3AOEC

Crystal structure of hetero-hexameric glutamate dehydrogenase from thermus thermophilus (leu bound form)
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
417
structure length
417
Chain Sequence
LKAYRPPEDPGLWDTYLEWLERALKVAGVHPTTLEYLAHPKRLVTLSLPVVMDDGKVRIFQGYRVVHDIARGPAKGGVRLDPGVTLGQTAGLAAWMTLKAAVYDLPFGGAAGGIAVDPKGLSPQELERLVRRYTAELVGLIGPDSDILGPDLGADQQVMAWIMDTYSMTVGSTVPGVVTGKPHALGGSEGRDDAAGLGALLVLEALAKRRGLDLRGARVVVQGLGQVGAAVALHAERLGMRVVAVATSMGGMYAPEGLDVAEVLSAYEATGSLPRLDLAPEEVFGLEAEVLVLAAREGALDGDRARQVQAQAVVEVANFGLNPEAEAYLLGKGALVVPDLLSGGGGLLASYLEWVQDLNMFFWSPEEVRERFETRVARVVDAVCRRAERGGLDLRMGALALALERLDEATRLRGVYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate dehydrogenase
publication title An unique allosteric regulation revealed by hetero-hexameric glutamate dehydrogenase from Thermus thermophilus
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
total genus 144
structure length 417
sequence length 417
chains with identical sequence D, E, F
ec nomenclature ec 1.4.1.3: Glutamate dehydrogenase (NAD(P)(+)).
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00208 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine dehydrogenase
C PF02812 ELFV_dehydrog_N Glu/Leu/Phe/Val dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1210 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3aoeC01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3aoeC03
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 3aoeC02
5A4DA 2P9EA 3H5AA 4IUYA 3HN7A 3DBRB 4HBGA 1B26A 3JQGA 3OEYA 2YDYA 5T6BA 4IIVA 3P2OA 4WCFB 5AXAA 1PJ3A 1R0LA 2CDAA 4RL6A 5TGDA 2FY8A 1IHYA 1X7HA 1ARZA 3OFSA 3ICCA 4DLBA 1GZ6A 2NADA 3KOUA 1IZ0A 3ICPA 5L4LA 2ZYDA 4NJMA 2D4AA 4A7PA 2PKRA 2GN6A 3ZWVA 4Z0PA 1A9ZA 3ZWCA 3I9NA 4M1QA 5IF3A 2GDZA 4LW8A 4J0FA 1EEHA 3KEQA 3Q6IA 1H6AA 4O6VA 3V1YA 2J5KA 5C7OO 4CMGA 1WAMA 1R4NB 1ULUA 3STHA 3GDOA 4QFDA 3EVTA 3QWFA 3LU1A 1SEVA 2WYUA 4OSOA 1Y9AA 5CDYA 5TNXA 3RUHA 3VPFA 4YT4A 3QVTA 2V6BA 4MP8A 3DWFA 1OAAA 4BNTA 3NAQA 4CLRB 4ND3A 4LGVA 5A5FA 5K0ZA 2EWMA 1NASA 2CVZA 5JAQA 4RF4A 3LYLA 5KWEA 1E5LA 4J6FA 1QORA 4E0BA 1E7MA 2ILTA 4PG5A 1PGOA 2DQ4A 4ND4A 1KETA 2ZKLA 4E4YA 2D2IA 1K6XA 3PJFA 3CEAA 2IZ1A 2NVUB 2ZB7A 2DBRA 4HKTA 1BMDA 4YRAA 3K92A 2DU8A 2PK3A 2VHYA 4KUHA 5IZCC 2Q1TA 1E1LA 3TRIA 4WLFA 4OHUA 3W6UA 3AW9A 5T8KA 2B36A 4IQ8A 1RPNA 3ZCXA 1LI4A 1B0AA 4P8RA 1W73A 3I9OA 3L6OO 1HSZA 3TL3A 3EW7A 2GYYA 1ADBA 1W6UA 4GSKA 4UVEA 3WTBA 4I5GA 1T1RA 1ENZA 5BSFA 3PTZA 3P5SA 2B0JA 4GGPA 2VHXA 1VRWA 2D3TA 2B5WA 1ZJZA 3LLVA 2FPIA 1DIAA 4FR5A 2AW5A 3NDJA 5JDCC 1PJQA 3DOJA 2G5CA 1YVEI 1PL8A 2ZK7A 2OBNA 4HWKA 4PLVA 1X0XA 2QRKA 3VKVA 1KVQA 3GGGA 3IUPA 4RGBA 1WVGA 2NTJA 1SZJG 3VPGA 4AJOA 3F4LA 3GVHA 4MKXA 3AI1A 1A7KA 1I24A 1E3WB 2I99A 4EDFA 2R2GA 4RVHA 4CV1A 3L6DA 1HLDA 4AJJA 3H7AA 1WMBA 2XXBA 4M89A 2V6FA 4XZ3A 1AHIA 2IEBA 4BQRA 5DT9A 1JN0A 1U8XX 3ZHYA 4E12A 1FXSA 2P2SA 4U0JA 4EITA 4R01A 5J23A 1WMAA 3FNGA 3WIEA 5ES3A 4BNHA 3VVBA 4PVCA 1N7HA 3LSYA 2NU7A 4QXMA 3WX0A 3INTA 1UZLA 3GAFA 4GKBA 3JD0A 1C1XB 2HUNA 3KYCA 1D7OA 3VZQA 2EKQA 3U3XA 1PU2A 1FK8A 2ET6A 4IJWA 2E4AA 3EDMA 4WE3A 2EW2A 4BNIA 2DBVO 2BGLA 4DQXA 3SVTA 2J8ZA 3PQDA 4YA6A 4E5KA 5G0SA 4AJNA 4YQZA 4NJOA 1HLPA 3PGXA 2GRAA 2Y93A 2VUSA 1E3LA 3X2EA 1MA0A 1VSVA 3WMXA 3DBLB 3I9JA 2DUUA 3DAPA 1GQYA 4WLEA 2BD0A 1DLIA 1NWHA 4NPCA 2UUOA 1D1TA 1PJCA 4I8XA 5F1OA 5JCJA 3NDRA 2O3TA 4TRRA 4UAGA 5JCXA 3FPCA 1R12A 2BMAA 2X0JA 3L77A 4JCOA 4RPJA 3GVXA 4JP2A 4BO3A 1U3WA 2A35A 1I8TA 2O50A 2O4CA 3WXBA 4HFRA 3WNVA 2I67A 5I8WA 4N7RA 5CHEA 4NK4A 3DZIA 2DPHA 3KSUA 2D59A 2LDXA 4PLTA 1P45A 4CODB 4FB5A 3HDJA 2FRDA 3C7CB 1A27A 1K5HA 1T1SA 3I23A 1BWSA 5A03A 4IMRA 4IDAA 2H5LA 1ZO8A 1PJ4A 3AUSA 3TZCA 3DZKA 3FR7A 4EW6A 1LDYA 4BO5A 1RWBA 4K9DA 3I6QA 3CMCO 1HDGO 1DIRA 3LC1O 2VRBA 1AXEA 5CG2A 3D3EA 3H9JA 1UP7A 3LT0A 3MJEA 4AFNA 5AXDA 3TOZA 4J4TA 3ZW9A 2RBEA 3C7AA 4KTTE 4GLOA 3GH3A 4J1SA 2Q3EA 4XIJA 3AY3A 1G0OA 1I2ZA 4J2OA 3VPSA 3O8QB 4QFCA 2AE1A 3ZWNA 4XDZA 4P22A 3QVXA 5DNAA 1GYRA 3LK7A 4MIYA 1U3UA 3MWDB 4HXYA 1PWZA 1LLUA 1Z75A 5THKA 1S6YA 2O7SA 5A04A 2OOSA 2VTDA 4FJ2A 1GU7A 5TC4A 2FHSA 2JFHA 3SXPA 3IKTA 3GZ4A 2NVWA 4OSPA 5T67A 1BXZA 3OJOA 5TX7A 3E82A 4NHEA 3Q2KA 1ZXLA 4DMLA 1ZJYA 4HFNA 3RAJA 2PNFA 2IZZA 4AJ2A 1H6CA 4IDFA 1Y5MA 5ICSA 2WMDA 3OMLA 3RJ9A 4PG8A 5ILOA 1C1DB 4J49A 3I3OA 3W8FA 2VZ8A 2O2YA 5KVQA 4PRLA 4PLWA 3DONA 3D5QA 4FC7A 1I0ZA 1WZEA 3KXDA 1E3SA 1IE3A 2ZIZA 3AOEC 3GF4A 3HJAA 3I9KA 1ML3A 3U4HA 4DLLA 2EV9A 1PQWA 1DBVO 3S2IA 2XOXA 1ZH8A 2UYYA 5A3JA 2P5YA 4OQYA 3UH1A 1MXHA 4N5LA 4MP6A 4RV9A 4J0EA 3PHIA 5DCYA 4E21A 3QQPA 4RLSA 3ZNNA 4C7JA 3OICA 5G4KA 1A4UA 1JVSA 3S2GA 3C3XA 4ZJUA 1LDBA 4BNZA 5F3RA 4BKRA 1XYGA 1R0SA 1EZ4A 2O2SA 3LF1A 4TROA 2X7HA 4PFJA 5IXSA 1WWKA 4TWRA 4WOKA 5ENDA 2HSDA 4EBFA 2X5KO 4FIZA 5AQ1A 2UVDA 3BHJA 1I30A 1DJNA 4LCEA 4PVDA 1A4IA 3EUWA 2C7VA 4Q3EA 1HDZA 2VNSA 4ROSA 4RVDA 3UW3A 4WLVA 1B8PA 3K96A 1DXYA 1NHGA 1WNTA 2VN8A 3M1LA 8LDHA 2W98A 1T25A 5KOIA 2NTVA 1DC5A 3U0BA 2UV8A 4PLZA 4CR6A 1I3MA 1Q1NA 1GV0A 3Q9NA 3PK0A 3HZZA 3FNHA 1A71A 4AJHA 1R6DA 3BMCB 2YUTA 1OFGA 3ONEA 1ZXBA 2YDXA 4RVUA 4L0QA 4CMAA 3FWNA 3FWZA 1ZK0A 2GERA 4JK3A 4E13A 5C37A 5JCJD 1GADO 4KTVE 4DVJA 1QYDA 1KVRA 3FNFA 4PCVA 2C07A 3FI9A 3MZ0A 3KLMX 2X0NA 4PG4A 1XU9A 3ZHXA 2YW9A 4TSKA 4PG6A 2CVOA 2O3UA 3TOXA 4BMNA 1X7GA 2Q45A 2Q49A 3PYXA 3VH2A 1WW8A 3INRA 1P1RA 2J5RA 2E48A 3CKYA 2ZQYA 4MVJH 2CVQA 1KYQA 3JQDA 3PLRA 4TRNA 2VOEA 5JBIA 3NTOA 4E30A 1E7QA 4K26A 2EKLA 4CM9A 1ZNQO 2PR2A 5BT9A 2B83A 1W4ZA 3GG2A 4U8GA 4CMJA 4OIMA 2CZCA 5IN4A 3TZHA 3WYEA 2JCXA 3KYCB 2CSUA 2QRLA 5IAAA 3K5PA 4YB8A 4BNWA 2X0RA 1AHHA 1HZZA 3EGOA 3RBZA 4XQEA 4OAQA 3JQ8A 3HFSA 2D1YA 3B1FA 4XJTA 5CFZA 4DWVA 1PR9A 5EL0A 1MG0A 4KQXA 4PN3A 4WOJA 1Y7TA 4UULA 3WTCA 1QR6A 3ITDA 3VZSA 3C7DB 1PS8A 3ONFA 3IQDB 2C0CA 3GZNB 4CLOA 2DVMA 2R6JA 3K31A 2JHFA 1E7YA 3O26A 3AY7A 1P1KA 1X13A 3W6ZA 4XQ9A 2D5CA 4KP7A 4JN6B 4L4SA 3GT0A 2P91A 2W4QA 3JQFA 4AJ4A 3TZ6A 5MDHA 3PQFA 1Y81A 1EQUA 4YAJA 2BGMA 1XLTA 1UXGA 3IDSA 1DJQA 5K9ZA 2Z1MA 1QYCA 3P19A 4PLYA 3ZV6A 1LDGA 2TMGA 1K2WA 2QYSA 3G3EA 4RF5A 3WFIA 2PFGA 3GMSA 2CDCA 3FNEA 1C3VA 5EESA 2P68A 1N1GA 4CQMB 2HLPA 2FSSA 3AI2A 3ZZNA 2JL1A 5KVCA 1Z45A 4YAIA 3ASVA 4CPDA 3MJVA 3SC6A 3ROQA 2HK9A 1C0IA 2DTDA 3AU9A 2WD8A 4UVDA 1KERA 3ETDA 3R6DA 1LU9A 1LX6A 3E6AA 1CYDA 4EUHA 3S2EA 1GEEA 3D1LA 3L4BC 2QG4A 4XKJA 4LRSB 1R37A 2EERA 2POQX 1LDMA 3F3SA 3GPDG 3QRWA 3I9LA 5IDWA 3WYCA 1ADGA 1FDWA 3PHGA 4EZBA 1V9LA 1PZGA 4NU5A 4MIEA 1YL6A 4XQGA 3ADPA 1LEHA 3UVEA 1XG5A 3IP1A 6ADHA 5KKCA 2OORA 3ABIA 3L4SO 3EYWA 4RQUA 4ZD6A 3TJRA 2X86A 5TRTA 4ONEA 2PGJA 4TRJA 5AXBA 2V7PA 1JKJA 1H93A 2O3RA 3DZJA 1HXHA 5JE8A 1MXFA 4BO9A 3K2BA 4IJVA 1J49A 1E0DA 4TZKA 3VHRA 4Z0HO 3C24A 3IMFA 3VVCA 1K3TA 2WJPA 3D4NA 5ITVA 2UUPA 4FSHA 1VPDA 1SEPA 5JO9A 3BTVA 3KBOA 1DHRA 3GGOA 2VWPA 1TT5A 2ZTUA 1IULA 2PGLA 3B1JA 3QWBA 5JAMA 3GEDA 1ISMA 4CV3A 5GMOA 4FCCA 1QG6A 3H65A 1UZMA 3DHEA 3IS3A 4JBHA 1NFRA 2O3JA 4UREA 2Y68A 2VT3A 4MINA 5CG1A 2GZ1A 3COSA 1N9GA 3CSDA 1QYVA 3ETEA 3KLPX 3IL2A 2XF8A 5KJ6A 1X1TA 3H5RA 3AOGA 3DL2A 4U7WA 2C59A 4Z9FA 1D4FA 4DPMA 4CL8A 1V8BA 2VRCA 2J3IA 1YQGA 4BOYA 1ZZEA 2WE8A 3M2TA 1F8GA 2HO5A 3RC7A 3HUDA 4NDNE 3T4EA 4CM9D 3OA0A 4PG7A 2FMUA 2G17A 1O95A 4WASA 3E5RA 3WGYA 4E6PA 4OXNA 3NRCA 2GGSA 2QQ5A 4OH1A 2RAFA 2BFOA 4R1UA 3Q1LA 3WGHA 2OFPA 4XQCA 1T4BA 1DPGA 2P4QA 2HRZA 4IS2A 3H9QA 5HS6A 3MTGA 1PJBA 3GVIA 4J1NA 3WR5A 4D0SA 3KYBA 4OQZA 5A05A 1H5QA 4GX2A 3FCOA 5HRUA 3ZNPA 1E92A 2G0TA 5B37A 3X2FA 4GGOA 5L3ZA 3PJGA 3WGTA 4F6LA 1RYDA 3WG9A 5F5LA 1NWCA 1GAEO 1Y8QA 2A9FA 4DUPA 4TQGA 2YQ4A 4A0SA 5DP2A 3ZWXA 1SNYA 2C2YA 3LT2A 1PJLA 4YVFA 1E7SA 4RLHA 5DULA 4O0LA 4Y8VA 4FFRA 5L4NA 2BHLA 3SBOA 1RKXA 2IXBA 4XYBA 1ZVMA 2VZ0A 1AXGA 1L7DA 2D8AA 3G17A 3ZV5A 4J91A 3GMDA 4WJZA 2I3AA 1ONOA 2WTBA 6LDHA 4FFPA 2PTGA 4CM7A 1YH3A 5EQDA 1PIWA 4CLDA 1BRMA 1ISJA 3UFXA 2P9GA 1NVGA 3GNQA 4ND5A 3OA2A 2AQIA 3R1IA 3RKRA 3I5MA 4PLFA 2HMSA 1HDOA 3DAFA 4OMUA 4GVLA 5U4QA 5L51A 3OJLA 2AEMA 3N74A 3R0IA 1DFGA 2EP5A 4IQ0A 3U4IA 3GAZA 4FFOA 2RHRA 4L75A 3ZNOA 2DBZA 3RFXA 1A7AA 3LT1A 1GPDG 2X9GA 4IDBA 1YB4A 3NGXA 4A27A 5L45A 4YAKA 1U4SA 4BNKA 1ZEMA 3GGPA 2PLAA 1EFLA 4WLUA 3WNQA 2FPPA 3KYDB 1GUZA 4KWIA 2YYYA 2W90A 3QP9A 1CEQA 4BO6A 4CM5A 3EY4A 4CMBA 5BNIA 1O0SA 3FRJA 4H15A 3PZRA 2HK7A 3EK2A 1BG6A 3WFJA 2VHVA 2X0IA 4RZHA 1LQTA 1U7TA 3RUCA 4IMPA 5G2OA 3U49A 3HQ4O 4WKGA 1HEUA 2EF1A 4TVBA 5A9SA 4XYEA 1KVTA 4YPOA 4LISA 1SBYA 4YT2A 4MDHA 1FF9A 1R4MB 3AM5A 3QA9A 2BFPA 1OMOA 4YWJA 4Z6KA 3QIVA 1I33A 4R4JA 1Z82A 4U0KA 3S55A 1CF2O 4ZICA 2CUKA 1ZFNA 2VUTA 4MOWA 4E32A 2Q50A 3JYQA 4CM8B 4B4WA 3RKUA 4BNMA 4WNIA 5JW6A 3FD8A 4HV4A 3EHEA 4Y9DA 4D7AA 1K0UA 2DUWA 4IDGA 1WLYA 4U5QA 4CMCA 1U5AA 1X0VA 1FJHA 1P0FA 3BXXA 1LSUA 4P4LA 1H2HA 4BO2A 3NJ4A 1HRDA 1E1KA 2ZQZA 4NFYA 3RSHA 3RUAA 1UR5A 1YOVA 2PD3A 1BSVA 5GZ1A 3L0DA 4LSWA 3GNSA 1D8AA 4BV9A 1RYEA 1ZSNA 5KVSA 1GTMA 4TZTA 2VRCD 3DBHA 2EW8A 3GOHA 5COQA 3FF4A 4JJGA 1FDSA 4U6SA 1Z7EA 2I6TA 1JU9A 3TSCA 4NBTA 4B7XA 4MPDA 4WEOA 3LDHA 3OQ1A 5KJ1A 4TKMA 2NM0A 3ZHZA 2Y1CA 3GK3A 1DB3A 4XR4A 2UDPA 1VM6A 4YBZA 1YGYA 3ZWMA 3OH8A 4QO8A 4UUMA 4R54A 2X22A 1H6BA 4RORA 3H9UA 3IJRA 1JLLA 2C5AA 4FJ1A 4LK3A 5KNLA 1BXGA 4MJLA 2IDZA 4C4OA 5CEFA 3TZKA 2VNAA 2PZKA 4XYGA 5AOVA 1O89A 1YRLA 4UUOA 3JCZA 1NPTO 1NTOA 4QEDA 2DFDA 4KDEA 3V2UA 4OO3A 2NLOA 2I9PA 4Q3DA 5JMWA 1MFZA 4CM1A 1QV7A 1VSUA 2NUAA 4FGWA 3RU9A 4Z0TA 5MGBA 3G1UA 5ER6A 1PZHA 2RHCA 1BGVA 2BFAA 2BI8A 1NXQA 1EVZA 1GPJA 2JAPA 3GEGA 3GNTA 3HB5X 4ZQBA 4I5FA 2WWRA 4W7IA 1HT0A 2E37A 1IYZA 2NQ8A 4OKNA 2WD7B 4RPKA 2DKNA 4XYMA 2NNLD 1ISIA 2OBYA 4ZQHA 1MP0A 2AG8A 4PLGA 4Z9XA 3UXYA 1HWYA 1DC4A 4LMPA 1D1SA 4GVXA 1ZKMA 4HFMA 2Q1SA 3BMNA 2YY7A 3D3WA 4CMIA 1DFIA 2NU6A 3GVPA 1U28A 4HADA 5JMPA 3ANMA 4IBOA 2NQTA 3KB6A 1E1MA 1KEWA 3W4JA 4YJFA 2PZLA 2X23A 4R9RA 4JIGA 2FWMX 2AMFA 1X7DA 2H9IA 1C0LA 4MVJM 4NFSA 2OO5A 3ADOA 3TN7A 2BRUA 3TQHA 4DPKA 2Q2WA 5AVOA 1ISFA 3A14A 3MCVA 3WIDA 4EJMA 4Q39A 1YL5A 4Y6PA 4E5YA 5JAIA 1M6WA 3LC7O 3BTOA 3U9LA 5T8KC 1KY4A 3UF0A 4BNXA 1ZK1A 2JD1A 3HDHA 1QKIA 1XSEA 1XIVA 1U5CA 2X5OA 5I9NA 1XDWA 2CY0A 3MJCA 2Y0CA 4BVAA 5F21A 4F6CA 5H82A 1DHTA 4Z9YA 1U8FO 4OKIA 4P4NA 5U9CA 5TT0A 1E7RA 1NFFA 2HMWA 3BHMA 3I83A 4WPGA 5H83A 2I3GA 3ZWYA 7MDHA 4IQGA 5KCZA 3OSUA 2I65A 2I76A 5EINA 4DC0A 4CJXA 5EMHA 3BTUA 1G6KA 1LQUA 4XRGA 4IDEA 2Q2VA 4O5OA 2JFGA 4QX6A 1KOLA 2FOIA 3TPCA 3JYNA 4FC6A 2BH9A 4DBZA 1A5ZA 3M1AA 4N18A 2Y1GA 4CV2A 4ALMA 3GQVA 5DBGA 1VKOA 1I3NA 4NU6A 5JDIA 5CDGA 3ZWAA 4IIUA 3UGKA 3OECA 1H94A 1P0CA 3RWBA 4GWGA 3ZW8A 1GV1A 4F3YA 1CETA 3SC4A 4CV0A 3SX2A 1DRWA 3CH6A 4FBGA 4LRTB 3ZNQA 4J1QA 4ZGWA 5KVVA 3W8EA 2B37A 4DIFA 2RIRA 4HP8A 5I9MA 5ICMA 5FI5A 4F45A 1TLTA 1X1EA 4CLXA 3V2GA 1KEPA 2Z1NA 4XDYA 1GQ2A 2BFMA 3MOGA 1HE4A 1M2WA 1AE1A 5F1PA 4FW8A 2ZYGA 3VOSA 4K28A 1HKUA 2VWHA 1ZBQA 1UXJA 4GQAA 2DM6A 2O7QA 3TFOA 2B5VA 5FYDA 1DO8A 4CM4B 3INGA 1U3TA 2VWGA 1SO8A 2EXXA 1YBVA 4E2ZA 2C5EA 4XJSA 4ITUA 2VHZA 3Q3CA 4LCJA 2I66A 4ZVVA 1PGNA 3DZGA 4PGFA 4DYVA 2YHIA 3OETA 1W0CA 4BO1A 3AWDA 2JJYA 1NPYA 3JQGB 5IDYA 1K89A 5JAZA 4TRMA 4KZPA 1KVSA 2ZCVA 1LRJA 4GBJA 1E3IA 1FDUA 4BHTA 3H3FA 1F12A 3E03A 4NJMB 4AJPA 2NV6A 3TDKA 1UXKA 5JDIC 4CMEA 2RH4A 3UCEA 4OXYA 2HK8A 2CNBA 3HG7A 3H3JA 5A1TA 4YJHA 1I01A 1EE2A 4L9RA 1U1IA 4O1MA 1UDBA 4GPD1 4BIIA 4TMFA 3F4BA 2H1SA 2DPGA 3RFVA 1N7GA 5DN9A 3KVOA 5CDSA 1V0JA 4GX5A 1Q7BA 1MG5A 3NYWA 4BKQA 4CM3A 1VLLA 2BELA 4LSMA 1TB4A 1PGQA 1Q0QA 2R00A 2F1KA 1GZ3A 1WDMA 1KS9A 4FOOA 1L1FA 4GX0A 3RBXA 3I6IA 3VAZA 1QRRA 1DRUA 3GN1A 4BMSA 5I7SA 3OJ0A 2QIOA 3QY9A 5I7FA 3C1TA 4MP3A 4EEZA 4WLOA 2J3HA 4IZIA 2VTEA 4CQLA 1NAIA 4D45A 1LDEA 2GN9A 1BW9A 1PJ2A 1NAHA 5CDTA 3U5TA 3WMWA 4AJKA 2YFQA 3PXXA 1ZEJA 4I9HA 3EVNA 2EGHA 4ILKA 4K1LA 4RF2A 4W9NA 3KHUA 1H0KA 1WZIA 3B20A 4D41A 4FFNA 5KKAA 3D64A 2X8LA 1N1EA 1OZAA 3NDIA 4XEHA 4E33A 1FDVA 4DLAA 3A4VA 1PTJA 1HE2A 1V35A 1YWGO 3O03A 4IXTA 4NI5A 1HF3A 4P38A 4RPHA 1MFPA 1ONPA 1YDWA 3GLQA 3OBBA 1I5RA 1PL7A 3VH3A 4MVJA 5JY1A 5TJ9A 4CMEC 3K30A 1B16A 1H2BA 1GUFA 3WSVA 1QYXA 1UAGA 1YL7A 1Q7CA 1Y8RA 4JJIA 3JQBA 2VUUA 1XHLA 3TZQA 4A2CA 3N58A 4RDHA 4L4XA 2ZB8A 3O4RA 2WE7A 3GDGA 2VYVA 3JV7A 3WS7A 1CDOA 3E9MA 2EEZA 4PIVA 3QWHA 4R51A 5TQVA 2JCYA 4ZU3A 1RM0A 1HZJA 4AL4A 2P4HX 4DGSA 4KOAA 4CMIB 3SLKA 3KTDA 1HSOA 4B8ZA 4BNYA 5A9RA 1PZFA 2NVBA 5FEUA 3BMOA 4WK6A 4M87A 4KWHA 1I10A 3ON5A 2AG5A 3WGZA 1YBMA 4BKPA 4AG3A 3U09A 3VKUA 1UUFA 4XGIA 1EUDA 2J3JA 1QMGA 4NQZA 4RCVA 3RASA 2W2KA 5U1PA 4W9NC 4AJ1A 1DRVA 1A72A 1UDCA 2VWQA 2ZJ1A 3K73O 4FFLA 3W1VA 3HDQA 1HYGA 2WM3A 1Z73A 1ENPA 1ZCJA 2PZJA 4EJ0A 5DBFA 4ZRMA 4R69A 2QHXA 1DIBA 4FD3A 4BMVA 4UEKA 3TF5A 8ADHA 1L7EA 3K9QO 3V5NA 1UDAA 1PS0A 1WPQA 1IY8A 2W8ZA 3JQBC 4QSMA 3UICA 2AQKA 3ZGYA 1LNQA 4Q9NA 4H7PA 3VTFA 2CMDA 3H6KA 1EDOA 2GO1A 1M66A 5T57A 1EUZA 4NK5A 2IRWA 2IYOA 5ADHA 3RC1A 3PPIA 1X15A 4L74A 1EFKA 1ENOA 1G1AA 1PZEA 5K6AA 1U7HA 4L4RA 3JQCA 4DRYA 3GFGA 3DBRA 1UXHA 2OUIA 2ZYAA 1PGPA 1A9YA 2NACA 4ZN6A 1KBZA 4L76A 4R3WA 3QJ5A 5GZ6A 4B7UA 3D7LA 1V6AA 3IKVA 2Z95A 2PKQP 4FJ0A 3M2PA 4ZRNA 2BI7A 1DLJA 3LF2A 4B4UA 2YZ7A 1NYTA 4WLNA 2LDBA 2JD2A 4HX5A 4BNJA 1I3KA 4CLEA 3W4KA 2DFVA 3ROPA 1QLJA 4E5PA 5FI3A 5BQFA 2F00A 4ALJA 3RUFA 1PEDA 1R4NA 2VZ9A 1E3EA 4AICA 1ZUD1 2Y05A 4QECA 3LZ6A 5T64A 3G1TA 4DMMA 1AGNA 4BB6A 2EP7A 1JAYA 3FHLA 4YR9A 5I7EA 4UEJA 4CLRA 4YAGA 3PJEA 5EPOA 5JC1A 1EVIA 3MTJA 2EHDA 1DIHA 1NFQA 1U3VA 2DLDA 4G65A 5DBIA 5L7TA 3DR3A 4PRKA 1NR1A 1SCUA 2DT5A 2HJSA 4D0RA 1JWAB 3WICA 1DDOA 1YS4A 3JQFC 2QYTA 4D3SA 5JPIA 4MVJD 2C7GA 5L7WA 1F17A 3BZUA 4PZEA 2NVUA 1WDLA 2AHRA 3OIDA 4H16A 4N54A 3SJ7A 4EI2A 1CJCA 3WGQA 2WDZA 2DAPA 5AYVA 4JNKA 4YDRA 5HWSA 4YT5A 5TS3A 1S7CA 1Q0HA 3I1JA 4XGKA 2PH3A 4GL4A 1XU7A 3L9WA 1RM5A 3CINA 3GA0A 5LDHA 5IDXA 3DMYA 4RDIA 5IN5A 1YKFA 2VYVD 3DDNA 1N8KA 5DCWA 2Q2QA 4R1TA 4I08A 1DAPA 5CP8A 3T7CA 4XA8A 4I5DA 5JYEA 1FMCA 1SB8A 4J16A 2HQ1A 4BNVA 1ADFA 1EK6A 5G4KB 3K8ZA 4LMRA 4NG5A 4E3ZA 3O9ZA 2SCUA 3JYOA 2OXIA 3ANLA 5L7YA 4ND2A 1KIFA 2FZWA 5JNLA 4XD2A 3DEYX 2H63A 3ORFA 4BNFA 3QV1A 3SEFA 1HYEA 4R16A 2GUGA 1M75A 4RVFA 1KEUA 1PS9A 5KTKA 1E3WA 3JD4A 4B8WA 3Q9UA 1P1FA 4WECA 2O3SA 4Y6SA 3O38A 3E1KA 1KEVA 3TWOA 1NQTA 2IODA 3AUTA 5HA5A 4BO7A 2IXAA 1GQQA 2XAAA 4BB5A 1ISHA 3CUKA 2V6GA 4BGUA 1LSJA 1NHWA 4A26A 1QYWA 1E6UA 4FS3A 2PA3A 3TL2A 3GG9A 1EMDA 2CF6A 1P1JA 4O63O 1CQJA 3ETGA 3QW2A 4K6CA 3KETA 1V3TA 4W99A 3GN2A 4HY3A 4B3HA 1C1XA 3WBFA 1B8UA 3RUIA 1RM3A 3HHPA 3FN4A 2XXJA 5HBRA 2Q99A 3SLGA 4FN4A 4IJKA 3ZWPA 1Y6JA 3RQSA 1E7WA 4NIMA 4BS9A 1YB1A 1LDNA 5A06A 3MJTA 3VPXA 4M49A 4YAEA 2FR8A 5C7IO 2X9NA 2CF5A 2O23A 3DOCA 3NGLA 4NNJA 4IY1A 4DREA 1DEHA 2G82A 3DBLA 3L07A 5ER9A 2JD0A 1EVYA 1TA4A 2HDHA 1J6UA 3F1LA 4CLHA 3UUWA 3W8DA 4DQUA 4Q3AA 4MO2A 3KUXA 1C0PA 1PJSA 4XB1A 3WBBA 3HNPA 3UCXA 2OP1A 1PR3A 2EJWA 5IXYA 3KSZO 1LUAA 1NPDA 1OC2A 3OF2A 3WYBA 1JWBB 2Y99A 1UH5A 1EDZA 1PWXA 2EKPA 1OI7A 4DYDA 3U62A 1B3RA 2OGUA 4DPLA 1B14A 3JQ8B 1OOEA 3F9IA 4G81A 1U2GA 1JTVA 2HMVA 3RFTA 1CRWG 1QXSA 1RM4A 1ZMTA 4J4HA 4KDFA 4YJGA 2HMTA 3CTMA 1P74A 5IDQA 4UVIA 4BNUA 4QUKA 4Y67A 4CLOB 4GSLA 7ADHA 1D3AA 3M6IA 3E18A 4R41A 3RIHA 4B4VA 1LLQA 4EYEA 3VH4A 1V3VA 2GCGA 3KM0A 3PDJA 3C85A 1C14A 4OOEA 3PEFA 1HDXA 5L53A 2AEFA 3HFGA 3I9MA 1YBAA 1EK5A 4D46A 3EMKA 3FSRA 4ND1A 4UEOA 3NTQA 4Q3NA 2XPCA 1SC6A 3JTMA 4IZHA 4KUGA 4BQPA 1NR7A 3WQQA 5IZCA 1BXKA 2JKVA 3F6YA 1F0YA 3KO8A 3OHSX 4AJEA 2VYNA 5G0WA 2PKQO 4KUEA 1GCUA 4LVCA 4R5MA 3IJPA 5B4UA 3O8QA 3AK4A 5BSEA 1Y5RA 3RUDA 4XX0A 3U4CA 2B4QA 5A02A 5BSHA 5JSFA 2FSVA 3H4VA 1YXMA 2WEKA 1ZW1A 3PFWO 3MJSA 4XWYA 5DOVA 1XA0A 3DQPA 4W82A 4MKRA 1CWUA 1UP4A 2ZTMA 2Y66A 2PZMA 2CDBA 4DXHA 2C20A 1E6WA 3N7UA 3H8VA 1F14A 1O6ZA 4I5EA 5JDCA 3D0OA 4IJUA 1DAOA 1DSSG 3RC2A 3WQRA 2YV3A 1EBUA 3ZU2A 9LDBA 1C1DA 4S1VA 3JQAA 1JVBA 3B6ZA 4YEDA 3VPHA 3ST7A 3GR6A 1YJQA 4AJLA 3C8MA 1YONA 5G4LA 9LDTA 5TSDA 4FGSA 3QVOA 4J3FA 5EQFA 1E77A 4YACA 3DHYA 4PLHA 3T7EA 3ENNA 2GASA 2FN7A 5G0UA 4BGEA 4HNHA 1PQUA 3DFZA 5JS6A 1YQXA 1M76A 2RCYA 5IG2A 1B15A 3NX4A 1LSOA 1LJ8A 1NP3A 3LC2O 3G0OA 5CEEA 1HE3A 4GWKA 3JQ7A 4BNNA 4J43A 2BLLA 4Y98A 3NEPX 1ULSA 4KQWA 3LLSA 4WEQA 4BL5A 1H9BA 5KIAA 3WSWA 4A10A 3I52A 2EJVA 1GYQA 4II3A 4J7XA 3VC7A 4ZHSA 2V6MA 4LVUA 4CR7A 2NU8A 2YHUA 3OP4A 4G5HA 3RJ5A 3VTZA 3WLEA 1ONNA 1TT5B 3CZRA 3ANNA 2VCYA 3BAZA 3PJDA 2P9CA 1DIGA 3E9QA 1IL0A 4NBVA 3V1TC 1HTBA 3IP3A 4ZA2A 4A73A 1XEAA 3L6EA 4ALLA 3EZYA 1YQDA 1UP6A 4LN1A 1PGJA 5CPFA 4NBUA 3DHNA 3RUEA 4WCDA 3ZWOA 1GZ4A 1N9GB 1HE5A 2AQ8A 4RJTA 1ZK2A 4NH4A 3PVZA 4TVOA 1MV8A 3QVWA 3HN2A 1TI7A 3BA1A 2HMUA 3K2EA 3KEOA 4QO7A 3ULKA 5ENVA 1B8VA 2HRBA 4CUKA 5H81A 1V3UA 3BMCA 3PWSA 4R68A 2AE2A 1B7GO 1P1IA 2CD9A 3UHAA 3PHHA 4OM8A 1KY5A 2FR1A 3F5QA 1LC3A 1VJ1A 1U9JA 1F06A 5BNFA 3ZDFA 3OIGA 3H5NA 2DBQA 3JYPA 2YFHA 5TLSA 4JGBA 3BMQA 2NTNA 1LRKA 4YQYA 1JKIA 5IZ4A 3WOHA 4KMSA 5JYDA 1EQ2A 5FWNA 1GR0A 5ILGA 4EUEA 3VH1A 2Y1DA 4INAA 1YDEA 4R5HA 4M8SA 1Y8QB 1TT7A 1ENYA 3S2FA 4UVHA 3PI7A 1ZIDA 4W7HA 2O4UX 2X4GA 4J9VA 1B2LA 3FTPA 4XGNA 4A5OA 4I9UA 3DTTA 3FBTA 3NUGA 1G0NA 3I4FA 3MJ4A 5L95A 2YV1A 4OJNA 3WDSA 1NVMB 4ALNA 4Q3CA 4F46A 5GZ3A 1CERA 1NM5A 2E49A 3VDQA 3QSGA 4CMKA 3KV3O 2PH5A 2JAHA 2VYND 3V8BA 2Z5LA 1I2CA 3GZNA 4FOSA 3WB9A 2YQ5A 5THQA 2Y0DA 2E82A 3AFNA 5BNTA 3PQEA 4A03A 1ZK4A 3RD5A 4YRBA 4IDDA 3HSKA 4URFA 2GLXA 3PIDA 3H9GA 3T4XA 1BDBA 4IDCA 3W4IA 4IS3A 4YYZA 5F5NA 5C3MA 1T26A 3OIFA 2D0IA 3JSAA 4G2NA 4YT8A 2B69A 2VT2A 1HETA 1HYHA 1LRLA 4CM6A 4O59O 1F8FA 1NQ5A 3UKOA 2ZB4A 5CPBA 3F46A 5A9TA 4EUFA 4HUJA 3JYLA 4QTZA 1JA9A 3DAGA 3GFBA 5B4VA 2QW8A 1P9LA 4DQVA 4CQMA 4D3FA 1N92A 5I7VA 3JQAD 4YJGB 2GN8A 4JJFA 4L73A 1JW9B 3GHYA 4EGFA 4E31A 5C5IA 3AOEA 3A9WA 3I4CA 4J90A 1H6DA 5BR7A 1MB4A 2Y1OA 1I36A 4U6QA 3WJAA 1R15A 5KJEA 4DBVO 1B3BA 1XGKA 1N5DA 1P33A 3GPIA 4J1TA 3WJ7A 5A9SB 2ZB3A 4FFMA 2IYPA 1VI2A 2DTEA 3G79A 3KRTA 4M55A 4D3DA 2J3KA 3NT5A 4BO4A 4CUZA 5BSGA 2DTXA 4YTEA 1RJWA 3NKLA 2GN4A 3LT4A 4MIOA 2D5AA 3DC2A 3AU8A 4NFHA 1TXGA 1MC4A 3B70A 2OZPA 3ZI0A 4PLPA 1ZMOA 3NTRA 1QLHA 3ZH2A 1AN9A 1P3DA 3D4OA 5DZSA 1GDHA 3ITKA 1HDCA 3PHLA 1YE3A 3AI3A 3H2SA 3RC9A 3V2HA 1MUUA 1XQ1A 2IZ0A 2Y1FA 2QZ9A 4UUPA 2ZTVA 1WXDA 1P44A 3C1OA 3IIEA 1OBFO 1BHSA 3DFUA 2Q4BA 4MKZA 4FPXA 1PSDA 1YOVB 1R16A 1SOVA 2QRJA 3RROA 3QE3A 4YXFA 3H2ZA 5DOZA 3V1UA 2Y67A 3QWIA 3E48A 5HTOA 3GHHA 3DBHB 1GUYA 2NWQA 2G1UA 3UAGA 1GCOA 4QT0A 4UUNA 3TNLA 4JQCA 4CL3A 4X54A 2JHGA 3JQAB 3GUCA 1X14A 3R3SA 4DTIA 4B3IA 3CMMA 4J7UA 3RBVA 5FF9A 1VL8A 2O3QA 3F5SA 2OMEA 4B79A 2AXQA 1Q7GA 3AJRA 1E6EA 3KSDO 3FPLA 1EUCA 4EEXA 3OJEA 3B1KA 4BV8A 3DO5A 3QHAA 4MVJE 1JDJA 1GL3A 4DIBA 1UJMA 1M6HA 1BXGB 1DC6A 1T2EA 1Z7BA 3ZHBA 1ISGA 1IUKA 1JAXA 2NSDA 3A06A 3JQ7B 4RZIA 4GLLA 4GMGA 5FFFA 3ZU3A 5IJZA 5EERA 4BUCA 3UOGA 5KJCA 1DFHA 3AUUA 3WWYA 3F47A 2OHXA 4JXKA 3DTYA 4J2HA 1T2DA 5DP1A 2P5UA 4R3NA 4QQRA 3WGOA 3CPSA 2Q1WA 2BKAA 1K6JA 1R66A 2X58A 1VC2A 1QSGA 1NBOA 1QV6A 4D43A 4WGGA 3K6JA 2AEJA 1TEHA 4C7KA 1P77A 1LTHR 2VHWA 4H3VA 4UVGA 4ZQEA 4JBGA 1DOHA 4NMHA 4BO0A 4OOFA 3OJFA 1JQBA 1EBFA 3PWZA 5DCUA 5TJHA 4RVGA 1SB9A 5EIOA 2R00C 3RI3A 1I3LA 3IC5A 2GZ3A 3PLNA 3BMNB 3PYMA 4BKUA 2IEDA 1ORRA 3D3WB 4N5MA 1EE9A 2ZATA 4JLWA 3AY6A 1ZSYA 4FQ8A 3PHJA 1P31A 4YJFB 2Q1UA 3IUSA 3QWAA 5JXWA 3HDYA 1J4AA 5TF4A 4K6FA 3HB4X 1BVUA 1GYPA 4XB2A 2HAEA 1O8CA 3OM9A 1SOWA 1YB5A 2O48X 5HM8A 3NJ8A 5F1KA 3EZLA 4IPTA 3PGJA 4I9NA 3BMQB 1T2FA 3CXRA 3HADA 3PRJA 1IHXA 3DOOA 3DXFA 2ZTLA 1M67A 1SMKA 4II2A 1I32A 3EC7A 2ZJ0A 3PWKA 4RPLA 4B4OA 3PFFA 4RQTA 4CQMD 3CIFA 3ZU4A 3DMTA 1Z74A 3U4DA 1LC0A 3FR8A 2OP0A 1CIVA 3BIOA 3ZWWA 4AJIA 2EGGA 1XELA 4RPGA 3WGGA 5TIIA 1T24A 3FTNA 4M54A 3A28A 3L4BA 1IB6A 3E9NA 3NT4A 1MGOA 4ESOA 5B12A 1GFSA 1PL6A 3PDUA 1HL3A 1H9AA 3ZWBA 4JROA 3ONDA 4BO8A 5LCXA 3RU7A 3FBGA 2FR0A 1IPEA 4Z3DA 3D4PA 1GEGA 3KYDA 4WUVA 2C2XA 1VE9A 1LLCA 3MOIA 3Q2IA 5JY6A 4IINA 1E1NA 4OXKA 2Q46A 1ID1A 3MWEB 2J6IA 3JQ6A 4YJDA 3DZFA 3RVDA 3KZVA 4IM7A 3LQFA 2B4RO 2FZEA 1YJ8A 2PD4A 4XIYA 4MVJI 3AM3A 3JD3A 4FDAA 4WCFA 3UN1A 2EG9A 4MVJP 4GX1A 4RVSA 3VZRA 4HFJA 4OGWA 1DC3A 3GC6A 1E3JA 1PJTA 1VL0A 2QX7A 5TT1A 3R3JA 2Y1EA 5L9AA 4XRRA 3GDFA 3GEMA 3ZU5A 2X1HA 3IOYA 2HJRA 2A92A 4XR9A 1O5IA 1R4MA 3WGIA 3QLJA 3BTSA 5LDGA 2C29D 2C82A 5GY7A 3DB2A 1NNUA 5T5QA 4BKOA 4CM8A 2JCVA 2V65A 2IE0A 1BTOA 3MEQA 5ITWA 3L9XA 3LVFO 3ROMA 2Q4EA 2JFFA 1W8DA 4BNLA 4EJ6A 4Z3KA 5B4TA 2Y0EA 3CZMA 2DC1A 1J5PA 4GAEA 2NU9A 2YHIB 2PV7A 3DMTC 3F1KA 1NQOA 2EIHA 1ADCA 1I2BA 2GR9A 2WYWA 5LC1A 4DL9A 1Q2XA 5HS4A 1LSSA 3NT2A 3ZN2A 2B35A 4AVYA 3HE3A 1JKFA 1XWFA 1ZK3A 2GPTA 2H6EA 3AUAA 4IGEA 4TKLA 2HCTA 5KJFA 2W2LA 2GF2A 2WYVA 3H9EO 1YO6A 4IXWA 2X5JO 3Q0EA 4Y6RA 3AM4A 2AA3A 1CQIA 1WDKA 4D44A 2J5QA 5K6AC 1SPXA 4JP3A 2GSDA 4W6ZA 2BF7A 3E5MA 3P2YA 4YJHB 4E2XA 3CE6A 5A5EA 5CAEA 4RO0A 1TVEA 4OL9A 4B7CA 5L40A 4GH5A 3WWZA 3DZHA 3ENKA 1C0KA 4WCFC 4E2YA 3ASUA 1IZ9A 4OYRA 3OQ6A 4CR8A 4HNGA 5COBA 4ZQGA 1T2CA 4BGIA 1Z6ZA 4GMFA 3VZPA 1OC4A 1VKNA 3ROKA 1BDMA 1VL6A 1XCBA 3GRPA 3ZV3A 3GRKA 3UCFA 4R9SA 1AUPA 4R1SA 4GI2A 3BHIA 1XQ6A 4D79A 1GD1O 1T4DA 1SAYA 3AFMA 3BYZA 2X6TA 5G0TA 4CUJA 1WP4A 2FPGA 1LBEA 1U2DA 3TFQA 4CQLB 2GZ2A 1VJ0A 4ALKA 1XR3A 2FP4A 4I1IA 3JD2A 3RCBA 1BW9B 1J0XO 2WD7A 2BGKA 5DF1A 4PZDA 3NV9A 1MX3A 1IOLA 5JFOA 1GY8A 1E5QA 1P1HA 4J4BA 1PQPA 2UAGA 4GKVA 3JQEA 1O9BA 1PX0A 3JQ9A 5JLAA 4ZQFA 5A3VA 4ALIA 1Y1PA 4PZCA 1UZNA 2X9VA 1LA2A 1NX6A 5JO0A 3DZBA 1LXCA 4L8VA 3SJUA 1Q0LA 1Y8RB 2WSBA 1K6IA 5CEJA 3S1LA 3VDRA 4S3MA 4NZ9A 1HDYA 1NQAO 5B1YA 2HU2A 3DBVO 2PWZA 1R0KA 1MC5A 1LLDA 2TMDA 3EAGA 4PLCA 1FDTA 2VQ3A 5L4SA 5C7LO 2HKIA 4J9UE 3WLFA 2QZZA 2CFCA 4NBWA 4Q3BA 1XKQA 2B4TO 4ID9A 4E5MA 4JX8A 1U4OA 2PGDA 3OEWA 2PD6A 2C54A 3BMOB 5G0VA 1KC3A 3A1NA 4WNCA 4YRDA 5DDIP 4E5NA 3IAHA 5CDUA 3JD1A 1N2SA 3PZBA 2AQHA 4MVJG 4D42A 2OL4A 4NBRA 1O94A 4IGFA 1BVRA 1HDRA 2GNAA 4J7CA 5IFLA 1IPFA 4B3JA 2E6UX 4M86A 2W2KB 2ZCUA 1UAYA 3WQSB 3Q11A 2PY6A 4XYLA 3P7MA 4JBIA 1NVTA 4BGVA 4DIOA 4YCAA 4R1NA 1VJTA 1QP8A 3OQBA 1KVUA 2RH8A 5AXCA 4CMHA 3G49A 3PP8A 5EJ2A 4P4GA 3C1AA 3JQ9C 3GY0A 1UXIA 3ZV4A 4N5NA 3D5TA 4DC1A 1ZSVA 2G76A 2A4KA 3PYLA 4W4TA 4XCVA 3PIIA 5I9LA 2YJZA 4E2WA 4NR0A 3HWRA 2YV2A 1EVJA 2GD1O 3E8XA 5COAA 4CM4A 2W2LD 5I8ZA 3GVCA 2VOJA 4BNGA 4DA9A 2I5PO 5JC8A 1Y9EA 2A94A 1MLDA 3S8MA 4RF3A 3GUYA 3QVSA 1T2AA 1KC1A 5EN4A 4MVJF
chains in the Genus database with same CATH superfamily
3RHSA 4M1TA 3WLIA 2HRCA 1XZAA 4IIDA 1GZ6A 3SK0A 4QHTA 1QFSA 2NZXA 1MBZA 3I9NA 3KTFA 4C87A 5ITQA 2ZE6A 3ZZUA 2G9UA 1ST2A 3ZTTA 1BE1A 3DWFA 1OAAA 4IYRA 4LGVA 4QULA 4I1YA 2W2OA 4BJHB 4ZAVA 3A6EA 1JHUA 2AN5A 3DP7A 5BQOA 2H5XA 4L3OA 1DCTA 3ENVA 5LA6F 3UAYA 3W2EA 4PQYA 4IH4A 4RAQA 1BX0A 5CFOA 1PLKA 2MJLA 3I42A 4ZAZA 1Q21A 4LDRA 1W6UA 1TMGE 1R88A 1ZOLA 5C81A 3ZCUA 4IV5A 2VJLA 1CB0A 2HIMA 3T5CA 4V38A 1SGWA 3NDJA 5JDCC 3D8LA 3HP1A 3HVUA 3P27A 4X62M 1X0XA 2R4QA 1P7YA 1OB2A 3AG5A 4MKXA 4LZOA 5JNUA 4IIWA 3VO2A 5SY9A 1EB8A 5AI9A 1ULAA 2P2SA 3UNXA 2HI0A 4EQ6A 2ZU0C 2PZFA 3FNGA 4V0SA 4FEGA 2P6MA 4GKBA 3WYAA 1GZ7A 2CXXA 1S0UA 1AC5A 1USUA 4RZXA 5D84A 4AJNA 4UUBA 1A98A 3NOOA 3DBLB 3I9JA 4JI5B 2JKYA 3DEKA 5ITZB 3GFOA 1CZUA 3A46A 3NDRA 3NLLA 5JCXA 3GBSA 2JVJA 4ZDWA 3ZHOA 4N7RA 2A7XA 3CR8A 3KSUA 2ZIXB 3CEPB 5IF9A 4KR7A 3JWIA 3A70A 3DT6A 2DUMA 5E6RA 4G5QA 4CFYA 2G7ZA 2ZYUX 2CUTA 2GSWA 2QP9X 2Q28A 3LPMA 5HF9A 3B53X 1WB6A 3MUNA 5CG2A 3THXB 2RBEA 3GH3A 2HPVA 1I2ZA 2XUIA 4Q1CA 2Q8PA 1YI0A 3K1TA 4BX2A 4DV1M 3L79A 1PTKA 5JT1A 2I03A 3DKIA 5T67A 1W2WB 3E82A 2JFBA 4HFNA 1Y5MA 4DUYM 4HJXA 5CB4F 5KYYB 3AQIA 3ICWA 4AKSA 4FC7A 2R5FA 4HGQA 1EWRA 5KQDA 4L95C 2IYWA 4RV9A 4DY4A 2I33A 3O1IC 3C98A 2W00A 1NSTA 1K82A 1DGBA 5BN5B 3ADCA 3WO1A 3OWHA 2JI7A 4UBJA 1W85A 5I7RA 4ZO4A 4GC5A 2BGIA 1I30A 1Y4UA 4UNIA 1E9VA 1NNSA 4F3RA 4CR6A 2Q5IA 1WPRA 1F4VA 3KUKA 3W2HA 5T3YA 1N9ZA 1JF8A 1SCKA 1GADO 1R9GA 5PGMA 1KVRA 1WDTA 4JFRA 2X0NA 2QBYA 6REQB 2UYOA 4PX3A 2G80A 4KPGA 1PP4A 4OHYA 3INRA 1VCOA 3NTLA 4HVAA 2F59A 2LVAA 4CM9A 1N0IA 4LHXA 3ZDYB 2NXJA 3ZUGA 3D8NA 4YB8A 2OGSA 3H2BA 2BGJA 2R4TA 1FBTA 4MK4A 3HKDB 4CCWA 4FHGA 1HK7A 3BIJA 5FL3A 3LS2A 4WOJA 5D7BA 1H2YA 4ANFA 5F12A 2CFTA 4LMAA 1B6SA 4FFWA 2IUTA 3N87A 1XLTA 3GFVA 2PGAA 1DJQA 2OXTA 5EP1A 4CEHA 4LDQA 3QYFA 3D6UA 3R7SA 3WRXC 2XDWA 2UYHA 2DTDA 2IDKA 3LECA 4YS6A 1AJEA 3ZHUA 4DAOA 3TD2A 1X8XA 2EERA 3A1CA 3V42A 4EW1A 1D2MA 5ED0A 4YPVA 2GEJA 1UT5A 1LEHA 1GU1A 3A3OA 5KOJB 2HWXA 3G85A 1N6RA 4RQUA 4FU0A 1E94E 1YD7A 1QGZA 5JE8A 1OZFA 3V76A 1XLTC 1AMUA 1AKEA 3ER6A 3GPBA 2CHFA 1E9BA 1M2GA 2AI2A 5BOVA 1DHRA 4GU5A 4WZAE 5HQJA 2VFAA 2WFLB 1F4LA 1ND5A 4WY5A 3TLZA 1E6LA 2H7YA 2PE5A 1M0EA 4ZQCB 1U0EA 3IJ5A 1D4FA 4DPMA 3OFKA 2J3IA 1YS1X 2XYQA 3EVBA 2EDAA 1L2TA 2FMUA 2DB3A 4B1FA 2QQ5A 3O3OB 4NOKA 3ZDAA 3L40A 3KT8A 3MTGA 1PJBA 5HQ3B 2J07A 1N8NA 3FCOA 4UBOA 1NWCA 2RIPA 4B85A 5DULA 2GAFA 3NBZC 5L4NA 2B8EA 3FW1A 4TXLA 1ONOA 4JXXA 1F9AA 4MRVA 5LFAA 1YH3A 2VP4A 1PIWA 5ICEA 4ND5A 2WIGA 4ITRC 3I5MA 4KKXB 4GVLA 1KGSA 5L51A 2QGNA 1RRMA 1XZEA 2CRUA 2BFNA 1KH3A 2X9GA 2GOYA 1W2HA 3UPDA 1S2NA 3PQCA 1T9KA 3CA8A 4KPUA 3ETHA 5C1DA 3NBAA 3ONVA 2FPLA 1H5UA 4GPEA 3EK2A 4F1JA 5TMDA 3RUCA 4OBXA 4JA2A 1B1AA 3FCEA 2QL7A 3GBVA 1GSAA 1N3YA 4HQFA 2Z0MA 2BE9A 3PSHA 1ZFNA 3TW0A 2XVMA 5LNK6 1RHJA 4JB8A 4LGCA 3OU6A 1QAMA 1NJ8A 3S81A 2DUWA 5E7MA 1SUIA 4C08A 3QIAA 3M49A 4P4LA 5CB8A 2BR4A 4DJ5X 1ZUIA 4X92A 2HA6A 1MJ5A 1JU9A 3P9XA 1O95D 3R3YA 2NM0A 2HLHA 4XR4A 2X2EA 4FBLA 2PBFA 5BUSA 2I8AA 1F38A 2HYIC 4XYGA 5JI2E 3H5OA 4IIEA 1Q3CA 1NPTO 2K87A 2RJ3A 4KDEA 4HRAA 2OOAA 4TX1A 3NI2A 1QV7A 5LZ7A 1V7ZA 3N6VA 1RTTA 3W90A 4BWVA 4ZQHA 5BR8B 2D0OB 2KE5A 3MW8A 1NXTA 1UFOA 4BP1A 1RT9A 2JGEA 5JI3E 4IBOA 2VBCA 1KU0A 3RNLA 1RZVA 3LBHA 5KHOC 5KX5F 3TN7A 1T9GS 5IX8A 1UOEA 3E3OA 4EATA 2Q2WA 1OIWA 3MNFA 4KSYA 2WF5A 2WZQA 1QKIA 1TJ3A 3CW9A 5HILA 1DHTA 3Q8KA 3S2SA 2WWVD 1VRVA 3I83A 4WPGA 4D6XA 2I76A 5HGJA 3O31A 3SIWA 2Z09A 4KFRA 5AVVA 1I3NA 1LGYA 4LBZA 4HK4A 2RFLA 4EY5A 4F3YA 1TYAE 1X7XA 3LCUA 4FHZA 3AFIA 2BM8A 1RZUA 1M34A 1M2WA 5F1PA 3DAYA 4K28A 5AJXA 1PT9A 4N41A 3PG5A 3F6CA 4YV2A 2J32A 5HMLA 2EXXA 1TTTA 2OHHA 5FL7A 2I66A 1AD2A 1ZXXA 1G63A 4IO1A 2BNKA 5H37D 3DDCA 1FIUA 2WY2D 5JNWA 1LRJA 2O57A 2O8CA 4BHTA 4M8LA 1UBFA 5REQA 2PG3A 1P2GA 5HSGA 4RDXA 5DSTA 3U37A 1MO4A 3RSOA 5KC9A 2LCQA 5AVSA 3KX2A 1E3TA 3BWVA 4N0PA 2DPGA 1ZL0A 1RJ9A 1NOKA 1TB4A 1G64A 3KD3A 5EFZA 3VAZA 4YMSA 4JLJA 2WT9A 4W1RA 4C0XA 1Q15A 2ZYRA 4IFTA 2SHKA 3TECE 1BW9A 1I6KA 1PJ2A 3PKZA 5HJ2A 4H27A 4DJDC 4UCQA 1TM3E 1KL7A 3D64A 3GGSA 2DENA 1V7CA 3O03A 4NI5A 5D7NA 4MVJA 3U7GA 4M9CA 1UMCA 3GGDA 4JLUA 2P2DA 2PGXA 3L7IA 1X1CA 3OP1A 3QVLA 2AIRA 4MLZA 4HJRA 4M0PA 2ZR0A 4LHZA 3ZWKA 1HQDA 3AVTA 5KU1A 1U4NA 4WA7A 4DJEC 5JARA 1L5QA 4D4JA 1I10A 2Q7XA 4EQ6B 3RREA 2HSZA 2AI3A 2XCTB 1XPUA 5CVCA 1U8CB 3BJZA 3NBUA 4OA5A 4UFPA 5DW3A 3N39C 3GLGB 3C1UA 2OCYC 2ZULA 3G5TA 2YYAA 2LVOC 3TF5A 2QTVB 5JJKA 13PKA 2AV6A 4CZ2A 3TG2A 4NK5A 1IRIA 1V8DA 1G1AA 4Z4GA 3MAGA 5BP7A 4ME6A 2ZYAA 1NLYA 4I2NA 4L76A 4KGXA 4N03A 3ZI4A 2BI7A 4HWGA 1YS7A 5E6RB 3AYZB 1PI3A 4BEBA 4BNJA 3B82A 1M8PA 1PFWA 2PCLA 4N8EA 4NH0A 1E3EA 5IM4A 4E46A 5GOTA 2IOHA 1AGNA 2BDTA 1W7AA 1P1BA 1NDUA 2W6MA 2OENG 1E4EB 1EVKA 2ZVQX 5DBIA 1GILA 2VF2A 2H00A 3ZQ4A 5AR1A 4D0RA 2CLFB 4XAQA 2VPWA 2FNAA 1FP4A 1ZVQA 5LXTF 4B8YA 4PZEA 2DAPA 2JIOA 1X2BA 5D87A 2XX3A 3J7TA 3MWJA 3WLMA 1IEXA 4JSTA 5AK0A 1SUFA 3GAMA 2GKOA 1ADFA 3MJDA 3G59A 4EM6A 3IULA 3JYOA 5EJFA 3UWDA 3ANLA 3V7NA 5L7YA 4YP1A 4R8RA 4XD2A 2G07A 1W85B 4B3XA 4DMFA 5KTKA 1NQTA 2JZNA 3CPEA 3O8NA 2XAAA 3TWLA 1KMNA 2DETA 2PA3A 3F6PA 4NOOB 4B31A 1YIOA 1P1JA 5EZSA 3OE5A 2XLJA 3KETA 4G4RA 2OY0A 4CTJA 3RUIA 4E1VA 1MHTA 3FN4A 2Q6TA 1JJVA 1VL2A 4DYHA 2YBEA 1YASA 2QBYB 2WNHA 2YXEA 1P6UA 4EA8A 4FGLA 4R81A 2J3DA 1XWWA 5CB4A 3WBBA 4ZK6A 4RHTA 2HF8A 2I4NA 5LDDC 3DFFA 4BAGA 1EUDB 4F38A 1NMQA 2GM4A 1K63A 3HHXA 3WHKA 2Y27A 1L5FA 1MOPA 2YJ5A 3F9IA 2H1LA 1L5KA 2JNHA 1MH1A 3IMKA 4BQNA 3RTAA 5EMNA 3AFHA 4MV0A 5FV7A 1USIA 4IEIA 2HX1A 3C85A 5EZ5A 1NUUA 1FP2A 4X66M 3A7DA 1YBAA 5G40A 4LWOA 1NN5A 4Z99A 3EQ7A 4MTLA 2JKVA 1VPLA 5G0WA 3DZ8A 1Y3AA 2QI9C 2Z30A 4XX0A 5FI1B 3EZ6A 3QE0A 4F1WA 3D8BA 1XA0A 2FCRA 5LMUM 1X3SA 4QELA 3D43A 2X9QA 1DIOB 5CFLA 4MUMA 2AKEA 3JQAA 2VPPA 4J3FA 5EQFA 1UBSB 1PK9A 5MF6A 1IWPB 4Q4JA 3ROGA 2PX5A 2RCYA 1NP3A 3I3SR 1C0EA 5CEEA 4NCIA 1AQLA 4WEQA 1GM5A 3U7RA 5KIAA 1DOZA 1WUHS 2CXTA 4US0R 2O5RA 1HGXA 1T0BA 3BD7A 3UOWA 3OCCA 1PGJA 5CPFA 3KOXA 2H0AA 2AR7A 2DH5A 5KDLA 5ENVA 4Z6YA 2HRBA 1KQPA 2CD9A 5F52A 4E14A 3F5QA 3ZDFA 4B34A 3ENWA 4ZCQA 5TLSA 3RG8A 1DS6A 4Q03A 1VDMA 1DT3A 2EVWX 1DL5A 4XPIA 3O94A 3FKQA 4JGGA 5BOSB 3DTTA 4GMQA 4R1OA 5JWHA 5EMMA 4EO9A 4LYFA 2Z5LA 1JPJA 4OM7A 2PZ8A 1WY5A 3RD5A 3C3YA 4CGZA 1XV5A 5HK9A 4RKFA 1NQUA 2D0IA 5I01A 2B69A 1MX0A 5C8ZA 1I6LA 4ZOLA 5HZKA 2KLBA 4BDTA 4B6JA 1YU9A 4DQVA 4B74A 2B2CA 4JJFA 4MW9A 2CNLA 1P5HA 1FTYA 3OQOA 1Z2AA 2CLKB 3CVUA 4J1TA 4Q4LA 4RV4A 3NT5A 4EJ2A 3DV2A 1HURA 4QPNA 3LT4A 3DC2A 1TXGA 2B82A 4PM4A 1HDCA 3FI0A 3KALA 3V4OA 1Q3BA 4PBRA 3NHJA 2M6RA 1MCZA 3RROA 3V4ZA 1VIVA 1C7EA 4K9OA 2C7OA 2B2XA 1OXMA 1PGYA 4JI6B 4ZKDA 3FPLA 1OVMA 4DEVA 1AS3A 4U7FA 1UJMA 5F3WB 3S4YA 5JPCA 1EESA 1TCVA 3NKFA 3NNNA 4REQA 3UOGA 2F1OA 1ZJWA 3HY4A 3MWYW 2D2VA 5DP1A 2NYUA 3WGOA 1RE0A 3V48A 1V5IA 3O3NB 2WWFA 3JRXA 4KQEA 3O74A 1WV1A 3CRRA 3PYMA 5IANA 3AY6A 2W83A 3UEOA 3B6IA 2REXB 4NY1A 3EZLA 3SQMA 3CXRA 3SFTA 1M54A 1MJFA 4XWAA 1OX6A 3PU6A 2OP0A 3WGGA 4R7GA 1X6VA 4OB6A 1UIMA 2AMVA 4QUJA 1IB6A 1L8LA 3YASA 2J9ZB 3TLJA 4ESOA 3WMFA 2XZOA 3URMA 2A14A 3FOAA 1SD5A 2FOLA 1XTRA 1VLZA 3Q10A 3ZXSA 1TLFA 3DBOB 3GJ3A 3HP7A 1X7XB 3U56A 1F2UA 3GC6A 5K3CA 4XRRA 2YWBA 1KEZA 4DLTA 1M34B 4LZJA 1JI0A 2ZUCA 5C1BA 3PPXA 3L82B 1FU4A 3FUVA 4PCZA 1GOTA 3BD8A 4KRFA 4K9SA 3F1KA 5KX5A 1K8YB 2WYWA 3KSBC 1DX9A 5JISA 5JJLA 2IXEA 2O8CB 4TUWA 5REQB 5KJFA 4RMJA 1WIVA 2R6GA 1FY2A 1VPTA 3A3NA 1KHHA 4P1ZA 1BC5A 1C0KA 3PD1A 2EKZA 4YDSA 1VKNA 4WJLA 3KAKA 3GRPA 2HA3A 3GRKA 3RFWA 5CDHA 3UCFA 3W5UA 3VU3A 4R1SA 2QVLA 2IPXA 3SQOA 2C58A 3PRHA 4YREA 3VHXA 1G18A 4DSZA 2J0QA 4E09A 2G0AA 5H7XA 1BW9B 1VMEA 2NSYA 1MX3A 2F3TA 4J4BA 1POXA 2BEWA 3L7DA 1BMQA 2RHWA 2HWYA 3SJCA 3WAJA 1R2ZA 1UMCB 3PF9A 1XCGB 4C2TA 1KJJA 2GEFA 2WSBA 1ZN2A 1K6IA 5CEJA 3C3DA 4S3MA 5C0OE 5E6UB 4YHHM 2NO9A 1R0KA 1MC5A 4IF4A 3OQPA 1T8SA 2C8KA 1QUSA 2BJWA 2V7UA 4WNCA 5K0CA 4LA4A 2I2FA 2EKFA 2KX7A 4M86A 1UAYA 4XYLA 4QLBA 4N49A 3FKSD 4ENVA 1INLA 5KSPA 1QONA 1JZSA 3BSSA 1PKEA 2G76A 2A4KA 1NHWC 4RTJA 4RJIA 3A1EA 3E8XA 2GXQA 3STVA 4N3GA 4KQ9A 1QTRA 3NRJA 1EHYA 2A94A 1T2AA 2REQA 3AVXA 2V6IA 1O8BA 2ZJOA 5LPNA 4GNKA 1FP6A 4IIVA 2ZIFA 2P9ZA 1PJ3A 3G7UA 3WDKA 3KOUA 3T7KA 4CDMA 1W9MA 4RZSA 3ZWCA 2IYVA 4JBYA 3IERA 5AKJA 3RHZA 1XHFA 4DCOA 4CMGA 3WE7A 4QFDA 5KYVA 3TLKA 4TYPA 3TEMA 4R2KA 3QVTA 4MP8A 3H0EA 2GESA 1XTJA 3EGCA 4BQEA 1QORA 3ZEIA 2HF7A 1PGOA 2VYFA 1FP4B 4E4YA 4Q0MA 1RADA 3OCVA 3MBOA 2AOTA 4HKTA 5IZCC 4OTZA 3AKYA 2EX0A 1QHFA 2JEOA 4MUIA 3LRXA 3EW7A 4ZZ3A 3UWOA 3WTBA 1YA8A 2VDOB 3QU4A 1I1HA 2D3TA 4LOKA 3PV0A 3UUGA 4EP1A 2H92A 5JHGB 4W9MC 2C7PA 5B1IA 4CV1A 2P40A 5DT9A 3K2QA 2AEEA 2CNWD 1HNXM 3M5WA 2ET6A 3IHTA 4LHYA 1XCLA 2QPLA 1Y9DA 2GRAA 1MA0A 4HDNA 4LC9A 1BHO1 3H1FA 1RHUA 3G2JA 5HRCA 3HTXA 2CCKA 5CB4B 1T2NA 1YAHA 4MGEA 4Y2GA 4YRSA 3SYTA 1RAGA 1PD0A 1PJCA 3BFJA 4JB3A 4YCBA 4IAOA 3I01M 1P5FA 4Z2AA 3KOZA 4RKYA 2DWCA 2JFPA 4QEKA 3LCRA 2DCUA 4CODB 3I4LA 3MMNA 5CITA 1IZ8A 3EXG2 4J0JA 2CXPA 2KS6A 3P8ZA 1PJ4A 3TZCA 3FR7A 4PAMA 2LVQD 1L4EA 4S1NA 1NVVR 3OEHD 1P4JA 1WETA 1Z6PA 3DTVD 1K98A 4XIJA 2CB0A 4J2OA 5ALEA 3AHJA 5CXXA 1PWZA 2FZGA 1LBIA 3M6XA 4TTQA 3HCCA 4NHEA 1X94A 4NYIQ 3RAJA 3ANXA 1OR8A 1SHJA 4WVFA 4QQNA 2P9FA 3I3OA 2O2YA 4DUGD 1TZMA 4JB2A 1IE3A 5JS8A 2UYYA 3O8RA 1ADYA 1SZDA 4Q4JB 3KP1E 1VB5A 3OICA 4IRUB 1GPKA 1JYEA 1JVSA 4DFDA 1J9EA 2XCLA 1LB1B 1TPZA 3I9V1 1XOIA 3QG1A 3I76A 3EEIA 3WMGA 4QRIA 1DJNA 1RAEA 4LCEA 2PRIA 5D2CA 4WLVA 5TR9A 1NHGA 4CDNA 1PEAA 1G4HA 5LOVF 2ZT6A 2AYYA 3KB8A 1HL7A 1D04A 4I14A 3FWZA 3AO0B 4XH9B 3I4VA 4HDKA 4ZHQB 1UWLA 3QK7A 5B58T 3VH2A 4S0ZA 2YOHA 1P1RA 3SI7A 2B7CA 2JH9A 1L4NA 4MB0A 3JZAA 1FU8A 1JJFA 4TN5A 4X7BA 4U8GA 4XPIB 1J8VA 4KCGA 4BNWA 4HOYA 3EGOA 3T52A 1YQUA 1ZINA 2J0SA 4XJTA 3S99A 4DR5M 1NHGC 1Y7TA 3WB0A 2C9DA 2FLVA 2CFIA 4CLOA 2IZOA 1JDVA 3NVAA 4DR7B 1JDTA 4AUKA 3BQMB 4LQCA 1OAOC 1QFYA 3K1AA 4EY8A 4ZOLB 1RKBA 2P68A 2Z1DA 3FYUA 4CPDA 3GP5A 1AA9A 4GZ3A 1SVNA 3T4PA 1ZUHA 4IH9A 1RC8A 5LMNM 1U9ZA 5IDWA 1ADGA 4PHHA 1YTLA 1V9LA 4BB0A 4EMBA 5C1IA 4UJ3A 4NMWA 3CN7A 2ZIAA 3CBQA 3M1YA 4NOMA 3U6LA 4KQKA 3RH0A 1NRXA 4LY0A 1QS0A 5K05A 4M1ZA 3M8KA 2PXCA 3LQKA 2MHCA 1BEEA 3B1JA 1U7DA 4DBGB 1RRVA 4ZI3A 4JBHA 2VT3A 4WKNA 2BMVA 2YJNA 3ETEA 4DM7A 3C6QA 3DL2A 4Z9FA 3KOMA 2ZWPA 4M1MA 3RK4A 1K7FB 4NDNE 4WSOA 1OXVA 3E5RA 4REQB 4OXNA 2XUZA 1NJGA 2RAFA 1P29A 2RGXA 2YWGA 3E05A 4RJKA 1RQGA 3NM5A 1MZPA 4GX2A 3GLFE 4LF8M 4ZEOA 1CRLA 1RYDA 4JCCA 3QYJA 1M6VA 1DOAA 1Y8QA 1EGMB 3VR5H 3KOOA 1VMKA 1AT1A 4L8GA 3FUUA 4Y8VA 3SBOA 1U2DC 1ZVMA 3AR3A 3FFWA 4CM7A 1O6CA 2A88A 2E7ZA 1C81A 2BJVA 1EM8A 3SBJA 3DAFA 2D06A 2AEMA 2KA6B 1CNFA 1XD9A 2RHRA 2CNWA 4HEOA 3C43A 5DFAA 3WNQA 4LZLA 3OY2A 4BO6A 4D4KA 4URYR 4A82A 4AY2A 2XWQA 1ECCA 1F2UB 3HQ4O 1WXIA 5KYKA 2I6FA 3CEHA 4M4SA 2GJKA 3OCWA 2VQEM 2VK1A 2J5BA 1RNLA 1TDJA 2LUOA 2GBIA 3JPWA 3QQ5A 1WLYA 5C32A 3M4XA 3NJ4A 2QGFA 4PC6A 2AN4A 2OYRA 5GZ1A 3B78A 3RVPA 4U6NA 3P5BA 1IM5A 2WNSA 2VSXA 1SWWA 1JHXA 5EKTA 2DKFA 4RORA 3H9UA 4FYVA 3OOEA 3R24A 5G1NA 1FFAA 1UCFA 1NTOA 2XNCA 1SCDA 2HSJA 1EG2A 3OPQA 4QEDA 3GPLA 4WY2A 1U7UA 4Q3DA 4CM1A 1PYGA 1MC8A 3VHXB 2BFAA 4AN4A 2GM9A 1GPJA 1P4GA 3TVDA 2LVNC 2Q9CA 1V5GA 3DVQX 3ILYA 2DKNA 1WX1A 4TM8A 3CPJB 4BN0A 2BEWB 2AK3A 1LBQA 4AP5A 4UOQA 2B25A 3MLBA 4LJLA 3MCVA 2PKCA 2X2FA 3LC7O 3U9LA 4HH0A 1GZ5A 2G1AA 2X5OA 1U5CA 1XFDA 3TGLA 5F21A 4KFTA 3BK7A 3F96A 4FD2A 5C5CA 2PR7A 3GLUA 2JIPA 4FC6A 2C83A 5AH0A 4ZO7A 5CDGA 3OPYA 2DX7A 1MQ9A 4JMLA 4RIGA 1GA1A 5EHXA 3U5ZB 1JYFA 2C5HA 1GWNA 1V2HE 1TK2A 1TFUA 1NR5A 3U6KA 2QMEA 3H4TA 5HKOA 3GUUA 1N5IA 2P30A 1C9DB 2C9MA 4F3CA 2P0EA 2REQB 2YHIA 1O08A 4RS3A 1NJ6A 4Q1DA 3MWKA 4BU1A 2D1FA 4PWZA 1UC4B 4M1SA 3W9UA 4BN5A 2X3FA 5EJCA 4OXYA 4MHTA 3M34A 2IKQA 1EE2A 1NBMD 4O1MA 3HV2A 2PFSA 4HI0E 1YA4A 1MOQA 2C9ZA 5AKHA 3UGQA 4ND8A 4V0NA 1NF8A 4XIIA 1GRVA 3CF4G 3IUMA 4CL2A 3F8SA 2AOTB 1GGNA 3HB9A 4HDCA 1EIZA 1A8SA 1J25A 4EHFA 3OLVA 2WTAA 1EA5A 4TYMA 1Y48E 3KNZA 1VP9A 3HVHA 4L2IA 4US1R 4L4XA 1DUVG 3COJA 2GCEA 1RM0A 3EVDA 3H05A 4YY3B 3WL8A 1VHWA 2FZKA 2QTLA 4B32A 1G1MA 2JZOA 3VR4H 4YX9A 4XGIA 2W2KA 5U1PA 4AJ1A 5IVDA 3BE8A 1I7PA 4GPTA 3IECA 5G1PA 2PZJA 1ENPA 3UPTA 4FMDF 2ATEA 4DV2B 4HDNB 1C9JA 1TRKA 4EG3A 5GOZA 1TYZA 3E7XA 4DZZA 1IXRC 3K9QO 3SAVA 1Z18A 2H1IA 4MQEB 2GO1A 1AKRA 1OGIA 2WHEA 3IAFA 4BKMA 1B74A 1EFKA 3D6JA 1U7HA 2DFTA 1KOJA 4YAOA 2ZRCA 3QY0A 3SHVA 4AKTA 3AUJB 4ZRNA 1S89A 2GKSA 2Z04A 2X8BA 1M2JA 2C2GA 4E5PA 2C2KA 1VE7A 2ZZNA 3G1TA 3T7SA 5AW9A 3QYAA 1B6TA 2LXNA 3RYIA 1IFYA 2AH5A 1XMQM 1E9SA 5L6MB 1K2VN 1TRHA 3WICA 3E7DA 1JQ5A 4HN2A 1DRKA 8GPBA 5AUOB 4H16A 2V0CA 1T5DX 3LOQA 1O77A 1Q0HA 4XGKA 4IOKA 4ZDJA 3TD9A 2LIVA 5F76A 1D5WA 3N8IA 4UUAA 3GB9A 4XA8A 5M04A 3FTQA 5AI6A 1BWRA 2Q7DA 5J40A 3NONA 3IUBA 5T4HA 4LMRA 1IG0A 2H1OA 4RA9A 2CE7A 3DLPX 5EUCA 1GITA 1T3LA 2TS1A 2WP0A 1FTSA 4M0FA 1IDN1 2B1RA 3E22B 4YFVA 3O38A 1KEVA 2FZ5A 5HA5A 3A36A 3OO1A 3VR6D 1LSJA 2HXYA 4IFIA 5T3UA 7REQA 2ANBA 2FI1A 1FVOA 3EDCA 1RM3A 3SLGA 4FN4A 5ALXA 1RYNA 1U0LA 4HDKB 3D2AA 5A06A 4M0CA 4NNJA 4K3VA 2G82A 5ER9A 1QBGA 2N0SA 2DWPA 4MGIE 1U8YA 3KUXA 2OP1A 1Y1LA 3HFRA 4XLZA 3U31A 4RD3A 3KXIA 3TKYA 1ZD8A 4UVIA 4BNUA 4CLOB 2GCIA 5AVXA 5JWOA 3AUKA 4JI7M 3B13B 3OM8A 1IDOA 2XPCA 1G5TA 1LF5A 3K1AB 2Q6OA 1JILA 3PBKA 1ORYB 3WLAA 3FYUB 1Y5RA 4KGVA 5JSFA 1BKYA 1VOTA 2NG1A 2ETXA 1L6IA 1U5BA 2P1ZA 1ZR2A 1U0HC 2CDBA 4DXHA 1JEEA 1JQKA 4MCJA 2A5YB 1R8JA 5FNVF 1QGED 4ZP1A 2Q62A 3LHSA 5JDCA 4F56A 1P4SA 1A3CA 2D2EA 2BZSA 4BLQA 3NXSA 1TIKA 3EXEA 1KWGA 1F5NA 2QRGA 4JT8A 3PUIA 1HOTA 2GASA 4V1CI 2PBZA 1TK9A 4G0VA 1WNFA 1HE3A 4BNNA 4AMVA 1QS0B 2L17A 4BL5A 2NNWB 2HV8A 1QKJA 3HUTA 4ZHSA 2AR0A 1Q22A 3ANNA 3P9IA 1U2ZA 3T3PB 3K9GA 4EVRA 4U9HS 4WCDA 1T5SA 3PVZA 3Q1KA 4EYOA 2F3PA 4R68A 3SZRA 1F51E 3AP2A 2PT5A 4DWOA 2IVFA 3CUVA 4LSGA 3KKMA 5FD8A 1M6VB 2Y1DA 4MJ3A 1Y8QB 3EPKA 4W7HA 4BVFA 4U63A 1NW5A 4OI4A 5A0FA 1WMSA 4XGNA 3LG2A 3I45A 3ED1A 2GK3A 4F46A 2AMYA 2QDXA 3IMGA 2G70A 4MB7A 3MN1A 1E2FA 1WUJS 4FOSA 3E9CA 1K6MA 1EX9A 4GI1A 1EM8B 1E9CA 5BNTA 4D0NA 1RDFA 3U6SA 3T4XA 5EZQA 5BR4A 1YA6A 5IREB 1M74A 5A9TA 4EUFA 2QY9A 1CS4C 4A92A 2DJIA 1MB4A 4XCXA 1N3LA 2P75A 2WJGA 4NC9A 4Q3OA 4JLSA 4XEUA 1A50B 3OSZA 4YAFA 1GDHA 4UC0A 1M83A 2VBFA 5CT8A 2XQIA 4OYYA 4OQMA 1PUJA 3QTTA 4JL8A 2R3SA 2QI9F 3UAGA 2F90A 4JQCA 4GQIA 4ARVA 2R5WA 4DG9A 1Q7GA 4DIBA 4KVGA 3VU1A 2DPLA 1AO3A 1FPQA 1X2EA 4CG2A 5EERA 2WWHA 1XDZA 1NBOA 1M0TA 5EP3A 1LTHR 4GNRA 4UVGA 4B7FA 4JBGA 5JR3A 4NMHA 3QPVA 4UHBA 5E3IA 1QM5A 1OWMA 1NIJA 4R2LA 3AWIA 1O8CA 1Y0BA 1LJLA 4ZT7A 4YFYA 1I32A 2Q8QA 4RPLA 1Y42X 1NBHA 3WRXA 1U1GA 1YCFA 2FWPA 3HJTA 4K9PA 1PTJC 5AW7A 2I9KA 4MR8A 1Y7HA 3FR8A 1N5MA 1BE8A 4ROTA 2MSKA 3E9NA 3IILA 3ONDA 3D7NA 1CR1A 2BFCB 1D0MA 3OPYB 3PX7A 4ZVRA 1UPCA 2GJ9A 1I4DD 1CJKC 4A2PA 4MVWA 2EG9A 2QNRA 4IFEA 3CEJA 3LUDA 3QLJA 3K2LA 3HVKA 1E2LA 1VCNA 2GVNA 4F12A 3BMXA 1R27A 4L9WA 2YHIB 4I1VA 2OCIA 3DULA 2C99A 2EOAA 3IOEA 4IGEA 1TGVA 2RGOA 3NV7A 1SC1A 3KDSE 1ABFA 5I7HA 3KFUG 2A1IA 1W48A 1SPXA 1YB7A 4W6ZA 4J3NA 4B7CA 2Y21A 4Q9HA 1G5PA 5K8IA 4GE0A 1TM5E 3LLUA 4WKOA 1C7QA 2C4WA 3U9TA 1QH1A 1GD1O 4LTDA 1L7RA 3EQ6A 4OB7A 1WP4A 5BW5A 3OF3A 1DDGA 4GS5A 3NPMA 3TLYA 3HKBA 3AV0A 5DF1A 1MV5A 1YE9A 4MGKR 3AHHA 4LRUA 1E5QA 2FB9A 5JLAA 4YP9A 1UZNA 5MHTA 1NVEA 1MRSA 1ZD3A 3WP1B 1R64A 1CY2A 1OZ0A 4L2IB 1RLIA 3FFXA 4MWDA 2O05A 1ODKA 5C4GB 3EAGA 4RHXA 5L4SA 4LG2A 2OGZA 2PSFA 4ZVNA 4RV5A 4HEA1 1JE1A 2C4NA 2PGDA 4E5NA 3IAHA 4OB8A 1DG9A 1ESCA 4BGDA 2Y1LA 3OVMA 3VYUB 1ZMRA 3LW7A 2W2KB 1KAOA 2C4UA 2XGGA 3UT0A 4UHKA 3SHWA 3K32A 4EY3A 3G49A 5EJ2A 4P4GA 3V8PA 2VJKA 4X45A 4M99A 4W4TA 5DHRA 2FQXA 2QJOA 3WJ2A 2Z7JA 4LNHA 2A5FA 1M2KA 4LE2A 1B26A 3OEYA 5T6BA 1FW6A 4WCFB 4QLOA 1U0OC 2QNIA 5DH9A 4IHJF 4LY3A 3IUEA 1E6MA 4OBBA 3K70D 4FVMA 3SC2A 1Z56C 2V59A 3ZX4A 3OQJA 1ZN8A 2V7VA 3EVTA 2WYUA 3IUQA 4YRMA 4P08A 3G9QA 4GUAA 4B7HA 2DWZB 3N1UA 2X3YA 4ARBA 2F5SA 3RYIB 5BQXA 2L2QA 2W0MA 3SM9A 2H48A 1T6YA 3WL3A 2YXDA 1ZNWA 1K6XA 2ASVA 4FK8A 4XOUA 4WP2A 4Q00A 2EQAA 1IN1A 2Q41A 3ELWA 1BKDR 3QPCA 3L6OO 1FDRA 5LMZA 3RHFA 1CNMA 2R6DA 3VV2A 3MIZA 5CXQA 5INTA 4GGPA 2VHXA 5LR6A 4HPJB 4P6VF 4AYWA 4RA9B 1ICIA 2QMHA 3A9TA 4QQKA 3UTCA 3VKVA 2FPKA 5KYWA 5LLTA 2OMKA 4BE7B 1K9SA 3QGMA 2ZBKB 3L6DA 2IEYA 2HBRA 2W4MA 1XQVA 2AG6A 4UD2A 2X9LA 1Z6AA 4BNHA 3FMIA 3L8DA 2IBSA 3B7NA 1KU6A 7REQB 4FWDA 3GO4A 2ECQA 2QQFA 2HWUA 3MXTA 5ALGA 1Z0AA 3ABQB 4Q1FA 2J8ZA 4FIDA 4DC9A 1O6FA 2YOFA 3WMXA 4QOZC 4B2PA 3H0KA 4UFNA 4LOAA 1NXOA 2NYRA 3FCUB 5D3ZA 3WHIA 2OR3A 1ANKA 4I8XA 3HVIA 1IXYA 3EZGA 4BO3A 2ESRA 3QEMA 3T3IA 4ON9A 1Y1QA 1ZMVA 2LDXA 1DXHA 4FYWA 1A27A 5FLKA 5H59A 1T1SA 3I23A 4B76A 4D8TA 3MELA 2RK6A 4NWIA 3ZIDA 4GWLA 3DD1A 4BO5A 2WTMA 4CKBA 3LC1O 2C2HA 1AXEA 3QVGA 5K51A 1USWA 3OLZA 1QAOA 1RBYA 1MPXA 3TIVA 3BG5A 1GLVA 4QFCA 3WC4A 2XYHA 3HHEA 3QVXA 1QGDA 2IPMA 1LLUA 1CKEA 5DO9A 1U5BB 2JFHA 3SXPA 3ZCSA 1L7BA 2QZ4A 5TX7A 5EP4A 3HB7A 2QCUA 4PLWA 3EXEB 2D5BA 1WZEA 1Q0UA 3S2IA 1PWEA 3GGCA 5EPUA 3N0VA 5LJLA 3N0WA 3IPRA 3CLHA 1VE3A 4EBFA 2H0RA 4F85A 4D8WA 1ZH6A 1PFYA 1QWSA 2WWTA 3R4VA 2JLBA 1T25A 3IHLA 4CDGA 1AK2A 5ALYA 3ZBTA 4IIFA 3Q9NA 2LZ0A 1OFGA 2YFYA 1GG9A 3FWNA 3SDBA 3CH5A 4ZVQA 2C07A 4QOSA 5LD2C 2VKQA 1JMVA 3KK0A 3KLMX 3TM5A 4I6EA 5FNVA 4Y1FA 3E5HA 3L4KA 3DFMA 3ZLVA 4PD2A 1KYQA 5JBIA 3G2QA 2B83A 1OI3A 3ZU6A 5IH3A 1SURA 2I1QA 1N2HA 5LA6A 1ECJA 3IVGA 4E94A 1RWKA 4QOEA 1JRLA 1X13A 2P5SA 2MSWA 4AIRA 1UXGA 3P19A 4DMHA 4AYTA 2PFGA 2II6A 2LH0A 5B1SA 1RQ2A 2G9QA 1TR8A 3ECCA 3THYA 1U8UA 5LQSA 3SC6A 3H04A 3HNOA 3Q7RA 4I3FA 4P58A 1CQWA 3E6AA 3L4BC 4BMCA 3VPBA 1KJNA 2QUIA 3O83A 2EG5A 4JDUA 4KAXA 3H5WA 3UG7A 3E7PA 2NXNA 1R4AA 4RAOA 3D81A 1OYVA 2B7LA 1H93A 1RBZA 3EGIA 2ZM6M 4F4CA 2R44A 4GP7A 4X71A 4OSEA 5ITVA 2PBLA 1E20A 1J23A 3NUQA 1YIAA 3A6LA 3PCTA 1W0KD 1CVIA 2IUFA 4JU8A 2ZKIA 2Y68A 4E5DA 2ZQ5A 2O1WA 2C59A 5AICA 1WBDA 4QPDA 4W6QA 2VAPA 1MJNA 2WE8A 3N2ZB 5IK2D 4MYSA 1O95A 4E6PA 3AEUA 1OD6A 2ONZA 4NCJA 4UXHA 4FFSA 1Z7WA 2P4QA 2HRZA 1YTUA 3WR5A 2ZUUA 4OQZA 5EHGA 2OV4A 5B37A 3PA6A 5L3ZA 1ZGGA 4F6LA 4DR4M 4FI3F 1THTA 3FMFA 5DP2A 3VK8A 3THSA 1MB3A 2Q21A 1GDTA 2FG7C 5CXUA 1C3XA 4KITB 3DCJA 3LZDA 1TW3A 3GRAA 3FOFC 4P17A 2A0FA 1CRZA 3JALA 2P9GA 3GP1A 1NVGA 5B64A 1JPVA 7MHTA 1R0CA 4MR8B 2X8AA 1DFGA 1H2EA 1NQWA 1O95C 3JWPA 1YR9A 2FFHA 4MSUA 2WU1A 4JOBA 3SZ3A 2PLAA 1EFLA 3EJWA 2JIBA 3WIUA 2W90A 2LW7A 3NHFA 5TGTA 2PLWA 4EY7A 4RD6A 3T6KA 2B78A 4B71A 3CB4A 4ESEA 4JI8B 4IMPA 4ZAGA 4Y0NA 4C04A 1KVTA 4MDHA 2BFPA 4CEHB 1Z3IX 4WOPA 4F84A 2AZXA 2VUTA 4EI9A 3JYQA 3EA4A 4HDMA 1TIPA 4GXNA 2VHEA 2GHIA 2J3QA 1OZGA 2QZSA 2V3CC 1P0FA 1HRDA 2FOXA 1H9CA 4NFYA 3RSHA 3RSZA 1Q44A 2OG2A 2ZBPA 4G1FA 1ZSNA 1RHKA 4K87A 4U6SA 2AGVA 3RT9A 4HPXB 3WZ2A 1AUQA 4JLMA 1YGYA 4YMWA 1DZIA 1KEKA 1SIOA 2A3NA 3MS7A 1ISSA 5KNLA 4MJLA 4XSGA 4F4DA 2JS7A 2Z2YA 4OO3A 2QAGC 1JSZA 2ZTHA 4NVRA 3BRWD 1QH1B 1W49A 2CUNA 5ER6A 4FS8A 2B6HA 3MA0A 1EVZA 1QQTA 3IAM1 3PUYA 4BATA 1KK0A 3AV0B 3HKBB 4RPKA 3ND8A 4NCBA 2IW1A 1STOA 2Q1SA 2YY7A 3QPDA 1AQIA 3KB6A 3DEAA 4HX9A 4PXSA 4GITA 3T9BA 3BXEA 4R9RA 4UCFA 3KKNA 4P3XA 1QHYA 3AQ4A 3QXHA 4W5HA 3RVMA 3RANA 4EBBA 2FG6C 1B0UA 1E3QA 3DE7X 1HT2E 4DMRA 4JC5A 2ODAA 1W4BA 2JD1A 1Q39A