 3N2LA 4ZU6X 5C52B 4PHGA 2JVKA 4FGKA 1FYWA 1CFZA 1XAJA 2I5PO 5M3BA 2FG5A 4QU9A 3KRTA 4WJKB 1HLDA 3ZWDA 4J6EA 1PFYA 4B3DA 3NXSA 1Q1GA 5BYBA 1Z75A 4YAFA 4F5DA 1VJTA 4JP8A 4Q12A 2XYQA 5HQJA 2O25A 2CVHA 1JEEA 5LBIA 4B6OA 2W71A 3SX4A 3STUA 1MC4A 3M4XA 3KSZO 2H9AA 5TVKA 2AS0A 3W4KA 3M2PA 3FI0A 3PIRA 4HH1A 2R68A 4M0EA 4OHPA 3WDMA 4EH1A 3CX7A 2JAUA 4BO8A 3B1ZA 1ZSYA 1Y5NA 1R5JA 5GOZA 1VFNA 3D7KA 1FFEA 1BWPA 1VA4A 2GAAA 1D4ZA 2ZRBA 1CS0A 2ZSHA 1SXGA 5E4FA 5FI5A 4RTLA 2WOOA 3U61B 2D74A 5HUJA 2Q99A 4ETNA 2ZI5A 4IXMA 4QAQA 3D4NA 4WN3A 5C37A 2WVHA 3MWDA 1OZFA 4QBFA 4DR3B 5KTOA 3CW2A 4KIGA 3GAFA 4L02A 4UKDA 3VBCA 1XZBA 3AF0A 4RF2A 3ZHOA 3L8DA 1W35A 3CF4G 2Z57A 3ROKA 3T4EA 4IDNA 4NBVA 4L75A 1G21A 1J7KA 1I1OA 2QMHA 2WNHA 4N5MA 2H8GA 4PLGA 4ZO7A 1I8TA 5CDHA 5BOVA 1XL1A 3ORHA 1QWSA 3JVEA 2EV9A 2RAPA 3U81A 2Z6QA 1TJNA 2PGNA 3G1UA 3U4AA 1XU7A 3KOXE 5JLAA 2D7JA 3JQAD 1WDMA 3DO8A 1N3LA 4A27A 4N0EA 1SHTX 1A2OA 2VNIA 1FQKA 3D4IA 3UB2A 4BAZA 1C1KA 3X2EA 1XTTA 3ZJ4A 4Z1MD 4X65M 1RJFA 3HWWA 5HJ2A 4M9ZA 3PUZA 2C7VA 1BD3A 2ZXUA 5C18A 1JHQA 3AV3A 2EWWA 8GPBA 4RTKA 1OT5A 3LQQA 4FZVA 5I7RA 3H84A 3KFVA 1VQ1A 4FW8A 2V3VA 2DBZA 1JDBB 1JIUA 1SHZA 2MINB 2R18A 1J70A 2C78A 3V46A 1EM6A 3PDIA 3V4SA 4EW3A 4JI3M 1L5YA 2O20A 2WZQA 1DKLA 3NTUA 5LMNM 1N2XA 1WMFA 1Z82A 1ZWKA 2QX6A 3IOYA 3BGDA 4E88A 1A1SA 4W8HA 4M4SA 1BGVA 3MUOA 4XR4A 2PZFA 5BN4B 2LVOC 4GLFA 1N3IA 2Q6VA 5H3HA 1DJMA 3ZCTA 3C74A 4G0YA 4HEHA 1Z2EA 1U28C 2GASA 5BSHA 2WWYA 4OXXA 2VP6A 2NO9A 2PKQO 2CLDX 2XI4A 4FIDA 1BXRA 1EINA 3LLUA 1S7CA 2BGUA 1WZ2A 1KFKB 3LLCA 1PNTA 2Q29A 3Q0EA 3AVPA 3ZVKA 2YYZA 3DUFB 4YJ2B 4WKGA 1AHPA 1T2DA 1ZGZA 3EGCA 3U6CA 3OPYB 4MDEA 2XTZA 3A1VA 1I2ZA 2XXJA 2ETXA 4MQ4A 4BFVA 2ZUEA 5IDXA 2BI4A 1ULAA 4X95A 5IJ9B 1T2FA 2I2WA 5TMEA 3IDSA 4YEDA 3ZK9A 1GG8A 4IGFA 2E2WA 2W2VA 3ETHA 5TC4A 1NJSA 4GS5A 3RSLA 2UYCA 1E89A 3VYSB 4Q4DA 4HRXA 2CXXA 2JCGA 3OLQA 1CD5A 1G55A 1MD9A 5CW1A 3QUSA 3GPLA 2R87A 1V5EA 4FD2A 1X13A 1GA4A 1ADFA 2GRJA 4LY3A 3GDHA 4ARAA 3AXSA 1CCWA 1OX4A 4CLOA 2WK1A 3GRKA 1CRQA 4Z7JA 1IBRA 3KYBA 4PC7A 5AM0A 3V7YA 1TO1E 4LK2A 2XCIA 4IXDA 2CDAA 1CY6A 3S5UA 4RZUA 3RWOA 2NXCA 3EEOA 4J6FA 3PTAA 1D1PA 3HRKA 5A7HA 1YE9A 3EDCA 5IULC 1BU8A 3OO1A 4Z9AA 2FLWA 1FDWA 1MU0A 3VR2D 4QFMA 3KUCA 1XV5A 3GJ5A 2J87A 4RF5A 2CNDA 2V7WA 4LECA 3ZU2A 4Z4CA 1JJAA 1LRLA 4IUCS 4KFRA 5FWYA 3PBKA 3G0IA 1KF0A 2DQKA 1OZGA 3GRPA 1GO5A 4H6PA 3HZZA 2G25A 4KAFA 1V16B 5DHAA 4RTOA 3FTDA 2C0CA 1ZOIA 4RVNA 3OT1B 2J0UA 2YZGA 4TKZA 4N5IX 4B6GA 1U11A 1D2GA 4JJ7A 3MILA 1K0UA 1OKSA 3BXFA 4DLYA 4HLQA 1DDIA 1V37A 2WE8A 5CDFA 4E4TA 1BVSA 4PLVA 3VDXA 1OLXA 3WY9A 1A27A 3MJRA 4Y2XA 3T3EA 4CFSA 2PS0A 2PGLA 2FP3A 4KO1S 2G04A 3OY7A 1DIGA 3ZI0A 1VG9B 2EBFX 2WU0A 5B4TA 2WSEF 1JF8A 1L5QA 1DV0A 3F0TA 4EHLA 1QTRA 3FCEA 3SAVA 1BNCA 3RUFA 3ZWNA 3AB3A 2IK8A 2ADOA 4YJDA 4DIMA 3CVVA 5T4EA 1XRLA 4Z9YA 3NXKA 4W5NA 1LDBA 2W70A 1OBFO 1HOTA 1XJQA 1U6IA 3E9SA 3F47A 2IOFK 4IZ6A 1KFJB 5JJCA 1QHEA 1V7PC 1WXDA 2JI7A 1YBVA 5AR1A 5EI5A 2PG3A 3T35A 4UFNA 5IW8A 1VKJA 1XALA 3FFTA 1YZKA 3MJFA 3NMUF 1MC8A 4RE6A 3GLIE 4GYJA 1XTVA 3EVDA 3ILSA 4QYIA 4MRRA 5E6JA 1G3MA 1Z06A 1F6BA 1LPBB 2PZAA 2WTXA 2G06A 3NDJA 3QVGA 4NS1A 2Q3FA 3E18A 4WY5A 1WB6A 4AIRA 4JLUA 1EFRA 2HJVA 3UBMA 4D45A 5I7UA 1W19A 1ZI9A 3WL5A 1EFAA 3B1KA 4N8EA 4LDJA 3LOUA 5FBZA 2A84A 3BGVA 5F77A 4MP6A 3OPXA 4B08A 2WD9A 4EKNB 1JWLA 2WSIA 4X66B 2XOXA 4JDPA 4B4OA 4BV9A 4YLYA 4AF6A 4DCUA 5TV2A 3WOVA 4FIZA 4KLRA 4D98A 3NYQA 5TY0A 4PYJA 1KAHA 3P71T 1SVWA 2VF8A 3F9RA 2R65A 3FXAA 4P58A 4B43A 4HJRA 4DSZA 4IHJA 2EP8A 4FGLA 3OLCX 2OILA 1GFIA 1DEOA 2FLKA 2JFPA 4KSYA 4XSHA 2BM0A 3GEEA 4UM5A 2WBLC 4ZGGA 2OUIA 3A7DA 4MS1A 2VPYA 1A5SB 4ER7A 1Q5PA 1AUPA 1UJ2A 2E4XA 1XMJA 2CWDA 2QN6A 4M9CA 1QFZA 4M87A 3I5MA 1X70A 1HDGO 1VDMA 1OIVA 2AD5A 3BJMA 1YFLA 1C3OA 4IS3A 5IYZB 3TIVA 3FHTA 2HWKA 3W2HA 1E7MA 4UHFA 2VNKA 5C8XA 3I9LA 3EFOA 2Q3DA 1K8YB 3RTGA 3LT1A 4AZ0A 1MZPA 1YKGA 4PYQA 5AICA 5CLQA 4OA5A 2NU9B 1XHEA 3HMKA 4BNZA 5LVAA 4U9IS 4OM7A 5C2JB 1F17A 2X4AA 3PR2B 2H06A 5ALYA 3OAAA 3TNYA 2OQRA 3I73A 1UDCA 2APLA 1FSSA 4Q82A 4JIGA 2RK6A 2XODA 3ABIA 2IEGA 2E5WA 2YICA 3EXAA 4M86A 4PIPA 4R2XA 3U7IA 1EBUA 4HO1X 3OEWA 1KMNA 3LK6A 2QW8A 2W6JD 3X2FA 4BJ3A 1TQ4A 4RY0A 1T5DX 3GC6A 2D13A 2ZRDA 4RU1A 1ISIA 1ZUNA 4FB5A 1E5VA 3F3MA 4M0CA 4CKZA 1IK6A 2V97A 3GA5A 3PC8C 2IX9A 4HN4B 1XTBA 4XA8A 4Y67A 1L8QA 4RSMA 3RU3A 4EZEA 3KQYA 3ICPA 4B3MB 1Y8CA 5D86A 1ZOPA 4WW0A 1XKLA 1J2TA 2O7RA 3KJIA 4YI3A 1T5LA 5AUPB 4ZA2A 4XPIB 5EHZA 5I7WA 1N6PA 1W36B 4YCAA 3GFRA 4C3VA 4QOHA 1XKXA 4HGNA 2FPOA 4BJHB 1OKKA 1UJNA 1O5OA 4PDGA 4LRXA 1PSZA 2GFHA 1RYEA 4A1OA 3MLBA 4IDGA 3FTEA 3Q3GE 5EOVA 1OFGA 4UN2B 2QUHA 2XUKA 1IOWA 2QD4A 4KGDA 4BBPA 1XSEA 1QVWA 4GZ6A 4MPTA 2UYOA 2DPGA 3CRMA 4Q93A 5CFRA 3BBLA 1KEVA 3O7WA 1N34M 3THXA 3HSSA 1H2HA 1G8HA 4OFWA 2JKVA 2YVAA 4HGRA 5JYEA 4CIXA 4TXLA 3PQ2A 3H5VA 2PIDA 1W7AA 2WMOB 3GEIA 1V1RB 3ANMA 3GGDA 2OBLA 4ONEA 2JHCA 5DVZA 4MGIE 3Q3CA 1UC8A 3AF4A 3MK31 1XNRM 1F4LA 3S7TA 4DVJA 2C7RA 4YI5A 2NSDA 2IYFA 1YD7A 2HWXA 2E4WA 2O2CA 2A57A 4G67A 2EEZA 3TPZA 1NDUA 3NZEA 4JOQA 2NM0A 1C29B 1MAAA 4G4GA 1JG6A 2ZYDA 3FMGA 1FMTA 1X2BA 2RGAA 3ZNOA 3CRZA 2J3MA 3CU5A 3E82A 3RRMA 3T3PB 3W3AA 2GD2A 3AUSA 3BWEA 4OKSA 2R4EA 4PYRA 4KR9A 4M8NE 5IWAB 2RB4A 2ST1A 2CV0A 2X9GA 3VYVA 1TAUA 5E0OA 2A30A 2FPPB 3IT1A 5KQSA 3IEIA 4HQLA 1KFBB 1H1DA 3LLSA 1NX9A 5CCEA 4G0PA 1JB0F 3CUUA 1GLVA 1MO3A 4RPHA 1T9KA 3MJVA 1DUIA 1DGFA 3OCUA 4WZ6A 5BSTA 4C5BA 1GJRA 2YNMA 3L27A 4PYNA 4EHAA 3NDPA 5HQTA 3UNXA 2BMFA 2C97A 4QVIA 1DTWB 1N5JA 4LQ4A 2QMYA 2VP4A 3N7UA 3UJ7A 4BX0A 4NOOB 2BFFB 1CW2B 1E4VA 4HXEB 4ZAZA 3MA0A 5GWXA 2PUJA 4XJTA 4NCBA 4KLAA 1ITZA 5ENVA 5FPYA 1Q21A 1RWXA 2FWNA 4E4YA 1YB5A 1KI2A 4O0LA 4L5BA 3KZMA 4ZVTA 4A0QA 4R2WA 1TM2A 1ZNWA 4NONA 2F17A 3FPGA 5E4JA 3AF3A 4CZ2A 5K3FB 4ZJUA 3FYUC 3R5TA 3VR0A 4HLQB 4BNHA 2AOWA 2Q3HA 3BH6A 3HB1A 4RIGA 2VBCA 4FX2A 1CLUA 1OIZA 7ADHA 2Q2QA 5HF9A 5IC4A 1U0SY 2P7IA 1KMHA 2GZMA 1KXJA 1L4YA 3IXLA 1CP3A 3N3BC 1NW4A 3OZVA 2C77A 1PJZA 4IJQA 4ZKEA 3AVVA 4GKKB 3AGPA 1HRDA 2KBEA 4QJBA 2WFAA 2PGOA 3GF4A 3LKDA 3MT9A 3UFXB 2OUKA 5JBIA 2HO4A 3Q1LA 3R6DA 1NAHA 1DC7A 1XD2A 3KHSA 3EPHA 3TLMA 4A91A 4HLDA 2GJ4A 2Q3MA 4ZQEA 3ZNQA 1TQ2A 2FU5C 1OMOA 4ZVSA 3ZKWA 5JEEA 1KI7A 2RHMA 4NHOA 3WLMA 2RHDA 4B7GA 4GI3A 4KNWA 5LP6B 2GM4A 5BYKA 1GVNA 3ND7A 4IJ6A 4W8GA 2JA2A 3ZQ4A 4IH1A 4M1ZA 5JQWA 1F4IA 3LQYA 3MJEA 1XP8A 5JR3A 3NGXA 4MS3B 5FLYA 4HNGA 1KVRA 3K9BA 4YDSA 1W5EA 2IKSA 3BD8A 2R6ZA 3BUSA 1ICIA 3H5NA 2I7VA 4HBGA 5ICMA 2PS9A 3BDVA 1XRPA 2DSNA 2UUCB 1BEEA 3PFKA 2YMQA 1BKYA 1MRZA 2EJSA 1C0EA 2B5WA 2BGLA 3DD1A 4WERA 3RYFA 4JIMA 2JF0A 4G4OA 1YFZA 3B3AA 4IFBA 1TT7A 4OPMA 3J7AS 2VK2A 1T2EA 1IDOA 1EE2A 2PBFA 3C3XA 2OBNA 4YACA 2X2PA 1R4ZA 4IGAA 2Q8NA 1MENA 5ALQA 5C7IO 2R47A 4UBJA 4TZTA 1JAYA 5IWAM 1L3BA 3LQ2A 2IXBA 4PTZA 3B7ZA 1DO2A 3KK0A 4KV9A 3ZZUA 3MW8A 4MKGA 2X5KO 1SQSA 2I8CA 4JYCA 3DEJA 2C9DA 4N01A 4N6GA 3ZDQA 2A1TS 4KWHA 5BSMA 1SVSA 5BOSB 1GTMA 4A10A 1FA9A 3MCUA 3WLNA 3BG5A 2VPQA 4M98A 5DM2A 4ITRC 1ZH4A 1FBNA 4NOMA 3ZY3A 2ZJYA 2JGRA 3BS4A 2BFCA 4ZYYA 1QVVA 4LF8B 1T6OA 2I1QA 4WKNA 3TZEA 1NQWA 3S2EA 3WKDA 4EB8A 4TWRA 2YQ5A 1JSZA 4ARBA 4L0QA 5KX5F 3KSXA 4D2IA 5IKPA 4O4LF 1CY2A 1U6JA 3UT0A 2ANCA 2FN3A 2GN1A 4RGQA 3NCTA 4YVFA 1MOQA 2JARA 4O2RA 2B0CA 3HCRA 3MWEA 3ZU4A 2NVUB 1IBLB 2ACEA 2I4LA 3VR6D 4N47A 3NYWA 3CVYA 2DLCX 1EZZA 1SUWA 3HCFA 1WBBA 2Z2ZA 3PNYA 1I3CA 2YDYA 4GBED 3MTEA 1YQEA 3RWBA 3WDSA 5JU6A 5HKKD 1G1AA 1YA4A 2RGRA 3M8KA 1PAUA 1T10A 4IRMA 2AZTA 4XM1A 5TSDA 3WNVA 1HFEL 2WSCF 1I7NA 2IZZA 2OPFA 1OLUB 3CH6A 3HUEA 4GKBA 1M1UA 5ALFA 1RQRA 4BC1A 4LF9B 2YIMA 4IMPA 4L4SA 3K5IA 3UMJA 4AF7A 4NCXA 4PYKA 4X5OA 4BO5A 5F3RA 4F2GA 2CT8A 3MQFA 3I12A 2JLZA 1M7GA 4GZ3A 2K5UA 2AXPA 5E6RB 4C08A 2FNAA 5J4YA 5KNCH 2HBYA 1ZITA 1ECGA 4ZQCB 1PJQA 5KQPA 2JDID 2HMWA 1P4JA 4ZCQA 5T8KC 1KO7A 2BJWA 3A6KA 3QELA 4GBGA 4LQLA 4OIFA 3UENA 3RFWA 2J6BA 2NQ2C 3A8TA 1Q3BA 2JFOA 3O75A 2OGUA 4DLKA 5DLPA 1Q7EA 3TPCA 2R7MA 4S12A 1GTJ1 1HM5A 2G71A 1C5KA 2QSZA 3N07A 1GHTA 3OJWA 4KQHA 2KZUA 4P3YA 1I2DA 2B1GA 3DEIA 4NXNB 2WAOA 2ISQA 3RT7A 3TLCA 4F8EA 3OOYA 4I6GA 4U7TB 1U7PA 4ERXA 4R71A 2K7ZA 4MPDA 4TMTA 3ST7A 3EJ6A 5L9AA 3UOGA 2BTEA 1M8KA 1HL7A 2VP3A 3CY6A 3A0RB 1NV8A 2NU6B 3F2IA 3R5KA 4JLNA 4DJDC 1YCGA 3IVXA 3IOEA 1N1MA 3HSYA 1E1CB 2JCBA 1GGVA 2BYTA 1E1NA 2CLMB 5FWXA 5HIKA 1EFCA 1KO5A 3TZKA 2IPAB 1YFKA 4JSTA 2J3EA 1JH8A 3RUIA 1TL7C 3LC1O 3V8RA 3AERB 1XZKA 4BZXA 2G36A 1MBZA 3HQ4O 3WVNA 2X3YA 3NUGA 3D1JA 4L57A 3IR7A 3ADDA 1CY1A 1DGQA 4RMNA 3NNNA 4LPKA 4QATA 3DOEA 3I9FA 1T6NA 3M9WA 3INGA 4EKDA 4YV2A 2WU4A 2HI0A 5LP1A 1IXYA 4DHEA 4CCSA 1JR3D 1VBNA 2P9EA 3BRWD 4NE9A 2AZDA 3DTVB 5GV7A 2PWBA 3OJLA 1DFGA 2ID9A 5FEMA 1WUJS 2F64A 3O82A 3V55A 1S3SA 3D7MA 1M6VA 4ZK2A 3SLRA 2BPOA 2B6NA 2G1UA 1ISRA 2AX4A 1TCAA 3IR5A 4LZJA 2WIDA 2XRFA 1QHIA 3S70A 3HJUA 4YRTA 1L3CA 4P31A 4EUFA 5ALVA 3JQDA 4CF4A 1LXCA 5CPFA 4GXNA 1XLTC 4DNQA 1UQUA 2VSFA 2A1UA 4IVQA 3NP9A 2ZYHA 5FA6A 4U7HA 4YALA 4AJOA 1ZOOA 3IQZA 3L7JA 4BZQA 1NXSA 1YDEA 2HF2A 2X9NA 2MR6A 4HRVA 2DR2A 1PGOA 2GWHA 1K08A 1TVKB 2EQ5A 2ZSBA 4JI4B 2JFWA 2YUIA 1L5RA 1V1RA 2O6HA 3L1JA 3L8FA 5B3JA 5LA6B 3TB4A 5BW4A 1TQ6A 3WGYA 4PPNA 5AKKA 5HGXA 2HH9A 1NP6A 2WC1A 2N3ZA 1XQXA 4DUYM 1F2UB 2OYCA 2NZXA 1P8JA 2X5XA 3SS8A 1SURA 2C9ZA 2EFJA 3DPIA 1A2BA 4BMNA 4ZJPA 4IILA 4O2LA 5LQDA 2JD1A 1W47A 2CD9A 2W2KA 3HY4A 3P2JA 4PSUA 5FADA 3KLNA 4DCSA 3AOGA 2ZTVA 4MCIA 5DNDA 3D64A 2OK8A 3ZHBA 4BDTA 1PL7A 4D81A 1MJGA 5BSWA 2QTVB 5CUQA 1CNFA 4KCGA 5J4LA 3N87A 1TJPB 3LT2A 4BQIA 3K6RA 3ZR4B 1NHGA 1Y42X 3UT5B 1C4OA 1LI4A 3DCJA 3HDGA 1VRVA 1NG1A 3WK6A 4ZI5A 3U4CA 4QLBA 1VYHA 4RDIA 1U8ZA 2A9PA 2E89A 4TRJA 1OTRA 2PD6A 1FFXB 3QLUC 3VKVA 4URXR 1G60A 1V9SA 1YUNA 1L2BA 4IW3B 3A6FA 2I3ZA 1L5HA 5ALTA 5E3HA 4G1CA 4IFEA 3ROEA 5B5SA 5CB0A 4RADA 1RAAA 2RC6A 2ZJ0A 4Y2VA 3TN7A 4QEDA 3U9SA 1G8YA 3QA3E 4IBFA 2X0EA 4YYZA 4OU5A 1PI3A 1KJZA 3KZKA 5TGZA 4DYDA 3ENWA 3DVRX 5AVWA 3ROGA 4K0RA 4L9SA 5HXAA 3AVXA 2FP4B 3D6VA 1EP2B 1QKJA 4BCBA 4Z6KA 1CHDA 3UWDA 1AKQA 1ESMA 1Y6QA 4INAA 4G86A 4GHWA 1Z8DA 1UPCA 2NYRA 2X2OA 3H42B 2HRRA 1YB1A 1FRQA 3WRWA 1ZH8A 2Z2KA 2ZJOA 4BKRA 2P40A 4D9MA 2B4QA 4JI7M 3AHGA 2A0UA 1FNCA 3KOZA 4A73A 3OEEA 1X8XA 1KDYA 1U9JA 4HPWA 4Q6BA 1D6MA 1MN6A 1P7WA 3FPLA 4RGYA 4B6JA 2WUGA 4YMTA 1R5LA 4GC9A 4Q1FA 2Q6KA 1DE0A 4RGVA 4Y2QA 5D1NA 5ICEA 1IBSA 4WFKA 5F7ZA 2X0KA 3R2JA 1XZDA 2FMKA 3UVEA 4FMDB 4GMXA 1K6IA 1M1XB 4HYEA 4BTEA 3NIWA 2F6RA 3T99A 4CGYB 2QGNA 1Q39A 4K9MA 3MWKA 4RNDB 1XU4A 1HORA 4EG5A 1JIJA 1IJBA 1I10A 1JPNA 4M0FA 1TPYA 3OFJA 3E15A 1SVKA 3GFVA 1UFVA 2CY0A 1FMFA 5DLQC 3QMWA 1T4CA 2HDNB 1RSZA 3GGSA 3G7UA 4EB6A 4O4IF 5L7YA 4UUQA 3O9ZA 1O96A 1ZD1A 3R7LA 4B2LA 2NNWB 4BFZA 3ANSA 2WIBA 3LUGA 3SGLA 1MC5A 4NMHA 3R76A 1ZMUA 1XNQM 4HDCA 4ID9A 2HD4A 5B1YA 1U90A 4AM8A 2CKMA 2ATEA 4QPCA 3RD5A 5CB4F 1FX1A 1U65A 2AJ8A 3SOPA 1EEHA 4RZQA 1G18A 2FWIA 5E7QA 1K6XA 2VRWA 1U8UA 4JODA 4DC1A 5F7XA 4LG1A 1A3CA 3B70A 1P29A 1C9JA 3PX2A 4U2FA 4IG9A 1G6KA 4ZI2A 2ZJ8A 5LU9A 2BGTA 1V8BA 3PXGA 1WUHS 3GRUA 1EFDN 2SCUB 4DV5M 3QVGB 5CVEA 3TLKA 4C14A 2F1JA 5HW0A 3IAUA 1DAGA 2Y66A 4LX0A 4P4LA 4DRZA 5AI9A 4EVIA 1KERA 3Q9NA 2Q4EA 3AY7A 3GPPA 4YCSA 5DWVA 3SOZA 4C6HA 4RWEA 3F74A 1RT9A 3HM9A 3KSAC 2JLAA 4JSYA 4EJFA 1GTVA 1Q0LA 4MTCA 2ZLBA 4AVYA 4DC0A 1N75A 3BSYA 3UMFA 4P4GA 5C5IA 4LF4B 5TT0A 4E94A 3QOFA 3ENKA 2VQEB 1BCRB 1WZEA 4F8YA 3CPEA 3DAPA 1YK1A 2ASVA 3IBTA 4GG1A 3UATA 1WHTA 3R7NA 5E9QA 3E7WA 1JKJA 2OWDA 3ESDA 3MG9A 3B1YA 1I7LA 1W88B 1HMYA 2BHNA 3M4NA 3GRYA 2X8JA 1M2VA 3KJQA 4HDNA 5A0FA 1T9DA 2C7OA 2HDHA 1G16A 2WZCA 4BRSA 2XCTB 4PRZA 2VPTA 4JR0A 3IAFA 2NYAA 4HH4A 4ER6A 3J81S 2FCRA 4NCNA 4NSNA 3SS9X 3C97A 4I55A 3WHKA 2HV8A 5HR5A 5LDDC 1D1SA 4QTXA 3Q8MA 3OIWA 1P75A 1OPRA 1RIIA 4IO1A 5BW8A 2KMLA 3EJWA 5KAPA 2VZ9A 2L4EA 3V80A 3CXUA 1ESDA 1UBTS 4J4HA 3BXEA 3IESA 4PWYA 1BE8A 1BTOA 2W6NA 1HDRA 2OECA 3OZEA 4MUYA 3RVDA 3RRXA 3KKMA 2VKTA 2QMQA 3QU5A 4TMXA 3NI2A 4F2WA 5FEUA 2PJUA 3GDGA 4UU1A 1T5HX 2AYZA 5EKTA 4JT2A 1M5TA 4PR0A 2AQKA 4ITVA 3PF9A 1JNXX 4OQEA 2WY2D 1AO3A 4MW6A 3VC2A 4OGGA 1I2MA 2WJZB 4D3YA 2PZ8A 5DT2A 1P4HA 4CLXA 5ESDA 2MJ5B 1RVDA 1VP9A 3L7KA 4RK7A 4II7A 2OO5C 3A4LA 4LSZA 4NU0A 5CX1B 2OFWA 1U2DC 3GN2A 5DTMA 3NEYA 4AK9A 1MAWA 1Q1EA 1TGYA 1COWA 1VG1A 1ISMA 4JVSB 4XSGA 3W6ZA 4B79A 4Y1RA 1C14A 5ITWA 3UPTA 3FKSD 2WU1A 4MUFA 4XTRA 4UOZA 1SA0A 1YULA 4MW9A 4Y2JA 1XTKA 4CDRA 5AKZA 2V0CA 4CETA 1Z4JA 3T9DA 2JFVA 2Q4BA 1LTQA 3LW7A 1POWA 3OHSX 1ZCFA 4JJZA 2QX7A 1P8AA 5PGMA 4PPQA 3WGNA 1CJCA 2BCEA 2INGX 4HMOA 4ND8B 3EIOA 5AKHA 3TZBA 3W6UA 3E4CA 4A6EA 3DQZA 4QUIA 3KXEC 1JIIA 1OFHA 2EFCB 3IUEA 3CW9A 4XZ3A 2Y0TA 2OA0A 3SP1A 1MIOB 4YYEA 4EDHA 3QBTA 4EJMA 4B9EA 4I81A 3FOCA 4LV8B 2OBYA 4K6OA 4K5QA 4IF6A 2VJKA 5T6BA 1S2DA 3DZFA 3JVIA 1P2SA 3EXEA 4ATNA 1AIPA 5FWNA 3DFKA 4ARVA 4WLVA 4X1YB 3OPYI 3P4XA 5FUBA 5IG2A 1HEUA 3AESB 2OGTA 4NJEA 4MCHA 5DT9A 4CL2A 5CD1A 1UAYA 2L09A 3AZOA 3LQFA 3LVWA 1KBZA 1KH2A 4KQ6A 2Q41A 3JD4A 2H2DA 2W2KB 3QUCA 2WUWE 2YC2C 4OHMA 1LDNA 5SYNA 3DCYA 4N0MA 2Q4RA 3WMFA 2Q28A 1UOQA 2PMBA 5KTNA 2OXIA 1JFFA 1FP4B 3C98A 4DA4A 2WG2A 1Q7CA 2R6FA 4XUCA 4MB7A 2R5WA 4ZK6A 1N0IA 3OFSA 3TIXB 2XQKA 2PUFA 2O5VA 4FFLA 4ZPXA 1C2TA 3C1TA 4REMA 3NHRA 1C1DA 4PRKA 1D0LA 2EKZA 5FT9A 4QUHA 1H6CA 2J5KA 3GDFA 2YCLA 4GQIA 1YQUA 4RTNA 2SKCA 3B8HA 4YRQA 3SQDA 3W90A 4EI2A 2AV6A 3KSBC 1KHTA 4DZRA 1CR4A 3CTWB 3QOXA 5AVYA 2NPIA 3ICCA 1F9AA 1QGZA 1YQ9A 5CEFA 4E0BA 4LGYA 2FWRA 3LK7A 4L5CA 5GQSA 1XQYA 5MHTA 2FLVA 1YLAA 3DWIA 1KBQA 4MW7A 4AX8A 5EP3A 3I0NA 3O4IA 4BEVA 4QUGA 2P77A 5BO5A 1T0IA 4E07A 3AFIA 2AHOA 2FW7A 5LYYA 3WDKA 3PC2A 5K20A 2G7MC 2I4IA 3BSFA 3G9ZA 4HPJB 5IVKA 2YWDA 3P9NA 3NAGA 2GZRA 3ZU3A 2IF0A 3TG2A 3VBEA 5AJUA 2HFKA 3RK0A 1N5KA 4P35A 1UWCA 5CVDA 4KPYA 4RKYA 3RTEA 4U2GA 3ZDDA 2O8NA 3BPSA 4LRWA 4DIBA 4PZYA 3VO8A 1AF7A 2FN4A 1U3WA 3AFGA 5FOVA 2ECQA 3VPAA 2FETA 1MO2A 3HCCA 2FX3A 3VR4D 1W2WB 1J0BA 4EYQA 5A1TA 1V26A 2VDKB 3DKVA 3EGDB 4N3GA 1U9YA 2JIBA 3AJRA 2XX3A 4YBRA 1Q0PA 1L7BA 3OF2A 3TL4X 1DTEA 1Z5AA 1TF0B 3H87A 2AD1A 1IAQA 2QX8A 4UVDA 3FNHA 5JCZA 2N0SA 4QYTA 4MGHA 4GSKA 2QLJA 3DMHA 3JQ9A 2KX7A 3MN1A 4LS3A 3CKYA 3DVAA 4DYHA 1DRJA 5J47A 1U0TA 2VYND 2QLBA 3P9ZA 1CQXA 3RC3A 4AB1A 4AYWA 5LLTA 4JI5B 4YS6A 2MMGA 2WUFA 3KWFA 4IY1A 4LBYA 4B34A 3EW9A 1KH1A 1NR1A 4NICA 3PPVA 1AGYA 1Y3FE 2PO7A 4LHXA 3FDZA 4M38A 2XZTA 5CLFA 1MRNA 2FUG1 4OSOA 2BR5A 4M88A 3TM5A 4U9UA 4MUBA 4RIIA 4CIVA 2C94A 3IQGX 2BTQA 4FHFA 4BNKA 2DFKB 4EO7A 5JYBA 4CF6A 4B3FX 4C9BA 3ZE7A 5IT5A 4F46A 1SGWA 3JYNA 4YXWD 2IH2A 4QXQA 2FPGA 1FDOA 2FQ1A 2GUGA 5CIYA 3I4YA 5K6RA 721PA 1FIUA 1SD2A 3IKVA 4JP2A 1K2WA 3W9YA 4CV3A 3KQLA 4ND4A 1NVMB 1SG0A 2QL9A 4ZAGA 4WSOA 3QJYA 4I4TA 2SCUA 1IEXA 1RPAA 4KMRA 4WFIA 4MYTA 3BWYA 3U1TA 1ESZA 4MGIR 3SBJA 1RHJA 3I05A 1IULA 1LRJA 1MOZA 2VTBB 2BSXA 3U5ZB 3VAYA 4Z49A 3A1EA 5INTA 2AQHA 2FH0A 3VKFA 4B7XA 4ETWA 1Y8RA 4Q16A 3HO6A 1M9NA 3DAFA 3B6MA 2DWUA 2XZLA 1P7VA 1AB5A 2JVJA 2E5LB 3ES9A 2OLKA 3PPYA 1AUOA 1P2DA 4NFYA 3WL3A 4OP2A 5BSKA 1EDEA 1U7ZA 2W2TA 3FMVA 4R3WA 4A8JC 3BL6A 5K8LA 2GEBA 4R41A 5K8UA 1Z33A 4HS4A 1RABA 4RD2A 4W9NA 2H1FA 1AKNA 1M8PA 1YCHA 3IV6A 4PX3A 4X84A 3C3DA 2GFQA 2B8EA 2QIPA 1GNQA 1M7HA 3H4TA 1IFXA 4HDNB 3U13A 4DAEA 5DGDA 2VEDA 1Z0DA 4HNAA 3HY6A 2QRGA 3GPXA 1SC3A 2Y68A 2YNMC 5F2OA 3PC7A 4LE0A 1DELA 3EXHA 5HJEA 2DWZB 1R6AA 2C1ZA 5FO0A 1PNVA 2QYSA 1K2VN 1NI5A 2WHYA 4HXFB 4R1NA 2BFBA 5GADl 2J9FA 4P83A 4HI0E 3STTA 2GNPA 3O4GA 2PEZA 2GR9A 2VP2A 3CM0A 1C3XA 3EUFA 4NKRA 3A6PC 2W0SA 4BO1A 2GYYA 4OU4A 4DF3A 1RLOA 2FSGA 1IU9A 2MDTA 4IJKA 4X64B 1DLIA 2QAGB 4OKNA 3RYIB 3IHPA 4IOLA 3MTQA 4LWOA 7GPBA 5DM60 1IXSA 5DI9A 1KJQA 3D59A 3QVWA 3ETGA 4FHEA 4ZI7B 1WM1A 3SLKA 3L04A 2JAPA 4YIHA 5U9CA 1PHPA 1XDUA 1P6QA 5CCBA 1J0CA 4XCVA 5H9VA 2ZFUA 1KO1A 5J40A 2I4MA 2P5TB 4GHAA 2W48A 4YCMA 1FL9A 4ZHQA 5A3QA 3M49A 5KU7A 2BL4A 4DDHA 4MCJA 5K0GA 4IHJF 3S40A 3ICWA 3OF3A 2FMXA 4OXYA 4R6XA 1ML3A 4IYJA 2RGOA 2OKCA 2O1WA 2QS9A 2PO5A 1QBGA 2RJ3A 3G2PA 4C2UA 4URFA 1ZU4A 3F67A 3R5FA 1L4GA 4ZOLA