3AOEC

Crystal structure of hetero-hexameric glutamate dehydrogenase from thermus thermophilus (leu bound form)
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
417
structure length
417
Chain Sequence
b'LKAYRPPEDPGLWDTYLEWLERALKVAGVHPTTLEYLAHPKRLVTLSLPVVMDDGKVRIFQGYRVVHDIARGPAKGGVRLDPGVTLGQTAGLAAWMTLKAAVYDLPFGGAAGGIAVDPKGLSPQELERLVRRYTAELVGLIGPDSDILGPDLGADQQVMAWIMDTYSMTVGSTVPGVVTGKPHALGGSEGRDDAAGLGALLVLEALAKRRGLDLRGARVVVQGLGQVGAAVALHAERLGMRVVAVATSMGGMYAPEGLDVAEVLSAYEATGSLPRLDLAPEEVFGLEAEVLVLAAREGALDGDRARQVQAQAVVEVANFGLNPEAEAYLLGKGALVVPDLLSGGGGLLASYLEWVQDLNMFFWSPEEVRERFETRVARVVDAVCRRAERGGLDLRMGALALALERLDEATRLRGVYP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate dehydrogenase
publication title An unique allosteric regulation revealed by hetero-hexameric glutamate dehydrogenase from Thermus thermophilus
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 144
structure length 417
sequence length 417
chains with identical sequence D, E, F
ec nomenclature ec 1.4.1.3: Glutamate dehydrogenase (NAD(P)(+)).
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00208 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine dehydrogenase
C PF02812 ELFV_dehydrog_N Glu/Leu/Phe/Val dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1210 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3aoeC01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3aoeC03
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 3aoeC02
4TZTA 4MDHA 4OKIA 3NX4A 2UDPA 5HRUA 4MINA 1TT7A 2XPCA 2Z1MA 3PQDA 3PLRA 3RBXA 1JWAB 3BAZA 2VRBA 3B1JA 3OJFA 4KDEA 1FDWA 1NFRA 3V1TC 4E12A 3JV7A 3ZWWA 1LA2A 4CODB 1Y8RA 3DXFA 1ENZA 3NUGA 2BFOA 2B0JA 2ZYDA 4W82A 5JAMA 3RKRA 3DOCA 1VE9A 2VUTA 4LK3A 3OMLA 2P9GA 4FBGA 3QWAA 3AM3A 3F6YA 3I1JA 3S2EA 3GEMA 1NNUA 3PHIA 5G2OA 4K1LA 2QRLA 3QRWA 1HE4A 4KUEA 3DDNA 1WLYA 1IUKA 1PZEA 4DIFA 1I2CA 4FFNA 4FOSA 1Y8QB 3GH3A 2X7HA 3CMMA 3BZUA 4EITA 3D5QA 4ZQEA 4IS3A 2FPPA 4IY1A 4ZD6A 2HMUA 1PTJA 2JCYA 2UUPA 4XQGA 2VZ8A 4E13A 2ZJ0A 3QIVA 1ZCJA 1GY8A 4NG5A 1EVZA 4E0BA 4MIOA 2O50A 4JP3A 3DMTA 3D3WB 3ZW8A 1AXGA 5I8WA 1P1JA 3AJRA 3AWDA 5LCXA 5JE8A 1LRLA 2NQTA 1H6CA 2VOEA 3X2EA 1DRVA 2VWGA 3ADPA 3GZ4A 4RVFA 4JN6B 1YQXA 1EQUA 2YW9A 1GD1O 4BKPA 1NQOA 4EI2A 2PD3A 5EINA 3M2PA 1U5AA 4BNNA 1DC6A 4DC1A 4YJHB 3LZ6A 1NFQA 3GDOA 3Q9NA 5DCUA 1Q1NA 3ZWYA 1C1XB 2HMWA 1A4IA 3G1UA 2GNAA 2VUUA 3L9XA 4S3MA 4AJOA 5KOIA 4UEJA 4X54A 1HL3A 1N7HA 1LJ8A 3WYBA 2PH5A 1RYDA 3P7MA 4UVIA 3CZRA 3VTZA 1W73A 2DT5A 5FEUA 3F1KA 4FJ0A 4PLWA 4XB1A 5H82A 4Q3EA 3RU7A 1F06A 3PRJA 1K89A 1Y9AA 4W6ZA 3SLGA 3CMCO 5C7IO 4ZQGA 3W1VA 2PH3A 1B7GO 4YRBA 2V6GA 1P1IA 3IKTA 3KZVA 3UUWA 4R9SA 4EUFA 3MJVA 3WLEA 3ZNOA 3GNQA 4Y67A 5I7VA 3QV1A 2P4HX 2PGLA 1C0LA 4MIYA 3LF1A 5A9SA 1I3NA 2WDZA 1AHHA 1EUZA 5BT9A 5LDHA 4ALLA 3GFBA 4M89A 3RUCA 1QYWA 4KOAA 3W8FA 5JMPA 1T2DA 4R1UA 2D5CA 1HDRA 4ZA2A 1ZK3A 2O2SA 2Q50A 5CEJA 1BHSA 1BVUA 2E6UX 2P5UA 3HB5X 1E3IA 4I5GA 5THQA 2P4QA 1P44A 2VTEA 3HADA 4LRSB 4GX2A 4IDFA 1H2BA 3JQFC 1LLCA 4MKZA 4OSPA 1SAYA 3DMYA 3S2FA 4MIEA 3ZHYA 3RKUA 1GQYA 1XA0A 2Q2VA 3KSUA 1F8GA 1VPDA 5H81A 2GPTA 1WXDA 1DJQA 1CEQA 2CNBA 1Z75A 1A9ZA 3KTDA 4GLLA 4NDNE 4FW8A 1PWXA 1CRWG 4FDAA 4R9RA 4Z0PA 3ZN2A 4BGUA 1KOLA 4XJSA 1JLLA 2RAFA 1DLJA 2CF5A 5JO0A 2Y0DA 1WDMA 2X9NA 3BMQA 4B8ZA 5GZ1A 4IMRA 3GN1A 1BWSA 1GR0A 2HK9A 5ILOA 3RD5A 2FZEA 4W99A 3GQVA 4BIIA 6LDHA 1LXCA 4CLOA 2PWZA 1UDBA 4PZEA 4E5YA 2CDAA 5MDHA 2C7GA 5ITVA 3AFMA 3IAHA 4BQPA 3GUCA 1EDZA 2C82A 4YJDA 5T57A 3WWYA 3H9JA 1ZEJA 2GERA 5TJHA 4B3HA 2PD4A 4YAEA 1D4FA 3GF4A 4UUPA 3QP9A 1RKXA 4R54A 1M2WA 2DTXA 3WBBA 4YJGA 4K9DA 5HS6A 4F6CA 1ADBA 1EE2A 1IULA 4DRYA 2QG4A 1U7TA 4BMNA 4MP3A 3IOYA 1GTMA 4WE3A 5T6BA 4BNTA 2OBYA 2OHXA 2OMEA 1LDBA 5IZCA 4B7UA 5I9LA 1PSDA 3AFNA 3K6JA 5G0WA 2J8ZA 2EKPA 1D3AA 4CLEA 3C3XA 3ONFA 4WCFC 1A27A 1Y5RA 2BLLA 4J7XA 4RVSA 4GAEA 3UF0A 2AHRA 1KEUA 5KVSA 1C3VA 1ENPA 2IRWA 4CPDA 1EK6A 3ZH2A 4BNWA 1PGJA 2R2GA 4BNUA 4LN1A 4BO7A 4G5HA 4GMGA 5TF4A 3B20A 4U0KA 3H2SA 4YT4A 1PJSA 1IL0A 3ROQA 1B2LA 1E3WB 4URFA 3LSYA 5JO9A 2GN9A 4M49A 2BFAA 1HE5A 2EWMA 1OC4A 1UDAA 3ABIA 3GFGA 2BGMA 1C0IA 3QWHA 2OGUA 3AM4A 4Q3CA 1P74A 1PZGA 4Y6RA 1C14A 1UDCA 4ND1A 3M1AA 3LC2O 3O9ZA 1J49A 2ZKLA 4PFJA 1KVQA 1PIWA 1XIVA 3ANMA 4Y9DA 4KDFA 4DBVO 5F3RA 4JJIA 1PWZA 4NH4A 1QYCA 4ZGWA 5EQFA 4NI5A 1DAOA 4IJKA 2PA3A 1ZH8A 4EEZA 1QYDA 4HBGA 1JA9A 3JQAD 1PU2A 3C1OA 1BTOA 1VM6A 1H5QA 2JFHA 4FFOA 1E7MA 4LW8A 5C7LO 5F21A 3R1IA 1X0VA 2CD9A 3ZWXA 4TRJA 4CUJA 1UXHA 3MWDB 4NJMB 3VPGA 4CMIB 1AXEA 5AOVA 1I32A 1JWBB 3DBHB 1WZIA 3FNHA 2NVWA 1LLUA 1EVYA 1NM5A 1RM0A 4UUOA 1CQJA 5L95A 1YONA 9LDTA 4ITUA 3RBZA 1A4UA 3PQEA 3I9LA 2RCYA 4BNVA 1MV8A 1GDHA 3GNTA 1JAXA 2X5KO 1ZW1A 5DCWA 5HM8A 2X1HA 1I3MA 4XYLA 3GVCA 1P9LA 1QV7A 4PG5A 4XKJA 4K28A 5I8ZA 2R00A 4E33A 3PYMA 2OBNA 2GZ3A 4NBRA 2NM0A 1U2DA 2C5AA 3ZV6A 5L53A 1MFPA 1EE9A 4G81A 7ADHA 4A2CA 1I24A 2AEFA 2PZJA 4CV0A 3WGGA 4PLCA 2O2YA 4E2YA 4XYGA 1VL6A 4RCVA 3H6KA 1ISMA 1IE3A 1JW9B 3B6ZA 3LVFO 4OXKA 3PVZA 4D0RA 1LQTA 2C5EA 5FF9A 2X5OA 2ZK7A 2VUSA 2NNLD 3GPDG 4AJJA 1SPXA 3OQ6A 2JAHA 3Q0EA 4IJWA 4AG3A 1Z6ZA 3KEQA 2WTBA 4BO1A 1ONPA 3E8XA 1HT0A 5G4LA 3HFGA 4CM9D 3JD4A 1E7WA 2VTDA 4MP6A 2EG9A 3UXYA 1K5HA 2JKVA 1EK5A 1K6XA 1YO6A 2F00A 2YUTA 3KVOA 3PHJA 4QFCA 3GMDA 3I4CA 3WLFA 1I2ZA 4GVXA 2Y1CA 2YY7A 3BMCA 3L0DA 2EF1A 2JCVA 1NAIA 1LLDA 1NR7A 3CXRA 3NAQA 3KHUA 4XR9A 3UGKA 3GHHA 2JHGA 3T4EA 2NU8A 3UN1A 3H9GA 1CDOA 3ZDFA 5TS3A 3FNEA 2QX7A 3IC5A 5TQVA 3PHLA 3WFJA 1PR9A 3WYEA 2AMFA 1KC3A 2C54A 1VC2A 1DIAA 4PGFA 4HNGA 4UULA 4C7JA 3WTBA 5JXWA 4W9NC 4UUMA 3TZCA 3ZU4A 1IB6A 1XU9A 4JROA 3T7EA 1HYHA 1JVSA 4BL5A 3O38A 5BSEA 1QP8A 1TLTA 4U7WA 4I9NA 3N7UA 4IGEA 4CM8A 4E2ZA 4LVUA 2ZIZA 3DO5A 3DBLB 5IXYA 3TWOA 5JCXA 4CQMD 1EVJA 3ICPA 3OIDA 2FSSA 4J91A 4XQCA 4ILKA 5DNAA 3ZI0A 4E5KA 2Q2WA 2GGSA 3HN7A 1F0YA 1X7GA 1WW8A 3FRJA 5EJ2A 1V3VA 4ND4A 3UH1A 4DMMA 5CP8A 3W4JA 1EVIA 5JDIA 4AJEA 1KIFA 1F17A 2J6IA 3K9QO 5DOZA 3ROKA 4D3SA 3OBBA 2VHYA 2VT3A 1Y8RB 1KVUA 5DP1A 3W6ZA 3WB9A 3NYWA 2I6TA 3PTZA 4OOFA 1B8UA 3H2ZA 1J6UA 1WPQA 3NTQA 3IP1A 3PWKA 3PJGA 3E9QA 3BIOA 1DJNA 2X0NA 4NBVA 1OFGA 4BHTA 2QHXA 4XX0A 4DBZA 3H3FA 1JU9A 1KERA 1C1DB 3PWZA 3G1TA 1M66A 1UUFA 2ZQZA 4WNCA 5T64A 4BS9A 5U1PA 2IYOA 3KO8A 1HLPA 3ZHZA 4YR9A 2EW8A 4R3NA 2A4KA 2H6EA 2HRZA 3NV9A 1MX3A 3OJOA 3RFTA 4J7CA 2BHLA 4NK5A 3H5RA 1DHTA 3L77A 1DIGA 4WEQA 3VDQA 4BB6A 3DHYA 1GCOA 1YB4A 1R15A 3JD2A 2XAAA 4YTEA 4CV1A 4CMGA 4CMHA 3GA0A 1CWUA 3LK7A 5JAIA 4RGBA 1SEVA 1XU7A 5CAEA 2CDBA 1WDLA 3I4FA 1NFFA 4QXMA 3MJCA 5CDUA 1DC3A 4GBJA 3GLQA 1DFHA 4K6FA 1IZ0A 2FN7A 1DPGA 3JQ9C 1V8BA 4BNLA 1EUCA 3EVNA 4J90A 5IDQA 4FFMA 5ER9A 4ALJA 3QW2A 2OP0A 4YYZA 4II3A 1YL5A 4BGEA 1AUPA 4Z3KA 1UP7A 5G4KB 3QJ5A 4FOOA 3RQSA 1NR1A 1EDOA 4N18A 5L4LA 4Q39A 2BKAA 2CY0A 1O0SA 5A02A 5BNFA 5JDCC 2VWHA 3U4IA 1ZK4A 4Q3NA 4CM1A 5DN9A 1Z45A 4RF2A 2B37A 4RV9A 4BO0A 1YL7A 2HKIA 1ZKMA 1CF2O 1UZLA 2BRUA 3H5AA 2E4AA 4YRDA 5IFLA 2VNAA 5TLSA 3ONEA 4M1QA 4Z9YA 4PLFA 4HFRA 3HN2A 2D3TA 1NQTA 1F12A 2JCXA 3VPXA 1DIBA 4KWIA 2W2LD 1Q2XA 1DIHA 2VZ0A 5TX7A 3V8BA 5A9SB 2NVUA 1G1AA 3H9EO 4RPJA 2ZTLA 2ZB3A 2YZ7A 2B36A 3KYCA 5DBFA 4CLRA 1O9BA 3F47A 4OSOA 1ZIDA 3ZWAA 1PGQA 1EZ4A 2EGHA 4JBIA 2VYNA 4WLFA 3HB4X 2X9GA 5DZSA 4HUJA 3NGLA 3TZKA 1E1LA 2EGGA 2IZ1A 3MTGA 2FP4A 2AXQA 1R12A 1I30A 2WMDA 1JN0A 5L9AA 4UUNA 2ZYAA 3GGGA 3OEWA 3PJFA 1YB5A 1C0PA 3FTPA 1GL3A 3FBGA 4DQUA 4U8GA 1R16A 3ASUA 2C7VA 4YA6A 1MC5A 3FI9A 3JD3A 2HJRA 4BNYA 3C24A 3MJSA 4TKLA 1O5IA 1CETA 4CMEC 3VVBA 4HWKA 4CR8A 3ANNA 3OSUA 4B7XA 3BTSA 3EMKA 3GY0A 3SVTA 3BMQB 4CM7A 3ORFA 2DU8A 4FFPA 4B8WA 2I9PA 1TI7A 2WM3A 2FWMX 3OQ1A 5H83A 4P4NA 4CLOB 1E1MA 3I6IA 4DYVA 3OHSX 5BSGA 5BR7A 1FK8A 4MVJG 3RWBA 1DDOA 1DEHA 4WJZA 3VH2A 2XF8A 4RJTA 1NVTA 5JY1A 5FFFA 2Y1GA 1RWBA 3BHJA 4NU6A 4YCAA 4WCDA 4L9RA 3DZBA 3E9MA 2ZB8A 1GZ6A 2NSDA 2DPHA 3ZWNA 1UXJA 5ER6A 3DFUA 1Q0LA 4YJGB 1DC5A 4QO8A 3O4RA 1NP3A 1WZEA 4EW6A 1TT5A 4ZICA 1T2AA 4K6CA 3LF2A 1PJLA 4RLSA 4GWKA 3L6EA 1E6WA 3U0BA 3WFIA 4DREA 2YHIA 3HQ4O 1XLTA 1DIRA 4P4GA 1JKJA 1T25A 2FR8A 3MZ0A 2IXAA 3JQ6A 2F1KA 1E5QA 3PEFA 2HSDA 3JQ7A 3QVSA 4AJ1A 3CTMA 2WD7A 1YS4A 2VWPA 2FHSA 3JSAA 1J4AA 1SCUA 1DFIA 1HSOA 5KJ1A 5EMHA 1ONNA 3RASA 1Q7GA 4XGKA 1RM5A 3ZU2A 3PHHA 1Z7BA 4XYBA 5K6AA 5BSHA 1XHLA 2Y67A 1SO8A 1IPFA 4B4WA 4XRRA 3A06A 3JQEA 3X2FA 2O3JA 3Q11A 4GKBA 4Y6SA 4D44A 5TT0A 2I5PO 4B3IA 4WGGA 2PGDA 4HXYA 1YE3A 2WYWA 1KETA 1M6HA 3QLJA 4Q3AA 3WQRA 3ZGYA 4UEOA 1LSOA 3P2OA 4DXHA 3H9QA 4DUPA 3Q9UA 1M6WA 3S8MA 1X7DA 1MXFA 5JCJD 3G79A 4Z3DA 4CM9A 4L73A 1B3BA 2D5AA 2EW2A 2HMSA 1VSVA 3TFOA 3GGPA 4RVDA 2AQHA 3P2YA 3TL2A 4IBOA 3QVOA 4P22A 4BNMA 5KKCA 3VHRA 2WWRA 1QLHA 4TVOA 2IXBA 1PQUA 4XRGA 5TC4A 1XG5A 1LI4A 1X7HA 4LSWA 4OAQA 4AJNA 4QECA 1MP0A 3KLPX 3IMFA 4E4YA 4KUHA 3R0IA 1E3SA 1NVGA 3G49A 3LT0A 1LDGA 3GR6A 4CMCA 1I3KA 3WJAA 2NVBA 3KYDA 4E2XA 3U09A 1C1DA 4ROSA 1ISGA 3NT4A 4FCCA 4MP8A 2AQ8A 1D8AA 1A71A 1R0SA 4O5OA 4ZQBA 3GG2A 3WMWA 3EYWA 4DYDA 3RC1A 1N9GA 1PL8A 1HLDA 1QLJA 5COAA 4ZHSA 2OUIA 1E7RA 4QTZA 3CPSA 2IZ0A 4WK6A 3E5MA 1GADO 1QXSA 2EJWA 3JD0A 3MJTA 3NEPX 3NT5A 4KTTE 4S1VA 3KRTA 3RBVA 2YDXA 4XB2A 4EGFA 2HCTA 3V2HA 4CQMA 1E7YA 4MVJE 1UZMA 3INGA 3P5SA 5A1TA 1MC4A 3D7LA 1JVBA 4QO7A 4YAJA 4XQEA 2J3KA 4CV2A 4Z6KA 1GQQA 5GY7A 3RUEA 1LNQA 1E1NA 2LDBA 3A14A 2Q99A 4YBZA 4CMKA 1ZZEA 2GD1O 1SOWA 2UAGA 1J0XO 5A5FA 1IPEA 2AW5A 4L0QA 4UVEA 4EJ6A 1E6UA 1H93A 3K30A 5G4KA 2P91A 4RF3A 3VC7A 2ZCVA 5KTKA 3F3SA 3HUDA 3E6AA 4WECA 3GHYA 4XZ3A 1HYGA 3COSA 4TROA 3W8EA 2NV6A 3NJ4A 3LLVA 4YAIA 4WLNA 2POQX 3UW3A 5U9CA 2Y99A 5HBRA 1NVMB 1PQPA 1BG6A 3F46A 4J1TA 3QQPA 4ALKA 1IZ9A 2YHUA 1ARZA 3SC6A 2J3IA 4J2OA 1LU9A 3ZWPA 2HK8A 4I5EA 3H8VA 1A9YA 3AY3A 3DTYA 1CJCA 4RVUA 1LC0A 1NQAO 3AI1A 3FNFA 2BI7A 2CVZA 4OKNA 5I9MA 4RLHA 1OOEA 3RC9A 3RC7A 5B12A 4PG7A 1V0JA 4YVFA 3BMCB 1FDSA 2HDHA 1ADGA 3WDSA 3GPIA 4RORA 3S1LA 4ESOA 4ND5A 5JS6A 4UVGA 5JC8A 5TT1A 3V1YA 3K73O 1SB8A 3GUYA 4PRKA 3VH3A 5IN4A 2RH8A 1ZSNA 3F9IA 4BO5A 2W2KA 2YJZA 1UP6A 5JYDA 3LYLA 3AY6A 5TSDA 3C8MA 1E6EA 4BNIA 5GMOA 1YVEI 1LDYA 3DR3A 1V6AA 4I9UA 4R69A 1MLDA 4JJFA 2EP7A 4J1NA 3I5MA 1IY8A 5ITWA 3V2GA 3VZPA 4MVJP 2AE2A 3MCVA 1B15A 1ORRA 2GN8A 2H5LA 3ZHBA 4CM8B 4B4OA 1P1KA 3DZIA 1E1KA 4H15A 1DLIA 5DBIA 3WYCA 1TA4A 5IJZA 5L7TA 5T8KA 2HAEA 5DOVA 4DLLA 2I65A 1G0OA 3OJEA 2GASA 4LCJA 4R1TA 4BMSA 1N7GA 1DSSG 1SB9A 1XR3A 4F46A 3SC4A 4L4RA 3WWZA 4IZIA 4D7AA 4L74A 4PG6A 3U9LA 1UAGA 2Z1NA 2OORA 5DDIP 1NHGA 2UVDA 3HDJA 3IUPA 3RVDA 5A4DA 1MFZA 3AI3A 1PJCA 3KM0A 4MPDA 3CZMA 4J49A 4NZ9A 1XCBA 1ZJYA 1T2FA 2ILTA 2Y1EA 3DONA 3PQFA 4ID9A 2QZZA 5JC1A 1WWKA 3QA9A 4LMPA 5IG2A 5JBIA 3BYZA 3TOXA 3ZU3A 4D43A 2HMVA 5GZ6A 4AICA 4ZN6A 3TPCA 4NQZA 1O6ZA 2C2YA 3QE3A 4CUZA 2J5QA 1AHIA 3UKOA 3DWFA 1KBZA 1XEAA 3JQCA 4XD2A 4FB5A 3TZ6A 3CSDA 2J5RA 4AJPA 3PPIA 1BW9A 2O3SA 3QWBA 3HZZA 3TN7A 1GAEO 1PJ3A 2RH4A 3JQGB 4IS2A 2YDYA 2VRCA 4BNHA 4P8RA 2VYVA 3PDUA 4RDIA 3OQBA 3RIHA 2A9FA 2AG5A 4NNJA 3EHEA 4KUGA 1YOVA 2Q1SA 5G0VA 4YT2A 2H1SA 4J4HA 4KQWA 2HQ1A 3WGQA 4DIBA 5HWSA 4CM5A 2X9VA 5A9RA 4TZKA 3GDFA 4D45A 3L07A 4WNIA 4QQRA 1QV6A 5ICSA 4U6SA 2NQ8A 4Z9FA 4N5NA 5CG2A 3QVTA 3HJAA 4OGWA 2BFMA 3E9NA 3GNSA 3VPFA 2QQ5A 2O48X 2I99A 1E5LA 2HMTA 3INTA 2GO1A 4ALMA 3OP4A 1ZEMA 2O4UX 2TMGA 3PP8A 4OH1A 4NIMA 1X15A 4HADA 4MKRA 5T67A 5J23A 4J6FA 1XYGA 4J7UA 1XDWA 5CPFA 4E5PA 4RZIA 3E82A 2V6MA 4GH5A 1U8FO 3MOIA 2H9IA 3M1LA 1VI2A 3WSVA 3B1FA 3PHGA 2PV7A 3RCBA 2A92A 1CQIA 4C4OA 2Q45A 3C1AA 1JDJA 1T4BA 4O6VA 3L4BA 5F1OA 3WOHA 5IDWA 1TB4A 1W6UA 3SLKA 5BQFA 2I3AA 2NVUB 4IJVA 4JP2A 2C59A 4CLRB 3KYCB 1YBAA 2Q1UA 1LDNA 4L75A 1TXGA 2J5KA 3UAGA 3FWZA 1LSSA 4OIMA 2DFDA 2X5JO 4UVDA 5T5QA 2PKQO 3QWFA 3ZV4A 4D3FA 5KJCA 4FFLA 3AOEC 1AE1A 2YV1A 4E2WA 4N5MA 1E0DA 3BXXA 1NX6A 4R41A 2W8ZA 1O94A 4YT5A 2Y66A 4YJFA 3SBOA 5B4TA 1GUFA 1PZFA 2YQ5A 3PZBA 1MB4A 1G0NA 3U49A 1FJHA 1R4MA 4MVJM 3RUDA 3PGXA 1QRRA 4BKRA 1PJ4A 1ONOA 2AQIA 3WBFA 3DOOA 3JQBC 3O03A 3C85A 1H0KA 1U4SA 3ICCA 4Y6PA 2JD0A 2Q4EA 3S2IA 5C3MA 1RM4A 3AK4A 3LDHA 2FRDA 1Z82A 3NRCA 1LC3A 5B4UA 1K0UA 3R3JA 1Q0HA 2ZB4A 1K3TA 2OOSA 4FN4A 4TRMA 4I1IA 4XGNA 4BNKA 2D8AA 5DCYA 5GZ3A 1PS8A 2XOXA 2OXIA 4Z9XA 4QT0A 4YQYA 3Q3CA 4D0SA 1BMDA 5F1KA 3JYNA 4ZJUA 4J0EA 3E18A 1QKIA 2WD8A 3VPSA 3UCFA 4CQLA 4JK3A 3PK0A 5F1PA 4EUHA 2OZPA 3I23A 3AM5A 1HRDA 2P2SA 3OICA 4CR7A 1HEUA 1ZK0A 4D41A 2B4RO 4DMLA 3ZV5A 1TT5B 3MJ4A 3VKUA 4IINA 1SOVA 3WGHA 5TNXA 4GMFA 4OO3A 2ZTUA 2YYYA 2G17A 2YHIB 5CHEA 2PLAA 2DLDA 2ZYGA 3DZFA 2D59A 2DBQA 2EXXA 2FY8A 5AXBA 1HETA 4RQUA 2DVMA 2PKRA 5B4VA 4I5FA 4DQVA 1HWYA 3FR7A 3FN4A 4YPOA 3JQ7B 2BGKA 2J3HA 2WD7B 4EDFA 4DL9A 3B70A 3LQFA 3F5QA 1ZXBA 3QVXA 5FWNA 2YV3A 4G2NA 1ZSYA 5U4QA 5ES3A 3A28A 1V9LA 3CINA 2Q49A 3ZWOA 1N1GA 2I76A 1DFGA 3TSCA 2PK3A 3RFXA 1N1EA 4IDCA 5CEFA 3BA1A 3KXDA 1LDMA 3BMOA 4DPKA 1NASA 1Y9EA 5COQA 2RHRA 3AUSA 2D0IA 1B26A 3LC1O 3GEGA 1U5CA 3DMTC 1ZMOA 4GX5A 4YQZA 2AG8A 4DGSA 5G0TA 1PJQA 2QYTA 1E7QA 3RU9A 4O59O 3NKLA 2VHWA 2V65A 3UHAA 1HF3A 1WDKA 3BTUA 3H9UA 3WGIA 1KVTA 3Q2IA 4MVJD 4BVAA 3PJDA 4AFNA 4BO3A 1ADFA 4YAGA 4FJ2A 5IDXA 4TSKA 3SXPA 2OL4A 3ROPA 1EBFA 4IUYA 2VNSA 1KVSA 3JYOA 4XDZA 5AVOA 4AJKA 2XXBA 3PJEA 3OH8A 4BNFA 1R6DA 1E3LA 2E49A 2NACA 1SEPA 1X1TA 3ITKA 3TFQA 1Q0QA 4HV4A 2Y1FA 2VHVA 4PZCA 3EAGA 2I67A 4GVLA 3E1KA 2VWQA 3EUWA 1HDXA 1PS0A 3KYDB 1PJTA 5B37A 4KWHA 1NPYA 3B1KA 5ADHA 4GGOA 4YT8A 6ADHA 1GYQA 3DOJA 3DBVO 2W4QA 2VN8A 3I6QA 4M55A 2C2XA 2JD2A 8ADHA 1N9GB 3D4OA 2BMAA 3OFSA 3H65A 4JBGA 1YJQA 5EIOA 3QWIA 1U3TA 3GZNA 3WX0A 4IQ8A 3JQFA 3KSDO 5EL0A 3JQGA 1ISHA 4NFSA 3TJRA 4CQMB 3GVIA 4A5OA 2GUGA 1SC6A 3M6IA 2YFQA 4GSKA 2QRJA 4BKOA 4NHEA 4QSMA 2AQKA 4Z0TA 4GLOA 4O1MA 1TVEA 4WKGA 3M2TA 1YGYA 1X1EA 1LSUA 4JNKA 4CV3A 1GZ4A 3WXBA 2PZKA 4I9HA 2HRBA 1BXZA 1PGPA 1W0CA 4LISA 3F4LA 4DA9A 3KSZO 3FBTA 3VZRA 3F4BA 2NADA 3G0OA 1NPTO 2AA3A 4ALNA 2Q3EA 2Y0EA 1R0KA 2DUUA 4FQ8A 1V3UA 4TMFA 1HDOA 2X0RA 3ASVA 4KZPA 3RUIA 4NU5A 3K5PA 1Q7BA 2DKNA 1O95A 4IZHA 4NPCA 3ITDA 4CM4A 3HDHA 4CLXA 1A7KA 2E82A 4INAA 1P1FA 1KEPA 1O8CA 4IJUA 2ZJ1A 3N58A 4W4TA 1L1FA 1GV0A 1QR6A 5CDYA 3WNVA 2PTGA 1YQDA 1VSUA 3PXXA 4MKXA 5F5NA 2Y1OA 2PR2A 4XYEA 2Z95A 3DAFA 5A9TA 2EHDA 2AEJA 3BMNA 1H9AA 3G3EA 4FIZA 4IQGA 4RPKA 4FPXA 4R1SA 2A35A 2C20A 3U62A 4A0SA 4GGPA 3NTRA 5HS4A 5KVVA 1D1SA 4LGVA 4EUEA 3ZW9A 5KVCA 3STHA 3INRA 1GUZA 3VH4A 2GZ2A 3CUKA 3GVHA 4WCFA 1LEHA 1N2SA 4A7PA 4FC7A 1U9JA 3TDKA 1XSEA 4JXKA 1GFSA 4J4BA 3GG9A 1GYPA 4M86A 3HFSA 4AVYA 3PLNA 3AUUA 2W2KB 1BXGA 1IYZA 5IZCC 1ZO8A 1U3WA 4PLZA 3OIGA 3GT0A 3ON5A 3FF4A 3JTMA 3PIIA 5DF1A 1U7HA 3W4IA 2VCYA 3MEQA 4AJIA 4JCOA 2O7QA 4PLGA 1VJTA 1Y5MA 3SEFA 4B3JA 2FPGA 2NU6A 4U6QA 4A03A 2FPIA 4PZDA 1LDEA 4JQCA 3FCOA 3A4VA 3WQSB 3ZCXA 3JQAA 5C7OO 1YDWA 4RO0A 3H7AA 2ZTMA 3ULKA 4J9VA 5LDGA 2GR9A 5KVQA 4I8XA 5TRTA 3NDJA 1UR5A 1PL7A 1JQBA 2ZATA 4GWGA 5DT9A 1VL0A 4OQYA 2GN6A 1ULSA 2WE7A 1DAPA 1NBOA 1ZVMA 3F1LA 3JYQA 1R4NA 1UXIA 1YBVA 3OA2A 5JAQA 3RUAA 4CMBA 4DWVA 5A05A 1GYRA 3T7CA 3I3OA 3I9OA 1HSZA 3L4SO 5JPIA 4WOJA 1L7EA 1ZK2A 3LT2A 3OETA 4E5MA 2GF2A 2QZ9A 3GGOA 3ZWMA 1H6BA 1FF9A 2QYSA 4PVDA 3HHPA 2ZB7A 1ENOA 1KVRA 3KLMX 3WSWA 2B4QA 3DZGA 3BHMA 5AXCA 4JJGA 5KJ6A 2D1YA 4IDGA 2WE8A 5JW6A 1OBFO 3DBRA 4MOWA 2EERA 3AU8A 4OHUA 5CEEA 5ICMA 1LSJA 1ML3A 3JCZA 4WLOA 4CR6A 2EP5A 4EZBA 2Y68A 3S55A 1BW9B 4ONEA 3GMSA 5ENDA 2C29D 3HE3A 1E3JA 4IIUA 5A3VA 2B5WA 3DZKA 3ZZNA 3HSKA 4J1SA 1ID1A 4RDHA 4RF5A 4R16A 1VL8A 1DB3A 4NJOA 1YB1A 3E48A 5CDGA 1YOVB 2JL1A 2X0JA 3OEYA 3O8QA 1P0FA 2NUAA 4XQ9A 4DPLA 3ENKA 3K8ZA 2IDZA 2G82A 3BTOA 3D5TA 3FSRA 3KUXA 4IDAA 2ZCUA 1U4OA 1X0XA 3PWSA 1H6DA 2O23A 4OQZA 5BNTA 3HDYA 2G5CA 2RHCA 3RAJA 5EN4A 1DXYA 3KOUA 4RVGA 5CDTA 1QSGA 2DUWA 3TF5A 3U4CA 1YWGO 1I3LA 2R00C 5K9ZA 2QIOA 1YL6A 1WMBA 2O7SA 4YWJA 4E32A 1YDEA 1U8XX 4PVCA 3CH6A 1A7AA 5KKAA 2RBEA 4E21A 1JKFA 5C5IA 3JQDA 4UVHA 1MXHA 1HDGO 1VRWA 4GX0A 2DBRA 3G17A 3FWNA 5G0SA 4R01A 1AGNA 2PFGA 3LC7O 4WOKA 2EJVA 1MG0A 4DVJA 1WAMA 2QW8A 3LT4A 2Q4BA 3KBOA 1T2EA 4D46A 1WMAA 3D1LA 3IP3A 4II2A 4BGIA 1FMCA 2NLOA 2I66A 1VLLA 4RPGA 1EUDA 4EYEA 1NAHA 4PLYA 1P45A 3PYXA 3RUHA 1DC4A 4BKQA 5DP2A 4XIJA 1XGKA 4YRAA 4OJNA 5TJ9A 1U2GA 3SJ7A 1GEEA 1T26A 2X58A 1SBYA 2GZ1A 1TEHA 3C7CB 1K6JA 4W9NA 3RFVA 2V7PA 3ZNNA 1CIVA 2GN4A 1UXKA 5TGDA 4ZRNA 4KP7A 4YJFB 1YRLA 4J1QA 3D4NA 1OI7A 3IDSA 4OXYA 2GYYA 3IJPA 4FGSA 3DL2A 4E3ZA 3DC2A 2LDXA 3ROMA 4MVJA 4EJMA 3FPCA 4CL3A 4RVHA 2PY6A 3ZNQA 3RJ9A 1R4MB 3ETDA 3WR5A 2DBVO 4J0FA 1QG6A 5CDSA 4CUKA 1UP4A 3I9NA 4D79A 4XYMA 3VDRA 2X86A 2QRKA 2VOJA 1W4ZA 1Y7TA 4BUCA 3EZYA 1LRJA 2Z5LA 4K26A 2CSUA 2JFFA 4IDBA 4XR4A 2GLXA 4F45A 1JAYA 1XKQA 4ZU3A 1M67A 3ETEA 3QSGA 3PYLA 3FTNA 1HTBA 4L8VA 2JFGA 1LRKA 2JD1A 3FD8A 3K2EA 2B4TO 1X14A 1UXGA 2WYUA 4BO9A 1Y81A 2X8LA 5K0ZA 2IYPA 1ISJA 3C1TA 2E37A 4QX6A 4O63O 3IQDB 4FD3A 4PLVA 1HE3A 3T4XA 4CQLB 5IN5A 5JDIC 3QHAA 4R5MA 4IM7A 3DHEA 4OL9A 3OJ0A 4CMJA 5EPOA 3AUAA 3WGZA 4TRRA 1R37A 1ZK1A 3Q2KA 3D64A 1U3UA 1ENYA 1SNYA 2G76A 4NR0A 5KIAA 1C0KA 1UJMA 3HDQA 4BQRA 1O89A 2EV9A 2E48A 3RUFA 1OMOA 5IF3A 2P68A 2UV8A 1KY5A 4GSLA 4J3FA 4O0LA 4PIVA 4ZRMA 4CL8A 1U28A 4FGWA 1J5PA 3DZJA 4NBWA 3TZHA 7MDHA 4TKMA 4P4LA 4BNZA 1HZZA 2C07A 4YAKA 2ZQYA 3UICA 1ZMTA 2Q2QA 3JQ9A 3BMOB 1ZUD1 1EMDA 3TZQA 3CIFA 2CF6A 1A5ZA 1UZNA 3EZLA 4U0JA 4C7KA 2CVOA 4IDEA 3UFXA 4LRTB 1GU7A 2FMUA 3UOGA 8LDHA 2NU7A 2W2LA 3I9MA 3ZU5A 3I83A 2HU2A 4XA8A 4BMVA 2NTNA 3AU9A 4E6PA 5JDCA 1T4DA 2OO5A 3IJRA 5FI5A 1I33A 1RM3A 4GKVA 1SZJG 1I36A 4JBHA 1KYQA 3TOZA 3HNPA 1EEHA 2PD6A 3GEDA 1I8TA 2X6TA 3DTTA 4H3VA 5HTOA 4TWRA 3IL2A 1ULUA 3LLSA 1BDBA 1WNTA 1XELA 4YEDA 1DRWA 3IIEA 5I7SA 2CMDA 4LSMA 1OAAA 1ZBQA 1G6KA 2B83A 3WMXA 1KEWA 3FHLA 5JNLA 3OIFA 1BDMA 1XQ6A 5L45A 1Y1PA 4JIGA 4YACA 4I5DA 4R5HA 2EEZA 1QORA 3ZWBA 2PZLA 3C7AA 3GZNB 1HYEA 5KNLA 5L4NA 1SMKA 2OP1A 1MUUA 4NFYA 3VAZA 1D1TA 2WJPA 3OF2A 4MO2A 1YXMA 1FDVA 3WG9A 1VKOA 2O3TA 2X4GA 2DPGA 3JQ8A 3RC2A 3GRPA 3V2UA 5CG1A 1P77A 4CMEA 5AXDA 3GC6A 3H5NA 4MVJI 3IUSA 2RIRA 1RYEA 5EERA 3K96A 3VPHA 4LMRA 1OZAA 3DEYX 2DTDA 2AEMA 4DPMA 4J9UE 4HKTA 4WASA 4CJXA 1T2CA 1W8DA 4RPHA 5I9NA 1GEGA 3ADOA 4IPTA 2VYND 3IS3A 4CM4B 1V3TA 4XGIA 4E5NA 3GOHA 1N5DA 5BNIA 4BKUA 3EGOA 4IXTA 4YB8A 3L9WA 2FZWA 2JAPA 1HZJA 4BNJA 4R1NA 3EC7A 5A04A 4DLAA 4R51A 2CUKA 5FI3A 1ZXLA 4BV9A 2WEKA 1VJ0A 3GVXA 3V5NA 3W8DA 2CDCA 4PN3A 4BO6A 3BMNB 2HO5A 4NMHA 3EDMA 5EESA 5G0UA 1S6YA 2D4AA 2VHXA 4BO2A 3WGOA 4RZHA 1KC1A 3U4HA 3WIEA 1HXHA 3IKVA 5C37A 2W90A 3JYPA 4NK4A 4NFHA 4AL4A 3WGTA 1XWFA 1T1SA 2O4CA 1PL6A 1N92A 5AXAA 2EKQA 1DBVO 2UYYA 4WCFB 2PKQP 1PGNA 1ISIA 3OECA 4H16A 5L7YA 3FPLA 3DAPA 4F3YA 1CERA 3E5RA 3FR8A 1Y8QA 3PI7A 1BXGB 3JD1A 5JCJA 4PCVA 2PGJA 3P19A 5I7EA 2AE1A 3RI3A 3NDIA 3PGJA 4KTVE 1LLQA 1K2WA 4IQ0A 3GK3A 2BGLA 4ND2A 4CLHA 4WUVA 1XQ1A 3D3WA 3DZHA 4BGVA 1V35A 2X23A 4W7HA 4GQAA 1EFKA 5K6AC 4D3DA 5IDYA 2DC1A 1NWHA 4GL4A 4ZVVA 3RJ5A 2B5VA 2I3GA 3JQAB 4G65A 4TVBA 4MVJF 1PQWA 3I52A 4YJHA 2VT2A 3TRIA 2DTEA 2Y1DA 2Y0CA 3D0OA 4XIYA 3AI2A 1C1XA 4Z0HO 1P33A 4FSHA 4HY3A 1R4NB 1GQ2A 1BXKA 4N7RA 4PG4A 2IZZA 4OM8A 4AJ2A 3SJUA 2O3QA 3UCXA 2B35A 2J3JA 4OYRA 3ZWCA 3N74A 5MGBA 5JMWA 1HDCA 4Q9NA 2NTJA 3A1NA 1IHYA 1PJBA 1LX6A 3DQPA 3OA0A 1N8KA 4YDRA 2HK7A 3K31A 1BSVA 2NTVA 1DO8A 1P1HA 3F5SA 4IIVA 3AOGA 1YQGA 4QUKA 2P9CA 5AQ1A 3Q6IA 4N54A 1NWCA 4CM6A 3VZSA 1IOLA 3ZWVA 2IE0A 3DBRB 3KV3O 3V1UA 4BNGA 4J2HA 1E77A 2G0TA 4L4XA 4PLHA 3JYLA 4XCVA 1P31A 1EQ2A 4QFDA 4BO4A 3A9WA 2FOIA 3K2BA 4P38A 4XEHA 1B0AA 2PZMA 1KEVA 2WYVA 1FXSA 3KETA 1I5RA 1BGVA 5DBGA 3VTFA 4HFNA 3H3JA 3O8QB 2TMDA 3C7DB 3VH1A 4DQXA 1D7OA 1IHXA 1DOHA 4B79A 1E3EA 1GUYA 5L40A 2P5YA 4OMUA 4FFRA 3SX2A 1M75A 3BHIA 4PRLA 4UREA 1ZJZA 5IXSA 1RPNA 2Q1WA 4M8SA 1GZ3A 3PFFA 3QVWA 4W7IA 4IXWA 3VKVA 1L7DA 4M54A 2ET6A 4R4JA 3VZQA 1I01A 4A26A 1Z74A 2HLPA 4XJTA 5CPBA 3W6UA 3D3EA 2Q46A 4F6LA 5JSFA 4FC6A 4FJ1A 2VHZA 1NYTA 3FNGA 1HDZA 1PR3A 4WLUA 1DRUA 3KYBA 1PS9A 4Y8VA 1MG5A 1U3VA 1WVGA 3CEAA 3ZNPA 5EQDA 1M76A 1Q7CA 1E92A 1NTOA 3DB2A 5F5LA 5JAZA 3E03A 3HG7A 2FR1A 3KEOA 1AN9A 4KMSA 1FDUA 5KCZA 2DBZA 4HFMA 1P0CA 4M87A 4QEDA 5HA5A 3DFZA 4IGFA 2UUOA 4BB5A 3GAZA 3OM9A 3TNLA 1GPDG 2BI8A 3PFWO 3MJEA 2Q1TA 1R66A 1VJ1A 5A5EA 4A10A 2R6JA 3ENNA 4J16A 5ENVA 2IEDA 4FR5A 4J4TA 2SCUA 2JJYA 1LBEA 2YV2A 1NQ5A 4AJHA 3VOSA 4ALIA 3W4KA 3U3XA 1UAYA 1JTVA 4YXFA 4EEXA 5B1YA 2GSDA 3NJ8A 2BFPA 1H94A 4ND3A 2CFCA 3WNQA 1ADCA 3DAGA 2EKLA 3MTJA 4A27A 3K92A 4B7CA 3ZV3A 3GDGA 5FYDA 4NBTA 4JLWA 2XXJA 1E3WA 3ONDA 2O3RA 4EBFA 3NT2A 4HNHA 1R0LA 1NXQA 5L4SA 4XWYA 3VVCA 1MA0A 3NGXA 4TRNA 5L51A 1GCUA 1Z73A 3NTOA 2VQ3A 1YKFA 2NU9A 4IMPA 2DAPA 1I10A 2YFHA 3RROA 5T8KC 4B4VA 3GAFA 1F14A 4IDDA 4BV8A 3GVPA 5LC1A 1ZNQO 2WSBA 4ZQFA 4PLPA 2BH9A 4R68A 3BTVA 5ILGA 5L3ZA 3QY9A 3ST7A 3OJLA 1K6IA 3AUTA 3H4VA 4XDYA 4UAGA 2HUNA 3EY4A 1E7SA 1LUAA 4BNXA 3EVTA 4DLBA 1DHRA 3ETGA 2V6FA 3AW9A 3MWEB 2GCGA 2ZTVA 3MOGA 4JGBA 5A06A 2CZCA 4TQGA 4WLVA 2CVQA 2GDZA 3WTCA 4D42A 1HKUA 4H7PA 5IAAA 5KJFA 5KWEA 4RF4A 1I2BA 3L6DA 4J43A 4NJMA 2IEBA 1QYXA 4CMIA 1KY4A 2NWQA 4I08A 3DBHA 5JLAA 1RJWA 2V6BA 2B69A 4OOEA 4L76A 3I9JA 4A73A 1QYVA 2DM6A 5THKA 4MVJH 4BO8A 3R3SA 4Q3DA 4UEKA 5A03A 4RQTA 5AYVA 1F8FA 4BOYA 1Z7EA 1PX0A 4R3WA 4CM3A 4E30A 5BSFA 3O26A 3LU1A 4GX1A 5L7WA 4E31A 2BF7A 2DFVA 4LCEA 1YBMA 3R6DA 4L4SA 4FS3A 1B3RA 5TIIA 1OC2A 1X13A 4OXNA 4RPLA 1FDTA 3WJ7A 1ZFNA 3NDRA 4DC0A 1HE2A 2A94A 3GRKA 4Y98A 1YJ8A 5JYEA 2C0CA 3WGYA 1T24A 1PJ2A 2O3UA 1HDYA 1BRMA 4ZQHA 3HWRA 5KJEA 3WQQA 2VRCD 1CYDA 2VYVD 4N5LA 2OFPA 4AJLA 4MJLA 5COBA 4GI2A 4DTIA 1WP4A 1ZSVA 3WIDA 2VZ9A 3U4DA 2EIHA 1EBUA 3CKYA 1B8VA 3GN2A 1ISFA 3I9KA 1EFLA 4WPGA 3UCEA 3ZHXA 1BVRA 3DHNA 1H6AA 1PGOA 4LVCA 2X22A 4CLDA 1UH5A 2FSVA 1B16A 1PZHA 1GPJA 3RSHA 3ANLA 1S7CA 4HFJA 3KB6A 1Y6JA 2FR0A 2YQ4A 3AOEA 9LDBA 2P9EA 1H9BA 1U1IA 3L4BC 1LQUA 1P3DA 2BD0A 5CFZA 3EW7A 3AY7A 4HX5A 4U5QA 2G1UA 3TQHA 3UVEA 1P1RA 1JKIA 3TL3A 3WICA 4RL6A 2H63A 4WEOA 2GRAA 5IZ4A 1I0ZA 2BELA 2D2IA 1B8PA 1T1RA 2PNFA 1NPDA 1YH3A 2JHFA 3PDJA 1VKNA 1B14A 1PEDA 1H2HA 5JFOA 3CE6A 3JQ8B 3S2GA 4JX8A 3U5TA 4GPD1 2X0IA 4WLEA 1A72A 3WS7A 3JQBA 5I7FA 1MGOA 2IODA 2HJSA 5DULA 2Y05A 4B4UA 1KS9A 4DIOA 1LTHR 3LT1A 1QMGA 3PZRA 3D4PA 3L6OO 4AJ4A 5JY6A 2W98A 3EK2A 4EJ0A 3Q1LA 2DQ4A 3PIDA 4NBUA 4PLTA 2Y93A 4CMAA 4PG8A 3DBLA 1NHWA 4KQXA 4Q3BA 5A3JA 1GV1A 4HP8A
chains in the Genus database with same CATH superfamily
3IVRA 5CH8A 2VRBA 1FDWA 5G41A 2PGNA 4QUIA 5DTJA 5KTYA 3I1JA 4PNZA 4WXYB 2A5FA 1QBKC 2QM0A 3H5WA 1T9GS 1WUJS 2BY4A 4EHIA 1FSGA 3PU6A 1JNYA 4P58A 4MIOA 1VPTA 4IG9A 4H7JA 3N6VA 5I8WA 4ZHQF 4PO3X 3GZ4A 4JN6B 1KI9A 2YW9A 3EPJA 4UUBA 4H6WA 5BYAA 1IM8A 4EPTA 4YJHB 2AYYA 5ALKA 2GNAA 2TSYB 3AMVA 4X54A 1HL3A 4JFRA 4TWIA 4UVIA 2CJYA 3VTZA 2P69A 4GECA 4W6ZA 1Y9AA 3R0ZA 2W22A 3LXXA 1KMIY 1QRUA 2GJSA 3LUHA 3U19A 3C48A 4X62M 5I7VA 3QV1A 1O6GA 1MN3A 4AYXA 4BB0A 5JSZA 3FLAA 2N9UA 1XVIA 4M89A 4KOAA 2VCHA 4M9QA 1ZK3A 1JR3A 2O2SA 3NAMA 2JH9A 5THQA 3A3OA 2CJPA 2YYAA 2RRUA 2QL9A 1SAYA 2JLWA 4KE6A 4BLCA 4P98A 1Z6AA 1XHBA 5LBTA 5ALZA 2AMYA 3U7GA 3KTDA 4FEAA 3LFHA 3W7AA 5EWLB 1A2KC 2B1GA 4CLOA 3L26A 1UDBA 5KTRA 3IAHA 3U3ZA 5AH0A 1VLZA 2ATIA 3CF2A 5AJHA 4CGYA 3TBKA 2DAGA 3QMWA 2ADOA 4Z2YA 4AY6A 1S2DA 3EIQA 1IN4A 4CVNA 1RAIA 3BDIA 2QQ0A 4FYIA 5B1DA 2AHRA 1KEUA 3KZOA 1T8UA 4B2IA 3GEPA 1NI4B 2Q8PA 1GZ7A 3T95A 4D97A 5E26A 2UVPB 4ZYTA 3ROQA 3GPBA 4MPJA 4AI6A 3AHDA 1OC4A 4HEOA 5GVRA 3ZHTA 1TCBA 4Z8XA 4I8OA 4QEZA 1GSAA 4JJIA 1KP9A 3SF0A 1KYVA 1THZA 1ISPA 2BT4A 3S7TA 1GPYA 3LCVB 1PU2A 1VM6A 1FJGB 1O96A 2QMEA 4RNDB 1NI3A 2GHRA 2IX9A 4CMIB 3CYFA 5KSYA 1CUAA 3HVRA 1E2GA 1XMSA 4D96A 3C8ZA 4Y2VA 2B8TA 3UO8B 4O4IB 2C92A 3W68A 1P9LA 2PZAA 3QUBA 4N65A 4YCDA 2DR2A 2CLFB 2NM0A 5EGNA 4RHUA 2XMRA 3GPYA 4CN8A 4MV1A 1AHPA 1IHDA 4OPMA 1XZGA 3Q8KA 2C5EA 1A77A 4C0WA 5D51S 2X4DA 2ZI4A 2QKYA 1BD4A 2HCRA 1NMXA 3B51X 4ZQIA 1M0SA 3LUPA 3HCBA 3C6XA 3L46A 1UKVY 3BMCA 2OOKA 2OG1A 1T4GA 3SJAA 3UGKA 3E1SA 4FSDA 3ZY3A 1Z38A 2XV1A 2AMFA 3L8EA 3VX3A 1O97D 3T7EA 5K45A 4DSTA 4U7WA 3EXG2 2ZIZA 1VE3A 5A3SA 1ZVKA 5KOYA 1RBQA 1H4QA 3X43A 4I1RA 5DP1A 5LU9A 4OOFA 4LYGA 1F9EA 3LECA 3NNSA 5KCMA 4O4LB 1T29A 3TSWA 4QXAA 1KERA 3BULA 1ZIYA 2HI0A 4P35A 1SC3A 4IBCA 1M66A 2ZSBA 3KJHA 2DFPA 2H1HA 3PF9A 3UB3A 2IHUA 2CDBA 2ORVA 2DFLA 4GBJA 2V3VA 2WDPA 2FVYA 4B87A 5GIPE 2ZI9A 5J2UA 1EVEA 3TRDA 5IM5A 3W1WA 4J0HA 2B30A 4CM1A 3O74A 2P9BA 3ACDA 1G16A 1ZKMA 1X1BA 5LQSA 2E4AA 5IBQA 4Z8YA 2C2KA 4K9QA 1O58A 2NVUA 2R2AA 1DCMA 1PGQA 1EZ4A 2ZBQA 4PC2A 3UJCA 5JS1A 3IULA 5KMGB 3WLLA 3DFIA 3GGGA 4XTRA 5EFOA 2HADA 2EBFX 1AUOA 521PA 4JZYA 2HQBA 3JD3A 4GDMA 5FO1A 2X4LA 2YWGA 3O83A 3VOTA 2DU8A 4LOKA 5KYVA 4MCHA 2R8BA 1NW5A 4MVJG 3RODA 3ILVA 3V4OA 1PJZA 1J21A 3ZIDA 4KXYA 4HCJA 1V5EA 1KDOA 4RHEA 1TT5A 2PZBA 3T5BA 2GPJA 2LVBA 3E61A 4FX2A 2QHOB 1ORTA 1MU0A 5FPHA 4DKXA 1XXHE 2C88A 1QIFA 5CVEA 1DO0A 4QVIA 2IPMA 1GNSA 3Q11A 3T0FA 1XWWA 1JG6A 2I5PO 4YROA 1T9DA 4QPNA 5J9FA 4DXHA 2F1OA 1ZOIA 4JYMA 2JRLA 4L73A 2D5AA 4FE4A 3O3CA 2ZSKA 1D2CA 3ZQUA 1X7HA 5B7GA 4U39A 1T9CA 3HUUA 4KUHA 1RWKA 1JUDA 4GG1A 2JFPA 3AC0A 1R5BA 1WIVA 4MGIR 1MB3A 5ALFA 3QX8A 5C81A 3SXUA 3QTTA 1LK7A 4A91A 1MJGM 1NO1A 4LFBB 4QTZA 1EDEA 1E96A 5EHIA 2I3DA 4H4CA 2R45A 5GY7A 4AECA 4ES6A 1LNQA 1S02A 5KQGA 4YRNA 2UAGA 5KQMA 4EJSB 1U0OC 2A9VA 3V1NA 5DX8A 4OB6A 4KQEA 2IELA 4RVOA 4YAIA 2Y99A 4Y9RA 5KQDA 3C2QA 2BWEA 2FG7C 3KQVA 1C8BA 1RQ7A 1UPBA 2V5VA 4MS3A 3IXMA 4LCBA 2OC9A 3BIWA 3OLZA 3L05A 4B32A 4EHJA 4RLHA 2E4ZA 2WR8A 1ADGA 3MGCA 2M1XA 1SB8A 2NU8B 5K01A 1SUDA 2YJZA 1N32B 4GOOD 3AY6A 5TSDA 2KX7A 2Y2VA 2JLXA 3UV6A 4I9UA 2X6QA 4H6XA 2DWQA 3MCVA 1ORRA 2ZBUA 3BEOA 3NC1C 4LXGA 2ATEA 4EI7A 1P1KA 2QSZA 3E2IA 3TOVA 1U2QA 2V4UA 3AHHA 5L7TA 2QPTA 3HKCB 4XM2A 1Y6QA 1JJIA 4H31A 1WMDA 5DNEA 3FPHA 3MSCA 5CX4A 4AW4A 2A1UB 3UT5B 2WIGA 1GGEA 1RAHA 1W19A 2WNHA 2NO0A 2C2YA 2YX1A 1RVV1 3WGVA 4MV5A 5C4IA 4KK4A 1C8LA 3HKBB 5KX5B 3AETB 3PDUA 4LJYA 3OQBA 2PKEA 4KV7A 4LS3A 2QX9A 3KXPA 5HP4A 3GXOA 1RCTE 3FVTA 4Z9FA 2I7VA 3IE1A 1E5LA 5JQWA 4OH1A 3WE7A 4HADA 3P9KA 5CPFA 4B3MM 3KT0A 4GH5A 2H9IA 4Q05A 4X62B 1KZYC 2J0UA 4P93A 3P9QA 2BWJA 4YJ3F 1JSZA 3H1AA 5IDWA 4D3YA 2XF2A 1PWEA 3TKLA 3GJ8A 4QPDA 2RKBA 3FETA 5KJCA 4D3FA 3AJ9A 3DCIA 2Y66A 4P3NA 5ECDA 4UFOA 3RIMA 3AWIA 4YAWA 3QOFA 3D6AA 1PFGA 1QRRA 1M83A 4XVQA 3WBFA 1FSSA 2D7EA 2HRQA 2C8LA 1LC3A 2O2ZA 3I09A 3EJWA 2J7PD 3SC2A 3EWNA 3OCVA 1PS8A 3TZEA 1M0EA 4QT0A 2HPAA 3CLRD 4O25A 2BE9A 1W94A 2IP1A 4CQLA 2I8AA 5F1PA 1IN1A 3AM5A 1T1GA 1ZA2A 3SFZA 4D41A 1GO2A 1KP2A 4CIDA 2PH7A 3G2OA 4J75A 1O2DA 5AKXA 4AZVA 2PLAA 1JKJB 2ZYGA 1Z5NA 2WD7B 1PLKA 4KFRA 4NATA 1ZXBA 1EFPA 1BROA 2YV3A 3CINA 1Q7TA 3QLTA 2OXRA 1CRLA 1PTJC 2Q1YA 3CUVA 4JYCA 5K6RA 4EUNA 3P4XA 3LC1O 3IRUA 4HX9A 2OZLA 3DMTC 1MW9X 4MUYA 2C00A 3WGIA 3MJHA 2P7IA 4KGDA 3TIIA 4XUCA 3F2IA 2DQYA 3RVJA 2BZGA 3NHPA 3ROPA 1L1RA 4RAOA 5CD1A 2NACA 2N42A 4JQYA 5KTMA 1QV9A 3OC0A 4CTMA 1UK7A 4GEKA 3BKWA 4GKAA 3TQIA 2HQOA 1L4YA 3ABSB 4NFSA 1EFUA 3S5JA 3ET4A 1RWMA 2WA2A 3G59A 3O2JA 1DP4A 3IEVA 1TK9A 3QIAA 1PP4A 1NIPA 1X1EA 4PTZA 2ZWVA 4LOIA 3I8XA 5AI5A 4Q9KA 2EEPA 3BN3A 4TMFA 1GL9B 2JFBA 3NM6B 2J9FB 4MUXA 1D2AA 5IJWA 2WSFF 1E66A 5HGJA 4IJ6A 1J20A 4G0PA 3ETHA 1GV0A 2Z95A 1WXFA 4EFNA 4CYMA 4MI9A 3T3HA 4B46A 3EC1A 2P9ZA 2ZWIA 1BCSA 4AVYA 4PLZA 1QO9A 3FF4A 2R25B 4HWGA 3FNQA 2YZNA 4AJIA 1M2NA 3S2UA 4NJEA 4WUTA 5BRAA 2ZTMA 4ZRDA 5TRTA 3ELUA 3KR2A 1VL0A 1DAPA 1BMQA 1ZVMA 3A27A 1GYRA 4C3VA 1C1HA 3IPRA 3H2BA 2QY6A 3SC3A 4QXOA 1GT91 3GQ5A 2JLCA 4PYQA 1EXWA 1DKLA 1FYEA 5TQ2B 1QG2A 4IUBS 4P31A 4WOCA 3VR2D 1G8YA 4GBED 1BW9B 5ESXA 1QRSA 1LNSA 2EJTA 4LRUA 1VL8A 3F73A 2V4ZA 2IDZA 1Z5AA 3QI2A 2ZCUA 4F5EA 1T91A 4UBMA 3SGLA 3ND8A 5A7GA 5K9ZA 2YVKA 1PUXA 1A7AA 3L8HA 3GPUA 3CVUA 4JLOA 1DCKA 2XQVA 3F0TA 3CRRA 4DHWA 1W85A 1P45A 1XZKA 4B3GA 4XIJA 5IJ0B 3VNQA 1VMDA 3HLKA 4BFWA 1R9MA 5ALDA 3PNKA 3N2KB 3IQIX 3TPFA 2AUNA 3DL2A 2Y76A 2LDXA 1KQPA 4M99A 1RC1A 4QNNA 3HKEA 4MAMA 3ZNQA 1XFAA 4KXXA 3ETDA 3DMRA 1GG5A 1JR6A 2VOJA 2CYBA 2CSUA 2JFFA 1R3DA 4F45A 3HJRA 4O2BB 3F6SA 3NC4A 5J59A 2HMAA 4OH7A 1ZMRA 4FD3A 4PLVA 6ABPA 1KARA 1XXLA 2BHSA 1S2MA 1ILEA 1X8LA 2FN8A 1R37A 1ZK1A 5AJWA 5K3CA 4FHCA 3MWEA 3GRAA 3UC9A 1K88A 2GAIA 2QTVB 1CRQA 4O0LA 5CD9A 2C07A 1OXXK 3UICA 3BMOB 3CLTD 4DCSA 4Q1AA 3NWOA 2CVOA 2BMFA 2V74B 2XTJA 8LDHA 1NQVA 2XOKA 4E6PA 1T4DA 4GXRA 3QFFA 3DTTA 3I6MA 3VR3D 3JQQA 4ZVOA 2DX7A 4DXAA 4ZI7B 4QOZC 1KIAA 5BWMA 2CUTA 1U8CB 2ZWPA 4YPVA 4I4IA 3MOSA 1JFTA 2GLTA 4V02A 3G0IA 4Q1EA 3GH1A 3HI6A 5KBYA 2QVXX 3OLCX 1R27A 2X4GA 4QBKA 1NBME 1FSZA 4GKKM 2FSPA 2P78A 2JFZA 5J5VA 2AF3C 2JI9A 1U99A 1HNXB 2QRVB 4E5NA 2H2WA 4BLOA 3ZWQA 1X7XA 3NMUF 1TU0A 3EC7A 3THSA 1MAWA 4R51A 2H9YA 1F20A 4C14A 3W8DA 4NMHA 2PN1A 1EJ6A 4RZHA 1KC1A 2R6ZA 1ZC3A 1FFBA 3ILSA 4AS3A 4K88A 4L0CA 3B6JA 3VAYA 3G68A 3IXLA 1YS2X 4LE2A 5LQMA 3PR2B 2ZXUA 2G09A 1KJQA 4V3BA 3IJEB 5K3BA 4HF7A 1MB0A 1X3SA 1A7JA 2DC1A 1WKCA 5KO2A 2R6GA 1LTMA 1BKDR 2Y1DA 5SZJA 3FH0A 2ONYA 1R4NB 2IZZA 4AJ2A 1X1QA 1V1RA 1Z4LA 4WADA 1NC3A 4CETA 4MDFA 1KEEB 3ILHA 1JSXA 3SATA 5KPZA 2JBAB 2YOFA 3V1UA 1KI6A 3P2KA 4L4XA 2XCIA 3ER6A 1JSRA 2RHMA 4BO4A 4B45A 3BS4A 5CCXA 5KQLA 1FPMA 1Q92A 4M53A 4ENUA 2ZR8A 1E3EA 4G4QA 3BHIA 2VP6A 2Z58A 4M8SA 4NZMA 5C1BA 5K0GA 4LXXA 3ZE6A 1YFJA 2F5NA 4U02A 2L2DA 2VHZA 3ETLA 1EWVA 4J2TA 5CM8B 4B76A 1GQOA 3KYBA 1PS9A 1SUPA 1UWLA 2RK6A 1WVGA 1MJGA 3IPYA 4LXHA 1PGYA 1T5HX 1QCDA 2IPOA 3CH4B 1CY2A 2C78A 2VDQB 3U9SA 2PRIA 4JI6M 4EY7A 2P90A 1Z68A 5ARBA 2A3NA 1DIOB 1UAYA 1SKBA 1TQDA 2V59A 1R6XA 2Q9BA 2XXJA 4JUCA 2CXOA 4LRYA 3SQDA 2G9QA 2ZPAA 2AFVA 2O25A 4IBEA 2KE5A 4G09A 4U4AA 4C0JA 4Q7LA 4BQQA 2NT3A 4DIUA 2GILA 4TM7A 3ST7A 4XIFA 5KNDA 5BUQA 4EY5A 3P9RA 2OORC 4CKYA 5LIPA 3OX4A 3UHJA 1VQ1A 4FMPA 4B44A 4YRSA 4YIHA 3FA2A 3IB6A 1IK6A 4L76A 5AMXA 1QK5A 2ZUUA 4Q3DA 3MWJA 4BUJA 1WBBA 4RQTA 4US0R 3LU1A 1T6OA 4CI0B 1E9RA 3CNEA 1NUTA 5EUBA 5IC6A 3PFIA 1EBBA 1Q21A 4ZQCB 5HJ7A 3U6OA 3RV4A 3UUFA 5CA0F 1NU6A 2YYZA 4P7FA 3DVQX 2XNDD 4LQ4A 4WMLA 3MJ5A 1M54A 2WWVD 3U4DA 1B8VA 1BVRA 3K1ZA 1OX5A 3I04M 2FSVA 2AFHA 3V48A 3AOEA 4FMCB 3J81S 4L72A 2Q3MA 1E1CB 3TL3A 3IAM6 1NUSA 4I7EA 3K5WA 4KAJA 4ROTA 1VIYA 3GGSA 5IXJA 7CATA 2WB4A 3EXHC 1LTHR 2YS6A 2Q7XA 4MQBA 3OZEA 4CMAA 3B6EA 4PG8A 3NYIA 1OT5A 2IC5A 3VR6A 4D5EA 1NOJA 2COKA 3A32A 2I71A 2VL7A 3UMJA 3E23A 4LYAA 4E12A 3SYNA 2WUVA 1AC5A 4XDHA 4XEUA 4FBGA 4FZJA 4N5HX 1WXEA 5AI8A 1OHHA 2DI0A 2HSZA 2CYAA 2HHAA 2ZYHA 3RS0A 4U2KA 4HDOB 4XQGA 3VJLA 5TPZD 1N9ZA 2FUKA 2JCSA 3E3LA 4E0BA 3JVVA 2GBGA 4J07A 1FLNA 3D3WB 5BMVA 5JE8A 4BRUA 1CPYA 3K9NA 4E4TA 3P4UA 4UAJA 2NO7A 2XHEA 2J7KA 5JS2A 3KXKA 3OP1A 4OJYA 3G1UA 2XGOA 1C2YA 3D6MA 5CX1B 4TT3A 4UU1A 5DYYA 1D1PA 4EFLA 2OZKA 1RQRA 4RK7A 1WOYA 2J08A 5HFJA 1IY0A 3DCNA 1Q83A 1DRKA 1NJ8A 3W8FA 2WNSA 2ETVA 3FIJA 2JS7A 3C45A 4LXIA 3ZDQA 2P5UA 1E2NA 1TQ4A 4IILA 4OSPA 3GLTA 2Q2VA 3B9RA 5H81A 2P3LA 5AVQA 2HWUA 2XXAB 1UBHS 4JJ7A 2K6BA 1VKHA 4WOPA 1WUIS 3WWOA 2ZS7A 4QWWA 4W99A 4A6EA 3CW8X 3R3ZA 2H1CA 2ZIXA 3HR8A 3NZEA 4B3HA 4R54A 3WBBA 4RD1A 4NRVA 1K3XA 2HDWA 1GTMA 3IUEA 1N6LA 1E1CA 5GJWC 4F3NA 3L82B 2O1WA 1A27A 1YKSA 3UF0A 4H7IA 4D9BA 5JH7B 3FTQA 4HAYA 4YT4A 1HQKA 2CMHA 3NHSA 4CG0A 1I2DA 4QLAA 4KE8A 1P74A 4YJ2B 1UPTA 1YCFA 3MG9A 5BQOA 1PIWA 4UPEA 2XQFA 6NULA 3U3MA 1KQ3A 3RTCA 4HRYA 3B3JA 1RJDA 5IU6A 2OYSA 4TS1A 3K1TA 1JFFA 3PHBE 5K7SA 2Y9PB 2Z3XA 1ILWA 5L95A 3RBZA 1ZGBA 1JS1X 2RJOA 3ANXA 5FO0A 4KIJA 2VATA 3OEED 3UW1A 1QHYA 1QU2A 3T4UA 2R1ZA 5C5EA 2R00A 1BE8A 1KKMA 4RZXA 2WHRA 1B6SA 4R2MA 1N3YA 5DNDA 7ADHA 5JVDA 2ZUTA 4C0AC 1XC7A 1ZR2A 2X9QA 1VL6A 2ZIGA 4B17A 2O0HA 4D0RA 2SICE 5FF9A 1HG1A 1V5WA 2WTBA 2VDMB 3OZIA 2PX5A 3BT7A 5ALNA 3PHJA 1L5SA 1Z5GA 5J58A 7REQA 1EG2A 4QGGA 2Y1CA 1K66A 3CEJA 5AHRA 3PEEA 2M9MA 2WFLB 3KB8A 3WO1A 4N7MA 1YVUA 4HEJA 4QELA 1DIAA 1Z5UA 4TOIA 2P9JA 4K6GA 3ORYA 1QDEA 5E4JA 4GKKB 1YK0A 3O38A 1QR2A 3L41A 3DO5A 1HLFA 4CQMD 1TAUA 3ANYB 4D57A 3HN7A 1WW8A 1PR2A 4ND4A 1EIWA 3GV0A 5JDIA 2H18A 2J6IA 1WKBA 2G72A 1KVUA 3R75A 4G0QA 2H31A 3PJGA 4DKJA 1TKAA 1NN1A 4LHYA 3QX3A 3FD9A 1L5QA 1NOKA 1N1DA 4NOLA 3TWMA 2VZEA 4IX9A 1RXVA 3IKLA 2WJ6A 3VR4D 5ITXA 3L8GA 1RACA 1YB4A 1JLKA 2HQRA 1EHCA 2Z30A 3GA0A 2AFIB 4EF5A 3SZUA 1Q1BA 2YWBA 4JDUA 4HJRA 3OUTA 5DJ5A 4DMCA 1SIBE 4J90A 2FMFA 3PE6A 1L4FA 4V2UA 2OP0A 1DCTA 4FOOA 1W48A 1QNLA 4EY6A 5F1YA 3ZOKA 1RLTA 3BJMA 5C80A 4RS4A 4RKRA 3FI0A 1ZVQA 3ZKWA 4Z9YA 3SMPA 2PYDA 4I46A 2ZI5A 3N3AC 1GCGA 3U37A 4G5OA 3BGDA 1Z88A 2ZTLA 1O9BA 4AYWA 5CLJA 3L0CA 1QCZA 2IZ1A 1JN0A 1JJFA 3K9PA 2Z04A 3IOCA 4QHSA 4YA6A 2IUEA 3MJSA 3VVBA 4DQDA 2IZOA 4QLOA 2G67A 4N6OA 3I4YA 2QS9A 5BR7A 3MCUA 1GGNA 2XF8A 4W5WA 4Y1GA 3OOHA 2RB4A 4L9RA 4XH9B 1XYYA 1DKPA 1DC5A 1TIBA 1VL5A 1N4AA 3U0BA 1SHTX 1A1SA 3J81k 5EMMA 2EC5A 2IXAA 2HSDA 1K8ZB 1DOAA 4KBYA 4C78A 2VSYA 3H5IA 4ZU1X 2I4TA 4LMBA 1UPFA 2QGFA 1U9IA 1TGUA 1SO8A 3KQWA 1YTUA 2VPTA 3RTBA 3FOCA 3ZGYA 3P2OA 4DG9A 1XTPA 1XZBA 5AHKA 3RFCA 5JCJD 1X94A 1KA9H 1B3BA 4WXPA 1E2KA 3FUVA 4OREX 1KL7A 3P2YA 3D6UA 3OIVA 1GT6A 2C8VA 4A1FA 1PBNA 3PVSA 4FEYA 3BRCA 2W43A 3M7GA 1PLJA 1WMFA 1CDZA 3WJAA 2XKJE 3A4IA 4FCCA 1QDRA 1LWOA 1K7FB 5DM60 2HF7A 1IFXA 3GLVA 4DR7B 1KJIA 2FW7A 1PNQA 2OUIA 1E7RA 1GKUB 1M2OB 2IZ0A 1F1JA 3NEPX 1QOZA 4KTTE 4FKMA 1OLXA 2FH5B 1DEAA 2AFIA 3P5SA 4UHFA 1X77A 2G0AA 3RUEA 1GU1A 3VRHA 4HB2A 1WS6A 1UMDB 2WQZA 3ZZMA 1OXVA 1VXRA 4DSAA 4ZVRA 2P9TA 3COSA 1O77A 1XQVA 1BG6A 3A58B 4JLBA 2YHUA 4J2OA 1LU9A 1ZA1A 3ZWPA 1EVKA 1VPLA 3GMTA 1O9HA 4OB7A 2CVZA 1WBDA 1MZVA 3RC9A 1I1HA 3S1LA 3TBFA 3DC7A 5EP4A 1FUKA 5HOEA 3F9IA 3O3NB 1FJGM 1YV9A 4BYMA 5BP7A 1JAZA 1YVDA 4C5BA 1TLLA 2JFQA 3ET5A 4NV0A 1OQYA 4Z3OA 1ZUHA 1KJNA 4CGZA 4E88A 4REQA 4TTPA 1N6KA 1MVOA 3EUFA 5FBVB 2HWJA 2VDRB 2R751 4M0EA 4IXNA 5IW8A 3HDJA 2EFCB 2GZDA 5GZ6A 4ZN6A 1K82A 5JXJA 4JLSA 4ZV4A 1II0A 2C5RA 2VJYA 1AUQA 4F92B 1S7GA 2Y0QA 3WYNA 1NZJA 4BLPA 2W93A 4BTLA 2GEBA 1GRRA 2RHHA 4ZVPA 2OV4A 3NVKI 4HGZA 4DIBA 1FFAA 4OGWA 4XASA 1R2YA 4ALMA 2O4UX 3H99A 3W5CA 1XVUA 2HV9A 1MEEA 3D3JA 4G1MB 1SFRA 3M1LA 1SIOA 4A8JA 1JDJA 3FLBA 3TVTA 1I4DD 4IJVA 1M2OA 1L3IA 3L0SA 4UHCA 2PKQO 2I22A 2YNMD 1E0DA 2QL5A 2WQ7A 2DECA 2EZ8A 5F73A 1VLHA 1D4ZA 5KDDA 2OO7A 1TTQB 1KZGB 2Q4EA 2VO1A 2GB4A 3NRCA 3AESB 1RRMA 1YZUA 1KNXA 2J3QA 4LJ6A 4EPWA 1T9HA 1V39A 4FQ7A 2TRSB 3F7TA 3QOWA 1JKXA 3D8TA 3OLVA 3L3BA 2R8PA 4BZWA 1R0CA 3WGHA 1H4TA 2D59A 5BQPA 5I6DA 4RM3A 1IXKA 2I2AA 3FPKA 3B70A 1DT5A 1OXSC 2L2QA 1VGQA 5ES3A 1RXYA 4QASA 4PZAA 4RLQA 4O4HA 2ES4A 3EW9A 1N1EA 4PAGA 2H17A 3NDPA 5ELMA 1KJYA 4IIJA 1IZZA 1ZMOA 4DGSA 4JHXA 1E5VA 4LRTA 3HXKA 2X0KA 4EGCB 4R81A 4C9BA 2CCGA 2ESRA 2D1FA 3VM6A 2PUFA 1AF4A 4OYYA 3FSGD 1KJ8A 2WLSA 5HTKA 2N1BA 1E2DA 5J5AA 2JRCA 2Z5GA 3ER9A 2CT8A 3I6QA 4CKBB 4X61A 3KJGA 4BVKA 1JJVA 3A04A 2YFQA 2PG3A 3KT6A 5DXAA 2H5EA 4O1MA 2ZWAA 2Q9AA 3DMNA 4KE9A 1NUHA 2NN3C 4QNRA 2FETA 1UBEA 1JALA 3QXSA 4KZPA 4G63A 1Q7BA 1SGWA 4K6OA 1C9MA 5LQUA 2YWCA 2BEVA 3KNZA 4MEBA 2NP6A 5D5PA 3PXEA 4W4TA 2JANA 1L1FA 2WJJA 5C8ZA 3WMFA 4NV3A 4NFLA 2AEJA 2GD2A 1P7PA 3CWCA 3K2LA 1KK1A 2GOYA 3NTRA 2ZPUA 4LGVA 1U0EA 1CQZA 3V32A 3ZIAD 3TIGA 4WCFA 2X40A 3EEQA 5DNCA 4M46A 3D8UA 2HKJA 1E3TA 2BM0A 1PK7A 1Q44A 3TKAA 3FYCA 3FPAA 1QAOA 4HX2A 3MEQA 2Y6VA 4MMYB 2BBTA 4B3JA 3B2NA 2NU6A 1UQTA 2FPIA 2WG0A 5P21A 3ZCXA 2BEKA 1MRNA 3K9WA 2AKEA 3FJOA 4PAQA 3F1LA 3OA2A 1NBOA 4CMBA 2AKAB 2D54A 1HSZA 4MMXB 4KFSA 3G2KA 1Z4JA 1X1SA 3GAMA 3A3NA 4PVDA 3DAYA 4NZNA 3CRNA 1C3EA 1QP0A 1SN7A 3WLMA 3EEFA 4MGHA 3OQHA 5L3QA 1OU4A 1DKOA 3EFHA 1XXHA 3R6TA 1DB3A 2REQB 4XQ9A 1N32M 3FSRA 1OTRA 1QQTA 3PWSA 4OQZA 2P4SA 5H3CA 3O4GA 4A36A 4KMMA 3EOZA 1PR1A 4NNOA 1AKQA 3DMDA 1U2EA 1ZD2P 3W2HA 2JY6B 4BKQA 2JAUA 2C4HA 1G5FA 3T0IA 2EDCA 2DJ5A 2O8NA 4B33A 4D4IA 3V55A 1EWKA 8AT1A 3H0EA 3TG2A 1TECE 3VDUA 2AFIE 3QKSB 1P29A 3BF7A 2ZDHA 4DV2B 3BUSA 3ED5A 3RJ9A 3CW9A 4TMZA 3M5PA 1UBNA 3EGVA 1E1QD 3FMOB 2O8BA 2HJ9A 2KRUA 5DMHA 3BD9A 2WYUA 1UXGA 3OZDA 2I4NA 3FDIA 2GESA 4RMJA 2WJZB 1W0JD 1O6BA 4CMJA 1YDFA 3AUAA 4EIWA 1A8QA 4KNWA 4AP6A 4WNYA 4NR0A 3E5HA 1O89A 1QHGA 3RUFA 2YN2A 3CUSA 3ZS8A 4PIVA 1B6TA 1JG3A 2G1AA 2R8OA 3O8OA 1B6GA 4ZP1A 2YWDA 1TW3A 1P73A 4M22A 4MYTA 1T0PA 2O1SA 3ICQB 5AESA 5HFNA 3WVNA 3I6ZA 1VSQA 4G4SP 2OO5A 5EC8A 2RGGA 4BN5A 3V2IA 3FLMA 2CHGA 3LLSA 4QOEA 2APLA 1U7DA 2XIQA 2CBZA 4PYKA 2XEDA 4PRYA 1KEWA 2GNPA 5D5HA 3N0TA 1QFXA 3KALA 1TL7C 2XB9A 3ZWBA 3RTDA 2JPDA 3MLBA 3W78A 4BU0A 2NSYA 4MA5A 1MUUA 1HTTA 2B2NA 4EAAA 3Q72A 2FX2A 3H5NA 1VE7A 4ZOLB 4CJXA 3QITA 1W8DA 2PS9A 4DV7M 1FNCA 2EBWA 4HSGA 4AX4A 3MGKA 3L9WA 2G04A 1TJ4A 4PCZA 4DLAA 4YUZA 1ZXLA 1FXWF 3SQNA 1GUAA 4YALA 3PUIA 4JGIA 2W90A 1V5GA 3N75A 1IUPA 2QI9F 3ZZUA 3FR8A 2JIZD 2XA1A 1IQPA 2ERYA 1VEGA 2VHQA 2QD1A 3D02A 1ECPA 5K6AC 4JN6A 3PTLA 2WSYB 5KYNA 4WI1A 3EEOA 4RGYA 3LPCA 4YJHA 5EZSA 1NKSA 1AA9A 4M6WB 1DL5A 4Z0HO 4Y2JA 1TD9A 5DT2A 2FWNA 4MQ6A 2WWHA 5JMWA 4PQRA 2CNDA 5A0TA 4RVNA 3HUTA 1IAQA 4LYHA 1NXOA 3LHIA 4FLMA 1TJNA 2G1KA 4MWSA 3F5SA 2H3EA 2VK2A 4N54A 4R7TA 4B1FA 5TVKA 2IZ6A 3FFWA 1TVMA 3ZG6A 2PUCA 4LMAA 1P2FA 3PFBA 3Q85A 3N59A 1PK8A 3I73A 1PD0A 1FXSA 3TLAA 2XECA 3AX6A 3UAXA 5EHZA 1PJ8A 1P5JA 2QLJA 4K7JA 2VDJA 4LWZA 3QVWA 1W2HA 1WLSA 4ITVA 3KYJB 3O94A 1I01A 5EWLA 2Q9UA 3W6UA 4RF1A 5DWDA 4E5SA 3U6SA 1MOZA 4PIMA 2DJIA 1DWPA 2XGJA 1NTOA 3DB2A 4MKGA 2GVNA 5KCZA 2O19A 3DE7X 3TNLA 1FFCA 1Y34E 5T3YA 1TJ3A 4YRMA 4AM8A 4D4MA 2IEGA 3ES9A 4JBWA 5ERGB 4HG2A 3U3XA 4EEXA 4Z2AA 4LDAA 4Q12A 2EG5A 1RWQA 3P97A 1AIPA 4MCAA 2Z5VA 1NI4A 2Q2EB 3RPEA 3THYB 2UVPA 4HD8A 5D7BA 1OASA 5L51A 1P9RA 1EWYA 1R8YA 2VK1A 5DGDA 1T6NA 2WWFA 3LVRE 3IHPA 1P8AA 1K6IA 4CWAA 3H4VA 2B34A 1BVYF 4K9LA 4O29A 5H0IA 4P7KA 821PA 3OU2A 2R48A 4V2IA 4CMIA 1PM5A 2NPIA 5AKEA 1CY6A 5THKA 2I54A 4KXFB 3KAQA 3K0FB 3BD7A 4O4IA 3WIOA 5EPUA 4F4JA 5L7WA 2DFVA 3WRXC 1H05A 3SQXA 1V25A 3AKEA 1M3SA 2C0CA 2HREA 4KPEC 1IBMM 4BASA 2QMUA 5BO5A 2NO9A 4ZQHA 4EO9A 1ZD3A 4AJLA 1DGQA 4DTIA 4BLUA 3FRHA 2OLEA 3H0KA 3K8YA 5LP6F 2QE7D 2HNAA 2C58A 1TMKA 4LNUB 4HFJA 2RGAA 1XEFA 3L4BC 3EW7A 4HX5A 3D7MA 2DZDA 1CJTC 3PQ2A 2OILA 4AIRA 4TKZA 4HH4A 4INZA 1MGOA 3PDHA 1KS9A 4JQOA 1IHOA 5C53B 3E7DA 4AC9A 2YOGA 2FUCA 3EAQA 2SKEA 2AKYA 1D2MA 3B1JA 3EAFA 4Z53A 3KCNA 2K9DA 1Y9JA 3DOCA 2QM3A 4C0HA 4DNPA 4HEA1 5I4CA 4O4LA 4PSCA 5FOVA 1AN0A 4M1ZA 5JQGB 5DW3A 4RKEA 3LRPA 1JSLA 2PVSA 2X7HA 4EOGA 3FTEA 3C6QA 3CVXA 1VCHA 2OC4A 4WSOA 2YC2C 1E9CA 2BKEA 1YQXA 3ZCRA 2DBYA 3CF0A 1LS1A 5LOVB 4HAVA 1Q91A 2FN9A 3AV0B 2G77B 4OU5A 5IT0A 1QUTA 1UDRA 1L5YA 1RYDA 4TL8A 2DT5A 5JAPA 3O9MA 4PLWA 4Q3EA 3TEJA 4DJDC 1HNXM 3OFNA 1X8JA 2PH3A 1B7GO 1F9AA 4LAFA 1CZUA 2BMJA 4Y67A 1A8HA 3LF1A 3VSCA 5J4HA 2RGEA 1ZICA 3IBFA 1I94B 1THGA 4PC6A 5KMGA 4C2TA 2PBFA 1FMTA 3QFTA 1P5FA 3IOEA 4L27A 1ZY2A 1PE0A 1VMKA 3QAUA 3WK9A 2ZYSA 3KWLA 2EZ9A 1Z75A 3LY7A 4IMRA 3TJZA 2WOOA 2AL7A 3M4NA 4ZCMA 2WIDA 2C7GA 5ITVA 2ZT7A 1ZGGA 3BAFA 4RWEA 2BDUA 1RKXA 1MAVA 3AUYA 4QZVA 4Y1RB 5K0BA 5T6BA 5JHGB 5KPDA 3UGJA 4J8PA 5EHNA 3T7IA 1T2NA 3AY0A 3CPHA 4EY4A 1GNTA 3E4CA 4N48A 3E4RA 1OLSB 4B74A 1ECGA 3E2PA 3BH0A 1NBMA 4C20A 4JASB 2ZRLA 3F96A 3R3YA 2BGMA 2ZRNA 4ZVUA 4HDCA 3K9OA 1E2LA 1U8TA 2ZKLA 1UWCA 4Y0NA 1Z5WA 1QKKA 1DAOA 1H5QA 4PR0A 2X4AA 4ZZ1A 3R1IA 1UXHA 3C8UA 2LHCA 3E3MA 2CCKA 1EVYA 5JZSA 1WUHS 4KXUA 4KC0A 1SVSA 3BQ9A 3QU7A 1U0HC 1Y8CA 1J0BA 3WBKA 3GVCA 4YX9A 1M8PA 1PR5A 5B6JA 4EJSA 2QXTA 4DR2B 4G81A 4YUAA 1X7ZB 2JBWA 4H27A 3NNDA 4IEEA 4R7GA 4IDPA 1HC7A 3E8XA 2CK3D 2FGJA 3KE8A 4C7OB 4KR3A 4JT2A 2R44A 3FPBA 1P81A 1AK9A 2C42A 2H92A 6Q21A 4MWGA 4X93A 3L0DA 4B80A 1NR7A 4YCLA 2NU8A 2BJWA 3IC5A 3ORRA 5HJ5A 2D2EA 1AO0A 4PGFA 3OC6A 2HB6A 3ZJYA 1EUQA 5AOCA 4QU5A 1QP8A 4DV7B 4PX2A 1GGMA 4G37A 4LZLA 4LEIA 2D1SA 3FCUB 3HWX1 1ZI6A 4J91A 3HKCA 1H1DA 1OF1A 1AD2A 4FOPA 4G0YA 3A0UA 3U3RA 4GLBA 2IYAA 4KFCA 5C2JB 4L16A 1HFWA 1T4CB 4QC2A 3FKEA 3NTQA 2A1UA 3UT5A 3E4DA 4DBZA 4DXDA 4OV6B 4WNCA 3NLLA 3O2QB 2PMEA 1CZRA 3M6UA 3RFTA 1K5PA 4NK5A 1GVHA 2OT3B 4DDTA 5BVHB 5F51A 3HKBA 1WZ2A 5KX5A 3AETA 3B3GA 4RGBA 4KX5A 3THGA 1Z2PX 4N47A 1RAEA 3HCDA 1NXXA 2FN7A 1XA3A 1V8BA 2GEVA 4M9CA 2M6SA 1SVUA 2H16A 4IP0A 4B7AA 1A50B 5I7WA 3B7NA 3VZCA 5T4BA 1ZGZA 3OPMA 4YP9A 2VUIB 4KHZA 1USWA 1DIBA 4TL7A 2W2LD 4BXOB 2Y27A 5DBFA 5DGCA 3V46A 3HUEA 2BHRA 5AKZA 1JR2A 1GG9A 1SQGA 4D5GA 1QK4A 5EUCA 3FTPA 3Q6MA 2I6SA 3W9SA 4X90A 1XTRA 4BNYA 3P45A 5HFAA 3RANA 2OWEA 3OSUA 3V34A 4DCTA 3GWZA 1CUFA 3O93A 4TN1A 4QGAA 3BX1A 3DYIA 4EB8A 4Y6LA 3SM3A 3UANA 4Q9DA 4LQCA 2Y1GA 2ZJFA 3KXEC 4Z54A 2XUZA 5ED4A 2ZB8A 4GVPA 1YRYE 4ZCSA 3TX6A 1YSYA 3GXBA 2BPOA 1HBJA 1JKJA 3RABA 1E5QA 4KAXA 5JPCA 3NH9A 3OX3A 2WD7A 4KQ1A 2I7PA 4DR5M 4XGKA 3ZU2A 4Z1OA 3IPLA 3AFIA 4B4WA 4Q47A 5JISA 2QG6A 3ZXSA 4XSGA 1GTJ1 3D8SA 4TWJA 3Q9UA 1NSFA 3WISA 3TLBA 4ACAA 3TFOA 3EZFA 4YAUA 4KITB 4P22A 4PYRA 1QLHA 2C9ZA 1XNJA 3I0NA 3U1BA 2HFJA 3KLPX 1QVWA 4F96A 1TJ5A 4D0NA 4YV0A 2FB9A 3ZBTA 1FFDA 4HMPA 3E7XA 3RHSA 1CEXA 1QLJA 2WYHA 3CPSA 2EJWA 4RXTA 5BVHA 4S1VA 1AGPA 2CLHB 3O95A 5CJJA 2P62A 2CJXA 4QO7A 2J3KA 5E4YA 4YAFA 2W6MA 1XPUA 3YASA 1K4YA 5I9SA 1IBMB 5H9VA 3A36A 4NP6A 4NEHB 2J9FA 1K06A 2A14A 2H4HA 2LWIA 3GHYA 5EEHA 4F85A 3LGXA 2LUOA 1WNFA 3WAJA 5HKLA 1TH2A 4P83A 1DV2A 1JHMA 2FSIA 2C77A 5J2UF 4G5QA 3H8VA 4RVUA 1ZMWA 2PHZA 3HBMA 4H35A 1RMYA 1FDSA 3BCSA 2XMCA 2A59A 1XP8A 1M2HA 4IDHA 1E2IA 4Y2HA 1XVAA 5AK3A 1R1DA 2DERA 5ITWA 3COPA 4MVJP 2LIPA 1B15A 4XLLA 3TIXB 2X3FA 4OQXA 4Y7DA 4JA0A 1AKYA 3DZIA 5BSWA 4O0MA 2XTNA 1XD2B 4DAEA 4GSYA 4GZMA 3RFUA 1DSSG 1DJOA 1OH7A 3KKPA 4GI5A 3WWZA 2FEOA 1KJJA 3IPCA 1KI8A 2GLUA 5A4DA 3QKTA 4UEQA 5L6MB 3B9PA 2J9RA 4LMPA 4R8KA 1J1ZA 5SY9A 1KIMA 3TPCA 2GXAA 3QENA 5TQ2A 4X6UA 2WP8J 1COZA 3NHRA 3DWFA 4ND6A