3AONB

Crystal structure of the central axis (ntpd-ntpg) in the catalytic portion of enterococcus hirae v-type sodium atpase
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
101
structure length
101
Chain Sequence
MTYKIGVVGDKDSVSPFRLFGFDVQHGTTKTEIRKTIDEMAKNEYGVIYITEQCANLVPETIERYKGQLTPAIILIPSHQGTLGIGLEEIQNSVEKAVGQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords V-type sodium ATPase subunit D
publication title Crystal structure of the central axis DF complex of the prokaryotic V-ATPase
pubmed doi rcsb
source organism Enterococcus hirae
molecule tags Hydrolase
total genus 33
structure length 101
sequence length 101
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2010-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01990 ATP-synt_F ATP synthase (F/14-kDa) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold ATPase, V1 complex, subunit F 3aonB00
5KNDH 4IX9A 3VR4H 3VR6H 5KNCH 2I4RA 3W3AH 5KNBH 3VR5H 2QAIA 2D00A 3AONB 4RNDB 2OV6A
chains in the Genus database with same CATH superfamily
1JZSA 2QM7A 4IKOA 1U7ZA 4DMRA 3FUWA 1LDYA 5E4JA 2DTXA 5CA0F 3O4VA 4YO8A 5AUPB 5DHUA 4IQ0A 4CM5A 4K03A 4I1RA 1NJFA 2ZW9A 5D87A 1SUBA 2VF7A 2GCGA 1V8BA 2NM0A 3OE1A 3R7WB 1DJMA 1XRNA 4L75A 2X5OA 4M60A 1IN4A 4YUVA 1UBFA 3H4IA 2I99A 5CA0A 3RBXA 3I45A 1L5OA 3TSAA 4ZCTA 3N0RA 3KSAC 1MIHA 5FR1A 4HDAA 1T3GA 5K8IA 1VLQA 2VF4X 3F3KA 4M1EA 2H9AA 4RWZA 2JGFA 3A1SA 4QAJA 3NW9A 1C3JA 3KQQA 3OM8A 2CBZA 1UQTA 2HNBA 5KVSA 2ZTSA 5DXJA 4U7GA 3C6YA 4FTWA 1AD2A 1EBBA 1MX3A 1TIPA 2Z95A 1ZGCA 1CDDA 3BJIC 3KX2A 3LPNA 4X8HA 1KJZA 2WHQA 3QEKA 3PZBA 3FY4A 4CL3A 4MVJE 1E2BA 2BD0A 2G9QA 2YZMA 2QRUA 3M5DA 4OY3A 4KR9A 4B71A 3I53A 3FMGA 4KW7A 1GDDA 4N7BA 2F59A 4EA7A 5JBQA 1RXEA 4KYUA 4MJ7A 5JZBA 4ZPXA 3N6VA 4FWTA 3WDKA 3AK4A 3EZ2A 1GPWB 2D1TA 4IRXA 4OKNA 2R8ZA 3RV4A 1QHEA 1MPXA 3F9RA 1P7YA 5EHZA 1JFSA 2XMDA 3EGIA 1E0AA 1GNTA 3PA8A 5FUVA 1RPNA 4IEEA 3TNJA 3A4TA 2I65A 2HMTA 4BLUA 4WINA 3F5DA 4MPDA 4G1CA 5FV4A 2OZVA 3GGOA 4MPPA 1JB1A 1SZJG 3EF3A 3T1YB 3GGPA 3MWLA 2BI8A 5LYJA 1S2MA 1LK0A 1WZCA 1NF2A 2PL5A 4OG2A 4X1YB 4QDOA 1E9SA 2OUIA 1E3LA 2AEEA 3CCCA 3HK2A 4M0DA 1FJ2A 2ZRKA 1NI4B 3ENQA 3AW9A 3K5IA 5AO9A 3G5LA 1DKUA 4P9NA 1G41A 2QTZA 3KBOA 4J0KA 2LCIA 4LHEA 4D82A 4ENSA 4MLCA 1UBOS 1THGA 1P2GA 2OBBA 3K2EA 4LSZA 4RD3A 4Y6GB 4BS9A 4XM2A 3HXMA 1GGNA 3GLSA 1YJQA 3AI2A 4MS3B 3EVCA 3UAZA 4EQ6A 5B57C 3Q87B 4RK5A 1PIWA 1ZH6A 1J8FA 1FNDA 1GRCA 1SC9A 4LECA 4C03A 4DR7B 2ZSJA 1OWOA 2WJ4A 4B79A 1LSUA 3RS0A 3ZIAD 4DFDA 5KVAA 3FCOA 1OIVA 3IE0A 1ND5A 2OPHA 3A3KA 3WY9A 1D09A 5KB3A 4IIJF 3F3SA 1AH2A 4JMLA 3M4ZA 3IRVA 4Q00A 3PRYA 2VTDA 1D04A 4P32A 4R9UC 1Z8HA 1W6UA 2JGJA 1N4DA 2X9NA 2I2XB 3C5CA 1YUMA 4D4HA 4ENPA 5IXJA 1Q3HA 1R18A 1RZRA 4ZCLA 4R71A 1XZBA 1FFAA 2L69A 2Q50A 5FL7A 4TWBA 3MVEA 1O03A 3P71T 4NIMA 2I6GA 2WVHA 3HHEA 4N6NA 1RC8A 2J30A 3PQ7A 1BA3A 1CETA 1HRKA 1IH8A 4I50B 1BGWA 4RQTA 4AS3A 1XMSA 3IKMB 3WADA 3G8YA 1QOQB 3OOJA 3IEKA 3ZZMA 4HPXB 4RVNA 3VR6D 2BZ1A 3WQRA 1U2DC 4NZ9A 3TYXA 2GPBA 5LQNA 2FPSA 2NU6B 5TB5A 1TM2A 2FZVA 3LECA 1UBEA 1IQPA 1FNBA 1PVDA 1L7XA 4WN3A 5JO9A 1OI3A 3PJFA 4C06A 5CVDA 4KAXA 3ZEIA 3VKGA 2PXAA 2C20A 3IPCA 4M1ZA 4OJKA 4MAMA 2GAOA 2IGTA 2WJZB 3GJRA 3MG9A 4G9BA 5LCXA 3OPYB 3RYIB 2VHYA 2UYQA 1TK3A 3G13A 2ZSHA 3ZXSA 4BNKA 4NOMA 1XPUA 2DUMA 3ZE7A 4JYPA 2GBLC 1YZGA 3JARA 1Q3KA 1AS3A 2RFLA 3TX6A 4MGZR 4PFQA 3R7WA 2FN3A 2VPXA 4KTTE 3ZXIA 3MT7A 3G0HA 1XC7A 1KI4A 2V0GA 4H7KA 1SXJD 2P91A 4W5JA 4ZEVA 3EPHA 2GYWA 1NAIA 3FPLA 1N2HA 3D8SA 3OQHA 4I6GA 5KO2A 1YQQA 4UAGA 3PDWA 2AN3A 4WKCA 3EOAI 1ARZA 1SVNA 1V3VA 2YOHA 4O4LA 5H68A 4I2VA 3WWEA 4LYAA 1G4HA 1UL1X 3KSMA 3LG2A 2X15A 1YS6A 3TW4A 3TOCA 3KUCA 4MP3A 1ZK0A 3EAQA 3GPDG 5F1KA 3EPRA 1L5QA 2ZB3A 5FADA 1JG1A 2JDIA 1L9XA 4HL6A 1V16B 2IY9A 5LMCA 2QL9A 4YGYA 2GWRA 4LXYA 3VGPA 1C1YA 3S5JA 2Q3EA 3ORFA 4QM6A 4Y3UA 1CQWA 4RADA 1FQWA 3QFSA 5DK4A 3CX8A 3ZDXB 1LJ8A 4QM7A 2ANCA 1JR3A 1XRRA 2ORVA 2OM6A 3E61A 3H05A 1NURA 2EOAA 2HSWA 3BZWA 3K5PA 3WGNA 2QN8A 4L85A 1Q0SA 3D43A 4Z5XA 4S0XA 2HNKA 1AUPA 5EP2A 5BORA 1OLUB 4FE4A 1MNAA 2QZPA 3IP1A 4EL0A 3JV7A 1BXGB 1XZ8A 1TMKA 2A7QA 2FZKA 4NBTA 1P6XA 3OJFA 4X1YA 2M6SA 3OTQA 1KKUA 1DRKA 4OREX 3MLBA 1QGOA 2O4CA 3IALA 2V6GA 1RPAA 4YACA 1PE0A 1DEOA 2YBEA 2Q9UA 3E1KA 5GZ1A 4A73A 1NI4A 4ZI7B 1SK8A 2F67A 4GNRA 3ANXA 4GSYA 3HR4A 1AUVA 5F4ZA 1I94B 1OAOA 5B1IA 4QVIA 2VYQA 4TOIA 1L7EA 1XF1A 2F3PA 4MS3A 3CR7A 4R54A 4EECA 3FPCA 4IYJA 1DLJA 4NATA 3VVBA 4JASB 1D1TA 1W5FA 3CJTA 5JBIA 3K6KA 4LYFA 1O08A 1S3GA 4Q3EA 2AR0A 5B4UA 3RAGA 3DZBA 3IAXA 2C4UA 1JX6A 4EPXA 4ICIA 5FRDA 3EUWA 1N3IA 1O5OA 1JU9A 2WWWA 3K3PA 4Q3OA 3T5TA 4KGXA 4R2XA 2O3UA 1ZGZA 3LUHA 3LT4A 3KJEA 4I50F 3VVLA 4A3SA 5ALFA 4HH4A 3A14A 3H3XA 3S2UA 4CM9A 2BSAA 5JC8A 4HMQA 3EW9A 4YRIA 1CNFA 3GJ6A 3I9LA 3QJGA 1V1JA 5J1SB 2GZ3A 3A1VA 1OCEA 1T5BA 1G1AA 1XD9A 3E0XA 3QOFA 2ZYUX 1D2HA 3AB8A 1I2MA 3GJ3A 2IDJA 3IQEA 4ZQCB 3V00A 4OQ4A 1CYDA 5DHRA 5MN5A 5L3ZA 3HCPA 5ILOA 2NU6A 2R47A 4AY3A 4X65B 1HYBA 2XGMA 2FFHA 3LVBA 4B1FA 3KL4A 1SD1A 2AV6A 4QGGA 2RK3A 1CZUA 4GX1A 1J9GA 3I2KA 4XSGA 4D81A 3KQNA 1FOEB 2FSSA 5I7OA 3QE4A 2E85A 3RYIA 1T4DA 4FMCF 1QFMA 3PR2B 3WRXC 2GM4A 1RRFA 1X7ZA 1ZD4A 4L8FA 1QIFA 1RXVA 2WSSA 2YMPA 5I8WA 1H5UA 2FW1A 4LEIA 1XMIA 4HGOA 3PFCA 4IXWA 4XQCA 4G36A 1FK8A 4LNUB 2IV2X 2HDHA 1XOIA 3RKSA 4YRPA 3RU9A 2X0DA 2R6GA 5JOQA 4QU5A 4CMIB 1JNXX 4YXFA 2IBMA 2Q5LA 1Z26A 3NBKA 2DAPA 1G38A 3GX1A 1JMYA 3MAAC 4K6GA 2P3QA 1FRZA 2QN2A 2EG9A 2BFDB 2YWJA 1MH1A 1VIAA 1Y3DE 5L4SA 3OU2A 1GLNA 1UT6A 2QTRA 1T0HB 4Q1AA 3W5BA 2CMGA 5DX8A 1O4VA 2O23A 1FDVA 1W52X 2E4XA 4Q9AA 5G40A 4KAAA 1KAOA 2HWKA 4PC6A 4HX9A 1OBHA 3NXKA 1VKOA 3FPGA 1SQSA 1QO7A 3T7TA 1E8DA 1V16A 3SYMA 3H87A 4N49A 4UD2A 5B3AA 3TSYA 5CCXA 4YCLA 4A36A 3JVUA 1DP4A 1G20E 2XVZA 3WGHA 2IFTA 3OZEA 2JL1A 4TMVA 2NUBA 2QG4A 1DBRA 2OHXA 1SC1A 2V3VA 3PD1A 3SBOA 1R5JA 1BIFA 1PX0A 4L51A 4DV5B 2FUG1 1RJGA 1VYHA 1KQGA 4M3NA 4IH9A 4YS6A 3RC2A 2ZIFA 2HZ7A 3D6AA 1ZJYA 4B3RB 4BASA 1UC9A 4E1VA 2D74A 1OLUA 3S68A 5IM4A 1IXKA 3QOYA 3T8YA 1CJMA 5KCMA 1BXGA 4JEIA 3V1LA 4BLWA 3CNBA 4LVOA 5AH0A 4HWSA 4I4TB 4BMZA 3R3JA 1JP7A 1Q3TA 3INTA 3IAAA 5JU6A 1ULTA 4JYCA 4GAEA 1E2JA 3AILA 4JVLA 5ESXA 4ZI7A 4AWXA 5B58C 1KI2A 4AZSA 1XDDA 3MT0A 3G1TA 2VA9A 4R1QA 1EK0A 4UHKA 3RU3A 2Q0QA 2X8WA 4OHRA 3TKAA 2P7IA 1L8AA 2X8LA 4PZEA 5AOAA 1K5PA 2Y68A 1M74A 3AM3A 3VR3D 5K99A 2PSSA 1NBME 4DMGA 2R68A 4EEKA 1DFIA 1E9BA 2HT6A 3B8EA 3R23A 2ATVA 1KJJA 4Q02A 4HVLA 1JDNA 1FP1D 1CUXA 2PAFA 4B33A 2Z2XA 3A1NA 4L16A 4WY5A 1Z0FA 3ZHBA 3LQKA 2J9YB 4L4ZA 3UGKA 1IUOA 2QRKA 1LDEA 3LUGA 5KSZA 1PYOA 2Q2NA 4M49A 4BTVA 1IZ0A 4B6EA 1UF9A 4D9HA 3P9QA 3S2EA 2HL6A 3ELDA 4YRGA 1A88A 3AETB 4G0NA 3VR5H 3EVBA 2F9MA 4AMVA 1ZSVA 3ZX5A 1SAYA 1JUDA 2BGKA 121PA 2C04A 3R3YA 3LWZA 3LDGA 1UKEA 1U02A 5EP3A 2FW8A 5CDFA 1PR4A 2NMVA 1YJ8A 3AIKA 4YRSA 3PRJA 2ZI5A 1YV9A 3A9VA 5B3JA 5FA5A 1UBSB 1H6BA 1O54A 3BGDA 3M2TA 1NXXA 1U2GA 4M8NE 4OBWA 5DYWA 2B4RO 3BIWA 3T3GA 3U7IA 3FNQA 4MB0A 4NBNA 2IYEA 2PLNA 1E1YA 1R0KA 3I3SR 5JCOA 3DMPA 5F76A 3OCYA 2ZWOA 4HSGA 1XYVA 3QLUA 2QPOA 2V7VA 4G0OA 1L5ZA 3TR6A 4MLDA 4TSFD 4ENUA 4BNJA 3KSDO 1ZMRA 1XCPA 1K6IA 5HCNA 5JCXA 3O8RA 1TYBE 1KEVA 2RHRA 1KKMA 1LI4A 2R1VB 4RV9A 3NB0A 2AFHE 2QN7A 3NOQA 3NDPA 3PX3A 3RD5A 5GAJA 4KUHA 3SGLA 3VTFA 2FWIA 1QRTA 1SBTA 2FFBA 2B69A 1W25A 2GEBA 2AUTA 3DAOA 1MNQA 3T5DA 4BNWA 4LGYA 2DVMA 1DBVO 3DD5A 4LNUA 1E20A 1J5XA 1UMCB 2VH2A 4JR0A 3OZXA 1CUUA 2XF2A 3QPDA 4CMIA 5LKRA 1VBKA 4A1OA 2Q4TA 3IT0A 3UV7A 3X2EA 1F2UB 2BFDA 1F9EA 5JD4A 5CLGA 3UJ8A 4YMSA 3WIBA 4WFQA 2XAAA 2B7LA 3DCJA 1V8FA 1C9DB 2QRMA 3LDAA 4NE7A 5CLHA 1C29B 1N6PA 1YVRA 2CHUA 2HWYA 2JC3A 3DV0B 3M49A 1ADFA 4QXQA 3WJ7A 4XEUA 4DQDA 3U6BA 2VP3A 1CCWA 5AKLA 3ETHA 2PKWA 3JCZA 4EAAA 4H0FA 1GDTA 1SBZA 4RFSB 3WO1A 1XP5A 5CVVA 2Y0CA 4TKUB 4H27A 1QFYA 1ZOPA 4POOA 4BLRA 5HOEA 2UAGA 5J5AA 4H1HA 1PBNA 4BMPB 1X38A 3VKVA 2HJVA 2I3ZA 1AC5A 5JO0A 2D1QA 4I4TF 4KE7A 1DC8A 4ZO8A 3H9UA 1DC5A 5IVDA 5K3OA 3IV6A 3F2IA 5IDYA 3TJRA 1G8PA 3IKJA 4IXTA 1HK7A 1E1CB 2W6ZA 4RD0A 2GNAA 5AVSA 4IJWA 1SBQA 4IFBA 2BEUB 4B7ZA 2A1TR 2ZPTX 3MTAA 4D99A 2CJWB 1WNTA 4I4TA 4AROA 2TS1A 3BEOA 4JI3B 1LU9A 2FMUA 3HXPA 1AA9A 3LZ6A 4HB4A 4KXNA 5KOHB 3MS4A 1MDFA 2LW7A 2PSJA 3W4IA 1A9TA 2PUTA 5JNVA 2FMHA 4Z0TA 4UHDA 2JK1A 4UE3S 1KTVA 1RLJA 4BQSA 4TTAA 3JQBA 1SBIA 5B2EA 2PT6A 3C85A 3M5WA 2EX0A 1CJCA 3UXEA 4BO0A 1G2QA 1GUZA 5B58T 2ZTHA 4N9QA 3BDAA 3FHOA 2BKAA 1RJWA 3IE2A 5LQRA 2O5CA 3CWCA 1KRWA 3RODA 1PJTA 4PZDA 3ND8A 5KVCA 3AKZA 4MI9A 5LZ8A 3TH5A 1GEGA 3G49A 5LXTF 3CTPA 1I8TA 2OBMA 1V0JA 4QJ4A 3MN1A 4WEQA 4BNUA 1YB5A 5JQWA 1E3MA 1R6AA 3LDFA 2OHGA 3AETA 4Q3AA 1NYQA 1Z6PA 4J0DA 5KAMA 2GUGA 3K8OE 1GPNA 4BEJA 3TZ6A 1FFHA 2EFHB 1L6RA 2ZXEA 3CPEA 4NMXB 4MI6A 3TKLA 3ONFA 4ZN6A 1VJ0A 2NNWB 2Y1LA 2IU6A 2ZWAA 4TLBA 4RK4A 2QGFA 2IYXA 4XKJA 3W8NA 3FCYA 1LKZA 1XTUA 4AG5A 2C4WA 4NDAA 4UNRA 4DJ5X 1XDGA 1C3EA 2ZRLA 3DMFA 3VU8A 4D0GA 1CUBA 2BIFA 3IO3A 5GOZA 1NJ8A 4M9CA 1ZGGA 3ADBA 3ACDA 2JH8A 4L4YA 2R6JA 4QDKA 1O0BA 3ROTA 3ITNA 5DCWA 1KI6B 3A3NA 3AY7A 4OHPA 4DLSA 3C6XA 1QPZA 2K87A 1FU7A 4NFSA 5TVKA 4ERNA 4IW3B 4JNKA 2R1VA 4DN6A 2C94A 3D7RA 1LC0A 2FP4B 4PLPA 1TJ4A 2ORIA 3ONEA 3MAGA 3NMUF 3R6GA 2PJZA 1A27A 1S4MA 2K4MA 1FYDA 5SY6A 4KFUA 3FOEC 3OLVA 1JVSA 1PUJA 1XLUA 2OKGA 2R96A 4FMPA 1YQGA 3VR0A 3IP6A 2AG8A 1G98A 1UMCA 1CC1S 4NOJA 3DVQX 5L6MB 4UAJA 2SBTA 3B38A 4EGQA 5IN4A 4PBSA 1N0HA 4MQLA 4XVCA 1L5MA 4HDOB 3L4BC 2WOJA 1F2UA 4MJ3A 1P9RA 1KAEA 4C3ZA 3UENA 4F45A 3ABSB 1Y6ZA 3B3QA 3O9MA 5LQCA 1TTHA 1SUEA 4OLHA 2GFIA 2WICA 1QZ3A 1C30B 3B9RA 4BO9A 2XYGA 2W6JA 2N75A 2D1FA 1KE2A 1PZGA 3PNOA 1MA0A 4RL6A 3ZCRA 2ZP1A 4RFSA 1YS2X 4OJMX 4TKUA 1J8YF 4WOKA 4C2TA 5ECWA 4F2DA 4X20B 3I09A 1TMYA 3KUXA 1GZDA 3HB0A 1FTQA 1NONA 1RAEA 2F7SA 5F1OA 1BFDA 2ICAA 2PCLA 3GDOA 4UASA 3ETCA 3HY4A 1IQ0A 2DTDA 2IELA 3H5VA 5F9MA 1YZKA 5IZCC 1OTYA 1D1QA 1QDEA 2PX8A 5TSDA 3U3KA 1F7UA 4R8KA 3R0JA 1Z5WA 2IF2A 3DKIA 4FOPA 4NABA 3F74A 3WO0A 1EWRA 4WCVA 3BWVA 1B6TA 3V4RA 1V6SA 2OPBA 1CZLA 2BEUA 4EG1A 3NV7A 3UW1A 1WXHA 4OKSA 4KXYA 1K3FA 2CJWA 2HLHA 4O2BF 3GJ8A 3NORA 4FUQA 4I9HA 1GNLA 2CZCA 2C3MA 2IUUA 2VXYA 4QASA 3IS3A 4B45A 3CEHA 5KOHA 4ZCRA 1NN5A 1XMPA 1W1IA 2N3ZA 4RHUA 3NH9A 4LPSA 3ZVLA 4YRNA 2PMBA 2VZLA 4IUBS 4NBRA 4ZCIA 3MXTA 1EE1A 4UOQA 4JI8B 4NBKA 5LD2C 2W2LA 3ZVNA 4X41A 2QPTA 2R6AA 3IHWA 4OHYA 1NVXQ 2VNAA 4HN4B 4JCOA 4LF9B 3D4IA 4Z4EA 1FJHA 4KQGA 4JLJA 2OLJA 4B4OA 5T6BA 2XXBA 1OT5A 4CLRA 1ICIA 1LLQA 2Y2VA 3BA1A 4LOIA 4CDGA 1DX4A 3KTFA 3FZNA 1C14A 2BT4A 4FX5A 1T1GA 3LO8A 4DLXA 4O4HB 1SKUA 1WSDA 2EJCA 3LZCA 3JW8A 2RGEA 2V45A 4I66A 4W9NC 4NCKA 3KPYA 2AF3C 2L18A 5IJ0A 2HSJA 3L93A 3ONDA 5TNXA 3TSZA 5JISA 1X7WB 1ZK3A 4ESOA 2CF6A 5DNYB 1K8QA 3UWOA 3ISVA 1VGVA 4B34A 3RM3A 4RPCA 2XXJA 4R1PA 3S4YA 5C46F 4Q9NA 5JYDA 4Q01A 1M6EX 2ZETA 1JHXA 2Y8EA 5EESA 5CLFA 1UZAA 2OD2A 4P53A 4EUSA 1WVMA 3PCTA 1Z06A 1IG0A 2QTMA 3AGPA 4J43A 3W06A 1H8HA 1EP2B 3NHLA 3KXKA 4UDXX 3ZZTA 4EHLA 1XROA 3I5AA 2DHDA 5AK0A 1OFUX 2R8XA 4HS4A 1L3BA 2AC2A 2NSHA 2NO5A 2O7QA 4BB6A 3KELA 5T4EA 1XZPA 1B8NA 3RG2A 2V59A 1PT5A 4LGCA 3MMPA 4Y1EA 1XNGA 1O95C 1QYCA 5IAKA 3C0KA 3D02A 4WK2B 2FP4A 3GUVA 4WH0A 5AD1A 1CRPA 2A1TS 3TRJA 1Q6YA 2QLMA 3ABQB 1AKYA 2X58A 4ZKEA 4GPIB 5KZMB 4TMFA 1O9BA 2JJYA 2YN4A 1EI9A 2C2MA 1WEHA 2HTEA 4MB6A 4D9BA 1N2IA 3FOZA 5JJIA 4F9FA 1FVFA 1QMGA 4TL6A 1NC1A 3KCQA 1V9CA 1GZ5A 5K0CA 4TS1A 3BB3A 1EP1B 2B99A 1SQ6A 3CG4A 1V2HE 5LJLA 3ZQ6A 2GHIA 4NBSA 5ALMA 1RKVA 3G2MA 4WNCA 1LDBA 3DJYA 5JXGA 1SG6A 3PIRA 3MGCA 4JC8A 4JIMA 4BQOA 2JD1A 4OX9B 4Q6BA 3ZD8A 3LCUA 4LWQA 4X1IA 4JROA 1EIZA 4ENTA 4F91B 2HRQA 1PJ3A 3F8SA 3BL8A 3SG0A 5LP6A 4Y30A 1S8NA 4N1AA 1C30A 4XGIA 2BELA 3BRWD 4Z3KA 2P2LA 1E5DA 2Q99A 4HEA6 2BPOA 3RRXA 4TXJA 3G7NA 1DB3A 1Q2UA 3GMTA 3WFIA 1ZK1A 4QTZA 1Z5OA 1SURA 3C6ZA 4XVHA 2HB6A 5ALPA 4QUGA 3WYNA 2JATA 4X20A 3SYNA 1IDN1 1PL8A 2BKVA 2JLQA 3KL2A 2NXNA 2PVPA 1X19A 3KZMA 3WNBA 3ZV5A 4DHWA 4S04A 4AKHA 4L4RA 3V5NA 3K8QA 4OHXA 1ZK4A 2H2DA 2A7XA 3UHPA 1E77A 2QP3A 2D2IA 1ZLYA 1W49A 2KBEA 2GJ4A 4RKEA 1S89A 4GYJA 5JCJA 3WNZA 1PS8A 3FSRA 1OHHA 4ROSA 3TG2A 1UP7A 2Z3ZA 4J29A 1M2OB 1TA0A 1F2TA 1Z0ZA 4I1PA 5KJ1A 2Q9BA 4OXKA 4NNPA 4PZAA 3ZGZA 1D7AA 1XDUA 4QXAA 3H04A 5DLYA 4BLVA 4GZ5A 4MI3A 1RNLA 2C42A 1VOTA 5FAXA 5T67A 3OI7A 4FILA 4JYZA 1DXOA 1HQDA 2FQXA 2ZZMA 2CLMB 3D6JA 5J3JA 3FOBA 3FTPA 1C9NA 1LW6E 1MV8A 2FZEA 3WP0A 1B76A 5K45A 3NKLA 4BMXA 5GQSA 2A0WA 2CNKA 4O4HF 4ZC8A 1NQTA 3GIDA 2P1DA 3ASVA 1YAHA 2Z83A 4G5QA 4GMKA 5DTRA 4HGZA 1IULA 3N39C 1CHDA 2WU0A 2P77A 3DOOA 1B0PA 2VC2B 2WLTA 1FX1A 4FZ5A 3ZH9B 4ZYUA 2R86A 2GI4A 3CTMA 2I2FA 2OBYA 3PTLA 4GPAA 4O4HA 3EUFA 2Q6VA 4Q1BA 5KNBH 1DUVG 1X1CA 2I3GA 2J08A 1CZKA 2GERA 2YL2A 2YOGA 3KPWA 2BEVA 3ROZA 2HA5A 5BSTA 2R7NA 2O8BB 3PK0A 1BH6A 4G4GA 5DEOA 2GRJA 3KEGA 1X7WA 2WSLA 3PX2A 1JPUA 3AP1A 4DIEA 3GLHB 3N2GB 1EDBA 3PB3A 3I64A 1XKLA 1HE2A 5KREA 2ATEA 1RCUA 1XTZA 2HNAA 3RJ9A 1YL5A 3AF4A 1IDOA 3CVOA 2M6LA 3O2QB 1ZW6A 4GLBA 1HT2E 2ZIUB 1XQ9A 4WBXC 4BFYA 1GM5A 3RVRA 1EK5A 3WL3A 1MFPA 5I48A 1JXAA 1RC1A 2Y27A 2PUDA 4LE1A 4G0XA 4ZGGA 5B7QA 3D8HA 2ZDQA 4M53A 3DF7A 5HKKA 1GARA 3PFIA 2XWSA 5K6RA 2HAEA 2VWGA 2HSEA 4UE6A 4BRSA 4QXPA 1N2ZA 3A6FA 3B1KA 2Z8YM 3PPWA 4Z8YA 1U2TA 2PIAA 1CR2A 4D9KA 1CQPA 1W0CA 1FW8A 1HE1C 3DVRX 4DZRA 1I2CA 3KWJA 4K9QA 1G8GA 1N7IA 1Y7TA 3H1GA 4MWEA 4NV1A 1TK2A 4HB3A 1I6KA 1ODFA 3OQ1A 3WGMA 4A0HA 1NNUA 3WXBA 5B30A 1F4PA 5J2UF 2H52A 1ODCA 1JHQA 5AXBA 1CJVC 5FOTA 3OD5A 1EGVB 4IUDS 3ICVA 5FUQA 4ZD6A 1ZAKA 4TL7A 2OXCA 3DC2A 5TC4A 4LMRA 4X8MA 3V46A 4A7PA 1QVZA 2ZI6A 1RYHA 3WIEA 1L4YA 3G2PA 4MQFB 2PS1A 2VHXA 4INJA 3JX9A 4HYTA 3AI1A 3F78A 2W8ZA 3RSOA 3KZOA 3E2IA 2IIBA 3D7SA 3VDNB 3OKFA 4Z49A 2J45A 2YY7A 2UYGA 3CX4A 5JQGB 2VYCA 1Z2EA 2NVWA 4JJZA 1HEIA 1P33A 2YWEA 2QX6A 4FSDA 4FFNA 4XYMA 2C2KA 1W5TA 2BLNA 2RJOA 2JGEA 4ZRDA 1DRWA 3TPCA 4C4OA 2R62A 1DHTA 4CMHA 1QIDA 2A9JA 1OTXA 5H0IA 3RAPR 4BNLA 4CG3A 2WW8A 1NW7A 3FNHA 4DNOA 2VPTA 3BWEA 3MWJA 1DC6A 1U7OA 3TECE 3ESQA 4BVGA 1EKXA 2SKEA 3W6PA 4DDVA 5DWQA 2QW0X 3IL2A 3D8RA 2ZRQA 3D3KA 3VZRA 5AW1A 1A5ZA 1EXNA 4UTZA 1G3QA 3MHTA 1G59A 4NMHA 4L8GA 5CH3A 4DUZB 2I4TA 2F1RA 4JGBA 5DMHA 4YH1A 1WDKA 5JEDA 2R8YA 4RX1A 4JC0A 1DXYA 1GNPA 1IEQA 1TOAA 2BMAA 3CISA 4H35A 4R81A 4RU1A 2QAIA 4WWHA 5CX4A 3G7SA 5DNAA 1NMEA 3I76A 5FTWA 4DIMA 3FZGA 1M2OA 1Y9JA 2I7TA 3QBDA 2G25A 4EVIA 1Y1TA 4TYYA 1JWAB 4ZMSA 1IBSA 4X62B 2CV1A 5HKAA 1IK4A 4GQIA 2X2EA 4V0QA 3DAGA 5GINE 3GZJA 4A8PA 1P0CA 3ZZ0A 1YMQA 1W73A 3SU8A 4QBTA 2VWHA 5LU8A 4PWZA 5IVIA 4HH0A 3FHTA 2ZIWB 3FPKA 2I4MA 2OFWA 4XIGS 4QLAA 4D43A 1JQEA 4AKTA 1PGJA 4AS1A 3IVRA 4U7DA 1E3TA 1SOUA 2GB4A 4YK7A 5E2AA 1TVMA 5YASA 2P2NA 3ELYA 2JFUA 3E53A 2HMSA 3CUTA 3EF1A 4JLKA 4BATA 3G2OA 2CDCA 5A4MS 3E05A 4YTEA 2LXNA 1T3LA 3IUEA 2IZZA 4RA9B 1RWBA 3MF4A 5GZ6A 3LTEA 4AAYA 1YH3A 4KWCA 5EIXA 3GPBA 1XVVA 2L0XA 3LXRA 4R7GA 3WTBA 4B6OA 4GOND 4YRZA 2AN5A 2FPXA 2H0QA 4EB8A 3BN3A 3GLHA 3N2GA 5FFFA 2DBZA 1KY2A 2QTBA 2WTBA 3D0QA 2O0HA 1SQFA 1YB7A 4HGQA 5DPMA 2QJRA 1JIJA 3H2JA 1J56A 1ETHA 3BE4A 3KB8A 1XXLA 1LRKA 4B9AA 2XD9A 2X40A 4TN1A 3AMVA 1A8PA 1EFCA 4EUHA 4YFYA 3L05A 3EOZA 3ZDQA 1AZLA 5HF8A 1C81A 4TVKA 4EYQA 3CA8A 2QN6A 4BMSA 1GGEA 4DXAA 7YASA 2ZCUA 4FYHA 3UGQA 4YRMA 4MINA 1FFCA 3ZS8A 2PH5A 3DT6A 3KFXA 5IJ9A 5FLYA 4A2CA 3M82A 2IZ0A 4CGZA 4BLSA 1SXJB 3JVIA 1H3FA 3CRZA 3H17A 4MARA 4QYSA 3ZWAA 3FFXA 3TN7A 3KR2A 2ZSEA 4Y9DA 3EXG1 4QVGA 1N33B 2CJPA 2ZAOA 2H7YA 2B5VA 5GV8A 3ENVA 3OPMA 2OCKA 4BJ1A 2YNMC 4BLOA 1ZM4A 2Q2QA 2QAGC 2FQWA 5KMGB 1GU0A 4EPYA 5JJLA 4G84A 1ZM3A 1BE1A 5KTTA 3EQ7A 1E4EB 4DPLA 3PI7A 1TCCA 4ND6A 3IPRA 4RE6A 2J3QA 2GD1O 2PSHA 2D59A 1HTWA 1TEXA 4JI6B 4MQFA 2E7ZA 5G0SA 4MGKR 5TIIA 4MULA 4BRUA 1JDTA 4P2GA 5AM0A 1P18A 3G9QA 2IPXA 1DJNA 3N2IA 5DMXA 5KNCH 1E0DA 3K31A 3HI4A 2HY7A 3G2IA 3RPEA 5JQGA 4GRDA 1HDIA 1U3CA 1CDEA 2VKQA 5H81A 1E6WA 1OXSC 4Z7OB 3OUTA 1F5SA 1FDWA 2WP0A 3NYWA 1KMNA 1QNFA 2CKDA 5CM9C 2ZBVA 4A0GA 6YASA 2NGRA 3IAFA 4I9NA 4QHYA 3QBTA 1B6SA 1VC2A 3TQFA 3HEBA 1R0YA 2E82A 3D3JA 2ZYRA 2DMRA 5EJGA 4V1CB 2DSNA 1LI5A 5LQAA 1CY7A 3AR8A 1I1HA 4H15A 4JKYA 3H7AA 4UUAA 1U4NA 1Q95A 2HJHA 3SWWA 1RWQA 3R3VA 1A9ZA 2EW2A 3MWKA 5FV7A 3EG5A 3M2PA 5G1OA 1MZVA 1VMIA 1AB5A 1Z45A 2OQIA 3BHIA 2X1HA 3CKMA 2VUUA 2JCYA 3DBHB 4KXQA 3GAAA 4QGBA 4C4RA 2J31A 4I08A 1F7VA 4X7MA 2DY0A 2VDLB 3WGKA 5KHOC 4YMIA 3ZWYA 4PYMA 4DOMA 1DIHA 4NAUA 3IIMA 1OH5A 5C3UA 1OY1A 2PCJA 3FHCB 4HDQB 3ZJ4A 2JFGA 4LWPA 4U9UA 5AJYA 2Q5QA 2YQ5A 4ZREA 5HBRA 1T2EA 2BISA 3BS4A 3PUVA 1XU4A 3KUKA 3O26A 5HEKA 2JCXA 4PYJA 4URXR 3GA5A 3U4GA 2QVCA 1U0SY 5TQJA 3ZIAA 2ZCJA 3WL7A 1W88B 2ODAA 3OTGA 1L8OA 1IZ9A 4LK3A 2YINC 4PO3X 2J5BA 2HH9A 2NU9B 2QW1A 1J2YA 1U28C 1O6CA 3UCEA 1FYVA 2DWUA 1MG0A 3ZU6A 4JYBA 5CB8A 5I4BA 4BN4A 4AD8A 1JZTA 2JIOA 3SHVA 1YS7A 1QIHA 4UREA 2HGSA 1MT3A 1M2NA 4MPJA 4KRXA 1X70A 3W8RA 1TFRA 2PKYX 3OPYI 2Q29A 4L9WA 4MTCA 3TIIA 1A7KA 1MX9A 2M98A 3G9ZA 3GT4A 2GLTA 1ZQ1A 3DS8A 4Q39A 4WZBB 5FIUA 2W2VA 4RA9A 5BR1A 5HXAA 1QTQA 3JQAB 4UHBA 3NBUA 2UXDB 3VR6A 1MENA 1C7ZA 2CLEB 2OLEA 3DGEC 5AJHA 5HRAA 4J7CA 5HZGA 1ZVVA 2NVUB 1JE0A 4UEQA 4BVJA 1BCRB 1Z4PX 5CDHA 5F3RA 1OASA 5K6AC 2ONZA 4GPEA 4HSEA 2GX6A 4EB0A 2ZT8A 1ZC3A 1T9AA 4EHIA 3H65A 3OKCA 4WGGA 3I05A 1I7PA 3EULA 4CTNA 1TA4A 4FNGA 3ABIA 3ZPXA 1VB3A 5CG1A 4K2HA 1WG8A 2UXBB 3FWKA 1G0OA 2H18A 3OSUA 4W7IA 1O0CA 3ADOA 1RYBA 2O1XA 2RB4A 3KWFA 4KGVA 4BNFA 2HKIA 2BFMA 5KS2A 1O94D 2XTMA 3BMOB 5FI5A 4ZVUA 1SXJA 5IUKC 4FP9A 2AFRA 3WK8A 3O74A 4EUFA 1V5WA 3CVYA 4A6EA 3EZNA 3C16C 1NR1A 3L79A 5EINA 5GM2A 2FPMA 3IIKA 4TT3A 3ZH2A 3L6DA 2ZBQA 1QIMA 3ZQKA 5KMGA 4J76A 1PTJC 1QJ4A 3M70A 2P2GA 5KX5F 2GRAA 2WT8A 1QF7A 4KDFA 2FZ4A 1E4EA 1W581 1JIXA 2I22A 4M0FA 2EL7A 3MSXA 1XZEA 4YAOA 4YV2A 4YV7A 4BKMA 1TLFA 2XUFA 3WGUA 4CI0B 4NEGA 4D9JA 5H16A 4AI6A 1WXGA 2WWIA 5BW5A 1QO0A 2ZYIA 4NX2A 3GVHA 5TARA 2QMHA 2DULA 2Q1SA 2I9PA 4WESB 3VOSA 3NTRA 1TCBA 2OAP1 3P9YA 1ULHA 4E21A 4JD5A 4MW7A 4DVJA 2YXBA 3LC1O 4F11A 1HF3A 2OV2A 4OAOA 5B3KA 2OB2A 1C8KA 3F73A 3BYZA 4RANA 3JYOA 3QPUA 4G67A 3C6KA 2GSDA 4QBIA 2AEJA 4JJ7A 4V1CA 1NXTA 2JD2A 3A4VA 5CLLA 2P6NA 2XY4A 4DJTA 4C0WA 4M9RA 3VOTA 4YMHA 1PVOA 2FF5A 4WNYA 4D57A 3I5MA 5EKSA 4RLQA 2XNCA 1MD9A 3WLRA 2WTAA 4HDSB 1T2VA 1E79D 2FLVA 1X15A 3K1AB 3DBHA 2C9DA 4TXLA 4CN8A 1E9RA 3UMJA 1NYLA 2QE6A 3MYYA 4RFVA 4A2QA 1T8SA 2MINB 3E9CA 4PHFA 1FW6A 3OE7D 1ZBQA 4IDEA 2FQQA 3TNFA 1TA9A 2X0EA 3WMXA 1XQVA 3A1UA 4LYGA 4PC7A 2DLCX 3E5HA 4HAIA 1ENYA 4ZVOA 5F7OA 5HUQA 3FNIA 1BE8A 2OR3A 3CLRD 3K9LA 2PH3A 4QUDA 2J07A 4OMFG 2GA8A 1B0AA 7GPBA 4DA6A 2PU7A 4KDRA 1NV8A 2A67A 3AVXA 3RVDA 1ODSA 2JHFA 5CFZA 1E2LA 4E5PA 4DC9A 2WAOA 2FTKE 3BSFA 2NU9A 2HMWA 1XNQB 1ZKDA 2ZQYA 2ZSDA 7REQB 3DMTC 2I1WA 4B80A 3GNLA 5ALQA 4BV2A 1J97A 5EE9A 2P2YA 1L3CA 1UPUA 5IARA 3BGOS 3U7HB 4NXMB 1FS6A 4HMOA 2I62A 4GBED 3TOVA 1W44A 1U3DA 2WMYA 3Q7SA 1DQRA 2AI2A 4QXRA 4AURA 4M9ZA 3SC4A 4KSBA 1FJXA 4M98A 5ALTA 1O6ZA 4TQUS 3I58A 1NQ5A 3P20A 3KJHA 1FPQA 4DF3A 5JMTA 4WZBA 3LS2A 4CKEB 4F04A 5CB4B 5AVTA 4X6YA 2DQZA 1MB2A 3JQAA 1LLCA 4NU5A 4Q7QA 4G5YA 5A06A 3T7AA 3TUZC 4QU8A 1K5DA 3T35A 3KXLA 4RELA 2O2XA 2J9FB 4X90A 1XD2B 1EK2A 1S1CA 2NVUA 3HHPA 4JK3A 1T3HA 1BCRA 5IM5A 1I3CA 5A04A 4MO2A 3RK4A 1VFNA 4BO4A 1ORVA 1IVNA 2ZS9A 2O7NA 1WEKA 3N3AC 3MFYA 2FH5B 3MMSA 2BTQB 3N59A 3GN2A 1CJBA 4E12A 1QRSA 2OGSA 2ZM5A 1CP2A 1HORA 2MMCA 1YGYA 3GRAA 4Q3CA 1B2RA 1RZ3A 1TPYA 3QOXA 4UNPA 4FOTA 1MO6A 2IPAB 4Z51A 1O1YA 1FP2A 4Z4GA 4FHCA 1MQSA 1GSIA 2NV2B 4NNJA 3H99A 2EYQA 3EBLA 1ADBA 4POAA 1F1JA 4V0OA 4EI8A 1EVLA 621PA 1RLUA 1C7EA 3TUJC 3E03A 3BMOA 5CFLA 2CBXA 4L5IA 1NJ2A 1LPSA 1XU9A 4MW2A 3FYDA 4ESEA 1GGFA 3EZGA 2XAUA 2VP4A 1NW6A 5EMKA 4JLBA 1MZPA 3V8PA 2C4HA 4YRCA 4L6IA 2Y0PA 4QGHA 1QHGA 3WRWA 4BNDB 3DBOB 2X22A 4XPZA 2JVJA 2WTNA 3IPYA 1U4SA 3MINB 3NWBA 3GEDA 2OXIA 1DELA 2GCOB 3AG6A 3W5AA 4IIBA 2VJMA 1G8MA 1P80A 2CCGA 1LSOA 4DLUA 5CCEA 3H2KA 2CJYA 4AN0A 4CKYA 3FN4A 5LLDA 3DZIA 2XUZA 5TGDA 4YPVA 3HFJA 3B36A 3H84A 2VZ8A 2KM1A 2GKGA 1XZKA 2BONA 3HJBA 2EJTA 4K7JA 2HMVA 3D4PA 3SSAA 2ID4A 2D6FA 1QPGA 1W1WA 3I9OA 4G1FA 3FYHA 1S2LA 5KQGA 2EC5A 2NZXA 2EZUA 2VEOA 2FZGA 3BD6A 3GI1A 1XX6A 1NSFA 2EIHA 1XMXA 4ZEWA 4JJFA 4TMXA 4L8VA 4O2AB 4R1MA 1IXZA 1RYNA 3H2YA 4N3NA 3HUTA 4PYLA 2H9YA 3EC2A 4HDSA 4ZQFA 1YB6A 3K1AA 3FCUB 4B4KA 4DA9A 1BDHA 1Y8CA 2OO7A 4Y6QA 4F2PA 5EJFA 3C3YA 3I1YA 4UBIA 5FHRA 3BORA 4K6HA 1E9DA 2MINA 2JGDB 3M3PA 1SBCA 4RYLA 3EZYA 3FAKA 3AVUA 4UAVA 1N5IA 2OCLA 2WJGA 5COBA 4IG9A 2YHAA 3FRHA 1C1DB 3RUCA 4Z7NB 3VR3A 1ESZA 2O52A 4YCAA 1QX4A 2QK4A 5KWIA 2PBZA 3OPQA 2NYAA 4RKRA 4XFDA 2IZOA 5DIFA 5IBQA 2PBRA 2VDQB 4AZ0B 4PCUA 5AW3A 3UBTA 4NPCA 1WHTB 3E1GA 1LFDB 1E1MA 4JT8A 2CT8A 1WZ2A 4KRYA 4PTZA 4F5WA 2QTLA 5IAEA 7REQA 4NONA 1C9YA 5DNEA 2KLHA 2WTEA 3JVVA 3GP8A 1NWCA 5KDLA 2J9RA 5ALWA 1EUZA 4O2LA 2J0SA 9ABPA 5JNLA 1NAHA 2N0SA 2PWYA 5FJJA 4EUEA 2PMCA 1B3BA 4DV2B 1EUDA 4RLHA 1FFXB 4KOEC 4HH1A 5D6NA 4MUHA 3F97A 4CMBA 1L7RA 1DAGA 1I3MA 3OMWA 4HPWA 5T57A 3UHOA 5LQDA 1H2AS 4CKEA 1JAYA 2AZDA 3BJMA 3CE9A 2IKSA 2Q6LA 3H5LA 5CW2A 4DV1B 1KS9A 1IB0A 4OEHA 1I4OA 1N2OA 1SD5A 1FP6A 1DEHA 1BHSA 1Z17A 1BQEA 2IW3A 3G0DA 3O31A 3TQRA 1ISHA 1G8KA 2J9FA 2Z5GA 1XD2A 3GEEA 4GWGA 4J1NA 1J0AA 5KHAA 3UZUA 2HRCA 4RCVA 4I9UA 4PGHA 3D0RA 5P8WA 4QBKA 2Z3WA 2AYYA 4TSFA 3N8HA 4J1SA 4GMHA 2G1UA 1ZN7A 3X1YA 3K9CA 3NRCA 2BTQA 3L0YA 4MW1A 4CEJB 3BRSA 3OA2A 3JD2A 3L7MA 2C82A 4HXGA 4RTJA 1J8DA 2VZEA 4OYRA 1YL6A 4M86A 3I62A 1GSAA 4TTVA 3AX6A 1B3RA 1UJ4A 5IC6A 3ZWWA 1L4GA 3EG9B 5FTNA 3BQNB 1TGYA 4B8WA 5DEIA 2ERYA 4ZQGA 2ZWMA 4MUNA 4Y2GA 4PG7A 5EHXA 1Y4AE 1HLGA 1UEJA 2WKSA 3ICCA 4UCXA 3IAEA 2H3EA 1CJTC 4F38A 3M4YA 1G60A 1EYZA 3LDUA 2ZAGA 5AVOA 4R83A 2IDMA 2Q62A 1N25A 1TAUA 4NZYA 3NVKI 2F62A 1A4UA 3KBBA 5G4LA 4BNDA 1YJBA 2DFDA 1E1LA 2RGUA 5CJJA 4TYQA 5EIBD 3MINA 1X7XB 3P5BA 2J9XB 4TWJA 4YIKA 4KE8A 1JLKA 2IUSA 2GCOA 3R09A 4HTFB 2GPWA 2CZGA 4LJYA 4MYUA 5ALZA 1Y4DE 5JPIA 4KR3A 3QHQA 1I51A 3F67A 4AY6A 1FSPA 3L0SA 3EIHA 1JEOA 2VP5A 1MPTA 2EBFX 3EDQA 1I4TD 4EO7A 4EY5A 2BHRA 2H5IA 4Q7MB 1YC5A 4EFLA 2RHTA 4B48A 2GAFA 3AIOA 1KDZA 5E3IA 4PG6A 1MX1A 3G82C 2RC5A 3PEUA 4WZAE 3UMYA 5F2EA 1ULSA 1H2BA 3CLVA 4QEZA 4RNCA 2V3CC 3T1QA 2MSDB 2IYLD 1TC1A 2QX7A 5EL0A 4YCDA 2A33A 4MKRA 1IEWA 1U7PA 2MMGA 1W85B 4O2AA 1S02A 4AO7A 3F71A 1M5RA 3CEMA 1OU0A 3GRRA 1DQSA 1TZBA 2ODNA 2W6PA 3IDFA 4OHWA 4WACA 4EW2A 2HLNA 1QFXA 3BZUA 3MB8A 1O4WA 1WCYA 4JJKA 2VTEA 2JGDA 3QF7A 5JTTA 5DFAA 4RJLA 2C7RA 1C1DA 1B73A 4DM7A 4HLNA 3V3TA 4MCIA 4BIIA 4DLYA 1UPCA 3CFYA 4MV9A 4UC0A 3UB4A 2H4XA 3B6ZA 1KFBB 1E3SA 2VDOB 3IPAA 1VXOA 4I5EA 4AZ0A 5KOIA 2R4QA 2VQFB 1WHTA 2RGGA 2LKCA 3MUEA 3VU9B 3U7GA 3Q0TA 1WOMA 2DH5A 1ILEA 2FPOA 2PV7A 4RENA 3DXYA 3SEZA 5F7XA 4ZK2A 4FGKA 4O1MA 4DWJA 4ERXA 2JB9A 3IEMA 1KC1A 1XWIA 3OCCA 4OHCA 5EE3A 5BMOA 2X9GA 3S99A 4RDHA 1Z6ZA 4DJDC 5EKTA 4F2HA 3JQ8B 5IKOA 2NUAB 1ZMXA 5DT2A 1Q21A 1YVDA 1RXWA 1FFXA 1ZR4A 2BGGA 1WJGA 4TXHA 2A94A 3L8CA 1XZGA 2RGXA 3ZDCA 3OTWA 4WBNF 2FKNA 3A6JA 3FUVA 3Q8WA 2ZPAA 2WKQA 4YJGA 1MJHA 1ZOLA 2SKCA 2HK7A 2J7PA 4S0ZA 3HSSA 1IHYA 4F2GA 3DLHA 1TC2A 4ILKA 3OCJA 2QYSA 1U5AA 2ZI3A 3IAS1 2CLLB 4RV4A 2QIOA 1SJ9A 5IAOA 3O47A 2Z5LA 1BS2A 4DC1A 2X2FA 3MTDA 4G0VA 1YRLA 3KOUA 3Q9SA 4YP7A 4CEJA 1X7YB 3B6JA 5EXTA 1Z35A 4IF4A 4RO0A 1NFFA 5EHGA 3WSVA 5J4KA 3U56A 3SEAA 4NVRA 2O9JA 3PQEA 5L7TA 1TFUA 1WE2A 1W9MA 2BN4A 2AG1A 5TJHA 4HAYA 4MI1A 4JZYA 5GONF 4KO4S 1DTEA 4MUXA 2NQTA 2NTEA 2Q49A 3NBXX 4BY9E 1UFVA 4WGFA 4IGEA 4DNQA 1F8XA 3I72A 5F4BA 3AM1A 3HEMA 4CT4B 4P5DA 1KRHA 4D97A 3HCAA 3N6RA 2QU7A 4HR7A 1UK7A 2ZYVX 1TPZA 1YD7A 4HNTA 5K6TA 3T5MA 2I3BA 4IIUA 3UFBA 3OFVA 3C7AA 3AUKA 2XPCA 1UANA 1TT5A 4AJLA 3GPLA 2BGMA 1TECE 1PP4A 3KD2A 2ABWA 4QTUB 1X7XA 3UJPA 1TQ8A 3MK31 2ILTA 4V38A 4HTFA 3A6ZA 1QGED 2IYNA 5E8JA 4XQEA 2VL7A 1E9FA 3AG5A 5BSUA 4BFWA 4E4TA 3U31A 3F47A 5KYTA 3T5GA 3ZU2A 1UFRA 3LRPA 3ND7A 1CQXA 4JA2A 2FJ0A 2PQ2A 4JQCA 3B9PA 2WRZA 2B9EA 1WOYA 4JXJA 4E5YA 2BP7A 3RVOA 2DQ4A 5C51B 4JX8A 4NDZA 4OB8A 4GOLD 2WVJA 6Q21A 2NTJA 3O21A 2VBCA 1L7PA 4OLFA 1QH1B 2JI4A 2D1RA 2GEJA 1D4OA 3OZAA 2P4EA 4A4DA 2XUAA 3U44B 4HT3B 4X7RA 1J25A 1GO2A 4MIKA 5JNWA 1N8KA 2Q5EA 1TM7E 2PUHA 2Q1TA 1W85A 4NJEB 1H2HA 4BYMA 1M73E 2A92A 3A1EA 1QE5A 1YQEA 4GXTA 4DDHA 4UCFA 3KCNA 2AG5A 3QK7A 1RFLA 1UQRA 4JJIA 1JPNA 3GJZA 2GT1A 4LCJA 4RA6B 4H0CA 1V3UA 4LVNA 4HI0E 4Y9RA 4U7WA 5G02A 1HSZA 2A0XA 3CLSD 2H29A 2XYQA 3GDFA 3TCNA 3P2YA 3W8EA 2XITA 4UQOA 2I5PO 3NDRA 2J32A 3BBLA 1BKDR 1QR2A 3DEJA 1Y7HA 1CBUA 2Y05A 4M7WA 4QWMA 4V0RA 2X9VA 4UATA 5EYPB 5GP1A 2MJLA 4PLZA 3TCXB 4B5KA 1I1NA 3D4OA 3KEFA 4HAVA 2VNHA 1U2QA 4ZHQF 4EJSB 2RAFA 3RIEA 3DL7A 2Y1FA 1CK4A 1DBSA 2ZSUA 3BFJA 4WXYB 3S70A 1RAGA 1KXJA 1LFAA 3K20A 2B7BA 3ROXA 4J4HA 3ZWBA 2AR7A 1WR8A 2FFAA 2VDUE 2XHEA 2XE4A 2XUQA 4X1OA 1S8AA 3ZLTA 4E4YA 2C0PA 4BEWA 2B8EA 5BWBA 1OXXK 2BHSA 1TO6A 2OT3B 3DMNA 3DAHA 3QG5A 4M8SA 1P4GA 2QV7A 2C92A 3LX6A 4EO9A 3HGTA 3JQ8A 3RFTA 1WIWA 1H23A 2O2YA 3O03A 1Y5MA 2B35A 4IHJF 4YAUA 1DTWB 2FMTA 2P4SA 2P3SA 1EVKA 3HPQA 1D2CA 3PGA1 3W4KA 1JT9A 2P7HA 4PICA 4DTCA 5HKBA 5ECYA 3UMMA 4OIFA 3AZOA 5JD6A 1YSCA 2X4GA 3PIIA 4MGHA 3KKMA 3KR9A 2PH1A 3FR8A 4RACA 5CH8A 4AQDA 4DUYB 1P2SA 2OGTA 2ROQA 4KG7A 5AK5A 4Q82A 2QLTA 4WQMA 2I1VB 2Y71A 1W34A 3VGJA 3L8ZA 4F56A 3RS7A 4QOJA 2V4ZA 5ER9A 1X7YA 3CO5A 3NHBA 4FS8A 5CVJA 1AMUA 2PG3A 2ZTUA 4MDEA 2ZGVA 4H1WA 4ZQBA 3DR5A 5B1EA 3R77A 3QKSB 3PWZA 4U6QA 1MORA 2XMCA 5FEMA 3U39A 4EKDA 3OESA 5AQ1A 3LBHA 1NVVQ 5ARDA 1O97D 4TL8A 2XKBA 4QNNA 3O0DA 5D84A 1OGYA 3DCYA 1KO4A 4JUAA 2IL1A 4HADA 1AXEA 1XJWA 4HGRA 3RJTA 3IULA 4YQFA 1BDIA 2QTGA 3DVAB 1SVOA 1ZD5A 1HUQA 1WMBA 2OENG 2OVBA 3NJ8A 2Z1DA 3HFRA 2W2MA 3QIVA 4MVJD 4NI5A 5CK4A 5DLEA 1NNSA 4WCDA 3CYFA 3QVXA 3TFWA 5J59A 2H5EA 4JOQA 1P5HA 2VCEA 5L7YA 3VPCA 4C4XA 4CQMD 2C5AA 5AHOA 2WNSA 4NF2A 5DJ5A 1NQUA 2PD4A 3DCNA 3P0RA 3IVMA 3NC0C 2PJDA 1DT3A 1WWKA 3BRWA 1VXRA 5C8YB 5IH3A 3PHIA 3PUXA 2QR5A 3Q2IA 2F2TA 1T5SA 5KNBA 4YREA 3HSYA 5CA1F 4V2IA 5LKAA 5ALDA 3IMGA 1E2UA 1DAEA 3N0VA 3G8DA 4GI5A 1SK9A 1P7WA 1T5IA 4IZHA 4Q9HA 4XTCS 4UU0A 5HVNA 3GLHE 1FRQA 3B7WA 1R0RE 4AIRA 1BX0A 1PS0A 1ODTC 3HO1A 1QH1A 1D2GA 4P7FA 3WLOA 1REQB 1ZFNA 2WJ6A 3BAZA 4LC9A 2ZJ4A 3BBPA 4EI2A 1O89A 4CV3A 4D0RA 2I4IA 4L3VA 3U44A 3DDNA 3I73A 1OB2A 1GQOA 2JEYA 3I1IA 1FMCA 3VZCA 1JKIA 2EKDA 2Q2VA 4NJEA 3AEXA 3QP9A 3TRFA 2IS1A 1S3SA 3Q72A 4W5NA 2XHZA 1IIRA 1PGOA 1BJKA 3L0IB 1FE8A 1P7ZA 5CM2Z 2Y77A 5F2KA 2H7XA 3T4EA 2GCPA 8ADHA 4D7AA 1D4FA 2H1RA 2HV8A 3CZCA 1UM9A 2H7CA 1KJQA 1R0WA 5FOVA 3U19A 3U5TA 1F8UA 4M8IA 1F20A 3K9HA 4ETIA 4R3WA 2Y1WA 3AF5A 3VNSA 5HHTA 2R00A 4ZGBA 3B1WA 4LJ4A 5A5VA 1EGQA 3BIFA 2BFEB 3CR8A 1AO0A 3RAFC 1JS1X 3LCVB 5AUOB 2P3OA 3LCJA 4W9MC 5B37A 4NYMR 1RYFA 2C2YA 5EYPA 1LW7A 3R5HA 4KIGA 4GLLA 1MOZA 3ZUGA 1W30A 1WL8A 4QGSA 3UJNA 1N6HA 4L5AA 4EJSA 1CX9B 5C35A 2A2ZA 3QWAA 3VYRB 2W9XA 4DC0A 1MOQA 4EI7A 4RKQA 3ENNA 5JC1A 3LW7A 5H3CA 2F6RA 5P21A 4DEXA 3ROPA 2PEYA 4GP9A 2AMFA 1DC4A 1CIJA 1V8DA 3OE4A 4N0DA 5ITZB 2H1LA 3NBAA 1PD1A 3RTGA 1YZVA 1DTWA 3F4KA 1HTBA 4X6UA 5LQUA 3HKEB 1IBMB 3DNPA 3C41J 4K5QA 1CW2B 2R8PA 2ZRHA 1HEUA 1EBUA 1N5LA 1UPBA 1Y1SA 3PG5A 3QHPA 4U6NA 5D3MA 5F78A 4U9IS 3VKWA 3ODGA 4QUAA 3U3OA 4MQ5A 4ZO6A 5BSFA 4ZJUA 4E6PA 1ISRA 4WIAA 2NZWA 4ZYZA 4ESVA 2WJVA 3FJYA 1NBAA 2BR3A 4MKFA 2QIPA 2OO5C 3LH5A 3MBKA 2Y92A 2TSYB 2WIAA 1RQRA 1V4BA 3NANA 2DETA 2HDWA 1O6GA 2WFZA 4PE5B 1H66A 2DZDA 4NE2A 1ECJA 1XP8A 3BSWA 4C14A 3HJRA 3EXHB 2PXXA 2X4IA 4GMDA 4LHYA 4P0QB 3CHYA 1BJRE 4KP7A 3VJRA 3DM9B 1AKUA 4ISBA 3MFQA 3OG9A 2XQFA 5FBRB 1U11A 2LZ0A 1EBFA 1OX5A 4AECA 4ZDKA 4TMYA 4DV6B 2F00A 2ZI7A 4N39A 3JQPA 3LMKA 4D9FA 2QTVB 2Q4DA 4H60A 4J6FA 2F8MA 4PFKA 4RIHA 3IJEB 4ZVSA 3X1MA 3CEPB 1JLSA 3CQ9A 3HKDB 3A6GA 4B46A 3GVIA 4IJQA 3BCHA 3RFUA 4AN1A 4GOJA 3N74A 4HMPA 5JHHB 2RH4A 4WA8A 5ICGA 3P4XA 3ZGYA 2E5WA 1J4AA 4GZMA 2C78A 2P40A 5DLQC 1V7QA 4D9CA 1C2TA 2QU8A 3EXIA 1IUPA 4JSRA 1YDMA 2W2NA 4IOMA 4EG0A 4E5VA 2LRHA 3ASYA 5DM1A 1ZL0A 4FS3A 4KR0A 4RYDA 3OM1A 1YKFA 2VSOA 4BFTA 5JRDS 4JOSA 3UJ7A 3KJZA 3AHEA 4DSOA 5KYNA 4QHTA 1E6CA 1JW9B 4AJPA 4HV4A 4K3VA 5IG2A 3E27A 5ECGC 2QUAA 4GD3Q 3AKYA 3OOEA 5C8YA 2V7GA 2MYTA 4UUOA 2MYUA 4GEKA 5C2JB 3NWOA 3WB2A 4OUKX 4DR1B 1EVQA 1E98A 3TTXA 3HUUA 4K9MA 4YQZA 1T8UA 1KSHA 4TTJA 5K0GA 4RHTA 1TM3E 4FGSA 3H1FA 3I0NA 1NPTO 5K3EA 2OC9A 1C3OB 4M6WB 2VVTA 1KVSA 4KWIA 4MQ6A 1YKSA 2A8YA 2C00A 2FJUA 4CJXA 3O7MA 4HWTA 1REQA 1J07A 5TS2A 1OGJA 4QFMA 3LCMA 4MKXA 4OK3A 4J03A 2A9FA 2VP2A 4DA7A 5AHRA 4C7XA 4QLOA 4Y2YA 4IXNA 2Y9PB 1JDBC 1YRHA 1GZ4A 2FW9A 2AFIE 2P4UA 3HR8A 4FDTA 4LWOA 1ZUHA 5JMOA 4CIBA 2H1WA 3UANA 1JQLB 4IAOA 2O2EA 1IOVA 2XOKA 2CWDA 2IJGX 3EQ9A 3Q2OA 4NZOA 3RC8A 1L1RA 2XMBA 1ZMBA 3RDPA 1QB7A 4HQKA 4QYTA 2ZUCA 1X94A 4OU5A 1ZN8A 1JDPA 2BFEA 4KFSA 4OFZA 2W8BB 2REQB 1ZJWA 2ID8A 3K70D 5LZ7A 1TNDA 4KGDA 3R2JA 4C4TA 3S1SA 1IRIA 1PWZA 3Q7IA 1DC7A 2JAUA 5JUWA 3FSEA 3LU1A 3Q5DA 3T0GA 2Q2OA 4WZZA 3QXCA 1BO6A 1NR5A 2BMEA 1SQ5A 5L3RA 3VZDA 5CPBA 2NIPA 2JANA 4OI2A 1Y6RA 3REFA 3DMRA 1QPBA 1BCSB 2D4AA 1EZZA 4LE2A 4KE6A 4R5MA 3THRA 2ZYDA 3U17A 5ITZA 4Z4FA 3GQBB 3K09A 1P1JA 2C95A 1LVGA 2C4MA 1N5MA 4KXMA 3I37X 3QKRB 1LSSA 4GDMA 4MZXA 2O8DB 4F8JA 3GZTB 2PV0A 4V24A 3VVCA 2QRHA 3HKEA 1RRPA 3OQIB 5KNCA 3D7LA 3NHJA 4U7HA 3T3DA 4DLWA 5A3QA 2OMEA 1A77A 3KQHA 3NHRA 4QC2A 1ODLA 3GBPA 4BO5A 4OP1A 1KBOA 3AM5A 1T9KA 4OXXA 4TKVB 4Y18A 2DCUA 3R74A 1C7QA 5B6IA 2PX3A 1GRRA 2WIJA 5C3MA 3ZJUA 3LCRA 1TZ2A 5DDIP 1M2HA 4H7IA 3PPXA 1TU4A 1YC2A 2CE2X 4ZT7A 4YJ3B 4AF6A 4E3WA 4BDSA 4TX1A 2A30A 3I2IA 3ZHYA 4ZU3A 3SLRA 3T1TA 5EZYB 3DEKA 3G9XA 1LK7A 3EXHA 3PFBA 1M8JA 1Z0DA 4ZAGA 4F93B 2PIDA 5J43A 3KVVA 1A2QA 1D0SA 1E7SA 5DBGA 1IBRA 2GN6A 1VSQA 2W4QA 5AW5A 4AMUA 3P2IA 3TDNA 4MK4A 3SBEA 4CCAA 4LRYA 5ELLA 1Z4LA 1TQ6A 2QTVA 2DSTA 1KFJB 2XV1A 3MC1A 1VMAA 5LL6P 3JQRA 1R27A 3HRKA 3HKDA 4UTOA 3EF0A 1VHTA 2PYDA 1MCZA 2KPOA 3H75A 4XQ9A 4ZDWA 3VPHA 1B1CA 3N76A 3F9CA 5H8WA 4C0XA 4V1CI 4NG5A 1U0RA 1H5QA 3G0OA 2GTHA 2IHJA 5F5LA 1OQAA 2WG0A 3SEFA 2Z2IA 1PQ4A 1HURA 1P4JA 2A0FA 3L7KA 2VQSA 3CUYA 4DTIA 4KQMA 4R1NA 3FUUA 2CUTA 1X1QA 3P97A 4X6XA 1HETA 1J0EA 4R8MA 3IAUA 4G0MA 2HR1A 1CVLA 1JALA 4LF4B 4R2KA 2VK8A 5JDCA 1G16A 2GM9A 3UMBA 3G85A 3NFRA 5INTA 3H42B 1QWOA 1A8QA 221PA 3G6WA 4YQYA 2WHYA 3MXOA 1L5WA 3RVNA 3IXMA 3SY8A 5IF9A 2BGJA 5MF6A 1RRVA 4QQRA 2NO4A 4P36A 1VSVA 2NZVG 1BXKA 4H08A 3IMEA 3Q0IA 2WJHA 1YQWA 3DUFB 1GU1A 4R3NA 1BNCA 5DGTA 1IXYA 1F6DA 3AP2A 1C3OA 3KU4A 4M6WA 1MEOA 4CM9D 4OXNA 2QJWA 3CXRA 4H3HB 4YDSA 3TXYA 1ULBA 2HOQA 4O59O 1CP3A 1OFIA 2EGHA 5JH7F 3LYAA 3TMYA 4HLCA 3TS1A 4PG8A 3A9SA 5K0BA 3D3WB 3VX4A 4MTLA 1W5SA 4YP9A 5IBPA 1YWGO 1W2WB 1CFJA 1NMXA 2EERA 3F3YA 5K7SA 2I54A 3Q41A 4KN9S 1NBMD 2HQOA 3HCNA 4JODA 3A04A 2QN1A 1FRFS 5FO1A 4RPIA 4DVGA 2FWMX 4BXOA 2EG5A 2NPOA 3QXSA 4HAZA 2VK1A 4ED9A 3HO8A 1PEAA 4P98A 1IBKB 4EF6A 3DOUA 1Y3CE 3JYLA 1M2KA 1RQGA 4EB6B 4LX8A 4IFTA 4V02A 2CCJA 4HB2A 2REQA 4P93A 4HPJB 1EE9A 1DVRA 1HA3A 1PJLA 1VZ3A 3KKQA 3WRVA 4GKBA 4YRBA 1N5DA 3G23A 3T0FA 4PLWA 3PXBA 4YRLA 3KT3A 1AKNA 4H6WA 3CRRA 5ALKA 4RXMA 2HXGA 3H2SA 1MUUA 2VTKA 4CT0A 2WHRA 3WIUA 1JHYA 5CFPA 2GZHA 2QT9A 4B3XA 3O8LA 1BCSA 1Q57A 2G0NA 4TVBA 4N82A 1NP3A 3GQBA 1YI1A 2O8DA 3H9BA 2JAOA 3I83A 3E7DA 3QKRA 4YJ2B 3ZWOA 3V48A 2VDRB 1YB2A 1G8HA 2N9UA 2QXTA 3PQ6A 4U7JA 4D9IA 1I3KA 1NVGA 3OQIA 1RU3A 1JU3A 1W48A 4RNDB 2XGOA 3R9IA 1GKYA 2G5PA 3WKCA 2YDXA 3AJDA 1V9SA 2C9BA 1I5EA 1LVUA 1Z4QA 2OSBA 2P9HA 2XB8A 4KACA 4OU4A 4Z4HA 5F51A 4UUMA 2ZJOA 4PYIA 4XX1A 2R48A 3S2SA 1CWUA 4CI9A 1NN0A 4FBMA 1KI9A 3KP1A 4EMUA 4A10A 4TKVA 2GHTA 3OWHA 4R2WA 1M2JA 1FUEA 3VMMA 2FPWA 4HK4A 2G6BA 3I01A 3FTDA 2VH1A 4YJ3A 2H9IA 3NHMA 5JATA 3ORQA 5EZYA 1L4LA 3SXJA 1VHDA 3ZWQA 2FN8A 1QIKA 2R6HA 3NTVA 4PNHA 2BBOA 4WW0A 4ID9A 4IG4A 5FH9A 4NC9A 2JFNA 5IAJA 1HT1E 1XA0A 3FB4A 3RF7A 3ZJ5A 2ZUBA 3EDYA 1H6DA 1JDSA 1U98A 4RSGA 3OQ6A 4C30A 2Q6KA 2C7VA 2NG1A 4C5AA 3L02A 4E5MA 2C7QA 3D54D 2DERA 5BQPA 1A04A 2DT5A 1YI8A 2Y1DA 1UZUA 4C4AA 1PU2A 4BFVA 1NHGA 3OF3A 1YCHA 3INRA 3T06B 1L7QA 1IL0A 2HZBA 1CDZA 3WKAA 4JQOA 4CLOB 3WSWA 3Q12A 3BJEA 3BERA 3ZDZB 4UJ3A 2OC4A 1L7AA 2VR1A 1BN7A 3WGYA 1T4BA 5M7EA 1DWUA 2XQJA 1G291 2HREA 3V8QA 3WGOA 4B4DA 4CPDA 5ELXA 4WK4B 2QI9F 1QMPA 3LUKA 1RM5A 3DZHA 4N0QA 3AHHA 1EXVA 4WLVA 1KAMA 1BOFA 1RQNA 1NRIA 2R5NA 4RQAA 3RVLA 4CM3A 2QZ4A 4CMAA 4BGVA 4NZPA 4HP8A 4NNOA 3SD7A 3DP9A 3UWKA 4Z2AA 2ETVA 4MKIA 1DXHA 4N0PA 1UJ6A 1EHIA 4EA8A 1E9EA 1N92A 3KT6A 4O33A 2Z4TA 4TKLA 4WXHA 2IYWA 4UTPA 2NZ2A 1YZNA 3QX3A 1AKRA 3OPVA 1P5RA 1R4AA 4RJIA 4KQFA 4ZC1A 2BHTA 4EB3A 4W7HA 4ZK6A 1U7HA 3DUFA 5FWAA 1EVIA 3AY0A 3H19A 3WKDA 4FBLA 3OMXA 1R74A 3MMZA 1R10A 1E79A 1V71A 4PSCA 4FI3C 3HYTA 3SKVA 1II8A 1XN4A 3CZRA 1QGAA 1QHXA 3HYRA 4HCJA 2CL5A 4QOFA 2OMKA 1F14A 1KPGA 3AV3A 3C1UA 3HUEA 2P5TB 3D3WA 2VAWA 5DSZA 3O73A 3T5BA 2OGWA 2JCSA 2ZJ0A 4HQLA 4TKMA 5TRTA 2GEFA 4URVR 5BT8A 3J7AC 4A0FA 3SIWA 1R0LA 3EFOB 3R8CA 3TXAA 2XCQA 1DMRA 3V80A 1T9BA 3F6BX 5B1YA 1ZVQA 3EY4A 1MXHA 3WZ2A 2DPXA 5LQSA 3MCVA 4JLAA 3KT0A 2D8AA 4NH4A 4DCNA 4H7PA 4GEGA 1RYEA 1RABA 3R44A 5J47A 3HUFA 1DMSA 2PSFA 1SHUX 1YCDA 3HYSA 2BI7A 3LPDA 2ZB8A 3PKIA 4EB6A 2CL0X 4FFOA 2V58A 1A7AA 2WYVA 3KQPA 1UAGA 1EQUA 3KSBC 1IWPB 1ANKA 2BEWA 2OWDA 3G2NA 2B7CA 2IYRA 5EUBA 4JR1A 2VK2A 2D1SA 1TZKA 2I7XA 3GOQA 4U5XA 9LDBA 5KOJA 2D5BA 1JHMA 5DTQA 2QF7A 3TLBA 3B8HA 1KDPA 4D26A 1BQ4A 1TZMA 4HLUC 2PUBA 5EP1A 1T5TA 1ZI8A 2W22A 3P2MA 1RSZA 3PIDA 3Q9NA 4GRAA 5I8ZA 3SQLA 4ZOQI 3OOWA 1BVUA 2Y76A 2YRWA 3OIGA 4XJTA 4BCDA 4M7PA 2C5HA 1A8HA 3F6SA 4BO1A 4YJ2A 4XPIA 5DN6D 1HNZB 1ZRMA 4EG5A 1K9SA 1ZD3A 4ER7A 4DDWA 4M0CA 1Z62A 3F6PA 2IIPA 1QHIA 1TL7C 1XLWA 1II9A 1Z4OA 2ZU0C 4FM9A 4DB2A 1O77A 2FUCA 3SJ7A 4RTMA 1KOGA 1NXOA 2O3QA 3QGMA 4OCZA 3URMA 1M0EA 1DT5A 1DBQA 4RTOA 1W4RA 2ZG6A 1YK0A 3BXZA 3ZHCA 3OFKA 3SZUA 4L9SA 2RJNA 3VSDA 2ZYTX 1JFVA 1L7VC 3AVTA 3CZ4A 3DKPA 1KH3A 3VU3A 4IZ6A 3NIBA 4EHAA 3AIIA 3FPJA 5FXMA 4AM8A 2EX1A 3VZSA 1XAGA 2J5XA 4GXNA 2ZBPA 3LC7O 1GEEA 4GVLA 2DJ5A 1RT9A 3LV8A 4KL8S 5E7IA 1WS6A 1EP9A 3CVVA 1AQLA 1F6WA 3HMQA 4N5HX 1HMYA 1W4BA 4L22A 3FUTA 3KLBA 3EYAA 4IDNA 3T5CA 4LQDA 3BULA 3K92A 1GOTA 3WZLA 2VO1A 1F0NA 1GFZA 1U9IA 3EAGA 1BU8A 2YASA 4FJ1A 1X0VA 4UVEA 4CTOA 3FVRA 2QTAA 1FFSA 2JI7A 5GJBA 1CZRA 1VL5A 5TY0A 5JSFA 2PGOA 1T8YA 5HK8A 1GCIA 1RJ9B 1TKAA 3WISA 2Q8NA 4KRGA 1T3SA 4PLTA 3ZCXA 1QCDA 1KO7A 3UJCA 2RHCA 4CLOA 3T1NA 1EGHA 3ZX4A 5K3BA 2XVAA 3BF8A 1QORA 4LOJA 3DE0X 2QWXA 2C5EA 1YTLA 1B16A 4UCQA 1RWOA 1XA4A 2B8NA 4D4LA 3R0QA 1HWYA 5IWAB 2X8JB 2JH3A 4FW9A 1H0KA 2P9TA 3IA2A 2RHMA 2VPWA 3TVYA 3P9CA 5COAA 1G3RA 4RS3A 1MDBA 1LXCA 2XIQA 1FEZA 5C80A 2QPLA 4KFTA 1Q7GA 3A9UA 3E1SA 2XADA 2XA1A 2K6GA 4L57A 5DP1A 3KXDA 3TCKA 1Z6GA 4CKZA 1UKYA 3UK1A 5JG7A 1WMDA 5L4NA 2CLFB 4IDDA 4K26A 1PL7A 4OHUA 4A6PA 5EZQA 4HGNA 1E62A 3RRBA 4I5GA 5BQ5A 3W9BA 1K2WA 3JPYA 4J75A 4ALKA 4PLGA 1Q92A 3DGFC 3QKTA 4K9RA 5CITA 2YOFA 4NY1A 3CSSA 1BC5A 4MQMA 5LMZA 4G86A 3EFOA 4XVUA 3C7TA 1FXWA 1SUSA 3DF9A 5F2NA 1JEDA 1S5PA 1ZOIA 1NZFA 2XDQB 1LVHA 5KSPA 2CVHA 4P4LA 3C97A 1UODA 2CV0A 1D5CA 4F60A 1N36B 5FOXA 2FN4A 4YJKA 1T91A 3Q3JB 1PKEA 4ZVRA 4B2LA 3D81A 4BP3A 2WD7B 1QBGA 4MR9B 3RS8A 3K72B 2H5JA 2Y1CA 1CUSA 2GO1A 4KUGA 3NEAA 4HEA1 5CNKA 3R3ZA 3UUFA 5A05A 4G97A 5DM70 3W4JA 5IN5A 4Y2VA 4DAEA 4L0QA 1H1DA 4D45A 2JRCA 4ND8B 2OXFA 4PVCA 2OYRA 4EITA 5HQ3B 2QD4A 2AVDA 5AP9A 3T1HB 3D64A 4G81A 4R84A 1E99A 2BKXA 2WPDD 4C6SA 1JKMA 2VNKA 3O8DA 1ZCZA 4ZVMA 3GIWA 3OCXA 4JNCA 5I4KA 1Q11A 4CMCA 3EX7C 3ICEA 3KU1A 2GF0A 2OZKA 3DMYA 3FSJX 4N4AA 4R7ZA 4TWZA 4ZU6X 3TQSA 4TYWA 1E94E 3ZCPA 3P4YA 3Q11A 3JQ7B 2BHLA 2FEAA 2IYVA 5LYYA 3GU3A 4I55B 4B6GA 3PE4A 4M8LA 1ZH8A 3DDOA 3ANNA 4ESHA 4RETA 2I8AA 4ZT4A 3HDHA 1PT6A 1GHTA 1KFCB 1YQDA 1SCIA 4IM7A 1NC3A 2JFHA 4K6FA 5BT9A 5G0TA 4BAZA 3PFKA 2VK4A 3ICWA 3U80A 1YBHA 5KQSA 5T4HA 1ZD8A 3KQSA 1IHDA 2QG6A 2ON6A 2P67A 4R2MA 5AXAA 5HM6A 2RI6A 3ULKA 4BNMA 3M6LA 5D5HA 2JLRA 4PX5A 421PA 1GA6A 4LC0A 2IYTA 2Y1EA 5EQFA 1PAUA 2Z1MA 4RMJA 4PN7A 1NRWA 4YAKA 1NIPA 3K2QA 1QP7A 3E3AA 4BAGA 1P8AA 1CPYA 3UTCA 1ZR2A 3ZGOA 2ZJ7A 2ZRMA 3CN9A 1NWHA 3C4QA 1IY1A 2NXJA 1HXHA 1T34A 2B61A 2I03A 3KE8A 3CNLA 2C3UA 3RU7A 5K8LA 4Z4QA 1YIDA 4OI0A 1EWTA 2WKWA 1C41A 5FOWA 4BX2A 1WB4A 3YASA 1UOPA 1ZJZA 2XRYA 3IERA 2IUFA 5A2GA 5AXDA 1NVAA 2XNHA 3LE8A 3LA8A 2P9CA 4NLLA 5ALLA 4O6VA 2QMQA 3SICE 4OA8A 1MJGM 2PH7A 1RJ9A 3MJHA 5CBPB 3K96A 5JWOA 3H1PA 5DASA 3KZVA 4V0LA 4EZBA 4GI2A 1XKQA 2D2VA 3JQBC 5IANA 4HB0A 1EFVB 4OHBA 1ZNXA 3MPOA 4EAQA 1C4WA 3PC8A 3IXLA 2DX7A 3OO0A 3QPWA 5TPZA 4BWFB 2NYVA 5L40A 3S8MA 1NG9A 2CFSA 3FNBA 3UN1A 1UDCA 4BNXA 2XB2A 4F4JA 3LBNA 1KK3A 4NCNA 4MR8B 4JI5B 5JSYA 5BYKA 2X8JA 4E5SA 1FLNA 1KZYC 4OHKA 4DWVA 3UA3A 1RW4A 1QKIA 1FYFA 2MYNA 2OORA 1TCUA 1OXBB 3AJ9A 3X1DA 2H2FA 1WMSA 4P3OA 4A27A 3DPIA 3LL4A 1E2FA 1KA9H 3AWDA 4RHEA 4C3VA 4I36A 3CRW1 4MKGA 3RFCA 3TQTA 1XTKA 3U0BA 3ZNPA 3HNPA 3Q3EA 4B32A 3EIOA 1Z75A 5FPHA 2XCUA 5DI9A 3MELA 5D6OA 3TK1A 3HCOA 2HLPA 1XVUA 1AQIA 1C8VB 2BMFA 3GYBA 4BMOB 2CFCA 1I6LA 3SFZA 2BUCA 3WJAA 4XUEA 3FYUC 4TROA 4DCUA 1VLHA 2CGEA 2ECPA 1DWOA 2TMGA 4OL9A 5I9IA 3GLGB 1RRCA 4HX5A 3ASUA 2E6UX 3FXAA 1GA1A 4D92A 3L7NA 2FN7A 4UEOA 2CE7A 1RQPA 3COYA 3O75A 1Q22A 3HVKA 3MOIA 3R3SA 2JEOA 3D6FA 4IDBA 4W82A 2XDQA 1RI5A 3K2BA 4QGAA 3BX1A 4LXXA 4XD2A 2BZSA 2AXPA 2JGNA 3BTSA 1YHNA 3DMHA 5DNDA 2AI3A 4L5BA 4BN5A 1MEEA 4IIVA 4I1VA 2G9NA 3B1XA 4YXWD 6GPBA 2BGWA 3I2JA 1K4YA 2WD7A 4QYWA 4MR9A 2ZYGA 2Q5OA 3VHQA 1EFDN 5A4FS 3LNCA 3ZQUA 2XEXA 3VKUA 1QIIA 2IUEA 3HXTA 5ARCA 1P6QA 2YH2A 3MOGA 4GWLA 4ND8A 3ZU5A 5HOQA 4IQFA 4D8VA 3SSNA 5HQ3A 3R9XB 4DLAA 3P52A 5KYUB 1NP6A 2X86A 1LPMA 3LT0A 1WCIB 1XRJA 4H2DA 1PNQA 2CUKA 1PGNA 4LDPA 4UFNA 1MQAA 3L0DA 3P0HA 4UULA 3WWOA 1N6KA 3GFBA 2P65A 2UYCA 1RBYA 2NAFA 4N47A 3AHGA 3CIFA 1NE2A 2ACWA 3SYLA 2DR2A 1KJNA 3JQ7A 1VMKA 3LFHA 1WPRA 4TRRA 5FDFA 2V97A 1UJBA 4I55A 3L6RA 1NXSA 2OFFA 4XQ0A 3FAZA 3ZHOA 2YXEA 4EGFA 3B3AA 1OU4A 3WHKA 2I6XA 1NM5C 3SZ3A 1UMBB 1V4NA 1G9SA 1K0UA 2VATA 3M33A 5FI1B 2C4KA 3TMKA 3WKEA 2X13A 4JUBA 1KMCA 2RC6A 2XB9A 3ICPA 3D0KA 4GMXA 4EKEA 4EYEA 1X1TA 3DDWA 3HU3A 4UTVA 3UMCA 2OM2A 1CJKC 3LOPA 3GT3A 3HYNA 2NO9A 2CLOB 4G8CA 5EPOA 5HIIA 3UNXA 3ENKA 3DEYX 5CW1A 2I66A 3EEOA 2YVLA 4PQYA 5JZSA 5JJ5A 5JAQA 4HQOA 2PTGA 5C18A 5IDVA 4NENA 1XDBA 3D5QA 1TUEA 4Q19A 4PO9A 2P6PA 4IBOA 4RE5A 3J81A 5B4VA 2QVZX 2J3MA 3HBJA 5DV9A 5JADA 2GBGA 3FM9A 5DE3A 1FCJA 1U1DA 1TQDA 3Q7PA 2XH8A 1RIFA 1MJFA 1ECBA 3WLJA 4QOSA 3GP3A 4Y2UA 4MA4A 3OBIA 1GPMA 4CQMB 2G0TA 1UKAA 1J2JA 4S1WA 2X3YA 2G07A 4JLMA 4LZAA 5GJCA 1T6ZA 5CBPA 4HNGA 2IU0A 4JXXA 3H4MA 4YYEA 3L6CA 3CF0A 1RHMA 2IOFA 3EGXB 3KKEA 3VV3A 1RZRD 5FL7D 4CKWB 5BWNA 1J2TA 4CL8A 4KO1S 4G2NA 1EFVA 1OLOA 2N46A 3BB4A 1MTZA 2PMWB 3H9EO 4H3SA 3RHSA 1VDMA 3KSUA 1NJ6A 3R1IA 2GPJA 2G04A 3BMCB 4MR8A 4Y0AA 3DEHA 4FKMA 4HFNA 5JFTA 2ID7A 4DBVO 1IY2A 1QHHB 4E07A 4EHFA 1A97A 1T0JB 1WA5A 4KNWA 2RGNC 1XRLA 3COPA 3B12A 2QA5A 5DX1A 1ABFA 2I9KA 1TYCA 1PR6A 3OJEA 4CCSA 4X85A 4B82A 3Q7TA 1OI7A 1VECA 4C6RA 2R4TA 2P62A 3KSZO 2EHDA 3QSGA 1EB9A 1THTA 3VVMA 1LV7A 1SVMA 3W3AD 4TLDA 2Z9CA 4OK5A 4AJEA 3T3NA 3RC9A 1E2HA 1R8SA 1ZU4A 1O95D 2O2DA 3QKIA 3ZBPA 4JV5B 4FPXA 1N9KA 3GLGA 3ETEA 2VEDA 1JDUA 5HCUA 2CHVA 4MICA 5KJFA 2NACA 2X5KO 4GOMD 5CHEA 1WUTA 3BSSA 4RY0A 5EJIA 4BQIA 2DR0A 3ZDDA 5E95A 4ZZIA 2E1RA 3QMPA 4WVFA 1ZWLA 1ZINA 4KVAA 2PO5A 5IDWA 2EF1A 3EEIA 4EUKA 3ESXA 4U0KA 5HSGA 1JGTA 1ZJ5A 4IWXA 4LDNA 4PXSA 1U1IA 4XFJA 5HUHA 5I9NA 1OBCA 2JZCA 4DCSA 4CF7A 5CXSA 3OX4A 3OZWA 4LN1A 1CB7A 1CEQA 1Z2OX 1QIEA 4RAOA 1I6WA 2ZIGA 5SZKB 4MV8A 3KR1A 2C3OA 3CJRA 5ICSA 1L5VA 1Y34E 2COEA 4K6MA 3O3MB 5EFOA 3GFRA 2B34A 3A4YA 4XQGA 2EWMA 2JDID 2YXNA 1T0IA 1ZHFA 3R9XA 3U26A 5T6MA 4FWBA 3KKOA 5T8KA 1TMGE 3DOFA 1CZHA 3PD0A 5EMMA 1WCIA 1DO2A 2OFXA 1C3XA 4XYBA 3SJBA 1IWOA 5JWRA 3ZQJA 4FD2A 2IPNA 1E9AA 3I30X 5EUMA 4A23A 2B4KA 1QOPB 4N5IX 4C1NA 2UYHA 1GPDG 3L0ZA 3QE9Y 3L7DA 3N6XA 3QWFA 2IU4A 1EM6A 2WSIA 1PZNA 2JJ8A 4KK3A 521PA 1XZIA 3VNAA 2BMDA 1HZZC 4F3KA 3K0SA 1Q0QA 1HNXB 1BEEA 2ISSD 1UMBA 3PQ8A 3TVTA 5GIOE 2YW2A 5LP6C 4W8HA 1RI2A 4B09A 4IX1A 2OL4A 3BC1A 3QU5A 3R7NA 5KHLB 2GWHA 4JBIA 2O5RA 5E6UB 3X2SA 1H0SA 3AP3A 1OFGA 3INYA 1KOFA 1RVV1 4D1YA 1CEYA 1DEXA 3QPAA 1UIRA 3G5TA 1BMTA 1YE5A 4MB2A 3F6EX 4S1VA 4KQ6A 4BKPA 1U2EA 2BH9A 1Y5RA 1KYIA 3CNEA 5BVGA 2DUJA 2WTXA 1VL0A 1QVWA 4QFCA 3CLKA 3DPSA 4QOIA 3QUAA 2CXPA 5CDGA 2WA2A 1QU3A 3ESCA 4GQAA 2JA1A 1GQYA 3TLGB 2F3SA 2IS4A 1WO8A 3A36A 4MVJA 1W36C 1EB8A 1G55A 4R01A 3SNKA 3UXMA 3WL5A 2X6TA 2RHJA 3O3NB 1KGSA 5D2CA 4D98A 1IOZA 4HFJA 4Z9XA 1VG1A 4G65A 4CQMA 1BS9A 3M5PA 2CDAA 3K16A 3E4DA 4GP7A 4UDNA 4C05A 3I4CA 4F1KA 4KC0A 3EWSA 1KP2A 5KSOA 4FYWA 3L6EA 1P0MA 2EJUA 4LBWA 4G56A 2XQIA 3CZ9A 1U3FA 2BFBB 2YX1A 1USGA 2ZJZA 4M9SA 4HWPA 4R1SA 5CXXA 3EGDA 3OT1B 4BXOB 4MCAA 3RBVA 2D7CA 1BXRB 3WS7A 3W79A 5HQJA 3QFRA 1OPXA 1T29A 3BMCA 2DBYA 2GBFA 1V48A 2QI9C 3A10A 3C3BA 3EIUA 3GXBA 4P5PA 4R68A 4WKBA 1QHHA 4KYIB 5LSAA 4G4SP 3W5DA 1SIUA 1ZRNA 3SHWA 4HUQB 4NOLA 4YQEA 4B8YA 2NSYA 4KIWA 4PAGA 3FF4A 2RG7A 2IS2A 4MUFA 3KT8A 2W0MA 3IVXA 3F7OA 4L6AA 4BBAA 3NOOA 5CPFA 1CY8A