3AONB

Crystal structure of the central axis (ntpd-ntpg) in the catalytic portion of enterococcus hirae v-type sodium atpase
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
101
structure length
101
Chain Sequence
MTYKIGVVGDKDSVSPFRLFGFDVQHGTTKTEIRKTIDEMAKNEYGVIYITEQCANLVPETIERYKGQLTPAIILIPSHQGTLGIGLEEIQNSVEKAVGQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the central axis DF complex of the prokaryotic V-ATPase
pubmed doi rcsb
source organism Enterococcus hirae
molecule tags Hydrolase
molecule keywords V-type sodium ATPase subunit D
total genus 33
structure length 101
sequence length 101
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2010-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01990 ATP-synt_F ATP synthase (F/14-kDa) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold ATPase, V1 complex, subunit F 3aonB00
4RNDB 4IX9A 2QAIA 3VR4H 3AONB 5KNBH 2D00A 2OV6A 3VR6H 5KNCH 5KNDH 3VR5H 2I4RA 3W3AH
chains in the Genus database with same CATH superfamily
4WJKB 3ZVRA 3DZ8A 3P2IA 5L3RA 1J8FA 1K6EA 5ALFA 3FHCB 2YC4C 3Q7IA 4CLRA 2PS3A 1U8AA 3UKJA 4O0MA 2QPAA 1F38A 1ZU4A 2ATIA 5LLSA 5GVRA 2XHZA 3BGWA 4MLCA 1JH8A 4K2AA 2LD4A 2VP5A 3EBPA 1DIOB 4JD5A 5JO0A 2FUCA 3DLIA 4I9FA 5AWFC 4Y2QA 2L82A 1OFIA 3M6VA 5EESA 1DDIA 4DT1A 2SKCA 1WKCA 2RHGB 3KLPX 2C5FA 4Q5IA 4MGEA 4R7ZA 2C9YA 1ID1A 4WHMA 4X92A 3GRUA 4IDEA 4IMIB 1KC3A 3C39A 2O2DA 5BNTA 1CDEA 2QZJA 4BWFB 3BRSA 4ZRMA 5DHSA 3SBDA 3WMRA 1Q0RA 2WWHA 1XKXA 2WSMA 4MV1A 1KH2A 2ZJ6A 1ULSA 4TRRA 1IBSA 4O2AA 5DO9A 2X4IA 2QZZA 1D9XA 1VJCA 4IQ0A 5FOXA 1G5RA 1XEXA 2EHJA 4BVJA 3ETEA 1CJBA 4XGNA 5JG7A 1CZOA 4U00A 4KQCA 5EHZA 2PD3A 4EPYA 1NVDA 2Q9BA 3HRKA 3KBBA 2SCUA 2O14A 4KVZA 2Z2KA 5EJ5A 4O1HA 3PEFA 1A4IA 1QDUA 2PN1A 3KOWA 3L01A 3PIIA 4K26A 5A02A 1DMSA 3OZCA 1A71A 5GP1A 1TI7A 2NTYC 4ZQHA 4LVNA 1JI3A 2BE7A 2Q07A 2VYQA 2WIFA 3VH1A 2OOSA 2D54A 4DVJA 2Q8NA 5JYEA 5E3HA 3R44A 4FONA 3OPYB 1TUBB 3RS2A 2P6OA 4IOKA 2CHGA 1P1RA 3FG9A 5DHRA 1WMDA 2QMYA 2C77A 4YRZA 5IXJA 1NVTA 1DV2A 3EA4A 1IPFA 1KK2A 3OSUA 3GEEA 2DR0A 4LOHA 4TQGA 3HXLA 1N9GB 1XP5A 4DDMA 2ALJA 4IZIA 4W5HA 3T34A 3AF2A 4FMBB 3VOSA 1I01A 1PHRA 3NANA 1NASA 1O6BA 2AR0A 1U81A 2OQRA 2WI8A 2XBLA 4LMAA 3B12A 1JSZA 5BR4A 4ZFNA 2PG3A 1YIAA 2XE6A 3HXOA 3PPIA 4A2WA 3GPCA 4RHTA 4XLLA 1NQXA 2PFGA 3LPCA 4BNDA 2CUZA 4ZYLA 2C1ZA 4KIFA 4ACAA 3KSUA 2GK6A 2D59A 2Q7XA 2FZLA 3RC2A 3SVLA 2MINB 1GZ4A 1JSLA 1Z4IA 2C9DA 2P7HA 4DCUA 3K0EA 3SOPA 3I4LA 3STTA 2JFXA 3T0FA 3WLQA 1NT4A 3P9YA 1P81A 2CE2X 3CUYA 3ZW9A 1B93A 1SVLA 4EH1A 4ZZIA 2P8JA 1GM5A 1E79D 3TRFA 2VHYA 2GKOA 2QRLA 1QAOA 1MRNA 2WKRA 3JQEA 3M9LA 4B9AA 3O47A 3E23A 3EIUA 1C1XA 2ZRNA 4GVLA 1JS1X 4L9RA 5DOVA 2PMDA 3SF0A 2QW1A 5A9SB 5IFKA 3ROKA 3O7MA 1GPBA 4XGIA 3T5BA 1BMQA 3H2YA 2JLYA 1BS1A 4OQYA 4AMUA 3BWVA 2XUAA 1V3VA 1TLFA 1Z0AA 2DLCX 1JEJA 3D31A 3V8QA 1B41A 1TM7E 5I7VA 2FF5A 1YQQA 4RHFA 3EH2A 1FFDA 4BE9A 1Y4ZA 4Z4HA 3B1ZA 2A9JA 1I7PA 2NO0A 4G81A 4V0ME 1F1BA 5FLXA 4IFTA 1CUZA 2RONA 4JZYA 1N4AA 2IP4A 4YMVA 5BVGA 3DBHB 2C1XA 1WMAA 4NZYA 1WPRA 2O1SA 4WLEA 4KO3S 4WINA 3RHZA 1NG9A 5FX2A 2Q5LA 3BMQB 2D6FA 1JT9A 1P5ZB 5LP1A 1Z68A 4KQ6A 2WU3A 1QFSA 4MOWA 5TGZA 3GOQA 2G4CA 3TW4A 4BMPB 2QAGC 2F4VB 1HDYA 2BFDB 4B1FA 3ZCUA 1FE8A 2PMWB 5AMXA 5DM4A 1A69A 4ARVA 2PMBA 5I3CA 2NOAA 4H6WA 2P2GA 1XYGA 1NR1A 1BXKA 3IE2A 4TL8A 2XHEA 3LLUA 1X7HA 1WCWA 2REQB 4MUGA 1LK0A 4YDQA 1NJFA 1LCIA 4Y1FA 3L1JA 1LGYA 4P58A 3T7RA 4CETA 2QG9A 2ID8A 1K66A 1YK1A 3AFOA 1YV9A 3LMKA 1J90A 3OOYA 4Q3DA 3NXSA 3ROFA 4DM4A 2ZUUA 5FEUA 1O2DA 2OV4A 5LYJA 3FCSB 4AJEA 4RTNA 1NLUA 4YJ3F 1W36C 1KJ9A 1YULA 2J5RA 4MJ3A 3NV9A 4Q21A 4Q16A 1LDNA 2D7CA 2X8JB 2E2WA 4JYAB 1Y7LA 1DO8A 1BS2A 1YMQA 1FVFA 1G18A 3HCEA 4QU8A 4G0WA 2BCGY 3N76A 4MVCA 4H17A 3X43A 4BE7B 1GZ5A 3QXCA 4UE2A 4A0HA 4IXMA 2EFCB 5KNDD 3VBCA 3IRVA 5JCXA 1RE0A 2OPBA 1R0LA 3BZBA 3DKPA 3H13A 4HB4A 4RTJA 3NEPX 3BERA 5ECGC 1GTL1 4BATA 3FVVA 3SE0A 3DE5X 4ZJYA 2X5KO 2ETVA 3MCTA 4KPYA 4ZALA 1ZI6A 2V7QD 3FOFC 1AN0A 1GAQA 2JFQA 3F98A 2P6RA 4KDFA 3Q5DA 1FLNA 4UPEA 4TYWA 1JKMA 4TTPA 2YJNA 2FZWA 3ZKWA 5ECDA 4B35A 1GL6A 1K6IA 2QQFA 1J2YA 4J9VA 4C6TB 1CF2O 1ESCA 1Z13A 5CK4A 3WBBA 1E3WA 4J94A 3GJ7A 2NPOA 3GROA 4KXQA 3N2GA 4HTFB 3RYHB 1GRRA 2ES4A 3PI6A 4M46A 3D4LA 2GVDC 4RM3A 2VYND 4LW8A 4DLLA 1X8LA 3MNFA 4W82A 3SEZA 3SS8A 2AN1A 3EVNA 2A5FA 4KRYA 3IJEB 4MWZA 3TLJA 3DONA 4BO9A 2BBOA 4ZQFA 1JTFA 5LJIA 2J0SA 1DWPA 1YB5A 4RH1A 2YXDA 4V24A 3ESYA 1Q3TA 3COVA 3NVDA 1RLJA 1BDJA 1XLTA 3QLVA 2BMDA 4XOIA 2G9NA 4QTYA 3SQNA 1WSBA 1WUKS 4IGEA 1KJQA 2IXAA 2YN0A 4Q3AA 4Q82A 2PO7A 3HG7A 3WE7A 5IJ0A 1C0EA 2GBLA 3UGQA 4Q02A 3SJAA 1L7OA 4C89A 5AW6A 2OFOA 2BEWB 2ZM5A 3NP9A 1OAOA 4EGQA 1WVMA 5DPMA 3RSLA 1A5BB 2ZB3A 1NM5A 4NDAA 3T5MA 1CIJA 3OJLA 3KZ1E 1XLTC 3QYPA 3EISA 3L2OB 3PGVA 2YRWA 1HMPA 3NAMA 2BRUC 1AX9A 4UU8A 3QTLA 2JW5A 3THWA 3N8NA 2WG0A 3GPIA 3P2JA 3WWOA 1A4RA 3ORSA 4FNGA 4RV5A 5F3WB 3O8RA 2IU3A 3SLKA 2AFIB 3WL7A 1JQBA 4YAUA 3ER9A 1H2EA 2RSLA 3CBGA 1NWCA 3RGGA 4B0PA 4R31A 2HR1A 1IB6A 4OG2A 1C0KA 1WJGA 3HCNA 4KXUA 3A4VA 5EE1A 1UDBA 1XA0A 3MLBA 4DLVA 4JLOA 4PGHA 2X9GA 4E12A 5A4AA 2H8KA 1A9ZA 3P9SA 2NYVA 4PICA 5ISMA 1NOJA 4E5NA 5BMVB 3E9NA 3EWNA 3OF2A 3JPYA 1TTHA 4FE3A 3VYVA 4XUGB 2X3UA 3RYCB 1E92A 3ROEA 2JJ8A 2JJ2A 1LKZA 1P4RA 1UK7A 1Y3AA 2GCOA 2GO7A 3FGPA 1S7CA 3JQAB 1SU4A 2NU6A 1FLVA 2R9VA 2QAGB 1IH8A 2QAJA 3MZ0A 2CF5A 2IZ6A 4Q4HA 1D04A 4H1HA 3TL6A 4WOJA 4DE5A 5B3AA 1ZL0A 3SS7X 3FM9A 5J59A 1PFVA 5DCYA 1SHTX 3EYWA 2YYYA 4N6NA 5CNKA 1Q1BA 5IJXA 3I6YA 1Q83A 1V2HE 2W6NA 3I4CA 3KFLA 2IYEA 4QULA 2Q5QA 1GPAA 2YQ4A 3T7EA 3FBGA 3KZNA 3VPHA 1UZAA 4KPUB 4XSGA 2ON6A 5EXPA 3OJFA 1WXXA 4Z8XA 1NU8A 1R9NA 1ZXLA 1IIRA 2CHVA 1DCMA 2HYDA 3KEGA 5EGNA 5FAXA 5LKRA 1G2OA 4MQEB 2P69A 4GXRA 2ONKA 4F9FA 2DUWA 2HREA 2C9CA 1SXJD 5JAQA 1WVGA 3QMVA 3OCVA 4WZBB 2VSXA 3UVEA 2IDJA 1X74A 2JEOA 1NC1A 2EQBA 4WMLA 3T4UA 3FTPA 3H2JA 1R0CA 3ZE2B 1PKEA 3DT9A 3E5NA 2MMCA 1P1IA 3HMKA 1O6GA 3NBMA 3RC1A 3ZWPA 5IC4A 2HA4A 4PNHA 4B34A 1I3MA 2F3PA 3L1IA 3NU1A 4J7CA 4JVSB 2RK6A 2OLKA 3EZ9A 2QGNA 1LI4A 3ET4A 4J7UA 4C0JA 3KKMA 1RD4A 3FRIA 4C14A 2PWZA 2WU8A 3RRBA 1C8VB 3MAGA 3MYYA 3NM5A 2DCUA 2FQQA 3EFEA 3O8QA 3CX6A 3QF4B 3R0QA 1QH8A 1IMJA 3NIDB 3R77A 1P8JA 1EUCB 1SKYB 1ZU5A 2V7XA 3PU6A 3RHFA 3SQLA 4ZO8A 1AQLA 1J09A 2XTMA 2AB0A 2FUKA 4DARA 1JA9A 5BVHA 4AECA 5KVCA 5L7WA 4F1WA 4ZO9A 2PKRA 3IEPA 1UBEA 4A0GA 3F47A 1EHYA 4H60A 2VDPB 3EPPA 2JFWA 4M76B 1CQXA 2V5AA 1L4LA 4EPVA 5JMWA 1O77A 1F8UA 5H16A 1RYNA 5DBHX 2WD7A 2YKGA 4JI3B 1XVIA 1JVBA 5DE3A 5G3YA 4AJ1A 1OCEA 4W7SA 4CMIB 1C8BA 5AKJA 1WMEA 2XBUA 3T1QA 4YPVA 1WRBA 4GL4A 1GKYA 3TI7A 4JYPA 2PSHA 2VDNB 3OECA 2QSYA 4C1BA 2HB6A 4H6VA 1N7JA 3UJHA 3FPKA 4Y6RA 3JYQA 3TLXA 4WASA 4JLAA 2XXJA 4P31A 4AICA 4MS3A 1QGUA 1AZLA 5TQ2B 3V8BA 3KKPA 1BH2A 3T5PA 1II9A 4OQ4A 4B79A 4EARA 3GA0A 2MHCA 1XX6A 3EVCA 5AIBA 3O8QB 3WMEA 4X8MA 1J9EA 3OFVA 4ZO4A 3V8RA 1NW4A 2ZTMA 2I65A 1XL1A 2ODWA 3AL3A 1EVEA 2HJ9A 3KCNA 4KDCA 1AIPA 4W5QA 3OJWA 3R6LA 4QX6A 3KAJA 1HDRA 4GXNA 1VZ3A 5IABA 4AQYB 1HQKA 4K05A 1EUYA 4IDDA 1E7MA 2BFAA 4UCWA 2G3YA 3A28A 5B1IA 1CPYA 3CVXA 3TZBA 4L08A 2JLUA 3AETA 5ALVA 4Q00A 2EP8A 5ALPA 2J33A 2FX3A 3DEJA 2D1FA 1QFYA 3D64A 4B3IA 3O4GA 2X0KA 5LOVB 4LQLA 4ZQEA 5FTJA 1C2TA 2AF4C 3OZBA 1HFJA 3K0SA 1AQ6A 1SPXA 3E7WA 2DYKA 1MPTA 2NO1A 4IQ8A 3RF6A 4D3YA 3GJ6A 5HF9A 5BW5A 1ODFA 1GU7A 1P75A 4ILKA 1XWIA 3DV9A 3T3OA 1SMKA 1XIVA 2HCBA 1EFPA 3FDZB 2JFGA 1QG2A 1GUYA 2J46A 3L93A 2QM7A 4WKNA 4BMSA 1Z0DA 4TVBA 2OILA 1US8B 4W9MC 1CG6A 4LKRA 1CUYA 2ZJ1A 4KE7A 1QIEA 1MG0A 4DCJA 1ILWA 1OLSB 4PRZA 3U3ZA 1GPKA 1MH9A 2ZSJA 1MVNA 3A1DA 1ZI8A 1QGZA 3WB0A 4BO7A 5HKKD 4JUDX 3ELYA 3TLMA 2ZIEA 3IV6A 4M98A 3MT9A 4H7EA 3JQ7B 3TBKA 4OYRA 3K70C 2JD1A 3TM5A 2GZDA 4HEA6 2GT1A 1KO5A 1XA3A 1QQAA 2I1VB 3L7OA 4WXEA 1CUVA 1XZEA 1U0HC 2W2LD 4H7IA 5P21A 2IV7A 1ZIOA 5BV7A 1AB6A 4JI0B 2QUZA 1JLHA 3BBPA 2HSJA 4YRRA 4F85A 4DDUA 3WLLA 3O95A 1WOYA 4RV9A 1DTSA 4XM2A 4YWHA 4IDPA 4IOMA 1ZR2A 1E2HA 4AZSA 2BLNA 3HB9A 5EVJA 5CFNA 5KMGA 5E1OA 4WY5A 4IOLA 1Z6XA 2V1XA 1E7WA 3KFXA 2GA8A 5BW6B 3TBHA 4DG8A 4EECA 4EBBA 4FQ7A 3PENA 2PRJA 4HN9A 2NV2B 2AMFA 4DB2A 3RSFA 4ALIA 2VQFB 1MW8X 4ECEA 1N5KA 2JGEA 2OZEA 2VHXA 4DG5A 3M83A 5C5CA 1RTTA 2DECA 4Y9RA 4F2WA 5K1ZA 4YAGA 2FOIA 4PANA 3EMDA 1HYGA 3TQOA 5JXGA 2NPFA 4IO1A 2H1RA 4N0EA 3RH0A 1QFXA 2VZ8A 4QAJA 1A7JA 1YI8A 5JYCA 3R8CA 2EU8A 4MVJH 3SCZA 1SXJC 4EJMA 3MRVA 5BW4A 1SQFA 4MWCA 2FHSA 3G9QA 5CYGA 4ZOLA 5ECYA 1YA6A 4EZBA 1L1QA 1PJTA 1YL6A 2GMWA 3B9BA 4KWTA 4HX9A 4O2LA 2DE0X 4WY8A 4C6TA 3EF1A 3M6LA 3J80A 3GFRA 4BIIA 1JEAA 4YMUA 4LMRA 4UM9B 1OB5A 1IBRA 1OTXA 4CV2A 2WM8A 4RPCA 3GJZA 5JNWA 4PFKA 3EXFA 4GWGA 4N3GA 1YMVA 4U2FA 4PCVA 1GAWA 1NT2A 2FGJA 3MMXA 3H5AA 3NYWA 5HOEA 5L3VA 2Q2NA 1RP7A 4GT1A 3TLEA 5IZCA 3U13A 2Z8YM 3A27A 2ZYUX 5LN1A 4S1TA 1J8QA 2IEYA 1R50A 1I6KA 4ZYZA 4OHOA 5BRNA 4C6HA 3E35A 4FB5A 3PL5A 3EJWA 2AMVA 4TKLA 4HEQA 3IYLW 3V32A 3MUNA 1MLDA 4FCWA 1NQTA 4CV3A 1IM5A 4IIYA 1CZRA 13PKA 2W6JD 3VKWA 3E8XA 2OQ2A 3I3OA 4O2AB 5ALDA 4QSHA 4ZV4A 1GNVA 3ADOA 4GO1A 5IKXA 1MC5A 3FOWA 4DM7A 2FZ5A 5EEGA 3HI6A 4US0R 4B2PA 3LI2A 4JBWA 5B5SA 1L4NA 2HF9A 4K9MA 3P9RA 3PHJA 1VHWA 4P5DA 4ALLA 5COAA 3OQJA 3MTJA 1EI9A 1BXRB 1TJ3A 3LA8A 2X3FA 2BFFA 5EC8A 1JZQA 3NBXX 5HKLA 3DBIA 4AY3A 4E1AA 1PJQA 3N0TA 4PLTA 1JYSA 1GAJA 4E5PA 1XTZA 1IDN1 4OIMA 4NQRA 1SU8A 1YASA 3C6KA 1Z0FA 3SM3A 5DI3B 1YJCA 2J9ZB 3U7QB 4X7BA 2UYYA 1BG6A 3RQSA 1FZTA 4HLQB 1HDZA 1XVLA 4EHAA 4ESEA 4FOTA 3KYBA 1QC5B 5KNCA 4IPTA 3KBOA 3GUCA 4HGZA 2I3GA 2FFQA 2P3OA 4KR9A 5HQJA 2FP3A 4HB0A 4INZA 1FNSA 1KC1A 3BD9A 2O2EA 1GQRA 4LISA 4DCNA 4O33A 3GBPA 5K9ZA 2M2IA 1ZI9A 5JANA 1UDRA 4OXQA 2JB9A 4D3DA 1NJ6A 4YS6A 5EE9A 5CJJA 3RABA 4PCLA 1U7ZA 4QA9A 1P9OA 2PFKA 3NOVA 1KSHA 2R6HA 3C3AA 4G36A 4HS9A 1O8CA 4L8GA 2ZUEA 1YZYA 4DSOA 1DAKA 2GPWA 1SIUA 2APJA 2P62A 4J0GA 5J2TB 3Q9SA 1NU6A 2RGGA 2CY0A 4K03A 5JCZA 1W0KD 5EINA 2PUBA 1U31A 2R0QC 3I9V1 3NW9A 4YO7A 3EDRA 1G8MA 3MOIA 1LV7A 5GIOE 3LKZA 4FLMA 5HP4A 1U7HA 4NC9A 1YZFA 3HLYA 3ZYCA 1U7UA 2QT1A 1JE1A 3JVDA 2VJBA 2YXPX 1ZNQO 2R6DA 4F4UA 2NXCA 4LNUA 4H18A 1LBSA 2J0VA 3BKWA 1BRMA 2O2XA 3WYDA 2HSEA 3HACA 5JAIA 2QAIA 2ZS7A 1WULS 5DF1A 3M33A 2XDAA 4F86A 1HLDA 1U4SA 1RZRD 2FETA 2OCXA 3JQ9C 1V6CA 3HSKA 2QORA 4QE3A 4W8GA 4EG6A 2W42A 1D2AA 1HTTA 1QS0A 5SY6A 4WOBA 1GTRA 1E5VA 3S1AB 1QCYA 4FZ3A 3WGIA 1IK6A 2PUEA 4FU0A 2UUPA 4DR3B 1ONOA 1HG1A 1YTLA 1XQYA 2JJ2D 2J7PD 2ZPTX 3LLVA 4JSYA 4LNUB 4MYUA 4O1MA 3VC3A 2B34A 2AS0A 4MV9A 3GPLA 1K68A 2FPSA 2JGDB 4EB6A 4Q3LA 2JFHA 4X24A 1NVVR 4XXHA 1TA4A 5A05A 1VDMA 3R75A 3IT3A 2ZSEA 1N8TA 3E4CA 4N3AA 4C0HA 2CMFA 5CB0A 4B45A 1U8TA 1X86B 4XUEA 2CHEA 1JMVA 4TL6A 5EXEA 3ZCPA 4AJNA 4Y2HA 4ZKEA 4IFIA 4W8HA 5C52B 1W73A 4M8LA 3PD0A 4LZAA 2QRVA 4PG6A 3T15A 3UAVA 3O3OB 3UMRA 2AI3A 1NXSA 3BPSA 3KE8A 1VPWA 1T9GS 5JCJD 2EW8A 4DCGA 2JKYA 2GEVA 3JALB 4ZHQF 1EZ4A 1YSCA 2AR7A 5EZYF 4P9NA 3GRAA 2I1LA 4FGKA 5H3LA 3FFAA 3FMOB 2GCPA 3WB9A 1A76A 1STOA 4XX0B 2ZI5A 3WWEA 5CLJA 1GA1A 4MCIA 5T8KC 3CF2A 2DWQA 2JLXA 2G5CA 2XCQA 3EDMA 3QVKA 3KOYA 1NUAA 2OXFA 2RH8A 2CJPA 5HFNA 2IF2A 1W5SA 1FJ2A 2B9EA 2CT8A 4FOOA 2PGDA 3ICPA 2I2AA 2CDBA 2IXBA 1ZOOA 4UASA 1LH0A 2VK8A 1KSJA 1B73A 3CF4G 3KLMX 4HSGA 3GJXC 3STVA 4RU1A 5LZ7A 3B9PA 4Q1DA 2UZ3A 3AHCA 4YCLA 5E6RA 1BYIA 3VOBA 5I3ZA 1DC4A 3GFQA 4JJFA 3I42A 3N1UA 2GN6A 4Z9AA 2HDWA 2BTQA 3RK4A 3TJMA 3D6JA 1Q84A 1Q0LA 3IE1A 3IVGA 2IS6A 3KPYA 4FKBA 1KIAA 4FIDA 3H65A 4L76A 1WY7A 2CNWA 2O52A 3FGOA 4RACA 5AHXA 3E9YA 2A84A 1DRUA 2YR0A 4PXSA 5BN4A 4GLBA 4LYGA 2FUEA 3JQ8B 1E3SA 4XARA 2R84A 3QSGA 4BGDA 5IKOA 3MINB 4AW9A 4LVOA 1G8SA 4NH4A 1ZWLA 1R0ZA 2ORVA 2HTEA 1HEYA 5EUCA 1VG0B 2FRXA 1IATA 2X0IA 4FD2A 4N1AA 2RGYA 2HHHB 2I4IA 2JKVA 1E1DA 3RIXA 3VYRB 3NDIA 3VMFA 2FWRA 2OCKA 4L57A 3ZY3A 1A8HA 1GNQA 4F3YA 2DJ5A 3EGDB 1FC0A 4MVJG 3IOMA 4B81A 3OC6A 4ZCIA 2XY4A 5AVQA 3NBZC 2RH9B 2GFQA 3VPCA 3HP1A 1N1GA 2V9CA 1WCIB 2PH1A 3DXZA 4YRIA 1YDHA 1MCZA 2VPPA 5E0OA 3U3XA 2BTQB 1MJNA 4YMHA 2O7NA 4XB2A 3RIGA 3B82A 1GQYA 3EXAA 5AVJA 3GRCA 4ZTZB 2UXCB 4N9WA 3WGQA 1K8YB 3DXXA 5JWHA 3GLRA 1T34A 1JG2A 1P31A 2XEDA 3A0UA 3GAFA 1ENPA 1S8NA 5EJGA 3TNJA 4BTLA 5C81A 2B3DA 3UB2A 1T2DA 4Z7OB 5IXYA 1Q0HA 1H0HA 3HBNA 3PDHA 1B6TA 1PLLA 4NABA 1I9CA 2Q8QA 3KSMA 3TRHA 1B7GO 3P9IA 4FEAA 3PNLA 5T3YA 3L7LA 1F8YA 1F8GA 1XMPA 2ZEJA 1D03A 2O3TA 4BLRA 4YT8A 4Q4HB 2BJWA 1ISJA 4Z4IA 2QM3A 2ATCA 2GHIA 3VO2A 3AP2A 1RAIA 3CV3A 3D0OA 3E4DA 3GAMA 3QKSA 5CT8A 3OOSA 4R1NA 5IS2A 4L75A 3OTGA 4QGBA 4HPJB 4R4JA 4RIIA 4G5FA 4IQ4A 3PPXA 2AJDA 2OBXA 5CT9A 3OCXA 1AB5A 3SIPA 1XQ9A 1T2FA 2OV2A 3CW8X 3RFVA 4L95C 4RZ3A 4BHTA 1XQ6A 4Q9NA 4X1IB 3ZHVA 2GKSA 5FF9A 2QNRA 1KGSA 2ST1A 1S0UA 3IP7A 2ZVDA 2OZVA 5JD6A 1A7UA 1C0LA 4HQNA 2PUTA 1M8GA 1T6ZA 2EKBA 2GPNA 3HNPA 4MSUA 1PWHA 4CNBA 3ANMA 1ISGA 5B37A 2GILA 1UJBA 5IAAA 4GUAA 1PN3A 3RM3A 4JEIA 1EEHA 5BWOA 5CB4F 2HT1A 4HN2A 2XT6A 5CW2A 2ODBA 2I1WA 3THOA 1EXDA 1U7XA 2UYGA 1L5ZA 3ICOA 4P4TA 4XDHA 5MF6A 4DL9A 2CYBA 4HGNA 1TVEA 4URXR 4HNVA 1EAYA 3KOZA 1N34B 1CY2A 1JDZA 1ZDMA 2R86A 2CNOA 3RUPA 3A31A 1SB9A 5E7MA 5A4IS 4YUAA 4CM8B 1AMUA 2Y1GA 3F6PA 4CWAA 2G0TA 3T95A 3X2EA 3CZ5A 5J4HA 2VUIB 2WJVA 3G2QA 3W1EA 4D9JA 1NV8A 1EFTA 1FFYA 4RO0A 4TV9F 2ZW9A 4ZDJA 1NF9A 2Z9BA 2BWJA 1OZGA 1BE8A 3LBYA 1XZDA 4XSVA 5FYQA 3QJYA 4GU5A 4RA9A 4F8YA 3U3OA 4RMJA 3OLXA 3FZNA 4J2TA 5SICE 2IOHA 5C1DA 5IARA 4YDHB 1JR6A 1DQYA 3QFSA 1SUDA 2BGMA 2NACA 2XTJA 3JAKA 4OO3A 5CVDA 4LTDA 4JBGA 1Z56C 2HPVA 1XNJA 4NCKA 3A70A 3KTAB 4WKPA 3WYFA 5BT8A 4KR7A 3ZBQA 1JG4A 2H7CA 2YNMC 1DGQA 1KY4A 1VRWA 2O57A 2Y1FA 3B3AA 3EQ7A 4OP3A 3MCUA 2BDTA 2GXQA 2UVPB 1GL3A 2WF8A 3HB1A 4JKIA 3FCOA 3M7IA 4M1KA 4UDYX 1N3BA 1Y1QA 4D79A 2BGIA 1SRRA 4UM8B 3RKSA 1C7EA 1HYEA 3QW2A 1DE0A 1N2BA 1PAUA 1RHJA 2IUYA 3L5KA 5CIQA 2JDIA 3PXUA 2QSUA 2XMGA 3BF7A 4BYGA 1SZPA 3DW3X 3NQ41 4GMXA 1NZJA 1W4AA 5F9MA 1KK1A 1RCFA 4L0CA 3S5JA 1VIVA 2VEDA 2H85A 1N9GA 2J32A 4S1VA 5K0LA 1ZYUA 1VFPA 4LRXA 3KSDO 1Z5NA 4O29A 1NAIA 2BEVB 5HM8A 1U8EA 3L1UA 5ALKA 2VTDA 3F6RA 3LCJA 4NYJQ 3AJRA 2O6HA 1HLGA 2C4WA 1C3XA 4ZT4A 5DV9A 1ZAYA 3PR3A 3GFOA 2P35A 4Q1BA 3EGOA 1AS3A 1TOAA 1ZXBA 5BN1A 3SDSA 3CVUA 5CCXA 2O1XA 1AS0A 3NG1A 4M0EA 5C32A 1CBUA 2OAGA 3OJ0A 2IEAA 1RS0A 4BJ3A 3PZBA 2AMJA 1A04A 1XEWX 1Y4AE 5F77A 1Q14A 3DOJA 3FI9A 1DQZA 1SHZA 3FKSA 3LE8A 2HBYA 4N5DA 4BNKA 1E2EA 1MO4A 2R1TB 3OFJA 1N8NA 1CQIA 2WWYA 2RAUA 2CV2A 4ER7A 3DPUA 4MUFA 1NRJB 2FSGA 3MCAA 1G42A 1KYIA 5AI9A 3DMRA 2DG2A 4RZ2A 1NI5A 1THZA 2BI8A 3B20A 1BGWA 3I04A 4DCOA 3KDPA 4MIKA 4EPWA 5JU6A 3CVVA 5FWNA 2C3YA 4XPIB 3SXUB 3C6ZA 1T8YA 1CZLA 1F6DA 2XQFA 4D4LA 4CIYA 1Q50A 2FW8A 4ZCQA 1LB1B 3BK1A 4AJ4A 1Z17A 1OH5A 1YFLA 3IL2A 1ULHA 5CT6A 4YN3A 4NMLA 1P6XA 1WBJB 3AILA 2I3DA 4L72A 4W5JA 4A91A 4E70A 4LSWA 4HDRA 5CGZA 2XAUA 1OPRA 3FWKA 4HYYA 2GM9A 5DK4A 3SOZA 2Q4RA 5E2BA 1GVHA 4UUMA 4NBVA 3K8OE 1VE7A 3QBEA 2ZE5A 1IZZA 5DNAA 3CN9A 2QQ0A 5A7FA 2C8LA 2WJYA 1L7XA 4A8JC 4BZZA 4B87A 4HXGA 1J8MF 1EUZA 3L1HA 2YWEA 4B4DA 4Q9HA 2DAPA 2JIZD 2AR9A 2VAPA 3QRWA 4JV5B 1XZHA 3LQ2A 5AVXA 3FPCA 4E7OA 5K0GA 1U99A 2C8JA 2DTEA 2PK3A 3CG0A 3COWA 3EZGA 1EFRA 3I76A 3L8ZA 4LQCA 4LWZA 4YRKA 5H68A 1YCHA 2AJ8A 4JELA 3G0HA 3EFBA 2YV4A 4GLJA 1QYXA 4V0KA 1ONSA 2H31A 3HUFA 3MWKA 1QRSA 1ELOA 5G40A 5BYJA 4RXMA 3L8YA 2H7XA 3LOUA 5CFOA 3HM2A 1CS0B 4NICA 2IH5A 1VMIA 2NZWA 2QG4A 3WKDA 3WISA 4DQDA 3K1ZA 1GZ3A 1UJ5A 4TZTA 3BN3A 1G291 3EXIB 4HQLA 4DXAA 4YY3B 2CVFA 2C9OA 3AUXA 2AQIA 2PA0A 3X1DA 1K75A 1PTKA 3FJYA 3GLFB 3GUUA 1CR4A 5HE9A 3IKLA 2I8LA 3AR6A 4OQQA 3FETA 1KP2A 3SDBA 1Y8QB 1BVRA 1LLCA 4GF5A 5LP6C 1X9IA 4OATA 4QTXA 1ZHOA 2R4QA 1OLOA 2C9ZA 1I30A 4QUIA 5AO9A 4I1YA 6LDHA 1L5OA 4Y2PA 4N12A 3LX6A 2RGXA 4UE6A 1ODSA 3OZIA 5LFAA 1Z0UA 5CG2A 5D3QA 1EK5A 1RAEA 2EWWA 3DLBA 1U0GA 3ML1A 2GEKA 1SZJG 3MFQA 5ARDA 3KXDA 4C0AC 2CNDA 4KTVE 5KDLA 3W04A 1EJ6A 4EG5A 1XDWA 4QPPA 1P74A 4D9EA 3IBYA 1QRAA 3BHIA 3F74A 1HRDA 3AY6A 5M34A 2GARA 3EG9B 4J4HA 5CYOA 2C00A 2D13A 2NIPA 1T4BA 3W5IA 1Y7IA 3ROPA 5JNTA 1NN1A 2YYZA 4PHTA 1OFUX 4X1YB 4EKYA 4LJAA 3AQIA 4RA6A 4M49A 6YASA 1PT5A 3X44A 3B13B 4YT2A 2AZDA 3I62A 3O21A 2EX0A 5K0FA 1CQZA 1M34B 2VJYA 4YT5A 3CINA 3A3NA 2H11A 3RYCA 1LZKA 2XQVA 1B4DA 1Z12A 3FGNA 3K72B 5DSTA 1Q44A 3QNWA 4CCWA 4PAMA 4UZEA 4FWTA 4B76A 5B57C 1IPEA 2ZE6A 5CDUA 3CZ9A 1LX7A 3DW1X 3G0BA 1J1ZA 1NJ2A 5BSEA 2H4JA 2HWUA 4JOCA 4X85A 2WYWA 5HF6A 2X0DA 4Z4FA 2OGTA 4YJHB 4Y1RB 5JH7B 3WBJA 3QUSA 1NXWA 5UKDA 4MS1B 3IUJA 1NG1A 4Y6GB 2TECE 1WSDA 3LQYA 4W1SA 4TKUB 2HI0A 2QMQA 3ENKA 3AEZA 3DHYA 2P9HA 4TT3D 5T4HA 1T4CA 1DUIA 2I87A 3EEBA 2IIBA 1X92A 2D0DA 4BNLA 3EY4A 2PZKA 4D4JA 3JALA 3CE6A 1QV6A 2E1RA 2P2YA 2YWHA 2CDCA 3IUEA 3TI9A 4D41A 4DA7A 3ZH2A 1EESA 4P3XA 4RF4A 2IYLD 4YAWA 5CH8A 4JGBA 2EKLA 2B83A 1PJ4A 1U90A 2ZFUA 1KDRA 3QIVA 5E2AA 1L4UA 5LBUA 2QBYB 1JDSA 4DMFA 3GEHA 2FPLA 1QV7A 4KJZA 4BKUA 5KYXA 2I78A 4ND8A 5U4QA 4KSYA 2IY7A 3G2NA 1UFRA 4LUCA 4NYMR 3QMMA 5MGBA 2F3SA 3MUFA 1E2FA 1G38A 3K2BA 2F8TA 5JS6A 1YR8A 4V3BA 2V0GA 1KFJB 3HBAA 4L15A 3WXBA 1Y34E 1CXZA 1EWKA 4FR5A 3SJZA 2OESA 2HUNA 1JEYA 2A4MA 4WZAA 1HI9A 3GEGA 4YR7A 3DHEA 2X7HA 4YMLA 3DC2A 4N3BA 4QUKA 4AP6A 2CDRA 1PZEA 3G9UA 2NP6A 3PR1A 5H3HA 1KWKA 3Q98A 1P5FA 1G21B 2AZMA 3ZTYA 3EC7A 3ZWYA 2PT9A 3LIPA 4CBVA 4F5ZA 4JI6B 4INJA 5C8VA 3GVIA 3V8VA 3KQNA 4LYYA 3G88A 1HKUA 4PN3A 1X7YA 4ZTBA 4JJKA 1RC0A 5HQTA 2PV7A 2K7ZA 4JL5A 4KN9S 2DQ4A 3UV6A 1JEYB 4MIOA 4G01B 4IIJF 5KYYB 1IHUA 1VBKA 3LZCA 4HFMA 2I0FA 2YXEA 3O82A 1EFCA 4DV2B 1RQLA 4DQVA 4XTCS 4EPRA 1MHTA 1XDGA 4FT2A 4FE7A 3HY3A 4CG2A 1UZUA 3V2HA 4OJYA 3GP5A 4A03A 3NIFB 3WLOA 4E2FA 3UQZA 3T7IA 2IIQA 1K1EA 2DY1A 3GO4A 1EK1A 4AYTA 3CLSD 4QUBA 5ITVA 1CUSA 3KSZO 1DC5A 1RCUA 1PL8A 1VP3A 2C2KA 2QP3A 4JVOA 3IP8A 4KXWA 3W77A 3A2NA 4AZ0A 2B61A 1T4CB 3IR5A 1BFDA 4LXGA 4J3NA 4EA6A 2CJFA 1KY5A 5AOCA 4X60A 2NXJA 4DJJA 2BAGA 3ZWDA 1OLUA 1PW7A 4Y0NA 3ZV4A 2F1KA 2JHFA 5FI1B 1H6AA 1W0JA 1FVXA 3RCBA 1UK6A 2J5XA 3I9KA 4WGFA 3A6LA 4E4RA 2YFQA 4ER5A 4IXWA 4B6FA 4LGVA 1JJVA 3AF6A 3HV0A 3FLAA 4IRUB 1IN5A 3VBEA 3C70A 5JWOA 1IBKB 3NHUA 1NL3A 1Y4SA 5ENVA 5U4XA 3ADKA 1WS6A 3D5EA 4DLXA 2GD1O 4NQZA 1ZFNA 1VJ0A 1M83A 4D25A 4P7GA 5TX7A 1Q2UA 3A3YA 2QOEA 3DDWA 2L42A 1L7EA 4HB3A 1RC8A 5IDVA 3WJ7A 1E5QA 1M6HA 3O4IA 4MQUA 4NOLA 4QREA 2NXNA 1P73A 2QX9A 3KOXA 3ITEA 1DEHA 4FXOA 4R1PA 5D6OA 3RC7A 4HH4A 2PXAA 2OFPA 3LAWA 3K92A 2AC4A 4D9MA 1CE8B 4EPTA 3D0KA 4DDVA 4UM9D 4MH0R 1GZ7A 4ZIRA 3OUUA 2VL7A 3EULA 3B3QA 1WXWA 3OM1A 4CQMD 5IPFA 3I2JA 1NMQA 4KVGA 3CEAA 4JMLA 5TDHA 3CISA 4I9HA 5GAJA 5JZ9A 1TD9A 3DPIA 3OG9A 1TVCA 4ETMA 4LDNA 5CCEA 1X94A 2QTVA 1UOEA 1T43A 1Q19A 1V39A 4US2R 4GOND 4K86A 1S1MA 3G8DA 4OU4A 1NI4A 4IDQA 3OETA 3WLSA 2IW3A 1I3OA 4MQFA 3GCZA 4B80A 1KDYA 4CM4A 1VG8A 4F2PA 3LH5A 1ADFA 1NUSA 1QG4A 2VJKA 1ECFA 1GQFA 1D09A 1N2CB 4NBWA 3HR8A 4RJ2A 4CFZA 2NAPA 1A9PA 1MAUA 5HFAA 3I9OA 1Z2OX 3RTBA 2B8JA 2P1DA 4IZ6A 4EJ6A 3O4VA 4M9RA 3HDVA 2Z5LA 3DC7A 2HCTA 3B70A 3N28A 5HKAA 5I7FA 4CFSA 2WAAA 3MOSA 4UJ3A 6NULA 2LGJA 3E05A 4MUXA 4A6DA 2IYSA 3R6WA 3SP1A 1JIXA 4MAFA 2G4VA 4ATNA 4IIUA 4AZWA 5J4LA 4CUKA 4GBED 4NBUA 3WIOA 2XGJA 2BP7A 1BE6A 2PKQO 2XUOA 3DJFA 4DLNA 4B17A 5L4LA 2OV8A 4LZPA 1L8OA 3MQFA 4BMNA 5A71A 3PUZA 5ERXA 3EUFA 4ABTA 1OHHA 2BONA 4LE1A 4KN8A 5K0JA 2AFVA 2XMBA 3EHEA 1U3CA 1HPLA 3MGBA 4HWSA 4Q93A 4DLTA 1Y9JA 1KJYA 4WXHA 3RJ9A 4MVXA 3PIRA 2PL3A 2HLHA 5FWAA 5BW8A 3P4UA 4RVFA 4KN5A 4QPJC 1H5NA 2DM6A 4U5QA 3DTNA 3L4SO 5IJWA 3A04A 2WF6A 5JQGB 5EUQB 2MWMA 1AHIA 2VH1A 3RBZA 3O9MA 1B0AA 2FRDC 2D5CA 3PC6A 3RVNA 5CB8A 1H2HA 1LI5A 1LJ8A 1UT8A 3H04A 3OT5A 4YXFA 3D2BA 4HFRA 3IAHA 5JPCA 4L0QA 4UAUA 3ZWQA 2BTOA 4N5MA 4BGEA 1UXGA 3PKJA 2REOA 1M8KA 4DMGA 2QS9A 3LUJA 1R7RA 2LZ0A 4RMHA 1XJ5A 2BVNA 3T8YA 1H9CA 2JNWA 2YXNA 4G5SA 2VP2A 1LDBA 2OCBA 1AVTA 5CBPA 3LBNA 1NSFA 5HRCA 4ZEXA 1GYPA 3HB4X 1N5OX 2JIQA 1M6VA 3T9EA 2P0EA 2R3SA 1GQ2A 4JJ6A 4DG9A 5HKBA 1YR3A 2HCJB 3QKSB 3ETCA 1A9OA 1PK7A 2DQKA 3GRPA 3RV3A 3OMWA 4DEVA 1KDTA 5FFNA 1I5RA 4L4XA 3CRZA 2F3UA 4MEJA 4MLPA 4U9IS 2KW5A 1BOFA 4UCXA 2WVAA 1S89A 1K7FB 4XIYA 5AW9A 1UBOS 3VHXA 1FS4A 1PEYA 1DJNA 3QG1A 4H35A 4JJZA 3T94A 3ACCA 5E8JA 4OP2A 1JXQA 2A78A 3L8MA 4INAA 3UHAA 1JQDA 4U1RA 4YAJA 1YZUA 3RODA 1TQ8A 2WJAA 3L8HA 4Q3EA 5ALTA 3WMFA 5IASA 1YR2A 2QD1A 3JQBA 4CM8A 3ZCRA 1V16A 1URPA 1ORRA 4MUMA 3VA7A 4MMZB 1H2BA 3DZDA 2HX1A 1ZD9A 1OROA 3PK0A 5GONB 5KTSA 1GRNA 4IIHA 4YMWA 2B3TA 3VOAA 1DTWB 3NC4A 4GMHA 2PH5A 1Y5IA 4H27A 1MQ8B 1XHFA 2GF2A 2HGSA 3C7CB 1XVVA 3CEJA 1P2SA 5GJCA 4CMHA 1OBCA 4ER6A 5KC8A 4FC7A 4LZZA 4R2HA 3MT7A 3PHLA 4ZK2A 2J9XB 4G09A 5AKXA 2OLJA 1JIJA 1OX4A 1RAAA 1T1EA 1DL5A 1XZGA 2P2ZA 3L84A 2HEIA 3LPAA 4QD3A 1RJ9A 3O3NB 2JS7A 4IKPA 4NE9A 5ELMA 3L7JA 3Q12A 5GOTA 4JITA 4OL9A 2FZVA 3A6ZA 4E0BA 1D2EA 1N2OA 1PNOA 1W29A 2JAXA 3NAQA 1N7HA 5FL7A 3EXFB 3VZBA 5IH3A 2GNOA 3DNMA 5CA0F 2UVPA 1RVDA 3OTIA 1GT91 2RB5A 3C98A 1JALA 1RWPA 2X6QA 3K16A 3T06B 1AKYA 5BRJA 2IP2A 3C85A 4YUZA 4OB8A 1O97C 3I83A 4YFYA 4Y98A 4CQLB 2P3QA 1IHOA 2JI8A 3OEEA 1HURA 4MVJP 3SS9X 5AW0A 1OB2A 5TGTA 2V55B 3UY4A 1Z22A 5EIBD 5K3DA 2HA3A 3NRJA 1WXFA 4H7FA 3GLUA 4KQEA 5F1PA 3R5FA 4FGUA 4M22A 3IA2A 4YRPA 3TIIA 3U7QA 2RI0A 3ZG6A 5HFJA 3HKEA 3HYNA 5C5IA 2YOHA 1U3VA 3UB3A 3FKJA 1TKBA 2FHPA 2XNSA 1PWEA 3DKRA 1H9AA 4JLVA 1M2EA 2PKCA 1M1UA 1WU8A 3IP9A 3GGSA 3VR1A 1SFRA 2OB2A 4BVGA 4U6SA 4OJNA 3BIJA 2Z56A 4AU1A 4QQ8A 3B8HA 4ACBA 1SVUA 3GQBA 4BP1A 4B6QA 4G0PA 1XKLA 1M2FA 4B3MB 1BOOA 2R47A 1NJSA 2QV0A 1ZY2A 2ZU0C 1H4SA 1YBFA 3KL2A 4Z49A 1V9CA 1QIKA 1XRLA 2OV6A 4G2NA 4Z2AA 3B1YA 1T8PA 1E5TA 2ROQA 2ZOSA 3G0GA 3CCBA 1TF5A 1WZEA 3P71T 4MW2A 4OCZA 3AERA 3ZHOA 5AUPB 1B2LA 1O89A 2AL7A 1QE5A 1BX0A 1XAHA 3BSFA 4LAFA 4Q03A 2Q7DA 3VR3D 3NB0A 4G4SO 4H7JA 4JMPA 3I12A 4NH0A 4NX2A 5G02A 5SZHB 1K7XB 3T9FA 3FZQA 2W6MA 1KO7A 3ORQA 1ZLYA 3W1WA 2IY8A 3B1FA 3NBKA 3MBIA 4LOKA 3OIDA 2GS9A 2X14A 2SECE 1WMBA 2UZ1B 3BGIA 4UTVA 3A36A 2YJ6A 1NMYA 3ICVA 1YNSA 4JIMA 3F4LA 2B6HA 4LRTB 4BGVA 1TCUA 3NUQA 3R3SA 2GZ3A 3ZDEA 2Q0HA 3LXUX 2HSGA 1IQRA 2I4LA 3AERB 5CG1A 2D1TA 3CLUC 1N0IA 4RE6A 5C5DA 4U8HA 4ZT5A 2W2KB 5EE3A 4KX3A 3DZGA 1G98A 1TM4E 1W4RA 2UV8A 1I4LD 4URUR 3V5NA 2AZ4A 2GF9A 1Z7EA 2FSFA 5KYNA 1VHTA 2I2WA 1GGEA 4NYJR 3GLGA 3TLKA 2PGOA 3ZXUB 3TOZA 1NZDA 2AQHA 2I54A 3DV2A 3N2KA 1R4MA 5AUQA 4EJSA 1UZNA 1YUBA 5CRIA 4HLUC 4IJKA 2QG6A 1ABBA 4Y9UA 2CXHA 4W1PA 2DPHA 1WO8A 3LGAA 3IODA 4BE4A 2PUDA 3OI7A 1PD0A 3M3DA 1GOTA 2HQOA 1QMGA 2DY0A 4MYCA 5CVUA 4NP6A 3DE1X 3V33A 2C3OA 2JGKA 4I1OA 4WKGA 2YVQA 3PFHA 2H1FA 1YFJA 2AJTA 2FCRA 5HCUA 5EI5A 1ZVKA 3TQSA 4IIJB 5AJZA 3WLEA 5CFZA 5K3FA 4G8JA 3L6CA 4ENTA 1Q77A 1WXIA 4BX0A 2GN1A 5JISA 1YGPA 2XSZD 4FI3F 1RMQA 1Y1SA 1YC2A 3DDCA 3H6HA 1MXFA 1N2HA 2IU6A 4ICIA 2Q27A 4QFBA 3BXFA 1DUSA 3DOCA 4J2HA 1DX9A 4G97A 3WAKA 3WWYA 1H93A 4D99A 5IDWA 2W8ZA 1EXMA 4GICA 1NBIA 4PRLA 1I4OA 3HQ4O 5JCOC 2CZGA 4JCOA 1U6JA 1YUNA 1NWHA 1NPYA 2FCAA 3W8NA 3IHWA 4YJ3A 1TZ2A 4N9QA 1F6WA 5JUWA 5JNSA 1C3EA 2OM6A 5FXMA 1MGOA 3IPXA 3QOWA 2BZ0A 3IUSA 1NAHA 1Q7TA 4KLZA 4LYFA 4PSCA 4ENUA 3ZE9A 4R6XA 3S4YA 2V7GA 4P4UA 2VK1A 2D4AA 3CB4A 4MWOA 3STYA 5B2EA 2YWXA 3BGSA 2G4LA 3VX3A 1LXCA 2N0SA 2AMLA 3OPNA 4QGFA 5K3BA 3B36A 4NFSA 3V2UA 2QTZA 5LQSA 5LMNB 3SR0A 1NRIA 1X42A 3JD2A 3EBOA 4A5SA 2IC5A 4W5NA 4MI6A 1F06A 4WZAE 5CIWA 5HZKA 3L7AA 1SUWA 1NM5C 1NONA 4MI3A 3S2GA 4YCCA 1RWBA 2KS6A 3VSBA 2XUIA 3IOCA 1SELA 4HNTA 2PRKA 1UBHS 4NDZA 2WF5A 1UIMA 1AQNA 1UJ4A 2YZ2A 1TQDA 3REQA 4D3ZA 2V6JA 1U1DA 3QE9Y 3OP1A 3OPVA 5IUKC 2V96A 2Y6UA 1MQSA 1E3IA 1QPGA 5CAEB 3WMGA 3ZJYA 5I45A 4XEHA 2BM8A 3G0CA 1NQAO 1VPEA 3INTA 3PC3A 4XWWA 2EGGA 1T3HA 4MHOA 5AW5A 1ZN2A 4O8CA 4GBJA 1UM8A 4Q0MA 2F48A 4QBGB 3B6KA 4DIOA 2D62A 5KQSA 1PTJC 4ZZ0A 3FWNA 3QPVA 1U3UA 4FYYA 4RAOA 3UH0A 1OREA 1SBHA 3JQ8A 4MYHA 1RKUA 4UBJA 4ZYTA 5TPZA 5T64A 1EBFA 5HUHA 3LXXA 2A94A 1YO6A 2V4UA 1JG7A 4N7MA 2RAFA 4LECA 1MJFA 5AQ1A 4B7ZA 5KBYA 4ZOEA 4MITA 2F55A 2ANBA 3H2GA 4ZCPA 2ZIUB 3NFYA 1VXRA 4G9BA 5DEIA 3MWDB 4ARBA 4WQMA 2OO5C 3WP0A 3KQLA 1DO0A 1Z3CA 1JDTA 1OIWA 4B3JA 2CV1A 3M6WA 1MNQA 5HCIA 3RVPA 2F2TA 5L6MB 2GD6A 3T7CA 5LZ8A 4BNZA 4MUAA 5U1PA 1ORTA 3VNQA 3TWOA 3WXMA 1T9GR 1K4KA 4MUBA 1JHXA 1JJFA 2OTCA 2OYCA 4CT5A 1KVSA 1PQ4A 3O4FA 2GHRA 3RU2A 1ABEA 2F00A 4PPNA 3DZCA 3PX7A 4ARCA 4Z2YA 4DY4A 1PNRA 4FQ5A 3ILYA 1NP6A 1QO0D 2A9PA 1YE3A 2L2QA 3IERA 1W76A 1FY2A 4HS4A 1GNRA 1QHEA 1TQ6A 2JJMA 4DIEA 1ES9A 1DBQA 4FZRA 4PHGA 1KFCB 3PQFA 4YFVA 3SNKA 3PQDA 1U0FA 2FMFA 1NFQA 4IG9A 3VNRA 2BYTA 1G59A 1HDXA 3TAHA 2ZDQA 1WIWA 5JRJA 2WP0A 4U5XA 1LU9A 1W85A 1U11A 4RK6A 5KNBH 1SGWA 4IEFB 3GNQA 3I45A 2EG5A 4FGJA 4BJHB 4KNYA 4HEJA 3BE4A 4YBRA 4L4RA 2EJVA 3NEJA 1GUDA 4TQUS 1PNQA 3QKTA 1I80A 5SY4A 4R8KA 3D8RA 5EJFA 5K20A 1P1KA 5B6IA 4FBGA 5HG0A 1TF2A 1YZNA 2CDAA 3D4PA 3FRHA 3OICA 3PX2A 2B7CA 4ZD6A 1FFEA 4B7XA 2OD7A 3H0CA 3NP7A 3IQXA 3FSRA 4J76A 4UATA 5F12A 3KHSA 2VJAA 4QWWA 1JG6A 4WEQA 3KKKA 1DC8A 4FNAA 4IJWA 1W46A 4ISCA 5ESRA 3SR4A 1IHPA 4AULA 2YVUA 3Q9UA 2HA0A 1PRYA 3OWOA 3EVAA 4FW9A 5KYYA 3OE7D 1KZ1A 5IAOA 3KETA 2ZR8A 5CPFA 4PYIA 4YQFA 1QRUA 3C41J 1EE2A 1LPOA 1JQJC 1OC4A 1AQYA 3GDOA 4Z1MA 5CIYA 4KQFA 2OZLA 2FPUA 2A7QA 4M7PA 1E4EA 5COBA 4GRIA 4D1YA 2XRYA 3HU1A 2MR6A 1B6RA 2NZYA 3NATA 1ST2A 3WGGA 3ZXIA 1ZGCA 4E2YA 1PI3A 2PXHA 4KK3A 4TWJA 5CB4B 1XZMA 3T12A 3WRXA 1AOXA 2V3WA 4PPQA 3HVJA 5LA6A 3LLCA 3VZPA 1ZCZA 2JIMA 3LT0A 1FQJA 3H8VA 5JC1A 4IKEA 4K81B 5B4VA 2ZRGA 2VP0A 3CLRD 2OBNA 3S28A 1U6KA 5BRAA 1T0UA 2WE8A 3R24A 4KWEA 3G2OA 5BMOA 1RPTA 2VYCA 4WA7A 3SEAA 4XWAA 4H9GA 4IV0A 5ALLA 1H8ED 2QTLA 2X9LA 1Z07A 2CLFB 3HCBA 4R3UC 4E09A 2XPCA 4JBNA 4Y6SA 4E30A 2WPNA 5K3CA 1MAAA 1WXGA 1TA9A 4ND6A 3UC9A 2PT7A 3LPDA 1CB0A 1E1RA 3OHPA 4UUAA 2D2XA 2AOVA 1NTOA 3E6AA 2ZIVB 4RLQA 1K7CA 2J3QA 1YAJA 3DBLB 4E22A 1EAMA 4OY3A 5E9AA 1X1EA 1L5WA 3K0HA 1G6OA 2PX4A 4W7IA 5K6AC 5HOQA 1E59A 2OXEA 1GTSA 3ZZ1A 6AT1A 4PBSA 1D6JA 2NO9A 1KEPA 2BI4A 3GA7A 4R1TA 2HEGA 1LBEA 3K6JA 3S8MA 3VSCA 3M5DA 4N0DA 1OBOA 4FYMA 4P5PA 4JJAA 5JOQA 1YQEA 2JGAA 2HV8A 2K4MA 2VUTA 4ZOCA 2OHOA 2KI5A 1O6ZA 1FDWA 2OHVA 1IN8A 2RGNA 3V6LA 4P92A 2RGDA 3KV1A 16PKA 3MCZA 5SYNA 4X64B 4CEIA 3K5WA 3QI7A 1IL0A 2VNAA 2VRCA 3HKBB 2H9AA 1EA7A 3PL1A 1DDOA 2PTHA 3ZKAA 1VMEA 2P67A 3LCMA 4H08A 4O02B 3NVKI 2X8WA 5LIPA 2P30A 1Y0BA 4IDNA 5EUBA 3KXLA 3IHTA 3L6DA 4HKTA 1IHXA 3W6UA 5E7QA 1FS6A 4HDRB 4LCEA 5BN3A 3PXGA 3CSSA 2F1HA 4NENB 1XNRB 2NG1A 4J2OA 1HA3A 1KZHA 5BSKA 3L1KA 3B53X 1ZH8A 3BKXA 4BN4A 4YRAA 1RMYA 1W4ZA 4HLNA 3CNHA 2XYPA 2VRCD 5JJBA 4IJ6A 3AIKA 2W6ZA 2JFUA 4IVRA 1XPRA 3OOHA 1Q7RA 4M1OA 3KT8A 4FK8A 5D1NA 3RVDA 3P4YA 5FPTA 2KLBA 1NDUA 1OX5A 4H1VA 1Y3CE 4EHHA 1A2BA 1NNUA 2XMZA 3FFWA 3F73A 1LC0A 1ZH0A 2R6JA 1U7DA 4W5WA 1HDIA 3Q87B 4IUBS 2FLKA 3JQGA 1H2FA 4G0UA 1GGKA 4ZI5A 4B6EA 4I4CA 4F06A 1IWBB 2RC5A 4ENPA 2C4HA 2BSXA 2Q5HA 1GG9A 2BN4A 1IY0A 4GI1A 5GVSA 3T4XA 3IBGA 3WB2A 5FDFA 3U09A 1WV0A 3JQAD 2VP6A 4MPTA 4BKMA 3LGXA 3NCTA 3SX0A 4EG1A 3SN6A 2W83A 2PWAA 3LU1A 4ZA2A 1I36A 1WPXA 1U6IA 3FYCA 3TZQA 1F12A 1JFRA 3E81A 4CVNA 1O87A 1GTG1 5I01A 3HYLA 3SGLA 1BX3A 3DB1A 3M9XA 3NTOA 3UHJA 4C2BA 4NU0A 3K5HA 3LOQA 4GP6A 1E2BA 1Z18A 1KDPA 1UL1X 1EP2B 2VHCA 3VZSA 4AJIA 1CP3A 1ZINA 5D86A 2A67A 4IXTA 1JIUA 2BFDA 2GZ1A 3PNBA 1NW8A 4O6VA 4YROA 2CYCA 3VSEA 1U0RA 2P3LA 1UFKA 4G1FA 2OA0A 3UKDA 4DMKA 2C29D 1WCV1 3LW8A 3HRHA 1P77A 2LIVA 4LBWA 1IOLA 3ISVA 1YR9A 4DADA 4U6QA 1PR6A 2XDYA 3AZQA 1LF0A 4Y3UA 5IHPA 3D81A 3IAUA 5FCDA 1W5EA 3USES 4NV3A 3K70B 1D6NA 4MV4A 1DQPA 4B71A 1P62B 2YV5A 3GZNB 2IP1A 3KS9A 2CNWD 3DTVD 1U2TA 3L7CA 4UQPA 4ZAZA 2AYZA 3VR6H 5FUQA 1UADA 2ZRMA 4NXMB 4CODB 3V4LA 3LDUA 1HXHA 5DX1A 4Z6KA 3H6KA 3R09A 3H75A 3U4IA 3AJAA 4JQCA 4XM1A 1RQPA 4EHNA 2Z2XA 3HPQA 2LXNA 2O8BA 1IZ8A 2Q5EA 3AYXB 4O59O 1QANA 4JS0A 4B3TB 1WF6A 3HCCA 3K8QA 3P27A 3PCRB 1AGXA 1C1XB 1UXHA 1C3OA 2EX4A 2IK8A 3JARB 4LZLA 4TMTA 5AK6A 1PJ8A 1N25A 2CXTA 1NFFA 3DTVA 4F6RA 4BFCA 3F8TA 4WESB 1GSHA 3JYLA 4LRSB 4TTJA 5IZCC 4RIEA 2Z08A 3TYXA 5T57A 2QTMA 2OGWA 1R4MB 4MZDA 1R12A 2JARA 5L53A 2PANA 1W1WA 2WWIA 1UOQA 2KBFA 1UK8A 3GT4A 3K4PA 1EM8B 3K9QO 2X76A 1PL6A 4AK9A 2WUVA 3FWHA 4EG4A 4XSHA 1PKXA 3LC7O 4KX5A 3JVVA 1Y5MA 3U48A 4DDKA 3P96A 4FWBA 3GA5A 4DUZB 4K46A 1KSFX 4CM9D 3EQ6A 3GRYA 3L79A 4MEBA 3T9CA 5G0WA 5C8DA 2CEKA 1ZMXA 3BOSA 3GLHE 2J3DA 1BWRA 4YUXA 4QBKA 3C8UA 4PGMA 2CCJA 3WDKA 3DFKA 1MW9X 2B92A 4FIZA 3P20A 3U3RA 4GI3A 3ZU2A 1JH9A 1W35A 5G0UA 5KMGB 2WMOB 2YV3A 4K9SA 5EIFA 2DFDA 3PQEA 2PAAA 3B2EA 3H5RA 3G5UA 3K1JA 5F7JA 5BSFA 1DC6A 2PBZA 3G5AA 1ZSNA 1GPWB 3N3BC 1L3BA 4R1QA 4XX0A 4W5TA 2BGWA 3K32A 2XMCA 3E15A 1YUMA 3T1OA 1ODLA 2PUAA 3LWDA 5I7UA 1V7ZA 1UMKA 1AZTA 2GHTA 2Q45A 3ZGLA 4P80A 2G71A 2PKYX 4OKSA 5C7OO 4WNIA 3THWB 3V6MA 1IQ0A 5CW1A 3JAMA 3TGLA 1UKEA 5FWYB 1NVAA 1PJRA 4PZYA 5G4LA 1TJ4A 4QOSA 1ISSA 1Z0SA 1QPBA 4S3MA 4FKZA 4KH1A 1DKNA 2HV9A 4XR9A 3NTLA 4FOSA 4CR6A 5IX8A 3EVFA 2H9YA 1CNFA 4RSGA 3V7FA 3OLQA 2AXQA 3VISA 3WOHA 3A7EA 4NK5A 4GDFA 5J63A 4RD4A 1W6RA 3P2EA 5I6DA 1W48A 4UBKA 2NP7A 4HWPA 1SEVA 4EHIA 5A1TA 2I6SA 4TKZA 1V3QE 3BHJA 3FDXA 2YIJA 1SQ6A 4G25A 4CGYA 5C35A 5K0TA 2PQ0A 4JLKA 1JDBC 2IYTA 1XZAA 3LA6A 3H2HA 3O3CA 4UD6A 2P2NA 3ME5A 4F3KA 1IE3A 1BXGB 2GCNA 3M6MD 2C5AA 2HRBA 1AHHA 3WL5A 1TL7C 2Q3DA 1QH0A 2B98A 4K6HA 4YA6A 3SD7A 4B3RB 1ULZA 3EZYA 4H7PA 3GGOA 3OSZA 3TXXA 4JAVC 1GTMA 4JVMA 5BP7A 1M72A 1RRGA 2DBYA 1ZM4A 4A7PA 5DYWA 1FYXA 2I33A 2OOKA 1VSTA 4QQNA 3WMXA 4RVNA 2OL4A 3IUBA 1E2KA 2VYVA 1KBOA 4BVBA 2HT6A 5TF0A 1P5JA 3RSOA 2VQSA 3MIIA 5EVCA 2C98A 3Q6NA 3AB8A 1DAGA 1QO0A 4FFBA 1Y37A 1MO5A 2VPIA 1XG5A 1XZNA 1RKVA 2HWYA 1IUKA 1TF7A 2BZSA 2EOAA 4GZMA 5EJ4A 3JQPA 4P83A 2WM2A 3D6HA 4YO8A 3RUAA 3LM8A 4BAUA 1E58A 1Y6RA 3UUGA 2NZ2A 4OAPA 2C0CA 5DTRA 1RAHA 4YP9A 3VNAA 5KDDA 4DNFA 2EJUA 3FR7A 1TVKA 2XF2A 3ZU3A 5BQXA 2ZJOA 3WYNA 2QBYA 1A9RA 4QPNA 5AJVB 2NUTA 4C08A 3C7KA 1D2NA 3RT1A 4WTOA 4PHHA 5F5XA 3O4JA 3UPDA 3T0GA 2VYVD 1TZCA 3PNOA 3JWEA 2FW0A 2FW1A 3A6KA 3AH8A 5DCUA 3IIJA 1VMAA 4YUVA 3ZQ4A 4HWOA 5BQ3A 2P78A 2W9XA 1SVMA 2UVQA 5HTKA 3NORA 5LOVF 2FFHA 4D0RA 1EJBA 3DXFA 4L8LA 1DVRA 4B84A 3F2VA 4YRTA 4X3OA 2AFHB 3LUDA 1EXWA 5D3MB 2BMVA 2EKDA 1E2NA 3HJAA 4G5QA 1QP4A 4BWYA 1BA2A 4MS3B 2ZAMA 1J39A 4IMJB 2GLUA 3P19A 4UREA 4YQEA 2OXIA 2X9VA 4BBJA 1SOMA 1Q57A 1PO7A 2WC1A 5KNLA 5D51S 1U9IA 4D6PA 3IH5A 3G8YA 1TO1E 1UFQA 2UUAB 2W4QA 4ARIA 1T3ZA 5K8UA 1PU2A 2FPGB 1HETA 2BFBB 5FNZA 1IBCA 5FOTA 2I76A 5AKKA 1FP4A 3V4VB 1T29A 4AROA 4BFWA 1NKTA 4GI2A 5D85A 1SUAA 2WUEA 3G23A 3OX2A 4PE5B 5LKAA 4JQZA 3RIMA 2EFDB 3P0RA 2GPTA 4AN4A 2ZREA 2H0QA 1H1DA 3MS7A 1SCUA 5TPZD 3UM9A 5I8WA 3HVHA 2C3PA 3I6QA 4E7PA 1MA3A 3UXEA 1GFIA 4LOJA 2PDAA 4LY0A 3W7BA 2IU0A 4O2RA 3RTGA 3NC0C 1G5PA 3CX7A 2VPTA 4E4TA 3G68A 4EG3A 3L4KA 4EI2A 3K9CA 4XYEA 4E32A 4RTMA 3GLHB 1CQIB 4LF5B 2Y71A 4EI8A 1Q1AA 2AT1A 5IBCA 3Q0IA 4OL0A 2Z95A 2FE4A 2NVOA 4Q34A 1RZUA 3OF5A 3DL7A 3G2LA 4JH0A 4F11A 4P3KA 3AYZB 4ENRA 2DR2A 2ZATA 1J42A 4IDFA 1WD5A 4L5BA 1JKIA 5F3RA 2EARA 4UBOA 1KI6B 3UTCA 4CMAA 1LPAB 2JZNA 3GEDA 3IAM1 4RHYA 4ETNA 3CLVA 1M1NB 4OX9B 4Z86A 3GLHA 3TCKA 3IUNA 3MUEA 4DJ5X 1QR2A 3FTNA 5F4ZA 3EQ8A 2GDZA 1GKLA 2YCLA 4Q3NA 4D26A 4Z9BA 1L5SA 2I4TA 4RCYA 4Q7QA 1T2EA 2PZGA 2E48A 1Z7GA 1JLLA 4CHGA 3QU9A 3G0DA 8LDHA 1W36B 2VP4A 1X1DA 3Q72A 1R5OA 1SXHA 2EJWA 3LX8A 3PUHA 3KV3O 3RRJA 3W6ZA 4CLRB 3L41A 5ICMA 1V71A 1YTUA 1FDUA 1JEQA 3KVOA 1O5TA 2R7NA 2ZE8A 3FXAA 3KJGA 2GEUA 4JFRA 1R3DA 1V5EA 1LY1A 3DD5A 3KLBA 3KQYA 3JV7A 3S6JA 1BVYF 5BNFA 3PJDA 4JI1B 3H0KA 1IFXA 1YL5A 2J6IA 3WJAA 3ZHQA 3QSYA 3K9BA 1C1DB 4IJUA 4C1NA 1CDZA 3ZDFA 3NTUA 2MSWA 1EVYA 3AHDA 2ADMA 2XSZA 3QPAA 1QQTA 2QWXA 1KYXA 3TE6A 4ZU6X 3BAZA 2ZPUA 3C7AA 3DVAB 3IPYA 4K28A 2ZIFA 3UMBA 3U4MA 3HL4A 4FILA 3WDSA 1Z06A 3EIOA 2OFXA 2QN3A 4O2AF 2VF7A 3FKSD 2VR1A 1ZD3A 2VK4A 3V8PA 1BHSA 2VDWB 1U0BB 5CT5A 2XAAA 1T1RA 1D4AA 3C8HA 3BSYA 2XJ9A 1GA6A 2AOTA 1WPGA 4UNNA 1LBQA 4UTXA 3R0VA 4I3HA 1LFDB 3MRSA 4DYVA 2X41A 2QL6A 1IXKA 4NPAA 1PFUA 2ZIGA 4F46A 4HAVA 4KWIA 1NKVA 2OBMA 2XVYA 3LUPA 4BFZA 4EW6A 4KXLA 4V0RA 4YRGA 5A0VA 4X1YA 2VLIA 2G80A 4PO8A 4TZKA 1UOOA 3V42A 5L7TA 4YEDA 3IQZA 2C5EA 2NVBA 3CVWA 3SJUA 4HZUA 2O0HA 2VCYA 4B9EA 5JBQA 2J45A 2DB3A 4NPCA 2VXCA 5JAOA 3D5QA 4Y9TA 2FPPA 4HAZA 3BZUA 3HM9A 1ZUIA 1PTJA 2PLWA 1I51A 3DE0X 3L92A 2ZTSA 3QH4A 3WWZA 3BXPA 1T9KA 3DOIA 3HV2A 3G2MA 3AVOA 3LUGA 4PCAA 4BJ1A 2YS6A 3K1YA 2X19A 3D7KA 5GOZA 1KJZA 1WSWA 3C43A 1QNLA 3FSGD 4NIMA 3EZNA 3RYFA 1WZNA 4CPDA 2HK9A 5JASA 2NQ8A 2O3RA 3MT0A 4LXQA 3DAPA 3EDQA 4MO9A 2I6GA 4GKVA 5CYPA 5HR5A 5J3JA 4OFZA 4CFYA 5EWMA 1I2ZA 1L4FA 1X8JA 3ITDA 1CHDA 3I28A 3BICA 2V4ZA 1DKUA 2OORA 1C8LA 3EIFA 1NURA 2IIPA 3EVDA 4O0LA 4F91B 4GLLA 4N3NA 1YKFA 2XUJA 3OFNA 4CTJA 3MJRA 3DVAA 3ZXSA 1RXYA 1ZCJA 2ZBRA 3MC1A 1N2CE 2P1RA 3VV2A 4N6OA 3ZK8A 4C7VA 8ATCA 1ST3A 4PTZA 5FYDA 2IQ5A 4EF6A 2W37A 2WM9B 1JWAB 1Z0ZA 3F5SA 4R9UC 5KWVA 4C4SA 2QDXA 3B89A 2IE8A 3F6BX 4AWAA 3AM3A 1R5JA 3PRKE 4EABA 1W5FA 2FSHA 4RC9A 3IELA 2B2NA 3SJBA 4YCNA 3DAGA 3JVUA 4PYJA 1BHQ1 5TQJA 3MJHA 2QUJA 2Y0DA 1MABA 5AKHA 5CFPA 4P54A 3EUWA 3IOEA 3OUZA 2WKSA 3D7SA 4RPKA 4ENQA 1C9KA 2PBLA 2WPDA 4EMTA 5JCOA 2JVIA 4N48A 1DT5A 4MEAA 4LF6B 2C61A 4YRBA 1TEVA 1D9ZA 4C4TA 3IS3A 4RXTA 1JG1A 2V7TA 1SAYA 4I6GA 2UYOA 4HXEB 4RIHA 3RJMA 3BGVA 2AWOA 3U7IA 3NJ4A 2YUTA 3A9TA 1G2IA 4GPEA 1S1CA 1BXGA 1GHTA 1UBNA 4QBHA 4QYMA 4WLUA 3NM6B 1WB4A 4LY6A 5EKUA 1EKXA 1WDMA 3ZE8A 2QRQA 3R9IA 1Z4JA 1W1UA 1I2AA 1OBVA 2WWGA 3DAYA 3GHYA 4QTUB 4R81A 4B74A 4MGKR 4D0GA 5FBWB 2FSVC 2JZOA 3H4MA 1HL7A 2DQZA 3AIMA 3GY0A 3K0KA 3L8DA 2RC6A 3Q15C 1JE0A 2FSIA 5K45A 1ECJA 2QD5A 2QRVB 3EZ6A 3D8TA 5KS2A 4AF6A 1PYDA 2XDQB 1SD1A 3I9V6 1MNAA 4NFYA 4MWBA 4TSFD 5AM2A 1M5UA 3CKKA 1L7DA 5BQ5A 4B85A 1P29A 1UZMA 2KE5A 3F6CA 4QEZA 2EZ4A 1RFLA 2GAIA 2PUHA 2ZRBA 3CGWA 3KL4A 3Q0TA 4FFVA 4GPD1 3KVNA 4BRUA 3R7WB 4BMOB 2RGAA 3GLGE 3AF1A 3PP8A 3D43A 4C04A 2GXAA 1OI2A 5ULLA 4E2WA 1QRTA 2PWPA 1RYFA 1NX9A 1WCXA 1Q1QA 3DUWA 3IHLA 2H0AA 5ALUA 3GCDA 3MAAC 5AVWA 1Q0PA 5EIXA 4OGLA 3H1FA 3ENVA 5ICCA 3EIQA 2HDHA 3SF8B 4Q3OA 3GRRA 4V2UA 1W8DA 5F78A 3C3MA 4QLBA 2CD9A 4EZIA 1FRQA 2FUG6 2FR1A 3NHRA 3GQBB 1FP6A 2C83A 3DAOA 3MCVA 3N2IA 3NOOA 1E9DA 3H5IA 4D8YA 1SCKA 4DTCA 1T9DA 2WJIA 5GJWC 1EVZA 4JHLA 1T9AA 3SSAA 5I48A 4UJ5A 1KARA 1MF7A 5DYIA 3RAFC 1UM9A 1ZOLA 1Z7YA 1U98A 2HRRA 3T0IA 1YT5A 1P39A 3HKDB 1U2EA 3QMWA 3DEYX 2IOQA 2YJ5A 3ZCVA 1DI0A 3K70D 4YP0A 4LJYA 2NZXA 1R66A 2A3NA 1OA1A 5KHOC 3RRMA 5J43A 1UC8A 4IWNA 5LP6F 4GOXA 4OA8A 4WLOA 2X5XA 1V5WA 3CW2A 2D3TA 3KEMA 1R8YA 5KUTA 3ZCXA 4QJ5A 4YJ2B 2RGCA 3GWZA 4DR2B 3MWDA 1J56A 2D1RA 3EA5A 3WQSB 4URVR 2YHIA 4E13A 1KL7A 1SKQA 3O2QB 4TTSA 1TYBE 1AKUA 3GV0A 4TLMB 5ALZA 3NC1C 5CFMA 2VPWA 4Q4LA 1TEHA 3QVSA 5GPBA 1Y33E 4Y9DA 1QYCA 1TDJA 5IJZA 1TJNA 3OURA 4KDEA 5IVKA 4EVQA 1DBIA 1Z2EA 2W2KA 4E2ZA 1WBDA 4D9HA 1L7PA 1KO1A 2EFEB 3THYA 3BTVA 3EVBA 2IEZA 4JLUA 1VMKA 3VUFA 1HOXA 3R7AA 2W6PA 3AK4A 2V45A 2GBCA 1CSEE 2EZ8A 2CFTA 2I7DA 4V0MA 5HPYB 2VEOA 1T10A 4QBFA 1UM9B 3QBVA 4F6CA 1KBQA 5A03A 2G9ZA 1X9GA 3I61A 4RH3A 2ZAYA 4F04A 2M6LA 5JADA 4CEJB 2DKNA 4DVGA 1TLLA 4PHFA 4YXWA 4DWVA 3QU2A 4WBNB 1YHYA 4ZODA 5F4BA 5CNMA 5TEWA 1ZM9A 4L07A 2JCVA 3IDQA 4GI5A 2QUHA 2AUTA 2HU2A 2XNKA 2HU8A 3KM0A 2FPXA 1GR0A 4UFNA 2EP5A 1GTVA 3RPEA 5LMCA 2BHSA 3WRWA 4YHHB 1V9SA 4J91A 2ZZMA 3V8MA 4BP3A 3GJQA 3R9KA 2RHJA 4PX5A 2XXAA 2MYTA 5BO5A 3EW7A 2WIBA 1YS7A 3N8IA 4O4IF 3LQ1A 3GDFA 4MCHA 3RAPR 1KMNA 5I4BA 1USIA 3W4KA 3F1LA 2QTWB 2VHZA 1Z16A 3DLAA 4M99A 5E6UA 4E46A 3HABA 1ENOA 2QTNA 2N1BA 5A4JA 2XH8A 3TEMA 3TOCA 2Z3ZA 4PTLA 5AD1A 5M7EA 2JRLA 4XYGA 5DRYA 3GGCA 5AR1A 4YAEA 2WJGA 2H07A 1MJ5A 1W96A 3KB2A 2QN8A 3KK0A 3HWWA 4PINA 5EGSA 5TRTA 3U7JA 2LCIA 1ESEA 1H2ZA 3INYA 3OKCA 1Z45A 1WDLA 1J0CA 3AUYA 4NNOA 1PT7A 4ZVMA 4ZVSA 1HQCA 2X40A 3C15C 3THYB 1ZS9A 3MLAA 3TSCA 3A25A 5A4FS 3K0AA 3AHGA 1VJTA 3LJKA 4FUTA 3H2IA 3RW9A 1TLTA 3R1IA 2ODQA 3UF0A 2ADFA 2QB5A 4JR1A 4LDZA 5IJ9A 3GLFE 5ABPA 5ED0A 1CE8A 3G2HA 4H4EA 4DZZA 2CFOA 4E31A 1PGOA 3KYDB 4RANA 1L5HB 2C2HA 4P5EA 5DFAA 1XJCA 1H4TA 1Y80A 2ZPAA 3CLKA 4RLSA 1KIMA 1USKA 3TBFA 1WY5A 3KZKA 1UKBA 5JHHB 3ZLTA 2V7WA 4FMCF 3TL3A 2Z1MA 1YS4A 3OBIA 3VXKA 2OXTA 5FB3A 4X95A 4MVJF 4ZOAA 4E07A 1UP7A 1CZHA 4DBLE 4TS4A 4ZI7B 1Z26A 1G21A 4MLZA 1N57A 3OKFA 4R2LA 4RPIA 4DNOA 1PS8A 4PG8A 1QH8B 4KUEA 3AEUB 3TLGB 1CTQA 1T0PA 4U2KA 1S3IA 2J3HA 4MRVA 3VNUA 2FRVA 2VJDA 3BC1A 3PGXA 3ZQ6A 1GQOA 1RXEA 1P1CA 1IB0A 3BFKA 3G17A 2BRUA 1QX3A 1QTNA 4I6EA 2FW7A 4JP3A 5BSMA 3UT5A 4DV0B 2FFRA 4MLDA 3OJEA 3VJRA 3HS3A 3MWFA 4IZOA 5JCJA 2R25B 4Q7LA 1MEEA 3W3ZB 4ZHQB 4ZJUA 3OZSA 4ZT2A 2B36A 1G5HA 2I3BA 4ZVLA 4LDJA 2F59A 1KEZA 2YMPA 1L4HA 3E9DA 3HFGA 4WZ6A 1P4GA 1C7RA 3N74A 4KWHA 4CLOB 1DP4A 4E94A 3PTAA 4KGZA 7ADHA 4PPFA 5I8PA 2I1QA 5CLIA 2H9IA 2GZHA 2XCSB 2A9OA 4DBLC 1XF1A 1X8XA 4MS4B 1N4DA 4Y6PA 2R7MA 5K0ZA 2G0AA 4AY2A 3UICA 3FYUB 4BLUA 3F7TA 2MR5A 3IIKA 3E9QA 1SVNA 1E2UA 3A58B 5BURA 1CULC 4G0QA 4N47A 1QU2A 3NGMA 2NUAA 1K2WA 1SJ9A 2BFCB 3A11A 5I9LA 3I9MA 1Y3IA 3ZJVA 1G9TA 4MVJE 2IZOA 2GXUA 1WW3A 2E82A 2VK2A 4CMJA 3PVSA 3A2KA 3CWCA 3WIVA 4BFLA 3OM0A 1W93A 4AO8A 3S44A 4CF7A 3AC0A 4PLPA 4RQAA 4KREA 5DW3A 1AMOA 2GJSA 2MYNA 3KUXA 4Z3KA 3R3HA 3I8OA 3LHIA 2HIAA 1DJQA 2F1OA 5EIBC 4F3RA 4BRWA 3QEOA 2R48A 2X8JA 5K2OA 5DNEA 4PNZA 1FIUA 4TLDA 2NSDA 1EK2A 1FFSA 1OGYA 2P9JA 1U28A 5CBKA 2YNMA 3N5KA 1CZKA 1HK7A 3NHAA 4Q4CA 2AC2A 3TLZA 4M87A 3AHIA 2V97A 1WE2A 4E51A 4WN9A 2VHWA 5JECA 1MMFB 2W2XA 3IOBA 3CPSA 1U04A 2JH8A 2RHDA 5LVAA 3SI7A 4GGOA 1ZC3A 2H1VA 2FMIA 4YTEA 2IPLA 4Y2VA 4KVFA 3EWAA 3O0DA 1JGTA 1NVGA 4U7DA 4LXUA 1GTZA 4XRRA 5U9CA 5BNZA 2PZBA 3CIFA 1WCYA 4IY1A 1XJQA 2Q99A 2XCUA 3QHQA 4QGAA 4BBPA 5J23A 4ZQIA 2H5LA 3DEZA 4EYSA 3QNUA 2WHYA 4G0MA 4PLHA 4PR3A 1E7RA 1N8KA 4X6LA 4CM3A 1EFDN 5D87A 1IVSA 1KP9A 2HOQA 3BUSA 4TS1A 3SHOA 5FOQA 4DSUA 1FCJA 3ETLA 1DLJA 5E2IA 1JKXA 2QPLA 2NUPA 1QR6A 4WBXC 2ZYVX 5KREA 1W2GA 3D3EA 2IEIA 3F0TA 4C9BA 4CL3A 1YBHA 4LBYA 3NLLA 4UTZA 1P4JA 5ALQA 8ABPA 4KAFA 2XRMA 3HJGA 1FUEA 5ELXA 2JFPA 3M9WA 4FBLA 2B94A 2INGX 4RVUA 1A96A 3V1UA 1ANKA 4YGXB 3E3NA 3N7TA 4M38A 2P4HX 4C4AA 2IUFA 3E0XA 4PS0A 3QYFA 1UEJA 1D2GA 2BZGA 1WUIS 3RUFA 3EPJA 5H8WA 1YDMA 1UBLS 4XE5A 5K8IA 3R5TA 1YZLA 1POWA 3DOFA 3EF3A 1FYDA 4E88A 1M3SA 4HUQB 4NE2A 2AUNA 4MUIA 2VQEB 5EERA 4X8LA 3B85A 5J2TA 2AFIA 2CLLB 2PJDA 3TZCA 3EDCA 4KAXA 1Y8QA 4RTQA 1YQ9A 2IHVA 5K0EA 3AL0C 2JCXA 4FDMA 1GA4A 5M3BA 3E7XA 4A73A 1S2OA 4L27A 1L5GB 4I4IA 2BSQA 1E3TA 1LW6E 4DREA 5C1OA 4EWLA 3VTKA 4E1BA 3KUKA 2YWDA 2ZJ4A 2QUKA 2VAWA 1V45E 2VNIA 3RK0A 4F9TA 1YL7A 2GNAA 4MQ4A 4GXQA 4LGCA 2LWIA 3A26A 2ZJAA 4OK6A 3GEBA 5IVDA 1RYZA 4AT1A 4BEBA 2G9RA 1V7QA 1M8PA 3EEIA 2YW9A 1F2TB 2J6HA 1BX1A 3EE6A 1FDTA 1RQRA 4XTRA 5FFFA 1WB9A 5K8LA 2JLVA 3VHXB 2CJWB 3OEYA 3R5JA 5J1TB 3AI3A 4JC4A 1MOQA 4C4ZA 4DDTA 4X93A 1E9EA 4YK7A 1DXYA 4UE3S 3ODGA 3BMQA 3CB2A 4P82A 2VCEA 1GEGA 3HJRA 4B3GA 3OX1A 3DYBA 5JAHA 1JLRA 1RKXA 3M1YA 4RENA 3FCAA 5KSZA 3P4XA 2BFOA 3AU9A 3ZV6A 2BGUA 2TMGA 3B7PA 4KP7A 5EMHA 3AFHA 5G53C 4F7DA 3N6XA 4UPVA 1P60A 4R9RA 4X1KB 2WWFA 3B2NA 3JQBC 1FFCA 5A1JA 1LUAA 3RHSA 1LWNA 3DO8A 1V5GA 3O26A 3HDHA 2IPAB 4KQ9A 2ZI7A 4JA0A 1KQFA 4KXYA 3WYGA 1ORDA 1TZKA 4B2LA 5K8TA 3P5BA 3S0JA 2UU9B 2RGRA 4UAJA 2I3ZA 1LDYA 1L8AA 2B0CA 3FPLA 1X1TA 3GX1A 3QQ5A 5IC6A 4PU0A 2Z3VA 5BUZA 4XQCA 3AZPA 1C3OB 3JARA 4BJ5A 1MBZA 3SXUA 1DAFA 3KSBC 1N78A 4AY6A 2HMYB 4WNCA 2BEWA 2CK3D 2L0XA 2Y0BA 5LP6A 1ZCAA 2OGZA 4PWYA 2REXB 1CVIA 3QVWA 2O8BB 1DOAA 1Z25A 2ZG6A 2OECA 1O08A 3CWZA 4HZIA 4O5AA 4QJBA 3DWGA 3K9LA 1LRJA 1XTRA 3AF3A 4YP7A 1XE3A 1XHEA 1F1JA 5DWDA 3E8SA 4RYLA 1E69A 5EWJB 1EVIA 2GD0A 1FRNA 3U4GA 4RMNA 3GH1A 5LPNA 1SVIA 4X1IA 2PPLA 5JQGF 4Q66C 1RADA 1VGVA 2QYOA 4W9NC 2XMRA 2QJFA 2WA2A 2VHUA 3ZZTA 1YZTA 5I7RA 1K2VN 4FCTA 1KO4A 4TL7A 2VHEA 4DA6A 2QT0A 3QVVA 4IBOA 4NBRA 1SO8A 3DULA 3VDNB 5DYTA 3R74A 1R6BX 2XLCA 3VDXA 2NU9B 4TS9A 1XDUA 2CBZA 3E3OA 3E3AA 3IJRA 3KJXA 2ZBFA 1ICEA 2IHZA 3DQZA 3HVUA 4LSZA 3A6EA 4EKNB 1HFWA 3CY6A 1UXIA 2XA2A 4GHWA 2ZUTA 1VLMA 2F9LA 3E0QA 1XZKA 1I3CA 5FPPA 1P5RA 4WK4B 3EG9A 1Z08A 2BOVA 1IULA 2G36A 4BP9A 2FAXA 4R7GA 1NXVA 4LF7B 3TM4A 2PH3A 3TPZA 1UBSB 2D06A 5J47A 1SUEA 1UODA 2RGEA 4HQKA 4C6RA 1GR1A 1Z62A 5BNWA 1Z6QA 3FAZA 3H5LA 2QRMA 3M2TA 2PLAA 1XCGB 1OU0A 3QWFA 2BFMA 1U80A 4GX2A 5AVUA 4R0MA 2P79A 4D98A 3F3MA 2PT5A 5JNLA 1TJPB 4E5UA 2J0QA 1SC4A 2HA7A 4RZXA 3M4YA 4KE9A 3WK4A 4DOMA 2M1XA 3DHNA 1JJ7A 4EFNA 4GUDA 2I62A 5H1YA 3TH5A 4J6EA 1SCUB 1FPQA 3DLPX 3DWFA 2D5IA 2Z5GA 1DQNA 1YE5A 3NAGA 2IZ5A 3ES9A 3GGDA 4D9NA 4QDXA 1Z9BA 3ILVA 1TECE 3RB8A 1UAYA 2G28A 1OX4B 2O0LA 3CURA 2BMWA 3H42B 3PUXA 4B6SA 3WHPA 2BEKA 2P2SA 4MW4A 3UUFA 1ZN7A 3A2MA 4S12A 4WE3A 4CQJA 2QL7A 4PLZA 1SRQA 3EGXB 2HL6A 4GBGA 2J0UB 1UT6A 2R8XA 3AO0B 3H9BA 3R5HA 3ZV7A 4BNFA 521PA 5A4KA 1LA2A 1Y1LA 1ZD4A 1Q3KA 3DVSX 4WAUA 3ZBTA 1JR3E 1U8UA 3L40A 4OSOA 5E4FA 1IRXA 1K3UB 3O1IC 3OQ1A 3ILSA 3URMA 2JLBA 4DKXA 5LWQA 1EE1A 2CWWA 4PG5A 1K86A 3QLUA 4IYRA 5F9HA 2H1SA 2QPTA 3REGA 4CMIA 4CQLA 3GZTB 5LJLA 4PW0A 3DP9A 3EG5A 1GGVA 4A8PA 1XK6A 4G4JA 5DTMA 3G2JA 2QZSA 2FSPA 4L73A 3L5OA 1ZH6A 4PX9A 3JZFA 2WBLC 4BGUA 4UUNA 4QDJA 3ZNOA 3QOYA 2FSS