3AP1A

Crystal structure of human tyrosylprotein sulfotransferase-2 complexed with pap and c4 peptide
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
302
structure length
298
Chain Sequence
b'LVMVVEYRYGKAMPLIFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWSKSGREKLRLDEAGVTDEVLDAAMQAFILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLKGDY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein-tyrosine sulfotransferase 2
molecule tags Transferase
source organism Homo sapiens
publication title Crystal structure of human tyrosylprotein sulfotransferase-2 reveals the mechanism of protein tyrosine sulfation reaction.
pubmed doi rcsb
total genus 106
structure length 298
sequence length 302
chains with identical sequence B
ec nomenclature ec 2.8.2.20: Protein-tyrosine sulfotransferase.
pdb deposition date 2010-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13469 Sulfotransfer_3 Sulfotransferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ap1A01
2GVZC 3B1XA 4IVPA 3L8ZA 3L8YA 2WMNB 5E7MA 1KK1A 4DC9A 2GA8A 2JIZA 5BQ5A 2LWIA 1KHTA 2XTNA 4B74A 5BN4A 1E4YA 1G1MA 721PA 3NBYC 1R6BX 5FBQB 1PLJA 1XD9A 4D6PA 2Q6TA 2PJZA 1IAQA 2ZIAA 2ZYVX 4KV9A 4R2HA 1JB1A 1YZQA 2VP6A 4P32A 1GWNA 4GZMA 3SNHA 3T06B 2D2FA 4XVQA 1FNNA 2HT1A 1W0KA 2VHJA 1PUJA 1N2CE 2C9OA 3VU9A 3WHKA 2BVNA 4A2QA 3LVQE 4DIEA 1BIFA 1C9KA 3HU3A 4Q1DA 1W5TA 2ATVA 2GZDA 2ZI6A 2PEZA 3NC0C 3LRPA 3ZVNA 3CIOA 4B71A 1E2QA 1A4RA 3KB1A 4QGFA 3TSOA 3H4MA 4D4JA 1NIPA 2QZ4A 2O8DA 5FOUA 5TARA 5KNCA 2HJGA 1GOTA 1Q1EA 3BB4A 1PLKA 2A78A 4QHSA 2OBNA 1NF3A 5D3QA 3SJCA 4X8OA 1FPMA 2ANBA 4DEXA 4IEEA 2J7PD 3SQWA 4IXMA 2ZRAA 3D31A 2FU5C 3AVXA 1QG2A 2FZLA 3MWKA 3E1SA 5FPYA 1XTJA 3F5FA 3N2IA 1J99A 5SZKB 1Z2AA 2ZANA 3DEFA 3RHFA 5FL7A 5LB4A 3KJGA 2O8CB 4IOMA 4PX9A 5AR1A 4QRHA 1W44A 4V0ME 2FA9A 1DAMA 2P65A 2V7QA 2VF8A 3SHFA 4OHZA 1VG1A 5JSZB 4BLPA 1CULC 2LCFA 4QGGA 5C18A 1PV4A 4Q4AA 2QNRA 3TVTA 2GJSA 1E2MA 2DBYA 1VPLA 1NMXA 3K9NA 3L0OA 2ZE8A 1YZTA 3SI7A 3W6NA 4DXAA 5JZVA 4TQAA 4URUR 4F7WA 4A2PA 5FUYA 1LW7A 5EE0A 3FPAA 5H1YA 4JLPA 1AM4D 3KX2A 4PAOA 2HT6A 3I8SA 5CYOA 4JVLA 1XEXB 1ZM9A 2Y8EA 1AZTA 4MYTA 4NYMQ 3AP2A 1U81A 5KNBA 2NG1A 1G4UR 3LDAA 4PQFA 2JA1A 4LJ5A 3D8BA 3PV0A 5AJXA 1COWD 3PEVA 3PR1A 4Q7LA 1D8TA 1MO5A 4CYMA 4D4MA 2X2FA 5HKKD 1E9EA 2C9YA 1R10A 4CIDA 1MH1A 4PZYA 1B23P 1P5ZB 3FB4A 2W2VA 2VHUA 3OAAD 1X1RA 2YWFA 1KNQA 4R2IA 2QRZA 2ZEJA 4PC7A 2UZ3A 2WPDD 2OFOA 4X8LA 1IHUA 2IT1A 3ZGXA 1UKVY 4HLUA 4PC3A 5EXPA 4F4CA 2PMDA 1XX6A 2VTKA 1HA3A 2IF2A 2ZE7A 3E5HA 1GNRA 4L9SA 3I62A 2WVJA 3Q72A 3G5UA 4WXRA 3NKVA 2ZETA 1E2GA 3C8UA 1NJGA 3CRW1 1JI0A 5FPHA 2ZSBA 4HB0A 3VX4A 4CEHB 2JLXA 2QROA 4TSFD 2H1LA 5FTLA 2F9LA 2BMDA 5CJPA 2IEYA 2C04A 2R6CA 3IEUA 3Q7PA 3TUZC 1GP2A 4B47A 1MO6A 3AH8A 3UPUA 3KXIA 1EG7A 1VYUA 3FGNA 4EQ6B 3VR3A 1KZ7B 4HDCA 1WE2A 4DCTA 2EFEB 3BS4A 4ZPXA 4AKGA 2ZYTX 2GK7A 5JFGA 1FQJA 3QKSB 4HDQB 3R7WB 2JLWA 4AC9A 1P2VA 2VYFA 2RGEA 5TVKA 4BLOA 4TYWA 1R0XA 5JI3E 3SJZA 1E3MA 2KSQA 3RSLA 4R71A 1G3QA 4XTRA 2ONJA 2XSZA 3A8TA 3BH0A 2AR7A 4HAXA 1CR2A 4JL5A 2X1VA 3SYNA 2ONKA 4MKFA 3KXLA 1GZSA 2GXQA 3AVVA 2NTYC 2Q0HA 4EDHA 5L3QB 4AWXA 3KTAA 1W47A 2FN4A 1OFTA 2P3SA 2JDIA 3D6TB 2GEVA 4PZLA 5GJCA 1XMVA 3AKEA 3EARA 1G7SA 2VIIA 1Z6GA 3EZ9A 3UG7A 4PR0A 1UBGA 4RCYA 3OIUA 1K5DA 1PJRA 3KTAB 2FFHA 2OT3B 3BAFA 4O2RA 2V6IA 4HATA 2IYUA 1XB2A 4B43A 1IONA 1Z22A 1R0YA 4OQLA 3QXXA 1Z0DA 2BBSA 4HAVA 4TZ0A 2DFLA 3IO3A 1CR4A 2PX3A 3TQCA 4DLXA 2P5TB 3QKTA 4LI0A 4DVGA 4Z54A 1OV4A 1YKSA 1NBMD 3UWKA 1XRJA 4A82A 3AVUA 2CHQA 2OXCA 1LF5A 1Q57A 4UNRA 1VHTA 3REFA 1TQ6A 5BN5A 2IBMA 2W83A 3K9HA 3IDQA 1S3SA 2IXEA 3OF5A 4M1MA 3LWNA 3RC3A 1SVSA 4UXIA 4BLSA 4D4LA 3OEEA 2V4ZA 3LBIA 3PIRA 1DBSA 3FE2A 3QF7A 3VNVA 2YOHA 2GBLC 3OIYA 3BORA 2QM7A 3GCGA 1XU4A 5KSYA 2Z6VA 1OXXK 4GOKA 4P33A 3OEHD 4ABYA 2YC2C 1ESNA 1VMAA 3CZPA 4JIMA 5AJWA 5HCIA 4UQOA 1KY3A 2QBYB 1N5JA 1CJMA 4PHFA 4ZKDA 2IS1A 3GLHB 3BE4A 2ZRKA 1AS0A 1XWIA 3AF1A 1X3SA 1T3LA 2RMKA 2WM9B 5C1BA 4PXAA 4M1TA 5EZ6B 2VP2A 1XMIA 1SVOA 4OJQA 4D80A 3I5YA 2ZI3A 3OE7A 5EE3A 5CJ2A 2ZS9A 1GILA 3R20A 1LFDB 3R9IA 1OH7A 2X19A 1EWQA 3NEJA 4D81A 3EPKA 1YRBA 3CRRA 2OAQ1 1KI3A 3KDSE 2XB2A 4N3NA 5FBWB 3QPVA 3NDBB 3K09A 3HR7A 1OLOA 2NO0A 2G0NA 4QBHA 4X8HA 4XIGS 2I1QA 1U8AA 3RAPR 3ZVLA 4HUTA 5KDOA 5SZIA 3RRZA 3ICEA 3LV8A 4GDFA 3RS4A 3VAAA 1DE0A 3GP8A 1AN0A 1X8JA 3FYHA 3JVUA 4NL4H 3QPWA 2CCJA 2HXYA 2P2LA 4CEJB 2ZS8A 5HZKA 1HTWA 3IBYA 1ZVQA 5FL3A 4BEBA 1ELOA 2F55A 2AXNA 3I61A 3ND8A 2XNDA 3CH5A 1JECA 4S35A 1CJKC 1Z6XA 3C15C 4UNQA 4ZIRB 1SXJA 1AZSC 4L9WA 5KPDA 1E2DA 4MYHA 4JBWA 1P72A 2AK3A 3M4YA 2G77B 4B2PA 3VHXA 1ZD9A 4MRNA 2ZR9A 3RRNA 5FI0B 1UPTA 4NYJQ 4BFYA 4HB2A 2G1KA 1AA9A 3FDIA 1NMYA 1SXJB 5LDDC 5IDVA 2IHBA 5AJYA 2H16A 1WBDA 4MRRA 3SQXA 1N6NA 2ZUCA 3TQFA 2G9NA 1LF0A 3FKSD 3X1WA 4M9SA 1R0ZA 2GESA 5LB2A 4PSAA 4G5RA 2J1LA 1OJLA 3LD9A 3MMPA 1AS2A 5B2ZA 4TMTA 2XNSA 3HYTA 4HUQA 3GMTA 1H65A 1Z6AA 3CR7A 1UKEA 1KDPA 1ZYUA 4LJ8A 2IEZA 3G82C 2Z83A 3U7GA 3HU1A 1TPZA 4V02A 3QE0A 3EASA 1C1YA 4RFVA 1XCMA 2AD5A 3QXHA 1CR1A 3QJYA 2H5EA 3EPJA 2P67A 5KO2A 5H8WA 2BIFA 4TQ9A 1QDEA 3ICQB 3TK1A 1NLFA 1AS3A 4ACAA 3QBTA 1L4YA 3R7WA 5LPNA 4ZO4A 2GKSA 1NL3A 2NO6A 4HEJA 4Z8XA 5IF9A 3AVYA 1Z0JA 1KY2A 2MSCB 2TMKA 2YHSA 3P32A 4OQNA 2IYQA 2JLRA 2QMHA 3FKSA 4KBGA 3X1XA 2PEYA 2JLVA 3A6PC 3QUSA 2XXAB 3U7EB 2HYIC 2FWRA 2VHTA 5FTMA 5HE9A 1R5NA 3U6KA 1WQ1R 3FHCB 3W3AA 4PHTA 2QENA 1AK2A 2C5LA 2YINC 4R7ZA 1QVAA 3WMFA 2XTMA 2D4HA 1T6NA 3PQCA 2QMEA 3U6BA 3PUWA 4QGAA 3GFOA 3GLGE 5C2JB 3CF6R 3HJNA 4JBXA 2J0UA 1ZW6A 4Z1MD 1KKLA 2ZRIA 3P4XA 1KI1A 2GCOB 1DO0A 1JXMA 2Q21A 4JT2A 4RD3A 4KODA 4A0FA 1OFHA 3PEUA 3PVSA 2GF0A 1DOAA 1U0JA 1DELA 1E69A 1XD2A 4Q4JA 2C99A 2V1XA 3SC3A 3R8FA 4IKEA 4P4TA 2A30A 5DNYB 4RKFA 3RS0A 1PVOA 2CMKA 521PA 4AIIA 1CXZA 4XWAA 3U3KA 4BZPA 1RRCA 5TV2A 1KJWA 1FX0A 4JJZA 4LGMA 1Z47A 5EQTA 2IWHA 2GCPA 1FNMA 4RCZA 4D4KA 4DHEA 3OFND 4QJ5A 1EX6A 1W36B 4KFSA 1Y3AA 2OM2A 3WYGA 5CK5A 4BE7B 4IDQA 2FSFA 1FFHA 1EFTA 1ZD8A 3DMDA 1OT3A 5JWOA 2VBCA 2YC4C 3BRWD 2ZRHA 3K70C 4D26A 3I72A 4NKRA 2WWWA 3W5JA 3TKLA 1G5RA 4HYYA 2EWVA 1N5KA 1ZM3A 3FMFA 4NONA 1G8YA 2CE2X 4A6PA 1K5GA 2IYRA 4WXPA 1YZKA 1RRFA 2GZHA 4DBLC 3OEED 2ZJBA 1ZM7A 2VA8A 4WZAE 3T5DA 2GNOA 4A92A 1G291 1BMFA 3LVRE 3NH6A 4QHTA 4B75A 2KBFA 5FBLB 5JEDA 5KOYA 4B6FA 4HLUC 3CRVA 3M1IA 4BZQA 2WJYA 1IOZA 4ZCLA 1UEIA 3FKQA 4FINA 1MRNA 3B13B 4DDTA 3B1YA 1J7KA 2QBYA 4M0LA 1D9XA 3B85A 4OQMA 4BZXA 1BYIA 3HWSA 2BEKA 4QBGB 1FMJA 1H8EA 2ZE5A 5JMTA 2BMFA 4A15A 4BUJA 4CDGA 5DI9A 3OESA 5D3MB 4TL9A 1HV8A 3N5CA 4M9XA 1SXJE 4UNSA 1RRGA 3Q85A 4I1SA 4BFTA 3LQRA 2WV9A 1IJFA 2IYVA 5KNDA 3EZ2A 1T5IA 4JVNA 3U7HB 2Z4RA 1OFIA 4YDSA 1W1WA 2WJIA 4KFRA 1A1VA 3PG5A 3D3QA 2GJKA 2G0TA 2ZITA 4LBZA 1F6BA 1YJ5A 3CX7A 2W58A 1RVDA 5BN3A 3HP1A 1FOEB 1YE8A 2OCYC 2WMOB 3WNDA 1GIAA 4AYXA 3U44B 4TL8A 5CM8B 4X8MA 2XSZD 5FL7D 3DKPA 3L2OB 4PQRA 4DJTA 3OZXA 2MMGA 5CDFA 2O8EA 1YR6A 3C4JA 4GFDA 4N0DA 4OI4A 2A5JA 4UXHA 2NO9A 1SHZA 5AUOB 2HYDA 2ZI5A 3HDTA 2JATA 3AVTA 3DZ8A 4GI7A 1C4OA 4JT4A 2AWNA 1NY6A 2JLQA 2WWHA 4GOJA 2C8VA 3K0FA 5JECA 2J45A 1DO2A 1E0AA 1F2UB 5KUTA 4JLVA 3P4YA 4YONB 4LY6A 1OHHD 1LS1A 2X77A 4I1OA 3LY5A 4TSFA 5FPTA 4C0AC 4TN1A 2GDJA 1Z8FA 4H1VA 2IX3A 3CRQA 1E1RA 4EPVA 1KDTA 1TADA 3VR5A 2ZUDA 4EAQA 2FG5A 4JSYA 4NU0A 2FOLA 4CEHA 2HXSA 1VDZA 4LYAA 1KDOA 1EFUA 5DHAA 4BFUA 3UKDA 2ZRFA 4ZDKA 2IYXA 4US0R 5F2EA 3WMEA 1FMLA 1RYHA 1F3OA 3PEWA 1AKEA 1NLZA 1PLLA 1E94E 3IIKA 4IVQA 2WTUA 1F60A 1XPOA 1S1CA 4ERNA 2W6IA 1S0UA 1E9AA 4OK6A 5HCNA 1II8B 3VHLB 1ZP6A 1G3MA 2QTVB 1KKMA 1P3JA 1Z83A 3LLUA 3TAUA 3PXGA 5TMPA 1P2TA 2C9CA 2IUSA 4DEYA 3T1OA 4AKEA 2A5GA 3P27A 3CUEF 2QA5A 1G19A 3CRMA 1KSJA 4LRWA 2GCOA 1JQLB 1Z6TA 4FD2A 3A4NA 3QENA 2BWJA 4ZCIA 3EZFA 3KXKA 1MV5A 1SKYE 1KSHA 1W36C 4U00A 2C03A 3SOPA 3S1AA 5A5GA 2IS6A 1J8MF 2WICA 1GNQA 3KKQA 2N42A 3AF0A 1IXRC 2ZJ8A 3GLIA 2AXPA 1WF3A 1ZC3A 3LA6A 3I5XA 3CONA 4HZUA 1U8ZA 2XEXA 3UMRA 2IW3A 3K0AB 1N6LA 3FOZA 1JALA 1FUKA 2OE2A 3W9YA 3VKHA 3IUYA 3BC1A 3U7FB 3C41J 1S96A 5DLQC 3AF3A 3CB4A 2QAJA 4Q1CA 3SZRA 1OFUX 1KAOA 3GLHA 2WHXA 3DOFA 4MITA 1WCV1 4S2EA 4HI0E 4QFMA 5F3WB 2EFGA 4Q1FA 2NGRA 1XMJA 4G5OA 4LJAA 4A0GA 2O8CA 3H86A 3V00A 2CE7A 4GP6A 3ZJYA 1DAKA 4KVGA 3A4LA 4HUQB 4JKYA 1EK0A 3DDCA 4LZZA 4D25A 4HAZA 2ZSFA 3CKLA 3K8YA 1CTQA 2KB0A 2D06A 5EUMA 2LKDA 4KBFA 5IHPA 4B73A 5EE9A 2H92A 1TU3A 5E7JA 2R6AA 4BLTA 2D62A 1CEEA 1XEWX 5FBVB 2IS2A 2VLIA 1OPXA 3I1FA 3LX5A 3O8DA 4PTLA 5JWRA 4IDHA 1E9FA 1TTTA 3ONWA 1YQTA 3VR4A 4G3XA 5D3MA 3SDZA 2EWWA 3BFXA 3THOA 1W0KD 1U98A 3SFZA 1ZD1A 4JJKA 1E2FA 1G5PA 2VSFA 3BD9A 1BOFA 3PFIA 4GL2A 4M53A 2C96A 3DHWC 3V4RA 2IYWA 2B7BA 4GMDA 4ZIRA 3IEVA 2ZI7A 3EC2A 2EFDB 1E0SA 1P9NA 4ON9A 4M1OA 4KLNA 5G3YA 4R98A 2RCNA 4PAQA 4IJMA 4TQUS 4WOPA 1U94A 2DHRA 221PA 1KOFA 2B92A 1YR9A 2QAGA 1NP6A 1DAEA 4P31A 4ZDJA 2EQBA 1OH5A 1E9SA 4JMPA 3KUCA 1NVVR 1A7JA 1M7BA 3QSYA 1OIWA 3U3MA 4XWKA 2A3RA 4JS0A 1UAAA 4DLZA 3IBGA 1D2MA 1YZGA 1OKKA 1F2TA 2F1HA 3RABA 4ZV4A 3EIQA 1CJTC 4OKSA 2QI9C 4CEIA 2G88A 1AQUA 5P21A 1YR8A 2WWGA 1ZC4A 1NN5A 1BS1A 3IPXA 4JYBA 4LCBA 3UIEA 1G4AE 1OYWA 4BFZA 1SVLA 1FZQA 3SFVA 2O8BB 3W5IA 1ETUA 1E99A 3W6OA 2HLDA 2F3TA 1Q44A 1RYFA 4NZYA 1Z08A 4XJXA 2OESA 3RS3A 5CLLA 4LHXA 2VP5A 1LY1A 2CHVA 2YVUA 3AP3A 3ZS8A 2N1BA 1UFQA 1DADA 4TMKA 4DDWA 3T34A 2RHMA 2KWIA 121PA 4B33A 2JLZA 2QY9A 3T12A 4A1FA 1F5NA 2REBA 3AUXA 4JLNA 3TLXA 4AG5A 4EFNA 2GAAA 1KO1A 4P4SA 5LD2B 3K0EA 3SEAA 4C0SA 2WKPA 3TJZA 3EIHA 4B32A 1I2DA 1I2MA 2AN9A 1UBEA 2NPIA 3CBQA 4M22A 3NHBA 2QT1A 4IDPA 2WOJA 1IN7A 2F9MA 3IILA 4DLRA 2BC9A 3T5GA 1US8B 2UVQA 1OKKD 2ASEA 4JBYA 4BASA 5IK2D 4WZ6A 3LX8A 3LBHA 2O52A 1E1QA 3LW8A 2ODWA 5EP1A 1KO8A 1GKIA 1N0VC 2IL1A 3GEIA 3I8XA 5EZ5A 3O8RA 2QGZA 2PLFA 1LV7A 1NLYA 3SYKA 3ZVRA 2IYTA 4HAUA 3KJHA 4FCWA 1DAIA 4MUBA 1T91A 5DHFA 5AUPB 3PUVA 1GFIA 2G6BA 3WHLA 4DCVA 5AJVB 5JCZA 4C3ZA 1WP9A 1N6IA 1ZNXA 5L3SA 1G8GA 2PT7A 3GFTA 5JRZA 4UKDA 4HLCA 5E7IA 3T15A 3VTKA 4IOJA 5CB6A 4V0OA 1OYYA 4Q18A 3TMKA 1E9CA 2W00A 3O47A 2D2EA 1N5LA 4PO9A 1T4GA 3WNCA 3B7GA 2WJGA 1E98A 3MWJA 4TWZA 1N25A 3GJ7A 3KQUA 5C46F 1UF9A 3EZ7A 4BLQA 4A0RA 1OE0A 1A2BA 2BBWA 4NHOA 3QG1A 1EGAA 3UMFA 4LYHA 1XDBA 4WAUA 2FDCA 3R8CA 3WBKA 5K8UA 4Q19A 2CCKA 4Q5IA 2PMKA 4IVRA 3EPLA 3VU9B 4L15A 1Q1ZA 1NN0A 4BECA 2OUKA 1NVXQ 2FH5B 4QNRA 1T0JB 1P6XA 4QBFA 5LBIA 1G8HA 4TMXA 3DM5A 1OIVA 1DAFA 2F6RA 3A1SA 3DOEA 5FR1A 2BMEA 4PPGA 1DVRA 1G7TA 2ZRGA 4JYCA 2R65A 2O8DB 1KGDA 2EW1A 4Q4LA 3K53A 3KKOA 3MWLA 4HB3A 5FTKA 5KSPA 1GDDA 1UEJA 4URZR 2GF9A 2RGBA 2W6JD 4H1UA 4CGZA 1NSFA 1RJ9A 2CL6X 1KI2A 2ZRDA 4ASUD 3FVQA 1T3HA 1D2NA 2XTZA 3IPYA 1PZNA 4AY2A 3K0SA 3VNUA 4EKDA 3U4QA 1X1SA 2DWQA 5JHGB 1BH2A 4E22A 2FPLA 2H57A 3N2EA 3GJ8A 1VCOA 1P2UA 3LQQA 2NZ8A 5AK0A 3CM0A 4Q1EA 4KITB 2IXFA 3MJHA 3K09C 3M6AA 3X2SA 1RKBA 2YYZA 1ANKA 4B76A 1ODFA 1LTQA 2GHIA 4FXPA 5A4JA 2Q9CA 2IYYA 3TBKA 4WW0A 1KI6B 2QSZA 1NVUQ 2WJJA 4MYCA 1KDRA 1LVGA 3BBPA 3U3RA 4LJ4A 1Z28A 1BMFD 2ZQ5A 3A1VA 3GEHA 5K8TA 2IYLD 1GNPA 4A36A 4R9UC 4HLQB 1W4AA 1GVNB 1HT2E 1W4RA 4Q9JA 1G20E 4LV5B 3RNLA 1RC8A 4O2LA 1P75A 1MABB 3CF0A 2ZJAA 4OBEA 4Y0AA 5GADl 2JEOA 3IKJA 4CT5A 2HJVA 1XEWY 2QG6A 1E9RA 1CJVC 2R8RA 3CF2A 3TNFA 2RKOA 5AUNB 3FHOA 2VHQA 3IHLA 4ZI2A 2V6JA 1G41A 2A7QA 3RANA 5G3ZA 3ZZUA 4OYHA 4A8JA 1T9HA 3CPEA 4C7OA 1GKYA 2IA5A 2ERXA 3JZAA 3BH6A 3EA0A 1H8HD 4C0KA 4TL7A 2W6ID 3U2QA 2OO7A 2F1RA 2QM8A 3GQBA 1KI9A 4US1R 3CO5A 2J59A 4PQYA 3ADBA 4C2UA 1R8SA 3KQKA 1II8A 3THWB 1CJUC 5SZHB 2AKYA 2KI5A 5IT5A 1V5WA 1GTVA 2BDTA 3NEYA 3OE7D 3MD0A 2HCJB 4IFEA 4V0NA 2IHYA 4Q9HA 1W0JA 5F9FA 2JJ1A 3ADDA 2PT5A 3FMPB 2A5YB 1W46A 1VYVA 5JS8A 2ZVPX 2Q3HA 4KU4A 4US2R 3C5CA 1GUAA 1SGWA 1E2LA 1IN5A 4XD7A 1SZPA 1VYTA 2VL7A 4MYUA 2OLKA 5JRJA 4MGIR 2O0HA 4A0HA 1YZNA 1XTRA 1E1RD 1ZUNB 2ERYA 1OXTA 3GLGB 1FTSA 4JLDA 1Q1BA 2CK3D 4AG6A 5DYGA 2O8BA 4FMCF 2ZI4A 3B1ZA 1VIYA 2FEOA 4ITRC 1G3IA 3JVVA 5EXTA 3ZIAA 2QPOA 5K8IA 5JJKA 3MJRA 4GT1A 4Q7JB 4MRSA 4WZBE 5B64A 3RRMA 3B9PA 2J0SA 2Z43A 1KMHB 2ANCA 2H8KA 4HZIA 2JLSA 4DRZA 3BJIC 4XH9B 3GJXC 4NCJA 1O87A 3W8RA 2KE5A 3DMNA 1P61B 4F38A 4L8GA 3GJ4A 2GVDC 1X6VA 2QE7D 5BYKA 3I3SR 1H8ED 2GXAA 1BKDR 1A5TA 1G7RA 5IK2A 1N5IA 3RWMB 5KSOA 2KBEA 4WVFA 4CEIB 2XJ4A 2J0VA 4DB2A 3L0SA 4PAMA 2JJ2D 2CNWD 4PPFA 5L3SB 1D2EA 1GG2A 3BH7A 1QVRA 5DH9A 1IY2A 2WAYA 5B57C 2ZU0C 2PH1A 4RZUA 2F3RA 3OIVA 1HQCA 4KLZA 1XZPA 3F3YA 1XFAA 5FOXA 2F7SA 2R6GA 1IXZA 4TLDA 1S9DA 2MSDB 4YC7A 4D0NA 5FH9A 1ESMA 2CLSA 3VKGA 1NIJA 3J81k 1CR0A 2J41A 2ZSDA 1ZM2A 1KSFX 2K5UA 1TL7C 4GMXA 2AK2A 5JCPA 1CKEA 4DSNA 3PENA 3SS8A 2OZEA 4KFTA 1XD2B 2OCAA 2XNDD 1HT1E 2QAGC 2NO7A 2QP3A 2O5VA 4QHYA 2J3EA 3U3OA 2VSOA 1UDXA 2FGJA 4DSTA 2FEMA 4U7DA 4ESVA 2OBMA 2CCGA 3BOSA 3RVBA 1NJFA 2XZPA 5EJEA 3K9LA 3OAAA 1S9HA 1JJ7A 2NZJA 4BEJA 2J0QA 2R62A 3R9WA 1OSNA 1S1MA 4TYYA 5JWHA 3TR5A 2BM0A 4TT3A 3BK7A 2GZAA 4M21A 1DAGA 2HLDD 5A0FA 2QP4A 4C4PA 3NWJA 5F9HA 1P60A 3T1TA 4C2TA 3A36A 3P20A 1MABA 1XCPA 4MQBA 2QAGB 5FFMA 3B78A 4FCVA 4NYJR 3U4QB 2YKGA 1QHSA 3AB3A 3CNOA 4J0QA 2ZRNA 3LLMA 4EPRA 3ADKA 1CS4C 1RZ3A 1DTSA 4TYPA 3QKRB 3RS2A 4DSOA 2KJQA 1SVKA 1KTVA 3VR6A 4OI2A 1ZNWA 2QE7A 3KUDA 2FFAA 2VP4A 4MDFA 1ZRHA 2AHOA 3H1TA 4I99A 5FOSA 2HEIA 1JNYA 2ZSEA 4WA7A 4Q4JB 1Z0IA 3SBDA 3BFVA 5FOWA 1GAJA 2BEJA 4UNPA 2ZJYA 1IN6A 4UNNA 1TF7A 4MKGA 5KPJA 2CHGA 3THXB 3W3ZB 2C98A 2GXUA 4G5QA 4MKIA 1Z5ZA 3SBEA 3LAWA 3HR8A 4LUCA 1U9IA 3ZYCA 2GETA 2QL6A 1J70A 4GSYA 1E2EA 2BKEA 4RKEA 5CK4A 1VTKA 3SHWA 1HUQA 2WAXA 1BO6A 3MUFA 3NTUA 3REGA 1OHHA 3GLFA 5EP4A 3VR1A 1VG9B 4G5GA 4CVNA 2E1RA 4DUGA 1ZUIA 2W2XA 5TB5A 5BW8A 1E2IA 1UDWA 1L8QA 5FTNA 2B7CA 1EFRD 2J7PA 2D7DA 1XEXA 1NBMA 1YR7A 2VP0A 1VKJA 4OK5A 1UM8A 2OCPA 1NG9A 4RD6A 3VKWA 4PFSA 2NMVA 4II7A 3A1WA 4QGHA 5AWFC 3BB1A 3MGCA 4URWR 1ZMXA 1OXSC 4IDNA 4EJSB 1HE8B 3BB3A 2XOKD 3GJ0A 2GILA 3K1JA 1BYUA 2J5XA 4GNKA 1ZIOA 4TTRA 4JLKA 3ZQ6A 2DWOA 3ETLA 3K0CA 3B1WA 5HTKA 1Q22A 4NCHA 3X1YA 1GM5A 1JAIA 1XTKA 2RB4A 2BCGY 2FJUA 3FHTA 3FMIA 2V55B 4URYR 2FF7A 4O3MA 1KO5A 4C0BA 2CL0X 2V8OA 4WBSA 2BJWA 4W5HA 1TUIA 1M7HA 2GTPA 1P9RA 3CW2A 1ZM4A 3TW4A 1EFRA 4AD8A 3A1UA 3KJEA 4HDOB 2G3YA 4C0HA 2FSHA 3CWQA 3CX8A 2XAUA 4V0MA 1M7GA 4LC1A 5DI3A 5FUXA 4EJSC 1XPUA 5GJBA 2PZGA 3GJ3A 1WB9A 4NBSA 4DIDA 1UADA 4CT4B 1CIPA 2OFWA 1MKYA 1WDTA 3AP1A 2R2AA 5HE8A 3S1AB 4QKQA 3RDPA 3GD7A 2YOFA 2PBRA 4ARZA 3ZZ0A 1G16A 3NBXX 3DPUA 3U44A 2CJWA 5M04A 2ZREA 4B2IA 4KHZA 4A8JC 5FUVA 3G0HA 3DL0A 3EXAA 5B58C 1E96A 1U0HC 4BGDA 2P5SA 1YHNA 3M0EA 4E5UA 3QBVA 2ZM5A 4Q7MB 4ARZB 1CBUA 3WP1B 4A8JB 2JLUA 1G6OA 3LNCA 2GJAA 2QTFA 2HCBA 1R4AA 2QEQA 1E0KA 1ZCBA 2OFXA 3KKMA 1OH8A 1ZNYA 2VO1A 2N46A 4K81B 3C5HA 2AFIE 4UXJA 1QHHB 3A58B 1IXSB 3MCAA 4MGZR 4QM6A 1TQDA 4MRPA 1TF5A 2OCBA 3THYA 4G5SA 3K70D 4NMMA 4QNMA 2FMXA 4ZDIA 5F98A 3CNNA 1HEIA 1QHYA 2BBTA 3QNUA 2OSBA 3QQ5A 1FW6A 4DCSA 4Q1AA 4MH0R 1CU1A 2P6RA 4IW3B 3QY0A 1E2NA 1QG4A 1KI4A 1JR3D 3Q9LA 3L0IB 2JJ2A 3UANA 1P4SA 2ZRJA 3EX7C 1N6KA 1XJQA 4BRUA 5UKDA 2ZRBA 1J90A 3VFDA 3DVLA 4KSCA 1NN3A 5J4LA 4JLOA 2JASA 3IO5A 2BHRA 4Q48A 5EUQB 1ZAKA 3GFPA 2NIPA 1NKSA 1NNEA 2IS4A 4I1UA 1LB1B 4MGKR 5KHOC 1SULA 3LH5A 5SZJA 1XJ0A 3RLFA 2BV3A 2LKCA 3U61B 1Z63A 4D0LB 4C0LA 3ZD6A 3HPRA 3A37A 1IN4A 3SE0A 4LX0A 4UJ5A 5C4MA 2W0MA 4HB4A 4CZ2A 1NRJB 4PPQA 4LJ9A 1II0A 3L82B 1XEFA 2OG2A 1XTIA 4RD2A 1QHNA 1M74A 4DLTA 2ZSAA 2WBLC 4M2LA 4PZZA 3GLFB 2EFCB 1TEXA 4YLGA 4K8OA 4HAYA 1Y63A 2A5FA 3MFYA 3SR0A 2QQ0A 3X1DA 2VQSA 4DLUA 1DG3A 2BBOA 4BFSA 3ASYA 1QHGA 4GZLA 2WIAA 3A1TA 1A82A 1RRPA 1UBFA 3QXSA 4OQXA 2REOA 1N6OA 3GPLA 3U60B 2YZ2A 4B3DA 3QKRA 2C78A 2NQ2C 1FTNA 4LV8B 1Q3TA 3KKPA 3FFBA 3EPHA 3ZZTA 3IIMA 1XZQA 4L5BA 2O8EB 2YWHA 5G53C 4CRWB 2ZRPA 4QBIA 2QMUA 1RE0A 4Q21A 4DCUA 1KK0A 1G17A 2YWEA 4PHGA 1B0UA 1FQKA 2WKQA 1E2PA 3MWYW 1W0JD 3AVPA 1GRRA 3AGPA 1S3GA 3NIBA 2AKAB 2DB3A 4HAWA 4EQ6A 2ZU6A 2PJRA 3AKCA 4RD4A 3OIWA 4M1SA 3CH4B 4RVCA 3WRXC 2RGAA 3Q7QA 1CRQA 1G3UA 2CL7X 4TLCA 2HV8A 4Z8YA 1E32A 4XVRA 5EXSA 1JR3E 5CB8A 2ZRMA 1QRAA 1JAHA 4AI6A 4NH0A 3WXMA 5JLJA 4B3BA 3AVWA 3B8HA 2CDNA 3I73A 5JHHB 1Z0AA 2OV2A 2QPTA 4KSBA 4QG7A 4G1UC 2BM1A 1G9XA 3SJAA 3VR2A 3GLFE 5FOVA 1SXJD 1AGPA 3IHWA 3THWA 4Z51A 2W0SA 2ORIA 2JJ1D 3TGPA 4JL8A 1EFHA 3N70A 3FFAA 3PCRB 1KI8A 1Q1QA 3B82A 2V3CC 1COWA 4IXNA 4Q4HA 4Q7KA 3GJ6A 4TYQA 4MKHA 2IF0A 4P3YA 1W4BA 1KAGA 3ND9A 4DKXA 1G5TA 4C7OB 2WOOA 1F2TB 3ZLJA 1FP6A 3EZ6A 5EE5B 1GRQA 3BFKA 2ZS7A 1P2SA 4URVR 3GLIE 4L4UA 4KXFB 3AV0B 3FWYA 4POAA 4Z1MA 1E1QD 1XJCA 3K9GA 4GP7A 1ZUHA 4BLRA 3P1JA 1N0WA 5JSZA 4M8NE 1CLUA 1M2OB 2QTHA 5TY0A 1S4QA 3NHAA 1US8A 1GL6A 2L0XA 1VG8A 1KMHA 4NYIR 5BYJA 1GL7A 2RHDA 3TH5A 4AKHA 2PZEA 2FV8A 4NE2A 3B6EA 2IYSA 5FR2A 2AWOA 2X8AA 3AUYA 4OHVA 5FUWA 3PUXA 2FE4A 2J46A 4EUNA 5HZHA 4AKIA 1SVWA 1HQYE 5KSZA 2B21A 2ATXA 4V0LA 2ZJOA 4DDVA 3IQXA 4TTQA 2REXB 2A9KA 4B34A 1AGRA 1T5LA 1U90A 2ZJ5A 4ZDWA 1XXHE 1E9BA 4GPTA 3CNLA 4W9MC 4KYUA 4TZ6A 4B48A 2YV5A 4AYWA 4Q01A 4XSHA 1OW3B 1IQPA 2G83A 4QXAA 1I4LD 3K0CC 4ILEA 1RJ9B 3QIAA 5E95A 4RFSA 4C0QC 3MG9A 5BWMA 4FMBB 2UKDA 1UKZA 5CYPA 4B3XA 1XD8A 1YZLA 4FW9A 2GAOA 1LS6A 2CJWB 2WIBA 3AKYA 4Q47A 4Q4AB 4JL6A 4C0JA 2FPMA 1N6HA 2ODBA 1WXQA 5DYIA 4L16A 3O8CA 2WWFA 3Q3JB 4FN5A 4ACBA 4XWOA 4NTZA 3EG5A 4KO8A 5AJZA 3T61A 3ECCA 1D5CA 1U9IC 3TSWA 2GBLA 1WMSA 2RGGA 4OI0A 2OBLA 2QORA 1KMQA 1XXHB 4FWIB 4LYJA 4YMWA 5EP3A 2DY1A 1GRNA 3AF4A 3AVQA 4Q02A 1TQ2A 5AUQA 4M1WA 2Q9BA 2B6HA 3X1ZA 2XOKA 1JQJC 4FCTA 1XPRA 1OH6A 3EWSA 3QVUA 3I92A 1CP2A 2BMJA 1TQ4A 4Q9IA 3CPHA 1Z6YA 1ZBDA 4FIDA 4P0TA 4FI3C 3WRYC 1WBBA 2JJ8A 4F93B 3CZQA 1W2HA 4WIAA 2DFNA 1MO3A 4E07A 5ANRB 2MMCA 3TAHA 3LO5A 1A2KC 2QT0A 5J4HA 1SKYB 1Q20A 4CEJA 2NOAA 1JEEA 4NYMR 4YMSA 1S8FA 3TSZA 1JJVA 1T0HB 3NVAA 4ZI3A 4Q9LA 4IEIA 1ZINA 3H2YA 1G18A 2BKUA 1L2TA 3UWOA 1MR3F 1P73A 4KJZA 1X8KA 2ZYUX 4JZKA 4DUGD 4NCNA 1IBRA 2DYKA 4EPWA 1GITA 3ZH9B 3QG5A 1IY0A 4LPSA 2ZR7A 1TF2A 4B3FX 2ZAMA 5DI3B 3OEHA 4B35A 1F48A 1VCIA 4MA4A 1R0WA 3QVVA 1I4TD 1OXVA 2IYZA 3B9QA 2QMOA 4G01B 4JVMA 4RZ3A 3O8BA 1L4UA 1J2JA 4IOKA 1HH4A 3EA5A 2GJ9A 3TW8B 1GL9B 1ZU5A 2QU8A 2VF7A 4PO8A 4LHZA 5KU1A 3CLVA 3QKUA 4E03A 1SVMA 2QSYA 2VEDA 1KJZA 5B30A 4DSUA 4BPBA 4O25A 4JKIA 2JAQA 4Q4HB 3TUJC 4RJLA 3WYFA 1AJEA 3MLEA 4NDZA 4H9GA 3B5JA 1JEDA 2GWHA 1KNXA 2R9VA 2CEAA 1IN8A 2DPXA 3BGWA 2FX3A 3H0KA 2ZVQX 4JLMA 4OQFA 3GJ5A 5IRCD 2UZIR 3VMFA 4DCNA 3R9XA 4LJYA 4PHHA 1KK3A 4I1VA 1AKYA 1J8YF 2ZI9A 5CIQA 1NBME 2FFQA 4TLEA 1XTQA 4V03A 1E79A 5DISB 1X8LA 4YMVA 1Q3HA 4BQSA 1WRBA 1RW4A 2GRJA 1KIMA 1IJEA 4EPYA 1W36D 4TMZA 2FGKA 3DM9B 5L3VA 4PO1A 1R8QA 3K0FB 1FP7A 1HY3A 2D74A 1NVWQ 2H18A 4IDOA 4FWTA 4LJ6A 1JR6A 4OK3A 3DKVA 1KO7A 4KI0A 4M9ZA 5HR5A 1P62B 1E2HA 1HURA 2P0EA 2ZROA 4GRAA 1DS6A 1EFCA 4Q66C 3RC8A 1UJ2A 1TUEA 3CWZA 3VQTA 1DPFA 1XXHA 2YWGA 4JSTA 4D2IA 2PCLA 4CF7A 2V7QD 3EAQA 1OXUA 2ODEA 3QI2A 3LFUA 1NSTA 3H84A 3NG1A 5KDLA 3OHMA 1IM2A 3MRSA 3NC1C 3VX3A 5ELXA 4C30A 3AM1A 2QPAA 1E9DA 4GBMA 3UK6A 2OILA 1NY5A 4XD7D 1XTSA 1YZUA 2Z5FA 4DLWA 4MDEA 2PL3A 4JVSB 1E0JA 2CLDX 2I4IA 2RH5A 3CPJB 4LV6A 1U99A 3T1QA 5J4VA 1VCMA 4FMDB 4PPNA 2FFBA 3ZVMA 1SHKA 2HDNB 2RGNC 1RPZA 4RFSB 1YVDA 3RS5A 3GLGA 2DR3A 2P6UA 2HUPA 1ZCAA 3W8NA 4RD1A 4KFUA 3IIJA 4C9BA 2XJ9A 1MT0A 1R5BA 1NG1A 1TMKA 5J4YA 1KZGB 1WA5A 4DLYA 4URXR 3SN6A 2ZJZA 3UXMA 1AQYA 2J87A 3UMSA 2CK3A 2ORVA 3IGFA 5FBRB 2C77A 3E2IA 1M1YE 3RRYA 2VSXA 4DB4A 3AF2A 2MSEB 4M1KA 4A2WA 1ZIPA 4QL3A 2J9RA 1ZJ6A 4D82A 4YQFA 4EIWA 3ZD7A 5G41A 4EFMA 1Z3IX 1T8UA 2V1UA 2IUTA 3TIFA 4LSGA 4Q03A 2WPDA 3Q5EA 3C16C 5J47A 2XX3A 4LC0A 4BWYA 5CDFE 4B44A 4TMVA 2GEUA 4Q1BA 2PCJA 4MRVA 3V9PA 4GOXA 5BXQC 1E4VA 2WWIA 3GLHE 1IY1A 3LXRA 3QF4A 3TRFA 2YJTD 1PUIA 4RSGA 8OHMA 2FNAA 4U5XA 3WNBA 1N0UA 3CX6A 3RWOA 3A4MA 3THYB 4YMTA 3I4LA 5JBQA 1ONBA 4PC1A 1I4DD 2ORWA 2Q3MA 3WMGA 621PA 3OFNA 3KL4A 4E09A 1K6MA 4BFXA 1XP8A 4RY2A 2IC5A 1G64A 1R2QA 1RIFA 2P6NA 1P7CA 2ZJ2A 4KYIB 4QM7A 4JLBA 4F4IA 4P4UA 3ASZA 1HYQA 3WY9A 3ZQJA 1G8FA 1Z29A 2YOGA 3AEZA 4QC2A 2O0JA 4IOLA 5TXGA 3QXCA 3U5ZB 1Z06A 2ZRLA 2QGNA 1Z2CA 2IWRA 3KFXA 4K46A 1P9WA 1QHIA 5DGXA 1H8HA 3FMOB 3K0AA 1KI6A 1Z07A 4IFBA 3BERA 2NPFA 3WYAA 1DEKA 4FMDF 3PUZA 4M1YA 1OB5A 2OAP1 3TE6A 4CW7A 4LWZA 3NBFA 1VHLA 2OXRA 4DLVA 2EVWX 4ESHA 2G1JA 1ZNZA 4Y0VA 5HKKA 2WZQA 4RZXA 4JLAA 2ECKA 2QP9X 4QJ4A 3ZS9A 2OLJA 5J40A 3Q5DA 5J4KA 5CITA 4YDHB 4U02A 4NYIQ 1JPJA 4PSVA 2RGDA 4TLBA 2AFHE 1E2JA 1L7VC 2CVHA 1XBTA 4NCKA 5KDDA 2FSGA 1FL9A 2BOVA 3ZDQA 3C14C 3LBNA 2F43A 1T3SA 1YU9A 5FPKA 2XXAA 2XZLA 2WSMA 1XCGB 1MO4A 2NO1A 2ZXUA 4B6EA 4EJSA 3AGQA 4TTPA 3F0TA 5FTJA 3W34A 5FI1B 2OHFA 4UJ3A 3PEYA 1U2RA 3KQNA 2PX0A 4TMWA 5H68A 3FTQA 4BFVA 2CNWA 1JXOA 6Q21A 1CRPA 1OIXA 3RYTC 3C7KA 4FMCB 5EP2A 2PLRA 1Z0FA 4IHQA 2EYUA 2X2EA 1S2MA 3EW9A 5FOTA 4LK2A 1UBCA 1EX7A 2WSSA 1SXJC 2ZE6A 5KTYA 2VPPA 2ZYWX 4LJ7A 1AIPA 3MSXA 1R5OA 3CR8A 3ADCA 1QZXA 2CLCX 2WJHA 2EU8A 1YRAA 1G6HA 1W5SA 2WWXA 3QXJA 2XB4A 4N1AA 4PC2A 2CVFA 2SHKA 4F92B 4OHXA 3T1VA 4YXWA 2QQEA 3TVDA 2C2HA 4HSEA 2V9PA 1JPNA 4OHWA 3DZDA 3KKNA 4N0EA 2AL7A 3HU2A 2IXGA 2DWPA 4LHVA 3EIEA 4RZ2A 2GK6A 3BXZA 4QOSA 1MOZA 3KFVA 2Q3FA 1X86B 1Q0UA 2B8TA 4HZUB 4A6XA 3HPQA 5GVSA 3GEEA 2GEDA 2R44A 1NVVQ 5KYKA 4M9QA 4PANA 3JZMA 3RSOA 2ZPTX 3GLIB 2IK8A 4B3GA 1M6NA 4I4LA 2IUUA 1QF9A 3NH9A 1TAGA 4G0NA 1NN1A 4LHYA 1W4CA 5L3QA 1VECA 1VIAA 5L8VA 5CLQA 1DARA 3LXXA 4XSGA 4A9AA 2A2ZA 4DLSA 4P4SB 3KQLA 4AK9A 2ZUBA 1M34E 2B8WA 3F8TA 3MAAC 2WKRA 4KCGA 2O8FA 1GSIA 3QPUA 1UKYA 3KZ1E 5LD2C 1OB2A 2XITA 5E3HA 1TNDA 1FX0B 4PSKA 3PITA 2Z4SA 1VCNA 1CF4A 1SKQA 2RAPA 3QF4B 3UG6A 2EYQA 2JLYA 2ZAOA 2VHCA 1VG0B 4LBVA 4LOAA 4LYFA 3K70B 1GKUB 5HPYB 4TYNA 3LW7A 1NI3A 4Q9KA 5JJLA 2ODNA 1KK2A 1XNJA 1N3BA 1G8PA 1QHHA 1M8PA 1Q12A 1MRSA 4KVAA 5TDHA 3IQWA 2J0UB 4KAXA 1W49A 4EPTA 2E87A 2BJVA 3U3JA 2V54A 3B60A 2FZ4A 2JGNA 3SU8A 3D7MA 5J5CA 4W5WA 2AX4A 2Q9AA 1EESA 2RGCA 1G7CA 3AKDA 1W2GA 2C95A 2H7VA 1D6JA 5EE1A 3QEOA 4V0KA 5DN6A 4F4JA 2DCUA 2BCJQ 5DO9A 1K8RA 2A5DA 4LDJA 5G40A 2OEPA 1FUUA 2WWYA 2RGXA 3WBJA 2F1IA 5CIWA 3QOFA 2JDID 3NDPA 2Z0MA 1NKTA 1RFLA 2DFKB 5DSZA 4A4DA 3EC1A 1O3YA 3E70C 4MUAA 4OL0A 3V4FA 1LNZA 2CBZA 2FSIA 4TL6A 2GCNA 1KYIA 2O8FB 4IRUB 3THXA 2QUZA 3AQ4A 3BIFA 1W7AA 4AURA 5GJWC 2EFHB 1NMZA 1TX4B 1TU4A 3P26A 1Q21A 1SVIA 5JI2E 4M4SA 3W6PA 3W90A 3DO6A 5GJVC 1SQ5A 4YMUA 5JEEA 3SJBA 2HF8A 2W6JA 2JCSA 2WSSD 4D0GA 2VH5R 2D3WA 3WP0A 1II9A 1V43A 1DG1G 2GJ8A 3T35A 2PZFA 2I1VB 1U0LA 4DWJA 5JS7A 3QEJA 4W7SA 1D9ZA 4ZKEA 2H17A 4XVUA 1ZU4A 2F43B 1W48A 1U8YA 4XOIA 3NBZC 4EFLA 2DFTA 2ZR0A 4HLDA 2QRNA 4LHWA 4DDUA 1EWRA 5L3RA 5H70A 2ZTSA 2F1JA 3L0PA 2FPKA 5CM9C 4AYTA 2O0KA 2VRWA 4O0MA 3PUYA 2J7KA 4QJ3A 1N6RA 5DN6D 1G21E 1E79D 3SYLA 1QHXA 3ZIAD 2RGNA 1T8TA 4B2LA 4NCIA 2WJVA 4OI1A 3RS7A 4ZCMA 1N6PA 1XF9A 4B3CA 4LPKA 5E4FA 2R6FA 5FPSA 2CXXA 5C4GB 1KO4A 4NPHA 1JBKA 1R7RA 3EWAA 4DZZA 3L43A 5EXXA 1KI7A 5K8LA 1G3RA 3HYRA 4W5JA 3B2EA 4LBYA 4MGYR 3KB2A 2JIZD 4OJKA 2D7CA 5JJIA 3AVOA 3BWDD 2VP9A 3KQHA 1QBKC 1KJYA 3I32A 2HF9A 3TR0A 1KSGA 3PJRA 2YNMA 3UATA 4TT3D 1JR3A 4DT1B 3QKSA 1XMSA 3KJIA 4LBWA 4EPXA 5GVRA 4TLAA 1E2KA 3NXSA 2E9SA 2I3BA 1Z0KA 2QN6A 3Q8XB 4NP6A 4XTCS 4BRWA 4I81A 421PA 1HE1C 4PC6A 5DIFA 4DT1A 1F2UA 2W2TA 1DAHA 2GXSA 4Q00A 1OF1A 1TEVA 4BFWA 2ZRCA 2AD1A 2XGJA 4JLJA 4RD0A 2XZOA 821PA 1E6CA 3B1VA 3TUIC 4F91B 4OHYA 1EXMA 4ASUA 4YXWD 2R6DA 5DE3A
chains in the Genus database with same CATH superfamily
3RTDA 4B6PA 3QE3A 1THGA 1G5HA 3B1XA 5NULA 5BR1A 3M49A 5HNKA 5I7OA 3L8YA 1I80A 2IEGA 5C32A 3UK2A 1BE8A 2LWIA 2G9RA 1E4YA 4CWAA 721PA 3DNFA 4FGKA 1JFTA 2RH9B 4PGGA 2NVUA 5AJUA 5FBQB 3U0BA 4NBWA 5KTNA 1XD9A 1UOEA 1ESCA 4D6PA 2Q6TA 1BCSA 4KGDA 1PDVA 5EYPA 3VC1A 4KV9A 3ZWOA 1VBKA 3H04A 3SK0A 3K9WA 2Q6IA 2VP6A 3IOCA 3OLQA 5FPQA 3NHJA 3PYMA 2RHLA 3IKMB 4P32A 3KV3O 4F3YA 1ZCZA 4INJA 2D2FA 3SNHA 1CRWG 1GZ5A 1RLUA 1W0KA 2VHJA 3UKOA 1N2CE 3KYIB 3KWJA 4KNWA 2BUAA 2Q8QA 3WJ7A 2D5BA 1ZXXA 2BVNA 4HDKA 3LVQE 4QOEA 2AN4A 1BIFA 1RVV1 3AOGA 1PFGA 4Q1DA 1HFEL 2O4UX 5DW3A 1HDZA 2PEZA 3NC0C 4XASA 3CIOA 2FWJA 2X6TA 3L04A 4PFQA 1P74A 3HUTA 4KUEA 3I42A 5EJ4A 2B78A 4QXQA 5CBPA 3C24A 3LU1A 4KUGA 1Y5LA 3HEAA 3ZWCA 2QZ4A 2O8DA 1IN1A 2P3OA 4XB6B 4XWTA 3J80A 3N8KA 1ZDMA 1CUCA 1NF3A 4DA7A 5D3QA 3JD2A 5AI9A 3JALB 3Q7IA 2V3VA 3F98A 4CCYB 3MRTA 1EUYA 4IJUA 1FPMA 2ANBA 2VT3A 3NYRA 2OZVA 3D54D 3ZNPA 4JROA 1RLMA 2GH1A 2ZRAA 4IXMA 3U13A 3VGJA 3VR3D 1N4DA 2W98A 5JROA 2W7TA 2FU5C 3WISA 1BD3A 2FZLA 2VQFB 2M98A 1XTJA 4P5EA 3S2IA 3ZZ1A 3F5FA 3RHFA 1Z2AA 2ZANA 3A9VA 5FL7A 5A0TA 5AR1A 3JWPA 4RZHA 5LMZA 5K3EA 3BPSA 1FLNA 3B9RA 2V7QA 1DAMA 3UAYA 3I6IA 4RLSA 3K71B 1VG1A 5CD9A 5JSZB 7ADHA 2LCFA 1GJRA 4QGGA 5LUBA 3ZDCA 3CISA 1PV4A 4ZK2A 5BSVA 1Z5PA 1WABA 3KZXA 4EW1A 1UUFA 1NMXA 5K0NA 3U7IA 4XUCA 5ECWA 2R7NA 3EXHC 3QK7A 4TLMB 2POQX 4OLBA 4TQAA 2I2AA 4F7WA 2AG8A 3RFUA 4EVIA 2UYCA 3G85A 3TF5A 4G4GA 3FPAA 4XR9A 5CYOA 2HT6A 2QAIA 1ABBA 3ZCXA 2Y8EA 1YCGA 2J48A 3O74A 4CUJA 1SPBS 5GY7A 1LPNA 2OV8A 1E7YA 3NEAA 4RLHA 4U3JB 2H1IA 4ZO7A 2JGDB 3GLKA 6YASA 5AJXA 4EUSA 5KOJB 3PR1A 4Q7LA 3T5CA 2WQ7A 5KQGA 1M5TA 1K7XB 5LP6F 4HQRA 4D4MA 2BKLA 5HKKD 4IZIA 1RI5A 4F85A 5A9TA 5AKGA 4IY1A 3WRXA 2BFDB 1B4DA 2VDUE 1EINA 4ZN6A 1QJ4A 3K30A 3DCYA 3PDIA 2ZJ3A 3OAAD 3G0OA 4TV9A 3OLZA 1EQ2A 4GLLA 2YWFA 4WKBA 2IYEA 3GJYA 3HI6A 3JZIA 1U65A 3KEGA 3QWBA 1X8XA 4PBTA 5DB4A 3I09A 4X8LA 4HV4A 1IHUA 1C0KA 2D1YA 2G5CA 3GG9A 1T36B 3MEQA 4PC3A 5JFOA 2WFAA 2J30A 1BXGB 3HXLA 1AQJA 2NUTB 1HA3A 2IF2A 1QO9A 3C7AA 1G21B 5ES4B 3U48A 1DWQA 4HR7A 3I62A 2WVJA 3DC2A 5F35A 4HP8A 4C29A 5JRDS 2DPLA 4AQYB 1BA3A 3ENQA 3R75A 1NJGA 3CRW1 1OBFO 5FPHA 1QH1A 4BN4A 3AWDA 2H1LA 4QOFA 1CY8A 2HPAA 1GG8A 4X6YA 4LJLA 1VI5A 2R6CA 3IEUA 3TUZC 4AS1A 4E33A 3TIGA 1KH2A 3F96A 3WNQA 3AJRA 4AM8A 2Z3VA 3WL7A 1F4LA 3L9WA 4LKOA 2EATA 3A04A 4CV3A 3HJAA 1QUEA 1FP2A 4PGMA 3ZX5A 4HDCA 5C5DA 5LQJA 2QIPA 3OM9A 2X0EA 4KRXA 5AW5A 2R0QC 1EHYA 1BE0A 4AJ2A 3TIVA 5KTMA 4HTAA 5JFGA 3Q11A 1FQJA 3FWNA 1O94A 4CI9A 3BL5A 4YHBA 1C9JA 4A5OA 4IMPA 1T0UA 1P2VA 3JVEA 3OMLA 1RAFA 2AMVA 2NW6A 1GGHA 2RGEA 4JLSA 5DASA 2OXFA 1R0XA 3EDQA 4UD6A 4JLWA 1G3QA 1TGVA 2B2XA 4RDIA 4AMZA 4P7JA 3VA7A 2TMDA 2VR1A 4R84A 5JS1A 1ZWKA 2RKWA 1J5PA 2HIAA 4FHZA 1T6BY 4QYSA 5FTWA 3VDQA 2FRDA 4B5KA 1B2RA 3AVVA 3M2PA 1VA5A 1O6FA 1FY2A 5L3QB 3V48A 3OCUA 1D7AA 1NXOA 1OTHA 3TDKA 2FN4A 4EAAA 4LHEA 3OY7A 2JDIA 4PZLA 2Q28A 2W2NA 4N8SA 4PYNA 4PVDA 5GIPE 3ANNA 3EARA 1NW5A 4BNXA 4ARUA 3EZ9A 3LP8A 3INTA 3ZXYA 2LP4Y 2A14A 2YXLA 1F1JA 3CE9A 3OLWA 1HXHA 1PJRA 1DLIA 1R4NA 3BAFA 4LMRA 4O2RA 5CT8A 5DMXA 2JIBA 3KTFA 2HREA 3ZQUA 4OQLA 1P1IA 2FDRA 5KYYA 1Y80A 5AI4A 4HAVA 2DFLA 3IO3A 4FGLA 2H9IA 3RD5A 4AP5A 4DKJA 1T2NA 4JB2A 4UULA 3IALA 3TQCA 4CBVA 1N0IA 1OY1A 2DFVA 5F2KA 4FLFA 1Z0ZA 4DVGA 4FD3A 1YKSA 3UWKA 2Y1WA 3WBFA 2YY7A 3KDPA 4CM6A 2BY4A 1BKYA 1G20A 3FTPA 4HZGA 3RUFA 4RTSA 2OXCA 2NTJA 1HL3A 1T2AA 2I6UA 1E3WA 3TXYA 4DZZA 1RZRD 2RHGB 1YDHA 1TMYA 4GE3A 4II2A 3BHJA 3WLPA 3D4BA 2IE0A 5HUHA 2OWDA 3ZV3A 4YV2A 3TZEA 1JFFA 3GEDA 3UAZA 3LWNA 3FSEA 1V26A 4D4LA 3OEEA 1E1DA 4K7JA 1WF6A 2PVCA 4WD3A 3RFFA 1QQAA 4DCOA 3EDYA 2MR5A 4XYEA 1VDMA 4RHFA 1N7HA 3GCGA 5JAMA 2AR9A 4YIHA 5K4HA 4BP8A 3KETA 5F1OA 1SCJA 3W1WA 4F72A 5KSYA 1AB5A 4S0ZA 2Z6VA 4QTTB 4DNPA 1EZ1A 3JD1A 4GO1A 4LXUA 5DSTA 1HPLA 4N6GA 3UMVA 4P33A 5HK9A 2PD6A 3OIDA 4ABYA 1ESNA 3IKLA 1U80A 3CZPA 4RDCA 4BFLA 1SU6A 5AJWA 1NMQA 1YZFA 5HCIA 1RXCA 4X94A 5IM4A 4KHPB 3RYCB 1L4NA 1L5KA 1CJMA 4AFNA 1G98A 5KTKA 2F8SA 3GLQA 4GKJB 1WHSA 1Y3IA 2XWBF 1X3SA 3PUHA 2WM9B 5TGZA 2PRIA 4M1TA 4KX5A 1XZHA 2VP2A 4UHKA 1Q6ZA 1SVOA 1U6KA 5EZ6B 3TI7A 4B8YA 5EE3A 3UJBA 5DNUA 4ZEVA 3DBHB 4NMWA 3UB4A 4EJFA 3K9FC 2J08A 3OZSA 4RM3A 3I39X 3DONA 1TXGA 4MS3A 3CUVA 4YAOA 4C03A 1VHJA 3CRRA 2OAQ1 3EZYA 3F7OA 2BF4A 1A50B 2XB2A 5FBWB 2R1TB 3QPVA 4DIBA 5BORA 3O4JA 5KVCA 3HR7A 3NDBB 2EKDA 1OAKA 2G0NA 2QRGA 1V3VA 1U8AA 2ZULA 2IZ0A 3RAPR 3U49A 4EZIA 4J2HA 2CNKA 4XARA 4M8IA 5IJXA 4MPJA 1HDRA 1JPUA 3RS4A 4LJSA 3VAAA 4F97A 1AN0A 2Y1EA 3NW9A 4YJFB 4DMGA 2XVYA 4RELA 3QPWA 4ZYTA 1USWA 4XX0A 5LQKA 1OVGA 4Q4CA 4PN7A 2HXYA 5JALA 4KQ2A 3JQGB 5DRYA 4AB1A 1N36B 1RQLA 1P7VA 4R1TA 1IB0A 4P3OA 1Y3CE 4YRNA 2P0YA 3I61A 3ND8A 3HDQA 4J29A 4NZOA 3RFVA 4CNBA 1Y33E 3BXPA 4NBVA 3CU5A 1RQPA 3D1VA 3SQDA 1DPGA 4YO7A 4OLFA 3V4VB 2Q1TA 5D87A 1YA8A 3C15C 3GELA 1AZSC 3I01A 5KPDA 1XZGA 3S2ZA 1I6MA 4JBWA 2YH2A 1G5QA 1I36A 2GZMA 1GPNA 1V45E 3PCXA 4NULA 4E5MA 3ZJTA 3VHXA 2C8LA 2ZBQA 1NP3A 5KNCH 2ZUUA 1ONNA 1A8PA 2ZR9A 4Y6PA 1UPTA 4NYJQ 4BFYA 1L7PA 1RQRA 5L4SA 1L4GA 1WLYA 4J1NA 4CE6A 2GPWA 2NYAA 4KXXA 4WKCA 3NVKI 5IC4A 4K9PA 4MO9A 2YY6A 2JJQA 2ZXFA 2QN1A 5BR7A 1EVKA 4OCZA 3RV4A 3DFZA 4ND5A 4MB2A 4KWIA 3T9BA 4H31A 3KQVA 1JG2A 3KQWA 1T9GS 1LF0A 2XPCA 1XQ6A 4HQKA 1EJ0A 1R0ZA 2C57A 4GLJA 4NBRA 4UUPA 3KOOA 5KWVA 1XALA 3DG9A 5KEIA 2YUIA 1B8NA 1G0NA 3IDZA 4JYMA 2XNSA 4LFCB 4HUQA 2XA9A 3GMTA 1H65A 1Z6AA 4QWMA 3E7DA 2EBHX 2RGWA 3T5TA 1F20A 3Q8LA 4S12A 5ER6A 1KDPA 2JJMA 2B5VA 4FFRA 5L51A 3TBHA 1XAJA 1JIUA 3HU1A 3ZDEA 4DAEA 2O5CA 3EVNA 4HTFB 1OAOC 1KH3A 1AK1A 2FZGA 1CUJA 4O8ZA 1CR1A 2JI4A 3QJYA 2A33A 3EPJA 5H8WA 3UB3A 4TQ9A 5D1HA 3TIIA 4Z7JA 5F4ZA 5JC1A 1RPTA 4RA6B 4DWVA 3ZHXA 1FK8A 3EXHB 5LPNA 4ZO4A 4NNJA 2Z3ZA 4OX9B 4HEJA 1EJBA 2Y0BA 3AVYA 2Y68A 3O8OB 1Z0JA 2WB2A 2V5VA 2HLNA 2MSCB 4OQNA 4CEIA 3X1XA 5CGQB 4WCFB 3R0VA 3WGVA 3W1VA 2R5WA 2FWRA 3BJZA 1ULUA 5HE9A 4DC0A 5ENZA 2JZCA 2HYIC 1M0TA 2WKSA 2CJPA 3CQ9A 3DYBA 3EYAA 3VO1A 4Z5XA 3UMJA 2XTMA 1N2EA 2I03A 3TEMA 3ETNA 1LSUA 1R6UA 4RIFA 5TQ2B 1A9OA 2IHZA 3R5FA 2XRFA 4H7HA 4BQEA 2JGAA 1RM5A 3V4ZA 5M7EA 3JZDA 1Y8QA 3HJNA 1LQ2A 1DLJA 2GRUA 3C43A 4NE7A 4CQMA 5BOVA 4G37A 4HH4A 3E3LA 1KI1A 1DO0A 2Z09A 1B41A 4DNQA 2AE2A 4ZOLA 1JZTA 1ISFA 1D4FA 3QMMA 4QFDA 5BVHA 1R8XA 1OWNA 2PT9A 1FRNA 3ZXXA 4YRAA 5F23A 2X4GA 3O8QB 1DIGA 2D00A 1K27A 1MAUA 1E69A 3IT0A 4EHKA 3HVIA 2V1XA 4ARCA 2Q6OA 3OLYA 3AUKA 4P4TA 3RS0A 2W2OA 3UV6A 4HNRA 5ECDA 521PA 5BYKA 1OUMA 1J23A 1EI9A 4PG4A 3SHOA 1GQFA 4G8CA 5TV2A 1W19A 3BAZA 4JJZA 1L7QA 2IWHA 1TQHA 2GCPA 3OTQA 4DHEA 4Z49A 1MJ5A 4UOQA 4YAWA 5HILA 3GQVA 4MGZR 1BXRA 3UUFA 1E1YA 1T8RA 5DM4A 3V34A 4X0EA 5DXFA 4B3IA 3LHFA 3KYBA 4QOIA 3RUIA 1ZD8A 1RDFA 3IL2A 1OT3A 2CJXA 1LLCA 1Z7EA 5JWOA 3U56A 3NGXA 1Q7RA 4N5IX 5E2IA 5G4KA 3BRWD 2VDWA 4EDFA 2C5FA 3K70C 3LLCA 4D26A 4L74A 3EVCA 5CB4F 1T43A 2JGEA 4B46A 4BBJA 4HPJB 4JR0A 1BXRB 1ZM3A 4NONA 3QFSA 5AKIA 4DLLA 5H4HA 2WAMA 3X2EA 4EF6A 4WXPA 3JQ9C 3EW7A 1GRCA 1FIUA 4BQRA 5BMOA 1ZAYA 2YXPX 4TSRA 1C9EA 1R0KA 1YQXA 2WIDA 3PJDA 2FQYA 2AI1A 4WZAE 5EWMB 4A92A 1C1DB 1AKQA 1ORWA 4KDCA 1V37A 5DM60 1G291 4Z1OA 1BMFA 1DKRA 3LVRE 4BMXA 2GUGA 4B75A 1GGEA 4JHLA 4UVHA 2EX0A 3EXIB 3ZU3A 5HP4A 5BY2A 1JFVA 1XMPA 4AUKA 3CRVA 1IOZA 3ZN2A 3EGCA 1RT9A 3OECA 4BNVA 1UEIA 1WVIA 2PX5A 3A4TA 3EWNA 5EIFA 4DDTA 4JI4B 3AFHA 2QBYA 4M0LA 4Z4CA 1JHQA 2KMLA 2JZNA 1JSRA 4GYJA 2RAUA 1BCRA 3QVGB 4QBGB 2QT9A 2XMZA 4R2LA 5DI9A 4CDGA 4YPFA 4TL9A 1F7UA 1RRGA 5EZYA 1U5BB 2FN3A 4PYOA 4QEDA 3LQRA 3U7HB 3EZ2A 1T5IA 2HA4A 4WCDA 1AHPA 2WLTA 2Z4RA 3JASA 2QD5A 4H7IA 4YDSA 4KAJA 4JC8A 3GZJA 2C3PA 1WM1A 2WJIA 4KFRA 3PG5A 4IHJA 1O0BA 4QNNA 4OGLA 1I9GA 4QQNA 1L5NA 3R09A 4LBZA 1EWYA 1YJ5A 2HCTA 3ROKA 2Y1GA 2DWCA 2D1FA 4RTQA 1GG9A 1L4BA 2BFEB 2WMOB 3A6FA 3ITNA 1N2JA 4P3XA 2QUJA 3DDSA 2J32A 1KJ9A 1XL0A 2R6ZA 1K7YA 2G5PA 2FZEA 3LT5A 1AGNA 3B6MA 3MF4A 5ERXA 5IBPA 1C3VA 1SOAA 1YBHA 5A3JA 4XDGA 4LF4B 4L0MA 5JQGF 1FF9A 3DKPA 3L2OB 2VXYA 3UMYA 4DJTA 1EVLA 2A67A 1NSYA 1G8AA 1PDOA 4KLRA 4LOIA 3C4JA 4PQGA 4GFDA 3ZHCA 4BX0A 4TV8F 3G2KA 5ICCA 2NO9A 1H2AS 1AHHA 2HYDA 2W2MA 1JDPA 3F90A 2JATA 4CF3A 1V5IA 3KL2A 4L4ZA 1XDGA 4GI7A 2Q2QA 4JT4A 1Q2UA 1BWPA 3MGBA 5FO0A 2M6LA 3SZOA 1QAOA 1VE1A 3ZD8A 4FR0A 1J6UA 2Q3BA 1DO2A 2IP2A 2DHCA 4OUDB 1RZVA 4F4DA 2AW5A 2HRQA 4I8DA 3KJFA 3KE9A 1N2CA 3WL6A 4HEA1 1MU0A 4C7JA 4LXHA 2GDJA 4FOSA 4CU5A 5LUAA 4DV7B 3CRQA 3KTOA 3OO0A 3N6RA 4G0MA 4DM7A 1B2LA 2W6QA 3EMBA 2ADFA 2B36A 3IQIX 1AXEA 4P36A 3N8HA 3OZUA 4LYAA 5DHAA 3UKDA 3AIMA 1SCKA 4E5PA 4U9UA 2XYHA 5D86A 1GZVA 4Y18A 2J5QA 5B6PA 4YX9A 4MUKA 1NR5A 5HUQA 5I7EA 1RWVA 1U63A 3M4JA 4ZCTA 1AKEA 4LNHA 3WZLA 1SD2A 2AZTA 3ANXA 3KAQA 3O8LA 4O4HB 1K97A 1ZCFA 2W6OA 3HA7A 1XPOA 3IEVA 3LDGA 1BQ3A 4ERNA 5FYQA 1XZJA 4JZYA 1ZOPA 3ABOB 3P9CA 4BNZA 3VHLB 1ZP6A 4GKKB 2XMPA 2QTVB 5AKEA 2OGTA 2I6XA 2YJ4A 4GGPA 1WR8A 1KKMA 4XX1A 2O20A 2PMCA 3LLUA 3VO9A 1UXGA 1LDNA 4G6ZA 5D7BA 1Q0TA 1CEYA 2XMSA 4DEYA 3D0QA 1TLTA 5CXQA 1K3UB 3KKZA 4F3KA 2FW1A 4XUGB 2R96A 3CRMA 5A05A 1KSJA 1S7GA 4LRWA 2ISSD 5ER9A 2GCOA 2G9VA 2R751 4FHGA 1R9JA 5E3JA 1VI6A 3KWFA 3KEMA 2BWJA 2Q6KA 4MWEA 1JH9A 2AQHA 3KOWA 1R6XA 3FW1A 4XM2A 1H6AA 1D5WA 2LVBA 3HB9A 1X7XB 1KSHA 3PQ8A 4I7EA 5TRTA 3W5VA 1G38A 2CFRA 4K40A 1SCAA 4RH1A 4GH5A 4OYYA 3PIIA 4K2AA 3SOPA 4H7JA 4AJEA 1J8MF 5A5GA 1EFAA 2IS6A 3HGTA 3E7WA 1GNQA 5LU9A 4AX4A 1Z39A 3AF0A 1RJEA 2VSNA 3BGDA 1WHSB 2ZIXA 4NV1A 1DG9A 3RYHA 3GLIA 3BXXA 1ZOLA 3GAZA 4RK0A 2YN2A 1ZC3A 3WTCA 4KQ9A 4L3WA 4BXOA 3D8SA 3LT1A 1U8ZA 4HZUA 4RNDB 5I8PA 3T1YB 3LDUA 5K3AA 1N6LA 1WD7A 3FOZA 2OE2A 1LLQA 1ZK1A 3F71A 4L75A 3UK0A 3IUYA 1XO1A 2D0PB 3BHNA 3P9KA 4MCAA 1O9HA 1Z45A 3NORA 1UKCA 5K0JA 4B4UA 1NJ5A 3DHYA 2Q5CA 3QPAA 2E6KA 4EITA 5E6RA 1DIOB 3SZRA 3N7UA 1MPXA 4OUKX 1L8XA 4QFMA 5F3WB 4UZEA 2BKAA 4O08A 1CE8A 2NGRA 4A03A 3R7FA 1I0ZA 4EG0A 2O8CA 3HBJA 5E6SA 2CSXA 3OUTA 1JAXA 3H86A 3V00A 3Q12A 1PBNA 4QU9A 1P44A 4FT4A 3QI7A 3DDCA 4ZV9A 4DCCA 1P81A 2ORYA 4D25A 2NTEA 4I9FA 3ESCA 4K2HA 1USVA 3P9PA 1ZRSA 2R47A 2ZJ6A 4K9QA 2VUUA 5K8VA 5KKCA 2DTXA 2LKDA 3PNLA 4KBFA 4F06A 2BEUA 5IHPA 3KAPA 4W5QA 2W48A 5EE9A 1YS1X 5E7JA 3VBEA 2D62A 1E7RA 1I0IA 2W70A 3V3KA 3UPTA 1P3DA 3HDJA 2IS2A 1OPXA 3ZLUA 4OXRA 4N18A 4LF9B 4IDHA 1TZBA 4UMVA 4FLEA 4I14A 3KP1A 3CJRA 4Y1FA 2X0IA 2XF2A 3CHYA 4J6FA 3BMOA 3DFKA 1U98A 1NM5A 4RAQA 1E2FA 1YAJA 3BD9A 3ZDYB 3PFIA 1WCIA 1TFUA 1Z2PX 3RC9A 2XBMA 4GL2A 3DHWC 4FFWA 1THTA 5A71A 1H0KA 2O05A 5IH7A 2IYWA 3GGPA 2B7BA 2Q5FA 5JH7A 5LDHA 5ESDA 3SHVA 5DNWA 2RBKA 2D13A 3RUAA 4JXJA 1CYDA 1MQ9A 1Z12A 2WIFA 4IJMA 4PAQA 1WQ3A 3H87A 3DMRA 4HQNA 1YR9A 3NQ41 4H7PA 3I53A 2JFXA 1DT3A 5HJ2A 4D8YA 4RF4A 2BFWA 1WSDA 5J2TA 4KVZA 4NLLA 1UIMA 4B7AA 1M7BA 2QG9A 4Z4HA 1DRVA 5K0TA 3QSYA 2VFAA 2YCBA 1OIWA 4K9OA 1W85A 5BRNA 3EIXA 3M1YA 3BTOA 3BA6A 3U3MA 3WKEA 5LLSA 5ALSA 1XNQB 1UAAA 4DLZA 5H3LA 3L6OO 4WADA 1D2MA 1KPHA 2H1WA 2OFFA 1GNSA 1OKKA 2F1HA 3RABA 1QPBA 3OX1A 2GBFA 3EIQA 2H1FA 1F2DA 1CJTC 3OLCX 4L4RA 4NZPA 4OKSA 5TS3A 3PQ2A 4J91A 1VBNA 4JC0A 2CGEA 4BNNA 1VZ2A 2UVPB 2VYNA 4JUDX 1Y48E 3FSRA 1ODTC 5IVPA 4R9RA 3E6AA 1TZKA 1OYWA 2FW0A 2TS1A 3AHJA 2AOVA 1W5AA 5HIKA 3W5IA 4DGQA 2VVTA 2P6PA 3HCPA 1ZONA 4ZFNA 1FFWA 5LP6C 2VF2A 2GTHA 3ILYA 1RYFA 1MCZA 2B1RA 2PH7A 1CNMA 4LTDA 4NZYA 4XJXA 3RS3A 1QS0A 3PGLA 4LHXA 4KOEC 1LY1A 3AP3A 1WB5A 1YA4A 4YCLA 1UFQA 2C1XA 1SBIA 2RG1A 4BO9A 1G8KA 4TMKA 3GLTA 1LVHA 4H35A 3M4ZA 3NZEA 2ZIUB 2AHRA 5DX8A 1CY6A 1VZ3A 4D6XA 2JLZA 4A1FA 4A8PA 4DMRA 5ECGC 2AOUB 1NKVA 2GK3A 2G67A 5FP0A 5LYYA 1A8UA 3BMNA 5FNVA 5D85A 3EIHA 4B32A 1F8FA 2Q3DA 1KS9A 3D4OA 1I2MA 2EZ4A 1UBEA 2O0LA 3CBQA 4LWPA 4M22A 3UMBA 3V1UA 2X22A 4PRYA 2O2JA 2WOJA 3GYGA 3GRYA 1AY0A 1VJ0A 5JXHA 1L1QA 1OLUA 2C2YA 1N1MA 4BIMA 3THRA 2BC9A 2ZTUA 1US8B 4E32A 3M5WA 4CMKA 2ASEA 3KKEA 1NVBA 4REOA 3WNVA 5A9SB 1T1IA 2DY0A 4GC5A 1E1QA 1MTOA 4ER6A 4YRIA 1GFWA 3L92A 1N0VC 3I8XA 2YZNA 3MTIA 3S8MA 1ZKDA 4F6CA 2ICAA 2VF5X 4O5OA 4ND1A 2PLFA 2GT1A 1VKRA 3MTGA 2YIJA 4FEYA 2E85A 1DAIA 2XWJI 3H3FA 3IMEA 5HF5A 5CDHA 2ZB2A 5AUPB 3QGMA 4OHMA 1C8VB 4BNHA 4YCDA 4MAAA 5K2MA 2PL5A 5IKMA 2G6BA 4ZRNA 3FZGA 2HWXA 2WTAA 5CVJA 5I7FA 3E23A 4DOMA 1XZDA 1L7RA 3IMFA 3D3NA 5ALIA 4Y6OA 3ROMA 1HTBA 2PH5A 3AUTA 4UKDA 5GONF 5C5EA 4DXHA 2A7XA 1K6IA 2B8EA 1OYYA 4V0OA 1GD1O 4Q37A 1QE0A 4HH3C 5CFNA 4JXZA 1ESDA 4L4SA 2FMHA 2VDKB 2NV2B 2I99A 1LLDA 1N5LA 2GQ0A 2IIQA 4PO9A 5CPFA 1G59A 3B7GA 4WESB 4IH9A 3UUEA 4DJ5X 5JQWA 3KQUA 1EYZA 3QELA 1UF9A 4PR3A 3EZ7A 3OKAA 1JQKA 2K7ZA 2BONA 3D7NA 1MB3A 2CFIA 1U7TA 3CW9A 1TJPB 4KREA 4GOND 1XVAA 4WAUA 2WWTA 3WBKA 4JB0A 3G17A 3EPLA 3LG2A 3C74A 3A6GA 2ETXA 1EA7A 2OUKA 4RACA 1QC5B 1Q1AA 3DTVD 3ZWDA 4QNRA 4W5NA 4HH1A 1MGPA 4TMXA 4NDAA 5CEEA 1WVMA 5IAOA 4JB8A 1RI4A 2F6RA 2JCYA 2GMWA 4DABA 4OLJA 1JDSA 5FR1A 1DVRA 1KYVA 3JX9A 2O8DB 1KY5A 3TG2A 3K0HA 1O58A 3KKOA 3MWLA 1Q77A 5FTKA 2GXAA 1GDDA 1RKXA 2CXPA 5DK6A 2W6JD 2C7OA 1NSFA 1RJ9A 4FX5A 5LA6B 2P7HA 2ZRDA 3IPYA 3W5SA 3KVRA 2Y9PB 5CEJA 1BCSB 1X1SA 2DWQA 3UC9A 3U4QA 1GEGA 5AVJA 2H57A 1Z0UA 1A9ZA 4AX8A 1BQEA 4CDRA 4H7FA 2ZYIA 3HL4A 2RGRA 1OI3A 2UZ0A 4Q1EA 3W04A 2I4OA 3FJ1A 4CIXA 4EYOA 3MJHA 3MGGA 2WUWE 1RKBA 3X2SA 1HSOA 1P1CA 1Q1NA 1XOIA 2J3LA 3FCEA 4MVCA 4RMJA 4XFDA 4WL0A 5EJAA 3OQVA 4B76A 4TTTS 1GPKA 2OCGA 1K92A 5A4JA 1M34B 2IYYA 5JAIA 1QCDA 2BZGA 2QSZA 4M76B 4NOMA 4AG3A 4PYRA 5BSKA 4PLWA 5ALDA 4MYCA 1KDRA 1LVGA 2B1IA 1ST2A 3K5PA 3NHPA 5CFMA 3QOWA 4RY0A 3NJRA 1J8FA 2KYRA 5EEHA 5KTTA 1EGMB 3FYCA 5K8TA 1VMDA 3OJCA 3ED5A 3T4UA 4R9UC 4HBGA 1W4AA 3AEYA 1DEAA 4LV5B 4U63A 3RNLA 4LFAB 1B3RA 3GC6A 4TYMA 4O2LA 4UU0A 3HGMA 1GV1A 1MABB 2ZJAA 2FW9A 5IKOA 5BWBA 1S2NA 3E82A 3RSZA 4E15A 4YUAA 5GADl 4YEDA 1UC5B 3H5TA 3L5KA 1PJBA 3K4PA 3TNFA 3WLMA 1LZLA 3IURA 5AUNB 5TS2A 4QXMA 4JI7B 3DFFA 4UHHA 1Z8NA 2A7QA 5FHQA 3SICE 4NENB 4Q3LA 2TYSB 1IK4A 1EE9A 2EJUA 3EMKA 1PR4A 1T9HA 3MAJA 4UE2A 5L53A 4C7OA 3RBAA 1GKYA 3HWX1 4NOKA 4V2UA 2ERXA 2ISCA 4Y2JA 2XVZA 3BTVA 2FSVC 4TL7A 4JI5B 2QZZA 1V35A 4C0KA 2H3HA 2WP8J 3GQBA 5A7FA 4US1R 2QRJA 3B6IA 2J59A 1I6LA 1SIOA 4NBTA 5IN4A 4ZI7B 3THWB 1CJUC 1MO2A 1PTJC 5C1PA 2JK1A 1KYZA 1O9GA 1T5DX 3KWMA 1SHTX 2KI5A 3GAMA 3IJPA 3H7IA 1CB7A 4O4HF 3ZDFA 1V5WA 1GTVA 1P31A 4IFEA 4ZO6A 2HCJB 2ZQZA 3RTBA 3GN2A 4PVCA 3BXGA 2E4VA 1I4WA 4AAYA 2PFKA 2VK4A 5JCOC 3FMPB 2PRYA 3EGXA 2GHQA 4PNEA 3QUCA 4RXTA 3L8MA 1UP7A 2WMYA 3U31A 3RJZA 3VHRA 3ZE0B 3E5MA 3K2EA 2XUKA 1AE1A 1JVNA 3BD6A 1B1AA 1WB4A 2OMEA 3E9DA 4DQ0A 1F14A 1GUAA 5IH3A 1UODA 3RTCA 1RC1A 3AESB 1GU0A 1IN5A 2HH9A 3A9CA 5CH8A 4PLZA 4D8TA 1XELA 2ZBEA 4M88A 3SSAA 3I9NA 4DDKA 4H4DA 1C41A 3S7TA 1E1RD 1Y4AE 3U7JA 5IDQA 2QTCA 1Q1BA 4GX0A 2YFQA 4FKZA 1L7OA 1RXVA 1I3NA 3FMGA 3T4XA 4HRVA 1UMDB 1UBRS 3VDMA 1QLHA 2ZI4A 4P3PA 2D1TA 1H3NA 4DN6A 1VIYA 2B1GA 3DKIA 5EXTA 1NXVA 3WLAA 1EVQA 5K8IA 4KK3A 3NTXA 5AKXA 3VSAA 5JJKA 4EY3A 5JR3A 1QZUA 1PO7A 1Z6ZA 1ZI6A 3IVCA 4RJJA 1G8MA 5JATA 4NFHA 3EF1A 4NXMB 4YP0A 2H8KA 4LVCA 4XEUA 5T57A 1YCFA 4G0ZA 1XWFA 4I8XA 4NCJA 4Q12A 4RC9A 3ZLTA 1MB9A 4D9FA 1FYDA 4ZU1X 3K8OE 4L8GA 1MAAA 4NZNA 3AM4A 2NYVA 2KS6A 2Q29A 5K1ZA 1R16A 4KG7A 3RWMB 4BBZA 4UNIA 2YN4A 4OEHA 2KBEA 4WFIA 5CXXA 2PTGA 4Q9NA 2XJ4A 2J0VA 2PPVA 1WUHS 3JQ6A 3X2FA 3DW3X 4PPFA 3BEOA 3PJFA 4XIJA 2QS9A 4PZCA 1D2EA 2CFSA 2APJA 2YHAA 5L3SB 2H6EA 2M6SA 5G0TA 1XRQA 2F3RA 4R1SA 4XPIB 1HQCA 4R1LA 3FDFA 3I76A 4D92A 3R3HA 2YFKA 4ISCA 2R6GA 1YC2A 3M6VA 4LXIA 4TLDA 4C7BA 1JXQA 4EAQA 1Y1RA 5BUCA 2YN0A 2NSDA 2C5HA 4D0NA 4DNXA 1BSVA 3HWRA 3JR3A 4KMOA 3VTAA 4RTJA 1ADBA 2ZSDA 4Y1EA 1ZM2A 1KSFX 1WCYA 2BFAA 1KQGA 4CFSA 1FS5A 1E8NA 2UYYA 5HZMA 4EK9A 1FYWA 1QDLB 3VPFA 5AHRA 5BSRA 4EW6A 1QQBA 3HXKA 9LDBA 4GOLD 3MPUA 2NO7A 5GV8A 1VL5A 1TYZA 3I6ZA 5E1BA 1FYXA 1N2OA 1UDXA 2B6NA 1GQQA 1W4LA 2B69A 3R5SA 3LPLA 4HVCA 4U7DA 5IKXA 3ESDA 4ESVA 2CCGA 1U02A 4PAWA 4JGGA 2YR0A 1S9HA 1JJ7A 2NZJA 3BQMB 2I3AA 3OAAA 4NJMA 3V97A 3F7MA 5JZOA 2J0QA 4MV1A 1ZH0A 4TYYA 3RVLA 1ODLA 3QZUA 3TR5A 4WK6A 5B3AA 3BK7A 3DP7A 1BH6A 2CLLB 5DFAA 5E6SB 5CCDA 2FMKA 3FA2A 4DZTA 3O2SB 5F9HA 1P60A 3T1TA 3HY3A 5HK8A 3A36A 2QMYA 2Z5LA 5AXDA 3LP5A 1MABA 2I29A 4OMUA 1SBQA 5C31A 4MQBA 5FFMA 4JFRA 4EFDA 2CHUA 2EKBA 2W4IA 1TJYA 4FSXA 4FDLA 3X1JA 3AEUB 3LOQA 3U4QB 3H1AA 1QHSA 1YWGO 1NOKA 1IUKA 4YECA 4YJGB 4ZTUB 3ZW9A 2ZRNA 1RXEA 2C4MA 1XZAA 3LYHA 4LMPA 4RQUA 5DN9A 3O5AA 3JQAB 4TV9B 1EP3B 4LZOA 3BFPA 4EENA 2H63A 1CS4C 1DTSA 3NRBA 3QKRB 4DSOA 1PGQA 3VR6A 4M6WA 4Q1VA 1MAWA 4ZXFA 1OVMA 2VP4A 4B8ZA 1DC5A 2LRHA 1VA4A 2QUAA 4MK4A 5FOSA 3IAM6 3W77A 4F4FA 5D2CA 1QQ7A 1LD3A 3BFVA 4GXQA 2BEJA 3KPWA 3JQFA 4UNPA 2Q50A 3ER6A 3QVOA 5FOWA 5C4IA 4OBBA 3Q3VA 1NURA 1U4OA 2QJTA 4UNNA 3R76A 1J56A 3THXB 4UDYX 4MWTA 2Q5HA 5FA8A 3IVXA 3KPYA 2DOKA 4G85A 2DC1A 2OTCA 4MKIA 3HR8A 3IQGX 4LUCA 5ENVA 3HC7A 4KQGA 4NJEB 4RPIA 4YRPA 4G5FA 3T54A 2WAXA 2GPAA 4ZQCB 3NTUA 1XRLA 4N7BA 5HQJA 2JFWA 3GLFA 1CHNA 1FE8A 1ULZA 5EP4A 5I5GA 3RUCA 2C3YA 3L8FA 4ARSA 3UGTA 4C4ZA 4MA0A 4EGCB 4MKRA 4IDBA 1RLTA 3DTNA 4ND7A 1JDBB 2VWGA 3ORRA 2D7JA 5ALWA 2P4QA 2XYPA 1NUUA 3SCZA 4HN2A 2J7PA 1VIVA 1IQRA 3ZCUA 1GFZA 1VQ1A 5H59A 1KJIA 4LRQA 3RT1A 3TOSA 2JI8A 2QV0A 1VLZA 2COUA 5GGXA 3VC7A 3DLAA 4RD6A 4C6TA 4CM9A 1F06A 4QGHA 2NSLA 5AWFC 5HF6A 1CUDA 1V3UA 2C4TA 3FRJA 4URWR 3TL3A 2VPWA 2IH4A 4FQ5A 2H59A 4E5VA 1P6QA 1HE8B 2J4FA 3FR7A 3K1JA 1JFSA 1BYUA 1Z8DA 4JLKA 5TPWA 5CCBA 3ETLA 1GPDG 1C7QA 4NCHA 1K0FA 1VI2A 3ESAA 1XTKA 3VTZA 4DIMA 4E2XA 3MQFA 2F8LA 4URYR 3FGZA 3LUCA 2ZAIA 2JGRA 2JHFA 3LC0A 1KO5A 1OXKB 5JPIA 4C0BA 4WBSA 1AV7A 3NKFA 1SUFA 3MS7A 4RSMA 5JAOA 5DCUA 3CW2A 3LQYA 1KDZA 3TW4A 3A1UA 1X13A 1GARA 2BTQA 4G63A 1LC0A 2RG7A 2VZ9A 4C0HA 4LMAA 2FSHA 3CUWA 3CX8A 5EOVA 2H2IA 4LYGA 4NAHA 3E4CA 3RF7A 4ENQA 1W1UA 1M7GA 3ADOA 4D4GA 4M1EA 3PFWO 2PZGA 3GLSA 2W43A 1L5OA 3S7ZA 1T5SA 4CT4B 5EKSA