3AONB

Crystal structure of the central axis (ntpd-ntpg) in the catalytic portion of enterococcus hirae v-type sodium atpase
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
101
structure length
101
Chain Sequence
MTYKIGVVGDKDSVSPFRLFGFDVQHGTTKTEIRKTIDEMAKNEYGVIYITEQCANLVPETIERYKGQLTPAIILIPSHQGTLGIGLEEIQNSVEKAVGQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the central axis DF complex of the prokaryotic V-ATPase
pubmed doi rcsb
source organism Enterococcus hirae
molecule tags Hydrolase
molecule keywords V-type sodium ATPase subunit D
total genus 33
structure length 101
sequence length 101
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2010-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01990 ATP-synt_F ATP synthase (F/14-kDa) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold ATPase, V1 complex, subunit F 3aonB00
4IX9A 5KNCH 3W3AH 3VR6H 5KNBH 4RNDB 2D00A 2I4RA 5KNDH 3VR4H 3AONB 3VR5H 2OV6A 2QAIA
chains in the Genus database with same CATH superfamily
1XL0A 4XVQA 3FDIA 4XZ3A 5K6AA 4A7PA 3QP9A 3JATB 1V8OA 4J75A 4YMTA 4Y6LA 1MIHA 1QIHA 1KI9A 2ZRBA 3AGPA 4CDMA 5B2FA 3EUWA 3ZI7A 3GFOA 3WB9A 4TRNA 4EZIA 3DV9A 1TM3E 3WJAA 4FVTA 4IICA 1ZRHA 3GLQA 1LNZA 1SVKA 1VCIA 2VSYA 4JL5A 4I8IA 2WE8A 1L8AA 1V4BA 2ZI4A 1MUUA 1RAGA 2C29D 3QELA 1U7HA 1CC1S 2PT7A 1MDFA 4FX5A 3RUCA 4XEHA 3TLEA 5D3QA 4Q1EA 4ZKEA 4CMBA 5CG2A 1BRMA 1OJ7A 1RYBA 4QGFA 5FJIA 1W94A 2Y27A 4L7VA 3S2GA 4LI3X 2EEPA 4EO7A 1DQSA 4TKLA 4HVLA 1U3GA 4BGIA 2O2CA 3FIUA 3D3QA 1JLMA 1L1FA 1IY1A 3D4OA 1Z0JA 5JBIA 1FC0A 4WCFB 5I7EA 3PEWA 3LQRA 3RO7A 4U8HA 4HQRA 3CNEA 3E3OA 3H8WA 1ZSNA 3IFSA 4QU9A 3U4AA 4DJ5X 4Q4AB 1J4AA 2QF7A 2W8BA 3DBRA 1H3FA 2GZSA 4AJPA 4KO4S 4LZNA 4MCAA 4XIJA 1W0KD 1WPGA 3ICVA 1U2ZA 3KLPX 3VUEA 2B36A 3CJQA 2MSNA 1IWPB 1SO8A 2VSFA 2PKQP 2ZS9A 3BHIA 1WZEA 2AQHA 4PTZA 2YS7A 3BBPA 2VK4A 3CJTA 2GJ8A 4JU9A 4DGSA 3RC7A 3HSYA 3DE1X 5LUBA 3JXEA 1IN4A 1KDRA 4NBRA 4RS4A 1A8PA 3RRFA 3RFXA 1NUHA 4JLUA 4BUCA 3PQ5A 1HDEA 2HSWA 3R7BA 1WP4A 1H2HA 2QN7A 1PUIA 3O74A 4EJ6A 3ESCA 3K9CA 3UYLA 2CDNA 5CEEA 4HQFA 4P54A 5IMSA 3WNBA 2BMVA 1ZD2P 4A73A 4PZ0A 1DRWA 3IKJA 4KAAA 1YMUA 1AKRA 2B1QA 1SUFA 3E58A 4JUFA 1CS0A 3U3JA 4JXXA 1AN0A 3GAMA 4OLAA 1VZ2A 2QG9A 2R6AA 1GA1A 4OGLA 4X20A 2ECFA 2CDAA 2C5GA 5J3JA 3CEHA 2AFIB 4WUTA 1UBHS 1YJBA 4XTCS 3TVYA 1RM0A 3S8YA 5ECYA 1ZSYA 3C16C 1EZZA 2C9DA 3AU8A 3DM5A 3EVGA 4UNIA 1AA6A 3NHRA 2RGNC 4CKCA 2IJGX 4GUAA 5DH9A 3VSBA 5CDFE 4J4BA 1GZ5A 5HIKA 1ZK3A 4QE3A 1T8WA 2R7KA 4G5QA 4CHGA 1UP4A 4BE9A 4RO0A 1JSXA 1S4QA 2Z8YM 1L5VA 4O4HA 4RH0A 3OPNA 3FPSA 1FUKA 3ITNA 4Y1RA 2F4VB 1LW7A 3AERB 1VG9B 1GUFA 1LCIA 2ZJ8A 3G59A 4IDAA 2CN1A 2R97A 4WZAB 5CAEA 1T0HB 4EABA 2FVYA 3P45A 1GVNB 2ST1A 2PZAA 4PO3X 1QX3A 3FWHA 1PLKA 1KJYA 3PQ7A 4Y7DA 4E22A 2ZJ2A 2FPOA 2DFDA 3QYFA 2FQXA 4EPYA 4GVPA 2CBZA 4TXLA 2DKFA 2BD0A 2PWPA 4AZ3B 4KR6A 4OXRA 3T7RA 5IASA 1E3WA 4R54A 3RD5A 1J56A 1PD1A 5FORA 2CL0X 1IZ0A 1NUQA 5FULA 3AR9A 4NE9A 2AJTA 3QVKA 3RQIA 1U9YA 4FI3F 3VXKA 3AP2A 3JD2A 4QECA 4BRSA 5ITZB 1TDJA 5C52B 5F1OA 3MUEA 4WV3A 1R16A 1GXSA 1NXSA 3NHLA 2HOQA 3GJZA 2Q5IA 5C81A 1UC8A 5IMBA 5KYVA 1W73A 2OCAA 5HNKA 1OWPA 3KJEA 4UOQA 1W1WA 5CYFA 3H17A 2OAEA 3PIDA 3GRUA 4BRWA 1ZK4A 3EMVA 4ZEVA 2FI1A 3QVMA 5KTRA 2JFFA 1F3LA 4PCUA 1MJNA 1JUDA 4F5WA 2VH5R 2G63A 4FC7A 2O48X 4U6SA 3UKDA 2Q9BA 3SK0A 1VL6A 3G8BA 1G3RA 1J22A 4B4OA 4MYSA 1BHO1 1P2TA 4RA6A 1EP1B 1NR1A 3H0EA 3KTAB 4ZT3A 4KQXA 1JU4A 4QUGA 4FQ5A 3F3YA 1PD0A 4OSPA 1IU9A 1TA4A 3DUFA 3PGVA 2I9PA 3JQAB 4LX8A 1K9SA 1JWBB 3GELA 2DTXA 4FFBB 3HFJA 4LNAA 4NCKA 4J49A 4QFCA 3BWYA 5K8VA 4WERA 4DYHA 2IU6A 4OIFA 4J43A 5EKXA 1IJBA 4UNNA 1L5OA 1JE0A 4N3CA 5KI6A 4L8FA 2X1MA 2JAXA 3JQBA 3P0JA 2R6GA 4LV5B 5CFPA 1SCJA 1X7WA 3BS4A 1VQ1A 3HMKA 3H1BA 3PX2A 5KWSA 2V96A 1ISFA 1LJ8A 2SBTA 2OPHA 2GD1O 4JHXA 2G70A 3D81A 1PZNA 4QL3A 3ROKA 2ZYUX 1SEPA 3FLEA 3Q98A 3SJAA 1NN5A 4XCVA 1E2JA 4AT1A 3SX0A 1TTTA 1NZFA 3CW9A 4HATA 4IJ5A 4NV3A 3RNLA 3SE7A 1QHHA 4OIMA 3ZJTA 3U4HA 3N2GA 2FP4B 1UM9A 4RELA 5B57C 3N28A 3OZSA 1UBLS 2MU1A 3DO5A 1WM1A 3MWGA 1PRYA 1VLHA 2RIPA 4YJDA 2BGRA 3FCSB 3E22B 2O23A 3F6PA 4FBMA 4WK2B 3RBAA 4LMAA 3V2UA 4CKEA 1L5RA 2L42A 5FNZA 1BDHA 5DGHA 1OAOC 5K3BA 3B13B 4OH1A 1UBTS 3LTEA 1JHAA 4OM7A 2AN3A 1T26A 2WHQA 5L45A 3OJWA 1WKVA 4HWRA 1UOQA 3WY9A 1MHTA 3C0KA 2MDTA 4IDHA 3ZY3A 2MIIA 1DRUA 1WBDA 3NATA 4D6PA 4LDAA 3GRRA 3ET5A 4JUCA 3T1OA 2XUAA 1E3EA 3KAPA 4DA4A 4NTZA 3LOQA 3GCZA 1G8JA 1XQ9A 3A70A 3CLSC 3O38A 2RGDA 1D2HA 4QELA 5GWXA 3HJHA 1G38A 4M36A 4P7GA 4GC5A 2QLBA 4CFYA 2NV2B 3TFQA 3Q9LA 2NXJA 1W29A 3WA6A 1FFYA 2XDAA 1JLRA 1ANKA 2NT4A 2QQ0A 4DLKA 3U09A 3DR3A 2WKPA 2EBWA 2FPKA 1JVBA 1YT5A 2AIRA 3ED1A 4N7RA 2HMTA 4TVBA 4Y2UA 1KEKA 4YP7A 1L7QA 1BD3A 2KJQA 2JIOA 1BQ4A 3IR7A 3WBKA 3V6LA 1NN0A 1VE7A 4DFDA 3S7TA 4C4RA 4U9UA 1Q16A 1Y7PA 2Q4RA 3DVRX 1V7PC 3T9CA 5I7VA 1NQ5A 3AJAA 4HQ6A 2QI9C 4RKRA 4YFVA 3ZHUA 3FUCA 4ZWNA 5CVUA 4V38A 3STUA 3GO4A 1EVYA 1TZKA 4CIAA 3HKDA 1X38A 4HWOA 2AG6A 1W88A 3TKLA 1L7XA 3UQYS 4CMHA 3K15A 2ICAA 4KV7A 1L1EA 2F9FA 3CUEF 5FTNA 5IBPA 4OKIA 4ZHQA 5LVAA 3RF7A 3NHZA 4XVRA 5BSKA 5K05A 3ABIA 3H5IA 4I81A 3FPCA 3PC2A 2XADA 1KGDA 1GDDA 4KGVA 1CIVA 1Y3AA 1JSRA 3BMOB 1GAJA 1NUAA 3HKEB 1PSWA 2O5VA 3FPEA 3KSRA 1E5VA 3DEAA 3PQFA 2FPLA 3F4LA 3PJGA 4A8JB 4ZCPA 3B6EA 5JSZB 1J49A 1PUJA 1QANA 1ZN2A 1E7WA 4H2DA 3IS3A 3ZHRA 2HU2A 5KX5A 1P8AA 4MULA 4IHAA 3BWBA 4LCJA 3IKLA 4BFVA 1RNLA 2AWNA 2GZRA 3K94A 1NX6A 3SC4A 3W8RA 3SFVA 3ZJ4A 4GKKB 1HORA 1VL0A 2XSZD 1GPWB 5TGZA 3ZC3A 1M2HA 3GJ3A 1CDDA 3BRSA 5BORA 2LD4A 4XIFA 1V9SA 1DQZA 3DE3X 5CA1F 4GI7A 5IJWA 1XRQA 1N2XA 2DH6A 2EBUA 5I9NA 3IDSA 2NADA 1EXMA 2BSXA 3H3XA 3MJEA 3L7AA 1GCAA 2XTMA 4XPIA 1E2QA 2W8ZA 4IZIA 3SIXA 1NBWB 2QP9X 1QBKC 1Q7TA 2B4YA 4FR2A 2WNSA 4M6WA 5IKEA 1XK7A 2ZRGA 4ILEA 3TDMA 3MMXA 1P0MA 2FDXA 3T5BA 4AXXA 1TMKA 5LKAA 3FI9A 4G5GA 1U0NA 1FIUA 1BEZA 1F1BA 1IXZA 1A9YA 1DKOA 1VB5A 1V9LA 4I55B 1D4ZA 1XE3A 2HWKA 1UKBA 1B6RA 1KBZA 2YOHA 3VPBA 3ZTYA 5FHQA 5B4VA 1L4LA 4GVXA 4PBTA 1FDTA 5FLXA 4KKVA 2BHLA 5K0BA 2DULA 4PAMA 3K32A 1IONA 3AVTA 3PNLA 3NHUA 2IUEA 5LZ7A 3EOBI 1U0HC 3U60B 3NC4A 1YUBA 3ACCA 3CR7A 3LL4A 3EXEB 3Q1KA 3VR5H 2A88A 3ACDA 4MGIR 5TJHA 4BFUA 4D0NA 3CLRC 2HA7A 2GBCA 3I30X 1QGED 3NYIA 4O02B 2IXEA 3FM9A 5LCXA 4G81A 4QRDA 5H3LA 1YBHA 4MO9A 5IJ9B 3CMCO 1BS1A 1DZ3A 1M66A 1RKXA 1ITZA 2RB5A 2I2WA 4IDGA 3NJ4A 4O6VA 4D44A 5CFZA 3EXAA 1TZ2A 2B1GA 3EF0A 1RYNA 4MUAA 3OHPA 4N9WA 3ZQJA 4YRAA 3R23A 1VHDA 5FI5A 3DEHA 3GCDA 4WKPA 1G7RA 1YRQA 4NOLA 3FDFA 3NBQA 3C45A 3TSWA 1N6RA 4DTIA 3FUWA 1RWNA 1TF7A 1C3OA 1VI6A 3KL4A 1JB9A 2XWSA 4FOPA 3ZDZB 4JWKA 4F1WA 4UNRA 3RH0A 4BO8A 5AKIA 5I01A 3PDIB 1DEXA 3DE5X 4LOLA 3M9XA 2AI3A 3DA8A 2B99A 2HJRA 2ZJ3A 3B8HA 4XQEA 2IX3A 1KO7A 3H1FA 2J0UA 4WJLA 1Z26A 3I0NA 1D6NA 4CIBA 1YK0A 1UFOA 2CNWA 2H5IA 1SCUB 3OEHA 4U02A 2EDAA 3A3YA 3HRIA 2NVBA 3OU7A 5AM3A 2OZLB 3VTKA 4N8SA 2A5YB 1NYQA 2ZKIA 2OBXA 1ZM2A 4L5CA 3DZ8A 3KV3O 4D1YA 1U2TA 4P5DA 1ORRA 2ZBRA 1WMFA 3CX6A 3U7GA 1NF2A 5B7GA 1D4OA 4U7WA 1RQ2A 1GPLA 2VDQB 4EB0A 2FW8A 3IVRA 2IIVA 3CLVA 3SDBA 1C9DB 4E2FA 4LJRA 3RVNA 5IH3A 2L69A 5K0FA 1UAYA 5JWHA 7MDHA 3WYEA 2CV1A 5D2CA 1TVCA 1J1ZA 4HI0E 2R7MA 3GDGA 5FXMA 3TOSA 3SPXA 3WMGA 2WINI 2F62A 4FE3A 1QHFA 1Z83A 3GT7A 4GX0A 4BZZA 1H4VB 1BN7A 1QFZA 4LTNA 3PZBA 5E9AA 2YZNA 3UEOA 4KQKA 1O97C 1D1QA 1XEAA 2XGMA 1NC3A 3L05A 4Z49A 1PO7A 5CB0A 2XI4A 1ZJJA 3PGA1 3FHCB 1XMSA 3MJTA 2X0EA 4BP3A 2XDWA 1M6WA 1HLPA 5EIOA 2EHDA 3EPHA 2EKDA 4IILA 4B85A 4MW5A 1FBNA 3GCXA 3U5ZB 4F5EA 4OQEA 3P9YA 2QRZA 2OYSA 2VUIB 3VZSA 4ENQA 1O96B 4N3AA 2R9VA 1OFUX 1QBGA 4BGDA 2VPTA 2E82A 3NAMA 4P0PB 4QDUA 2JFPA 4QC2A 1VLJA 5IBCA 2Z43A 2A1IA 3GYBA 1C9EA 1M2NA 1V7CA 1JT9A 2NUTB 2FUKA 1EE1A 2HBRA 2VRWA 3HI4A 3HXKA 1UT8A 4L02A 3RABA 4KNYA 3HB7A 1TM7E 3AO0B 5CH3A 1OUMA 4DXHA 2AG0A 2AZ4A 1C2YA 1KARA 1XGKA 1H23A 2WEKA 4G5OA 5JT1A 4QFMA 1N2BA 5D7BA 2M1ZA 2PSEA 2VJQA 4LRWA 3K0SA 1EE9A 1X1SA 4WY8A 3TD9A 2TYSB 3CN9A 5MN6A 4OYRA 4FD2A 3SKVA 2VWGA 4C4TA 1JKMA 2QYHA 1M6EX 3T0IA 5TSDA 2DX7A 4AYXA 4PRLA 4AP5A 4Q34A 2AOUB 3VPDA 2H1IA 1SVOA 4MB0A 1M5TA 3RFCA 3SZMA 4LN1A 2JRCA 4CQMD 4IO1A 2I1WA 3R3ZA 4G4SO 1L7MA 2Q21A 3H2BA 5CR9A 1CZKA 1URPA 3PDJA 2HY7A 1MPXA 1UKVY 1XMJA 1L5QA 4JBYA 3IVGA 4FW9A 2BT4A 1BSVA 4M1TA 4LHZA 3LY8A 2VSNA 4TMKA 4WSOA 1BH2A 2P65A 3B53X 3HB9A 4ZVNA 3SI7A 4WFQA 1JR3E 1MJGA 1ZH4A 4ZVOA 3RC9A 3TI7A 4BJ5A 4GP6A 1JFSA 1OU0A 1ZN9A 1XHEA 2EQ5A 2ODBA 3PNKA 4XX0A 5IAGA 5DLDA 2G77B 4CHTA 4BFTA 1IDOA 1U81A 2UUCB 1L7DA 2LDBA 1E6KA 2VQFB 4ALIA 3MQ4A 3RHTA 1CY4A 1E2HA 3UZUA 2FMTA 4ND3A 1JFRA 5FBRB 5BVGA 4BO7A 3D1JA 1L5ZA 2QTBA 1G2QA 3M34A 3EQ9A 4R40A 5TT1A 1KBQA 1G16A 1DIAA 1HE4A 2G8NA 2HM7A 2WAMA 3NASA 4WZBA 1KRHA 4KHZA 4NP6A 1Y9AA 5FAXA 4LY0A 2CNWD 1KI4A 1ICIA 2AOUA 5NLLA 4PC6A 5DM1A 2YWEA 1GITA 3UG7A 1I7DA 2GLUA 5GONB 5JXIA 1GPNA 1A8HA 5SYAA 2H5JA 1CZOA 4GQAA 4R84A 5BRNA 1KVUA 2G1AA 4I99A 4OHWA 1YJCA 4E46A 3ZE0B 2GJ4A 5JCOA 3R7FA 4V24A 1V8BA 5D84A 3FYUC 1NLZA 3ZDRA 3OLVA 4MQ5A 2OD7A 4I5DA 5HJ5A 3L8MA 4O1MA 3HLYA 1PNOA 1QZTA 1T1IA 4FMPA 3AK4A 4NU5A 4XDGA 5ESXA 3ROXA 2A0YA 1YVPA 4Z51A 1XTRA 4EY6A 1E6EA 3FVRA 1DEOA 2Z3WA 2B2XA 3R0JA 1LPSA 3OQMA 1JA9A 4NZOA 4D41A 3FOWA 1VP9A 3KR2A 4JASB 3JVIA 4L5YA 4ARZB 1QOQB 4UHCA 5LC1A 3UCXA 4RJTA 1M72A 4EZEA 3L18A 2G6BA 4Y0NA 1NR7A 3ZLJA 1SKAA 4Q4AA 5IVDA 2AC7A 1ODFA 3GRAA 5EPEA 3RG2A 3K6KA 3TDNA 1XAIA 3H6HA 4XFKA 1FFWA 1E1CB 1FMCA 1N2OA 3B1XA 3VU8A 2ZM5A 3QYPA 2AZXA 6ADHA 2VYND 2DWOA 1LSUA 1BS9A 4K05A 3KG2A 3LPDA 3MTEA 3A9SA 4LVUA 4MPPA 3RSGA 4M1EA 4ZAZA 2YBDA 1WHTB 2VDRB 4YJ3F 3T4UA 3WWDA 2H0RA 2VJPA 5IZCA 2TRSB 1PZGA 1TF2A 1ECBA 1TGYA 3FMGA 3NM6B 4HZIA 3SDZA 3O9VA 1XTKA 4U2DA 2VHCA 3GJSA 3X1MA 2QY9A 4EG7A 2PJZA 4MUGA 5K0ZA 1FRQA 3ZDEA 2A9RA 1M1YA 3K5PA 4HGZA 4O2LA 3VO1A 1YOVA 3S5JA 4ZGWA 5CM2Z 5B4TA 2AI2A 1J97A 3DBVO 3S1SA 4MRVA 2K6GA 2ZIFA 3IO3A 4GEGA 5AW3A 4Z54A 3DUFB 2HSGA 5ALEA 16PKA 5BVHA 1WW3A 2WHPB 3IBTA 5E38A 1U3DA 3KTAA 4XD7A 1NU6A 4JYZA 1QU2A 3RIYA 4IR7A 3VHXA 2CFTA 1OTYA 3HBLA 3QUAA 5A05A 2IV7A 1UBNA 2CNDA 1IN6A 3E61A 5BN4B 1T5LA 1XEFA 1BXKA 3SIPA 3V2IA 5BN1A 2AN5A 3EGWA 2A1UB 2G9RA 1D0VA 3G02A 1UPBA 2MYNA 3QTTA 4WK6A 1YZGA 1EGAA 1PQYA 2IUUA 1R0YA 3TRJA 4M1WA 4C0XA 4IOLA 1VKNA 4RK7A 1L4MA 3R9WA 1PQUA 2H2WA 1IZYA 3C3KA 5LZ4A 4RS3A 3MWFA 3ZDXB 4EKNB 3RRNA 2Z04A 4MAAA 2OV2A 1UQTA 1RXUA 3V4RA 4OXXA 3GT3A 3DM9B 5BWBA 4Q3BA 2YC4C 4MV9A 4ER7A 1DCMA 5JVDA 2D8AA 2H1LA 3I2JA 3OTIA 3GUYA 2H7YA 5CYGA 4H3SA 1D4FA 2ZYSA 4TTSA 4CYMA 3A6DA 3L4KA 1JHZA 1R8QA 4C4PA 1SHJA 4LMBA 3AM3A 4L27A 3FPAA 3TPCA 4R69A 3IYLW 4AKEA 4AKSA 4M8KA 3ML1A 2GEFA 4B1FA 1JG3A 4MMYB 2YFHA 2H7CA 3DAGA 3I8XA 3KOXA 5AIAA 5DTQA 5E0KB 5F3DA 2QM7A 1QDUA 1GTZA 3B38A 3PFNA 5KVVA 3FY4A 3HHPA 2XTZA 4MWDA 2JVJA 4WNCA 5DMXA 4LF7B 1QKIA 3IOBA 4M6WB 2HA0A 5JG7A 5C5DA 3EQ2A 3WGIA 1GU1A 2XXBA 2C95A 3RTDA 4F4UA 4PGHA 3EQ7A 4XEUA 3HJGA 4W8HA 1PFVA 2NPOA 2NPIA 2WWGA 1T5TA 4ISBA 4PCLA 3O4JA 4KWHA 4RE5A 4XI9A 6REQA 4LHSA 2FDRA 5K3EA 5EFZA 1MENA 3ZKAA 3MD9A 4UBNA 1H2RS 4Z8XA 1CR6A 1Z28A 4G67A 1NNUA 4IFTA 3ORYA 1G5PA 4D98A 4P0QB 5K2OA 1G7TA 2BSQA 2RHBA 2ISSD 2RK4A 2P5TB 3OIUA 4ZPJA 1Y6QA 2NSJA 4FFBA 1UDXA 4GX1A 3DW1X 4ZVMA 1JNXX 3MD0A 3FJOA 2BKUA 4FINA 3HMQA 1FYXA 3NC1C 4RA6B 4PAOA 1X7YA 2O20A 1J2RA 1MXHA 2OC9A 4KK4A 5CM9C 5EEGA 3KZ1E 4L4XA 3T99A 3FB4A 1M7BA 1S9DA 1A5ZA 1KQOA 1DINA 1ULBA 3HVHA 4UXHA 4EG6A 4ND2A 1XWFA 4AO7A 2AK2A 4F9TA 3B12A 2W0MA 3D54D 1MOZA 2R8OA 3DTVA 3C3XA 2FW7A 3EMBA 4YCJA 5HDBB 3KR0A 1PJZA 2PSJA 2VUTA 1WUJS 1TTPB 4QOEA 5ICFA 5AOAA 5IDYA 1FMTA 3DWEX 4DA8A 4EGSA 2E5LB 1H66A 4F84A 2O7RA 1KDOA 2VPWA 3EZNA 4KXXA 2ZUWA 4I36A 4YACA 1BX0A 1C3EA 4ZCLA 1L4UA 1L4YA 1M5UA 2Q7OE 3A3OA 1FDSA 2G28A 1C7QA 5FTMA 2IYLD 3QI7A 1WCIA 1II8B 1ZC4A 3Q3GE 4JI5B 2PH3A 1OOEA 3WLQA 5C34B 5GM2A 1GNQA 5CT4A 1EDEA 2YVAA 5T4EA 1OYOA 2N75A 4CKBB 1VPDA 1E62A 2RHLA 3IAXA 3RANA 4QTYA 1QX4A 2Q8PA 4ZDKA 3UFXB 3LK7A 3ZCRA 4Q7EA 1YKFA 1V45E 3HN2A 3RGGA 4IMRA 2B5VA 3HUFA 1VKHA 5JFGA 2WWYA 2GZDA 4MR7A 2C4KA 5DM0A 1G8KA 1L4HA 2QEQA 3HABA 4O4HB 5JFTA 1F2DA 2Q3CA 1UODA 3LC7O 4LXHA 4RKWA 3HE3A 1ESEA 3NBZC 1N2JA 1PEAA 3P97A 4INZA 4RUKA 2K7FA 4WE3A 1A2BA 1E1RD 3PC3A 4BGEA 3D6FA 3DTVB 4RTQA 3UJHA 4YONB 5AI5A 4UUNA 1CE8A 4BLOA 5IAOA 1VG1A 5AW9A 1NVTA 3EOAI 1BU8A 2BZ1A 3LFUA 4YCLA 5AOVA 3FYCA 3A31A 3NT4A 3CM0A 4L57A 4K7JA 1N0IA 3P5BA 2DPGA 3CBGA 2Y0DA 1RAIA 3A14A 5LDDC 5E2IA 2VAWA 1JYEA 2QLNA 3HUTA 2BDEA 3OQIB 1MRNA 3AHDA 4WHMA 5E6SB 1JBKA 3VHLB 3KQKA 4NYMR 5DM4A 9MHTA 3KZOA 4QXAA 3EPRA 2IYEA 2Q0QA 1M2OB 1TK2A 3AV3A 3QPBA 3PUVA 5EERA 4ZYUA 2KX7A 1LLFA 1FSGA 4G0QA 3HCFA 4RKQA 2R1TB 4EKIA 2RHHA 2IZ7A 1HLDA 2PGIA 3GFPA 4KJZA 4WH0A 2A30A 4K1LA 5HZGA 4YASA 1CD5A 2OHXA 2XVZA 3QYJA 4E7PA 2KBFA 3AEQA 5FA6A 1GQSA 1RBYA 5CCDA 1HUQA 3ESQA 2ZK7A 3MLBA 4OQYA 4JENA 3WJ7A 3OTWA 2RG7A 3IHWA 1T9BA 3O47A 2YV5A 3AUUA 3UN1A 1ENZA 2GZMA 2IHVA 1OLSA 2JIBA 3C6YA 4PLYA 3VYWA 4DJTA 2E3JA 4B7AA 1VJDA 5H81A 1NP3A 3DMHA 3SIWA 3DV0B 4A2QA 3N76A 3LT0A 2IFTA 2JBWA 4IP0A 3UJCA 5B3JC 1VYTA 3ONVA 2AFRA 4B6GA 3AC0A 5HGJA 3I6ZA 3CW8X 3N8IA 3CNBA 2IPNA 3DMNA 3IR6A 3OZCA 4QTUB 3VX4A 5FWNA 4FMCF 2V6FA 2XDQB 2VDOB 4QDOA 5SZJA 5U4QA 1JEYB 2FPPA 3BMNB 1RI4A 3H65A 1PT7A 4DSTA 4I50A 4Q6BA 4RVUA 2IKQA 3IEUA 2IF0A 2Q7XA 2WMDA 4NCIA 4O63O 4RETA 1AHPA 3Q4GA 4RHEA 1KZ4A 2GZHA 1E69A 2VHTA 4EUFA 4IRUB 1RIFA 5JNVA 2OAGA 3LLUA 5CA0F 4BKUA 4NV1A 1QAQA 1XA3A 1J8VA 3RIXA 2J3EA 1Y81A 4TKVB 3IB3A 5GZ3A 4RGVA 3BREA 2QZPA 3GLRA 2YQ4A 3HV2A 3TZHA 3HNRA 5KHAA 4FDUA 4B73A 3ZWWA 3KQUA 1NBOA 3E3LA 3TEMA 1WULS 3H3JA 3IT1A 2HSEA 1AGYA 2VT3A 1DCTA 3VNQA 4XD2A 4ZO9A 2QRGA 5K01A 3P9IA 3PIRA 5KWIA 1LK5A 1U9IC 3KOUA 1R4NA 2PO5A 3U4QA 1AKMA 4ODIA 1KIMA 3WBJA 4BPBA 3CPEA 4BFYA 2J41A 5LYJA 1OYVA 1K0FA 3F7TA 2ISQA 4Y18A 3DLBA 5KVSA 1ZMXA 3E05A 5TVGA 2EWVA 3FJYA 2AMYA 4D9IA 1UF9A 2XIQA 3GXOA 4I5FA 3VI4B 3ZWDA 4FE4A 1NG1A 3WFIA 4HFJA 1WABA 2JLUA 2AXPA 3GHYA 3HJTA 1C7IA 2HH9A 3HWRA 1ST2A 3EVBA 5FNVF 3UBMA 1CWUA 1QDLB 4LV6A 3R7WA 4LVNA 3DL7A 3NYQA 2VJYA 1JDBC 2VI5A 4LOJA 3VO9A 3EPLA 1WCYA 1GSAA 2QTTA 1PYDA 1VIDA 2H9IA 2K2WA 3K7EA 2CZCA 1XZBA 1X87A 2DSTA 3OLZA 3PQ8A 3MRXA 4OFBA 2EWWA 3ILVA 4FFVA 2UYGA 3H2GA 4H4DA 4UNPA 3SCZA 2JATA 5DASA 1CZNA 1E9DA 1Z06A 2X0NA 2YY6A 4LYYA 5U1PA 4ZVUA 2ZRDA 3GN1A 4I1RA 4C7OB 4Y2QA 1SR8A 3TH5A 2J3IA 1Y3FE 2V7XA 4HDSB 4TLDA 2DQ4A 1BA3A 4DYDA 3HXQA 2H11A 3PRYA 5JBQA 3SYRA 3QWHA 3EF3A 1V5WA 3H1PA 4YR7A 1T8UA 3L1KA 3L6UA 3WTCA 3NM4A 4C07A 3IKTA 5HUJA 1OX5A 3AR2A 3UJ3X 1XN1A 2ENUA 2OV1A 5C35A 2UZ0A 4L78A 1NV8A 3KB8A 1N8TA 1OAOA 3EQZA 2AKAB 5CK4A 3B7PA 3CRZA 4B2PA 1MB4A 3NAGA 4B3XA 4BJ6A 2WJHA 5B3KA 5CCXA 3TNJA 3BRCA 4Y9UA 1FX0B 2ZKLA 4EB3A 4GSYA 4KTTE 1NRIA 4L08A 1M54A 1CLUA 2H9YA 4C03A 2XGSA 5EINA 1YRHA 5LIRA 2XXJA 1GZ3A 1NULA 4QOHA 1N6HA 3NRBA 1TZJA 3H5WA 4U2KA 2IYAA 4D9MA 1YZUA 2XOEA 1AHNA 1ZA1A 4LSGA 2PNJA 4QUBA 3U48A 1T2DA 4OQFA 4Y8VA 4IQ8A 5GIPE 4YP0A 4AJ9A 1R0CA 3LECA 4FR0A 1QQAA 4L6CA 3AY6A 4V39A 4YO8A 5MDHA 3AETA 3BJRA 4YCCA 1JEJA 5KS2A 3NP7A 3R5FA 4Z3DA 1IB6A 3N39C 4PYQA 2R8YA 1CQWA 3URKA 4G63A 2AZMA 3Q88A 4YB8A 3BD9A 1MH1A 3KLMX 1O97D 1DELA 3AXTA 3LLCA 4IBOA 4ZCMA 3AM4A 2R6FA 4J2OA 1U0RA 4FDTA 1Z35A 3RK4A 5I45A 1CEXA 4RDHA 3ITDA 3GA7A 5DYWA 5FF9A 4M9UA 1JTFA 2BCGY 3A6HA 4MWSA 2B6NA 3LUPA 2BEWA 1E9BA 4QSHA 4UVHA 1XVIA 5EMLA 4DV2B 4C5AA 3EUEA 5C9ZA 5FWYA 2V0GA 4G37A 2JLWA 2P2SA 1W5EA 4UBLA 2FFRA 2GBLA 3NALA 3KEQA 3KJQA 1GRVA 4QPJC 4C29A 2UXCB 2RK6A 3TLYA 5EJ4A 1GKLA 2ONKA 2QR5A 3DZCA 4OTZA 1XJ5A 5A03A 1E4EA 3CXUA 3OIFA 1V6SA 4WOJA 1UBGA 1YOBA 4D4GA 5HXAA 2J0UB 4GNKA 4PO8A 4MLZA 2GI4A 3COSA 1JDJA 2H63A 2ZUSA 4PZCA 1RJFA 3UFXA 1ZEJA 5I4CA 4YCSA 2XQKA 1PR9A 5DYYA 4JLBA 5GVSA 1AS0A 3DMFA 4QYXA 3NWEA 3R9XB 1QO7A 5C3UA 2FZLA 2AGVA 2YWGA 5H70A 3AFMA 1OA0A 3EEFA 3LQYA 4O0MA 3QJYA 2PM8A 4XDHA 5JRJA 3CLUD 1A82A 1N9KA 2DTDA 1G55A 2CDCA 2Y1OA 3RU2A 4E4YA 1DB3A 4U2FA 4RGQA 1GCOA 4X0EA 5ILGA 3UCFA 1BRTA 2EFEB 3KZKA 5CIWA 5JI3E 1E18A 1LDYA 1WS6A 1VHJA 2J7KA 5EMJA 3VVBA 3BH0A 5BQXA 2V97A 3EA5A 3I05A 4OL9A 3R9KA 5DN6D 1SVUA 3J7TA 1OHHA 3DEZA 2C9CA 2AQ8A 3DZFA 4HDMA 5LWQA 2OFOA 1NQWA 4DDUA 1N36B 4F21A 1PT9A 5DGCA 4OD0A 3FLAA 3IT3A 4PZDA 4R3UC 5ER9A 2QRNA 4HUQA 5KTOA 2BYTA 2F1IA 4LSMA 4NI5A 1GTRA 1WD7A 2C00A 4OREX 2FOLA 4B6FA 4TKZA 1YDMA 2J48A 2YXLA 1L7OA 5IDQA 2WMOB 3ROQA 3VNVA 3M6VA 3T1QA 1I4LD 3RYTC 1A3CA 4A92A 3JZMA 3PHBE 1MFPA 2ONYA 3MCWA 1T5IA 1YZKA 1MJ5A 2AOWA 1DQYA 1UOOA 3DLPX 4WJKB 5EGNA 1EQAA 4N5IX 4C0KA 4HB0A 4ATNA 2C61A 4J2TA 5FOTA 2Z4RA 4BO0A 2Q6VA 4FK8A 5CDSA 1RQNA 3GWZA 1I3MA 4RPGA 1C2TA 1SWWA 3NHJA 3TD6A 4Y6OA 1PT8A 4C6SA 1U02A 1RSZA 3L7YA 4PSUA 5JS7A 3ZI0A 3DKIA 2WRZA 1X2BA 3ZW7A 2R62A 1IZ9A 1NI5A 1AZWA 1V5FA 2XUZA 3INNA 2YZGA 3REGA 3BTUA 4XGRA 4C4ZA 4ENTA 3KFXA 1DCKA 2C4VA 3EH2A 5C4GB 4KIWA 1USWA 3MJ4A 5EWJA 4WNYA 4R4JA 2PX6A 2ZSIA 5A3RA 5M7EA 1X19A 2HJGA 4P32A 4Q7JB 5EWLA 3VC2A 3EWAA 2JI4A 3KCNA 2R87A 4A0GA 3ZHTA 4Q66C 2ZIWB 4BNXA 2A8YA 3AL2A 1FYEA 1JSCA 2C2YA 3RRZA 3UA3A 4ENWA 2B8NA 5BYBA 3TZEA 2H1RA 3PD1A 3PXGA 3O8DA 1EM6A 1ULTA 1QYDA 3PYLA 3T1NA 4AD8A 5IZ4A 4PVCA 4JJ4A 2QJWA 1ZH8A 1QH1A 2XDYA 4GR5A 2IGTA 1G4HA 1EX1A 1QC5A 4RACA 1YNSA 1L5YA 2VNIA 5FI3A 2EF1A 2W2QA 1SEVA 4PX2A 3V6MA 2AG8A 4KQWA 4EEXA 2JGRA 1I10A 2QX9A 3SKYA 2GXSA 2OB2A 5ITWA 3CUTA 3NVMB 2CBGA 2O7VA 2ZT8A 4GOOD 4H18A 3KQLA 3KD3A 1DAOA 1W4RA 5F33A 5F78A 5FYQA 3LD9A 4NBNA 5B2EA 5IANA 3HS3A 1DKLA 1EE2A 3AT1A 3QTLA 4KMRA 4Q3AA 4DA9A 4DDHA 4LECA 3SE0A 1GA4A 2IYTA 4IJ6A 4REOA 5TB5A 4C01A 1PJ4A 4FN4A 1MC8A 2B3DA 1OCEA 3AI1A 3K20A 3PNSA 1KTVA 4KG7A 4C4SA 3BL8A 3ZBUA 4D8UA 1RLOA 2M2IA 1BOOA 1CU1A 4MYUA 1KZ6A 1YQTA 3PR3A 3CH7A 3NFYA 4LWOA 4TMYA 3H6GA 4EYEA 5JHGB 2BUCA 1HYEA 3CKKA 3I5AA 5EHIA 2DHDA 3PTLA 2C84A 4ZOLA 5HK8A 4UTRA 2BMFA 4FFDA 1KYWA 3M6UA 2ZLBA 4Y6SA 5CT9A 4JUBA 5BWNA 1ZOSA 2VZ9A 4EFNA 4F4JA 2O1SA 4G0PA 2I7DA 4YA6A 1L5SA 3H9EO 5JSQA 4JI4B 5KINB 1JLLB 1VPVA 2OWEA 5DE3A 2RH9B 1E9AA 1ZD3A 3BOSA 4HFNA 3KKZA 4J1TC 1N5IA 1SOAA 1VHLA 3E22A 2IHJA 4NCAA 4O2BA 3F4KA 2XCOA 2BZGA 1S3SA 4BNNA 5IZCC 3W7AA 2FHSA 3HXPA 4M98A 3HVRA 1XU4A 5LBTA 1NW4A 3ZG6A 3PI7A 2YZ2A 5JTTA 1TT7A 4R2WA 2H6EA 4RDCA 5HF8A 4RFVA 2RARA 3JQ7A 2D4AA 3QF4A 2D5IA 1TVKB 3WLEA 4BNIA 4B3TB 3CRRA 4ISCA 1I24A 4PLGA 2OKCA 1RTKA 1Z8NA 2ZBUA 4J3FA 4JEIA 4YRSA 1KOFA 1LWOA 4G41A 4EJ0A 1PVDA 4YT4A 4L3WA 2Q5EA 3SR3A 3RF6A 1CQJA 1RPTA 2DKNA 3JD0A 4M83A 1AQ6A 1HDYA 2P35A 5CPFA 3S2UA 4WRRA 4YWJA 1NVMB 1IY9A 3CVYA 4ZDIA 2CDBA 3CVXA 3BQNB 4B6JA 3IP3A 3VYTB 2PTGA 1X9GA 2QG6A 4YRBA 4KXUA 5FA8A 4IF6A 3L6BA 4NDNE 3HBFA 3L3BA 1RXVA 1J5XA 2RGEA 1L1QA 2C5FA 1IBCA 1J2EA 2GO1A 2WSMA 2XB8A 2XMSA 3QU2A 1ADYA 1CUWA 3WP0A 2VQ6A 4BX3A 2OORA 3KETA 3QX3A 1UAAA 3MXTA 3ZXIA 1DWUA 2P6MA 3BJMA 2NU7A 3DG9A 3OF5A 1VSVA 2QV0A 3FDJA 1USUA 3W78A 3RHFA 1Z07A 4B32A 1ISPA 2GF9A 1I2MA 4KCGA 3CH4B 4OXIA 4EI8A 1YBAA 2PFKA 1VA4A 3OTGA 3VBCA 3LUKA 3IQDB 3PXCX 2PZ8A 3KCQA 4G8DA 3UGTA 2CT8A 2N46A 1U7XA 4QXOA 1RLMA 4Q1BA 3ZV6A 4DJDC 4ZYYA 1FNNA 2ZUCA 4RDXA 3O95A 2SICE 2AMLA 1GCUA 1LI4A 1IXRC 4XIYA 2MINB 1KORA 4FEYA 5BMVF 2ZIAA 4MEBA 2WM8A 4K6OA 5F64A 3V2GA 1TUGA 2PWZA 3CG0A 4E32A 5C46F 1DG1G 2D4HA 3KWJA 3M3PA 1Y7HA 1HV8A 4J4HA 1RW4A 3DKRA 1V11B 1YR2A 2X8AA 4DG9A 2WJ4A 4TTJA 4KB5A 3RT7A 5T6MA 2CNNA 4U2GA 1XNRB 1ZGHA 1AG9A 1XTBA 2RMKA 4IW3B 3QGMA 4DA6A 4QT4A 5JALA 4N3GA 1Q0LA 3EIHA 3DXYA 3QF7A 4WK0B 3U62A 4WAUA 1DARA 4B17A 2X6TA 4JWTA 2W6MA 3CF4A 5HCNA 1G9XA 4N5MA 2QA5A 3JVUA 3MRTA 4WVLA 3WIOA 3U80A 3TLJA 4DGQA 1JSZA 1JQEA 3F9CA 3V8NA 3GZNA 1I5RA 3HYTA 3SQDA 2PHZA 1JVSA 1LRLA 4RSHA 3OAAD 4BC0A 4CQLA 2MCFA 5BUQA 3UPUA 4MQBA 2A5LA 4WCFC 4DRXA 4NK4A 3N8HA 1I2ZA 4B74A 2V7GA 4DR3B 4C3VA 1N8KA 3ZS8A 2A6PA 4JP8A 1D9ZA 1IE3A 2FMUA 3EPPA 4NAUA 4QQKA 2CF5A 4Z8YA 5CA0A 3OA2A 2B1IA 3DVSX 3VV2A 4FB5A 4EKYA 2R0QC 3QKWA 1A2OA 5JE8A 2DPHA 3AVYA 3HR4A 3E5NA 3UVEA 5LWHA 1QIMA 1PFGA 2C7GA 2O1WA 4HLUA 2NXNA 2GRAA 1ZI6A 2AFIA 4ZVQA 3THWB 4MI6A 2O8EB 1KS9A 4MUJA 3ZCSA 1K92A 1H5UA 2PGOA 2GUGA 2QXUA 4ND6A 1WOMA 3AF2A 2Z30A 1PJAA 4D9HA 3A1UA 4ZVRA 2WIBA 3JRWA 5JLJA 5EA2A 1L5NA 1XVUA 1WXHA 1XJQA 2R48A 2XCLA 3OQVA 4GLFA 2J3DA 4JKIA 3MGGA 2FCRA 1SCBA 2BI4A 4IX1A 2P1ZA 4B3JA 1D6JA 1PWHA 2HJVA 2YMMA 2ASVA 2Q0SA 3HZHA 5EE9A 2W6PA 4L4ZA 1Z5VA 4MS1B 3IHKA 5JJLA 1E1RA 4KQHA 4R2KA 5AKGA 1H5QA 3ILXA 4QYMA 2HNKA 3SSOA 4PYJA 1ADJA 3EDYA 4JLVA 3QVSA 4MWEA 4P7KA 5EVCA 5H4HA 3UGJA 3AGQA 1ULSA 2D5CA 4MV6A 3D1LA 2NZXA 1L6RA 1I2AA 1TVMA 1AKVA 4G6ZA 2AWOA 2X13A 10MHA 3R7NA 1JF8A 5AXBA 2JCYA 3KQVA 5SYMA 4BNYA 2FN9A 3C6MA 3ROMA 4WBNF 1Z6XA 2FMXA 4HGPA 4UXIA 1XD9A 1R27A 2CXRA 1TJPB 2AW3A 3JQEA 2YXPX 3BRWA 4IZOA 3OIDA 5FV7A 3ZDQA 5K0TA 1NP7A 3IRUA 1XPRA 1XLTC 5IC5A 1K7FB 3KB1A 3PTZA 4D8XA 4E1VA 1KHHA 2NACA 4MW4A 4C7OA 1I4EB 5IUKC 1QV7A 4HNGA 2A9QA 1JI0A 1P6QA 3F67A 3RSLA 1G8YA 2ZWPA 1U2GC 4RHXA 3RSCA 2ZTVA 4FJ1A 3UK6A 1KI2A 1RWXA 1GG2A 2CVHA 4DBLC 1DO8A 1XMXA 2ZT6A 3L7KA 3OOEA 2P4EA 3MB8A 1UM8A 3FVQA 4OQDA 3UK7A 4ZCSA 3W9SA 5HYVA 5KHLB 4KR9A 5I7RA 4M0UA 2EG9A 5IXSA 2CHUA 2YQZA 3E0XA 1KEVA 1Q6ZA 2QE7D 1G5QA 3ONEA 3HGTA 1HTWA 3ZE6A 4EI9A 1U28C 2NQ2C 3HWWA 4OUDA 4PICA 2Z1MA 4UFOA 1FYWA 4OA8A 1TQ2A 4IEIA 5IFKA 1J2UA 4ZAGA 3PQ4A 4HS9A 4B47A 3N5KA 4KEAA 3ROGA 4CQJA 2O2EA 4EMUA 2ABWA 3E2PA 5G4LA 4JOQA 5LU9A 3KP1A 4M9QA 1GSOA 1ZWKA 3EUFA 4TWRA 4WCDA 3IA2A 1X1BA 4W6QA 1HNXB 2Q4EA 1ZH2A 1EVQA 3CRVA 4L3VA 4TV8A 1G6HA 1XZGA 1FUEA 2J9FB 2D1QA 2RJNA 4CWAA 4XVHA 5DV9A 5EMMA 4I9UA 1BHJA 5JNLA 1Z37A 3AETB 1E1CA 4UZSA 1N4AA 3ZNPA 4NXMB 2I7XA 1KY4A 3P26A 3LPCA 2HNAA 4L1KA 2E2WA 1EHCA 2WF9A 2YIJA 3W9YA 2ODPA 1PJSA 3GCWA 4BKRA 1R0RE 4MJ3A 1BE1A 1E92A 4R2IA 4N5DA 1GPKA 3PWSA 3G2OA 5C8ZA 3PV0A 4MTCA 4HADA 4TV9A 4BNKA 3WNCA 3BQ9A 2OFXA 1FQJA 1LBTA 2C7PA 3DMYA 1A7AA 4OJQA 4EPRA 1L5WA 4MIOA 3UJ8A 3WFZA 4ZO6A 1FNCA 2VZLA 3F5FA 1P5HA 4E09A 3DDOA 4WN9A 4QVIA 2W4IA 1OI2A 1ZL2A 1TEHA 3HCOA 2WUGA 2QPAA 1T3ZA 1VKRA 3VSCA 5CFRA 4QNRA 4NH4A 4HDSA 5F3WB 1ESCA 3TQFA 2IZZA 1IN8A 2QN1A 5FOQA 2C2BA 2Q9UA 3HXOA 3OLWA 3IHLA 4ZYTA 4MWTA 3X1ZA 3X43A 4H4EA 1KI1A 1CQXA 5E4JA 1E2PA 3UMGA 4HV4A 4FBGA 5IK2D 1XNGA 2A5JA 2JB9A 3OT5A 2YRXA 1CTQA 4WCFA 2DHRA 2Q3BA 1HFEL 4D3FA 1NDHA 4GIBA 3GFVA 4E12A 1UIRA 4EB6A 5AW4A 4CEHA 1G5FA 1G1AA 4WZBE 1QF6A 4B4KA 1SCIA 1THTA 1YDEA 4MTLA 4R8KA 3R5TA 1ZGGA 3GEEA 3HVKA 3RK1A 4JL6A 2VTBA 1GN8A 3GL9A 3U5TA 2BFFB 1I2DA 4R2LA 3B3FA 2JIZA 5FPSA 1ZD8A 3FJ1A 5G4KA 2O8CB 1H0KA 1WUIS 1GFWA 1BMFA 3ZE8A 1JKJB 2A57A 1H4TA 4JYCA 2Y99A 5EY5B 3ROFA 3RUEA 4WESB 3CPHA 3WOVA 4TRJA 1NVDA 4O4LF 4GMXA 2PGDA 1TQ4A 3LKVA 2QT1A 2CC2A 4D82A 1NRJB 3OZGA 4BNLA 3MS2A 3EE6A 4D3ZA 2IXTA 3FUXA 1P44A 4FFPA 1TGVA 3K0FA 3LDFA 4JN6B 3NB0A 4H6VA 4GPBA 4UCQA 4BLPA 4OQ4A 4PX3A 4AUKA 3IEPA 2HT6A 1U3WA 4PLCA 4EJFA 621PA 5JWOA 3KUCA 4NYIQ 1WMEA 4CETA 3VR4D 4XJXA 1NBME 3BDIA 2D1SA 3WMWA 3K8QA 4DJJA 1RLJA 1SELA 2JGLA 2P79A 2YWFA 5TE9A 3K0KA 4H0NA 1M2WA 2X41A 3VDQA 4FHZA 3DLHA 1Z13A 2EWMA 2WFAA 1TEZA 1OFTA 4KXNA 5CLIA 5C8YB 3RTGA 1MJGM 1P4JA 1Y3HA 3MN1A 3TLMA 3THRA 1YZLA 3KOMA 1I5OA 1CQIA 2Q5JA 3L82B 2UZ3A 1LDBA 2ZSFA 4OP2A 4Y6QA 4ER6A 1ETUA 3EIEA 2AL7A 3QNUA 4JFAA 3QBJA 3G5UA 2O3QA 4FGZA 4H1TA 1JQLB 1ACJA 4Q48A 3CEMA 2O59A 1EIWA 2G1KA 2GM9A 3CONA 4WNIA 4D4IA 5BWMA 3W5DA 1C1HA 2PANA 2XUPA 2FWPA 1YL6A 4A03A 2ZFUA 1EP9A 4JEUA 3A2KA 1NWHA 1YMVA 3AZPA 2VTEA 4JJ8A 1LQTA 3NUGA 2QORA 1NTOA 1YHZA 2AJBA 2CXXA 4DLPA 3GP8A 1G3UA 4CG0A 1K7XB 3V8VA 3FHLA 5SZIA 1DRKA 3TGWA 1OZAA 5LP6C 1ZJYA 2WSLA 3A9UA 2DXIA 3A2MA 1EK2A 4KVZA 4YHBA 3ZCVA 4BFSA 3U7RA 4RTMA 1QH1B 1K5DA 1X74A 3OP1A 4CM7A 1V16A 3F98A 1P1CA 4C0JA 1JFLA 3LGSA 2XUFA 2Z2YA 3ZYZA 4LPKA 3UTDA 4RU1A 2WIJA 4NHEA 2QZZA 2OZPA 3HADA 4L9SA 5THQA 2ZR0A 4FKMA 4J0GA 1ZXBA 1XNJA 2GBLC 1SZDA 2NZYA 4IX9A 2IHTA 3ZV7A 3M1YA 5I4IA 3HTXA 4US1R 3RS2A 3P9ZA 3T7IA 1F6DA 4KACA 2PUTA 4CNQA 4U00A 2E4AA 1EUDB 3T95A 2AV6A 2CUTA 3LPMA 4NV0A 3M3DA 4C89A 1PGNA 1Z5NA 4YX9A 5JD4A 1E1KA 3BFXA 3LT5A 1Z29A 1NVEA 4B5LA 1S1MA 3OFNA 1HI9A 1KZGB 2P3QA 5H80A 2O0MA 2EZ4A 2XUOA 3GNQA 4UC0A 1O58A 2JLVA 4OYYA 5I8PA 1G41A 4TL8A 1DC7A 1FEZA 3RG8A 1H4SA 1N2HA 1EB9A 1P45A 3GG2A 4L74A 4EJSC 4Q15A 3LDGA 1J8FA 3G8AA 1TW3A 4R41A 2CYCA 4B7UA 2P8JA 4BYMA 1FX0A 2AK3A 2IUSA 2WLSA 5FP0A 2CLCX 5JOQA 2PZLA 5E0OA 3NVAA 1MR3F 1W44A 5A3QA 2IYXA 2BFEA 3MQ2A 4Q3OA 2AOVA 4MARA 2O2ZA 4WI1A 3P96A 3SQNA 5DTEA 3N2EA 3WL4A 1SUWA 3FETA 1SULA 4C21A 3AG5A 3KEGA 2WJ6A 4D9CA 3DOUA 3TDKA 1J1UA 4EELA 3LBFA 4D4JA 4EFDA 1LQ2A 4QJ5A 3DLCA 4JLNA 1GAEO 1P18A 1B3RA 3L8CA 3QY0A 4X7MA 2Y1KA 2M6KA 3J80A 2EJUA 2WABA 4B0OA 3FHJA 3EXHB 3W2IA 1YDFA 2PZJA 1R00A 3CNOA 2QJFA 4PXYA 4QJIA 3RV3A 4D9GA 4OM8A 1CFZA 4OHPA 4YS6A 2BBTA 5F1YA 4C20A 1TLTA 1JKFA 2WWIA 3K1ZA 4NENA 4XDZA 2ZBFA 4HRXA 2CMDA 1H0HA 4QUJA 1PV1A 2AFHE 3K8YA 4L28A 2AMJA 4Q00A 4XXHA 3RWBA 2GA8A 1KAEA 2WWFA 5JV5A 4EHDA 1OAKA 1FP1D 1V41E 4G0OA 1DBRA 1G6KA 3CO0S 4JJ7A 1DC4A 2FMKA 4WJZA 2J07A 3K31A 3UW1A 3ENNA 4KE9A 4H3HB 4B2LA 5JYDA 1KP2A 4X90A 2R3SA 4K2AA 4N12A 1WTCA 1PKXA 4KFRA 4TT8A 5KWVA 2OBNA 3ZHYA 5AFSA 2QTGA 2ZAMA 3AV0B 3R41A 1XU7A 2HQ1A 5CX1A 3AF5A 5G40A 3WMEA 4KN6A 3WLOA 4BASA 2MSKA 2VZEA 1TAGA 1X7YB 3FMOB 4JYBA 1QIIA 1R9JA 3KZXA 5DM60 4YJFB 2OLKA 1F9EA 3CKYA 1PGOA 4B0PA 1XTTA 3CNHA 4K6HA 1G8GA 2ZUBA 3TKAA 2DQSA 2HLPA 1FSPA 3KJZA 2VKQA 5B2ZA 3P32A 4L5JA 5H1YA 4TYNA 3U56A 1GL9B 3M5DA 3R09A 1KFBB 5HCIA 5A7HA 2BFBA 1N2CE 4NOMA 4BV9A 1D8AA 3OFKA 2OE2A 1MCZA 4N48A 2GHRA 4CR6A 1DDOA 3PQEA 4PIVA 3S99A 2B69A 2OECA 3WKDA 4A8JC 5A9TA 4MS3B 3N87A 3OPYA 6NULA 1POWA 3FTCA 5T57A 4M88A 3O8RA 3TOXA 4DDMA 2W6NA 4IPTA 3ICEA 3QM1A 4IJVA 4YALA 3L6OO 2H3HA 3SHTA 2RGUA 4DQUA 4URVR 3SEZA 3D4LA 4OK3A 2QRLA 1FZQA 4YRGA 3UAZA 1NUSA 4Q02A 2F48A 3M6WA 1P6XA 2PD4A 1RI5A 3EH1A 4EHBA 2C03A 3ISVA 1J39A 1N77A 2XQFA 2D13A 4JBHA 4JLOA 5JJ5A 5K3OA 4N76A 3CCBA 1TQHA 5HZMA 1OKKA 3ZS9A 3AEZA 2HQBA 1JG2A 4LQ4A 3NX4A 3ETJA 1O6ZA 2PCJA 1E0SA 3H9BA 4MEJA 4MVJA 4F4IA 1M2JA 4MV4A 1EEHA 2XGJA 1RWOA 1QIEA 1R0SA 1V4VA 3PVSA 1AS2A 3F47A 3GZJA 4JB8A 5D6NA 2OXFA 5GV7A 2EZ9A 3WRYC 4OL0A 5ALTA 1QAMA 1HFWA 2IYFA 1CUHA 3C7KA 3TJZA 6AT1A 4F3RA 2GLTA 5JY6A 1OQAA 3DQQA 3PB3A 4G86A 3GNTA 4HQOA 4IZHA 4JC8A 4G0YA 1NJ6A 2X8LA 4PR3A 5CURA 3USES 5IVKA 2QBYA 2O8BA 1CY0A 3ZDBA 3BE4A 3OOSA 2BTOA 4HWTA 2VJOA 3DEIA 3LM8A 1N8SA 2FQWA 2BMWA 4DDKA 1K6JA 1OXKB 1Q0HA 2ZB8A 4O59O 5E2AA 5FL7D 3VNUA 4LHXA 4NH0A 5AVZA 4H77A 1SUCA 4JQSA 1U0LA 4H60A 4YN3A 4GPAA 5J4LA 2D2IA 4IDCA 4YRLA 4WNAB 4AWAA 2VH2A 2ZPTX 4WPGA 2O5RA 1DKUA 1DKQA 2JJ2D 1JN0A 3UKJA 4KR2A 4OJTA 3G1TA 1GU7A 2PJUA 4AKHA 3MAGA 4L85A 1A50B 1Z5OA 2FW0A 2RSLA 1TM4E 2W2OA 2YWXA 3DAYA 1JLHA 4WZBB 1CYDA 4HXYA 4C87A 4BO1A 2F3PA 1PHPA 2EVWX 2P40A 2XRFA 3B3QA 1Z6ZA 3E8XA 5C7IO 3ELWA 3FR7A 4Q6WA 1DL5A 5CW2A 5K8IA 1QQTA 3TX2A 2V59A 1S5PA 2Q4DA 3CC8A 2I4TA 1XYGA 5H4GA 3WLRA 2F9LA 3AEKA 3KQOA 5A7FA 4QM7A 1OIXA 3G9TA 3NIGB 4JY7A 4NU8X 3F4BA 3QFRA 2NYVA 5DHTA 3U19A 1A5TA 4M8IA 2BEKA 4WKBA 1MQ8B 1S4MA 3RBZA 3QJGA 3NETA 5EHNA 4W4TA 2H8GA 3ST7A 3PUZA 3S70A 1JW9B 4H59A 2WYVA 1I3CA 2DUJA 2OVFA 1M1YE 2YWRA 3K3PA 5DBGA 3UMBA 2NSLA 4CKYA 4ZJZA 3TZ6A 1ODJA 4QWWA 2RHDA 1ZVJA 3MT0A 4FTWA 5BNFA 1QPZA 5D51S 1T8RA 4N6GA 1JKJA 3TJRA 5FI0B 4DIKA 1SMKA 4E5DA 2PUCA 1FPQA 2AEMA 5DHRA 3H1TA 1E8MA 1U2RA 3WQQA 2REOA 4YUXA 2XLCA 4UMEA 2COUA 4QRHA 2ZUVA 3I1IA 3K09A 4IDBA 3WMRA 1JA0A 1ZY2A 1SZJG 5CJJA 2J9XB 2I8LA 4DSUA 1E6WA 1L5KA 4GZ3A 1ZNQO 4TVKA 4MW9A 1AGPA 2F1JA 3D43A 3LE8A 2EC5A 2C97A 2QZSA 5B3JA 1KIFA 3NPMA 2AF3C 3ODPA 3R3YA 3NPAA 5AWFC 3U26A 3JTEA 3AFOA 1JAHA 1JEEA 4IXTA 4K9QA 3T5GA 4QJ4A 3L7OA 3E27A 5CGZA 1KRWA 1CULC 3GUHA 1HDIA 1RKBA 2I4RA 3UW3A 3T61A 4KUEA 1XZIA 4JP3A 4KLAA 5TS3A 4DAOA 4C88A 2WG2A 3FHOA 1NKTA 3PA6A 2FQYA 3IMEA 4XE5A 2ZAIA 2FOXA 2QZJA 4ZQFA 4LJAA 3SYNA 2EJVA 1EFRA 2O19A 1GGNA 3BXPA 4WZAE 4Q82A 2GF2A 5TEVA 3QH4A 1TMGE 3BULA 1ZGJA 4K5QA 1W36D 1JDVA 3V1MA 2EFJA 4TTQA 1EDBA 3T7KA 3H11B 2HA5A 4A9AA 3T5TA 1BEUB 1PJ3A 3U9LA 4A2CA 5TPZA 3B2NA 3DYBA 4QHSA 4LY3A 2CYAA 2ZB2A 3FCXA 3KT3A 3CLUC 1GV0A 1V26A 3DZGA 5JW6A 4X1KB 3KSBC 1OH8A 1QU3A 3R3UA 1ULZA 1W1IA 1Z22A 1P0PA 3UJ7A 1SXIA 2WG1A 1R6AA 4IQ4A 3ESZA 4QQFA 4X93A 1A98A 3FPHA 5TGDA 5G3YA 1DIGA 2JH3A 2TMDA 1E0DA 3AKDA 1MQAA 3HU2A 5AJHA 4YPVA 4C2TA 3RHSA 3A2LA 3O75A 3SLKA 3BCRA 3BFVA 2A35A 5CIYA 3MBOA 2W0SA 2ARKA 5BRAA 2IE0A 1EMDA 1OZGA 2W2LA 2GPSA 2JKYA 5COBA 1PJBA 4R9SA 5P21A 2DR0A 1PK7A 3EC1A 1HH4A 2GXAA 1L6IA 2RHRA 1W88B 3Q7PA 5TVKA 2FAXA 4ME6A 4F9FA 1RYEA 4NJEB 3V5NA 4IJUA 5KTTA 3OVMA 2OXIA 4C14A 3MFYA 3EIOA 1SD2A 3JAWB 3IAS6 5TDHA 2OZVA 1XA4A 1GJRA 1KMCA 2RHJA 3SOPA 5JQGF 5DLEA 2NTEA 1E6LA 4GX5A 4FGKA 2CCKA 1O6CA 1GILA 1K8ZB 2FEWB 4ES6A 2UYHA 5GV8A 4TSFD 2R65A 2PGLA 3O90A 4EPWA 3PF8A 5BY2A 5TARA 3EZFA 1Q7EA 1LLUA 4KXVA 4MJLA 4LI0A 4MV0A 2IXGA 3TR0A 2IL1A 2BKXA 5JNTA 1Q7BA 2UYOA 4PYLA 2O5CA 1UPAA 4P3NA 4YAFA 5SICE 3MQFA 4LWPA 4QUEA 1AUXA 2GHIA 1LBIA 1OI3A 1WUYA 4HTFB 3PUIA 4AMGA 1N75A 3C6ZA 4A10A 4RHUA 3CUSA 2AX4A 2Z58A 4XYMA 3NGXA 4JVSB 4IJKA 2PMWB 4NU6A 5E9WA 1SURA 2Y1LA 1VI5A 3TGLA 4MITA 4OHKA 1V1JA 3IAM1 3II6X 1Z5UA 3X1XA 1U0OC 3Q8MA 2YWDA 2DHQA 1UUFA 3TZCA 4EECA 4FHGA 1IH8A 4YIHA 4G1CA 5JMOA 4RSMA 1BQEA 1JR3D 2HJHA 4KV9A 4HAXA 1WXIA 3C3BA 2IA5A 4AKIA 4HT3B 4QJBA 2I2CA 2EFCB 4IDEA 2VG8A 4II3A 4F38A 3JARB 1CUUA 1ODIA 2KQUA 4NRDA 3C39A 2YFQA 2JC3A 3F8WA 3W5IA 4R5MA 3REOA 5I5GA 1GY8A 4W99A 4J03A 4H7DA 4WFKA 1XKTA 1H6DA 3AOEA 2P4HX 4W8GA 4ZALA 3HYCA 3VTFA 1KYXA 3V1YA 4JMLA 1NSTA 2WMYA 3BGOS 5CITA 1E32A 1S8NA 2DBVO 4AJKA 1N0WA 4JQOA 1TFUA 4IIFA 5L3QA 1J07A 5KTPA 4O5OA 2KYRA 4KIJA 3HXMA 1U7OA 3E9MA 2CKDA 3O1HB 5JPDA 4DR2B 2J3HA 3P9CA 2BBWA 1YCFA 1QIKA 3CZAA 3SQWA 3WLSA 4F4DA 5KQPA 5CG1A 3KU1A 3CLTC 1AKTA 4N0DA 1CIPA 2Q4TA 4BVJA 1E7MA 1XTSA 1SA0A 1US8B 4ABYA 4DLTA 1A0OA 1PT5A 3DULA 3H2HA 1QRSA 1T6ZA 2G36A 1F5NA 4OMCA 1V96A 3A1EA 1M8JA 3F74A 3SMVA 1BE0A 1ZVMA 4ECEA 4DV6B 1E60A 4MX8A 3DB1A 4NBSA 1CPYA 3L4BA 3ZWNA 5IHPA 3OQPA 2IGBA 1CY6A 3R3JA 3ZKWB 1N2CA 5EPOA 3FOZA 2ZP1A 3CUUA 5KNCA 3D6HA 4K9MA 2CL5A 1TJ5A 2O3JA 5B3AA 4B75A 4KSCA 1S1CA 2JHGA 1KHTA 1RKUA 4LXQA 4XWAA 2GH1A 1VMEA 3F1LA 4FLFA 3OJEA 4OAQA 2ATIA 3TLGA 4EHIA 2NYAA 1H1LB 4HH3C 4QXQA 4D02A 3W3ZB 1DO0A 1QM5A 1Z0UA 2J9YB 4TVOA 3CHYA 4E2WA 1ISSA 2JD1A 2SHKA 1OGJA 3R0XA 3SU8A 4F12A 2OOSA 1UPTA 1XZ8A 5JJKA 3GRPA 3OE7A 3VR2A 4ZK6A 4KR7A 2XF8A 4C3UA 3VI3B 1O4VA 4MUBA 4V03A 4LOKA 5DVZA 121PA 4EQ6B 3QU4A 2OV3A 1ZJZA 3CF2A 3CW2A 4NG5A 2H92A 5F3RA 1T24A 4JXKA 2DY1A 3TTXA 3DPUA 3MTQA 1U2SA 2AD5A 1E9CA 3RAGA 1PS8A 3A1NA 3ZHZA 2WJWA 1A88A 4B6OA 3TTSA 3RVSA 5KX5F 3L43A 3H4MA 2NZUG 5DWQA 4DCTA 1JXOA 4P36A 4ZANA 4BE4A 2K2QB 5KYUB 1QCZA 2NYUA 2R6CA 3K9FC 3GLIA 4I0WB 1QO9A 1SKQA 3FNBA 4Z2AA 4M3NA 4RAQA 1U5CA 3BN3A 3I04A 5DIFA 1XROA 1PJQA 4M9CA 1DUVG 1ZCZA 2GESA 1RC0A 2QQEA 1B73A 1QONA 4P92A 4RZ3A 1Z47A 4U9HS 3V7YA 4ZICA 2AF4C 1NNEA 1N6KA 1L5GB 2RHWA 3H4TA 2Z3ZA 1WEHA 3V42A 3CX8A 4OHVA 1YS6A 3CVUA 4FEEA 4JR2A 4UTPA 1TQDA 3BTVA 3N2ZB 2I7CA 4ARAA 2E18A 2G5GX 5F77A 3C3YA 5L3SB 1E64A 3AVPA 2XRMA 1K66A 1SBCA 3PUHA 4MSUA 5D3MA 1V43A 2QMHA 4MIEA 2Q6TA 3ZTTA 4DN6A 2YJGA 2FZWA 4CM3A 2GOYA 1ZI8A 2FSHA 1ZA2A 3MYYA 3LIPA 4ROSA 4WADA 3LKBA 5DHSA 1B0ZA 1GGFA 2Y0EA 3WAKA 2EBFX 4E33A 3UATA 3N2LA 2FY8A 3KO8A 1EX7A 2I2FA 1M73E 4TMVA 4YP9A 4M9XA 2I71A 2ALJA 2JIQA 3I1FA 3IQGX 1Q7RA 5CYOA 3ROEA 5KVAA 1K0UA 4Q3DA 3P9QA 5HEKA 2LKCA 3VJLA 1N0VC 1OFUA 4ZI3A 5BNWA 2HU5A 4ZQEA 2FZKA 1Y4ZA 4DDTA 4ZCRA 2GYWA 5DNDA 2C07A 2Q2VA 3SYKA 3ASUA 2QDXA 3CB4A 3DF7A 4US0R 4N18A 3W9BA 4DXAA 5FLYA 2GTIA 3N3BC 3VVCA 1I5EA 4JGGA 3HBJA 5JSFA 3CSUA 1KK2A 3ZXXA 3KQPA 1WXFA 4X66B 2QUZA 3O91A 2JGFA 4FZ5A 4G65A 4RIFA 3GLIE 1K1EA 1XTUA 1K8YB 4MKGA 2PZBA 1OBOA 2A9VA 1CQZA 2ZDGA 1DKPA 2GN4A 3RFFA 1MKYA 4R2MA 5HJEA 5IS2A 1QH9A 5K6RA 1XNHA 4PM4A 1WPRA 2G76A 4ZV7A 2GAJA 3OTOB 1M75A 1AGRA 1G21A 5EQDA 4X6LA 5ENDA 1MW8X 1N33B 3OE5A 1IB0A 2PX4A 3SX4A 4NVRA 5L51A 1DBSA 4QPPA 2FSIA 1SNYA 1DAPA 4HBGA 3UJ9A 3NANA 3ZZNA 2J9RA 1BOFA 2R6JA 3G7UA 3O82A 4HEA6 1EGHA 4QBIA 1JA1A 4Y2SA 1GZVA 4NFHA 2ODAA 1SC1A 1B6GA 1EVZA 1GNSA 3I4CA 2C83A 4PCVA 4UHFA 2D62A 3GQBB 3OCUA 4MDEA 3RS3A 1IJEA 1OXMA 4ZRDA 3LVQE 1FSSA 1JU3A 1UC9A 5L7YA 1ZD1A 3FUTA 3PHCA 3H6KA 3AZOA 5DTIA 4ID3A 2GYVA 2WT4A 5BSUA 1M9NA 1FP4A 1UADA 4Q1VA 3PUJA 1POXA 4DLUA 2PRIA 5H68A 3QJ5A 1HC7A 5T4FA 4BP9A 4F5YA 4PGFA 2H4WA 1BJRE 2CK3A 5ERYA 1WZCA 1E2EA 1QPBA 2CXNA 3NJ8A 3Q87B 1BHQ1 1FFDA 1MAAA 3K0FB 3K5HA 3I62A 1JQ3A 2PN1A 1Y5NA 3I1YA 2BLLA 3UBTA 1R9NA 2H16A 2QJOA 4YECA 3TZKA 1J9EA 1KAOA 3HH8A 1J25A 2PUWA 3KFVA 3ON5A 5F21A 1WQ4A 2CXQA 1ZD9A 3M4NA 1J8MF 4B79A 4F3KA 3H1EA 4L0MA 2HMYB 3GRFA 4E11A 1ZCFA 1DIOB 4BDSA 4IJMA 4AS2A 3F5QA 4ZQHA 3GT4A 1DJPA 3VV3A 3F0TA 2ZS7A 1X6VA 1Z6YA 3HLTA 1YA8A 3M5WA 3HJAA 2GEDA 4IDDA 3VJKA 3ETHA 3WIEA 3S2ZA 1E3JA 1CP2A 3T0GA 1DZIA 3BXEA 2BFDB 2HD4A 4J1TA 1GCGA 2OD9A 3C7TA 3LIIA 3MAAC 3S29A 1JIKA 4S1NA 1O0CA 5C4MA 2LV8A 4QZVA 5HW0A 4I2NA 1E66A 3EXIA 1JPUA 3M6MD 4OQQA 5DN6A 5FIUA 4NG4A 4BNDA 3IE1A 3KE9A 5HRUA 5EKSA 5BNIA 2CFRA 1VCMA 2C77A 1BCSB 5KYGA 2XUGA 4E03A 3INGA 5IAJA 2XZLA 1T35A 5H5JA 3RS7A 1R4MA 4K9SA 5IYZA 1NM5A 1YR3A 2JJMA 4POAA 2ZSUA 2MYUA 1LC3A 3HVJA 1W85A 2Z3VA 4D8WA 2HMAA 5C80A 3UC5A 3Q8LA 5JSZA 5H3CA 1Q0QA 2AN1A 2VDLB 5KSWB 2M6LA 1LLQA 2VS1A 2DPLA 3MEQA 1I0ZA 4B2IA 4EMTA 1E0AA 4FWBA 1VC2A 3K1AB 3GPBA 3N59A 1D1SA 1X70A 5KHOC 1K86A 2YXDA 5KDLA 4M89A 3IUMA 3KKEA 2AUNA 3NHSA 1H65A 4YJ2B 2R751 1FLAA 1ZUWA 1C1YA 2IEDA 3X1DA 2UZ1A 3EPJA 3RSQA 4UDYX 4NAVA 4UNSA 1C8VB 1QTNA 3KJFA 5LZ8A 2NMVA 1Z7YA 5CA1A 2O0LA 1DXQA 2DLNA 1C3VA 2PU7A 4FOOA 2ACWA 4QOSA 3VZCA 1Z2OX 4MDYA 4E1BA 1OROA 2NO6A 3BIFA 3M3HA 4MGHA 5DHPA 4CTMA 5KB3A 1Z2AA 1OD6A 4OP3A 2QLJA 3D3JA 4QATA 5ALIA 2WY2D 3UANA 3PJDA 3UJPA 4IGFA 3W8EA 2Z09A 5K3DA 4DWJA 5JLAA 7ABPA 4I4CA 1ZUHA 2O0JA 1J90A 3P2KA 1E89A 4W5QA 1ZGAA 1X9IA 5EEHA 1G63A 3RKUA 1TLLA 4ZC8A 2Y05A 4BBAA 1NNI1 2XVYA 1Z5ZA 4RMNA 2OBLA 2V0NA 3GFBA 1RFGE 3U44B 3HBMA 4QASA 4R1MA 2QG4A 1ECGA 1MD9A 1KP3A 4GL4A 2QRPA 2PA3A 2H52A 4CMIB 2VF4X 1H1LA 3P1JA 5EMHA 1Y9DA 3SDSA 3TZQA 4A5OA 5L40A 5LQNA 2GCNA 1YKSA 1BH6A 1SHKA 4AK9A 5IDXA 5K6TA 3IOEA 3J7AC 1OBCA 1ATIA 3C5EA 1YB7A 3TTUA 3IERA 4FNOA 4UPVA 4YAIA 4V0RA 4IIJF 2HV8A 1G21B 1VL8A 4QYIB 3MMSA 4IM7A 1T6XA 1AQJA 3UAWA 2SNIE 1JPVA 3WKBA 2IWRA 3ZU6A 3V4VB 3GNLA 3MJCA 3TB6A 1WHSB 4ITUA 1YRWA 1FL9A 5E6UA 1KK0A 1E79A 4WT7A 3EULA 1QFJA 1F2TA 4R9RA 1CF2O 1ZQ1A 4L9AA 5FFMA 4LF5B 1AVTA 4X8HA 3TVTA 3U7FB 4EG0A 1QYXA 5EP4A 3MJRA 2FRXA 4M9ZA 2D54A 3RDPA 2JFGA 3KKQA 4IXWA 3ZOZA 2OMEA 1NBEA 1TFRA 4WWHA 3R76A 4EBFA 1ADBA 1VG0B 2WU8A 3IUNA 2V3CC 4HEJA 2BL4A 3WGLA 5K5EA 4FN5A 2C2KA 4B8YA 3F90A 1OAAA 4FZ3A 1O03A 1DFGA 1P19A 5EIBC 1E3MA 3ZJYA 5CVTA 5I9TA 1UAGA 1Y3BE 4RLFA 4F56A 5ICGA 2ZJ4A 1XF1A 3FNRA 3KAKA 4X91A 2MOKA 4WOBA 3HEBA 2IBSA 1IZZA 1W19A 3E9ZA 4MMXB 4PLWA 5LQMA 5SZHB 1P2FA 1ZBDA 2ZJZA 3A25A 3L0PA 4OH7A 3THSA 2PIAA 3GLGB 4KPYA 1Y34E 3QWBA 4KOAA 2JL1A 5CM8B 2Y6VA 4P3PA 4C3OB 1DG3A 1GOTA 3O2JA 1GAQA 5JDCA 2P3OA 5HIJA 2IEBA 2I8AA 1H42A 4ADSG 4NCJA 1Q83A 5FJJA 1NXTA 4I19A 3ZD9A 5FOXA 2OHGA 5IJ0B 4WY2A 3G0IA 3AM1A 3N2YA 2O2GA 1CQPA 2PH5A 1XZAA 3RREA 5LQKA 4X24A 3RYIA 4CKEB 2FUG6 4WASA 3U0BA 2DU8A 1RM4A 3CZ9A 3JU3A 2R4UA 3KVRA 2OCXA 3OQJA 2PUBA 3QMPA 2O6HA 3HGQA 5I7UA 1JDUA 4FOSA 2J0QA 2OCBA 4BQEA 1EWQA 5H8WA 1HEUA 4F4HA 1U99A 3KQMA 5A4JA 4IZ6A 3PLRA 1I9GA 2YN4A 4ZARA 1Z2CA 2XTNA 5K9ZA 1XKLA 1O2DA 4TYWA 3ETNA 5IXJA 4AU1A 2XUHA 4G4JA 1LPMA 2Y4NA 4PS0A 4C6TA 5EHZA 2ZIUB 4GGMX 4DC1A 3MSXA 1IK4A 1D0SA 2ORIA 3GMDA 5B1SA 2WSIA 3EZ7A 3HC7A 1AMNA 2PKQO 5ITZA 4IIYA 5ALMA 3VR5D 3EFBA 4BQNA 1RXSA 3E84A 3ZW8A 2QR3A 5K99A 4AF6A 4GUDA 3C24A 3ETGA 1JXAA 4LDQA 2FWJA 1YQUA 4KVFA 2FE1A 4Q47A 2A59A 3TCKA 3U1BA 4MR8A 2DT5A 2NV6A 5J4YA 4J0KA 1YUNA 1T9CA 2JJ1A 1KVQA 3TN7A 1KFKB 4PINA 2WZCA 2Q8NA 2NU8B 1E0JA 4OXQA 3UB4A 3VFDA 4PZUA 1M0SA 3CZPA 3PQCA 3PDIA 3PEYA 3WK5A 2EHJA 2R5FA 4UUOA 4GP7A 5CTJA 3RYHB 5ED4A 1HYBA 3K09C 4Q1FA 1ZMBA 3EW9A 1SXJB 4IMPA 4BUZA 3VR6A 4AG6A 3V9PA 4UEQA 3MK31 2D06A 2OY0A 1L7AA 1RZ3A 1GNVA 4H1UA 1NXOA 2HCRA 1FS6A 4B48A 1O4WA 4CQLB 2DERA 2I2BA 4HQNA 3I9V6 2WJZB 1YASA 5EJ7A 1OB5A 5BW5A 3WB1A 1GUYA 4NAHA 1B0UA 3ND9A 5EXDA 1NBAA 4NPCA 2FSFA 3TOCA 4TQUS 3HG7A 2EW8A 3AFIA 4I4TB 4WECA 2I78A 1GR1A 2JCXA 3HUDA 3WGUA 1JEDA 1ZEMA 3JZAA 4WLUA 4W1PA 3VKHA 3P4UA 4EKDA 3HCPA 4HTAA 1MLDA 1X7XB 3K2BA 2G80A 4WKGA 1MN6A 2I2AA 3MTJA 1Z15A 3IMGA 4C6TB 2XTAA 1ZRNA 2F3QA 1ZESA 2CLFB 3LLSA 3LVBA 4LVCA 3DHVA 4UHBA 4YP5A 5E6RA 1AH2A 4OJYA 1KRXA 1Q2UA 3DEKA 3H1GA 1XC7A 4GMKA 3KDAA 1PWYE 1SIWA 2W93A 2C59A 2XNKA 4KN5A 4UHDA 2H4YA 4HWSA 3P27A 1FSFA 3DB2A 3LHKA 1KK3A 3SZ3A 4TLLB 2WUEA 4GGPA 2R47A 4BFLA 3IBFA 1D2NA 1KTIA 3CY6A 4IV8A 5M3BA 4P08A 1E1MA 3FRHA 2PSHA 3H5RA 3JSXA 4MRNA 3WL6A 4BFWA 5C1PA 1NU8A 3OO0A 2XQIA 3S44A 1ZRMA 2FWIA 1N0UA 1KJQA 5IABA 2CB0A 3G2LA 4RM2A 3Q10A 4CV2A 4CT5A 5CVVA 5BMVB 1M0EA 3ACBA 1BMDA 1AQYA 1GZ7A 4HRVA 4QBGB 2W70A 3KPWA 5K7SA 1V39A 3CT4A 3TSZA 2JIRA 4E31A 2DFPA 1QTQA 4ED9A 2QD2A 3Q7SA 3X0DA 2PMFA 3K70C 1RQXA 2Q49A 3UT5A 2WB2A 3BT7A 4FC6A 3NNNA 4P5PA 5G0SA 5DNWA 4RTJA 1LY1A 1GPMA 2JZCA 2H07A 2HMWA 1ZLYA 1YI0A 3ND5A 1WUKS 5HK9A 4PBRA 3R6DA 5DISB 4AXBA 2EW1A 4KQCA 5B7QA 4MJ7A 2HDNB 3U61B 1NLYA 1A9OA 2Z4SA 3N0WA 2ZDQA 4HUTA 2J45A 1EI9A 1NBIA 2I33A 4PGGA 4TQGA 1ZR4A 1A1VA 3VNRA 4IEFB 4MLCA 2PTHA 4BMVA 1WX1A 3EZ9A 2XECA 1FF9A 3UKOA 3N9IA 3U4CA 3CX3A 3Q6IA 5G1NA 5EJEA 1RYHA 5L9AA 3N2KB 1MX9A 3K4HA 3QVWA 5LSAA 1VKOA 1AUOA 3BWVA 1GD1O 3GBVA 1E5TA 4I50F 3ZZMA 1TYZA 4H7KA 1V6CA 1Z2NX 4RJ2A 3YASA 5KYXB 3K4PA 4LZLA 1FJGB 1XJ0A 1HR0B 3ILYA 1P33A 2ID9A 1OA1A 2FX2A 4UEJA 3W8NA 1T5BA 1FCJA 2BFCA 4M7WA 5CNKA 5MGNA 3ADKA 3QKSA 2PL3A 4J1QA 2DJ5A 3EG9B 1GGVA 1T10A 4LWZA 1LF5A 3T3NA 4O25A 2WYIA 3KJXA 3O3MB 3ORSA 1N3IA 1PYOA 3DFMA 1HQYE 3GVPA 2WTEA 2X8WA 5YASA 3FOAA 1DEHA 1FZTA 3ZIUA 1F0KA 4IDQA 1N4DA 4TWIA 2JFBA 2JNWA 1RMQA 3SF8B 3VPAA 2OFPA 4PLHA 3TW6A 3L8DA 4V0ME 3HV0A 4ABTA 3L6CA 1EFAA 2Q46A 2NO1A 4OB6A 1NJ2A 5BWLA 4W5WA 4MQEB 1Q0TA 2JZOA 3KQSA 5BN4A 2C98A 1E3IA 2RGAA 4P53A 4UZFA 3HA7A 5KU1A 9LDTA 4G5XA 4R2HA 4M53A 2AVDA 1TO1E 4ZVVA 4CUKA 4MLDA 5A9SA 1LPBB 1D8TA 1G8FA 2XB6A 3IIMA 1RRVA 4O4JF 4DQDA 2E87A 3KKNA 4TTVA 1U0JA 5LQSA 1UXGA 2VAXA 3Q6MA 4YRKA 5FQNA 3S55A 13PKA 1OVMA 4KAFA 2O5EA 4NNPA 3RFTA 2NVWA 4UMDA 3VKFA 5KYYA 3PU6A 4I55A 2EXXA 2HQOA 4UAJA 3RVOA 2PGNA 3VC3A 1GAWA 1R1DA 1PX2A 4X6XA 2ZWAA 3IVCA 4MV8A 2ZBPA 5DX8A 4DKJA 3C8UA 2YRFA 1RJ9A 3MC1A 4QA9A 1WVIA 1NIJA 1T3GA 2RHOA 4RNCA 1Z8HA 4DM3A 4EW2A 4F2GA 3NXSA 2OQ2A 1J8YF 1WL8A 2W6OA 1TU0A 3OM9A 1SXJC 1FRZA 2WWWA 3E70C 4NJMB 2VPQA 4L75A 1TTQB 3OZTA 2V7VA 4ENUA 1VJCA 4KFCA 2QX4A 4GQIA 5DBOA 2AYZA 3HKBB 1NQOA 4ZIRA 2JGEA 5LQRA 5FBWB 4CUJA 1QGOA 2OK7A 3QVXA 2FEOA 3MOGA 1X0VA 5IU6A 3RVJA 1NW8A 2DR2A 3HU3A 3AEXA 2PQMA 3KM0A 4FUQA 4RZSA 1Q15A 3AW9A 1PR4A 2F4NA 4MPTA 5JQGB 1EUDA 2RDMA 1ZOIA 4M2LA 1YQDA 5LQCA 4BLTA 1MV8A 1Z45A 6REQB 2HK8A 3H4VA 2B4QA 5LJIA 4MYHA 4GBMA 3RC3A 1H4QA 4JJIA 3I9NA 3BK7A 2QD5A 1ULUA 3PC7A 1HRKA 1FX1A 1QWSA 1W49A 2DFNA 3EAQA 4X95A 4R81A 4EI2A 1KMHA 1V2HE 2H4HA 1B1AA 2IUFA 2Q3HA 1EBFA 4HN9A 1EP2B 2CHVA 3R4VA 1YVEI 3A3PA 4IQ0A 4EX7A 4P7FA 4Z9AA 2FLVA 5IKPA 1ORVA 2R2GA 1RXEA 4ZCTA 4DWOA 4B6PA 5DYNA 4K88A 4UHEA 4XSVA 2VYVD 5A0FA 4ER0A 3EXG1 2C4NA 1IHXA 4DZTA 4RY0A 4IRXA 1K8XB 3WC4A 2JHPA 1YZVA 2I3DA 3AOEC 1FXUA 2QB5A 4UJ5A 3AVWA 1C41A 4LYDA 1T9DA 4RK0A 3GFSA 4TSFA 4Z9XA 1Z2EA 4A8HA 4H7PA 3W4JA 4CLDA 4DY4A 1U3UA 4NFSA 1KO1A 3JQAD 3OJFA 3FKJA 1BU5A 2C0PA 5HMMA 5KNDD 3A06A 3QNMA 3WDMA 4JSRA 1NLUA 1XFDA 2F67A 1Z25A 2PKXA 3MOIA 3O1JC 3PNBA 4CGYA 1DRVA 4EUNA 2Y1XA 3GBPA 5J5VA 4PG7A 1Z08A 2X1LA 4L0QA 1EFLA 5C8YA 5B7NA 2EKBA 2OHOA 4AJ1A 7YASA 4O1HA 3VYRB 4O2AB 1TF5A 1B3BA 2HGSA 3GLHE 4MKIA 3UO8B 4A3SA 5JH7A 3SIRA 4QBTA 3PXBA 3ZDYB 3WNQA 4RY2A 3SAJA 2X0DA 1OSNA 3ZKWA 5AJWA 1FMJA 4Q21A 1ISHA 2QRUA 1R0WA 2Z8ZA 3FTDA 5IAKA 1Y33E 3SS8A 4F2DA 4AJOA 4ZRNA 2B35A 5JC1A 3UTCA 4J16A 3MWJA 4RMJA 3WS7A 4CMKA 4DPLA 3LUJA 8MHTA 2NO0A 1B2RA 1VYVA 2W9XA 4FYYA 2AQKA 1HOXA 3HDJA 4ECAA 4ZZ3A 4DWWA 1GG5A 3M6IA 3DOFA 3ZWOA 5ALUA 3G2JA 1J9ZA 2A9FA 1LPNA 3WLKX 3ZE2B 4RSRA 4P7JA 3C5WP 3TECE 5EJ9A 2RB4A 3OF2A 5BT9A 2KBEA 4ND8B 4AX4A 3JWEA 2HQRA 2X0RA 2IK8A 3I2HA 4DAEA 1BW9B 1AKUA 4XM0A 3TXXA 3DDCA 1UKAA 5LZ5A 1N2SA 1UR5A 1E4YA 5GAJA 1WHTA 1MAWA 4KVAA 4LBVA 1CNMA 4Q1AA 4ZEOA 2ZJAA 2NUTA 1G7CA 1YQWA 1QZ3A 4MVJI 3S28A 3CV3A 1Y8QB 4I6EA 5HQJA 4GMGA 1ZJ4A 1X7WB 2OO5C 2ZBEA 4L6IA 4LHEA 3PITA 3BORA 4MS3A 4HYTA 3IQZA 4OI2A 4UBOA 1DAKA 2YDYA 4HB2A 1IY0A 2IWHA 3IELA 3RQSA 1RRCA 2WJ3A 4GBGA 3TE7A 2PX8A 5E3IA 3AIKA 3IAM6 2Q4BA 4TQAA 1WMSA 5JSHA 1P1FA 2H00A 4ERNA 5AVXA 5JAZA 1GUZA 3LY7A 3V34A 4CZ2A 5AK3A 2HC9A 1M8FA 1XMPA 3BRQA 1E94E 1N9ZA 1TO6A 1ZOLA 2V4ZA 3M4JA 4QICA 3FSGD 4RH1A 4UATA 3OZBA 1Z17A 2BEJA 1V2GA 1Z0DA 4J6EA 3RASA 1B2LA 1MMFB 3E9RA 3AHGA 3QVOA 3THOA 1A77A 4MK4A 4QGHA 3SQOA 3UMSA 1RZRA 1MGOA 3OX3A 3R6GA 5CLGA 4FYVA 1IBSA 4IIBA 4U3JB 3ODGA 3G13A 1VBFA 3A3NA 3T7EA 3NEYA 2JEYA 1NQAO 2DJIA 3OZEA 3D3EA 4HHEA 1AZTA 2O3UA 3GFQA 4MRMA 2CKMA 4K86A 4N7BA 3RC1A 4MO2A 3VQTA 2V0CA 4AMB