3AOEC

Crystal structure of hetero-hexameric glutamate dehydrogenase from thermus thermophilus (leu bound form)
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
417
structure length
417
Chain Sequence
LKAYRPPEDPGLWDTYLEWLERALKVAGVHPTTLEYLAHPKRLVTLSLPVVMDDGKVRIFQGYRVVHDIARGPAKGGVRLDPGVTLGQTAGLAAWMTLKAAVYDLPFGGAAGGIAVDPKGLSPQELERLVRRYTAELVGLIGPDSDILGPDLGADQQVMAWIMDTYSMTVGSTVPGVVTGKPHALGGSEGRDDAAGLGALLVLEALAKRRGLDLRGARVVVQGLGQVGAAVALHAERLGMRVVAVATSMGGMYAPEGLDVAEVLSAYEATGSLPRLDLAPEEVFGLEAEVLVLAAREGALDGDRARQVQAQAVVEVANFGLNPEAEAYLLGKGALVVPDLLSGGGGLLASYLEWVQDLNMFFWSPEEVRERFETRVARVVDAVCRRAERGGLDLRMGALALALERLDEATRLRGVYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An unique allosteric regulation revealed by hetero-hexameric glutamate dehydrogenase from Thermus thermophilus
rcsb
source organism Thermus thermophilus
molecule tags Oxidoreductase
molecule keywords Glutamate dehydrogenase
total genus 144
structure length 417
sequence length 417
chains with identical sequence D, E, F
ec nomenclature ec 1.4.1.3: Glutamate dehydrogenase (NAD(P)(+)).
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00208 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine dehydrogenase
C PF02812 ELFV_dehydrog_N Glu/Leu/Phe/Val dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1210 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3aoeC01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3aoeC03
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 3aoeC02
1NVTA 4R4JA 1R15A 4XKJA 1O95A 1UR5A 4BO5A 1C3VA 4GGOA 3FCOA 1GZ6A 1ZVMA 1KVSA 3B70A 4J9VA 3I9JA 4PVDA 5L40A 4PG4A 4GKVA 4TRJA 5DP2A 5IZCA 1MFZA 3BMOA 4XQ9A 1CERA 1YXMA 1SMKA 1ZMOA 1EFLA 5TIIA 4AJ1A 4WCDA 2WTBA 1QV6A 4Y98A 3RWBA 4PG7A 5JCJD 2WYWA 3DBRB 3V1YA 4YJHB 1HEUA 1WMAA 3IJRA 1ZO8A 3KSUA 4F3YA 4LVUA 1PZEA 1G0OA 4BB5A 1AN9A 3IKVA 4KTTE 4CL3A 4CM9A 1MV8A 4EDFA 4EJMA 1XQ6A 4CM1A 2HKIA 2ZB3A 2QHXA 4IZIA 1CWUA 1K2WA 1V8BA 2AQHA 1ZSVA 3E5MA 4D43A 5FYDA 1IPEA 3GFBA 3S2GA 3UN1A 4HV4A 1KERA 2X58A 1IHYA 1Z45A 3MTJA 4GBJA 1GFSA 1Z82A 2NU9A 3RSHA 3UGKA 2BHLA 2H9IA 1SEVA 3P5SA 3EDMA 3H2ZA 2VQ3A 4ZRMA 3WDSA 1PR3A 3ICCA 3BMNB 4Y6SA 3MTGA 3O03A 5JXWA 4D3SA 1LLQA 7MDHA 3IC5A 4L0QA 4ZHSA 1KY5A 4IINA 3UCFA 3SC4A 5C7LO 3JCZA 1LI4A 3CKYA 3PJDA 2VUUA 3UAGA 1XA0A 3LQFA 2VWQA 1X14A 2DT5A 3OBBA 1E3WB 4INAA 4P4NA 2GD1O 5A06A 2HU2A 5KVQA 4FOOA 4JCOA 2O3UA 4BMVA 4YT4A 1XG5A 5HBRA 3U4CA 2VCYA 5A4DA 4D3FA 1D1SA 3EUWA 3H65A 4BUCA 4YQZA 4BQRA 4BNHA 4NFHA 1O0SA 2PKQO 3WXBA 2JHGA 4PFJA 4BL5A 4UEOA 3UW3A 4AJNA 2C2YA 4CM8B 4GMFA 2D3TA 3M1AA 1IYZA 2Q3EA 2B5WA 1ISGA 2IE0A 5JAIA 4QQRA 3ZNOA 4EZBA 4Q3AA 1C0IA 2J8ZA 5IAAA 5JBIA 2VZ8A 5G4KA 1BRMA 1ULUA 2EEZA 1UXGA 4JQCA 4BNJA 4NBTA 2VHXA 1CQJA 5DZSA 3VZQA 4R16A 3DZHA 4Z0HO 1EUDA 3PLRA 3I52A 3WWYA 1MC4A 4XQCA 3UICA 4NIMA 5KJFA 3QIVA 1FJHA 1GPJA 3U4HA 2BFOA 4MVJF 2O7SA 4CV3A 3BTOA 3JYPA 5I8ZA 3OFSA 1ZK2A 3WOHA 2GASA 2EIHA 4XYEA 4CLDA 1ZUD1 1KY4A 1CIVA 2HK7A 1FXSA 1UP7A 2E37A 4RL6A 4TKMA 3JD1A 3HQ4O 1E3LA 2DAPA 3OEWA 1DC6A 4JBGA 4P38A 5JSFA 1L7DA 1SCUA 5U9CA 4XIJA 3ST7A 4BO8A 4HNGA 4D3DA 2C0CA 2WM3A 3BXXA 4WLVA 4YRDA 2VNAA 4K26A 4TRRA 1T4BA 3ICPA 2IXAA 1BXZA 1I3LA 1MLDA 3L6DA 1A4IA 7ADHA 1I2BA 1IB6A 4PG8A 3A28A 3N7UA 2O2SA 1GY8A 2FY8A 4JJGA 4ALMA 5H83A 2HSDA 1Q7BA 2JKVA 3GVIA 2X0RA 2D2IA 2NWQA 5A02A 2W90A 2JD2A 4E2XA 1U4SA 1KEPA 1H2BA 3GH3A 4Q9NA 3NT4A 5G0TA 3RUFA 4CM3A 3F1KA 4CMAA 1Y8RA 3QA9A 3BYZA 4DLBA 1T1RA 3A1NA 3WWZA 4TRMA 4OM8A 3MOIA 3EK2A 1DJQA 1XYGA 4ZD6A 1A4UA 5IXSA 4W7HA 4URFA 3KRTA 4GX1A 3ZWXA 3TOXA 3QE3A 4MPDA 4BS9A 1T26A 1YBVA 3A9WA 1PZHA 3H6KA 2OOSA 2X9NA 1NTOA 3JQGA 5BNIA 5JYDA 4NI5A 1DRUA 3ZU4A 3D4PA 3DOJA 1VJ0A 3D0OA 1I3KA 1W0CA 3KYCB 1MB4A 5THQA 2YUTA 1AXEA 4R9RA 1EVIA 3AUTA 3FPCA 5T8KA 4I08A 4L75A 1XCBA 2RBEA 5DCUA 5L9AA 4DBZA 2Q1SA 1JAXA 3ZHYA 3U49A 2ZYDA 1SEPA 3WMXA 2QRKA 1DLIA 1XU9A 2QW8A 4PRKA 4XQGA 3HB5X 4OXNA 1E3SA 2O3SA 3UFXA 4D79A 1U7TA 5B4VA 2C54A 1YDWA 2FPIA 3ZWAA 2OBYA 3IS3A 4HKTA 1E6EA 1UAGA 3IUPA 4CLOA 1NFFA 3NDJA 4Z0PA 4QEDA 3I3OA 3SC6A 4BNZA 2VOEA 4W99A 2FR8A 4OSOA 2PNFA 4LMRA 3CIFA 4J2HA 5JMWA 2JD0A 4A7PA 4U0KA 3I4FA 2WD7A 3KYBA 3OF2A 3Q3CA 3ENNA 3I9NA 1MGOA 3P2YA 4KMSA 2BMAA 4CMEA 4IGFA 1N1EA 1ZCJA 1Q0LA 2HMWA 1DPGA 4RZIA 4ALNA 4RCVA 2EKLA 1UXJA 3LYLA 4ZQHA 4IDBA 3BA1A 3WTBA 3TL2A 1B16A 3DZFA 2FR0A 1FDUA 4NR0A 3S1LA 3Q2KA 1XWFA 5DULA 4EW6A 3PK0A 5A9SA 4YJFB 4IIVA 1BG6A 3STHA 1GPDG 4LW8A 1TA4A 1AHIA 4MKXA 3BMCB 1YGYA 3AW9A 4QFDA 3VDQA 2QRJA 1EK5A 2BD0A 3RQSA 3GAFA 1PJSA 1YL6A 4JP3A 1N7GA 3I1JA 1YOVA 2Z5LA 1PZGA 3X2FA 1B8VA 2YV2A 3D64A 1NX6A 5DNAA 2ZKLA 5FF9A 3VZSA 5DBIA 1ISMA 4MOWA 3ONFA 1DC5A 4MVJA 1JWAB 3E8XA 3RBZA 4FFOA 3GN2A 3GHYA 2GO1A 2OGUA 1I36A 2EP5A 3DMYA 5I9MA 4CLEA 1DXYA 4IM7A 5LCXA 3SJUA 4CM9D 2P9EA 4Q3CA 1GQ2A 3WQRA 2VTEA 2QZZA 3DMTA 1AXGA 3RC7A 1BVUA 5U4QA 1K89A 3KYDA 3MJEA 4AJ2A 3W8FA 1L7EA 1YJQA 4E4YA 1Y8RB 1B0AA 1DAOA 1GCUA 1KEVA 5EL0A 1YKFA 2P4QA 3D5TA 4BKUA 5HRUA 1VL8A 1X0VA 4L9RA 4BNYA 4BNFA 4MVJI 4BNIA 1R4NA 3RUDA 1RM3A 4NDNE 4IQ8A 1YH3A 3DHYA 2BH9A 3P19A 4CLHA 1B26A 5G0SA 4YJGA 1NM5A 1C1XB 3LU1A 3FTNA 4HUJA 5JS6A 1HDYA 3JTMA 4S1VA 3ZHXA 3JQGB 3RU9A 3VPGA 2D0IA 1BTOA 3COSA 3JYOA 4B3IA 3OETA 5A9RA 5J23A 2YDXA 5IN4A 2HK9A 4IMPA 1HT0A 4WECA 3PXXA 4A10A 2A94A 2VRBA 2EGHA 3HDYA 2PGJA 3WGGA 4XR9A 4E21A 1RM4A 4RF4A 1K6JA 2B4QA 4YCAA 5H81A 3DZBA 3VAZA 4CMIB 2XOXA 3FNFA 4LSMA 4BKOA 2CDAA 1PEDA 2IODA 1FF9A 2HLPA 1E3IA 1S6YA 4LVCA 4CUZA 4WASA 2X5JO 3ADOA 4XEHA 1EUCA 2DPHA 4Q3BA 1ZIDA 4RORA 3ABIA 3WQSB 2ZJ0A 3U62A 1B3RA 1PWXA 5GMOA 5JFOA 2O48X 2Q4EA 2CSUA 4CUJA 1YB5A 2Y93A 5F5LA 2DBQA 2Q46A 1B8PA 1NWCA 2J3JA 3C7AA 3FR7A 1LX6A 4XYMA 1EEHA 2HK8A 2NTJA 2BGLA 2NVUA 1YL5A 3C1TA 4TSKA 5TLSA 2X9VA 2Y0CA 3ZN2A 4MVJH 5JPIA 5T57A 2H63A 5BR7A 4IDEA 4A03A 1UDCA 4DL9A 3D4OA 4DBVO 1ZBQA 4B8ZA 1SAYA 1I01A 2YYYA 4KZPA 5FFFA 3ZZNA 1E7MA 3TNLA 3UKOA 1H9AA 2GN9A 2NU6A 2WMDA 3GEGA 4LCEA 3SEFA 1JVSA 1N8KA 5JDCA 1LQUA 3KYDB 4BIIA 1WLYA 8LDHA 3BHJA 4CMGA 4H15A 5K0ZA 2YJZA 2YZ7A 4IDCA 5KOIA 4XCVA 1E3JA 3P7MA 1TXGA 3CMMA 2O4CA 3HUDA 2AEMA 1Q7CA 4HNHA 4XIYA 5F3RA 5G2OA 3RC1A 1U3TA 2Q1WA 1HLPA 4JP2A 5ADHA 3RIHA 4FFMA 1OBFO 2RH4A 5BSFA 1CQIA 2D1YA 1SOVA 3E9NA 3KBOA 3FBGA 2CNBA 1BW9A 4P4LA 4PLZA 1P74A 2DLDA 4BNVA 3RU7A 2E6UX 2G1UA 4C7KA 2X0JA 5HA5A 2YDYA 3QV1A 1IY8A 1PWZA 5TS3A 1H6CA 2GNAA 4OO3A 2VUSA 3UUWA 4AG3A 3PI7A 3WLFA 3RJ9A 4WGGA 3H3JA 2X0NA 3JQBC 3WR5A 4FB5A 3LLVA 5L51A 3RUIA 2I9PA 5FI3A 4N54A 4CR8A 3F6YA 1GAEO 1PGPA 5KKAA 4WUVA 4AICA 4YRAA 2C2XA 3I83A 3MJ4A 1WP4A 1JW9B 3AU8A 5KJ6A 4IXTA 2HUNA 3KLPX 4Z9YA 3WS7A 4FGSA 5I7FA 3EHEA 1ENOA 3BHIA 5DOZA 2GERA 4YXFA 3WLEA 1P1KA 1O8CA 1QYXA 3CMCO 2H1SA 3VH4A 5JDIA 3F4BA 5A5FA 1GQYA 1HYEA 2VOJA 1Y7TA 2VWPA 1HE4A 3C85A 2O50A 2HO5A 3JQEA 1UXKA 4NMHA 3W4KA 4GQAA 5I7VA 4IS2A 5JDIC 4WNIA 3DFZA 3D5QA 3GHHA 4CMIA 4NBUA 2QYTA 1VLLA 4I9HA 5GZ1A 3ZV6A 2O3TA 3MJVA 2ET6A 2NVBA 1OFGA 3IL2A 2GZ2A 1LLDA 2D8AA 2C59A 2CVQA 3IJPA 5L4NA 1DDOA 4GMGA 5C7IO 4XA8A 1D4FA 1GDHA 4UVIA 1JQBA 3AJRA 4E5NA 5L7WA 3O38A 4M49A 3AI3A 3B1JA 3IOYA 3WGQA 3AOEA 2PGDA 3P2OA 1GCOA 4D0RA 1QKIA 4CUKA 1UDAA 4OOEA 3ZGYA 2PKQP 1PJ2A 3JD3A 1MP0A 2Y0DA 1BXGB 2DQ4A 2XAAA 1HDCA 4MO2A 4YBZA 4ND3A 4DTIA 4J3FA 4CV2A 4XDYA 2I3GA 3LT1A 1UZNA 3ZU3A 2FWMX 1DFIA 4O6VA 3Q11A 3QWFA 3F1LA 3PIIA 3LK7A 2DC1A 2AE2A 1DRWA 1Y5MA 1KS9A 2YQ5A 3PQDA 4J9UE 4YPOA 5JDCC 3DZJA 4Q3EA 2D5CA 4QTZA 2Q2WA 2FPPA 3E18A 4R3NA 2FP4A 4DPKA 3NJ4A 2A35A 4PZCA 2DPGA 3HSKA 2DFVA 1ENZA 2E48A 2JHFA 4MINA 6LDHA 4IJUA 1ONNA 4E2ZA 4W9NA 1KEWA 3IAHA 4L76A 1PQWA 1FK8A 3DDNA 1IHXA 3CTMA 1Z7BA 2Y0EA 3RKUA 3UHAA 3TFOA 2WYVA 1B3BA 1ONOA 3BIOA 3C7CB 4GVLA 5G0WA 2LDBA 2PD3A 4NHEA 5EESA 1K5HA 3G49A 4BGUA 3ROPA 4O0LA 2NVWA 3FRJA 1ZJYA 1ZXLA 3CE6A 3R1IA 3MCVA 3Q9NA 3QRWA 4LRSB 4OAQA 4OH1A 4M89A 5ILOA 5HS6A 3ZNNA 3IQDB 3R3SA 3B6ZA 4UVEA 1O9BA 4FN4A 4YJDA 1LJ8A 5ENDA 3SLGA 3ULKA 4DLAA 4WNCA 2NU8A 5KVCA 5F21A 1DB3A 5TNXA 1LSSA 3C8MA 4RLSA 3KZVA 4BKPA 4CM4A 4D45A 2X4GA 4KQWA 3CEAA 2V6BA 2ZTUA 3DTTA 4FFPA 1SOWA 3AI2A 2YY7A 2IDZA 4G2NA 5DT9A 3OHSX 4YRBA 5JO0A 3LZ6A 3AFMA 4J6FA 1QYDA 4FD3A 1EVZA 4CMHA 2WYUA 3RVDA 1KC1A 2EXXA 3GMSA 4X54A 1ZEMA 3VPFA 3QJ5A 5IDWA 2B0JA 3W6UA 5KJ1A 2OP1A 3JQ8A 3O8QB 1R12A 3GGGA 3IUSA 1DFHA 3UOGA 4CQMD 4JJIA 1JDJA 2VRCD 3BTUA 5AQ1A 1NR1A 3TZHA 3GNQA 1Y9AA 4J16A 4A5OA 4FSHA 1U7HA 1ZNQO 5KWEA 3C1OA 3O26A 2I76A 3GZNA 2FRDA 1H6AA 2Y1OA 1NWHA 4XGNA 2HJRA 5COAA 1IUKA 4MP6A 2W98A 2CDBA 3QWHA 1U5AA 1B7GO 1M2WA 3H5AA 2IZ0A 3DMTC 1LQTA 5CFZA 4R68A 1VSUA 3TRIA 1T2EA 4DRYA 2DTDA 2YV3A 3DBLB 3QVSA 3ZWVA 1W4ZA 2PA3A 4BO6A 3DWFA 1EUZA 4WCFC 5GZ3A 1CYDA 1ZKMA 4IDAA 4IZHA 3GGOA 3M2PA 2HMUA 4CM5A 3OIGA 3D3WB 1FDSA 3WGHA 4L73A 4PVCA 1I33A 3MWDB 1NQAO 3RFTA 4ND4A 1XR3A 4CR6A 3MEQA 4DYVA 3PQFA 4J4BA 3DO5A 4I5DA 4U0JA 4PZEA 4RF3A 6ADHA 1TLTA 1TB4A 5CG1A 3JQFA 2O7QA 2P2SA 3EZLA 4A26A 4LCJA 3RKRA 1SB8A 3MOGA 3ONDA 4R69A 3OQ6A 3PYLA 1C1DB 3L77A 3DL2A 4KDEA 2Y99A 1EVYA 2WJPA 1BW9B 1NASA 4R3WA 2R6JA 3IP1A 2J3IA 1H0KA 3FWNA 3ROKA 3MJCA 3L4SO 2VHWA 1GTMA 4OXYA 2CUKA 3ANNA 2IEDA 2GZ1A 3OECA 1HSOA 4Y8VA 3LVFO 3ZCXA 2ZTLA 1R37A 2AXQA 3W6ZA 4QSMA 2ZJ1A 1H6BA 1QP8A 4WOJA 4RDIA 1J5PA 4CJXA 2DBRA 3DONA 4BNWA 1D1TA 2P91A 4TVOA 3Q0EA 3QHAA 1Z75A 4I8XA 5BNFA 4B3HA 4ND1A 4CM8A 1PL6A 3ZW8A 5EJ2A 5G0UA 3OA2A 5TF4A 1PL8A 1U3VA 2PFGA 1GZ3A 2IZZA 1DHTA 5COBA 2PZJA 4NU6A 4A0SA 1F0YA 1I30A 1LRLA 5JAQA 2D59A 4M55A 1NHGA 3WB9A 5AXAA 3DAPA 1U3UA 2VRCA 2I65A 2BFAA 3AUUA 3OMLA 3KM0A 5AXCA 3R0IA 1U8FO 1HE5A 3Q9UA 1A9ZA 4Z9FA 1S7CA 3CH6A 1BDBA 3ROQA 8ADHA 4XRRA 2VUTA 1X7GA 4PRLA 4TRNA 1GADO 2Q99A 4EBFA 2RH8A 5JY1A 3GZNB 3JD4A 1KIFA 1XU7A 4IMRA 1UDBA 3AOGA 1M66A 1LRJA 1P33A 2DBZA 4MP3A 2C20A 3ANLA 4ZA2A 3ZWCA 1E0DA 3JQ8B 4BO4A 3K92A 3G0OA 5ITWA 2IRWA 3W8EA 3HN2A 1V3VA 3GDGA 2I67A 1IULA 3OICA 3JYNA 4R41A 2O3JA 1XDWA 2PD4A 2VWHA 4FQ8A 3H7AA 4ZQEA 3HG7A 4PN3A 3RUCA 3TFQA 5IZ4A 3WFJA 1BDMA 1M76A 3NYWA 4FJ0A 5ER6A 1K0UA 2Y68A 4JROA 3HWRA 4II2A 5L4LA 4EJ6A 4MVJD 3EVNA 4P8RA 5TT0A 3QP9A 1ZW1A 4DPLA 3LC7O 4KDFA 1QMGA 1T2CA 3OIFA 2VN8A 3IP3A 5THKA 4I5GA 4BNKA 1IE3A 4AJJA 4OYRA 1VSVA 3QQPA 1HDZA 3VOSA 4J1QA 5CEFA 1T4DA 1C14A 1H9BA 4ZJUA 2AMFA 2XXJA 2CMDA 4RPKA 1T2DA 4J1SA 1O5IA 1EZ4A 1DJNA 3MWEB 5DP1A 2NLOA 2RHRA 3W8DA 4DYDA 5L95A 3S2FA 4ROSA 1Z73A 2BGMA 1NP3A 5HS4A 1PGNA 3EW7A 3GR6A 3ZV4A 3ZWPA 4B7XA 2AG5A 1SNYA 4OXKA 1WDLA 1ZK1A 5B1YA 3GVHA 2ZK7A 2Q1TA 3KUXA 2PH5A 4PG5A 1DIGA 2VT2A 1PTJA 5DCWA 3IDSA 4CMBA 4G65A 3ETGA 1Y8QA 4M54A 4CL8A 2WE7A 3A06A 3E1KA 4NJOA 4CQLA 2R00A 1CF2O 4WOKA 4DMLA 1M6WA 4NFYA 5A3JA 1LUAA 4YEDA 1YQXA 3A4VA 1GYQA 3SJ7A 3CINA 5EQFA 4B4UA 3QVWA 5TSDA 4GX5A 4CLOB 4J1TA 1XSEA 3H5RA 4J90A 1X1EA 4CMJA 1ADBA 5KTKA 4DPMA 4HFRA 1GD1O 1LA2A 3ZW9A 4IGEA 1PS0A 1ZK3A 1ZFNA 4DIBA 4W9NC 2Q45A 5DF1A 3WIDA 3RI3A 3NT2A 4WLUA 3SX2A 4FC7A 2G5CA 1CEQA 1HTBA 2EP7A 3WYEA 3GDOA 1NR7A 3KVOA 3PJGA 3LT0A 4RVHA 1MUUA 3WNQA 3A14A 4ITUA 1LNQA 3GEMA 4DMMA 2GDZA 3JQBA 3FR8A 4OOFA 4IUYA 4U6QA 4CV0A 3RCBA 1V3TA 2B83A 3BMCA 4JX8A 3WMWA 5L3ZA 4PIVA 2VHVA 1PGQA 1RM0A 1KETA 1X7HA 1E7RA 3DBHA 1QYVA 1E1MA 3U4DA 2EW2A 2OO5A 1WXDA 3EGOA 4YAKA 1J4AA 2X6TA 4O59O 4FFNA 3KOUA 3M1LA 4MVJP 4QO7A 1PJ4A 1FMCA 1JKJA 2EKQA 2JJYA 4KUHA 4F45A 5FEUA 2DFDA 3ASVA 1KC3A 5B12A 1UP4A 5CEJA 4EITA 1NPYA 3H8VA 4H3VA 4OMUA 5TRTA 3G79A 5ICSA 4ND5A 3F5QA 3E03A 3CSDA 3R6DA 5IG2A 1E1NA 1Z7EA 3K31A 2RHCA 3OM9A 2PR2A 3DBVO 3G1UA 1P1IA 2OP0A 1U3WA 4DIOA 3U5TA 2OZPA 2CF6A 4JJFA 2W2LD 4XYBA 1LC3A 1HWYA 5FWNA 4BMSA 4GGPA 4YAJA 2UUPA 2NM0A 1Y5RA 3RASA 1HYGA 5CDSA 2QIOA 3LC2O 4HFMA 4MIYA 3SVTA 1K3TA 2P5UA 2JFHA 2FHSA 4GVXA 5ENVA 3K2BA 2FSSA 1H5QA 1E6WA 2GR9A 3O4RA 4MIEA 2OORA 1FDTA 1Y6JA 5LC1A 4CV1A 4R9SA 1I0ZA 3DXFA 2FSVA 1EDOA 3I9LA 1U8XX 5ES3A 3D7LA 1U2DA 4IJKA 4J4TA 4J0FA 3PVZA 4IDGA 1Y8QB 3ZH2A 9LDTA 3FI9A 3F3SA 3AY7A 1VE9A 3JD2A 1ENYA 3C1AA 1KVQA 4Z3KA 4YAIA 2P5YA 3PZBA 1VKOA 3LF1A 1YB1A 3VHRA 4UEJA 1YS4A 4WLNA 4BNXA 1E7QA 4ZICA 1QLHA 2Y66A 4N5NA 4R5MA 4W4TA 5K6AC 4RVSA 3H9UA 3PYXA 3LC1O 2QZ9A 4CMCA 4M86A 4FBGA 3NRCA 4F6CA 4GLLA 1HDOA 2XXBA 4WEOA 3JQAB 1M67A 1T2FA 3INTA 3RC9A 3U9LA 3DTYA 4NBVA 3DOOA 5L45A 1NFQA 4U8GA 5C7OO 4PLTA 4TZKA 4WKGA 3M2TA 4MP8A 2EKPA 5T8KC 1XGKA 4MDHA 2NVUB 3RBVA 4FFRA 4N5MA 1T25A 4U7WA 3DQPA 4IS3A 5AYVA 2CDCA 1NFRA 1XIVA 4GH5A 3FHLA 3NX4A 3ORFA 4RVFA 3PHIA 2R00C 1M6HA 3EY4A 3HDQA 4OKIA 2OXIA 3WGTA 3OEYA 3JSAA 1D8AA 2ZCUA 4TZTA 3WQQA 2Y1EA 1U28A 1EMDA 1HDRA 1P3DA 2JCXA 4GSLA 3K2EA 2X23A 1LXCA 4BQPA 1I24A 2DU8A 3GUYA 1LTHR 3ITKA 3L9XA 2AHRA 1X7DA 1DHRA 1UUFA 2BFPA 3KEQA 4ALKA 1WAMA 1IOLA 3ZU5A 5CHEA 5IDXA 1DO8A 2O4UX 3HE3A 3PHLA 5CDYA 1XEAA 1A7AA 3WSVA 3WYBA 3JQ9A 3U3XA 1ONPA 3PHHA 2Q2VA 1DLJA 2Y1GA 4QUKA 5DCYA 1WDMA 1WW8A 3ZWOA 1N7HA 3DBRA 1YBAA 3GLQA 5BT9A 3V2UA 4Z3DA 1HLDA 1ZMTA 4CLRB 1H6DA 4AVYA 5JMPA 3RUHA 2NACA 2HMSA 3VPHA 2A92A 2DUWA 2E49A 4S3MA 5L7TA 4NG5A 4UUMA 3BMNA 5B4UA 1CJCA 3HB4X 1LBEA 2ZCVA 1DC3A 2NSDA 3PWKA 5T67A 2O2YA 3NEPX 5U1PA 1GEEA 4NPCA 1F8GA 4BNTA 1YQGA 3ZWBA 4J7XA 1TT5A 3AU9A 3WIEA 4GL4A 4E5YA 3AI1A 4Q3DA 4UVHA 4GLOA 5TJ9A 5JAMA 1I32A 3MZ0A 4IY1A 2AEJA 3ASUA 4RPGA 3TDKA 4JBIA 2CVZA 3PDUA 4DGSA 5C3MA 1JLLA 1LSJA 1DIRA 1OMOA 3U0BA 3VVBA 1IZ0A 1YDEA 4Z6KA 2BGKA 1XLTA 4ZQFA 3DEYX 3PP8A 2PD6A 4TVBA 3TZ6A 1VI2A 3QVTA 1BXKA 5BQFA 2BI8A 1EE9A 3BMOB 4LRTB 1V3UA 3G3EA 4O5OA 2GN6A 2FOIA 3TZCA 1QV7A 4D41A 4UVGA 4DC0A 3JQFC 4UULA 4BO0A 3OA0A 2YHIA 2XPCA 1AGNA 3ZI0A 3I6IA 4YJHA 1CRWG 2PZLA 3V2GA 4EGFA 3ANMA 4AFNA 1KYQA 3TOZA 5C5IA 4CM6A 3G17A 1ZSNA 4I1IA 5DN9A 5A3VA 3WGIA 2EF1A 3K6JA 4FS3A 3L4BA 3F46A 3KV3O 4EUEA 1ISJA 1EFKA 4W82A 4RPHA 3VZPA 1PJBA 1PJTA 2ZTMA 2RCYA 3HN7A 1KOLA 3KLMX 1ARZA 4IPTA 1Q2XA 5COQA 3ENKA 4KQXA 3D4NA 5IDYA 1NXQA 5TGDA 3OH8A 1TI7A 1AE1A 4R1TA 3RROA 5L53A 4BGIA 5GY7A 4HWKA 3TQHA 3I23A 3DBHB 4BO7A 1A9YA 4H16A 1HZJA 4AJKA 1YVEI 2RAFA 4JIGA 1H93A 2EV9A 3ZV5A 3NGXA 3WGYA 2D4AA 4BNMA 4M1QA 4WE3A 4R01A 3V8BA 3NJ8A 4RF2A 2BKAA 2JFGA 2R2GA 4XZ3A 3KETA 4IJVA 5DDIP 4D46A 2G0TA 3O9ZA 3VTFA 1R0SA 2JAPA 4C4OA 1Z74A 4GI2A 3DAGA 1LDEA 2H6EA 1A27A 3BHMA 3JQDA 3T7CA 1ADGA 2X86A 2ZB8A 3E6AA 2YHUA 5EMHA 1KVTA 3PIDA 4E0BA 2GLXA 4RVGA 1PQPA 4XGKA 1R16A 2AEFA 3KYCA 5A9SB 3ZDFA 4RVDA 1EE2A 4YJFA 4OHUA 5ER9A 5G4KB 4E2YA 5KVVA 3AY6A 3V1TC 1X1TA 3U09A 3G1TA 4UAGA 3V5NA 1JA9A 2WD7B 5JLAA 4OL9A 2VYNA 5L4SA 5HTOA 3I9MA 5TJHA 1O94A 1P1RA 5AXBA 2FZEA 2VWGA 3ZV3A 2EJVA 2LDXA 4MVJM 1A7KA 4CPDA 1YB4A 4FCCA 3JQAD 3LT2A 3DOCA 3K30A 3VH3A 2NADA 3GRKA 4HP8A 3KO8A 1OAAA 4UUOA 1ISIA 3RFVA 1B2LA 4TWRA 2GRAA 4XB2A 4RF5A 1PS9A 5EPOA 4AJOA 1PL7A 4XRGA 2CVOA 1UH5A 1LDMA 1TEHA 3M6IA 2WEKA 3GZ4A 4J0EA 4XYGA 2IEBA 2TMGA 3WFIA 3KXDA 3GPIA 4UVDA 1WZIA 4R51A 1CETA 2AQIA 4BNNA 3BZUA 2PY6A 5T6BA 1UXIA 2C5AA 1DIBA 1GQQA 2Z1NA 1EVJA 1R4NB 2OHXA 1DIAA 1DSSG 1HDXA 1Q0HA 1T24A 3I4CA 3O8QA 1HDGO 3B1KA 4XYLA 1PQUA 2DUUA 1MX3A 2B36A 5BSGA 1SPXA 3QVXA 2GZ3A 1P45A 2CY0A 5KJEA 1E3EA 1YONA 5ICMA 1RWBA 5JE8A 4CLXA 3L4BC 5IF3A 1DC4A 1HETA 4K6FA 3PRJA 5IJZA 4J1NA 5L7YA 1NQOA 1NYTA 5I7SA 4LGVA 1E5QA 2A9FA 3Q2IA 1E1KA 1OC4A 5TQVA 5F5NA 3D3EA 1SB9A 5CPBA 4DQXA 3GG9A 1HSZA 4J43A 2TMDA 3HJAA 3OJEA 4HY3A 1TT5B 5BSEA 5T5QA 3NTOA 1J6UA 2C07A 3UF0A 1ADFA 1YBMA 3GNTA 4GAEA 4BO2A 4D0SA 2NU7A 3LF2A 3AM3A 2FZWA 3K9QO 3PZRA 4QFCA 4WJZA 3DFUA 2V7PA 5DBFA 3WBFA 5A04A 2F1KA 3LDHA 3S2IA 2GCGA 3PJFA 2J5RA 3VKUA 5ILGA 1IPFA 1DRVA 5I8WA 2PKRA 4YACA 2EGGA 5CAEA 1D3AA 2B37A 4DIFA 2Q4BA 4PLGA 2HAEA 3EZYA 4Q3NA 1Z6ZA 3VZRA 1RPNA 1HXHA 4IDDA 4E33A 3CUKA 3E9QA 3UCEA 3I9OA 1VM6A 4GX0A 3UXYA 4YR9A 5IXYA 4DQVA 4FJ1A 2O3QA 1JKFA 2X5OA 2AA3A 4HX5A 4YJGB 4E2WA 4YA6A 4RJTA 3K8ZA 1C1XA 2QYSA 3MJSA 4WEQA 2JFFA 2E82A 4JN6B 1NPDA 3B1FA 3WGOA 4AJPA 4R1NA 1DFGA 1YRLA 2Q50A 4GWGA 4JNKA 3S2EA 3PHGA 3WX0A 3QWIA 3WJ7A 1VJ1A 2ZATA 4MVJG 1N92A 5CDUA 1YL7A 4UUNA 1X15A 1G6KA 3H9GA 1EDZA 1PIWA 2GN8A 2IXBA 3KSZO 4U5QA 5EQDA 4XJTA 1DAPA 1CDOA 2W2LA 4DLLA 1PGOA 3BMQA 5JCJA 3GUCA 4BHTA 3F47A 4KTVE 4L4RA 1OZAA 1XHLA 4L74A 4XJSA 5TT1A 1P0FA 4U6SA 1O89A 4E13A 4PG6A 1QG6A 2PGLA 1GZ4A 4XQEA 1HE3A 3Q1LA 1N9GB 3INRA 5KNLA 2FPGA 1QLJA 3L0DA 5FI5A 3NV9A 4J91A 4MJLA 4DWVA 1PS8A 2X5KO 3N74A 3TWOA 5JY6A 2JCYA 4JK3A 4ZVVA 5EINA 1U9JA 2HQ1A 1EBUA 2FN7A 1RKXA 1YOVB 1NAIA 3EAGA 4DREA 5HM8A 1NQTA 3ITDA 1B14A 1KEUA 4BGVA 3GVCA 3AM5A 1V9LA 3BTSA 4EUFA 5K9ZA 3TJRA 2YHIB 2Y1CA 3RAJA 1UJMA 2Y1DA 1LDNA 1P1JA 2IZ1A 1I3MA 3K5PA 1ISFA 1LSOA 4NQZA 1SBYA 2VYND 4FIZA 5KJCA 4Z9XA 1ZJZA 1JAYA 2GGSA 2V6GA 3N58A 1B15A 4BKQA 1ZK4A 1ZH8A 4OQZA 3QWBA 2IYOA 1I5RA 4NK5A 3HFGA 2QQ5A 2PV7A 1XKQA 2QX7A 4B7UA 4FDAA 2PTGA 3B20A 3EC7A 5C37A 2GPTA 5CG2A 1E77A 4EJ0A 5F1KA 4YWJA 1KBZA 4HFNA 1PR9A 4CODB 1YQDA 5K6AA 3EVTA 4O63O 1AUPA 3E5RA 3KHUA 4N5LA 1T1SA 3K96A 2DKNA 3LT4A 5EIOA 5IFLA 3H3FA 1NVMB 1NHWA 1QYCA 1YJ8A 3QSGA 4YQYA 5GZ6A 1GUFA 1RYDA 1UP6A 4UEKA 4Y9DA 5TC4A 3VH2A 4E5KA 1BMDA 4XD2A 1ULSA 3DHEA 1WPQA 1JVBA 1KVRA 1F8FA 3VPSA 3GDFA 4E6PA 3ZHZA 1NVGA 3GN1A 3H9QA 4J49A 4FGWA 3WGZA 2P9GA 3JQ7A 4HXYA 4J7UA 2PLAA 5T64A 4AJLA 1NBOA 1MG0A 4K6CA 4NBWA 3PEFA 4YAGA 4CM7A 4FOSA 1N2SA 4PLWA 3ZWNA 1BGVA 1PZFA 5TX7A 4FR5A 1BSVA 1VL0A 3I5MA 1L1FA 1I8TA 2X22A 4YT8A 1N9GA 4L4XA 1BXGA 3DZIA 2BFMA 2EWMA 1PGJA 4PLVA 2CF5A 4WLEA 1RM5A 4PLHA 1NNUA 1AHHA 2UDPA 1PSDA 2I3AA 3GAZA 4DVJA 4GSKA 3DAFA 1E92A 1VPDA 2BLLA 2JD1A 3BMQB 4HADA 4B8WA 3TSCA 1UZLA 1ZSYA 2YFQA 3JQ6A 4ONEA 3DR3A 1SC6A 4ALJA 2VNSA 1GYPA 2V6MA 1PJQA 4LSWA 3VKVA 3OQ1A 3JYQA 1ISHA 4NZ9A 3RC2A 5A5EA 4FPXA 3C3XA 4L8VA 3RUEA 3PGJA 1E6UA 3PFFA 5I9LA 3NT5A 1ZEJA 5AOVA 1PJLA 5BNTA 3L07A 3HFSA 4FC6A 3I6QA 4RQUA 3WYCA 2J6IA 2O3RA 2W4QA 3GRPA 3NTRA 2PWZA 1ADCA 4E5PA 4DXHA 1LLUA 5IN5A 2Z95A 4XGIA 1GL3A 2OUIA 3ONEA 4J2OA 4BMNA 2Q49A 1VKNA 2UAGA 4I9UA 1E7SA 2UV8A 1E5LA 2B4RO 4G5HA 3RD5A 4MVJE 3PFWO 2CD9A 4GKBA 4RZHA 2NTVA 2NV6A 2P9CA 4JXKA 4ND2A 3FNGA 3L9WA 4ZGWA 1Y9EA 2AW5A 2X8LA 1MA0A 3FN4A 3PWSA 2NQTA 4WLFA 1F12A 1MC5A 4EEZA 2ZIZA 1GUZA 3JQ9C 3GOHA 4Q39A 1W73A 1GU7A 4B3JA 3GK3A 1N1GA 3TF5A 2GF2A 4IXWA 2JL1A 2VHYA 4RGBA 5JCXA 2WD8A 2WDZA 1P44A 1JU9A 5A9TA 4JBHA 4CR7A 1C0KA 1VL6A 4P22A 1LDGA 3JQ7B 1A71A 1C1DA 2QG4A 1X13A 3PHJA 2ZQYA 4PLCA 3PGXA 1EQ2A 3KSDO 3VPXA 1E7YA 5KCZA 1U1IA 3CPSA 4I5EA 4B4VA 4WCFB 4WK6A 1LDBA 3GVXA 4BO3A 2Q2QA 4IIUA 4E32A 3F9IA 2P68A 3ZWWA 3VH1A 3VTZA 3BTVA 3SBOA 3GEDA 3S8MA 2DVMA 4RV9A 4YB8A 2Q1UA 2X9GA 2AE1A 3NUGA 3ZU2A 3E82A 1LC0A 1JTVA 3FD8A 5F1OA 5HWSA 1ORRA 4QXMA 2AG8A 2BRUA 1H94A 4KOAA 4HFJA 2VTDA 3W4IA 3HDJA 1VJTA 4RVUA 4ZQBA 3FF4A 4XR4A 1Q1NA 4NJMB 5JO9A 5B4TA 5H82A 3GMDA 4P4GA 1M75A 4MKZA 2J3HA 4IQGA 2Y1FA 3WICA 1JWBB 3R3JA 3ADPA 3GG2A 1K6IA 5IDQA 2PZKA 4RDHA 4NBRA 2POQX 4K9DA 3KEOA 5JC8A 1R4MB 1OC2A 1UXHA 2SCUA 2W8ZA 4OSPA 2JCVA 2YFHA 4B7CA 2VYVD 4WLOA 3FNEA 4CM4B 4I5FA 3JQAA 4YDRA 2CFCA 1X0XA 4ZN6A 2I99A 3HZZA 1IL0A 1ZK0A 3EYWA 4ILKA 1SO8A 1W8DA 2YW9A 4IQ0A 2X1HA 3E48A 3GPDG 3E9MA 4GX2A 3JYLA 2B35A 3GC6A 1LEHA 4IDFA 3TN7A 4BNLA 1FDWA 2Y05A 4TQGA 3HDHA 4XDZA 4RQTA 2EHDA 4BNUA 2A4KA 1P1HA 3U4IA 4UREA 4HBGA 1GR0A 4I9NA 1PU2A 2GYYA 4DUPA 3ETDA 3JD0A 3DZKA 2PH3A 3DBLA 2FR1A 1KVUA 1LSUA 4ALIA 4TKLA 1YO6A 2YQ4A 3H9EO 3SLKA 1E7WA 3T4XA 2XF8A 3CZMA 3H9JA 3NGLA 4AJ4A 5IZCC 1XELA 3QW2A 1R6DA 3DC2A 1JKIA 2ILTA 2E4AA 2V65A 4IJWA 4EI2A 1F17A 3FNHA 4YT5A 5DBGA 1HKUA 2NQ8A 2YV1A 1OI7A 1ML3A 4F46A 1MXHA 4RPLA 1ZZEA 4E30A 2EERA 2B4TO 1GEGA 1QRRA 4ZRNA 2G17A 3ON5A 3OIDA 1LRKA 3IIEA 9LDBA 4IBOA 3GY0A 3NDRA 4FW8A 4WPGA 5AVOA 1PJ3A 1HE2A 1NQ5A 1G0NA 3D1LA 2RIRA 3D3WA 3OQBA 4GPD1 4OQYA 3NTQA 1F14A 5DOVA 1QSGA 3VDRA 4ALLA 4BGEA 3L6EA 2OBNA 5CEEA 3WJAA 1I2CA 4TMFA 2H5LA 3SXPA 2UYYA 3UH1A 3GQVA 3ZWMA 4AJHA 3WTCA 4K1LA 1PJCA 1K6XA 4WCFA 4AJEA 5BSHA 4Y67A 1R0KA 1ZXBA 4BVAA 4CQLB 2O23A 3W4JA 4MKRA 4E12A 1C0PA 2X7HA 2I6TA 4KWIA 4KWHA 2OFPA 4J7CA 4BV9A 4AJIA 5JNLA 5LDHA 3RFXA 4W7IA 2PK3A 5MDHA 1J0XO 1Q0QA 2VT3A 1U4OA 2DBVO 3OJFA 4ZQGA 1BHSA 1R4MA 2V6FA 2C7GA 4PLYA 3UVEA 5JAZA 3QVOA 2BF7A 1BVRA 1WVGA 5F1PA 2Y67A 4H7PA 4Y6RA 2VHZA 3H5NA 3NDIA 3IMFA 3DB2A 4O1MA 2W2KB 4EEXA 1YWGO 1QORA 1A5ZA 1P9LA 3F4LA 3GT0A 1OOEA 4QECA 4ESOA 3L6OO 2C29D 1DEHA 4OJNA 1P31A 4E3ZA 3GFGA 1V6AA 4C7JA 4N7RA 4PGFA 4A73A 5KKCA 3AFNA 3AWDA 3F5SA 1WDKA 2C82A 1UAYA 2P4HX 3EMKA 2AQKA 4XX0A 1DIHA 2DTEA 2EJWA 1FDVA 2HRBA 1V35A 4LISA 1G1AA 1E1LA 1P0CA 4QO8A 4R1SA 4YYZA 1VC2A 4CQMB 4PCVA 3KB6A 3MJTA 4Z0TA 3HNPA 5I7EA 1RYEA 3K73O 2UVDA 4GWKA 4NH4A 4CMEC 3INGA 3AY3A 3QWAA 4J4HA 3OP4A 3X2EA 3OJ0A 1UZMA 2EG9A 3ZNQA 2DM6A 5EERA 1ID1A 5B37A 1P77A 4LMPA 4EUHA 2HMVA 1WWKA 3H4VA 2ZB4A 4KUGA 2VZ0A 1H2HA 1WMBA 3RUAA 4YVFA 3DHNA 4E5MA 1QYWA 3I9KA 2HCTA 3NKLA 1T2AA 4XB1A 4EYEA 2PZMA 2HRZA 1GYRA 1LDYA 4B79A 1U2GA 3WG9A 3PJEA 1HZZA 2J5QA 3GA0A 4FFLA 3HHPA 3GF4A 5A03A 1R0LA 2JAHA 4Y6PA 2G76A 2J5KA 3NAQA 4R5HA 4NU5A 1R66A 4B4OA 5I9NA 2B69A 3Q6IA 4OKNA 2IYPA 1V0JA 4QX6A 5A1TA 4ZU3A 1NPTO 1Y81A 2WWRA 3GVPA 2FMUA 3T4EA 3ZWYA 5MGBA 3CZRA 1TVEA 3KTDA 4M8SA 2GN4A 1GV1A 4R54A 1Q7GA 5KVSA 2D5AA 4R1UA 2EW8A 3FPLA 3OJLA 3AK4A 2DTXA 5CDTA 4A27A 3LLSA 5CP8A 1P1FA 2I5PO 3ZHBA 1EQUA 3PDJA 2WSBA 5CPFA 1DOHA 2HDHA 3PQEA 3T7EA 2ZB7A 5KIAA 1HRDA 4NNJA 4NJMA 4D7AA 2NUAA 1I10A 1PX0A 3ETEA 4D42A 4KUEA 1O6ZA 4DC1A 1TT7A 4RPJA 3AM4A 3IKTA 2ZTVA 2BI7A 1SZJG 3TPCA 2W2KA 1IZ9A 3TZQA 1WNTA 4CQMA 4DA9A 3WBBA 3FWZA 1NAHA 2ZQZA 3PWZA 4ID9A 3GNSA 4NK4A 4PZDA 3QLJA 5JW6A 2BELA 4JGBA 1D7OA 4UUPA 1I2ZA 1BWSA 1W6UA 4BV8A 3DZGA 4A2CA 1U5CA 1QXSA 1B8UA 4DQUA 5JYEA 2CZCA 5A05A 3PTZA 4BO9A 3FSRA 5JC1A 1DBVO 2NNLD 2OMEA 2VYVA 3V1UA 4YTEA 2HJSA 1GV0A 3TL3A 4K28A 3CXRA 2X0IA 1N5DA 1A72A 2I66A 3PPIA 4M87A 1MFPA 2UUOA 3UCXA 4BO1A 1E3WA 4YT2A 3FTPA 3JQCA 2ZYGA 3LSYA 3RBXA 3VVCA 4YAEA 2QRLA 2VZ9A 4KP7A 2Z1MA 5LDGA 3WNVA 1HF3A 3JV7A 4QT0A 4N18A 1C0LA 3AUSA 4TROA 1F06A 1RJWA 4FJ2A 4JLWA 5AXDA 4E31A 2GSDA 1ENPA 1J49A 2ZYAA 5CDGA 2GUGA 1EK6A 3ROMA 4CLRA 2C7VA 2NTNA 1HL3A 5ITVA 4L4SA 3C7DB 1Y1PA 3AOEC 2HMTA 3C24A 1QR6A 3WSWA 2AQ8A 4PLPA 3PYMA 3AUAA 3FBTA 5G4LA 4B4WA 1LLCA 4AL4A 3GGPA 1LU9A 4BOYA 1HYHA 4OGWA 1JN0A 4RO0A 4MIOA 1WZEA 4G81A 4NFSA 3H2SA 3OSUA 4D44A 3V2HA 1VRWA 1XQ1A 3W1VA 4XWYA 3TZKA 4CMKA 2F00A 3S55A 5G0VA 3PLNA 3HADA 3ZNPA 2G82A 5EN4A 3RJ5A 3OJOA 4II3A 2J3KA 1I3NA 1YE3A 4BKRA 2B5VA 4BB6A 1EBFA 2OL4A 1GUYA 4F6LA 4BNGA 2WE8A 4LN1A 4OIMA 4RLHA 3QY9A 4PLFA 1MG5A 4W6ZA 2C5EA 1MXFA 3BAZA 4LK3A 3VC7A
chains in the Genus database with same CATH superfamily
2ZJ7A 3GFVA 4FNMA 4R4JA 4XKJA 2HPAA 3EMVA 3FCOA 3G9ZA 5EE1A 2IUFA 2D0OB 4FHGA 3I9JA 4JB2A 4J9VA 4Q4AB 3KSXA 3CB4A 3EQ2A 3W2IA 4GKVA 4TRJA 1UC8A 5DP2A 3WNBA 5G1OA 2XGNA 1G71A 4OJTA 4I4TF 4AJ1A 2OXTA 5LZ9A 2WTBA 1QV6A 3BG5A 4MCJA 4PZUA 2PCLA 3KC2A 3L6RA 3Q88A 3RWBA 1XJQA 1FFBA 2RAVA 2DWCA 4DDVA 5EJ9A 5IVPA 5JCJD 2EP8A 3VA7A 3TLBA 2Z4SA 3E21A 1HEUA 2XUJA 3IP8A 4HPWA 4X1IA 1E6MA 1WMAA 3JATB 2XQJA 4F3YA 4FGLA 1UFRA 2VKQA 3Q3JB 1G0OA 1CP3A 5FWDA 1AN9A 2X0KA 3IKVA 3CKLA 4ANFA 4CL3A 1MV8A 4EJMA 4TUYF 4CM1A 3I92A 5E8RA 4ZEOA 3LBAA 2Y71A 3TGLA 4U7JA 4Q66C 1RXEA 1V8BA 3KR2A 2QU7A 4KHZA 4LOLA 4ZCPA 1P7YA 3E5MA 4D43A 3IRVA 3OBIA 1B6RA 1SHTX 4OGFA 2D0DA 2DQKA 4LV5B 5DNEA 5FYDA 5H02A 3UN1A 4ZJYA 2ZYRA 4BATA 1IHYA 4DS3A 1QMPA 1Q44A 1UFKA 2FUG6 2AMLA 2F4VM 1KR2A 3DVLA 4UTPA 2HC9A 3ACDA 1JLMA 1ZISA 2Q3BA 1HQYE 1RJEA 3JAWB 4IUBS 1RPZA 2VYFA 3U3RA 4CJ6A 4IHQA 5J4HA 5CB0A 1T3GA 2PSSA 4REZA 3ICCA 2G4LA 3BMNB 4Y6SA 3AVXA 3PC7A 4GOOD 2NOAA 5JXWA 4BU0A 1GKUB 1ZNXA 1P0PA 1TM3E 3IC5A 5KAMA 1KY5A 1GQOA 3UV6A 3ZTTA 7MDHA 1Q0SA 3SC4A 4EA9A 2DOKA 3ZI4A 1UBHS 2YICA 3GJ8A 2HPVA 1J0CA 2C3MA 2Q0SA 3DUFA 1O6FA 1XA0A 2CNNA 4ARBA 5LJIA 4IBEA 1EG2A 1X14A 4R84A 1OLXA 1CLEA 1ZOPA 4GLBA 2ESRA 3AKCA 2OYSA 2R5NA 2HU2A 4P4SA 4BWGA 1ZMUA 1R6VA 5FXMA 4AIIA 3GJZA 1P3QQ 5BSRA 3DGEC 3WC4A 3RC8A 4OK6A 1XJ5A 2FQYA 5A4DA 3TPZA 1JPNA 2HJWA 2FZKA 3H65A 3B9QA 1P7VA 4RHYA 4WCVA 2ATVA 4H0NA 4BL5A 5BVGA 3ZQ6A 3UW3A 1JWLA 1BROA 1T4CB 2YH2A 3SYNA 2D3TA 5JAIA 4K9KA 1ISGA 1E60A 2BEWA 3N59A 821PA 2IBSA 1GZUA 2EJUA 4EZBA 6PFKA 4Q3AA 4DCPA 2G0NA 2P35A 4EARA 5IAAA 3TLCA 5EZSA 1RE0A 4AJ9A 2FW8A 3W9UA 5G4KA 2V6IA 5BPHA 1ULUA 1HL7A 2FPUA 3BXHA 2X9LA 4MW6A 1ZVVA 4JQCA 1KSHA 4CEHB 1OWLA 4AN0A 5CNKA 4BNJA 3N39C 4H7DA 1AQ6A 4Y9SA 5ES4B 5DU2A 4YV0A 2XXAB 1M54A 1EUDA 1U98A 1J9GA 1U11A 1Y48E 5DTQA 1SXQA 2R6ZA 2JK0A 4TSFA 4TZ6A 2GEUA 1VCMA 1JEQA 5IBPA 4NIMA 3KSAC 1V96A 4Q4AA 1GPJA 3TXAA 3FGNA 3AEQA 4NRVA 2WAOA 1YSCA 2OC9A 3JVEA 5E4FA 5FUMA 1XYVA 1EB8A 3UG7A 1VPWA 3CBGA 2W4MA 3OFSA 2GASA 1MX5A 2ZI3A 5J4VA 1MA3A 1XZHA 4XYEA 2EAUA 5KTTA 1XVUA 1KY4A 1CIVA 1YFLA 2RK6A 4CHTB 3NIGB 4BASA 1HFEL 4U2KA 3OC0A 2E37A 2AD5A 1RYYA 2ZJ8A 3H11B 4MUAA 4RL6A 4X1KB 4IYJA 5B2ZA 3QUSA 3I01M 1E3LA 3O4JA 3OEWA 4MS1A 1DC6A 4P0TA 3RV4A 5B58C 4JBGA 5JSFA 3NHRA 3THXA 1T8PA 4IRXA 3FH0A 5BW4A 4XIJA 5JARA 4PBTA 3IAM6 2WM3A 3B74A 3AERB 2FMIA 2VR1A 1TYCA 5LD2B 4JT8A 1T4BA 2REXB 4DSUA 3L6DA 2WHXA 1JMYA 3BSFA 3A1CA 5E6SB 3QUCA 4EQ6B 5F2NA 1CRPA 1IB6A 4KXUA 2IDKA 5A4KA 2JGDB 3L1VA 1R50A 2UXCM 2F48A 4PFSA 1A96A 1H0RA 4EPRA 5H83A 1U9YA 1KXJA 1LZLA 4LWOA 4LF4M 5FWXA 1KDOA 2JD2A 5CLQA 2I3BA 3GWZA 3RUFA 4CM3A 4IIFA 4Q9NA 1JHQA 2OYCA 3SMVA 1QWSA 2DF8A 3DQZA 3F9RA 1UDXA 3QITA 5BUZA 3TB6A 4H08A 5JAOA 2DBYA 1W7AA 4GM4A 1Q1AA 4AF8A 2OZEA 2R45A 2E55A 4HN4B 4IJ6A 5ALLA 4JL8A 4JI3B 1ZH4A 1T1RA 5DTRA 4ZVQA 1AA6A 3T9BA 1JQJC 1C7ZA 4J94A 3GP1A 5FRDA 4CCWA 1KTVA 1HFJA 3FRIA 3KL4A 4GZ3A 5KX5B 5HM6A 1YKSA 1CJTC 1V4NA 3KRTA 3M3HA 2QTLA 4P9NA 4W5QA 2XCIA 1F9AA 1WZNA 3QE3A 1ISSA 1A95A 3PD0A 3A9WA 1YIOA 4JOBA 2OOSA 3JQGA 1Y7LA 2GXUA 5C2JB 4YX9A 4NI5A 3KWJA 5J5CA 3ZU4A 4TUYA 3CO0S 4B3TB 1L5QA 3D0OA 5DWDA 2ZITA 5AUPB 4BC1A 5BP7A 2LUOA 1U3FA 2IHBA 1AXEA 1IWBB 1USGA 4KHPM 5THQA 4ACBA 2VHCA 4R83A 4ZOLB 2OZKA 4WY8A 3DEIA 4DV5B 2PJDA 3PNQA 4L75A 2GCOA 2PUWA 2PRIA 5F9MA 4X7MA 1E1QD 3F7OA 4Q1VA 3U49A 1MV5A 1VI5A 1CZLA 2DR0A 5AJTA 3U7FB 4LSGA 2QRKA 4PZ9A 3LZCA 3TWKA 1DLIA 1AXRA 2WG0A 4XQGA 4HN9A 5AKYA 1E3SA 3MCZA 1NBIA 4YMTA 4P3PA 4D79A 2BN4A 2H0RA 3CH4B 3O0DA 2QZPA 1NLZA 4R7ZA 1N8TA 1YDWA 1GVNA 4OV6B 2OBYA 4BFTA 1CFJA 1TK2A 3CGGA 2CVHA 1NFFA 1OLUA 1TVMA 3NDJA 2HV9A 4EKIA 3G88A 3I3OA 3SC6A 4BNZA 3SVLA 4W99A 2XCTB 3D0QA 1QH8A 4TYMA 5A02A 2FNAA 4NFLA 1WMDA 4LMRA 2E21A 3PEEA 4F93B 2PL9A 1KDPA 1QVWA 3DDCA 3HB9A 3I4FA 2HU7A 1ZVJA 4PF1A 1M1UA 4ISBA 4YASA 2OFFA 1MGOA 2AK3A 1LJLA 2F1HA 2QVLA 1LVUA 2BMAA 2AZDA 3EBLA 5HOEA 1HFWA 2I1QA 2CWDA 5HW0A 2YWRA 4IGFA 1ZCJA 2B25A 1DPGA 2G1AA 4RZIA 1D7AA 1VIVA 1C9DB 5JSZB 4Y28F 3ILSA 3LYLA 4H7IA 4NNPA 4ZQHA 3BA1A 1MJFA 4YV1A 1B16A 3B8EA 3DZFA 3THXB 1FDUA 1AV6A 3EIEA 4EW6A 5A9SA 1T35A 3UBMA 4KN9S 3R5SA 1QGAA 3MBOA 4U00A 4HEJA 4HLNA 2RGEA 1YGYA 2RCNA 3LUHA 3AW9A 4PE5B 4QFDA 3VDQA 2P4SA 3I76A 4L5IA 2XQIA 1N7GA 3MUEA 3CLUC 1YIAA 5K3CA 4B45A 3DJFA 3I1JA 1UC9A 1PZGA 5K0JA 5CK5A 3FVWA 4LWPA 2QD2A 4ZRDA 2NYVA 5DNAA 2CCGA 1UQRA 5DBIA 3SHWA 3ZJYA 1B00A 3RAEC 2Z83A 5EXDA 2HREA 3RBZA 5BYJA 3GN2A 3GHYA 2C2OA 2J3QA 2OGUA 1L8QA 1IWOA 2W6QA 4Q34A 1YU6A 5I9MA 1OTRA 2CXUA 1OYOA 4XVQA 4RKFA 3PV0A 3PSHA 2VPPA 3HGTA 2IZOA 4ITQA 1KMHA 2BBSA 3HP7A 3C4QA 4G0OA 3WQRA 2B9EA 3AVQA 1JAZA 3ETLA 3DMTA 4GP9A 3RC7A 1TYBE 2JZ0A 2VJLA 5HIJA 3L02A 3MD9A 1WULS 2QNIA 5CGZA 2AOTB 1NLMA 4G56A 1R9MA 1ORWA 1B0AA 5EL0A 4DUYM 4AROA 4JUCA 1YHYA 4BKUA 1V7CA 2GYVA 5HRUA 4ZAYA 4L9RA 1R6BX 3K72B 2E1RA 3NFRA 3O4HA 1J1ZA 1MRSA 4JGGA 3IMEA 4BNFA 3ZE6A 1OPXA 4QTTB 4NDNE 1TCBA 1Y1KE 3S7ZA 1VI6A 4KGVA 2Q62A 4FZ3A 2GCOB 1BCRA 4CETA 3E7XA 4E03A 3IXQA 1E89A 2BH9A 3P19A 5DHFA 1TZCA 5G0SA 4YJGA 1FUYB 5JVDA 3QKRB 5CH8A 2OO7A 4K7JA 1VPLA 4N5IX 1M0EA 4LBZA 2H9AA 5JS6A 1GG2A 2WM8A 2FKAA 3JTMA 2IYRA 4S1VA 3ZHXA 2IUTA 4GUAA 3RU9A 4NE9A 4L16A 1IG0A 3UFXB 3JYOA 3TTXA 3VR3D 4N3GA 5IN4A 4L1KA 1K88A 2RHLA 4IMPA 4J2TA 1DE0A 1X9HA 2NPIA 1NVMA 3HACA 1KH1A 3PXXA 5C52B 4HSEA 4A10A 5FSWA 2BEJA 4MYRA 3I04A 5HZMA 2P3OA 1Q15A 3SAUA 2XFTA 4DLSA 2RI6A 3GT3A 4EO4A 2LH0A 1G66A 1AG9A 5NULA 4FHZA 4E21A 4P7FA 2B4QA 2KX7A 3ZGXA 4DDWA 4Q7JB 2VP5A 3KQNA 4R2WA 3DZBA 4XIGS 3VAZA 3FNFA 4RL4A 2IODA 3GLHA 2QTTA 1R5OA 3HGQA 2CFSA 3WK6A 2H7XA 2HOQA 5DNYB 3ADOA 4XEHA 2FFQA 1THZA 3S70A 7AT1A 3ROFA 1EUCA 3QYEA 1KK3A 4P3XA 4KQJA 2QMYA 4BEBA 2BFCA 3EWAA 3KOYA 4PQGA 4BUZA 4DT1A 5KYYA 1ZIPA 2ZJ0A 1TGUA 3U62A 2XA2A 1AKYA 4NX2A 1F4IA 1IWPB 2OCBA 5HK9A 2YNMC 4OREX 3SYTA 4LF8M 3U7QA 2ZR8A 3RS7A 4BVEA 2J7OA 5D85A 1VE6A 3B38A 1IBMM 2YRWA 4YHBA 1H4SA 1F0PA 2Y93A 3JVUA 2DKFA 1GPKA 3BIXA 1CJKC 1V8OA 1B8PA 3BXPA 4BC0A 3E5NA 1EEHA 1ZUHA 2HK8A 4JIMA 4M99A 2NTJA 5CX1B 2B8WA 5ALOA 4K6KA 3BDVA 4QYIB 3ZH9B 2FZCA 2HXYA 3EXG1 3L1HA 3N5KA 1KRWA 1QO7A 3ZN2A 3SICE 1B1AA 4HZGA 4IVPA 2H63A 1PW5A 3GPBA 4QTUB 4B3MB 1J0EA 1KK1A 2EYQA 5F2OA 2XJ4A 4IDEA 3ZR4B 4YRCA 5BR7A 3JWPA 4DBVO 4OX9B 1ZBQA 1SAYA 2OB2A 1H1LB 3CX3A 4KZPA 2GZDA 3ET4A 1UOPA 3DKIA 3TNLA 2QXUA 1H9AA 2WMDA 3LHIA 3R5XA 4HLDA 3FVQA 4URWR 1IHDA 3D5EA 3I3SR 4FYXA 4UBKA 1PX2A 1JSLA 1P39A 2ZRDA 3N6RA 2RH9B 1LQUA 4D81A 2AW3A 1WLYA 5EUCA 4BIIA 4OX9Y 4OGGA 3SFZA 1FMFA 2JFXA 3G2JA 4IDCA 2JCGA 4GBMA 4XCVA 1T2VA 3RT1A 4D25A 1EJ2A 2X15A 4OHRA 3HUDA 1OE0A 5DLYA 3ZX4A 2FSIA 4FKBA 4EVSA 5CFMA 2WWVD 3IGFA 2AVNA 2YMLA 3PGMA 2PEYA 3RIHA 3Q3VA 2UUCM 1ONSA 4TTQA 5BSFA 3IXMA 2DPMA 3CNLA 1OGYA 4G1MB 2P40A 1SOVA 1OKKA 2CNBA 1BW9A 1FX0B 2DLDA 4MQMA 1DCFA 2IUYA 4BUJA 4EPWA 4BKMA 2HCBA 4C7KA 1U8AA 5LBUA 1R8SA 1G63A 2OCPA 1E0JA 2IE8A 3VR6D 1U0NA 4CT4B 3JYHA 3O8CA 3B3AA 3AILA 3A6LA 5I45A 3H8WA 4PO3X 1Q19A 2XIJA 1H6CA 2GNAA 2VUSA 4LOJA 1BAPA 5AVTA 1JMVA 3TRHA 5C8YA 3PC8A 1VG8A 1XNJA 4OLAA 1BYUA 3GLIB 1RW4A 5H0IA 1FP7A 3RVMA 4FB5A 3DLHA 3EAQA 3LLVA 3JARA 4YRKA 5JIBA 5L51A 1K8YB 2NTYC 5FI3A 4C4ZA 4CR8A 1FNBA 1VZ2A 2CDRA 4EG3A 3S1AA 3JWHA 3I83A 2J9FB 1ELOA 3ID6C 3MJ4A 3EVDA 3SIWA 4DIUA 1JW9B 4EYSA 4JKOA 2EATA 5IT0A 2HGSA 3KLPX 4Z9YA 3NHMA 1U1CA 1NKVA 4LOHA 4X91A 5I7FA 4ZMSA 2FQQA 5HFJA 3QWLA 1P1KA 2PWPA 3CMCO 1YB7A 3VNAA 1PUJA 2EOAA 2BEUB 5JNTA 2XZFA 1L4KA 3FFBA 5FAKA 1P0QA 4KR7A 4PO1A 2YCLA 1GQYA 1Y7TA 1HE4A 4EMTA 3CLTD 1CY1A 4IHJA 1EFHA 3W4KA 2C57A 2CW5A 4MV8A 3SARA 1JKMA 3ETNA 2ZE6A 5JDIC 4FD2A 1GN9A 3PDHA 4YGYA 1Z5AA 2R97A 4NBUA 5TARA 1VLLA 1ZCAA 3L7JA 1SG9A 1ZN8A 4PYMA 2ZUTA 3SEAA 4XPZA 2ET6A 2NVBA 4MUFA 1OFGA 3IL2A 2GZ2A 3IPCA 4MMZB 2GLUA 2XKJE 3N86A 4YRJA 4R1OA 4DUZM 3H2BA 4ENTA 3HBJA 3KT0A 3NHLA 2O8FA 3D0KA 4FBLA 5L4NA 3ACBA 4IIDA 2BSAA 1LI5A 2Q5HA 3OZGA 5JSHA 3H05A 3ND7A 4DV4B 3BE4A 4E5NA 2A57A 4AO8A 1NHWC 1QZUA 3TNFA 1JG2A 2EEPA 3KKEA 4Q1CA 2VJPA 1A2KC 3B1JA 1KDRA 4GM1A 3WGQA 1RHRA 4F5EA 5CLHA 1K82A 2H1IA 5IAGA 2BI4A 2KJQA 3C7TA 4J0IA 3RVOA 1U7XA 4NPAA 1M2GA 1QKIA 3NXKA 4D0RA 5K4GA 1L5FA 5C18A 4K0RA 3SZLA 1UDAA 1QDRA 4OOEA 3ZDZB 4CUKA 3I2GA 3OUTA 2AN9A 2VK2A 1FA9A 1N5RA 3DL4A 4I4IA 2OORC 4KWTA 4PFQA 3SQXA 3LT5A 2DWLA 1U28C 4L28A 4MW7A 1KZYC 2AMVA 1BXGB 2YWXA 4ETWA 5B55A 1HDCA 4YBZA 2QGNA 5CVUA 2GLTA 3L2OB 4ILEA 4CV2A 2VHEA 4XDYA 1WXEA 4YO7A 3CEJA 3LT1A 5FH9A 3ZU3A 3CIOA 1EUYA 1OBCA 1DQSA 3GH1A 1QIIA 3RS8A 3LY9A 3SHQA 3ZE0B 3QWFA 2DWUA 3A4TA 4P17A 3LK7A 1SU8A 1S2GA 2GRUA 4C43A 5A0VA 1AN0A 3A1UA 3Q3GE 2G36A 1NVVR 4QUBA 1I7PA 4UPDA 1JILA 2D5CA 2Q2WA 4RDCA 2G83A 4QC2A 1GLNA 3DOIA 4Z4EA 3NGMA 5B3JC 5E26A 1ZKDA 2H51A 2RKOA 3BRQA 1YA6A 1YR7A 4UTZA 3HYNA 4FNAA 2ZYVX 5IJ0B 2WQ7A 3D0RA 5A0TA 1QHSA 4M9ZA 3QEKA 5J59A 4W9NA 1KEWA 3IAHA 3Q5GA 3JARB 5DXAA 5GINE 3HZJA 3QYPA 3SM9A 9GPBA 1KJ9A 1L7VC 1X70A 1JPVA 1B3BA 1NUUA 3DPUA 2E85A 3ZQJA 1FMJA 2BKVA 5G0WA 2OFOA 4XJXA 1OGIA 5JS8A 1H8ED 1K5HA 3STVA 1XMQB 2FG5A 4IX1A 2NVWA 4BVKA 3X1KA 1PWYE 4IIEA 3UAXA 3WXMA 4CKXA 5BR1A 1JRLA 1XRQA 2ZRPA 3Q9NA 3QRWA 4OAQA 4RA9A 4UBNA 3ZPXA 4AU1A 5ILOA 4Q47A 3IVAA 1YZQA 3K8YA 1OPRA 4H4CA 4TXJA 5HS6A 4V1CA 3LNTA 1U0GA 3PNYA 3C8DA 4HDOB 3CX6A 4JU9A 4TMVA 3F98A 2CKMA 1XB2B 2I1WA 5EJ4A 3PBKA 2L0XA 4I55B 2HY7A 3SYRA 1C80A 4NEQA 5FUVA 2LVPC 5DNVA 1FVXA 2GF9A 3C8MA 1CQWA 4DCOA 3ILHA 5AJWA 4YMLA 1JQ3A 3I6BA 2QPLA 3R20A 3PUKA 2YY7A 3FYUB 1L1ZA 4XSVA 4G2NA 1JDSA 2AFIB 2HJGA 3FDFA 1AUAA 4YRBA 1IHOA 1X1SA 3LZ6A 4QEKA 1H2RS 4RSGA 1Y8ZA 3K1AA 5ALWA 2WPDA 1RI1A 4FR0A 4K05A 4K9NA 4CMHA 2NZYA 1FVOA 3I53A 2WYUA 2DY1A 1R0RE 2XMSA 5IM5A 1GU0A 1DXHA 5REQB 3ZCRA 1SH7A 1RHJA 3U39A 3KJIA 2V54A 1D2CA 1F5SA 1VHLA 2BTQB 1CEEA 4H4EA 4IXNA 2XNDA 3O8QB 2EIXA 2J33A 5FDFA 3WQBA 4I9GA 3KKZA 1VP9A 3UOGA 1N2GA 2DB3A 4JJIA 4GNKA 4AKEA 1BJRE 1TYEB 4JR1A 3WGMA 1NR5A 4B3CA 3NWBA 4BQNA 2JW5A 2O1WA 1NR1A 1Y33E 4K87A 3EEIA 5LM3A 1OYWA 1SPBS 2VEDA 2HD4A 4MB0A 4FSHA 1U7HA 4TV8F 1VYUA 4FOTA 3OX3A 2QLJA 3OM8A 4LZWA 3O26A 4BFCA 2NO5A 4LZOA 5DK6A 2F59A 3GZNA 4JLSA 3URMA 1EFRD 2WPNA 1PRBA 1NWHA 3GW8A 2OKCA 4DIDA 4K9RA 5COAA 3K9BA 5IUJC 5KSZA 4EG6A 2HA2A 2W98A 3C3YA 3EAFA 1NRIA 4HDRB 4LSZA 5KYWB 1B7GO 3ZCUA 2CGEA 8GPBA 3TL6A 5CFZA 4BX3A 3WYNA 1QH1B 1DQPA 4GXRA 4B3FX 3K9PA 4J3JA 5JR3A 2FX2A 2DTDA 4DWJA 1Z7GA 1FP4A 1GP2A 5FULA 4ESVA 1W4ZA 3UJ9A 1O5TA 1Z0JA 3GQBA 5LZ7A 4DNOA 3G2OA 4S1NA 1XK6A 1QU2A 4N6OA 2B2CA 1G4UR 3COYA 3IUYA 3AHFA 4IZHA 4PR0A 5JI3E 1FDSA 1V5IA 4LJ9A 3CLRD 3S7TA 5B1SA 3CRZA 1RFGE 4PGHA 3KHTA 3MWDB 2G09A 2Z9BA 4XM0A 5BW5A 5KYGA 1K1EA 1TAUA 4TTVA 2OQ2A 1N5JA 1PBTA 2FFRA 4Q3OA 1G8GA 4J4BA 3DO5A 4U0JA 1YE9A 3LBHA 4DUGA 3DV9A 1NATA 3WWPA 4MB7A 4CCAA 4A26A 2TS1A 1RZRA 3RE8A 1MTOA 1IG3A 2PWAA 3ONDA 4R69A 4S2EA 2DNAA 2AI1A 1Z39A 4TSRA 3CISA 2G28A 5AUNB 2QWXA 1BGWA 4IO0A 1HKHA 2BY4A 2WJIA 2HA5A 2YXDA 3DQQA 5BV7A 3FOZA 3DC7A 3IQEA 3FWNA 4PANA 3ROKA 3L4SO 1M8PA 1GTMA 3EFEA 4I1VA 1CIJA 3ANNA 5TB5A 2WUGA 4ZDKA 4F1IA 1R37A 2AXQA 2F2TA 2CV0A 1S89A 4ETMA 1H6BA 2H8KA 4HUQA 4V02A 4UPEA 2C92A 4RDIA 1J5PA 4NMWA 3COVA 2DBRA 5HKLA 1D1TA 2P91A 1PNVA 2VXOA 3Q0EA 4HWTA 2JI8A 4OMFG 1Z75A 1COWD 4GI3A 1VPEA 3T9AA 2I91A 2UKDA 4M1EA 3VKGA 3HU2A 3QLUA 1JALA 3LXUX 5EGNA 5ICCA 4RJKA 4B3HA 4ND1A 5KTOA 1L5LA 3NBYC 4GYYA 1FE8A 2VP0A 1PL6A 1BRTA 2H0QA 2JIPA 2IXFA 5G0UA 3OA2A 4MGKR 1XPRA 5JRDS 5LYJF 1VB5A 4PX5A 5HVNA 1YC2A 2PFGA 3IBSA 1GZ3A 3L4EA 5HDQA 1M2OB 4HGYA 5TQJA 5COBA 3W7AA 2OBBA 1SBHA 3FJOA 5JAQA 2GTPA 1Y5NA 2D59A 4LFBM 2PV0A 1CXZA 4MS4A 1YZ3A 3FDJA 4XTRA 2AZTA 1J06A 3DAPA 1U3UA 4TWJA 3L4KA 2QTVA 4F4DA 1L4MA 1P2SA 4PSAA 3W3AD 3OE1A 1JG1A 1A9ZA 4RJ2A 4Z9FA 2Q5IA 1R8JA 5JJ5A 1DBSA 1J0DA 4YAUA 8ADHA 1G9XA 1SUAA 1KHHA 1PSZA 8AT1A 3TR5A 1MZPA 1KAQA 3M3PA 1X7GA 4B31A 1S4QA 1LLFA 4QUHA 2RH8A 4F8JA 5HQTA 3GZNB 4TXNA 1S9DA 2PG3A 2ZTSA 1KIFA 4BPBA 1UDBA 4K9MA 1M66A 3VKHA 1EM8B 1P72A 4MP3A 4O3FA 4WI1A 2W48A 4U9UA 5TDHA 4UAVA 5FT9A 4BO4A 5JU6A 3SSNA 3CA8A 5ITWA 4BPRA 1JPUA 3HCWA 2IRWA 1DKMA 2XUAA 3P9IA 3W8EA 4ERNA 2WJ6A 1V3VA 1FLAA 4WBXC 1IULA 3OICA 4N47A 3D9QX 4FQ8A 3DEHA 3WA6A 1N34M 1EAMA 2WK1A 1RWQA 4Q9IA 2DMRA 3L8FA 4YQFA 4H3HB 4KE7A 5FTWA 1M76A 4RZXA 1V11A 4FJ0A 3RV3A 2XT0A 4MQ6A 2Y68A 3VJKA 1YCHA 1TH2A 2JEOA 1EE1A 4DBGB 4MSUA 1U6KA 4M9CA 5E1OA 5TT0A 3QP9A 3EIHA 1QO0A 2V59A 4IKEA 5P8WA 3HBFA 1VTKA 1MO2A 1DWPA 3FUXA 1F3LA 2XOEA 4GPIB 3I0ZA 2CLEB 3ONNA 2ERYA 4S24A 3IP3A 4J0KA 3PL5A 3TXYA 4YRLA 1URPA 1VIDA 4CE6A 3QQPA 2I54A 3JZDA 5E0KB 2WIBA 2YV4A 1T4DA 5HHTA 4MQ5A 1OKSA 4CF4A 1H9BA 2IEGA 3JPYA 3Q8LA 1Z4IA 3O7MA 5AI4A 5LOVA 2CMDA 1YU9A 4YJ2B 3SFVA 2REOA 3KR0A 5DGXA 1GPMA 1TO2E 3CSSA 1IJBA 5HGXA 5DP1A 1L5WA 1VG0B 5AKIA 3MTQA 5L95A 3AFIA 1LFAA 3A25A 1BH2A 4HLUA 1R8YA 2BGMA 5C1BA 5HS4A 1XD2A 1BU5A 3PKZA 1NV8A 3IG8A 1EFDN 2GCNA 3LIIA 1TM4E 1XALA 2AXNA 3E9DA 1GRRA 3DMHA 3OX2A 5CIWA 3BMXA 1Z4PX 1B0ZA 1Z8NA 2AG5A 3GJQA 1HG0A 4KHPB 2XWQA 2P8SA 3KLBA 3QXSA 1KDYA 1ZK1A 4KQCA 3ZJVA 3GVHA 2O8EA 2OV2A 3T1NA 2M6SA 5AUOB 1Z8FA 5HK8A 5LPNA 4MGKE 4I55F 3S40A 2VT2A 4CQJA 1H23A 2QUZA 1PTJA 1L4LA 2CNDA 3OZWA 4BTLA 4HZUB 3QE9Y 2QD5A 4EA6A 3U26A 3BN3A 2GYWA 2HA4A 2CBXA 3IERA 2LHCA 1TJ5A 3PUJA 3A06A 3FCAA 3O73A 4NJOA 5BXYA 4MK4A 4F0JA 4WOKA 3V76A 3QPCA 3DE1X 4NFYA 5A3JA 3VR5A 4YEDA 3NOVA 4I8OA 1YQXA 3WLJA 2YXNA 3A4VA 1IY9A 1QWOA 1KWGA 3WDLA 4EGJA 1YQTA 4TT3D 2DH6A 3SJ7A 3SMQA 3CINA 1YB6A 2EJTA 1MO6A 4RKUF 1J42A 1B74A 1C8VB 2ZIAA 3GI1A 4M0FA 1G5IA 2GPSA 2O14A 4CNQA 1DELA 1MJ5A 4ZV9A 1E1QA 1KZ9A 2XGGA 3LUAA 2JASA 3FMFA 1AS2A 1C7EA 4K2AA 4F4JA 3O8RA 2C4UA 1X1EA 2FRXA 2ID9A 2NZVG 4XCQA 2ODNA 4CMJA 4YUAA 3WZLA 3II6X 4NXNM 3NR2A 2V7BA 5LMNB 4DPMA 4HFRA 1AKQA 4NZMA 4QT4A 3AHEA 1WPXA 1W34A 1UK8A 3OWXA 4IGEA 2YINC 3DDHA 3T5MA 1E6CA 1ZFNA 4OP1A 1PR6A 2AV6A 3N76A 4MAAA 4AURA 2A1UB 2G5CA 3C97A 3WYEA 7REQA 2XZLA 4FM9A 1GDDA 2W2MA 4OHYA 3PA8A 2AYYA 1DQNA 2N42A 2J09A 2IHJA 2WNIA 3OZEA 2Y20A 4YBRA 4AP6A 3BL8A 4MQ4A 2VCEA 3AQ4A 1S01A 3TCXB 3QEBZ 3JQBA 2YWEA 3T5PA 5J2UF 3NOQA 3OJXA 3R5TA 3P71T 2FPMA 2ZTDA 4DR4B 3ORSA 5K3SA 5DFLA 1PEYA 1NA5A 2J46A 4U6QA 2WU0A 4ND6A 3WMWA 5CYGA 2OO5C 4H18A 2J7PA 2IYZA 3H2JA 1E2PA 1FYDA 2YHSA 4LBYA 2VHVA 2YVQA 4PIVA 5AOCA 5AK4A 5K0NA 3A2KA 1X7HA 1GOTA 2KW0A 4RH0A 3KYJB 3RGPA 3HABA 4GR9A 1SA0B 3DBHA 4PC6A 3TOCA 3U4DA 1IN7A 3EBOA 4MRAA 1IN5A 3A0UA 3TS1A 1PJ8A 2C2MA 5KYNA 4IILA 1QKKA 1JLKA 4UC0A 2PSDA 4U2FA 1HRKA 2QV0A 1JEYB 4MVJP 1FMCA 1WCWA 4FMDB 3MSCA 1ULHA 2G1JA 3A2LA 3KR9A 1C4OA 5M5BA 5B12A 1EP9A 1UP4A 2GBPA 3LKDA 3O4FA 1JIQA 5AW7A 4A8JA 2DZNB 2FMTA 1K66A 3EISA 2QTGA 1NPYA 2PBFA 3S44A 1S2MA 3U60B 4ND5A 3O2QB 5DE3A 1XA3A 4MJXA 3E03A 3R6DA 4XPIB 4X71A 1SVUA 3MPOA 3GEHA 3RIXA 1NUTA 4R05A 5CXQA 2JUJA 1NUAA 2B82A 2DUMA 4P54A 3TDNA 2PR2A 3D43A 3DBVO 2CB0A 2PMCA 2QM7A 3T95A 2EZ4A 1P1IA 4JKYA 1X19A 2O8EB 4KITB 2B99A 4C4PA 1N5IA 3ZDRA 2R1TB 1O95C 3WFZA 1BE1A 2JK1A 2PS9A 4LX0A 1SY7A 3JU3A 3TTTA 3RE1A 3OCJA 5D1HA 3LP8A 1DKNA 2APJA 3LX5A 1KIAA 4RA6B 3RASA 3EGVA 4MIYA 3SVTA 1R6AA 2PO5A 1LI7A 5CFPA 4UFPA 1KH2A 1RAIA 4MQFB 4DV6M 3DVAB 1P2VA 2ETXA 5DEOA 4B17A 1PJZA 1KOJA 3H17A 2FSSA 1H5QA 4MIEA 1RQRA 1Y6JA 4ACAA 4DR5M 3DXFA 1FBTA 2JFNA 4BZPA 4C1BA 1HURA 3D7LA 4IJKA 2J0EA 5JZVA 1IN4A 3REOA 1IZZA 1TW2A 1QOQB 4M8KA 1ZN2A 1L7QA 2AEEA 1Y8QB 1UF9A 3P45A 2XMPA 3F3SA 3OTWA 1SCDA 1QDTA 1VE9A 1VKRA 2FTKE 5E6UA 1EXVA 3QBEA 3MQ4A 1U0OC 3ESXA 1T5LA 3FTQA 1P7CA 2P5YA 4J3NA 3T3DA 3V8QA 4BJ1A 3BVPA 4Z3KA 1MVOA 1YB1A 2H2GA 4IOKA 3VHRA 3I5YA 3Q0TA 3Q8KA 1P9NA 4UEJA 1YS4A 4WLNA 4BNXA 1E7QA 4GMHA 2M9MA 4R5MA 3B8HA 5IXJA 4NBKA 1ZU5A 4RVSA 1HO3A 1ULBA 3PYXA 1XZLA 4OPMA 4D5EA 4DV2M 4DT1B 4ERXA 1Q7EA 4JP5A 4RH3A 2VT6A 2OAEA 3Q72A 2XTAA 4D80A 1J1IA 2HEGA 1HE1C 3ZEIA 4GDMA 1J5XA 1M67A 1H9CA 1H85A 1G7RA 3EB9A 1G8YA 5A2QS 1AS3A 1O96B 4NS4A 3RC9A 4DDKA 4WD3A 2VSOA 4Y1RB 5ICGA 2QYOA 2C04A 3FHOA 3M2TA 4MP8A 2OQVA 4OB6A 5ITQA 5ERGB 4ZZ1A 1TU0A 3DA1A 4N5MA 1OLOA 3DQPA 3OQVA 3R9WA 3IP5A 1V4VA 2CDCA 3AJ9A 1WY5A 5FPSA 4PQRA 1W36D 4GH5A 4BXOB 7CATA 3FHLA 1DTSA 3NX4A 4E94A 3SAVA 3PHIA 1XJWA 3UAVA 2HCJB 1DWQA 1NG1A 2R00C 4GOXA 4OKIA 5D8DA 2OXIA 3UJHA 3OEYA 3WGTA 3UTDA 3H5OA 2VSNA 1Z25A 4C0KA 2ZCUA 2YWFA 3WQQA 1P3DA 1THMA 2AK2A 4GZLA 2X23A 1NQVA 2VA8A 4UATA 3L9XA 4L72A 2PWYA 2AHRA 2SNIE 3MWLA 1X7DA 3OIYA 1DHRA 1TUEA 2K4MA 3D2CA 4IKOA 3WJ1A 2HBQA 1LBTA 1WAMA 3SEQA 5A6VA 1YNSA 1SFRA 4FNGA 1OX4B 3ZU5A 1XLWA 2CUZA 1JLHA 1JP7A 5CFLA 3DMPA 1JFTA 5EP3A 2EWWA 4YRNA 4TV9B 1JKJB 1DPFA 3MHVC 3U3XA 3GEEA 1G6HA 2HA7A 3PHHA 1DGHB 4L5JA 4X8LA 3LO8A 1KZ7B 3O8LA 1O4WA 5DCYA 4BMYA 1WW8A 2HLNA 3ZWOA 1YA8A 4LRYA 1JL3A 3FSGD 2AC4A 1MN6A 3NH9A 1TADA 4KH0A 3D8TA 1ZMTA 4DLPA 5IK2D 3ZE1B 1E9FA 1EDDA 5FBHA 4CKWA 2MMCA 4C7MA 2E49A 5L7TA 3K70D 1JFSA 3AUJB 2WUFA 4Y2XA 1WXWA 4NS1A 1CJCA 5GONA 4HEOA 1DKPA 3OHPA 1LBEA 4QXPA 4TVKA 1XBTA 4LF9M 5I7OA 1G8JA 1DC3A 2BEVA 5ITZB 4ZYTA 1G59A 1T36A 3PUWA 3PWKA 5ARCA 3I5UA 1U0BB 2CL0X 5T67A 3GGSA 1B8OA 1JG6A 3FWYA 1JDVA 4HDKB 5U1PA 2RHJA 3GGCA 4E3WA 2X6RA 1N2IA 4MI3A 1G5QA 2P9HA 2PRYA 4HGQA 4BNTA 1YQGA 3WO1A 2JY7A 1JT2A 2L18A 3OZDA 4JKIA 3TINA 4E5SA 2P3LA 1YJ5A 4H0FA 1H2FA 1XC7A 3AI1A 1ZMWA 1RAGA 3DTNA 3IUEA 1KOGA 4IY1A 1OAOC 2AEJA 3KD3A 3ASUA 1NJ8A 3UJNA 3QNWA 1XCLA 5BV8A 1NY6A 2ZM6M 2CVZA 2W6JD 3HLTA 3SAWA 4JJZA 4OEHA 1SBQA 3NOOA 1RABA 3FHJA 1JLLA 3IEXA 3RSGA 1PI3A 4HEQA 1GTSA 4REQA 4CG1A 2QMEA 3VVBA 1RVDA 5I9TA 3L1KA 5AVSA 1IZ0A 1CJMA 1BS9A 3GBVA 3LFTA 4HB2A 5EYPA 4JQZA 4Z4FA 1XLTA 2FUKA 3AVOA 4JC0A 4N0PA 4ZQFA 4RWEA 5IVHA 2O8CB 2GZHA 4BVHA 3KCQA 1RYBA 2G9RA 3DEAA 3GARA 1Y8AA 2ZIGA 2BI8A 4BRZA 3N2NA 5DVZA 4F85A 4LRTB 2OC4A 1CQJB 3SBDA 4BY9E 3G3EA 3G68A 3DA8A 2AN4A 2FOIA 4EW2A 2IYSA 3BT7A 4RANA 3ZHCA 1JHOA 1QOZA 1W1IA 1XPOA 4BO0A 1WXXA 3MB5A 1ETUA 2FPWA 3OA0A 4Y1GA 2OCYC 2K2QB 2Y9MB 5TMEA 4MV9A 1AGNA 3RNLA 3I6IA 4LYAA 1XE3A 4G4GA 3RRJA 1KEEA 1KYQA 4C4RA 2PANA 1D2AA 2HU8A 4B2YA 5C5IA 2EHJA 4LE0A 1ZPDA 4I1IA 2M60A 3T3GA 4KGZA 4YLEA 2H2FA 3R8FA 3L46A 3SHOA 1PJRA 1CDZA 3IEPA 3KV3O 4QDTA 4U7HA 4EUEA 4H3SA 2ZI4A 3K9OA 1G21B 3QVKA 2I71A 4MICA 1PJBA 1PJTA 5KYUA 1E58A 3R7WB 4W7SA 4LHZA 2R4TA 3WBKA 4IPTA 2KNAA 4TOIA 4FMDF 4NYJR 1OJLA 4U9HS 1C2TA 1B42A 4MYCA 5JNWA 1JJ7A 4ENRA 1K9SA 4LY6A 3D4NA 2Q9UA 5FNVB 3QUTA 3R23A 1AE1A 4Y30A 1B73A 2XF2A 3OQIB 5HP4A 2A9JA 3IT0A 4BGIA 1MO5A 2WWHA 4HWKA 4WESA 2E9SA 3QOYA 2VYQA 4MRNA 3GIWA 3ZVMA 4R7TA 1HZJA 4AJKA 2BMEA 3ZCBB 1E3TA 1HYBA 2YZGA 4JIGA 5HR5A 4DR2B 5IREB 5AJXA 3W0FA 1XMIA 5I7HA 4YDQA 5LB4A 1Z2DA 4WE3A 4BVBA 4ZC8A 1LBSA 2DUJA 3C14C 2BHRA 4RF2A 1Y6GA 3H5WA 4TV9F 4UM5A 5TF0A 2BKAA 2CXOA 2JFGA 4XZ3A 3KETA 4IJVA 4O5AA 2RE8A 2ZBFA 1OI4A 3O9ZA 4RK4A 1YR3A 3U13A 1R0SA 4YRGA 2O5VA 3IJ5A 1Z74A 4R2KA 3ZDYB 1WBBA 4CT5A 2WVAA 3IDZA 1DWUA 1GJRA 2P7HA 3DKKA 2ZSBA 4HDKA 4K2HA 1Q3BA 1Z5WA 4MWOA 3KQLA 3KTFA 1KE2A 3T7CA 5IANA 2LP4Y 1ADGA 2PVCA 4PHHA 3E6AA 1VCOA 1C7IA 1KVTA 4A1FA 2FVYA 1I94M 3ELDA 4E0BA 2HCFA 4HEHA 4RVGA 5HIAA 1A50B 3LRPA 4I4NA 4INOA 4EHJA 4AY5A 2ID8A 3BE8A 1NI4A 5K1ZA 2JS7A 5DSTA 1PNQA 2JEYA 4GXQA 1LQ2A 4QPZA 2AEFA 5I48A 5KTMA 2GZAA 1XJCA 1TVKA 2LW7A 2V97A 3MD0A 3VPBA 2IPNA 2JBAB 5KVVA 4QOHA 5I7RA 2JJMA 3V5NA 1JA9A 1JE0A 1EHCA 2I0FA 2WD7B 4HYQA 1RAFA