3AP1A

Crystal structure of human tyrosylprotein sulfotransferase-2 complexed with pap and c4 peptide
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
302
structure length
298
Chain Sequence
LVMVVEYRYGKAMPLIFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWSKSGREKLRLDEAGVTDEVLDAAMQAFILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLKGDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human tyrosylprotein sulfotransferase-2 reveals the mechanism of protein tyrosine sulfation reaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Protein-tyrosine sulfotransferase 2
total genus 106
structure length 298
sequence length 302
chains with identical sequence B
ec nomenclature ec 2.8.2.20: Protein-tyrosine sulfotransferase.
pdb deposition date 2010-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13469 Sulfotransfer_3 Sulfotransferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ap1A01
2ATXA 1JXOA 2OCAA 4ACAA 1G5TA 2QP3A 3X1WA 4HZIA 3A1WA 5KDOA 5TMPA 4ERNA 3P20A 3CF2A 5E7JA 4ESHA 1NG1A 2XX3A 4E03A 5TY0A 4BLSA 1IXSB 1N6NA 3BGWA 1PUJA 4GOXA 2O8CB 1IN7A 3L0IB 3VR4A 3IO3A 1KK3A 3ZD6A 1P7CA 2OCPA 3ZVLA 2FPLA 2YC4C 3V4RA 1U9IC 2RB4A 3GLFA 4Q47A 3ZZUA 2JGNA 2OFWA 2D2FA 3DKPA 1Q1QA 4PC3A 3DO6A 3U3MA 2C78A 4UNPA 1KTVA 4BZXA 3BIFA 3P4YA 3TH5A 5JSZB 4V02A 1KO1A 2F6RA 4DSTA 1D8TA 4G5GA 2CHGA 3W6NA 1XXHB 3UPUA 4IDNA 4V0KA 4PQRA 1KDRA 1NN0A 4Q48A 4EPYA 1SVKA 1AS2A 4BFXA 2AD5A 4B71A 4US1R 1IXRC 5JWRA 3W5IA 2LCFA 1NN5A 4HB4A 3AGPA 3WMFA 1NVXQ 1ZM3A 1PLKA 2UVQA 2WJIA 3R8FA 1S96A 3G0HA 2YV5A 2IYLD 4TN1A 1O87A 1FW6A 2RGXA 4BLTA 1AZSC 1G5RA 1OFTA 4IOLA 4KBFA 4M8NE 2AHOA 1IN8A 3PUVA 4N3NA 4HSEA 1XU4A 4JBWA 3PEUA 4RD1A 3FKQA 5BW8A 4JBYA 4TLBA 5LD2C 1DAEA 2VP4A 2O8EA 1W2GA 4OHWA 2RHDA 2KSQA 2QORA 2YYZA 4DWJA 4B2PA 3A1TA 3AEZA 1GTVA 1MABA 3EIHA 3GEIA 3C8UA 1PLLA 5DH9A 1II0A 1AS0A 5EE9A 1M7GA 4B35A 1DOAA 1SXJB 1M7BA 2ZRCA 1BMFA 4D0LB 2J0UB 1YHNA 3K9GA 2AFHE 4EJSB 2RMKA 1UADA 3KUCA 2ZRNA 4NL4H 2H57A 3SHFA 1OYYA 5DSZA 4EPVA 1NVUQ 2NZ8A 4RSGA 3K70B 3FTQA 4K46A 4A0FA 4D0GA 2G83A 2GJSA 2X19A 2ZITA 4HLCA 1FL9A 1OB2A 2JIZD 2RGNA 3CF6R 2QNRA 1XNJA 1XMIA 4Q03A 1QZXA 4CW7A 4GSYA 4XWOA 3E5HA 2BJWA 4UKDA 3VNUA 2NO9A 1ELOA 3ZVNA 3LQRA 3CRQA 4H9GA 4Q9IA 1YR9A 5FR1A 3O8CA 5TVKA 3NBXX 1OF1A 4ACBA 5A5GA 2IYZA 2WKRA 1YR6A 1UJ2A 2VIIA 4NYMQ 3I4LA 1YVDA 2ZVPX 4NCHA 3AVUA 3WHLA 4DEXA 2ATVA 3QF4B 4TSFA 3O8RA 4QGHA 3W6PA 5JWHA 1P60A 4BQSA 2D06A 2REBA 5KOYA 2NOAA 4O25A 2DY1A 4NYIQ 2IYWA 3TR0A 4FWTA 5FTNA 2ZJZA 4Z8YA 3U3JA 3NH9A 1G64A 2AWOA 4ZI2A 5JJLA 4C0AC 621PA 1QHIA 3QG1A 1QRAA 4A82A 1JR3E 2ZAMA 4AWXA 4DKXA 4M1MA 3T35A 4XWAA 4CT5A 2QY9A 5DI9A 4DEYA 5JI3E 3AH8A 3M1IA 2Q9BA 3Q72A 1XMVA 1OXSC 3CNOA 1G1MA 1W47A 1CJVC 3F3YA 2V7QA 4LYHA 1Z08A 4R9UC 1ZCAA 2VA8A 3RVBA 3B13B 1N25A 3VR3A 5L3VA 1KGDA 4LV5B 1N6OA 1S9HA 2J1LA 1CKEA 4P33A 5EXTA 1GL7A 1NJFA 2CHQA 3GLHB 4BLOA 4L9SA 4DCSA 2QGZA 2XGJA 1RRCA 1R0WA 3UWOA 2JJ2D 5HE9A 2AKYA 2L0XA 4HB0A 1R8SA 4IKEA 4RD6A 4NPHA 2FSIA 1RRPA 1LW7A 4FMCB 4HB3A 4HLUA 4L4UA 4M9ZA 1ZNYA 4X8OA 1TF5A 1A5TA 4HATA 4HZUB 1HE8B 2G6BA 1TX4B 4LYAA 2J7PA 2C98A 4BFTA 1DAGA 5E3HA 1T9HA 3GQBA 2OBNA 1JNYA 3DZDA 1NBMD 2N1BA 4MQBA 4RVCA 3OE7A 3OEED 5BXQC 1ZIPA 4F92B 5HZKA 2A5YB 2EW1A 4MYUA 4MKHA 4Q4AB 5C4GB 1ETUA 1P6XA 2ZIAA 3ADKA 4HAXA 5UKDA 2IUUA 4N0EA 1P5ZB 2ZRHA 1OH5A 1GDDA 3ZZTA 1Q3HA 2EFEB 4GI7A 1ZAKA 4F4CA 5CYOA 3I92A 5IF9A 4L8GA 1T3HA 3U7HB 3U2QA 2ZUCA 2ZI7A 4PHFA 1E1QA 1DE0A 3IIKA 4LJ9A 2OBLA 3K0AA 4BZQA 1KNXA 4NH0A 1SVIA 2C03A 4G5OA 2DWOA 3KFXA 1Z63A 1G19A 3RS4A 1E2KA 2R6DA 3LH5A 2BCGY 1E2HA 2FFHA 2WIBA 4MDFA 4F38A 1KJZA 1OXVA 1RFLA 1OV4A 1VG1A 1FUKA 4IDHA 3IILA 2FH5B 1MH1A 1TQ6A 2GDJA 4MITA 3EZ7A 2ZVQX 2BDTA 3HU1A 3EA5A 2ZU6A 821PA 2QE7A 5G41A 2XTNA 4R98A 4WAUA 2Z5FA 4CEJB 2D7CA 4ARZA 4BZPA 2WBLC 1M2OB 3FE2A 1XRJA 3CX8A 3UG7A 4AD8A 3ECCA 4QGFA 2WWXA 1Z3IX 3L82B 2G1JA 4HEJA 2G77B 3REFA 3B60A 2ZJOA 4EKDA 4FWIB 3CRW1 3BORA 4IVRA 1F3OA 2ZANA 1II9A 1N5IA 2NPIA 2E9SA 2D3WA 2C9CA 3U3KA 3BB3A 4I4LA 1E0KA 2O0KA 4QNMA 1E0SA 1G17A 2OILA 4C0LA 4TTQA 3FDIA 4KFUA 5JJKA 4RJLA 1ZNXA 1OKKD 1KO4A 1QG2A 2XITA 3RS2A 1EFRA 2AXNA 1YZKA 3IBYA 1E2QA 4Q4LA 1E6CA 2QU8A 1ZUIA 1W1WA 3A36A 3KKMA 4EPRA 3CWQA 1VCIA 2WJVA 2GZHA 2YVUA 2CL6X 5TV2A 1XMSA 3HDTA 3ZH9B 2IBMA 4E07A 1NVVR 1EG7A 4AI6A 3BS4A 1N3BA 4MKGA 5FUWA 3QPVA 2WPDA 5HCNA 4DXAA 1N2CE 5L3SA 1EK0A 3VU9A 2TMKA 5FBRB 2XZPA 3K0AB 3MUFA 3TGPA 1S3GA 2C2HA 5C4MA 3WHKA 2J9RA 1CTQA 1E96A 2G0TA 2HV8A 2WJJA 2QAGB 4A4DA 2ERXA 3EZ2A 1XZQA 1KZ7B 2ANCA 3L2OB 2VH5R 1E79D 4S2EA 1M74A 1NJGA 1QHHA 3X1ZA 4M1OA 3TE6A 1GKUB 2DFLA 4G3XA 4PC6A 4PPNA 3VX3A 3K09C 4KXFB 4BUJA 4A2PA 1VIAA 1FTNA 4B3BA 3LA6A 5F9FA 4ABYA 2ZSBA 3U7GA 4B6FA 1P61B 4GOJA 2PX3A 3EZFA 5FFMA 1WBDA 1DPFA 1GZSA 1GSIA 1QHXA 5EE3A 4R2HA 3ICQB 2ZE6A 2JASA 3PFIA 2ZAOA 4LYFA 4HDOB 4HAYA 1OYWA 4JLKA 2QENA 5L3RA 3HR8A 2E87A 3OEEA 2RGGA 3LAWA 2G3YA 3OE7D 2J3EA 4R7ZA 1QVRA 2ERYA 4LJAA 2P3SA 4TT3A 5KNBA 3CH5A 1UAAA 2PBRA 4F91B 3AVXA 4EFLA 3NTUA 4KLNA 3P1JA 2C95A 2JJ1A 2LKDA 2P5SA 2Q9CA 2EWWA 4TYPA 5J47A 3W8NA 4B73A 5FTMA 2GTPA 2B6HA 4CT4B 2HLDD 3VNVA 4D82A 3T1VA 2YC2C 2X2FA 4IHQA 1SVLA 1YZQA 4DLZA 1XTSA 1P73A 1I2DA 2B7BA 1J90A 3NHAA 4KSCA 1G8PA 3VQTA 1VYTA 1WF3A 3IIJA 4JYBA 3SOPA 1Z07A 1NN1A 2KE5A 4QHYA 2JLXA 5JLJA 2OUKA 4UNQA 1RYHA 1XPOA 1SKYE 1AQUA 3GEHA 2FEOA 5CJ2A 3K53A 2HEIA 3WXMA 2O0HA 5KPJA 4Q00A 2QP9X 4V03A 2OZEA 3QVUA 1CS4C 4JT2A 4TLCA 4NP6A 2W0SA 1SVOA 2LWIA 2PMKA 1UKVY 2N46A 2QSYA 2FX3A 5EXPA 4JIMA 4POAA 4XVUA 3RANA 4XWKA 4TMZA 2W6IA 4NHOA 4D81A 2PMDA 5A4JA 2ZRIA 4B32A 1E2LA 4C2UA 4QM7A 5EE5B 1GL9B 2BMEA 1W49A 4TSFD 3TIFA 3TR5A 1C4OA 1X86B 1I4DD 2IT1A 2IF2A 3KDSE 4TQAA 2GAOA 1KO8A 2JEOA 4NTZA 2ZS7A 1GIAA 2DB3A 1U0LA 1GRQA 2GZDA 4HAVA 2ZS9A 1VTKA 3X1XA 4Y0VA 4QBHA 2GEVA 4TZ0A 5D3MA 1AJEA 3MD0A 3OF5A 2WJYA 1KAGA 1EFHA 4HDQB 3IKJA 3M6AA 1R7RA 3UG6A 2QA5A 3MSXA 4O2RA 2XJ9A 5BQ5A 3VU9B 4QKQA 1Z0DA 4OK6A 2JLYA 1UDWA 1Q3TA 3HPQA 3NC1C 1NP6A 1S0UA 4FMCF 1X1SA 3QKSA 1WA5A 3I1FA 4BFUA 3KXIA 2EFCB 2A5GA 1NI3A 3CNLA 4B3CA 1S1CA 4DJTA 1NIPA 1E2JA 4XVRA 4JL6A 5JS7A 3LBNA 3RS5A 5C1BA 5CDFE 3CRVA 3AQ4A 3B6EA 3I73A 1B23P 5FL3A 1N5JA 1XXHE 1W48A 2CL0X 2GCPA 3EPLA 4NONA 3WP0A 2OO7A 3QKSB 4LJ8A 2VQSA 5FBVB 1TPZA 1ZNZA 3K9LA 3ZQ6A 3IUYA 1J7KA 3D3QA 2IX3A 1L8QA 3FGNA 4NYJR 1Z5ZA 4JJKA 3EPHA 3A1SA 4YXWD 1DAHA 2P6UA 3THYA 2FWRA 3BB4A 3AVYA 1NLFA 2VEDA 4M1KA 4IDPA 2GHIA 3AVQA 3ASYA 5EP1A 3ADBA 2D2EA 4EPXA 5IRCD 3KX2A 5HPYB 2X8AA 2XEXA 1FMLA 5DHFA 2OXCA 2OFOA 4FCTA 4B34A 1P72A 2IEYA 3L0PA 4RZXA 4YDSA 4OI4A 4DCNA 5BWMA 4DDWA 3BH6A 4MH0R 1YZGA 5B2ZA 3OAAA 4A8JC 1E69A 2XZLA 2W2VA 4IEIA 4MGZR 5JJIA 4DDTA 4ZIRB 4W5JA 2ZJYA 2WIAA 3ZIAA 3BD9A 4C4PA 4DB2A 2IS2A 1JJVA 2FEMA 3PENA 4DLXA 2VSXA 2BVNA 1CF4A 1KAOA 5L3QB 1DAFA 4N0DA 2I1QA 3LW8A 3GEEA 2OESA 3THWA 1Q21A 3QXCA 3QIAA 4Q9HA 4Q19A 4MYHA 1GL6A 3FMFA 3U44B 4PZYA 3NWJA 4I1SA 2ZRFA 4GBMA 4LBWA 4GFDA 4EFMA 3DM9B 1CR4A 4UNNA 2CCGA 3U3RA 1G3UA 2QG6A 4CEJA 1KMHA 4Q7LA 4IRUB 2BIFA 4D4MA 3AUXA 2GXUA 3MWKA 1FTSA 4DIDA 2ZRLA 1OXUA 3ZZ0A 3CIOA 3K0FB 3WYGA 3QUSA 2ZE7A 3NBYC 1E3MA 2CLSA 3GFOA 4DB4A 1ZIOA 4EQ6B 3W6OA 4OI0A 1K8RA 3TKLA 1X3SA 1GNPA 1MT0A 1G18A 4B48A 4DLSA 3B2EA 4TYNA 1OJLA 2PEYA 1YZTA 4LBZA 1VKJA 1OFUX 3X1YA 3FFBA 3KJHA 4ZIRA 1HA3A 4BRWA 1EFTA 3EARA 5G3YA 1QHNA 4A9AA 3AF4A 1G8HA 1OPXA 4BLRA 1KNQA 1RJ9A 5FPSA 2ZI9A 3G5UA 1Z0JA 2DPXA 3QBVA 4C0BA 3GJ4A 4LSGA 4L5BA 3BFXA 4IVPA 4PX9A 4AK9A 4URVR 2WWIA 5FH9A 2V6JA 1WB9A 1MO4A 1D2MA 4LV6A 1KI6B 1DARA 1Q20A 3EC2A 3P26A 4PC1A 5H1YA 1P75A 1S8FA 4ZDIA 5JSZA 4G5QA 4B3FX 3LBIA 4JSTA 4CZ2A 1TU4A 4W9MC 2LKCA 2ZXUA 2WWYA 4U7DA 3W90A 2OAQ1 4P32A 3OESA 4C0QC 2O5VA 3WNBA 2ASEA 3EAQA 3C14C 3X2SA 1MO3A 3ZD7A 3IHWA 2V8OA 1LF5A 4D0NA 5H8WA 1ZJ6A 4OQMA 3LFUA 2GILA 2FU5C 1GFIA 3GJ0A 2ORVA 2GCOB 3OZXA 3AVWA 4F4JA 1A1VA 4I81A 4WA7A 1YRBA 4JYCA 4YC7A 1S9DA 1SULA 3GP8A 3LO5A 1E98A 2ZJ5A 1F5NA 1COWA 1MKYA 2P2LA 1KI8A 1Q22A 2ZEJA 3K1JA 3FWYA 1YZUA 1KI4A 1X1RA 3AKCA 1KJWA 5C18A 2NO1A 2O8CA 5FOWA 1VHTA 2BM1A 221PA 3K9HA 3TRFA 4AKIA 3NDPA 2O52A 4M1SA 5EZ6B 2UZ3A 4DCVA 1SKYB 1YZLA 1SQ5A 4B6EA 3L0SA 4GNKA 2CCKA 3Q5DA 4Q1DA 5J40A 1NG9A 1E9AA 1ZUNB 1OSNA 1KO7A 2VSOA 4RY2A 3SJBA 2A78A 1P4SA 2GKSA 3B5JA 4Q02A 1IY1A 4Q7JB 3T5DA 4PFSA 4QBFA 5HTKA 3T1QA 5ELXA 2AFIE 5E7MA 1TEVA 2QPOA 2I1VB 1JJ7A 2D62A 3DHWC 2Q3HA 4LBYA 4OQNA 1GAJA 2FFQA 2FSGA 2J46A 2QBYA 3QXHA 4C3ZA 3AUYA 2QI9C 4URUR 2GJ9A 2GWHA 3NH6A 4ESVA 3KKPA 2BM0A 3FMIA 2HF8A 2ZRDA 4ZO4A 3WRYC 4CYMA 1S4QA 4ZPXA 2IYTA 1WP9A 4QNRA 2BEJA 3N2IA 3PR1A 4F7WA 2R65A 5M04A 4OJQA 2Q9AA 1CLUA 1LV7A 3FB4A 3SBEA 3BJIC 121PA 1SHZA 4C7OA 4PAMA 1Q1BA 2Q0HA 1W44A 4EPWA 3H0KA 1CEEA 3GLGA 1SHKA 1Q0UA 1OB5A 1W4CA 4B43A 4UNRA 2V3CC 521PA 4II7A 3AKDA 5AJYA 1J2JA 4LPKA 4JLMA 4JVMA 4GZLA 1T5LA 1ZC4A 2IYYA 1LTQA 3EWSA 3PEVA 3ZDQA 1RE0A 4JLAA 2QTVB 2WMNB 2CK3D 5SZIA 1ZMXA 1W0KD 4B75A 3OEHA 1P2UA 4E5UA 1P9WA 1EFUA 1NF3A 1TQ4A 2IEZA 2WSMA 1RZ3A 4PO1A 3TJZA 5CM9C 1XDBA 2HJVA 3IDQA 4NKRA 3FKSA 2O0JA 3ZS9A 1F2TB 4JLPA 2FA9A 4QGAA 4DSNA 5B30A 2Y8EA 1GRRA 3A1VA 3O8BA 5A0FA 3EC1A 2XSZD 3A58B 1MOZA 4PQFA 3EXAA 3F5FA 4PPQA 3W3ZB 5DNYB 3CH4B 5JCPA 1Z22A 1CIPA 1E99A 2QEQA 2QQ0A 1ESMA 2VP0A 2ZETA 5GVRA 5DLQC 3SFVA 3NEJA 4HUQA 1ZM4A 4TTPA 4US0R 1K6MA 1AGPA 1R5OA 1MRNA 1OIWA 2IUTA 2V6IA 3KJIA 3FKSD 5DN6A 5F3WB 4CEIA 1D9XA 4E09A 2GJKA 5GJVC 2CJWA 4BFWA 3QPWA 2HF9A 4EJSC 2NQ2C 4XSHA 3WBJA 2W6ID 4HB2A 2CCJA 2IW3A 1W0KA 2CE2X 1G8FA 2ZR0A 1HY3A 2PT5A 2QROA 4OYHA 1UDXA 1Z83A 2QUZA 1U8AA 4O2LA 4DLRA 4YMWA 2WZQA 1L7VC 3PV0A 4M53A 2BCJQ 4M9SA 3SJCA 3GLHA 2OCYC 3DKVA 2GXQA 4LOAA 3EWAA 1QG4A 4XJXA 2QMUA 2GBLC 3GLGE 4OI1A 1Y63A 1N0VC 1XCPA 3QF7A 4HUTA 3TW4A 1BH2A 3MRSA 3FOZA 4P3YA 5TDHA 2FNAA 2XJ4A 3MFYA 3PUXA 3VR6A 2GF9A 4FMDF 2YINC 3QSYA 4LRWA 2O8DB 5SZKB 1HH4A 1YJ5A 1YU9A 3RWOA 1HQCA 2EU8A 4EPTA 1A2KC 2RGNC 2C77A 1WRBA 4JZKA 5JWOA 1T91A 4LHXA 1FQJA 3QE0A 1JBKA 1M6NA 1FZQA 1PUIA 1P9RA 2WOJA 4AURA 3C16C 5CIWA 4G0NA 4AC9A 2D4HA 5CLQA 2RGDA 3A1UA 4TT3D 4Q9KA 1UEIA 2PLFA 3WMGA 4JS0A 3RSLA 1CXZA 4FCVA 1L2TA 3GJ6A 3K70D 4WZAE 1CR2A 1OIXA 4BEBA 2W2XA 5CB6A 3BAFA 2CLCX 3B85A 3B9QA 5AK0A 3I5XA 1NMYA 3KXLA 4G5SA 4MRSA 2JLUA 3TSZA 1N6LA 4AYWA 1IJEA 5DO9A 3B8HA 4OHXA 4GP7A 1JPJA 3I5YA 3GMTA 1ZRHA 3ZVMA 1II8A 3HPRA 3JVUA 4KO8A 4RFSA 2XOKA 1XD2B 4DLWA 4DBLC 1AN0A 2YZ2A 2GEDA 3NBFA 4AYXA 4Q01A 3MLEA 2ZSFA 3T34A 5CB8A 2GRJA 3CF0A 2O8FA 4YMSA 4UQOA 4RZ3A 3ND8A 3W3AA 1KZGB 4OI2A 3TLXA 2YNMA 4I1OA 1JEDA 1VPLA 1DO0A 5KTYA 3TNFA 2BKEA 4TYYA 1GKYA 2HYDA 4UXIA 1XTIA 4WOPA 3RDPA 1JXMA 1N6HA 3QQ5A 1BIFA 2XB4A 3DZ8A 4NYJQ 1LY1A 4Z51A 5CDFA 2H16A 4JVNA 1H65A 1P2SA 1VG8A 2WWHA 2BMFA 3R20A 3UXMA 2PX0A 4XH9B 5TARA 4Q4AA 4BWYA 4PXAA 4LHYA 3U6BA 3LXXA 5G53C 1G7RA 2RAPA 4RFSB 2MSDB 1EFRD 2HT1A 2IS1A 3CW2A 3LLMA 5EUQB 4KU4A 1OKKA 2HJGA 3K09A 5FOUA 3DPUA 1I2MA 1BS1A 3CWZA 1T8UA 4DZZA 1U9IA 3LLUA 1E9FA 4JLJA 1G291 4ASUD 5DYGA 4B3DA 3DL0A 3LY5A 4LCBA 1UFQA 4YLGA 4MDEA 1K5GA 2F9MA 4IXMA 4KJZA 2H7VA 4DSUA 4AYTA 1FX0A 5DHAA 2OLJA 3NVAA 4G5RA 4ZDWA 1G4AE 4IEEA 1KI3A 4DCUA 2BEKA 4KFSA 3SN6A 3AV0B 2G9NA 3T06B 3EIEA 1VCNA 4QC2A 3Q5EA 5G40A 4C9BA 2VP2A 3AVVA 3TAHA 3VKWA 5J4LA 1J8MF 1XJCA 1TU3A 2W00A 2ZU0C 4G1UC 3KZ1E 2ZSEA 3SYKA 4NBSA 4GPTA 1DG3A 5CM8B 4KYUA 3AF2A 1T6NA 5FUYA 1NKSA 3EG5A 2NO7A 3SNHA 1N0UA 3B9PA 1E9DA 3DDCA 4QL3A 1XD9A 4HLUC 1R0ZA 1NLYA 3MJHA 2OM2A 2Z4SA 2BV3A 2QM7A 1KSHA 1QDEA 2DWPA 3BC1A 1TADA 1CULC 2WM9B 2R8RA 1PV4A 1G5PA 2IXEA 4QGGA 1IN5A 1HURA 3K70C 1JI0A 2OXRA 3E1SA 4FINA 2HCBA 4OK5A 4A8JB 3UATA 4RZUA 5C2JB 3A8TA 3RWMB 4PAOA 2V1UA 4MYCA 1IXZA 3ZLJA 3BXZA 1A2BA 4URXR 1OHHD 4AY2A 4PO9A 1Z28A 1U8ZA 5AUPB 4KVGA 2C5LA 3K9NA 1TL7C 1XXHA 1KI2A 1G41A 2ODBA 1AS3A 2FPKA 3ASZA 5FUXA 5IDVA 4EDHA 5B57C 4IW3B 4JL8A 1NSTA 2IF0A 2UZIR 4PZZA 2VSFA 1NBME 1NIJA 1TEXA 2QQEA 3PUZA 3WY9A 3EZ9A 3N5CA 4C0KA 5FOTA 4NZYA 4YXWA 1Q57A 2GF0A 4H1UA 1NBMA 2J5XA 3LWNA 4MA4A 4AG5A 1XX6A 1EGAA 2ZROA 2FGKA 1E4VA 2PCJA 2EYQA 4M21A 2NPFA 3C41J 1XEWY 3AKEA 3KQNA 1AKYA 2BBWA 2DFTA 2ZSDA 3P32A 4Q1FA 3R9XA 2ZPTX 1MO5A 5KYKA 3GD7A 4QRHA 1FUUA 4BEJA 4LC0A 4A6XA 4M0LA 1Z0FA 3ONWA 2NGRA 3EPKA 4TMXA 1DAIA 2YKGA 1H8ED 1B0UA 1XP8A 3CZPA 3QNUA 5TB5A 3VR5A 3CR7A 2V7QD 5IK2A 2FJUA 3VR2A 2QL6A 1U99A 4YQFA 2NO6A 1ODFA 4WXRA 2JLZA 4DDVA 1Z8FA 3QKUA 1X8KA 3ADDA 3K0CC 5FI0B 2MSEB 5J4YA 2AN9A 2FFBA 1NMZA 2KB0A 2WTUA 3BFKA 1U0JA 4KAXA 1KMHB 4IDQA 1IONA 1PJRA 3GJ7A 4Q1BA 3X1DA 5GADl 4A92A 1JR3A 2R62A 3TSOA 1F6BA 4HAUA 3CKLA 2R9VA 2VHUA 3P4XA 5JCZA 1N6IA 2EVWX 4LPSA 2WHXA 3LXRA 2X2EA 3BK7A 3IIMA 4O0MA 5FL7A 2GETA 3RC8A 3VMFA 2ZRBA 1Z47A 2GEUA 2FN4A 4I1VA 1KK1A 5AJZA 2VHQA 4AKGA 3TK1A 3GFTA 1QBKC 3GLFE 4TL8A 5L8VA 1XZPA 2C99A 1RJ9B 4Z54A 3M4YA 1JR3D 1ZCBA 2IC5A 2PJRA 4HI0E 2OAP1 1IN4A 2WAYA 2ZI5A 3H1TA 5H68A 3F0TA 4UJ5A 4DHEA 3TAUA 4P4SB 4BLQA 2G0NA 1J70A 4DLYA 1N5LA 2QBYB 1XD8A 3AF0A 1LS1A 1XEXA 3CRRA 1XCMA 1TF2A 1UKYA 1ANKA 4LHWA 2H1LA 2X77A 2SHKA 1KDTA 1WMSA 3UMSA 3HWSA 2IUSA 2J0SA 1KK2A 4TL7A 3MWJA 4JBXA 2HCJB 5DISB 4KFRA 2BOVA 1D6JA 1IY2A 3KQUA 4FD2A 4LJ4A 3Q85A 1JALA 4WW0A 2JAQA 5JHGB 1H8EA 2QRZA 3T1TA 1MABB 5KSYA 4IVQA 4QG7A 4KV9A 2EFGA 2RH5A 1Q1EA 1OT3A 5CK4A 1T8TA 4Q7KA 5SZJA 4BE7B 2RGAA 1KMQA 1JQLB 1XPRA 1XTKA 2RGBA 2W2TA 3AP2A 3Q7QA 2VF8A 3DMNA 2NG1A 2QP4A 4V0MA 5F98A 4IXNA 2Q3MA 4CEIB 4TMVA 4C7OB 5K8TA 1TAGA 1XB2A 5AJXA 3SJAA 4TLDA 2ORWA 5KNDA 1WBBA 3WRXC 4P31A 2REOA 1RC8A 1TQDA 1X8JA 1LNZA 4YMTA 1IHUA 1AIPA 2GA8A 2PZFA 2R44A 2VHTA 4BGDA 2YWEA 3VHLB 3THXA 5H70A 1OHHA 3LDAA 2ZSAA 2AK3A 3LVQE 4HZUA 4JT4A 4D2IA 4DRZA 1OW3B 2Z4RA 3SZRA 1EXMA 4HYYA 2N42A 2MSCB 3TVTA 1OH6A 1RRGA 4IFBA 4DSOA 1Z0AA 1E79A 4A2WA 5BYKA 5CYPA 3EIQA 3C15C 3VAAA 4DLUA 2VF7A 2JDIA 4YMVA 4MGKR 4TYQA 4D26A 2VP5A 1F2TA 2CL7X 3BB1A 4PSKA 2CE7A 2JLVA 2KBFA 2QT0A 3GFPA 2IXFA 3GLIA 3LX5A 2WPDD 1W36B 3CX7A 2GXAA 4CVNA 5FPKA 4IOJA 2GVDC 3EW9A 3IQWA 3L8ZA 3CPEA 1FFHA 2FF7A 2J0UA 2IYUA 1US8A 1R0YA 2Z43A 3IPXA 3IPYA 2F7SA 5HZHA 3ZJYA 4J0QA 3HYTA 2P65A 2ZR7A 3NDBB 4TL6A 4LHVA 1UEJA 3K0FA 1NLZA 2YWHA 1Z6XA 3SI7A 1OH7A 1QHGA 3I8SA 1XBTA 5F9HA 3W34A 3VKGA 3GPLA 5CITA 1XF9A 3QENA 3I72A 4LI0A 3CNNA 2ODNA 4LJ7A 3QKTA 1YKSA 2GJAA 2OFXA 1YE8A 2C96A 1KSFX 2BHRA 3UMRA 4HLDA 3K0CA 3CR8A 2PLRA 4V0ME 4PC2A 1ZP6A 1E2EA 2F55A 2IYQA 3U6KA 1E2FA 2W6JD 3W8RA 1FPMA 1C9KA 2REXB 2F43A 4TMWA 1MR3F 1RVDA 2IS6A 1G7CA 2J7KA 4JKIA 1GKIA 4A6PA 3A37A 2CVHA 3DVLA 1XWIA 3TW8B 2PL3A 2VBCA 1G8YA 1WE2A 4NYIR 2OSBA 3V9PA 1SVSA 3FHOA 2CNWD 2CMKA 1M8PA 3AF1A 3NBZC 1Z2AA 2H18A 3LW7A 3IEUA 1GG2A 2P6NA 2CDNA 5LPNA 3B1WA 3SQXA 1BO6A 3TUIC 3ETLA 1ZYUA 5LB4A 1RKBA 2QMEA 3KB1A 3GJXC 4OKSA 2ZI6A 2GBLA 2R6FA 4Q4HA 1NN3A 4IJMA 4Q9JA 1U98A 5EQTA 5FPYA 3HU2A 1G16A 2W83A 3KTAB 4RD3A 4DC9A 4GDFA 2IXGA 3LD9A 3GJ8A 1SXJA 2QT1A 4Q1EA 4D6PA 4BLPA 3CRMA 2WKPA 4GT1A 2F1HA 4DVGA 721PA 1XTRA 3C4JA 4BPBA 1ZNWA 1HUQA 2QTHA 3FFAA 4ZKDA 3DMDA 5AUNB 2RGCA 4WIAA 4B47A 4HDCA 3VHXA 4MRNA 3FHTA 2BMJA 3T5GA 1VG0B 4K8OA 5HCIA 2G88A 3IO5A 3OIUA 4OHYA 4FN5A 5EP2A 1IBRA 4C30A 2VLIA 1L4YA 4MRVA 1KI9A 1OIVA 2GZAA 2ZQ5A 3C5CA 3MGCA 3U44A 3B1ZA 3H84A 2HXSA 1KI6A 5IT5A 1GILA 3JZAA 1YRAA 4TL9A 3MAAC 4DLTA 1G6HA 2B21A 1E94E 3ZS8A 4QOSA 1GP2A 2JJ8A 3RS7A 3SR0A 4RD4A 3EX7C 3QF4A 2AL7A 2ZRJA 1Z2CA 3KKQA 1H8HA 3LBHA 3LRPA 3QG5A 4PHHA 1N0WA 5CK5A 4QHTA 1K5DA 3SJZA 5HKKD 3SC3A 1H8HD 1M7HA 4NDZA 1R10A 4Q4JA 2A9KA 5CJPA 1KO5A 4TWZA 2V1XA 2D7DA 3RRZA 2P6RA 2VYFA 5EE0A 1DVRA 2C04A 1F60A 1R5NA 3RAPR 1RIFA 3KJEA 1G3IA 2ZYWX 4NCJA 4XIGS 3U3OA 1VCOA 1FOEB 5GJWC 4ITRC 4BASA 1F2UB 1T0JB 3PG5A 2CLDX 2Z6VA 3CO5A 3LQQA 4FW9A 1G3MA 4JLNA 4RCYA 1ZINA 1W7AA 2F1JA 2FMXA 4BRUA 2ZRKA 3IGFA 2WVJA 1WQ1R 4KVAA 5J4HA 2VP6A 3SE0A 2PH1A 3KFVA 4ILEA 3RRMA 4EFNA 4M1WA 5K8IA 4XTCS 3RHFA 4YMUA 1A4RA 3W5JA 4Q4HB 2YHSA 3QXXA 4R2IA 3U4QB 2ZYTX 3RNLA 1GITA 1GM5A 5EZ5A 5EP3A 1TTTA 3ZQJA 1SXJD 4DUGA 3CONA 5JRJA 1NVWQ 2HT6A 5JI2E 3HR7A 3SU8A 3OIVA 1T4GA 2XXAB 1CJKC 4O3MA 4R71A 1ZVQA 1AZTA 2P0EA 2MMCA 2GJ8A 2ZI3A 1V5WA 2H92A 4Q4JB 1EX7A 5ANRB 3WBKA 4AIIA 3A4NA 3SHWA 2VP9A 2QPAA 1GUAA 5KU1A 2OLKA 4JSYA 3RYTC 1VIYA 1KY2A 2DFNA 1CJUC 1XFAA 4MRRA 3AVTA 2P5TB 1OH8A 2KJQA 4LX0A 3RS3A 2NTYC 5AUOB 2A5DA 4TQUS 2QMHA 4GRAA 4MKFA 1BOFA 2JIZA 5JEEA 3THYB 1IJFA 3UIEA 4YDHB 2XSZA 2XAUA 1TQ2A 3KUDA 2IL1A 1JB1A 3H4MA 4RZ2A 3CB4A 2JLRA 4HUQB 2RHMA 2F3TA 3MWYW 4B33A 2JLWA 4GOKA 4MUBA 5TXGA 4NE2A 1G20E 4BFZA 1KOFA 2H5EA 2ONKA 2W6JA 1KK0A 1TF7A 5EJEA 1ZUHA 2WWGA 1DBSA 4C0JA 1E2NA 5FTKA 2FPMA 1XJQA 1JPNA 2CK3A 2BMDA 2DR3A 2FZLA 2V4ZA 4A0RA 1Z06A 2WICA 4ON9A 5BYJA 1HV8A 1FP6A 1SVMA 3KB2A 3N70A 4TLAA 4M4SA 4KODA 3C5HA 1ONBA 3OHMA 3PUYA 3SYNA 2B8WA 2EFDB 1TMKA 2ZE8A 4WVFA 2YJTD 1UBEA 2JLSA 2AWNA 1PZNA 1NRJB 1UF9A 1ZD9A 5FPHA 1IM2A 3EASA 1VG9B 1YR7A 4JJZA 1W5SA 1VCMA 4LJ5A 4U5XA 3FYHA 5B58C 3B7GA 2BKUA 4U02A 1A82A 1Z6TA 2GK7A 2IWRA 2ONJA 3R7WA 3QXSA 2K5UA 1W4RA 3E70C 1CJMA 4CDGA 3LNCA 3WMEA 3T1OA 1QVAA 2JDID 1U90A 3L8YA 1S1MA 2IHBA 5DI3B 4MRPA 1DTSA 4M9XA 3W9YA 3RLFA 1RYFA 3UANA 3WP1B 1ZM9A 3QI2A 1C1YA 1TUIA 2JA1A 5JMTA 2QM8A 5EXXA 1HT1E 1RPZA 3VR1A 1AA9A 1X8LA 1AK2A 4LV8B 2OBMA 2FG5A 1E2PA 4A8JA 1YQTA 2GESA 4KSBA 2QMOA 4QBIA 3I62A 1AKEA 3AB3A 3QVVA 1T5IA 2RGEA 4PHTA 1KKLA 2Z0MA 1Z29A 5KSOA 2PT7A 3HYRA 3PXGA 3BERA 3WYAA 1KYIA 2AK2A 4WZ6A 5AJVB 1DAMA 4A0HA 1P3JA 5KSZA 4TZ6A 2Q3FA 1DAKA 4CEHA 2V9PA 1DELA 1VYVA 2KI5A 3A4LA 3R7WB 5FBQB 3AF3A 4WXPA 5HR5A 5EUMA 3H2YA 4BFVA 3K0SA 2Z83A 1YZNA 3FVQA 1D9ZA 4B76A 2YWFA 3PEWA 1J99A 2QPTA 1F2UA 1NL3A 4I99A 3MJRA 4P4UA 3VFDA 1LS6A 1Z6AA 4S35A 4WBSA 1E0JA 4C0HA 4JVSB 4P4SA 4FMBB 2YOFA 1G3QA 2DWQA 1RRFA 3O8DA 1U8YA 1E9CA 5E7IA 4RKEA 4LC1A 4QJ3A 5LB2A 4D4KA 1UBFA 2B8TA 4IDOA 5J4KA 2ZUBA 2C9OA 3RS0A 2QN6A 3BOSA 4OK3A 1CBUA 3Q8XB 4Z1MD 1DEKA 1E4YA 4UNSA 2J0QA 2F3RA 3PVSA 1XEXB 2FE4A 3AVOA 3AVPA 1VDZA 3NIBA 1E9RA 2JCSA 4I1UA 3TQFA 4LGMA 1DADA 1KKMA 1CR1A 1FQKA 5G3ZA 4QJ5A 5SZHB 1ZW6A 3O47A 1HQYE 1KDOA 1SVWA 2FFAA 2ORIA 2HXYA 4A0GA 1QF9A 1LF0A 2ANBA 1ZBDA 2PEZA 2HDNB 4FI3C 4Q1AA 4PPFA 3FMOB 4LDJA 5AUQA 2B7CA 2ECKA 2ZYUX 1NNEA 4D25A 2ODEA 3KXKA 3DOEA 2CXXA 2GK6A 3THOA 5AJWA 5P21A 5C46F 2J59A 1KIMA 4JLBA 4NCIA 3IBGA 4AKHA 1WDTA 1GWNA 1BYIA 1R5BA 1JAIA 2BBTA 3U60B 2ZM5A 3P27A 5KPDA 1E9EA 1CU1A 2GVZC 3HP1A 1R2QA 4KITB 5LDDC 1KSGA 2NMVA 4XVQA 3OIYA 1W0JD 2VRWA 2EFHB 3TSWA 4PAQA 3LVRE 3NHBA 5KDLA 4PQYA 4BFYA 1AM4D 4LUCA 4XD7D 5JZVA 1SKQA 2I3BA 1KDPA 4EQ6A 4M9QA 5IK2D 3AP1A 1YR8A 1I4LD 3V4FA 2R6CA 2XNDA 4DIEA 1W36C 3ZIAD 3SFZA 4PTLA 1XPUA 3TQCA 2W58A 1DG1G 4PR0A 4ZI3A 1PVOA 4JLVA 4KLZA 3QPUA 1ZU5A 3QXJA 5D3MB 5JHHB 2VTKA 2E1RA 3OAAD 3SEAA 1E2IA 2DCUA 2BWJA 5KDDA 2UKDA 3QJYA 5FTJA 3SYLA 1CJTC 2WOOA 4IOKA 4A15A 5AR1A 3ND9A 1P62B 1JR6A 4X8MA 3E2IA 3B78A 2EWVA 5GJCA 2FDCA 4URZR 5IHPA 3CLVA 3BWDD 3I32A 4P4TA 5JBQA 2OHFA 4LJYA 1D2NA 4BFSA 1RW4A 1HEIA 4N1AA 3QY0A 4TLEA 1HYQA 1A7JA 3CPHA 3J81k 1V43A 4V0LA 3D7MA 1OXXK 1CR0A 2ODWA 2QSZA 4QBGB 2WJHA 2ZJBA 1JAHA 3CUEF 3R8CA 3TUJC 2DBYA 2ZUDA 1W2HA 4MUAA 2DHRA 4L15A 5E95A 2J0VA 5JFGA 2IYRA 4QFMA 4TYWA 4IOMA 2XXAA 5JECA 1G7SA 1Y3AA 1IN6A 3I3SR 3RC3A 2CHVA 1W36D 3CBQA 3ICEA 4M22A 4JL5A 2B92A 4GP6A 2AD1A 2ZTSA 3A6PC 4A2QA 1KHTA 4Q7MB 4MGYR 4CIDA 5KSPA 2YOGA 4CEHB 4XD7A 2VHJA 3CZQA 5F2EA 5L3SB 1E9SA 2ZRGA 2IHYA 1MO6A 1WXQA 3PUWA 1NSFA 4C2TA 3AP3A 5B64A 4TTRA 1OXTA 1E2DA 2AXPA 1TNDA 1T3SA 3FMPB 2CVFA 2QRNA 4FIDA 1XTQA 4F93B 2IYVA 1BYUA 4X8HA 4W7SA 3GLGB 4JLOA 2F9LA 4MKIA 4C0SA 1E0AA 4KBGA 3LV8A 1M1YE 3BBPA 1U0HC 2IK8A 3THWB 3EPJA 4Z8XA 3F8TA 4V0NA 3R9IA 3RRNA 3SDZA 1KSJA 1R0XA 4RD2A 2OCBA 5FBWB 4CGZA 4D4JA 4FMDB 2ZRPA 3UMFA 4ZDJA 1XEFA 4ASUA 1E1RA 2IS4A 5LD2B 5D3QA 2QZ4A 3QKRB 6Q21A 1ZD8A 1MRSA 3CPJB 4JVLA 4PHGA 4EJSA 1GOTA 2IYSA 4CF7A 1KI7A 1HTWA 2WSSA 3PITA 2YWGA 3WNDA 4A1FA 3AM1A 1T0HB 3MCAA 1FNMA 2EQBA 1KY3A 3JZMA 2O8BB 1SXJC 2BC9A 2RCNA 2ZRMA 5J5CA 2WMOB 4UJ3A 2P67A 2IWHA 1GRNA 1U2RA 1W4AA 4AG6A 3BE4A 4MGIR 2FOLA 4WZBE 2A7QA 4DT1B 1GNQA 3GCGA 3PIRA 2D74A 3N2EA 3D8BA 1R6BX 1UBGA 3A4MA 3KKNA 4XSGA 3GLIB 2HLDA 2O8BA 2KBEA 4D4LA 2RKOA 2ZR9A 2JJ1D 3TVDA 3KL4A 4LJ6A 5GVSA 1G21E 5BN4A 3V00A 1US8B 3NC0C 4JLDA 1W46A 5BN3A 3MG9A 4QM6A 2ZRAA 1D5CA 3WNCA 4W5HA 5KO2A 3K8YA 2R6GA 2MMGA 2XZOA 3KTAA 3KQKA 3OFNA 3WYFA 2QAJA 4ZCMA 1FMJA 1S3SA 4OQLA 5CIQA 2PCLA 5E4FA 3S1AB 1CP2A 2WAXA 2XOKD 5AWFC 3L0OA 3ADCA 3KQLA 3B1VA 3VKHA 2J45A 2JATA 3B82A 2Q21A 4U00A 4Q18A 4US2R 5FOVA 2PZGA 3DM5A 3MMPA 1U81A 4LWZA 4MYTA 2WKQA 2NIPA 1EFCA 1IQPA 2EYUA 3I8XA 2F43B 3Q3JB 3JVVA 3IHLA 5KNCA 1N6KA 3OFND 5DYIA 3PCRB 4GZMA 1ESNA 3FHCB 1E2GA 5LBIA 4H1VA 1FP7A 3U4QA 2I4IA 4P0TA 1TUEA 1WCV1 1GNRA 4GMDA 4D80A 3TUZC 3UKDA 4OQXA 2OT3B 3KKOA 4LZZA 3D6TB 5DE3A 3TBKA 5FR2A 1FNNA 4BECA 1VECA 2GNOA 1UPTA 3U7FB 1E2MA 1ZC3A 5FTLA 4KFTA 2YOHA 4M1TA 4PPGA 3VX4A 3BRWD 2R2AA 3SBDA 2J87A 4Q9LA 1VMAA 4EIWA 2AR7A 1S2MA 4M1YA 4RCZA 1G6OA 1II8B 4OHVA 4AKEA 5KHOC 4DT1A 2WSSD 3G82C 5L3QA 1X6VA 4DCTA 1D2EA 2OE2A 5FPTA 3L43A 5GJBA 4PSAA 4B74A 1G3RA 2ZJ2A 2VHCA 1E1RD 1L4UA 4EAQA 4B3XA 3B1YA 1UM8A 2DFKB 3FPAA 4URWR 4OJKA 1QHSA 3PQCA 1SXJE 2ZREA 4X8LA 4ZCLA 2XB2A 5FL7D 3NG1A 3QKRA 3RABA 2QTFA 1XMJA 4HAWA 2CJWB 5K8LA 1AGRA 4QJ4A 1G4UR 1EX6A 1LVGA 4RKFA 5DN6D 3S1AA 2V54A 3BFVA 2FZ4A 1P9NA 4PO8A 3BH7A 3AKYA 4ZDKA 4GL2A 2W0MA 3ZYCA 4ARZB 2IYXA 1T3LA 2A5JA 2C8VA 2FSHA 4B2IA 2ZS8A 2WV9A 3Q7PA 1UKEA 1O3YA 1KI1A 2Q6TA 3BH0A 3DOFA 4G01B 2QAGC 3CX6A 4UXJA 4FXPA 4XTRA 1J8YF 4Q66C 5JRZA 2QE7D 1IAQA 3U61B 1EWRA 1KJYA 2A30A 1Q12A 4NCKA 4Q5IA 5JS8A 3LX8A 4NMMA 3ZGXA 3PJRA 1CRPA 3EA0A 1VHLA 3QBTA 5FBLB 1NKTA 5FOSA 3UK6A 4NCNA 2A2ZA 1N5KA 3RRYA 4QXAA 1HT2E 1F48A 1QHYA 1ZU4A 4KYIB 4DUGD 3U5ZB 1E32A 1EWQA 3OEHD 2XNSA 1SGWA 4DLVA 1AQYA 1OFHA 2AKAB 4KI0A 3H86A 4B3GA 5DIFA 2F1IA 1E1QD 3KQHA 1OE0A 2O8EB 2ZYVX 4L16A 2A5FA 3VTKA 1LFDB 5EP4A 4PC7A 1ZM2A 1HE1C 1IY0A 2PJZA 1Z6YA 2VL7A 2V55B 5JEDA 4RFVA 2QGNA 5HE8A 8OHMA 2IA5A 5K8UA 2J41A 4JKYA 2ZJ8A 4LYJA 1JEEA 4M2LA 1W5TA 1U94A 1ZM7A 2OEPA 3QOFA 2NZJA 1LB1B 4FCWA 3PEYA 4DDUA 4OQFA 2WJGA 3NEYA 1EESA 1VYUA 4KCGA 4TMTA 4ZV4A 1NMXA 1Z0KA 2GXSA 4OHZA 2J7PD 5HKKA 1NY5A 1G9XA 3REGA 4OBEA 1CRQA 1XCGB 3GJ5A 1Q44A 4QHSA 3UWKA 4ZKEA 1I4TD 4V0OA 1QHHB 3TMKA 1JECA 2JJ2A 2G1KA 2JLQA 1P2TA 3HU3A 3QEOA 3T15A 3SQWA 4LY6A 2R6AA 2X1VA 2QAGA 5DGXA 5DI3A 2XNDD 4TMKA 4TQ9A 2WWFA 2XTMA 1XTJA 1SZPA 4NYMR 5EE1A 3GLIE 3DEFA 2O8DA 4K81B 2BJVA 1PLJA 3AGQA 1NVVQ 4B2LA 2FV8A 1E9BA 1R8QA 4PSVA 4XOIA 3GLHE 3QEJA 1MV5A 2BBSA 2NO0A 2GCNA 3SS8A 2O8FB 2GCOA 3M0EA 1W0JA 4F4IA 2HUPA 1XEWX 4PANA 4NU0A 2FGJA 3MWLA 3B1XA 1UBCA 4JMPA 2H8KA 3D31A 1GVNB 4L9WA 1JQJC 5J4VA 1N6PA 3C7KA 2AX4A 3HJNA 1BKDR 3T12A 2VO1A 4GMXA 3I61A 1G8GA 1M34E 1COWD 2ZI4A 3K0EA 5FUVA 2OG2A 1G7TA 3T61A 4W5WA 1IOZA 1P2VA 1FX0B 2WWWA 4LHZA 2BBOA 5FI1B 421PA 4LK2A 2CBZA 1OFIA 3NXSA 4LBVA 1N6RA 1Q1ZA 1R4AA 2FSFA 4ZCIA 1XD2A 1W4BA 3GJ3A 2CNWA 5FOXA 3U7EB 3Q9LA 3EZ6A 2ZJAA 4OL0A 1Z0IA 2A3RA 1UKZA 3KJGA 4URYR 4UXHA 4Z1MA 3OIWA 2H17A 4HAZA 2F1RA 4Q21A 4KHZA 4EUNA 5KUTA 4A36A 3R9WA 2VPPA 2C9YA 3NKVA 3ZVRA 2HYIC 3IEVA 5BN5A 2GAAA 4E22A 3THXB 2ZE5A 5EXSA 2PZEA 1OLOA 1Z6GA 2XTZA 2DYKA 4RD0A 4HLQB 1DO2A 4PZLA 1BMFD 1DS6A 1NY6A 3IQXA 4IFEA 4Q1CA 5CLLA 4B44A 2OV2A 3CM0A 3GLFB 1XJ0A 4CRWB 3RSOA 2CEAA 4YONB 2KWIA 1ZD1A 4Y0AA
chains in the Genus database with same CATH superfamily
2ATXA 1JXOA 3O94A 3MCZA 5CLJA 3KHSA 3EAGA 3AG6A 3C3WA 3NAGA 2ZBQA 3A1WA 3A1DA 3VAZA 2P9EA 3X1WA 5TMPA 3QMWA 3CF2A 4WNAB 2IELA 2Q46A 3QHPA 4PVDA 3UJ3X 1B2LA 2JFYA 3U4CA 1IXSB 1TYCA 4G85A 1N6NA 3W1EA 3LCRA 3E1KA 4UPVA 4GOXA 4WFKA 3IO3A 3WQRA 4BRSA 4E5MA 3GG2A 1NA5A 2RHWA 1I10A 3IQHX 1LJ8A 4M86A 1P4GA 3PGMA 5JT1A 1YGYA 3ZD6A 3B5EA 3IEMA 1P7CA 3HUUA 2W2OA 1Z88A 4UBKA 3V4RA 2X86A 5IC4A 5ENDA 1PX0A 1T2UA 4MWSA 1TK3A 4MP6A 4R1LA 3VGPA 1J1ZA 3EFBA 4FNMA 2VWHA 5BWCA 3GH3A 1FNDA 3L40A 4IJ6A 4MUFA 5IM4F 2A33A 2IIVA 4EY6A 2JGNA 3FF1A 1CWUA 2JW5A 2BFPA 3ZX5A 1M34B 3DKPA 4GGOA 4KXVA 1REQA 3OBIA 5BSTA 1MHTA 1HQKA 2C78A 1RIIA 3TDKA 3U3MA 3WGVA 3O2JA 4HPXB 3VI3B 4WJLA 2I9KA 4UMFA 4XASA 5CR9A 3TH5A 2QJRA 3BE8A 2F6RA 4DSTA 3SE7A 4LWOA 1EM8B 4GQBA 4QFBA 4G5GA 2XUPA 2Q6KA 3PA8A 1I6MA 2BTEA 4EFDA 4O29A 5CXSA 3AJAA 1A4IA 3IAM6 1NN0A 3TPZA 4DM4A 5GM1A 1AQJA 4BFXA 1SUWA 1Z35A 2Q6VA 3UAGA 4B71A 1W9MA 2HU7A 1JJAA 1QDLB 4LOKA 3OJOA 1OI4A 5JW6A 2AUTA 5JCOC 5T3UA 3HB1A 3AOEA 2GPNA 2JI7A 3MT7A 1NUPA 2GLXA 2MSKA 3KV3O 5A6SB 4F6CA 4HNAB 3ZLTA 3O0DA 3TTUA 3FYUC 2D6FA 1ZGCA 2YV5A 4TN1A 5HKLA 1ECBA 4RTNA 1FDRA 1T9GS 2RGXA 2UDPA 3N7TA 4KBFA 1YFZA 2Z5VA 3OM8A 2AHOA 1IN8A 1H2WA 2ZTMA 4MYRA 1UCFA 3ZEIA 5BW8A 4JBWA 4RD1A 3CG4A 3FKQA 1UWCA 3K9BA 4O5AA 4CV0A 5BURA 1DUIA 1SHUX 4XVCA 1T1IA 3HYCA 1DAEA 2VP4A 3PXUA 1W2GA 4OHWA 4Y1GA 1R4NA 5A1JA 1USGA 2QORA 2PWPA 3EFEA 5ADWA 1TD9A 2C4HA 1GTVA 3SGLA 3SQDA 5DH9A 1BA3A 4X92A 1TQHA 1M7GA 2DBRA 2CKDA 2WB4A 1A69A 1M7BA 3OSUA 1BMFA 3DV0B 2QUIA 2J0UB 5ALZA 3K9GA 2AFHE 3VR6H 4EJSB 5JSQA 3NT4A 6REQB 3KUCA 1EUQA 1SQGA 2R6ZA 3K9QO 3V4OA 2CHFA 1AQLA 3GT0A 4MR9A 5HMLA 2JFOA 3LJKA 3DE0X 4FHEA 1QYCA 1R3DA 1S6YA 1S8NA 2C3PA 3QX9A 3K70B 5BUZA 3K3PA 4KE7A 3UC9A 3HBLA 2G83A 1UK9A 1EIZA 1Y7HA 3I64A 4MI9A 1PNTA 4BJ3A 3U9TA 4JBHA 3HU5A 2XYQA 2GD0A 3U16A 2J8ZA 1OB2A 4H31A 4PX3A 2RGNA 3UPDA 3M2TA 3VPDA 5LP6A 4Q03A 2UZ4A 4CW7A 3ZWOA 3AEYA 1L5YA 3GARA 1TYZA 5FUBA 2YUTA 1L5WA 2C88A 4RVHA 3RK0A 4F9GA 5TVKA 4KREA 1P0IA 3IBFA 3NBXX 4EOGA 5A5GA 1CDEA 1VSBA 2IYZA 4J2TA 4TKVB 1UJ2A 2VIIA 4UC0A 4XUEA 2WWVD 3AVUA 4NCHA 5KTMA 3WHLA 1E20A 3DDZX 4QGHA 3UPTA 4ZCPA 5FD8A 1HL7A 1OGYA 4BQSA 2XNCA 4MVJE 2DY1A 1U9ZA 4CG3A 1E92A 4UULA 4EI7A 3B3QA 2NTVA 1C4WA 1G64A 1Y1LA 3CXUA 3I2KA 4KN6A 621PA 1GNSA 3DG9A 3QG1A 4U3JA 4A82A 3C3DA 1WY5A 1NU6A 1BDBA 4KG7A 4PX5A 3ACBA 2WT8A 4UTOA 4XWAA 4ZEWA 1GZ3A 1VGVA 4ZCTA 1KRXA 5JQGF 4JB8A 3WK9A 4ENTA 4QQRA 1V37A 4GGPA 3DPIA 1H4TA 5AHKA 5B3JC 5CNKA 3Q72A 2N1MA 3HUTA 4EG7A 4EX7A 5B36A 2QXYA 3SHVA 5CLFA 3F8SA 2GBPA 4WLFA 1G1MA 3SQOA 4UOQA 4YJ3B 2P8SA 4PNZA 2C2WA 1YO6A 3CVJA 3AO0B 1EUZA 4ZVPA 1TJ4A 1WBJB 1JSLA 3RVBA 3E58A 5A0TA 1QONA 2NU6A 1N6OA 1PSZA 4KOEC 3VO1A 1TECE 2D1QA 2J1LA 3IAS6 1NJFA 4BLOA 2O2JA 4EA7A 1YA8A 4D0RA 1RRCA 1CVRA 1P6UA 1R0WA 1T8WA 2C0QA 2JJ2D 2O2ZA 3UWOA 3F9RA 2FSIA 3D3NA 3D5TA 2NUTA 4FMCB 5J2TB 3MS4A 1W5EA 2HK9A 2PZ8A 4MUXA 1A5TA 3EPPA 4FGKA 2G6BA 1X42A 1GPWB 1SM4A 3SIRA 5KNBD 4MW7A 4YQYA 5E1BA 1ENOA 3GQBA 1I7QB 4FYKA 1RQGA 5C7OO 5C32A 3REOA 3HLKA 3JASB 3O3MB 1JNYA 2VATA 1N9ZA 1YJ8A 2N1BA 3FPBA 2QDKA 3IDSA 1C7EA 3OE7A 4RVCA 1H93A 2PMCA 3ODGA 3OEED 3LNTA 4Y1FA 2VK4A 4YP6A 2A5YB 3RBVA 2DFVA 1CT9A 1VE3A 4Q4AB 5C4GB 1ETUA 1F9AA 2CMFA 5UKDA 1QTIA 3HYNA 4FZ5A 4HTAA 2IH4A 1YK1A 3WAJA 2ZRHA 2IV7A 3U0BA 4ZU3A 2JLAA 3ZZTA 2RGYA 3CUWA 3GJZA 2QVXX 4FFBA 4GR9A 4UBIA 4F4CA 2I6XA 4J0FA 4B0OA 2AEJA 1N2IA 1Y82A 2XWBF 3OT5A 4W1SA 2OORA 1UMCA 2PA3A 2ZUCA 3KKEA 4EO9A 2DQKA 4ZARA 4LYYA 3QEKA 3HY4A 3ZBUA 1OLUA 5AI9A 5G02A 1C8BA 5IAJA 3UJNA 1GUFA 3CZ9A 3TW0A 3IIKA 2D00A 1ORHA 2NTJA 3G8DA 4FX5A 2WAAA 1A5BB 1T8SA 4FBGA 4LJ9A 3VV3A 4ALIA 1N32B 4LOIA 2DWOA 2A92A 2HSZA 1G19A 3HVIA 3CZ5A 3BGOS 2BDEA 2BCGY 2WJWA 4RHEA 2OHGA 5KWEA 3P0FA 5CG1A 1KP9A 4R2JA 4F38A 4MDFA 1OV4A 3WYBA 3WRWA 4IDHA 3IB6A 2C2XA 1MC5A 5K0TA 4HV4A 1R1DA 2AJ8A 1SB8A 1YS1X 2NP7A 4Q4CA 3LM8A 4D56A 4DQ0A 2ZVQX 5IZCA 3HU1A 821PA 2QE7A 1N7IA 3JS5A 2XTNA 1T2AA 4IHJB 1Y80A 1Y1KE 3CGWA 4ITVA 4MMYB 4D43A 2WTNA 4Y2UA 2JCYA 2JFPA 3VVBA 5CB0A 2Z5FA 1CQXA 2OV1A 2Q7XA 1NMSA 3SF8A 3L92A 4JX8A 3A1NA 3NHSA 1CVIA 1Z3IX 2WWXA 1V4NA 2H07A 3FNEA 5K7SA 5KYYA 1VMDA 2R4UA 2RHTA 3LL4A 6YASA 4Z4FA 4OH7A 4R2LA 4R8KA 1HNZB 4PLGA 3CRW1 3H16A 2C5GA 1N5IA 4IX1A 3PWTA 5ENZA 4MMXB 2VUSA 1XHFA 2E9SA 1IHYA 1DQSA 2D3WA 4JR2A 3GGPA 2OVBA 1NTRA 1HLDA 3P9CA 4IDBA 1BVYF 3IMFA 5HF6A 2O0KA 5T67A 1G17A 3FOEC 2P8JA 1F0PA 3N2GA 1A9YA 3CLUC 5JJKA 2DPLA 3WBFA 1QK5A 5BW4A 1TZCA 1PG2A 1OKKD 1E8MA 1KO4A 1JU4A 4JLUA 5K6AA 3EIFA 3IUSA 1EFRA 2PMBA 4MS4A 5DRTA 3VDRA 1Z4IA 2H2DA 4LZJA 1HF3A 1OWNA 3OJLA 1VJ0A 5G4LA 1EE9A 1ZUIA 3RC7A 3U3XA 4BE4A 1NXWA 1Z16A 3W8FA 2Y05A 3UH0A 2AN4A 2Z8YM 2WJVA 5ILOA 2VSQA 1DCMA 2CL6X 2DE0X 2G28A 3B51X 3HDTA 2WG1A 2AE2A 2IBMA 3I9MA 4EG4A 4LIPD 1NVVR 2CUNA 2YN0A 4L6IA 3G17A 4C4TA 5BT8A 1N34B 1RM0A 3LRXA 2J3MA 3QPVA 3B3AA 4RLQA 2GB4A 1FVFA 3KAPA 1HEUA 3KZOA 3PFBA 4GD3Q 3FFWA 4YJFA 3SX4A 3ZH2A 3I9KA 3QX3A 3WNZA 1ESCA 2FR8C 2XZPA 2XQKA 4KWIA 4HEHA 2C2HA 5C4MA 1TCVA 3PDWA 2G0TA 3NRJA 1HL3A 3ETHA 4K9PA 1EXVA 3VRHA 4OHPA 4E11A 2R7AA 2O9JA 3EZ2A 4RMIA 1KQNA 3H05A 2CHEA 4OM8A 1OV6A 4CM1A 2ANCA 4JJAA 1DKQA 2VH5R 2XTJA 2QVYX 3GMDA 1BU8A 4XB2A 1VJDA 3EUFA 1T8YA 3GNTA 4KXWA 1LSUA 4HPJB 3GAMA 3PD1A 1SCUB 4JIGA 1E3WA 1FRVA 3TE6A 1A8UA 2O2HA 2SECE 4PPNA 3VX3A 1DQYA 4BUJA 3COWA 4ZRMA 1GYRA 3JPWA 2VSYA 4GI2A 4PNHA 4RA6A 1R9JA 3VVLA 4B3BA 1UL1X 2ZSBA 1P61B 2PX3A 2Z5GA 3EZFA 3TL6A 4ARCA 2YWRA 5FFMA 1DPFA 1DX9A 2JAOA 3UOAB 1ZD3A 4LWPA 3QJ5A 3UK1A 2JASA 4K9OA 5KNDD 2WFAA 2XY4A 3NWEA 1W5AA 5JZBA 1A9XA 1KVUA 2ZVDA 5IABA 3HR8A 3OEEA 4AQYB 1V96A 3OE7D 2J3EA 1SZCA 3UHJA 3W5DA 2P3SA 2XEDA 3G0OA 3GJTA 2QU7A 4F5WA 5KNBA 1KR5A 1X7GA 1XKLA 2H31A 3CH5A 3LKVA 1I3CA 2QNBA 4ZCSA 2R48A 1WKBA 3O3NB 1ZHOA 2LKDA 2JJ1A 4HADA 3LQ2A 3QVMA 3G13A 5FF9A 3HA7A 1BZYA 4B73A 4BIIA 4GXNA 2HLDD 2O14A 3OA2A 3WR5A 3IULA 3SOZA 4DLZA 4NOLA 1P73A 2WU1A 1RBZA 3FY4A 5CPBA 5JSUA 1NQOA 1HDXA 4GLJA 4Z3DA 1G8PA 3O5AA 2BFBB 1QCCA 2XCUA 1FYXA 5DMXA 4KGZA 5AXBA 4EJMA 1ENZA 3LGXA 1L8AA 4RMNA 5K03A 2B6NA 1Z38A 2OUKA 3EQ2A 1JTFA 4C5BA 1RYHA 1V25A 1Z8HA 1SKYE 3AY0A 4JFAA 4Z4HA 3GEHA 4HMOA 2BUBA 1KEKA 5K0LA 1GFWA 4ITUA 4GUDA 3WXMA 2O0HA 2QJFA 4Y9DA 5KPJA 4G0VA 3U48A 3WB9A 1B16A 2R68A 4MI1A 4OMDA 5F5LA 1MP0A 2NN3C 2YDXA 4RXMA 1CUBA 5DASA 2WVHA 4NP6A 1HLGA 1FFXB 1M6HA 5BW5A 2INGX 3IXLA 3LK7A 1ORWA 4HVTA 2O8NA 4POAA 1NUHA 4XVUA 1FSPA 4JU8A 4GMFA 4LDZA 2RFLA 3DDNA 4TMZA 4Z7NB 2X6TA 2HA4A 5A4JA 1PK8A 3II6X 3FDXA 4OAOA 2WYUA 3Q6IA 1C0IA 2ZB4A 3O9ZA 4RPHA 4QM7A 2B30A 4M99A 1XZNA 1C9JA 1Y8AA 2BMEA 2ZWMA 4Y2SA 1CX9B 3C7CB 1D3AA 4FN4A 2W37A 3B1KA 4TSFD 4YRFA 1C4OA 4YN3A 3TIFA 1I4DD 1KIAA 2IT1A 1DWQA 1M6EX 2JEOA 3PSHA 2G71A 3R2JA 4NTZA 4Q9AA 4A8TA 4EH1A 4WCFB 1EFDN 5JMOA 4TZTA 3FI0A 3KPJA 2RJNA 4HAVA 1QQBA 3HDYA 1SBHA 4WECA 4AN1A 1GZDA 1VPWA 3BXXA 5IKOA 5IC5A 4D9NA 3KYJB 1FRNA 2PZBA 2R7NA 2WJYA 3OF5A 2IVZA 1B00A 1GKKA 1PGQA 1M5RA 4IIJA 3WG9A 3CGGA 2A9VA 3UG6A 1MNAA 2CFIA 3IP1A 4XEUA 5FBKA 1EWKA 4HYEA 3VPFA 3HJTA 3CVXA 4UUNA 3DEAA 2JLYA 5BMVB 3EGCA 3HPQA 3OZFA 4K87A 1NP6A 1S0UA 4P0PB 3AW9A 1U2ZA 2IHUA 3KXIA 3GNSA 3MUOA 4K6HA 4Q7EA 2ZZNA 1R8YA 4IHAA 4B3CA 1I3OA 4F96A 1NIPA 5GOTA 3LPCA 1E2JA 4XVRA 4CL0A 2I03A 4MUGA 4RQUA 1OXKB 3B6EA 3I73A 3QVWA 3L84A 4F3CA 4BV2A 1W96A 3E9YA 1O95C 1J9EA 2HHCA 3EPLA 2X9LA 3IB3A 2G8LA 1USIA 2EX1A 2OO7A 2QZPA 3QKSB 3W2FA 1ZNZA 3K9LA 4D57A 3VC2A 3IUYA 1FJGB 4M9RA 1RWNA 1L8QA 4RIHA 3KJNA 1N9GA 3FGNA 5AJHA 3TRJA 1MC4A 3LBAA 5K3CA 1PFVA 3EPHA 4YXWD 1DAHA 2AGVA 2I1WA 3A4YA 5AH0A 3RS8A 5T41A 3M3DA 1XEAA 4RH0A 5CFLA 3A2LA 2E4AA 5A4FS 1H5QA 3G9QA 3F5MA 1W9HA 2A9OA 4NHEA 4OHCA 4IDPA 1CYEA 2FVYA 2GHIA 4UHKA 3S27A 4HWSA 5EP1A 1LPAB 1MVOA 1EP9A 2EIHA 3AJDA 5IRCD 4F2GA 4LJLA 2IHKA 3KX2A 2X8AA 2UXCB 5DHFA 2OXCA 3DMRA 4FCTA 4GX0A 1P72A 4FT4A 5IYZF 4JP1A 3LWZA 3G2IA 4C29A 2P3LA 4QJBA 4MH0R 1AURA 3UW1A 4F5ZA 5B2ZA 1NQTA 1Y98A 3KVYA 3U9SA 1FDUA 1N5RA 4A8JC 5IFLA 4IEIA 3Q0TA 3DBHA 4MGZR 2G08A 5AW7A 2PSSA 1JQEA 2QPLA 3GRZA 5IVHA 2JGLA 2ZJYA 4O4JB 3ZWYA 3F1LA 1PX2A 4DB2A 2IS2A 4F60A 2I7DA 2FEMA 3AI3A 3FCSB 1GXSB 2VSXA 3JQGB 1KAOA 4RIFA 5DHPA 3TLMA 3ZDEA 2HSDA 4N0DA 2MOKA 3LW8A 3L02A 2LIVA 1DXQA 1BFKA 2OESA 3N0XA 3PQ5A 1U2DA 2O2SA 1NC1A 3QIAA 3QXCA 1N8SA 4Q19A 5LMNB 4NV3A 1NJSA 1PF7E 3FMFA 3STTA 4PZYA 2QWXA 4I1SA 4CM9A 2YVAA 2YXNA 5KREA 3FLEA 2GZMA 2Q28A 1CQIA 2BF7A 4MPJA 1I6KA 3UJCA 4BX0A 1AA6A 4DR7B 4IZHA 4D4MA 2A67A 3QA9A 4Y1EA 3UK2A 4CN9A 4RUKA 5IDYA 4NABA 1YNOA 3U40A 3BWEA 1QUFA 2IYPA 4J7XA 2XUIA 1CUIA 4UTPA 1FA9A 3GFOA 3P52A 3NHWA 4EQ6B 5AKLA 2FPRA 4QSMA 1Y9DA 1K3TA 5HG0A 4KGXA 1MT0A 3GELA 1PDVA 4JQSA 3B36A 3B2EA 5ISMA 4TYNA 1OJLA 1WSWA 3HKCA 5AVTA 1GKLA 1VKJA 1ZRSA 1YI8A 2P9YA 1H69A 1MJGM 4ZIRA 3N2GB 1HA3A 3EARA 1DFIA 2A0XA 8AT1A 1KNQA 1RJ9A 2WUEA 2QN1A 1U80A 1XAIA 2ZI9A 5HRUA 1WZ2A 3U4AA 2YIMA 1IVNA 1Z4NA 2VQ3A 1Z26A 3GF4A 4LEIA 1L8XA 3WIDA 4CLRB 2Q3DA 3N0VA 4B7AA 2WWIA 5KKNB 1D2MA 1YOBA 2C4KA 3AUFA 4LV6A 1DARA 1JQ5A 1KI6B 1XPJA 3EC2A 3P26A 1N77A 1E58A 1S7GA 2Y3IA 4R1TA 2GD1O 4G4GA 2XIQA 2I8CA 4B3FX 5JH7F 3LBIA 4JSTA 2V6MA 4W9MC 3MJSA 5IKMA 2ZXUA 5EWMB 4REQB 3WK4A 2HMSA 4CODB 4G1EB 1TC1A 1AQNA 5H3LA 5F7OA 5GINE 1IY9A 2JHFA 4WSOA 2R79A 2EKPA 3MVEA 5CURA 1JTEA 4PN7A 3FIUA 5D5HA 2P9GA 2PQ6A 3O82A 3X2SA 3AR2A 3IHWA 2V8OA 2H59A 1MAHA 3H2KA 5JXGA 2I6FA 2XWSA 3RAGA 5AM3A 4N8SA 1T4MA 3CXRA 4R3UC 3DD5A 2AN1A 2JIQA 3GJ0A 1Q2UA 5C1IA 2M6KA 1YRLA 2ORVA 2W22A 5HUHA 2GCOB 3AVWA 4F86A 1NNUA 3T7SA 4YC7A 2EX4A 4HFMA 1JFSA 5BSFA 1U3FA 4YIHA 1SC3A 1H5UA 2P2LA 1B76A 3KE8A 3L0DA 5DTJA 4G56A 4P2BA 3K1JA 4GQIA 3H5LA 4NQRA 3PUJA 1ZOLA 2QX4A 5HUQA 2VHWA 1Z56C 3IQGX 1KJWA 2B2NA 5C18A 3I9LA 4D02A 4F1KA 1SUEA 1VHTA 2BM1A 2PZJA 2E6UX 3H7IA 3K9HA 5EQFA 1DIBA 3KEGA 2ZTVA 1VB3A 2O52A 3HQ4O 3E8SA 2OA0A 4WKPA 4ND8A 1EVLA 1YZLA 1SQ5A 4DCVA 4TLLB 4GR4A 4N5IX 5TQ2B 1JWLA 4XCXA 1HLFA 3Q5DA 3UKOA 2BZ0A 3DHEA 1Z8NA 2B37A 3JAKB 2W6CX 2OGUA 4WY2A 3ESXA 3LUAA 4L73A 1FYFA 1NI4A 4MV0A 1P4SA 3T5DA 4Q02A 1IY1A 5BWOA 1S8AA 5ELXA 2J9YB 1QOPB 3OTIA 4KQ6A 1IWOA 1GTG1 1TEVA 3AR5A 4Q3LA 2JAHA 1JJ7A 4RX1A 1KEEB 4LBYA 1WMDA 4OQNA 1R8XA 2FSGA 3UV6A 3VDQA 4U9HS 8GPBA 1D5WA 2QI9C 1ISJA 3AUYA 1XRRA 1N1DA 2X1LA 3PDCA 2GJ9A 1WSBA 3D8UA 3ZWXA 2UXBB 3UGQA 2VP3A 2XZTA 4LHSA 4IF4A 5JD6A 5U4XA 1K5PA 2BM0A 4ZO4A 1Y1RA 1J00A 2FLWA 5CT9A 1UMDA 3C97A 3V4VB 4CYMA 3E8MA 2HR1A 3PNLA 3UC5A 4R16A 1VKZA 2DLDA 3BA6A 1FYWA 3DMGA 4ZXFA 1KVQA 4GAEA 4IHJA 2A5LA 4WOKA 4ZVKA 5KHAA 1TKBA 2GS9A 3PR1A 5IUJC 1GSAA 1H3EA 3QE9Y 5EY5B 1CLUA 1LV7A 1FLDA 4OQZA 4RVUA 3LHIA 4OA5A 2CB9A 1RQ7A 3ZGLA 3M82A 1UKBA 1N7HA 2DPMA 4N7MA 2KPOA 3QYJA 1TKAA 4D44A 521PA 1C41A 3W0LB 5EJ4A 4QPPA 3V1LA 1CLEA 3FWKA 3RG2A 1PO7A 2FVXA 3T5PA 5IH7A 2VT3A 3GT3A 2WNHA 3ZIUA 1U8FO 4BO7A 3MF4A 3R77A 4ABTA 2CYCA 3FVRA 1W94A 2CFCA 5D87A 5BRNA 4MR8B 3V4SA 4WOJA 5D01A 5JD4A 4S04A 5JZ9A 2ZM6B 3MWFA 4DGSA 2WMNB 5SZIA 1ZMXA 3TJRA 1EUDB 4FP9A 2HBQA 4OHFA 3WLAA 1MX3A 4ND1A 1P9WA 1EEHA 1TQ4A 4GWGA 1XN1A 3EGEA 2IEZA 3IXMA 4Q9DA 3WYDA 4EHDA 2I6SA 4YRTA 4N48A 1XDBA 1B6GA 4C5AA 3FKSA 3ZS9A 4BKQA 2A9JA 1IOLA 2FA9A 1ULBA 4JLPA 4ZXPA 4DSNA 5K05A 2F64A 3M4NA 3EXAA 3F5FA 2BFCA 4PPQA 3W3ZB 5M3BA 2P27A 5JCPA 2ZETA 1E99A 3I6MA 2Q4EA 4FDMA 4PTZA 3ZXUB 3WIVA 4Q82A 2XQVA 5TF0A 4TTPA 1ZM4A 4UBOA 1DDGA 3HXMA 1WSDA 3JWGA 5H83A 4IIHA 4KPFC 1NI4B 1NJ8A 3FLBA 1MRNA 1TTHA 3UO8B 3C3AA 4BCCA 4GLOA 2R6JA 1EVYA 4RESA 3OZBA 3DTVD 1D9XA 1WHTB 3WLLA 4BFWA 2JFUA 4HDSB 4MJ7A 4FOOA 2LGJA 2IVFA 1VBFA 1NLMA 2ZWAA 4HB2A 2VRCA 3HEAA 4MPPA 4X85A 5BN3B 1W0KA 1XXLA 1QH8A 2CE2X 4BKPA 1G20B 4CU5A 3I5UA 5FHQA 1U8CB 1YOVB 3WGJA 2ZUTA 3TLZA 1VP9A 3UW3A 2PT5A 5G4KB 4RY9A 3WK8A 1UDXA 2ACWA 2WT9A 4KX3A 1A4UA 1P0MA 5CVVA 4YMWA 4R9RA 3OX3A 1XFDA 2W98A 3NB0A 2BCJQ 3PV0A 2VRBA 4LOHA 4M53A 4MQEA 3GLHA 4OV6B 1VJ5A 1X2BA 2OCYC 3ERCA 4LOAA 2IZ1A 4CHTA 1T0UA 2O5EA 1Y1SA 2WTXA 3KZCA 3MHPA 2SCUA 5IKPA 4RPCA 4M0EA 4HUTA 3QF7A 4E4RA 5LYJB 1E63A 2LDXA 2P40A 2PANA 1FU7A 3NFYA 3BDIA 5D00A 2GF9A 1GQ2A 2B1RA 1V3TA 2C5SA 4FMDF 1P81A 3UZUA 3ZW8A 4LRWA 5K3EA 5SZKB 1HH4A 1YU9A 3V3KA 4NBRA 2ZIFA 1VI2A 3FUCA 2RGNC 4EPTA 1T1GA 1C5KA 3CH7A 1MVNA 3GN2A 1RU3A 4FFNA 4N8DA 3QE0A 3I45A 2Y0CA 1PUIA 3VC7A 4AURA 1WNFA 2P9QA 2YXBA 2WAOA 1R0KA 1SA0B 3IHKA 4H7EA 3Q87B 4QDOA 4AO8A 1F1JA 4IIJB 2L82A 4JENA 1UEIA 1KMMA 4J1TC 5KVQA 4ZI5A 4DM3A 1X7YB 4MUEA 2A1TS 1O9GA 3B3FA 4JS0A 3WMGA 3ZXXA 2DFDA 1MHPA 3ORYA 4OSOA 1RQ2A 2DKOA 4YUVA 4OMFG 4MQFB 3QK7A 3V4ZA 1DBVO 3GO4A 4DA7A 2X9QA 4P38A 4EA8A 3EXHA 1SJ9A 3LSTA 5ESXA 4F97A 1D07A 3TWOA 3K1TA 2C59A 3F6YA 1VKOA 2XA9A 5AHWA 5DWQA 5TX7A 3IPLA 4XIYA 4ZQBA 1IG0A 3I5XA 1RWKA 3JQ8B 2P2SA 3IUMA 3DTTA 3P9ZA 4AYWA 4PRLA 2I4MA 2JFXA 3K2IA 5DO9A 2BMWA 2FSUA 4GP7A 4ZD6A 3ZYZA 3L6DA 5B5SA 2V3WA 3Q7SA 3HMQA 2CC2A 4KO8A 4LF9B 2OQVA 1DZIA 1U0NA 3O7WA 1H2HA 1C0KA 3HWRA 4PCAA 5IJZA 2DBZA 1E3WB 2D8AA 2YZ2A 3CNHA 3WDSA 2X2OA 2PRJA 3DYBA 4KIFA 5JG7A 4P92A 1LPOA 2VR1A 3OQ6A 4DR1B 1QAMA 4UU8A 5CB8A 5EHIA 3LC1O 2FUEA 3CCFA 4DZTA 1U2GA 4BX9A 4D1YA 1W2WB 5EZYB 2R6HA 3DLCA 3KEOA 3AOEC 3DUWA 4G1CA 1O6ZA 1K4MA 4TYYA 4JOQA 1BHSA 1UK6A 4UXIA 4WOPA 3UA3A 4C4ZA 3RDPA 1J25A 1JXMA 5JUWA 1PUXA 1T10A 1LI4A 2JLBA 3A25A 1P4HA 3DZ8A 3AM4A 3DZCA 4NYJQ 4I7EA 3ZCVA 1A9QA 1T5BA 1J5EB 2H16A 2ZB8A 2HMUA 4DW8A 1WHSA 1P2SA 4RTLA 4U7TB 4DQXA 1WV1A 3JQ6A 5EERA 4XLLA 2VJLA 4RMGA 5AM5A 5D7BA 1NJ2A 1YR3A 5G53C 2EL9A 2RAPA 1P7PA 1FEZA 2YNMC 4NEQA 3WO0A 1EFRD 3L6OO 4B3IA 1YBHA 4LRSB 3KSDO 1DP4A 1Y6FA 3DBLA 3TTSA 5FI3A 4ZJYA 1ETHA 2AOUB 1OKKA 1YCGA 2HJGA 2DBQA 5FOUA 5IC6A 2XT9A 3TRDA 1LPMA 4D8YA 2AZXA 1Y8RB 3F90A 4RVGA 4WXMA 3LLUA 4DZZA 1G291 4RZHA 1PWXA 4B3DA 5DSTA 4KR3A 1TFRA 3KHKA 2BGWA 2JRLA 4JD5A 4YLGA 2BEWB 1ULZA 4B80A 2F9MA 3AI2A 2H7VA 2QW8A 3KKLA 4TRMA 4AYTA 3JATB 1E59A 2OLJA 3NVAA 3S44A 4CG2A 2QTLA 3PXXA 1IZ0A 4EY5A 5JSHA 4DCUA 3CEPB 3SN6A 4AX8A 1Z7EA 4MKXA 2C97A 2WSBA 3K5HA 3T06B 4TS9A 4D41A 4ZZ1A 3WGTA 1GNVA 4P3KA 5HIIA 2VP2A 1TDJA 1M6VA 2RCYA 3I04M 4U7WA 3VKWA 4DNQA 5J4LA 1EGHA 1XJCA 3M9LA 1TU3A 5E3IA 1KFKB 3RSCA 1NV8A 2FPPB 2C3YA 4QOHA 5CCEA 4K1LA 2KYRA 2NZXA 1DG3A 4GPTA 1T6NA 1NKSA 2PS3A 4LXIA 2PYIA 1CUZA 1NZDA 1ZMTA 4XDGA 3NORA 5ED0A 1N0UA 1H1LB 2QAIA 1BCRB 1Y7TA 1ADBA 1XD9A 3HCFA 1NLYA 1YIAA 3MJHA 3PRHA 3TDMA 1JKMA 2PUGA 1XZLA 3GA5A 5ALJA 1GGEA 1KFBB 4FZRA 3TTXA 5IKXA 1TADA 4H1HA 2FQQA 3U7IA 3AX6A 1G5PA 1GARA 1ZKMA 2IXEA 1QF7A 3OC0A 4MS3A 4RK1A 3UJ6A 4ND2A 1JI0A 2OXRA 1AGXA 4O4HF 4BV8A 1M6VB 1L9KA 1MEEA 3CMMA 4CCYA 4D42A 3S81A 5CB4F 4MYCA 4EMTA 2JB9A 1A2BA 1XU7A 2AV6A 2J9XB 4S3MA 4EP1A 3DB2A 1G2IA 1Z82A 3RC9A 1GU1A 3HLYA 4Q4DA 3CRZA 3LIPA 1M54A 5B7QA 1W59A 4YRNA 3OFVA 3SICE 1YS9A 1NX9A 3ENWA 1B41A 1RACA 1Q0LA 2ODBA 1AS3A 2FPKA 1KRHA 5FUXA 1LZKA 3W8EA 4JL8A 4LVUA 4WFIA 5CDHA 3WY9A 2M98A 3N5CA 1I0ZA 1WUJS 1DNPA 1XTZA 2L2QA 4YXWA 3OM1A 4XX0B 3DCJA 3BCHA 3ABQB 4M8LA 4UD6A 4NCXA 3LWNA 2AOUA 1U8UA 2FGKA 3GRVA 2EYQA 4FSDA 4IGAA 3Q88A 5CT4A 3COJA 1ECCA 1IM8A 2ZIZA 3F6SA 3I0NA 3NOOA 1SOMA 4D98A 4EEKA 3IDFA 2ZPTX 1MO5A 1MB2A 1FUUA 1FXWF 3M4XA 4BEJA 2CNOA 3TZKA 3PNSA 4A6XA 1Z0FA 3EXEB 3ONWA 1N2HA 2CGEA 3A6JA 3MUNA 2P9CA 1COZA 1DAIA 2ZJ0A 3RV3A 5CT6A 1W88A 1H8ED 1KDZA 2KX7A 1L5ZA 1XP8A 2AG8A 1JDTA 4EF5A 5A4IS 4PYQA 3DVRX 2MSLA 3CR7A 1QB7A 3DNFA 5IYZB 1ZJWA 1IVSA 3R3UA 5IK2A 1C4XA 1DPGA 1U99A 3EDRA 3L1VA 3TB6A 3T3EA 3JWEA 2YFYA 4X1IB 4DDVA 1D4ZA 1EQUA 1JKFA 2Q27A 3GRAA 2J31A 1YR2A 4RSHA 3SCZA 4NARA 1JHRA 1O6FA 2I4LA 2EJBA 2FFBA 2WSIA 4PLWA 3OTOB 1BMQA 1AE1A 3OWOA 1KMHB 5AXCA 3OTGA 1LBSA 4DUYB 3M83A 4OTZA 4XPZA 4ZYYA 2X3YA 1PJRA 4FLFA 4F1JA 4WGGA 3KTOA 1EDEA 1DMRA 1R0CA 1E4OA 1YUBA 2XE4A 3ITKA 1NKVA 3QOYA 3QFCA 1JG2A 2JFZA 1RXEA 4U5QA 2EVWX 2WHXA 5EGSA 5JS2A 3IIMA 3D6NB 4EHLA 4UUBA 3Q8KA 3WLOA 4H6PA 2I2CA 4HQ0A 1JTVA 1Z47A 3FTCA 4KDRA 3C8HA 4F4DA 2FN4A 3JQCA 3KLNA 1L5LA 5B1EA 3FPEA 5I7VA 1C9DB 1QP7A 4MWEA 5LL6P 3K1YA 4HFRA 3GFTA 4QQFA 1THMA 4J1QA 1L7EA 2NSLA 1C1DA 3C74A 3FM9A 5SYAA 4RMHA 4BYGA 4LFBB 2AR0A 3M4YA 3QLTA 1R16A 2IC5A 2NO5A 2JGJA 4Z54A 2QRPA 1AHPA 2C0CA 2GEJA 1IN4A 1CRZA 1SFRA 3MLAA 5H68A 4YRMA 1WQ3A 4M8KA 4QRIA 1N5LA 1U7OA 3H9UA 4RF3A 1XD8A 2ZJ3A 4MW1A 2JEYA 4Y8VA 2C9MA 4UVIA 1UKYA 4DE5A 2X0JA 4LHWA 4CXMA 1UXJA 2W8BB 4I2VA 2ZIXB 4JXZA 3IAFA 4G97A 5KTSA 2J0SA 2IUSA 1P77A 4NK4A 4QBKA 5INTA 2PKEA 4BXOA 2R5WA 3U3DA 2BOVA 4MW9A 3EZLA 4FEEA 3KQUA 1H85A 4J6EA 2I4RA 3F5QA 1B8OA 2ZPUA 2JAQA 4WCDA 1H8EA 4MV5A 3ZHQA 4DIKA 5ITSA 5JHGB 5JAPA 1IUNA 1XIVA 1QRRA 2PUTA 4FEAA 2QRZA 1QLJA 3L77A 3ZC3A 2X0NA 3T1TA 3A3KA 2Q62A 2V4UA 5BSEA 2VF5X 4A03A 4KIJA 4UHBA 1Q1EA 3AU8A 4IIVA 1P4AA 4Q7KA 4BO6A 2BMVA 2WD7A 4BE7B 4F9EA 2V0GA 5L45A 1JQLB 1NYTA 2QM0A 1UPAA 1XTKA 2RGBA 2W2TA 2CXSA 3Q7QA 3QVTA 4QE3A 1P8AA 3TTVA 1X0VA 2R1TA 5IDWA 3VDNB 5JFTA 2NG1A 2ZUEA 1YTLA 3FR7A 1LPPA 4REMA 2ZZKA 1VB5A 3N28A 1L5GB 2AN5A 2IZZA 4GQAA 2HHAA 1PJSA 1XB2A 3C0KA 5AJXA 2HK7A 4B6OA 2HQ1A 2CNBA 3SJAA 4ALJA 1X1AA 2ORWA 5BQFA 1O4VA 3WRXC 2REOA 4A6EA 4D4HA 4F45A 1GEGA 1PJ4A 2NVWA 2IZ6A 5YASA 1GGJA 2AG5A 3GC6A 3ZCQA 1VA4A 3PBKA 4UUPA 3AIKA 2RI1A 3HBFA 3K6KA 1KPHA 4IDGA 4DRZA 4BNVA 4JT4A 1OGIA 4YRRA 3JQ9C 3ET5A 9LDTA 1NVDA 2W93A 5KKAA 4BVJA 1IUPA 4WINA 3GPCA 1T8RA 2MSCB 1YB2A 3ZDFA 2COEA 2ETXA 1ZGZA 4NG4A 1RRGA 3VPCA 4IFBA 1I3NA 1TCBA 3IA7A 2A94A 4U63A 4YAOA 1ZVVA 3O8NA 5TVGA 3EGWA 4JODA 1FDIA 3OCWA 3I0MA 1QJ4A 1TA4A 2F8TA 4KR9A 2G06A 3DEYX 4AZWA 2NPOA 1RXVA 3IUNA 5JYEA 5CUQA 1YIOA 2VP5A 3HA2A 4EVIA 2EP8A 5KQRA 4M98A 4CF4A 3BB1A 4RW0A 5DHUA 5KZMB 2JLVA 4AJEA 1SXQA 1GQSA 2KBFA 3JRXA 3UOGA 3B5IA 3C24A 2IXFA 2WF5A 3F4KA 3NIDB 3A6KA 1TRHA 2PGAA 4MARA 4X41A 3SKXA 5JAMA 2C8JA 3DBRA 2QL9A 3FLMA 4TMYA 3HYSA 2GVDC 3EW9A 1NPDA 4O1IA 2J0UA 2QLJA 3TEFA 1IC6A 3G0GA 2YJ5A 1BEEA 1EHIA 1FU4A 3B20A 5ESRA 1LC0A 2F7SA 2FW9A