3AONB

Crystal structure of the central axis (ntpd-ntpg) in the catalytic portion of enterococcus hirae v-type sodium atpase
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
101
structure length
101
Chain Sequence
MTYKIGVVGDKDSVSPFRLFGFDVQHGTTKTEIRKTIDEMAKNEYGVIYITEQCANLVPETIERYKGQLTPAIILIPSHQGTLGIGLEEIQNSVEKAVGQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the central axis DF complex of the prokaryotic V-ATPase
pubmed doi rcsb
source organism Enterococcus hirae
molecule tags Hydrolase
molecule keywords V-type sodium ATPase subunit D
total genus 33
structure length 101
sequence length 101
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2010-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01990 ATP-synt_F ATP synthase (F/14-kDa) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold ATPase, V1 complex, subunit F 3aonB00
4IX9A 3AONB 2D00A 2OV6A 5KNCH 2QAIA 5KNBH 3VR6H 2I4RA 4RNDB 3W3AH 3VR4H 5KNDH 3VR5H
chains in the Genus database with same CATH superfamily
5CA0B 4DYHA 1SA0A 4DJJA 1HT2E 3BTUA 5I7SA 4IDPA 2ZPTX 4PANA 5KTTA 1U2PA 2WFAA 4HUQB 3NATA 3WB0A 2D5IA 3N05A 2PKWA 3PSAA 3REFA 3V00A 4A27A 1BE1A 1R0SA 3TZLA 4YAKA 3ZVMA 2P77A 4FVTA 4INAA 5BW8A 3VU8A 1ZD3A 2JW5A 1LQUA 3ASVA 1CUBA 1U3TA 2UUAB 2J5BA 1KZ4A 2XUFA 3MK31 5FAKA 5L3SB 5CH5A 4F3CA 4IQ0A 4YH1A 5J2TA 1OA0A 4H6PA 2IH4A 2HSJA 2M98A 1L7NA 2W0MA 5DB4A 3L7IA 1TGYA 3H3XA 4CKEB 4MR9A 3BORA 5JR3A 3PXBA 3KQNA 1JR3A 1Q6ZA 4M1ZA 4MWDA 3PFIA 2Y76A 4FSXA 3QIVA 3EARA 3K6SA 3GFOA 1W96A 2FXVA 1MA3A 3LUBA 3Q41A 4AAYA 4BMXA 2YW9A 3OI7A 2EFJA 2H7XA 5GADl 3A1DA 3IT3A 3ITNA 5B1EA 5M04A 1TQ8A 3I2YX 2IQIA 2HI0A 2BELA 3UA3A 3EUWA 3LRXA 3BQNB 3ENQA 5ELXA 3GZNA 1WZEA 1KAMA 2O2SA 4ZCTA 1Z0ZA 3C3WA 4RK5A 1XQ1A 3BSWA 1MV8A 2ZYAA 3CLVA 1J8FA 4IH1A 1F4VA 1WB5A 4MPPA 4HGYA 5LYJA 4C6HA 4D0GA 3QE0A 3WISA 3ZU5A 3IFSA 1E2PA 2QTCA 4F0JA 5IWCA 2H63A 2ZXUA 4PW0A 2PN1A 5HX7A 5IAAA 5ALLA 1DIAA 1UOPA 3O26A 4D79A 3SD7A 3T5BA 4YJ3A 4Q4CA 3GEPA 1EVKA 1A3CA 4LDNA 2ZJ7A 5FCDA 1Z0FA 3E9RA 1MC1A 2XTZA 4DJ5X 2UKDA 2C2OA 2WUEA 3DEJA 3DUFA 3FCXA 3PHJA 4MIYA 1WCIA 1BQ3A 3IBTA 4UE2A 3ZV4A 1LPBB 2ZRDA 3CLSC 4UAUA 4DMUB 3UK1A 1QHFA 2KBFA 4AXXA 5KYGA 3AVYA 1L2TA 2A33A 2CMGA 1Q1QA 2EKQA 3DO5A 5LD2C 3DMTC 2FKNA 2A9JA 2BVNA 2ZR0A 1RXYA 4RW0A 4QODA 5IT9A 5HILA 2QUKA 4HMPA 4RZXA 2NO1A 2W00A 3OEEA 2X9QA 3OCXA 1G8KA 1ZK0A 2JG3A 1NXQA 3BGVA 3CF0A 3QUAA 1NF9A 1RYBA 2WSMA 1UDCA 2GO1A 5JQGA 2Y3IA 2Q4EA 3GJYA 4DNPA 4DT1A 3T1VA 5J3JA 4H4DA 3D4LA 4KLNA 4K9KA 1OV6A 4A8PA 2Y05A 3OPMA 2AZTA 4KR3A 3TL2A 4YDHB 1XYVA 4I2VA 3PJRA 2B1IA 1RAFA 2E3JA 4BBJA 3PDIA 3QU2A 3FMFA 3OUZA 3D8UA 3TLEA 3CJQA 3UEOA 2X8AA 1O3YA 3ZEIA 5C52B 3FCEA 2ZITA 1NP7A 5K3DA 1R5BA 2DPLA 1RBQA 4O63O 4REQB 4WY2A 3BGSA 4CFYA 3ZQ6A 4R1MA 2EZ4A 2DFKB 1Z7YA 5KTOA 1QUFA 3ELUA 2G4VA 2AG0A 4A1FA 4XVUA 2BGRA 3BCRA 1ISHA 4NESA 3NEYA 1VCOA 1USGA 1A5SB 3I6ZA 3KX2A 3QXHA 1JFLA 3ASYA 2XXAA 1DEAA 5D86A 2Q5LA 1U80A 1P8JA 1RW4A 4TV9F 3TSYA 1U0SY 1A5TA 2O52A 2VVTA 2UDPA 2Z3WA 3M6LA 2Z9CA 3H2SA 3AP1A 3ICQB 3W5AA 3FWPA 3ZKWB 4AYWA 2ERXA 3RTEA 1GPDG 3I9LA 4L3WA 4QOEA 2Z30A 1V5FA 2D0IA 4DKJA 5DLQC 2EP7A 2NSJA 5KNLA 1QMGA 2D3TA 2Q5OA 2WVAA 5SV2A 1CU1A 4R84A 3O7MA 4MW4A 5E8JA 2BDTA 4E08A 4PPNA 5IWAB 4NF2A 4IMJB 4WXRA 2BJWA 3TOCA 4DRYA 1NRWA 3O2JA 3K32A 5DO9A 1WD5A 2CB0A 2P6UA 3QVSA 4R2KA 4CEHA 2OBXA 1NVVQ 3ZIAA 5FWNA 3PHBE 3AJEA 2I87A 3SS9X 3GT4A 4HKTA 2A1UB 4EYSA 2H9AA 4D45A 3P26A 1I51A 2WTUA 1SZPA 2O7SA 1P3Y1 3HHEA 3BKXA 1PG5A 2GRJA 3HPQA 4RA9A 2P3LA 3IBYA 2GKSA 3V4OA 4BTLA 3BWMA 10MHA 3V9PA 4EW1A 3VOAA 2RGRA 1M66A 1X1DA 3PCXA 1ADBA 3Q7QA 2OFOA 2BD0A 5BVGB 2I9KA 3N2LA 4ND7A 3BRQA 1R5NA 5D3MA 4MS3B 1HEIA 1GR0A 2Z58A 4HNSA 4XYEA 2BMVA 1QIIA 4BLWA 4H7HA 2GVNA 2GLUA 3BJMA 5EMLA 3RCBA 1JMVA 4D3DA 1SIWA 1U0JA 2RK6A 4MQ5A 5HZMA 3PJFA 4BC1A 4IIYA 4HNAB 4E1AA 1QP4A 2BGGA 3ERCA 1XIVA 3V1NA 4WADA 3C5HA 1WS6A 2YZGA 1FVHA 4KE6A 2VO1A 4BX2A 4E2WA 5BR7A 1QPZA 1RQ2A 1DARA 3SC2B 3AI3A 3F7OA 1LWNA 3R0JA 1GRRA 1HE4A 4JQSA 4MARA 5DKFA 5FP0A 1KDOA 2VWPA 2LE0A 4PRYA 5H9WA 3LKBA 3DDWA 1QRAA 4NX2A 2W2LD 2QR2A 1RRKA 2B7CA 1TAQA 1NKTA 3LQ4A 2GF2A 1DX6A 3FFWA 1BC5A 3SIPA 2GYUA 2WTXA 4HAIA 4UBKA 5A6VA 1W6UA 4OXNA 1RWKA 1Z0SA 4P36A 4XWGA 2DYKA 1G20E 3BREA 5IASA 3IKTA 2UVPA 3KFLA 3MJHA 4DCGA 1KVRA 3T9CA 5GPBA 4LZZA 2VUIB 3S0JA 5IDVA 3UV3A 4ZHSA 3FNIA 4B8WA 2PFGA 3D81A 2BMWA 4Q16A 4XTCS 4N8DA 1E3TA 1UKZA 4N7BA 3QPBA 1T1SA 4C7JA 4OYHA 4R8SA 2OBFA 2VRBA 4UHBA 5CTAA 4HZUA 4EB8A 4P82A 3OSUA 1V1RB 3ZE8A 3RRMA 3FCAA 2J9FB 3ZHYA 1GGMA 4BIIA 3OQOA 2G77B 1N32B 3Q3EA 5FPYA 5DNCA 1JHQA 1VCNA 3T7KA 3ND6A 1M2HA 4JA0A 4GYJA 4MW7A 3TOXA 3UAVA 1W88A 4S3MA 4BLPA 1I9GA 4FYVA 3KR2A 1EK1A 2IX9A 1M2EA 1Y63A 4TPKA 2MSNA 1M2JA 1ISRA 1VSVA 3NUQA 2F3UA 2BYTA 4NZMA 3KEGA 3NXKA 1EGMB 1EQAA 4MQMA 4J6FA 5HS4A 3COJA 1FX1A 2UZ1A 5DBFA 3TX6A 3CUSA 1U6KA 2OENG 4EFDA 2BUAA 3ONWA 1NVEA 2VYCA 3ZD7A 1CX9B 3VXKA 1H8EA 2W2XA 1L5WA 1SCDA 3VMFA 1D4OA 2HEIA 4DMFA 1BXRA 3BFVA 3H7IA 3H9GA 3OFND 1A5ZA 2WW8A 4YJ2F 4XARA 3ZV7A 5F4ZA 4B40A 4F5ZA 4Q1DA 2V7EA 1X8LA 1HO3A 5EP2A 2BFCB 1I14A 5CXXA 4GR4A 4A9AA 1P0FA 2XT6A 1L5SA 2OE2A 1WDTA 4C08A 3UMBA 2QTHA 3QX8A 1SBCA 2ECFA 4CMBA 2B4AA 5CLFA 2FXIA 3LRTA 1T6XA 4LVUA 1H3EA 2VP6A 3AWIA 2HRCA 4DV3B 2W8BB 3QWIA 3RARA 4C3ZA 3AUFA 4HQRA 5JJBA 1GNQA 1L8XA 2FPRA 1NQAO 1T4DA 2EGUA 4L28A 4QOJA 4CLOA 1QYCA 2SCUA 2W2KA 3GW8A 3K1AA 3PFGA 4IFIA 4NG4A 3OOWA 3EN0A 4RPHA 4WQMA 3SSMA 3T7IA 2B0CA 4F9FA 5JH7F 5KPDA 1X7XB 3Q3IA 3HUUA 3E4DA 4YMTA 1CYEA 1KHTA 5TE9A 4GECA 1LBTA 2O0KA 2XXJA 4GF5A 3JQGA 4R40A 1SQSA 4RS3A 3OU7A 2B61A 4MA0A 1U7WA 1B3BA 4LISA 3H19A 1EVIA 3Q6NA 4OKNA 5JJLA 2PS1A 2WVGA 2ILTA 2C2HA 1QLHA 1P6XA 5EY5B 1RYYA 3AONB 2UYQA 3E27A 3CKLA 4AJ1A 4DCPA 1FVOA 3U26A 1JTVA 4F3RA 3BXHA 5AHKA 1E79A 2CLFB 4DCNA 2GZRA 3MCWA 4RVCA 5ERGB 5BNTA 1PYDA 2XT0A 1MRSA 1W59A 2O6HA 3G68A 3LF2A 4L6AA 1B74A 1ULTA 1R0LA 3IV6A 1PJTA 3PG5A 4ZPXA 5HKOA 2JBHA 4FYKA 2RGUA 4GT1A 4IZIA 4IEFB 1TGVA 3RKRA 4BZQA 4AQYB 1YQGA 2QUZA 3SHVA 3R2JA 3BDAA 2Y0BA 2HJSA 4IH9A 1XDBA 1E1CA 3ISJA 3K9WA 1OFUA 4JUBA 1GEGA 1WU8A 2JA1A 4K0KB 2G7ZA 4MR7A 1FS5A 1KTVA 2Q2OA 4E7OA 4EPVA 1ZC3A 5ITVA 1QZ3A 2EG9A 5EMHA 4QWMA 5J5CA 3W9UA 3A6GA 3BWVA 4PC7A 4Z0NA 3X1JA 3SC3A 1V11A 3CEPB 2FLWA 4NFYA 4KO8A 3L77A 1OT5A 2E4YA 2FPOA 1JEJA 4FFDA 4A36A 1RZUA 4AO6A 2FOIA 4MR8B 4OHVA 4E5YA 5FV4A 1GA1A 2JVKA 2NUPA 1CUHA 4WDRA 2XOKA 3BGWA 4XOIA 3U9TA 2GFIA 4TYQA 1WDWB 1JR3D 1EUZA 4DTCA 3RC8A 1CB7A 1ORWA 2I4RA 2PKCA 4OI2A 4NZNA 4K28A 4MH0R 3LLVA 4O5AA 4OD0A 2FX3A 4RSMA 3WRXC 2J9YB 2IUEA 2Z56A 4AO8A 8GPBA 1VKHA 1Z25A 1J8DA 1LI5A 1XCLA 5C8YB 4G26A 1J00A 2ZRPA 3N0XA 3SU8A 4D4JA 4DMHA 1VIVA 5ICGA 2AN1A 2N42A 1PNTA 1NR1A 3EEYA 3JTEA 1HDIA 2Z2YA 5HZHA 1W0JD 3U3XA 4WK6A 1VG1A 4YRPA 2JANA 5SY6A 1AUXA 1JHXA 5E1BA 5FHRA 2FQYA 3P8ZA 1EXVA 6Q21A 3O82A 3AHHA 2QUAA 3W8EA 5FBVB 3KLNA 3S2UA 2OC4A 4I1UA 4CL2A 1U2EA 4LRQA 3JSXA 1A8IA 3IQWA 4KO1S 2OOSA 3LS2A 1S2GA 3MVEA 4MKHA 1I36A 5KKAA 3ZZNA 5KSWB 4XVHA 4LJRA 1DRVA 1BH2A 5JHGB 1UKVY 1ST3A 1U8FO 1YVPA 3KB2A 1YQEA 3ESYA 2QLJA 2VP9A 3K6SB 1UAGA 3N5KA 1HQYE 4BMCA 5IULC 4PYKA 3HEBA 1DQPA 3ZUGA 1TZBA 1FP4B 3WGZA 4AMUA 1DBVO 1N6KA 3DEFA 4ZT5A 2BMAA 1JB9A 4QEDA 5ILGA 4MYTA 3IAHA 3DOHA 3H3FA 3FPCA 4LYAA 5L53A 1FYEA 3T7JA 3DT9A 1Q7RA 2VRCD 3A9CA 2CVHA 1WNTA 3N2GA 3WNDA 4DA6A 4IZ6A 4EATA 4YJGB 3HH8A 1ZH0A 4UBJA 4XGNA 3REGA 4KXNA 1PZNA 2HWWA 5ECGC 5SYAA 1F2UA 2JGLA 4QLOA 1Y8RA 3EMBA 1MX3A 4C6TA 5LSAA 2WQ7A 2HFJA 1XMOB 4LHZA 4J03A 3KTFA 1ZK3A 4KR6A 1M1YB 2I2CA 3Q40A 3U6BA 1T43A 4I4NA 2EBFX 3RAPR 5BN1A 1FRVA 5GZ3A 1KIAA 2A86A 2Q5IA 3ZU2A 1MOZA 2R2AA 4MRSA 2I1QA 4PX3A 4C07A 2FPKA 1YDHA 2Q7XA 2ZLBA 3BJZA 4ZVPA 3U4IA 2H7VA 1VJGA 5DNUA 2O5EA 1FSPA 1DKMA 3SC6A 1RCTE 2OZVA 1GA6A 2Q3MA 1D2CA 1V7ZA 3VH1A 5EJAA 2LPMA 3KHSA 1MC8A 2FY8A 2DJ5A 3HCAA 3GRFA 3I4CA 3T9FA 1UDWA 4BASA 2C7QA 2K6GA 2A5LA 3SM9A 3AR8A 1U8EA 3GUCA 5ALMA 4DR7B 3C3BA 1MJGA 3WGNA 5C3UA 1NBIA 3HVRA 1UFOA 4L08A 1Y1KE 3HR8A 1W4AA 4LXGA 5ERYA 2IYPA 1PRYA 4MW0A 1PGPA 3MRXA 3LPCA 4QELA 2ZRQA 4RY0A 3T9EA 1COWA 2FN8A 3EIFA 3VQTA 3N8HA 4R54A 1PQ4A 4W9NA 3X2FA 4FQ8A 3Q12A 3ZZ1A 4HOYA 2AOTA 3ACCA 2P9TA 2B4QA 1UM9A 3JWIA 1Y8ZA 4J7UA 5LQKA 4GGPA 1NUQA 3D3JA 4AZ0A 1SCKA 3NVDA 2C5SA 1EUCA 3OUTA 2C03A 4KWTA 4NYJQ 2VAXA 4R7GA 1B6RA 5I7RA 2B9VA 1F2TB 1MZPA 4L4YA 1V4VA 2IE8A 2RH9B 2ZCVA 5AWFC 3IAEA 2ISCA 1F9AA 1Q1AA 2X8WA 2FSFA 4G4IA 4OLFA 2HPAA 3VKWA 1B3RA 4TVOA 5B3AA 5DCUA 4GAEA 1NVXQ 2PX0A 4DLUA 2IT1A 1Z28A 3WLNA 6GPBA 1Q44A 4Y6GB 4R5MA 2PUWA 3OLQA 3SYNA 4GDFA 3N76A 4BNWA 4BNIA 2QP4A 1S8FA 4N03A 3M4ZA 4FGZA 3RYTC 4CYMA 3VHXB 3QW2A 4G0MA 1GRNA 2E4ZA 1SUEA 4J07A 5EG5A 3HV0A 1JG1A 1EVZA 1YB6A 3B1WA 1C9JA 1EDEA 1KDTA 1L5VA 3IO3A 3MIIA 3NDRA 1CUXA 3PNLA 3ZNNA 1YB1A 3WHLA 1LVGA 3FPHA 1EG7A 4KE9A 3NB0A 1MEOA 4UZEA 2OHJA 5BOVA 2Y1XA 2I3GA 3KB8A 3O8NA 3C15C 5DIZA 4N3BA 1GGHA 3G2QA 5K0EA 3KE9A 1ODLA 2AG6A 2UVPB 1P1JA 2PSJA 2X5OA 2X8JA 3GGDA 3GQBB 5K6TA 3ZI0A 3JQAB 1MF7A 3LCJA 2O57A 3QSYA 2X2FA 3AUAA 5IUNC 1HKHA 3FKJA 1YRAA 1JH9A 1C0LA 1RR6A 5AM0A 3VNSA 2H5JA 4ZALA 3FJYA 5KS2A 1ACLA 2GXUA 4TXNA 1KKMA 2BN4A 2BI7A 1UBLS 2OO5A 3JWPA 4MRMB 2NLOA 1NATA 3T0GA 5KDOA 3HJUA 3LUDA 4J9UE 1JI0A 1UJ4A 4TMXA 2J3JA 3RFUA 3WK5A 5HTOA 4Q9IA 4HAWA 1IJBA 2JBWA 2JFZA 3FHOA 4GZMA 5DYNA 3PC4A 5E7QA 1CP3A 2QU7A 1W9MA 3GPBA 3C3CA 1CLUA 3AKCA 5IK2A 2J3MA 5FWYA 5EUBA 3R7NA 1CS0B 1E9RA 1YJBA 4L6IA 3TR5A 4RWEA 4B73A 2YINC 4WKGA 5LQRA 3OE4A 1O1YA 3GPDG 3GNTA 3NDIA 2I55A 4OHOA 4IJ6A 1GSAA 4K9MA 1R3DA 3FYDA 4KPUB 4LSWA 5D3MB 3PUXA 3BF8A 3SX0A 4EKNB 2C5BA 1IVYA 2K2QB 1OLOA 3KL2A 1YHZA 4QAJA 3PDCA 4EA8A 5KCMA 2JFUA 1G8GA 1ZM2A 3DT8A 3ENNA 3HCEA 3QEOA 3G82C 3QWFA 4FQ7A 5KIAA 1TT5A 3A26A 2H8KA 2ZUWA 4FDAA 1VC2A 3CGWA 4GVPA 4F92B 3HB9A 4QYIA 4MAMA 4EVIA 2PLWA 3SC2A 5CB4F 3FZGA 3NETA 2E6UX 2Z04A 1A77A 4M21A 4AN0A 2Q2NA 1GVNB 2F2TA 1A4XA 1PHPA 2FPIA 1SVOA 5D5HA 4AZ0B 4BWVA 2Y0CA 4Y2GA 2QTBA 1Y9ZA 3DDNA 4QZVA 5I9IA 5BSFA 3A6DA 2DPXA 1ENYA 1IHYA 4G4GA 3QVTA 4XPIB 1HE1C 3RRZA 3EYWA 3AYXB 1U0HC 1ZU5A 3TQOA 1EDZA 2X6QA 1BJRE 1KMHA 5CIQA 3LVFO 3WIUA 3BM5A 2HA5A 2DR3A 3CUVA 4RM2A 2OEPA 3ORFA 1NULA 2E4AA 1EK5A 4M60A 4D9HA 2B1QA 2FMTA 1RYFA 1ZVVA 4ED9A 4EYEA 2DERA 3MQ4A 5CNMA 2QWXA 3MW8A 4UUQA 3B9BA 3SE0A 1K3TA 2EKPA 4AL4A 1B41A 1RFGE 1T8TA 3UWDA 1DWUA 1GQYA 1I7PA 4IXNA 4I55A 4NHEA 4N3NA 4GQBA 2Q29A 1F3OA 5COBA 1KQNA 4W5RA 2XKKA 1Y82A 4BIMA 3DC7A 2CL6X 2XUKA 1A2OA 3D8NA 3INGA 1B42A 1F06A 1MO6A 1ZJJA 3L0DA 4S12A 1NASA 2AFHA 4AP5A 5A3QA 1IVSA 4CM7A 3GLSA 1KK0A 3O1LA 3AF3A 4I8XA 3IEKA 3PCTA 3FH0A 4LHVA 1TB4A 2BR5A 2V59A 2R7MA 3AH8A 3FDZB 4HEJA 5J59A 4C4TA 1NQVA 1YB7A 3L1JA 1QLJA 3IHTA 1JFFA 1Q0ZA 2ALJA 3DZFA 4L75A 1JZTA 1YD7A 3ESQA 4BFVA 4J3FA 1XHLA 3GYGA 1TRKA 4TRNA 4R71A 5JMPA 3EVDA 3QI2A 2BFDA 4BB6A 4AX8A 1JLLA 1EK6A 4KG7A 4D4KA 1Z5GA 3L0IB 4Y6RA 3OJXA 1U63A 1RKVA 2JLQA 3N0WA 4KRFA 4G0VA 5K6RA 4X61A 3GGSA 4MUMA 4Q7EA 3FG9A 5KHLB 4EKIA 4ZT6A 1UWKA 5B7PA 3FNBA 1HYBA 4Z9FA 4JLAA 4TWRA 5LDGA 4C9BA 1V9SA 3FWYA 1SURA 3T5CA 5G53C 2BFEB 2D5LA 4UQOA 4D9NA 5C8YA 3ZIDA 4GPD1 1TKRA 1YI1A 1YKFA 3P9KA 4JROA 3OZBA 2P5YA 1C1XA 2C84A 4CMJA 4GWLA 1GP2A 3QF4A 2W6IA 1FVFA 1LPSA 2NT3A 1XE3A 3FKQA 3KP1A 4K6MA 3SQWA 2G28A 4AQDA 1P6QA 3BGIA 3SFZA 3VNUA 3K3PA 1PZGA 1UBMS 3CRNA 3IMEA 2ATVA 4JP3A 4E2ZA 4B3BA 3FTPA 3BQMB 2EZ8A 1JDJA 2ID9A 3TRJA 4B80A 1ZI9A 3DE5X 4NCNA 4KMMA 4K88A 1P5RA 3DV2A 3ZN2A 3MCAA 2O8EB 1PW7A 1OXMA 3ETEA 4KQJA 1DU4A 4ZJYA 1HEYA 4F1KA 1CIVA 1P7WA 5JDIA 1DIHA 1ZI8A 2ZRNA 3FZYA 1JDVA 3L07A 4CGZA 3CEMA 2J7PD 3U1VA 5DHUA 5F7OA 3KD3A 3ZJUA 1W73A 3FLMA 5EINA 1YIAA 4GM1A 4IV5A 4Y9TA 5I9TA 4PQGA 4I9GA 2DUJA 1JU4A 3VR1A 4CM4B 2I7CA 2YMLA 4YJGA 2ROQA 4DDUA 4PR0A 1E3DA 3FDXA 3CLUD 1PLJA 4BNDB 3VO2A 4H18A 2ONKA 2CDRA 1L1EA 2OLKA 2G6BA 4JP5A 4B0PA 4D41A 4BC0A 3D5QA 4JY7A 2Q45A 4U0JA 3K5PA 3R3WA 4UAVA 4Q24A 1EM8A 1QP8A 1KBQA 1NE2A 2V4MA 4M7WA 3TLJA 4CM3A 3Q9NA 1Z2NX 3D5EA 1L5RA 4EJMA 1R6TA 2ECKA 4OP3A 3MYRA 3QBVA 5EIWA 3TYXA 5JCJA 4WKPA 1H2HA 2NUTB 2GZHA 3EFBA 4MIKA 5DK4A 4FYMA 2R68A 1EX1A 4P53A 3O75A 4TXLA 3ZJ5A 1NVBA 1RJEA 3ONDA 3F0TA 3ESAA 3I28A 4UTVA 4MWSA 5ALPA 2PH1A 1SUAA 4BN0A 3SKXA 1IEXA 3KYDA 3OQIB 3OOHA 2JFVA 2RHDA 3C5CA 3K9CA 3PNOA 4FGSA 4GPIB 4J9VA 3U19A 2VJAA 3ECAA 2I2BA 2XDYA 4U9HS 2Q4OA 4OTZA 3AVXA 4BV8A 2IUFA 3H16A 3KWJA 3MERA 4O1MA 4XPIA 5F73A 2JLYA 4QNMA 3QOYA 5CYOA 2Z2ZA 3DZIA 1X38A 2XUGA 3DP7A 3K0BA 2V0GA 4L8YA 1X7XA 3G0DA 1T2FA 4DMLA 2X3UA 2ZI4A 4QG7A 5G3YA 3IEUA 5BWLA 2XUZA 1XEWY 3C45A 3I9OA 3WICA 3WNZA 3NTOA 2P6PA 2G5CA 5BR4A 1AKNA 3W05A 4OQDA 4E4TA 2Q07A 1UPAA 2C2KA 2ZBQA 3V1YA 1IZYA 1H4TA 2WMNB 1I01A 1UZLA 2CY0A 3D4PA 4H17A 5DWDA 3WYFA 4C4SA 4PG8A 4HEQA 1JFSA 3WAKA 4OGLA 3SDBA 3K9BA 4WKNA 3QXCA 3BCUA 5AVYA 1PK8A 4JEHA 2YWCA 3R5XA 1Y8AA 3ROGA 5A4MS 3RV3A 5TQ2A 1JJBA 1BA2A 1X0XA 5LP6C 4PSVA 3UGJA 1QU2A 3TXXA 3EEOA 5HUHA 1VKOA 2AL7A 2H5IA 3NXSA 3TSZA 1CDOA 4KRYA 4PEVA 3O4VA 2V9CA 3EVTA 3AJ9A 2A9KA 3ZQJA 4QVKA 5EIHA 2PPVA 2YZ7A 4R2XA 1XK7A 2NSYA 4F56A 1TQ4A 1UPTA 2EQ5A 3AVWA 1EDBA 3ETGA 3HN6A 4AYTA 1M8PA 4JR0A 2ZYRA 3I45A 2FKAA 3CEAA 4Y1RB 5JUWA 4H4EA 2JLAA 3U37A 4AJIA 2G83A 3K6KA 4QG3A 2VDLB 4X90A 3JXEA 4JI1B 4MVJA 3N2EA 4JLKA 3TTTA 3V8PA 3C8HA 2P5SA 3OTHA 1USWA 2J9RA 1XLVA 2BTEA 3H84A 1XI2A 4RE5A 3T0FA 3OJOA 1CY1A 1GT91 1WTAA 2NZ8A 2WIJA 2V7QA 3LZDA 4IF6A 4KAXA 1SCUB 3DFIA 3D2BA 4RXTA 3HZOA 5BT8A 4BQOA 1OFTA 2PKQO 1V5GA 4NH4A 3E35A 4R2HA 1SQFA 2DHCA 3T3PB 5JOQA 4HV4A 2FFBA 4P98A 4F5WA 5K0TA 3ITDA 1ZMOA 3GUYA 1ZUNB 4ZZIA 1QVRA 3AWDA 2C4KA 3QX9A 3QU5A 2TMYA 4JEMA 3E8MA 2IJGX 3K5HA 4CG1A 3FTEA 5CUQA 1W34A 1DJLA 1HF3A 1U3UA 2MIIA 2C3OA 3OTQA 4ZD6A 1P4AA 3CCCA 3G8BA 1G18A 4CG2A 1OHHD 4MEAA 1EFKA 4JU8A 4IOJA 5EGNA 4IS2A 1PT9A 2FZKA 1SBNE 3K0CC 4JYBA 3M6UA 2WQZA 3FZNA 3H8VA 4MNTA 4FFMA 1VM6A 4MZXA 4I1PA 4YT2A 2WIFA 3RFTA 4F71A 3F6SA 2VDOB 3FNQA 3UANA 4BGVA 1GCAA 2QZJA 1IWBB 5LQAA 3EVEA 1BS1A 2RCYA 2QIOA 2P9HA 1NVUQ 3P0FA 4J0FA 2QTMA 4QXPA 4CM9A 1GAQA 3OVMA 2W42A 2VH5R 1C9DB 2ONJA 3TG2A 1G3IA 2ET6A 5C51B 2NZYA 1HKUA 1RI3A 2WF7A 4R6WA 2DLCX 1IRXA 3AEUB 2H3HA 1W25A 2XE6A 4YYZA 4C2UA 1JI3A 3GWZA 1R9GA 4B2YA 4GMDA 4J29A 4N47A 3BS4A 3IP8A 1UDAA 1L1QA 4NU0A 4GXQA 3IDSA 4RZQA 3W7VA 3JWHA 4ES6A 1Z83A 4K9RA 3I0ZA 4LSZA 5IVIA 3V1UA 4MUEA 1IY1A 1IBLB 1SKYE 1N0WA 3KZMA 5CJJA 3JQDA 2C1ZA 1VIAA 1SG6A 2I9PA 1L5LA 4FZ5A 2NUAA 3UJAA 3FHJA 3QKSB 1N7IA 5DT2A 3S28A 3VO8A 1QP0A 1GTZA 2Y0EA 3ZNOA 5LBTA 4XFKA 1R8YA 1XTSA 1Z4MA 4GMHA 4DCSA 2OVFA 4ZYXA 5KWVA 1XRJA 4LRWA 3WBFA 3P0EA 1X2BA 2VH1A 3L5KA 2BW0A 4GZ3A 2W2TA 5ICEA 2WWYA 2WFMA 4L0DA 1IVNA 4B48A 1JJIA 1N2XA 3ABQB 3R0XA 4AJEA 4MGEA 3NKFA 3W90A 4GR9A 221PA 3TLXA 1LLFA 2W2PA 3OTWA 3IH5A 3UAOA 3V80A 4M9SA 4CTJA 1IL0A 3O84A 4FKMA 4K81B 1AMUA 1AT1A 2H1SA 3KQWA 4TZ6A 4BXOB 3NVKI 3A06A 1F4LA 2RMKA 1ZQ1A 3NZEA 4OAOA 4RFSB 3SF0A 1QPGA 1JLHA 2Q6TA 3GJ6A 4FHEA 2ZYUX 4ZOLB 3A3NA 4O2BA 5EXSA 1U9CA 2GYWA 5EUMA 3JQPA 2CW5A 4HDKA 3K0SA 3OQIA 4K6KA 5DNVA 4OPMA 1EE1A 1J09A 4HVTA 3N87A 1C8LA 3TEFA 4YXWA 3K9FC 4WEQA 4RYDA 5IXSA 1U1EA 2FJPA 4G9EA 5BR8B 4B4DA 4V0ME 2C04A 1DG1G 3B3AA 3LWNA 5DIFA 2BL4A 4J0EA 1AO0A 2AG1A 2CFCA 2XCRB 2ZSFA 2Q3DA 1TNDA 3DVSX 3MTJA 5EXTA 4MYDA 4AKGA 2ERYA 5JXWA 4M54A 4Q9AA 5JLJA 1S3FA 2V6BA 3ENZA 1JHVA 3WYEA 4PWYA 2HXSA 4BNYA 3D2LA 3FNGA 1ZGCA 4X00A 4EG4A 5IJZA 3A3PA 1X8JA 4P3NA 3RSZA 3WGYA 1FJ2A 1GPMA 1NDUA 3A4NA 3RSGA 1AC5A 3FB4A 3WNBA 3FSGA 1EGQA 4WXPA 3SEAA 1F17A 2B6HA 4MULA 4TYNA 4WBNF 5IKPA 3V7NA 1D1TA 2J09A 1E2FA 2EP8A 2F67A 5JC1A 4M9RA 1M9NA 2B30A 1ZY2A 3HJHA 4CXMA 2ADMA 1SBTA 1OV4A 4LRXA 5CDFA 3G1UA 1ZA2A 4KR2A 2EOAA 2ARKA 2IQ5A 1UANA 1Z08A 1F8GA 3LCCA 3JQRA 2Z5VA 4LXTA 2HO4A 4UFOA 1XVUA 5G4KA 1TLLA 3AMVA 2X58A 3VRHA 2OCAA 5IHXA 1A9ZA 1VJ0A 2CJPA 1GIAA 3E22B 3KZOA 1QC5B 1PK7A 2KMLA 4HDRB 4WPGA 4DXAA 3S27A 1FXWF 2BCEA 2JD1A 2PT9A 4HXFB 4QRIA 1Q1GA 2GWHA 3BOSA 3JD2A 3JQCA 3L2OB 4IW3B 5D87A 3RVDA 1II8A 2AEJA 4AF7A 1WXEA 3ENWA 2OCGA 4C14A 4IVRA 3EJ6A 1E6MA 4DPLA 1MIOA 4ZV9A 3HO1A 2OPBA 4QPDA 3W77A 4XOUA 4MVJG 4PC2A 4NCXA 5TQ0A 2Y1EA 3PHIA 1PEAA 5IK2D 2YJ3A 3TSCA 2O4UX 4CIDA 4GICA 3HB1A 3KB1A 1P2TA 2VJMA 3DL2A 3EVGA 3S1AB 4Q4LA 5F5LA 4L74A 3U40A 4DF3A 5GZ1A 4AKEA 3FUXA 4FYWA 3NT4A 3P2JA 3QFTA 1ML3A 4PF1A 1V41E 2OXIA 1KI4A 3WGOA 3IP6A 4EB0A 3Q0IA 1YRHA 2XMGA 3EW7A 5HVNA 1YUMA 2YWDA 2ZUDA 3MQFA 4QVIA 3JX9A 4LBYA 4EO4A 3GLFE 2I2FA 4MDFA 4PG6A 4S35A 2JLCA 4MS4B 2NZJA 4E6PA 1C0IA 2GJ8A 3VSAA 1Y1QA 4DQUA 2GOYA 3RVKA 1QGUB 5KWSA 3OY7A 2QK4A 2QG4A 5CYPA 4B34A 1EVQA 4XR4A 1JE1A 5F64A 2P90A 1OOEA 2DR0A 4JJAA 4BN4A 4EHKA 2PYZA 3M49A 3ROXA 2ZWAA 1JFTA 3KV3O 1RM4A 3K1JA 1YZQA 4FMBB 5TGTA 4E51A 4I19A 3JQEA 4NCHA 1JFVA 1PO7A 3RQIA 1WPGA 3ESCA 4RKRA 5JYCA 4NOKA 5AJVB 1WMAA 3OOYA 5F3RA 3OF2A 3RG2A 4ZQFA 5EIBC 1SKUA 1UBTS 3SS8A 2H06A 3V3TA 4TMTA 4E0BA 1QFMA 5GTDA 1G42A 1XZQA 5CHYA 2G80A 1R66A 4CMIB 2C94A 3Q7IA 1PEYA 1XJQA 3PEFA 3WWYA 3F71A 1UQUA 3JU3A 2RC6A 5EMMA 1Y1SA 3WXMA 4MQBA 2HDWA 3FIUA 3L1IA 1HEUA 4J3NA 4MHSA 3KAJA 3O4FA 2X13A 4IYRA 4LZJA 4Q3LA 2ZJ0A 1RTTA 3W3AH 3U39A 3TJZA 1VECA 1E2BA 3P0RA 3C1UA 3KLBA 3R3VA 4LYYA 3L9WA 1YZFA 4C4PA 1SZCA 1SPXA 1KSHA 3GEIA 4DCTA 4L6CA 2DLNA 3DAFA 2ZDGA 5TVKA 3ADBA 4C3OB 1DFHA 5LBUA 4I8DA 4QDOA 3BK1A 5B2ZA 1EZ4A 4PC1A 2WINI 3AHFA 3U3RA 2JJ1A 1WOMA 4K6GA 3W4IA 1AIPA 1LQTA 1GLGA 1VA4A 3MJCA 1D2HA 4YRTA 3LW8A 1BQEA 3MS7A 2V8OA 5L3RA 1UAAA 5IDXA 1UMBB 3EXEB 3HO8A 1WDLA 1TDJA 1CWUA 2EX0A 1KC3A 4UBNA 3W2HA 4TL8A 2VUTA 2WWWA 1OYVA 3GJ3A 4EGSA 3ETLA 2IDMA 2OKGA 3OESA 1KP3A 4BPRA 4JLSA 4KQCA 4OX9B 5KOJA 3TLYA 1GZ7A 1P75A 1TF7A 4KXQA 1VP9A 1WUHS 1E98A 2NU7A 1C0KA 1FU7A 3CR3C 3GGJA 3KTOA 4RTJA 4PFKA 1U8XX 3TPCA 3A04A 1R8XA 3OJ0A 5DGTA 3STWA 1JDBB 3O8BA 2M9MA 1O5TA 2R79A 1ZAYA 1C41A 2D2FA 1UBFA 2DY0A 3FMGA 2VEOA 3MPOA 5JPCA 4U2GA 3HR4A 3FTFA 3CIFA 2Y68A 4LQDA 4CEJA 1JECA 2R1TA 2Z83A 4OEHA 3IQZA 3RPEA 3HGQA 2BLLA 3EXFB 2XMRA 3TM5A 1U4NA 5JJ5A 4A8JC 2EJBA 1P5FA 1A7AA 4PZYA 1ZUNA 1MRZA 4P5PA 5B6PA 1VBFA 2XUPA 2QVBA 4JUIA 2GNPA 1L3BA 3D8BA 4ZVUA 3F67A 3D7SA 3TFOA 2Y1OA 4IHJB 1GPNA 2HTFA 4ZHQF 2AMLA 5JATA 2C3PA 1A69A 1XNJA 1G7TA 4JT4A 4G1BA 1AMNA 3MWEB 4TKZA 2QUIA 1H1TA 1WMBA 3VNVA 2Q2VA 2GA8A 3AI7A 4U7PB 1OXBB 1DQRA 4ZQCB 1W6RA 3JV7A 1GZHB 1UUFA 2C0QA 1QIGA 3EAFA 4G1CA 1EFHA 5A5FA 5BPHA 3P9PA 1IXSB 2YC4C 2W9XA 1KY5A 1JEAA 2YQZA 3AEKA 2OXRA 1RZRA 4FS8A 3U6KA 1Y80A 2JAUA 3Q2IA 4XCXA 3V8MA 4ZJPA 4NJMB 2Z6QA 3HYCA 1GTRA 3EYAA 4LRUA 2BCGY 3UWPA 1AU9A 1CZNA 5BW6B 3ZIUA 4L72A 2DC1A 4EPRA 2VTBA 1Y42X 3PL1A 2E6KA 1XZLA 4H7FA 4NBSA 4UJ3A 4DA8A 3AKEA 5JZVA 3RUFA 3HTXA 4GYYA 4IKOA 1GDDA 1MIOB 3ZZTA 3KUUA 1VI6A 3OE5A 3Q3JB 4WCDA 4X84A 1OI4A 3E9ZA 4JMPA 2MTBA 4I5GA 3WIBA 4KVAA 3AR6A 1FFDA 2O0HA 4JITA 4NJEB 3ETDA 3IUJA 2JEOA 4D3FA 1TZMA 1L4GA 1R50A 3EZGA 1B16A 4ABTA 1U3DA 2VFAA 3PYLA 3FMOB 2NXEA 4OLHA 1QR6A 1G20B 3M70A 1T5BA 1L7VC 4OQZA 1DUIA 4DANA 2FCAA 3DTTA 1IZ0A 1XROA 4XYLA 3SF8A 2N1MA 1Q77A 3CLTD 1MB2A 4P38A 4RHUA 5L6MB 3QH4A 5CLLA 3L7DA 3SGLA 2YYYA 2CEAA 1P3DA 1W75A 3RSFA 5EJ9A 3NJRA 4X24A 4IDDA 5TPZD 4S05A 1NNSA 3AUJB 3DEAA 4LZLA 3A7EA 3MWDB 1ENZA 3DDSA 2IUUA 2IS2A 1AX9A 5ITSA 2W5UA 3PDUA 3WWEA 3PXDA 1TVMA 2X6RA 1UJCA 2PTHA 3G7SA 4UHCA 5DVZA 3B7GA 4RMJA 4XVQA 2RONA 4V0NA 2VA8A 5EUCA 5I8ZA 4ENPA 3FYCA 1XRMA 1I80A 3CLHA 1HZZA 2GCGA 4OIFA 2Z2IA 4O2AF 3U4GA 2EW1A 1NOIA 1UC4B 3TTXA 1BU8A 4DKXA 4WNYA 4ZIRB 1S3IA 1T9BA 1W5EA 2X9LA 5DLYA 3VR4H 3B9QA 5DEIA 3W7AA 3EUAA 5JZMA 1FL9A 4DGQA 1NU8A 4BQNA 1FDUA 3KZXA 4CKZA 2AHOA 4MV6A 3TZEA 1TVCA 3HJBA 4CQLB 5KVSA 3M83A 1OLXA 2BR3A 4L16A 3OQMA 3OQ6A 1EWKA 4KFUA 1YTUA 3HADA 4DA9A 3S1AA 3SNHA 7MDHA 2GEUA 2VYVD 1RXUA 1SOMA 4FR5A 2G5PA 5AK6A 1WF6A 1YHYA 4IX9A 3DMPA 2BBTA 4O0LA 3EHEA 3UJ3X 3GT0A 4U7HA 1TUEA 3CRRA 3BAFA 3KQOA 5DH9A 1GYQA 3S55A 1T24A 2CNWD 3IA7A 3IUPA 4B6QA 3U4QA 4FWIB 1Z29A 1XPOA 4PZDA 4MTCA 3PB3A 2QY9A 3GPLA 3T1NA 1LJLA 3WLOA 1RYMA 2YNMA 4LK2A 4PSAA 1NMYA 1HOXA 4UU8A 1E89A 3D8SA 2DHDA 3OQ1A 3IEXA 3QHQA 5TQVA 3ZWYA 3O4IA 5BQ3A 2HIHA 3IO5A 1D1QA 2HV8A 5A4DA 5EA2A 2AMJA 1WR8A 3E5RA 1YFKA 5FFNA 1X7ZB 3VV2A 1U94A 3E4CA 4YRDA 3ZWPA 3ZD6A 3B89A 4XM1A 4ZT2A 2WU3A 5A1JA 2RHCA 1IOLA 4CDGA 2FA9A 1M8GA 5FL7D 2FPPA 1FB5A 2RH8A 5JALA 5EXDA 1Y6RA 2QTWB 3HUTA 4QATA 3W3AD 3Q10A 3JW8A 3PUHA 1R1DA 1T1IA 1YAJA 2QRQA 4NG5A 4EX6A 3CR7A 1KORA 1MPTA 1U5CA 3TKLA 4TLBA 3RGWS 3VSCA 5A71A 1CETA 3M1YA 2B2CA 3F5MA 4JFAA 4ZQGA 4YMSA 3I5UA 5HBRA 3TLGA 1LLQA 1QG4A 1ZOPA 4IKPA 5JZBA 3VC3A 2XVAA 3PI6A 4RGYA 4RELA 5DM4A 4EPYA 4DDMA 3PEWA 1KZGB 2I7VA 1OR8A 4RK7A 4Y9RA 2WTNA 5DNAA 1XQVA 5BSRA 4KFCA 1W1UA 3E7XA 3PD1A 3K53A 1ZGHA 4YMHA 3PVSA 2W71A 2PGDA 4PG7A 1IHUA 1N33B 2PVPA 3ONVA 4P54A 5FLKA 4RUKA 5CCDA 3ZJTA 4HVCA 3N0VA 3GLGB 2Z5GA 2VUUA 1QBKC 3DZCA 3PGKA 3MA0A 1Z2CA 2H4XA 4MCIA 2J07A 2ZAYA 2Q4BA 3KQMA 5GZ6A 4TMWA 3WRWA 4W5JA 4HDKB 1X87A 3HVHA 3UOAB 3OCUA 1P39A 4AW9A 2O3UA 3C24A 1V43A 2Q99A 5H4HA 5LOVA 3H17A 3MTGA 1XZNA 3AG5A 1A9QA 1D7OA 2KX7A 3S2SA 1JHPA 2X7HA 3D3QA 3IJ5A 3N9IA 3FSGD 4RL4A 3V8EA 2CWDA 3RUPA 2ZYHA 1G17A 3KKOA 4I6EA 2BDEA 1HMYA 4Y2PA 3KLOA 5DSZA 5E3HA 4EB6B 2WK1A 2HSEA 3B12A 3OP4A 1OI2A 4Q00A 2O7RA 1LDBA 4M9ZA 3KKEA 2XI4A 1U90A 5GV8A 5BT9A 3SZ3A 4BAGA 3MWJA 2I8CA 1AUOA 3G85A 4AKHA 5AH0A 1KI8A 1ABFA 5IBPA 3NV7A 3Q98A 5JARA 2I34A 1IQRA 1CDZA 4FONA 5JJIA 1G5TA 3E61A 3WGTA 3EZ9A 2Z4TA 3U4CA 1GQ2A 2DOKA 2V74B 2O8DB 1JT9A 3B3FA 1EI9A 2IOYA 2PO7A 5JD3A 3VR0A 3W3ZB 5T7BA 3D5TA 3DB1A 1ESZA 3A9UA 4OHBA 5C32A 1UMDB 4RULA 3WRVA 1HH4A 2WTAA 4OK5A 4RV4A 5GQSA 5HPYB 1UZMA 3A7DA 4DLSA 3W9SA 2WABA 4JJZA 1GYRA 4LG1A 4BYMA 4EY3A 3V8QA 1BAPA 3W6PA 4MS3A 1DXOA 1ODKA 2FPIB 3T4PA 4MGZR 2R5FA 1HT0A 3FTNA 4H7PA 5JS6A 4ZWNA 2WP0A 3DBOB 4HX5A 3C5WP 3P9NA 1K75A 1DEKA 3HXLA 1LGYA 1K7YA 1P0PA 5JXGA 4DQ0A 2PJRA 1ZGJA 4P4NA 2P2ZA 1JDNA 2GJAA 1SBHA 4ENRA 1P9RA 2XX3A 3R4VA 2ETXA 1VE7A 1EWTA 5IC6A 4BJ6A 1T1EA 3P2IA 2ZJ5A 3QXJA 3JR7A 1C3JA 3LQRA 2A5JA 1ID1A 3RRJA 3NUGA 4PZUA 3WFIA 2WZBA 3FCUB 3W4KA 4EFLA 1ISFA 5KYXB 2G9NA 5ALEA 4DA4A 3UMYA 1ISSA 3WOVA 3RGGA 4BJ5A 3A2MA 3KT8A 2X9NA 3JRXA 5E7JA 1QS0B 5BWOA 1W9HA 4RABA 1RQ7A 3WADA 2B1RA 4J0GA 3W5SA 1CR2A 5JECA 3M1IA 1IAQA 3T15A 2AEEA 3O4GA 3LXUX 4DSAA 3HJFA 2W2OA 2O2EA 4ND8B 1B76A 3JD1A 3RC7A 2JH8A 1JPNA 3RU2A 3A1SA 5CA0F 3FOAA 3HUDA 5DBGA 2LGJA 4Q6BA 4P58A 4Y0NA 5FWYB 2YV2A 1JIQA 2D59A 1PKEA 1YRLA 1C8BA 3RVSA 4DHWA 3G2HA 4ARSA 4JBHA 3DUWA 4D8UA 1M1UA 1P7VA 1CHNA 2WNIA 3HYLA 3SBEA 4IDNA 3H5OA 2A30A 1BIFA 3HKCB 3BGOS 4G97A 5BRNA 4A8HA 1TQ2A 3L43A 1JKFA 2G72A 3UWMA 1QS0A 4GUDA 4LE1A 3OPNA 1M1NB 1IPFA 3CF2A 4NAHA 5BNZA 1L3CA 3ZDCA 3QY9A 3CZPA 5BSWA 1YTLA 2DAPA 2PZAA 1ZM9A 2VT6A 1BD4A 4Z4IA 2XNHA 3A11A 4YP6A 5JYDA 2RIPA 2Z9BA 4NMLA 4O4JA 3TNLA 3VYTB 1VHLA 4LOLA 3U7GA 3LFTA 4QHSA 1D04A 1UJMA 5KSPA 2O2HA 2XZOA 4A7PA 3GFFA 2RKOA 3OLZA 3L4SO 1Y6QA 1JVNA 1KETA 2AA3A 3W7BA 2IV3A 3KKKA 2V3VA 3AHDA 1ISMA 1GZVA 3ANYB 3LT5A 1K7CA 2TYSB 4LBZA 5MHTA 4DVGA 3I1IA 1BQ4A 1OWMA 4FFBB 4NJEA 1JQEA 3KQVA 2D6FA 3WLEA 2RGEA 3WGGA 5FPTA 3AESA 3RBAA 2OV3A 1E6LA 1RYHA 4NBUA 3ACDA 4L3VA 4HAOA 2P1DA 2R62A 5LQMA 3DDHA 5F9HA 1WABA 2V9PA 3VO9A 2I8AA 2E7ZA 5IX8A 1IHPA 1TIPA 3WNQA 4Z4HA 3W2TA 2OXCA 5DYWA 4L5IA 2OVBA 2VJDA 2XVXA 2OGTA 5CVDA 1E4EB 3QJYA 1ZRSA 3HUEA 1K7FB 1PJ8A 5KAMA 1APBA 1RI2A 1YR2A 1ZXXA 2A1TR 3HLYA 4WN9A 3THSA 1M2VA 4XB1A 5FYDA 5IAOA 3RU9A 2QJTA 3ETNA 4RQUA 4F6RB 1W581 5B37A 1PV2A 2RKBA 3AC0A 1IRIA 1CQPA 2X7JA 4FXOA 1DV1A 1SXIA 1U3CA 1YQQA 2Z08A 1S1CA 4MUHA 3WZMA 5LWQA 2IYEA 3HUFA 4DV4B 3WYDA 5CD1A 2JFOA 2J46A 1ZSYA 3I04A 4MYHA 2VTKA 1F2DA 1C2TA 3P96A 4RD1A 3RWBA 4F2PA 2OB2A 2Y27A 3CGGA 8LDHA 4CNQA 2PEYA 5IABA 1IONA 1VYHA 1M10A 2WU4A 5H83A 2F3QA 5THXA 2ZE6A 4N40A 2IPOA 2FTKE 4WINA 2FZVA 4LECA 3THYA 1OXVA 2HDOA 4HBZA 3VNQA 1JILA 1MPXA 3DCIA 2JHFA 2ZYDA 2QMYA 1ONPA 2XVZA 4UPDA 4Y2UA 5EHGA 4D8YA 3VU9B 3VZPA 3ST7A 5I4KA 1BMFD 1NTOA 2QMQA 2IYNA 1VZ2A 4PM4A 1Z6QA 5B6IA 4V0OA 1VE6A 4AZWA 1I4EB 1DUVG 3PHCA 2AB0A 2CNKA 1VYUA 5CFOA 2Z6VA 1NQUA 4GLOA 4OA8A 2WKWA 4NEHB 4OOFA 4DR4B 2BBWA 1OXXK 1XZEA 3EGOA 3E6AA 2BM0A 5COQA 3A9VA 3CX8A 4ENSA 5M2QA 3PP8A 5HYVA 4MR9B 1PZEA 1UZUA 4ZEWA 3VISA 1K66A 3W3AA 1P1RA 4I5EA 2V9ZA 4ZU1X 2H9IA 2ZRAA 5D5PA 3D7NA 1X1CA 2BFOA 3KSMA 2ZRIA 4L57A 2EERA 3IL2A 3RYCB 3OC0A 1JIJA 3PJGA 4PO8A 4G1UC 3T7RA 4Y0VA 4EMBA 2CJWA 3FPLA 2ZYWX 5J1TB 3CX6A 3U60B 2YZKA 1DPGA 4G0WA 3KVRA 4H3SA 1JXOA 4KYUA 4TLEA 1VB5A 1MJHA 2Q6KA 3TB4A 4AJNA 4BMDA 2ZIXB 1U11A 2EX4A 2LCFA 1KEUA 1W0KD 2BF7A 3OE7D 3WK7A 1I6KA 4WBXC 2SKEA 4JN6B 4GC9A 1YWGO 1A04A 2VHTA 1M5UA 2DG2A 1MAWA 4BVHA 5BWCA 1ZPDA 1WW2A 1SCBA 1L7AA 4Z7OB 1OLSA 4FCCA 1X9GA 1VDMA 1TPYA 3FR7A 3JYPA 1DCMA 3GJZA 4BKUA 2FG7C 2M6RA 2Q49A 5JD4A 3IPCA 1XTKA 3GGCA 4HJXA 5LXTF 3UXHA 3I5YA 4ZKEA 3PJEA 3W8RA 3IP3A 4WMLA 3FY4A 1E5DA 3FNHA 1MH1A 1O94A 4BO0A 1MDBA 4QXRA 1Y5NA 2OCDA 5H70A 5C46F 2C7PA 2AOUB 4HNQA 3I8XA 2BHNA 2XADA 3BXFA 1TYDE 2IFTA 1QE0A 1QCDA 2FMXA 2DM6A 2YJ6A 2YJNA 4D26A 1QO0D 4QRDA 3LZ6A 5KREA 4IHJF 3L7OA 2CLLB 1OIVA 3G0OA 3A3KA 5TRTA 2XUIA 3USES 3Q8LA 4H6VA 3UH1A 3VZBA 4ZO8A 3FROA 4G67A 1GFZA 4DY4A 3OZAA 4JB8A 1MO3A 4TMZA 5B1DA 1WETA 2RHWA 2HWKA 2AQKA 2PR7A 3OKFA 5HRUA 3JYLA 3BICA 3W2GA 4XM2A 3ZXIA 4JT2A 1Z62A 1KMMA 2XB4A 4TS1A 4XEUA 2D0DA 1ZCFA 1JEDA 4D8XA 1Y33E 3D6TB 4PSDA 2ZE8A 1QVZA 2ZG6A 3VV3A 3R0IA 3H2IA 4EK9A 4V1CA 4JEIA 5EKSA 5DCYA 1NVDA 4OGKA 2JD0A 5BURA 2HAEA 1ZJZA 2OGWA 4B9EA 4MCJA 4PCVA 4WCFC 5CP8A 1PSDA 2HX1A 4RC9A 4OAQA 4M55A 3M5PA 3QEMA 5LIRA 4K6FA 3PS9A 5HKKD 3IPAA 3OJCA 2PD6A 4KAAA 1ECBA 4QBTA 4FDLA 1C1DB 4RPLA 3FRHA 2A94A 1S2DA 3SBOA 3HCNA 1JHZA 3M9XA 1N2OA 1CP2A 5DRYA 2II6A 3KR9A 2EL7A 2XBLA 3O2SB 4E5VA 4PBSA 4UZFA 1KOJA 4DDVA 1Q92A 2NNLD 4KMSA 2I6UA 1TEXA 3FWNA 5DTMA 5A5EA 1MH9A 4U8GA 4RHXA 3HV2A 1KEPA 3PIIA 1BDBA 1WXFA 2OA0A 1IQUA 2R2GA 4DCMA 3INTA 4Y1RA 1YFLA 1O77A 4JD5A 5GMOA 4B3FX 1SXJC 4LTMA 5JMWA 1J2JA 1T10A 1YIDA 1HQDA 2VP3A 2Q8NA 3BH7A 3MNFA 5EIOA 5IM5A 4B3JA 1PGOA 5LJIA 3OEWA 4MAAA 1XNGA 5IBCA 1OY1A 1G2PA 2G25A 4M7PA 3W9YA 3KPJA 4DV2B 2CYCA 5I9MA 4FHGA 5FNVF 5I7AA 3MS2A 3VJMA 3PIDA 1NN3A 2QPTA 3AEUA 3AKZA 2VXBA 1U8UA 1CY0A 1MO2A 2UYOA 3D7LA 3I6IA 3L6RA 4M2LA 5HE9A 1NV8A 3PKIA 3C3AA 4GLLA 4UD2A 1SUIA 2MSDB 3KLPX 5CNKA 1OWNA 1JBQA 5E6RA 2V7PA 4EHDA 5BUSA 2AMVA 2G0TA 3E03A 2KW5A 1BRTA 4YJ2B 5KC8A 3AQIA 4AZ3B 3SMVA 3DTYA 1NLMA 4RY2A 5ESXA 5C4MA 4K05A 3ZGYA 2EJCA 1T1GA 2HA6A 2VPYA 2VPPA 3A8TA 3HDJA 3RK4A 2FMIA 4DLNA 5ICMA 4F4HA 5LFAA 4MI9A 5AI8A 4A73A 4AWAA 2EQBA 3K0EA 3ED5A 3G5AA 3IQEA 3O03A 3PD0A 4RHYA 2EFGA 4BTEA 3SQMA 4A8JB 2GI4A 3U4QB 4B47A 3MJVA 3GUHA 4YGXB 3OFKA 4F86A 4Z1MD 3RLFA 4NNJA 4JGIA 1IZ7A 3K6JA 5DW0A 3H0CA 1ZKDA 4JGBA 4W1PA 4BPBA 4CLHA 4EKGA 2DQ4A 5BP7A 1QB8A 1U28C 3BT7A 3U3OA 1MORA 3MYYA 3VPXA 4TMKA 2H7YA 1TUGA 2AR7A 1BS2A 3VVCA 4JJEA 4RFSA 4QUEA 1J2YA 2VWGA 4PX5A 3UKDA 5CB6A 4LMRA 2CXQA 5IAGA 3MUEA 4M9XA 4MMYB 4UNIA 1HI9A 3DMFA 1OAKA 2ZIZA 3O74A 4M8SA 3ZIAD 5EEHA 1T6YA 4GZLA 3S44A 1LSSA 1JT2A 1HFKA 3RYIA 3ZYCA 3SIWA 3PR2B 2PMDA 1EBBA 4Q3AA 3QGMA 4X91A 2CXOA 2Q8QA 2WMDA 2B2XA 2X9VA 3B51X 3OKPA 3Q4GA 3QIAA 4JT8A 4K40A 3ZK8A 4EY7A 3L18A 4FGUA 4FOPA 2IF2A 4RZIA 5D85A 4AJJA 4QD3A 1M2OA 2Y1WA 3AVUA 5LQUA 1HRKA 3ELWA 3HY6A 2JFWA 2V98A 4G0QA 4URUR 2DH6A 1X8XA 4XWYA 3RS9A 2P4SA 4CU2A 4W1QA 3MTEA 4H15A 3T5PA 3FUUA 5FL3A 1BXKA 3CMCO 3C6MA 1U0RA 2JFYA 4QXOA 1P29A 3RUEA 5IS2A 3SR4A 1YQ9A 1G9TA 1ZOSA 4WJKB 4AVYA 4BMVA 2JIDA 4W8OA 2QG9A 4U5QA 3BIXA 1EQUA 3DL7A 2VPQA 2CXXA 2QN3A 2VNIA 3U13A 3EPKA 3IP5A 3K09A 1MDFA 3LH5A 3U61B 2WD7B 4RHEA 3AEXA 2PSEA 3FOBA 1JA0A 1MC4A 3MZ0A 5HF9A 3RBXA 3HKBA 2QGZA 3T9AA 4EY5A 2FZGA 2P30A 1YVUA 2INGX 3OCCA 4B76A 4DLWA 3DDUA 1SVSA 5JO9A 1X1TA 3UGKA 2ZYTX 3FFTA 3V42A 1VYVA 1DC5A 2PZKA 5TS2A 3SI7A 1LF0A 2HLHA 2FDRA 3M6FA 4MUBA 1SKMA 5G0UA 1WUTA 3AVOA 1A4UA 1XD2A 2CFIA 1A71A 1XKLA 1E62A 1FSFA 1V96A 2NN3C 3WMGA 4RSHA 2CNNA 3AF2A 2CFSA 3LQFA 4UQPA 3ZDXB 1WBBA 2JZOA 4WI1A 2CXHA 5DZSA 3NIGB 1ZLXA 1O58A 2YQ4A 1TOAA 4X6UA 1YXMA 3ILYA 1W2GA 2XA2A 2LW7A 3I2HA 4RM3A 1CJTC 1QK4A 1JXQA 3FFBA 2DHRA 3LU1A 4EHHA 1QMPA 4HLNA 2YIDA 1WXIA 1DC8A 5A9SA 3PRHA 2VYVA 3UUWA 1MTZA 4UHJA 5A2QA 3B53X 1C3EA 2ZANA 3I9FA 2AYZA 1V26A 3CNBA 3ID6C 5C53B 1S2NA 1ZJ4A 3VBEA 4DLKA 4UEKA 2A1IA 3UMMA 3INNA 2X0EA 1J7KA 3RABA 2IU0A 4I5FA 1DC7A 4OYLA 4PZCA 2Y2VA 1RT9A 5TEWA 4OXIA 2HPZA 2PCLA 4YAEA 1NLFA 3ONEA 3OQHA 2YVAA 4INZA 4B3XA 2YDXA 2CXPA 3ZHRA 4RBNA 3KIPA 3ZY5A 5K51A 5ECYA 2QL6A 2ZJ4A 3OWOA 1IPEA 2CE2X 4MW1A 2W43A 1Y1LA 1EP9A 3M6XA 3MWFA 3RHSA 2VQDA 2GB4A 5BY2A 3IIEA 3BZBA 3IUNA 5DTEA 1LNQA 3U49A 3LOPA 3UCFA 5L7YA 1TMYA 2YV3A 3A28A 4FDTA 5JPIA 4RJTA 1CJKC 4V24A 2GN4A 5NULA 1CHDA 1YR6A 3N6RA 3G9UA 3CVUA 1UOQA 5K4HA 1KQPA 2W8ZA 2ZYGA 2Z8YM 4MJ7A 4LFBB 3PX2A 3BVPA 4XB6B 4QGHA 1T34A 2HYDA 3L6UA 4MWOA 5AJHA 5TQ0B 3WMXA 3FDJA 2LCIA 2Z6AA 3O1JC 1HORA 1JXMA 4IRUB 1F60A 5EUQB 3OM1A 1KYWA 4YRZA 1R27A 2W6JA 3HMKA 4IO0A 4IIBA 3RASA 4PGMA 1U9YA 5EXEA 3DFZA 5IUKC 3WL3A 2IVFA 1OBVA 4F4FA 1G38A 2HZ7A 3C3EA 1MO4A 1PIWA 1L7PA 3G9ZA 2VOEA 4QXAA 3MTAA 3LUHA 2PZ8A 4Q5IA 3VGJA 5JYBA 2PZBA 1PJAA 4FD3A 1DOHA 5TMEA 1L9KA 3VPAA 1UZNA 2G4LA 4QYSA 3RRNA 5DASA 2ON6A 4CLOB 3L9XA 1UCFA 1HTWA 3GGPA 1OFVA 2IPAB 1MJ5A 1IY9A 1RM5A 4Z4EA 3AEYA 4ADSG 2VKTA 3E58A 3N2KB 1THZA 1TFUA 2ACVA 4ZO7A 2XGJA 2BEWA 4ZCMA 2PX3A 2X40A 1Z4QA 6ABPA 2P2SA 1YZGA 3NHZA 3EGIA 1YRQA 2W0SA 1GVHA 2JIBA 3LP8A 4M76B 1NHGA 1VPLA 2MMCA 1ULAA 1CR0A 3LVBA 2QZ9A 3DYBA 1ND5A 1YJAA 2H1WA 3EDCA 4AP9A 4BV3A 5IU6A 3T1OA 5L4NA 1DC3A 1RVV1 2QM7A 3V5NA 1J56A 1BX1A 4L5CA 1CUDA 2ZB8A 3WJ7A 2AFHE 2ZAMA 1OREA 1DFIA 2PWZA 2EJVA 3N2ZB 2R4TA 5DISB 3D1JA 1KAQA 4KQIA 5H7XA 2C2XA 4FNOA 3L4BA 4AJLA 1SXPA 2WJGA 4Z4GA 4JBGA 1YRWA 4LK3A 3R0VA 5AICA 3MUFA 1SULA 1OTXA 2NSLA 3D1VA 2VH2A 1E5QA 1KY2A 4FOTA 4JENA 5ESRA 5CXUA 5LVAA 4N1AA 3CNHA 5ELLA 3ZQKA 3PYXA 3I6MA 4OHCA 1R5JA 5JNVA 1N8KA 4TUYA 3N5CA 1CLEA 3KQSA 2PUBA 1P7PA 1VA5A 5TARA 3R9KA 2ORIA 4AYXA 4EI7A 2HBQA 4YREA 2X15A 2ZKLA 1NG9A 3TLCA 2NV2B 3AUUA 3IJEB 3KPWA 4HPXB 5CURA 4MUAA 2PXHA 5ULLA 1HTBA 4HB3A 1Z2DA 1KJQA 4RMIA 4WLNA 1WB6A 3G8YA 1XTTA 2GFQA 1WHTA 1X2EA 3CZ5A 3SIRA 3TQQA 3U3KA 4G5FA 5L8VA 2FZ5A 1HNXB 3K6RA 2Z8XA 1NJGA 3H2ZA 3N8KA 1MN6A 1M2VB 1LB1B 1YF3A 2FWNA 4CCAA 3BAZA 2NV0A 2WHQA 2Q1XA 3LF1A 2AI3A 3KAKA 4TV8B 2CLEB 5ELMA 3RRXA 3VPDA 2I65A 2R9VA 2RJNA 2RHHA 5D51S 3VR5H 3V8NA 4F6RA 4KPEC 1K3UB 2BONA 2PL1A 1UBNA 3OSZA 4JJKA 2AXQA 4NU6A 3DAGA 3ELDA 3T8YA 4EF4A 4XRGA 4NK5A 1ENPA 4D9BA 5C5DA 4G36A 5BYBA 1WXXA 1RKUA 2AX4A 4BNUA 2CT8A 1AH2A 2LXNA 5AJZA 4I9NA 1VGRA 1ZNZA 2E89A 1KDPA 1GNRA 2QRLA 4KHZA 4N49A 2UU9B 1G21E 4YJDA 3WMEA 4UUMA 3KZKA 4OU4A 5TIIA 2WIGA 1Z56C 2YXBA 4FN5A 2O3QA 3H2HA 1JPJA 3DTVA 3HL0A 4Y3UA 1CQJB 1HPLA 5IAEA 3GNQA 3RYHA 5I7WA 1F0PA 4C89A 1CS4C 2QAGB 4CEIB 3KSBC 4WLFA 3PL5A 1G5RA 4KVFA 5EPUA 4BQQA 3RYCA 4K2AA 1CZHA 2NZVG 3QU9A 5IJ9B 1KEEB 1MJGM 2IHJA 1TTPB 3LI2A 2HHLA 4PHTA 2ZJ2A 3IP1A 2W58A 1RC0A 5SYMA 4KX5A 1PJRA 3LHSA 1PWYE 1KFKB 4KPUA 1G55A 2C9OA 2A1TS 4OIMA 4OHXA 2VHQA 1DHRA 4AF8A 5KMGB 2J9FA 3KKPA 3HFRA 3PJDA 3P2EA 1PNVA 4R01A 4Y0AA 5H5JA 4KR7A 1SQ0A 3VJKA 1M34A 3QUBA 1SCUA 4A3SA 1JIVA 2D5AA 4HLUC 2FLVA 3U1TA 4H1VA 2PRIA 3FYUA 1T91A 3SEQA 2XKAA 1PR0A 1VYTA 3HCOA 2Q1WA 1S8AA 3C41J 4UHDA 3RV4A 2QU8A 4OMCA 1AD2A 4PYNA 3PPVA 2P6RA 3WV4A 2PUTA 3UXYA 6CHYA 2CJFA 1GQFA 3FVVA 4JVLA 4FWBA 4XX0A 1FLVA 1B26A 3EEFA 1RQPA 3CY6A 4FCTA 2G71A 3KJZA 4J0JA 4N5IX 5EHIA 4ND6A 2CZCA 1G20A 1TAGA 1Y3DE 3HEMA 3O9VA 1FDSA 4EHFA 5K9ZA 4AG5A 1KR2A 4BVBA 1G3RA 2WM9B 4XFJA 5CNIA 1PUJA 2XRFA 2A5YB 5IYZB 1HURA 2NTNA 4C01A 3V33A 1RLUA 1YC2A 3NFYA 3ZU4A 1CNFA 2VHWA 1RAHA 3CS3A 5GJVC 4DJDC 2W8BA 5MDHA 3BMOA 2ZUCA 2FRXA 2UAGA 5C8VA 1YK1A 4MIEA 3B5JA 3M3HA 3RC1A 3PE4A 1DSSG 4D46A 3KQLA 3BD9A 3N7TA 5AHOA 2C8KA 2I76A 4HXYA 2GFHA 2YN4A 2DX7A 2PL9A 1V71A 3NTVA 4IKEA 2ORYA 2PZGA 3AIMA 4MVJM 4QFCA 3ZW8A 3QVKA 4EL5A 4YUWA 5BORA 5LN1A 1KP2A 3OHMA 1DWOA 4RPCA 4YCMA 1DQSA 2ODPA 5FBWB 1I2CA 3T5GA 5TMPA 4B1FA 1G5PA 5CDUA 4EZIA 3PEYA 5JD6A 1R4MB 2QTNA 2ZUTA 3TLMA 1DRUA 3H9BA 1GKYA 5AVKA 2EL9A 1ONOA 2PKXA 3GHYA 2IHBA 4KWIA 4R81A 5F7ZA 4D96A 3HDHA 1E0DA 4OKSA 1SVIA 3OPQA 4FGLA 2QM3A 4Q1EA 3S5JA 1BN6A 2BMDA 1KP9A 4NICA 1VBMA 4OBEA 2D1QA 5AKIA 3RW9A 5KWJA 4HQLA 1R12A 2HYIC 4YEDA 5TPWA 3DTVB 4OMUA 5AO9A 4A0GA 5F1PA 1TIKA 3K0FA 2YXDA 2Q27A 3EC1A 4NIMA 2FX5A 2JIPA 4N41A 3ZZUA 3HBAA 1PQYA 3X1KA 1GL7A 4LIPD 2H5EA 5E7MA 5ALSA 4IIJF 5JD5A 3I6BA 3ADPA 3EXFA 3MMPA 1YDWA 4KB5A 1HNZB 4M9UA 4WZAB 5DOZA 1PZHA 4KH1A 1T8UA 1VG8A 3QNWA 5E8RA 5BO5A 2BKVA 3ZXYA 5JH7A 1QRSA 3SKYA 1GN9A 1P2UA 1E1QA 4NZYA 2VBIA 3MTIA 5FI0B 3QVOA 3KG2A 1FQOA 3LCUA 4PZEA 1KOGA 2WM2A 3ER6A 4NXMB 1E6CA 3PWTA 1CVLA 4H7IA 1H5NA 1U1FA 3DBIA 2ZSEA 2VHVA 3D0OA 3HU3A 4LJ4A 3L0ZA 1UPXA 5DE3A 3C6KA 2GBFA 1QBGA 1A4IA 4QX6A 2KJQA 5EJIA 1QONA 4K9DA 2EGHA 5B3LA 1ADGA 4KNWA 1DKQA 3WKBA 4A03A 2K87A 4RXUA 2VKQA 5L4SA 5C34B 5DGHA 1RWVA 2EP5A 4HP8A 4C05A 4DEXA 4RCYA 2GBIA 3IBSA 1YS7A 4FX5A 3VUFA 1AQJA 1BA3A 4BDSA 5AM4A 1YKGA 1FJGB 4JHLA 2GHRA 1ODTC 2AJDA 3U9LA 5EESA 2E9SA 1M2GA 1PJQA 3BXXA 3FI0A 5CEJA 1OA1A 4H6XA 2DB3A 3WYNA 5AKEA 4R4JA 3TGWA 3LK7A 5E9WA 1VKZA 3T5TA 2JCXA 1KA9H 5BNIA 4IDBA 2IYOA 2WUGA 4RIGA 4H1UA 1O96A 1GKKA 2ZK7A 1MABB 3A9SA 2O7VA 2XMPA 3N2IA 3HU1A 4O8ZA 4GS5A 4O4HA 3TN7A 3W34A 4EGCB 1VG0B 4UM9B 3IP7A 4RGBA 4UOQA 4EY4A 4D0SA 2J3HA 4P08A 1ZHHA 4MLDA 3L04A 1MX1A 1XCPA 1J2EA 4CIWA 2YJ5A 1B1AA 2OYRA 3TBKA 4ARBA 5K5EA 2GGSA 5JCJD 2H2DA 4RKYA 2MYTA 1UPBA 3HLKA 3MLBA 1E20A 3ML1A 1LDEA 3ZEAA 2GD0A 2TSYB 1S9HA 3UKOA 3R9XB 4QDTA 2XAAA 1HYEA 3TSAA 2AVNA 4HQ0A 2H2AA 1S02A 2UVQA 2O2GA 4B3IA 2WQ6A 3JARB 3F8WA 5CVJA 4E14A 3E22A 2YXNA 3DB2A 1H0SA 1S4MA 1QCZA 3O1HB 4TWJA 3UG7A 1P80A 2VSNA 1VJ5A 4HWPA 3PC3A 4NEGA 5JXIA 3RVJA 3DGFC 1KGSA 3R7AA 3DE7X 2WUWE 3QQPA 4FGWA 4MVJI 2O0JA 4ZMBA 2PUFA 5I8WA 1IOWA 2ENUA 2HADA 3SR0A 5H82A 5LLSA 3RS8A 4DQDA 5JMOA 2H0QA 1N7JA 3RAFC 1V5EA 4GI3A 5K8VA 1O95D 1TCAA 5F4BA 2JIQA 3SXUA 3GL9A 4KTTE 3ZOKA 3EBLA 3CIOA 3UC5A 1O6BA 3KTAA 3I9NA 3SIXA 4MINA 4EJ2A 1JSZA 2PKRA 1Q3KA 2YWRA 2NV6A 3DW1X 4GE0A 3B8EA 3A6HA 4OHUA 2ZIAA 2AD5A 3QUSA 4QFMA 4B75A 1C3XA 3U56A 1O0BA 3GFSA 5FAXA 2YRFA 1DCTA 2NAFA 3QKIA 5I01A 5AKKA 3CE6A 1NN0A 4X6XA 1JR3E 2QTGA 2Q4TA 1NVKA 4IEEA 5D8DA 3CW2A 1TO1E 4V38A 4CODB 1L4MA 4JK3A 3LOUA 3P4YA 4B3RB 3DONA 4OBBA 2WRZA 3KSUA 4YHBA 4BFUA 3CVJA 3GARA 1RRPA 1VTKA 4URWR 2OOKA 3E23A 3P9IA 2HK6A 1NUTA 1U3WA 2BP7B 1NSYA 4C7XA 4JI2B 3CX7A 3BL5A 4D97A 1ESNA 1IEWA 1I9CA 1JF8A 1SH7A 2BSAA 2C5FA 4KYVA 4MUFA 1WJGA 2EWWA 3OAAD 4ZXFA 1E2LA 1F20A 1P31A 2GZ2A 1VKNA 5DM0A 1RI4A 1LTHR 2VJOA 4Y2XA 3A58B 4QTXA 2WFLB 3RRBA 4PRZA 2FFQA 4ARZB 3KUXA 2JGIA 2WPDD 2M32A 3QXGA 1JJFA 2J0UB 3ZHUA 4ZAZA 3IUMA 1M6YA 4IWYA 1T1JA 3PHLA 2BFAA 3LZCA 3ZZ0A 4MWZA 3TINA 4L2IA 2O8CA 1IBMB 2YYAA 2WBLC 1AURA 4LMBA 3LGXA 3NNSA 4MWTA 2A4MA 4LF6B 3NYIA 4PE5B 1IMOA 1Y1PA 2QJFA 1CJMA 4UMDA 1VDZA 5J40A 1AM4D 5FX2A 1HNWB 5EFZA 3F9IA 1A9XA 4TV8A 1KPIA 3QPVA 5IF9A 4YVFA 4V1CI 2H1OA 3IA2A 1V3VA 2Z6UA 2HWXA 4HLUA 3AZOA 3RKSA 1EBFA 3T4UA 1Z4IA 3UMSA 5B5SA 4JLJA 5E9AA 1S2LA 3NBKA 3QMMA 1GD1O 1U8CB 4OB8A 2XGSA 3PK0A 4R8KA 4BUJA 1NXPA 4DLYA 2H48A 3DTNA 1Y6FA 2RAUA 2I4NA 3KZCA 2D74A 2FG5A 3Q5EA 4W9NC 4E94A 3QTLA 3MWLA 4FJ2A 1UK6A 2HCFA 3OE1A 2NO5A 4O33A 3L7AA 4B3TB 1NNEA 4ZOLF 2FFRA 3STYA 1FOEB 2JGKA 2JFPA 2WTBA 1F4PA 3OMWA 1Q0PA 4KKXB 4K6HA 3QITA 1KNXA 3PFHA 3PQFA 3O8QB 4US1R 1G16A 3TVDA 2ENWA 4E88A 2PL3A 2X14A 4HAXA 4LOKA 1TD9A 4BN5A 1TEZA 3ACBA 1BFDA 5KYWA 5TDHA 1HK7A 3SXPA 5JIBA 2HK9A 1RXVA 3DE2X 3H87A 3L7LA 5EKXA 3TDNA 1M0EA 3VKHA 2XH8A 1LVHA 3A2NA 3CUEF 4HDNB 5DP1A 4CTNA 2HR1A 3FPSA 3ICEA 3WDKA 3GN2A 1YBMA 2QX8A 2IPXA 4OM7A 1BS9A 5L3SA 3RF6A 1QHIA 2GEDA 4YFVA 2AN5A 1S7CA 1IY2A 4DARA 3OCJA 2XDQB 2YY7A 4YMIA 3Q9LA 2PSDA 3U0BA 4UNRA 2JFGA 2GN2A 1UXGA 1QG6A 2G67A 1Z6TA 5E7IA 1TPZA 1Z2EA 3HYNA 5TF0A 2ZBRA 2OQ2A 3V2GA 1FNMA 2OZLA 4IL5A 1I7NA 3OZTA 1I4OA 2IDKA 2X3FA 3FDZA 5EE1A 1I6WA 1N1MA 5EERA 2HUPA 2J6BA 2CLDX 1JWLA 1DKUA 5CT6A 4DZZA 3H11A 5ADVA 4GLJA 5CLHA 3KJGA 1SC9A 4WHMA 1PFWA 5DHSA 4LJSA 1O7JA 2P67A 1MOQA 4L9WA 4G5GA 4QQKA 2OFXA 1T2NA 4TKVB 4DG8A 3E48A 3MGBA 2KSQA 1QZZA 5TMDA 4IGKA 4B6GA 4AKIA 4ZARA 4ARIA 4D9JA 3RWMB 4DIUA 4JBNA 3CLRC 4G0PA 1LX7A 4BB9A 1H4QA 2C42A 2NUAB 5CD9A 1T3LA 3VDQA 3I52A 4IWNA 4L5BA 1R0YA 3EK2A 1AHHA 1ZCZA 4F97A 1XLTC 4C4OA 1TRHA 1J1UA 5EMKA 4G09A 2VJCA 4A6XA 2O05A 5IW8A 1OX4B 5LU8A 1JHMA 4UTNA 2OKCA 3S68A 1Y8QA 3OEHA 4AF6A 4BE9A 4HK4A 4ILKA 1SB9A 3PDJA 4JJ4A 4YRBA 1T2UA 1RZRD 5FFMA 5LP6B 2AC4A 4MA5A 1PS0A 3VZSA 2XRZA 2G04A 1HDOA 2PXXA 3IUQA 4DJAA 4BUZA 2RGNC 4CUKA 2JJMA 3ILVA 5DX8A 4DILA 5B64A 4TMVA 4CR7A 1TJYA 2Y0PA 4HQOA 1M2KA 1GARA 2V54A 4H7EA 4CNBA 2QI9C 1NQ5A 2JGDB 3CB4A 2AK3A 3ESZA 3MOIA 4QARA 4XIJA 2GAFA 3WIOA 4KITB 1YE5A 3HJGA 4ZAXA 4XI9A 3HVJA 4IM7A 4QJBA 1I2AA 5G0WA 3GY0A 2CSUA 3D4BA 3JVVA 4ZCQA 3OX4A 2G82A 2X7XA 5BVGA 4ZDWA 1XALA 1YCDA 1XU7A 4ZAFA 3TEJA 1J0AA 5FORA 4JU9A 3B3GA 2E85A 2WR8A 2PZLA 4EUEA 5FWXB 3FPJA 4RJLA 1G8AA 1X1EA 1J24A 2P9BA 3WSTA 5LU9A 3TNFA 1BFKA 1K2WA 1WPXA 4S1TA 5HF6A 1GFSA 3S8EA 3AINA 5T67A 1D1SA 1JQDA 4DBVO 1HTTA 2GPNA 4ETMA 5H8WA 3ZJVA 1QCCA 2OTCA 1ZR4A 3M3DA 3ORSA 3BE8A 3DEHA 3LUFA 3R7LA 3DEIA 5HOEA 4NYJR 1WMFA 3EXIB 3C7TA 4N82A 3B9RA 4UW9A 4E33A 3C7KA 2O2JA 3NH6A 1IIBA 1II9A 2MINA 2SECE 3EUFA 3NQ41 4JQZA 1XQXA 1UPFA 3LLUA 4KN8A 2XNJA 2DFTA 3U7HB 4LRSB 2GS9A 1U8ZA 4EKDA 1E8MA 1EP2B 1TJ4A 2QX9A 1ODJA 2WU8A 1FBNA 1ULUA 2F55A 4DRZA 3MJTA 4Q3KA 4TKMA 1CDDA 1FFAA 2POQX 1SR8A 3JAWB 3KOYA 1M34E 1DG9A 1MT3A 2XYQA 3NOOA 1F2UB 2D7JA 3DFMA 3KB6A 3SM3A 1F0KA 2QYHA 4BV9A 2BI8A 1ZM7A 4KW7A 5K1ZA 3SLGA 2DU8A 4I2NA 4RF4A 2NXJA 4RJ2A 4V1CB 3AF6A 3T7EA 1HDXA 4FFSA 3TAXA 4EW3A 2ZSHA 1FP2A 2OZKA 3H11B 3OF3A 3R41A 4NH0A 2E1PA 4R1QA 1UPUA 2GAIA 4MYUA 3N7UA 2NUTA 2BP7A 2JJ1D 3GXOA 1RP1A 4YV7A 4GRIA 4YY3B 2QAGA 5J4YA 3RS7A 4H1WA 3UMFA 4CEIA 1VSBA 5BN3B 1IG3A 2ZUBA 2REQB 3WYAA 2QB5A 2IH5A 1T5OA 1NYLA 1RBMA 4GU5A 3B2NA 1E1RD 3KBBA 3V1LA 3J80A 4I8IA 1WX1A 4MQ6A 3IJRA 1TE2A 4U5XA 4PN7A 4AICA 5DW3A 1HQCA 1D2NA 1M67A 1N9ZA 3H3JA 1U2SA 2CXNA 2A58A 3QKTA 7ABPA 2WSSD 3AX6A 4ZTUB 2O7NA 4MVJP 3CNNA 1RQNA 3EA4A 5FPQA 3KJQA 1MVOA 4B46A 4BU0A 2UYGA 4FZVA 1V16A 3QTBA 3EH2A 3HBMA 3SHWA 3V1KA 3NHLA 2BBSA 3KC2A 5B2EA 1DEHA 5KCZA 2JLXA 4TWBA 1T2EA 2ZS8A 2QD2A 3Q3CA 2GD2A 3TQHA 1RMQA 3QMVA 1UWLA 4MWEA 4FTWA 3M5WA 4BQSA 1XHFA 2FZLA 4UTOA 1DV2A 3RS2A 2IC5A 2XR1A 4IHAA 5CR9A 4CIXA 4Z2AA 2PLFA 3MJDA 4ZOCA 1ONNA 5AUNB 2FK8A 2V5VA 4ZODA 1ZIOA 4BX9A 1PJ2A 1TZKA 3EDRA 3G5MA 4Q9KA 4EY8A 2BRUC 1XF9A 2Z1NA 4HB4A 4BNHA 4AFNA 2C8LA 3AU9A 1BX0A 3QLUA 4K6OA 1QDEA 2VPZA 1RPTA 3ADKA 3G89A 5K3SA 3CUWA 4CCYA 2YWGA 1GCGA 1OZAA 1P0QA 1P2GA 2OD7A 2IEAA 2QP3A 2Q9CA 1IY8A 3I6QA 1P1HA 1XCGB 3KJIA 1ML4A 4I9FA 4JA2A 3U31A 6AT1A 2XXAB 1NONA 1QKIA 2VT7A 1J0BA 5C18A 2BKEA 3LKZA 3MRSA 4X1IB 5EIXA 2YMQA 5FOQA 3IPRA 3D7KA 2XE4A 1OE0A 4ALKA 5TMBA 5CITA 1E1CB 3RWOA 5ICSA 3UC9A 4OGWA 3B6KA 5T57A 3KAQA 5EOVA 5HIKA 3QEMB 5A4FS 5KX5B 5KI6A 4S1OA 4IUDS 1YZTA 1S0UA 3MHTA 4L22A 1A1VA 1VKRA 2ST1A 1T4BA 1VPDA 1Z4LA 2Y1GA 2FEOA 3QLVC 2JHGA 4BFLA 3EAGA 1W30A 2Z09A 4MS4A 1XZMA 3DE6X 3WL6A 1FCJA 3WVNA 3EZXA 5KTPA 1K5HA 3WWDA 4PCLA 4TZ0A 5BW5A 1BMFA 1KPGA 4G37A 1Q74A 1QYXA 2R6JA 5DHQA 1MQ9A 3H5LA 2RDMA 3HDGA 1P4RA 3RYHB 1NW8A 1JFFB 1HFEL 3P9QA 1YNSA 4JLVA 2EIHA 4JLBA 4X63A 3RNLA 4BX3A 1CCWA 4QJ3A 4HN2A 2QNRA 5AHXA 2D0PB 1CJBA 1YCHA 2VHCA 4CR8A 5IPFA 1VL6A 4DXHA 3TLGB 4F4JA 3P5BA 4ZZ3A 1V48A 5EEGA 4M0FA 4DQKA 1XNQB 2GRUA 5ARCA 4MITA 5F2NA 3E9EA 4U7JA 1WP9A 1ATIA 5ALHA 1ZVKA 3LLCA 3V4VB 3AV0B 3ICOA 2XMDA 4RLHA 4ESOA 4PXAA 3HBLA 1GTL1 4A5SA 4JUCA 2WTEA 3IGFA 3G6KA 3VOSA 1PP4A 4NAUA 4HGRA 1P9WA 2ZRLA 2C99A 3H9EO 5EWLB 4U00A 4ZYYA 1XJ0A 4X66B 4JL8A 1Z0UA 3O3OB 3I39X 1P60A 2EF0A 1KH1A 2J3IA 4JIGA 4Y6QA 2H4WA 3LQQA 4DDHA 1AS0A 4WERA 4CV3A 3R4CA 4FE3A 1KYIA 4KEAA 4WTOA 5K01A 3J81k 3FNEA 6ADHA 4WA8A 3KJEA 3VVBA 1JALA 4WXEA 4CDMA 1XXHE 2NWQA 2OHHA 2RBGA 4INJA 3UHOA 5LDDC 1GNPA 3JARA 4N5DA 2DE0X 4ZEOA 2VF2A 3ZH9B 1ODIA 3T5AA 3SG0A 1M3SA 3SDSA 5JCZA 2XUDA 5P21A 4MGIR 1BHQ1 4J4TA 4MRPA 2GEFA 5KEIA 1Z06A 2IIQA 1RJ9A 3C4JA 3W6UA 1ESCA 2G9ZA 5KYUB 4IWXA 2FN4A 3GVXA 4FIZA 3P27A 1PEKE 1ZH8A 2OAQ1 4V3BA 1GQOA 4PNEA 5KTRA 3HXMA 4G23A 3AFOA 2F4VB 5BSEA 3S2FA 3UUGA 1QX3A 1XZAA 1OKKD 4FSHA 4NZZA 1L5NA 3IAM1 1OXKB 3UJDA 5J9FA 2PGAA 3IVMA 4ENVA 1JLRA 1Z8HA 2HJWA 1MW9X 2YNMD 3LT4A 3L0PA 2ATCA 1BYIA 3QVLA 5E6SA 4YJHB 1QHYA 4BO6A 4I6GA 1CUEA 1JAZA 2YJTD 2F8TA 4L7QA 2WVJA 3KHKA 5I9NA 5NLLA 2NW6A 2AJ8A 3BH6A 5AVUA 5CVTA 3SOZA 5ALOA 3OZRA 1VLJA 2ZU0C 5EQFA 4QOHA 5A3JA 2ACKA 1FYXA 1BKSB 1OIWA 1SVLA 4YRJA 1W5SA 3JR3A 1SN7A 3TTSA 3TFWA 4K9QA 2JFFA 3MWDA 4EA7A 3N86A 3KYJB 2MINB 1C8VB 2HDNB 3KVVA 4PS0A 1GG8A 1JHDA 1HMPA 2EHDA 1EFTA 3F1KA 2A84A 2GF0A 4D9GA 2ZIWB 5HHTA 3L05A 3B7PA 3WJ2A 2X0JA 2BT4A 3RODA 1DIRA 2WI8A 3AVQA 2UUCB 4CQMB 2FSGA 1TL7C 1YIOA 3DV9A 1LVUA 3WQRA 1BDHA 1XRSB 1CYDA 2UZ3A 4GOND 4M36A 5I47A 1RKQA 1FSZA 2CDNA 4MVJH 2RFLA 4DXDA 4F72A 3ZU3A 5ADHA 5J4KA 2AZDA 1A8PA 1CRWG 5BOSA 2D1YA 5J5AA 3GFPA 1SCAA 1ZGGA 1COWD 1JDS