3AP2A

Crystal structure of human tyrosylprotein sulfotransferase-2 complexed with pap,c4 peptide, and phosphate ion
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
303
structure length
300
Chain Sequence
ELVMVGVEYRYGKAMPLIFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWSKSGREKLRLDEAGVTDEVLDAAMQAFILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLKGDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human tyrosylprotein sulfotransferase-2: Insights into substrate-binding and catalysis of post-translational protein tyrosine sulfation
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Protein-tyrosine sulfotransferase 2
total genus 108
structure length 300
sequence length 303
chains with identical sequence B
ec nomenclature ec 2.8.2.20: Protein-tyrosine sulfotransferase.
pdb deposition date 2010-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13469 Sulfotransfer_3 Sulfotransferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ap2A01
5AJYA 4JLNA 4DDUA 4CT4B 4K8OA 4PC1A 2C2HA 4RCYA 1W49A 2AD5A 2AKYA 3RRMA 2ZE7A 4MYHA 5KDOA 3AF0A 3OE7A 1ETUA 2Z83A 4GDFA 5HKKA 2O8BA 1BKDR 1BIFA 2ONJA 1OFIA 3WBJA 5G3ZA 3DKPA 1QRAA 2V7QA 3HR7A 3RNLA 4DIEA 1NSFA 3EC2A 5JSZB 2VEDA 1P9WA 2R44A 2BEKA 3K9NA 2W2XA 2BMEA 1E9FA 1DAKA 1G5TA 4JVNA 2ORIA 1GUAA 3RS3A 2RH5A 4LGMA 5AJWA 4XWAA 3EW9A 4M1SA 4PSKA 1HURA 1VKJA 2QRNA 4JBXA 3PIRA 2CK3A 2FMXA 3CX8A 1G1MA 3LA6A 2QE7A 2OM2A 3LFUA 4KI0A 4PHTA 5CM8B 4Q18A 3AVTA 2VBCA 4AK9A 2CHQA 1XMIA 3K09C 3O8BA 5BN4A 3AVXA 4NCIA 4TL9A 1ZD1A 3I1FA 1Z0KA 2QMEA 1LVGA 4OQFA 1MABB 4MGKR 4L16A 4D82A 3Q5EA 1J90A 4AWXA 1IY1A 1M7BA 1E9EA 3QPVA 4X8HA 2Q6TA 3N70A 3QXSA 2K5UA 2G6BA 4C0BA 3W34A 3AP2A 1EK0A 2XEXA 1G8FA 2O0HA 2WPDA 2FGKA 2D2FA 5J47A 2HYDA 2G0NA 4M0LA 4UNPA 1CS4C 2GJSA 3PUWA 2B6HA 2XNSA 4DKXA 3OEHD 2OAQ1 1BH2A 2EFCB 4Z8YA 3QENA 3WHKA 1DEKA 2ZRMA 5J4KA 5G41A 1ESMA 2PLRA 3R9IA 1VECA 4M8NE 4I99A 2QT0A 5BW8A 2VRWA 4HLDA 3QKSA 5EQTA 4MA4A 3RS0A 2W6JA 3EZ7A 3TK1A 4BFWA 3EA0A 4V03A 2IW3A 1NJFA 5JJIA 3EZFA 1W0JA 3QPWA 1OW3B 1XEWY 3ND9A 2O0KA 5FL7A 2KE5A 5DI9A 2CVHA 4IEIA 3W3ZB 1KYIA 1HA3A 4DHEA 4XIGS 1KI8A 2ZYTX 5FOVA 3ZIAD 1N6IA 1RVDA 1FTSA 4BRWA 4CEHB 1KDPA 1NLFA 4TTPA 3TVTA 3KQLA 2IYRA 2FJUA 2V54A 4OKSA 3RSLA 1TQDA 3GEIA 4O25A 3VNVA 3U7HB 4DUGA 3P27A 3UPUA 4N0DA 2WIAA 1ZUHA 2C5LA 4NCKA 3EA5A 4JL8A 2HLDD 1JR3E 1AKYA 3WYFA 2H18A 3UKDA 4ASUA 4B71A 5GVSA 5G40A 3ZH9B 4IHQA 4DB2A 3KKOA 2CCGA 4AYXA 2BC9A 1N6NA 4UQOA 3PUZA 1KDOA 2A5YB 2ZJAA 4OI4A 4LPKA 1T91A 5BYKA 3FFAA 2ZJ2A 2ZRBA 4WBSA 2QTFA 1NKSA 1WDTA 3TAHA 2RGGA 2CL6X 1KZ7B 4JJKA 2IC5A 4TLBA 1H8EA 1KMHA 5C2JB 2J45A 1S2MA 5FH9A 1XTKA 2IEYA 1G3IA 4MYUA 2O8DA 3J81k 1X8JA 4KO8A 1TQ6A 1P9NA 4URVR 3T61A 1FMLA 3IHLA 2OBNA 1ZM4A 3OIWA 2R9VA 1Z0DA 4GNKA 4Q1BA 3TQFA 2HYIC 2OAP1 2WJHA 1ZC4A 3H1TA 3SOPA 2AWOA 2BDTA 1K5GA 1ZCAA 1UKVY 5EE5B 4EQ6A 1RRCA 4BZQA 2WPDD 2H5EA 4RFSB 1G8PA 2OLKA 3ZVMA 5EE1A 3DPUA 4KSCA 3S1AB 2WICA 4D80A 3U60B 1Z2AA 2BMFA 2OSBA 2ZVQX 2HJVA 4PSVA 4B6EA 2ZRPA 1SKYB 2XB4A 3CNNA 1XEFA 3PEVA 2VHTA 5CB6A 4NYIQ 2CJWB 4WZAE 3NBFA 2IYVA 4UXHA 5C4GB 3AVVA 4CIDA 1PLKA 5TXGA 2GCNA 3GLIB 3NC0C 3BOSA 1QHHA 4QGAA 4I1OA 2WJJA 3FYHA 4H1VA 4OQLA 3LNCA 4YXWD 3GLGB 4NMMA 4L8GA 2VP4A 1GKUB 1U0HC 3WNDA 2ZRAA 2XZPA 2OO7A 3AGPA 4PHFA 3DMDA 2OFXA 3U6BA 1Q1ZA 4KV9A 3NVAA 4PR0A 4LX0A 2CLCX 4C0LA 3DHWC 4CW7A 4LK2A 5GADl 4LJ5A 1TF2A 3U4QA 2CXXA 2UZIR 4RZXA 2ERXA 2VP6A 2G3YA 4Q9HA 4B2PA 1CU1A 2CBZA 2VIIA 1XMVA 2R6CA 2V6IA 2OBMA 1KI9A 3W6NA 3THXA 4B43A 2C99A 3PEUA 4ZI2A 3E1SA 1DO0A 4R2HA 4LY6A 3TSOA 4ZKEA 2P65A 1T6NA 1EFCA 1E1RA 4AG6A 2HT1A 1VG0B 2ZITA 3H4MA 1OXXK 3CPJB 4XOIA 2BIFA 4CRWB 5DHFA 5EE0A 1RJ9A 4A8JC 1PZNA 1KSJA 3P26A 4G5OA 5EE9A 4RD0A 4LJ9A 1L4UA 4R71A 2RGNC 1GFIA 4BZXA 4PPGA 3D31A 1S9DA 1VG1A 4HAWA 2JATA 4FW9A 3LQRA 1N6KA 2WSSA 1M7HA 4YONB 3VAAA 2RGXA 1N3BA 5HE9A 1OFTA 3GEHA 3GJ5A 4GMXA 1KHTA 3C15C 1Z0IA 4HB0A 2VHJA 1XXHB 1Q21A 2FFBA 3FKQA 2XZLA 2ZE5A 1MO3A 3R9XA 3OESA 3ZVLA 2UVQA 2RGCA 3SYLA 1G4UR 3FMOB 5B30A 4OI0A 1R7RA 5JEDA 1XEXA 3K70B 4W5WA 4AKHA 1SVIA 2ORWA 4AG5A 5FR1A 4C0AC 2ZS9A 2C98A 4JT2A 3SR0A 4B3XA 1H8HA 2NPIA 4GOJA 4ITRC 4NCJA 2C78A 2F1RA 4I81A 1VMAA 3JZAA 4XVUA 1EWQA 3NDPA 4QBFA 1YZLA 4Q9IA 1KO1A 1YQTA 4P32A 3UG6A 4E07A 2ERYA 3BBPA 2HCBA 4BFVA 1HE1C 4A82A 3I3SR 4PPFA 3THYB 2FU5C 1KOFA 3ZS9A 3IHWA 4TSFD 5EP1A 4ZCMA 1NN1A 1U81A 3R9WA 2PBRA 1KO8A 3GMTA 1CXZA 1RJ9B 4TMZA 3B7GA 1CR1A 4M22A 2QAGB 4URXR 3VNUA 4YXWA 3O8DA 3SI7A 1E2MA 2BCJQ 1Z5ZA 4QG7A 3V4FA 3AKYA 2N1BA 3R20A 1Z83A 1QF9A 2WJVA 2DFKB 2YWHA 4NYMQ 3S1AA 4A36A 1US8A 5FTNA 2GAOA 2IXEA 4M9SA 4PAQA 4JT4A 2FFQA 3SJZA 821PA 3THWA 1KTVA 2IYXA 3DM5A 2PZEA 1F2TB 2AWNA 3H86A 2GAAA 4EJSA 4ACAA 1GNQA 2A5FA 2XTMA 2ZI7A 1RW4A 4EFLA 4C0JA 4KFSA 1OYWA 4O2LA 4D6PA 4GMDA 4XWOA 3ZVRA 1YJ5A 1JXMA 2VHQA 1BOFA 4IOKA 1G9XA 3T5DA 4P4UA 1XXHA 4C0SA 1FUUA 1SVKA 4QHYA 1CR2A 4G01B 4DLXA 3LXRA 4IFEA 1Z3IX 1KY3A 2V8OA 3EZ9A 2OEPA 3MJRA 4IVRA 1MO4A 3KJGA 1GKIA 5FBQB 1ZW6A 1NLYA 3RVBA 2BBOA 1S0UA 1PLLA 4D25A 1IN5A 1R0ZA 4XSGA 5H8WA 1TTTA 2WMNB 4PC6A 2CHVA 1NMZA 4YDHB 2EYUA 5HZKA 5FBWB 4XWKA 1JJ7A 3QXXA 1YRBA 4HI0E 1NN0A 3QIAA 3TH5A 1KZGB 2HDNB 3T06B 1XDBA 4MKIA 5FTKA 4WA7A 3EPHA 4HZUB 1KJZA 4NP6A 3T12A 3VR6A 2N46A 2DY1A 3VR1A 1KK2A 1KK3A 4PFSA 5FUYA 3SE0A 4ZIRA 3CNLA 3L82B 4YDSA 2IUSA 4IDHA 2GK7A 4P31A 5JBQA 2OE2A 2WWYA 2DB3A 2DHRA 1W47A 1HE8B 4JSTA 4UJ3A 2ZI4A 2ZYVX 2BM1A 1TNDA 3BH6A 4RVCA 1EXMA 2FSHA 4P4SA 1NY5A 5IDVA 2GJKA 3WBKA 1GOTA 3P4YA 5L3SA 4QOSA 5J4YA 5TVKA 1YKSA 3A1WA 1OHHD 3WYGA 2PJRA 1T3LA 2J5XA 1TQ4A 4EPTA 2CCKA 1KI6A 1GAJA 1E2QA 4NU0A 5AWFC 4FXPA 4LHVA 4PHHA 2QGNA 3HYTA 4QNRA 4ZDWA 2GESA 1P2TA 2QORA 2ZTSA 4DCSA 4A6XA 4WZBE 3CRMA 3I5YA 2W83A 2G0TA 4Q1DA 2WJGA 2V1XA 1OXUA 2R2AA 2GF9A 4BLQA 2CLSA 3CB4A 3TUZC 4Q1CA 4ZKDA 3WMGA 1G3UA 3DM9B 5K8TA 4XVQA 1N6RA 1G7SA 4RFSA 1GITA 4WOPA 1OLOA 4CEJA 1CR0A 3B2EA 3U4QB 1Z6XA 1KSHA 4PQFA 1GZSA 2AHOA 2WKRA 5JS7A 3OEED 4WZ6A 2B8WA 2CNWA 2ZSFA 1D5CA 3PITA 4OL0A 4AYWA 2I4IA 4JVMA 1W5TA 2WAXA 4V0KA 4BE7B 4UNQA 5FOUA 2O8EB 1XB2A 1ELOA 4CZ2A 3JVVA 2XB2A 5IF9A 1GG2A 3OEHA 3B78A 4GRAA 2BWJA 4ZDIA 4ZCLA 1P72A 4GP6A 2CJWA 2PX3A 3IIJA 1E2JA 1LY1A 3K9HA 3KKNA 4B48A 1IONA 4KLZA 4WIAA 5DI3B 3AUXA 2ZRJA 4P3YA 3AF2A 2ORVA 1FNNA 3TW8B 4DEXA 4L9WA 4FCTA 1AGPA 2RGDA 121PA 1E0JA 4LC1A 4A0FA 4TT3A 1AM4D 1X1SA 2RKOA 2QPOA 2RGNA 2GF0A 3AVQA 3KQHA 2MMGA 3BRWD 3M6AA 4KCGA 4E22A 2YOGA 4UNSA 2DPXA 1P3JA 5JZVA 1NN3A 3PR1A 1KI2A 1SKYE 2CK3D 3EWSA 4D4MA 4DCTA 4N0EA 1E94E 2TMKA 2JJ1D 4B3DA 1AIPA 4RD2A 2AXPA 4L4UA 5F9FA 1N6HA 4EKDA 1G7RA 1XTJA 1D2EA 3CO5A 2EU8A 1J70A 1XJCA 2KI5A 1ZBDA 2QI9C 1E1QA 5KTYA 3OHMA 4KYIB 5GJBA 2XGJA 1ZM7A 2J59A 3CZQA 1M8PA 4Q4HA 1GDDA 2JJ1A 4QGGA 3NWJA 4OYHA 1NVUQ 4HB4A 3BIFA 3TUIC 4G5RA 5A5GA 4DDVA 2ZSAA 5DI3A 4AC9A 3KZ1E 1EX7A 1NY6A 1XCMA 2F55A 1IM2A 3C16C 1XNJA 2OFOA 3W5IA 1JEEA 5CYOA 2OILA 3P32A 2G9NA 3NBZC 1SQ5A 4FINA 3P4XA 4EUNA 1YZKA 2JLQA 1ZNWA 1Z08A 3K9GA 3DDCA 4MRRA 4E5UA 4P0TA 1U8AA 2JLVA 1ZM9A 3MUFA 2V55B 2AL7A 4NZYA 8OHMA 4EJSC 3CPHA 3LO5A 2BBTA 3B85A 4X8MA 4A2PA 2D7CA 1XFAA 2H57A 2QNRA 3BH7A 3A4NA 1CULC 3T15A 1BS1A 1YZUA 2YC4C 3C7KA 3AGQA 5EP2A 2KB0A 3GD7A 4OK5A 1M74A 1KJYA 2AFIE 4HLUC 1T5LA 2AFHE 1CIPA 1HY3A 5SZJA 4JLAA 2QP3A 3W6OA 2J41A 4A0RA 2EWWA 4M1TA 4LBYA 1D9XA 1DAGA 4XVRA 3L0SA 3U3KA 3FKSA 4LJ6A 1JPJA 4M4SA 3UATA 3QJYA 3NG1A 4QBIA 5KYKA 1EWRA 2WOOA 2QSZA 2J0UA 5KSZA 4AKEA 1BYUA 4EPXA 3O8CA 3HU2A 3DZDA 3NC1C 4Q1FA 2ZI9A 4YMVA 4X8OA 1M1YE 2YHSA 4BUJA 2V9PA 1WE2A 2Q9AA 2ANCA 2JAQA 1UDWA 2R65A 3ZJYA 4IDQA 4DC9A 2JLYA 2NOAA 1T8TA 2B8TA 4NL4H 4BRUA 3K9LA 1DAFA 3BC1A 5JI2E 3FMFA 1IJFA 5D3MA 1Q44A 4IDPA 3D7MA 4QXAA 4IVPA 2ZU0C 4GBMA 3UWOA 2ZJBA 5BN3A 1GTVA 1G4AE 1MABA 3AVPA 1BMFD 1S3SA 2D4HA 3A36A 4K81B 5BYJA 5LBIA 2PZGA 3I8SA 1A2BA 3GJ0A 3VR3A 3WYAA 3JVUA 4DUGD 2ZJOA 2GCPA 2XNDD 4M21A 4Y0VA 2F1JA 1VIAA 1VIYA 521PA 3P1JA 3MFYA 4OQXA 4MDEA 4QRHA 4DLVA 1VHTA 2PT7A 1Q57A 4RCZA 1Y3AA 2OG2A 2HCJB 2FWRA 4DCUA 1BMFA 3CLVA 1U0LA 2BEJA 2ZXUA 2JJ2D 4Z8XA 4JBYA 3GPLA 1P6XA 3KJEA 3MD0A 1NSTA 5HPYB 4JVLA 3QUSA 3LBIA 1OH8A 2NG1A 1I4TD 3TAUA 1VPLA 4BASA 2QU8A 4TLEA 1NNEA 3U6KA 4LYJA 1Z22A 4LJ7A 4ON9A 3L43A 4G5GA 3B1YA 3C14C 4Q03A 4TYYA 3UMFA 3U3RA 1JALA 1OXSC 2BM0A 3OF5A 4Q4JA 4LUCA 1N25A 2VSOA 5HR5A 5DGXA 2Z43A 3IIKA 2WTUA 1LFDB 1IN7A 2BJWA 2DWOA 2ZSEA 2G1KA 1OXVA 4Q4LA 1MRNA 1NKTA 2ZIAA 4LBZA 2QROA 3QXHA 4IEEA 1Z2CA 1LF0A 4QBGB 4ESVA 2JLXA 2GTPA 1K5DA 3U44B 2C77A 1UKZA 3VR4A 1E96A 1II0A 3KQNA 3VR5A 1VDZA 3KJHA 4CEJB 4QGFA 4OHXA 2Q3FA 3E2IA 1YVDA 1XJ0A 4LRWA 4OHWA 3VX4A 3CKLA 4IXNA 3FTQA 1T0JB 2ZI5A 3KUDA 2IA5A 1Z6YA 1II8B 1OKKD 3I72A 3D8BA 3QVUA 5JS8A 3AM1A 4AURA 1LW7A 5EXSA 2PLFA 4NYMR 4DLUA 3A1VA 4I1UA 3I62A 2VH5R 3U3OA 4C0KA 3GLGE 1O87A 5CYPA 2GJ8A 4DCVA 4JYCA 1NVXQ 2FNAA 1WBBA 3IIMA 3FHTA 3AKEA 1E2NA 3QVVA 5FOWA 2P5TB 3QI2A 2GHIA 4HB3A 5ANRB 3RYTC 3A1UA 1OE0A 2IT1A 2IUTA 2F43B 3I92A 4LV5B 1S96A 2WAYA 3FFBA 5F9HA 3AKCA 4HLUA 2QENA 3NHAA 4ZDKA 1ZD8A 4NCHA 1JXOA 4POAA 2NPFA 1UADA 3BAFA 2VP0A 4EPRA 1SXJD 3CR7A 2D3WA 3ZS8A 1UKEA 2F6RA 1OPXA 2HV8A 2GVZC 5L3RA 2PT5A 3TR5A 2OT3B 1VYUA 1ZU4A 4HEJA 2UKDA 2WWGA 4MKGA 1P4SA 3HU1A 2AX4A 1ODFA 4MH0R 2VF8A 4YLGA 4KODA 5AR1A 1NP6A 4M1KA 3FHOA 4PQRA 1H8ED 2NO1A 2QY9A 1Z63A 4LV8B 4BLTA 1VYVA 4R7ZA 2QPTA 3AV0B 4DSNA 5B57C 2IBMA 3SBDA 2ATVA 1G7TA 3VKHA 4H9GA 1A82A 2NQ2C 3SYNA 3I4LA 2V3CC 3BFVA 2IXFA 3RS7A 2ZR9A 3M4YA 2KBEA 1NL3A 3V4RA 1E9DA 1LV7A 4D81A 4BLOA 4S2EA 1E0AA 3BS4A 1OFHA 1HEIA 3AP1A 2Z5FA 3B60A 4CVNA 5CIQA 3Q8XB 3D3QA 5DE3A 3R7WB 3M1IA 1FW6A 4NTZA 1KDTA 4DB4A 4PZLA 4MRNA 3B82A 4PXAA 4LJ4A 4TYQA 2L0XA 4ARZB 2WZQA 4OHVA 1SVOA 1S1MA 2OXRA 2YOHA 4G1UC 3KFXA 4NH0A 4DEYA 4O3MA 1Z0JA 2GCOA 3K0EA 3LD9A 4GP7A 4Q9KA 2O0JA 3K0FA 1R5NA 3KL4A 1JBKA 3SN6A 5FTLA 3SBEA 1ZNXA 1R6BX 3DOEA 2XJ4A 3CR8A 3IQWA 4R98A 1E4VA 2X77A 4PC3A 4BGDA 3RWOA 4HLQB 2O52A 4RSGA 2OXCA 5B58C 2IS2A 2DYKA 3I8XA 4QHSA 1F48A 2HT6A 3BJIC 4RD1A 4CT5A 1I4DD 3C8UA 2VHCA 1CJUC 3CPEA 1YZNA 3NKVA 1E2PA 3UG7A 1UBGA 5KNDA 1KY2A 1ZP6A 3CNOA 5E7MA 4PAMA 3T34A 3SZRA 1TX4B 5G3YA 2R6GA 2Z4RA 2ZRFA 4CEIB 2ZUCA 1J2JA 2ZR7A 4A92A 3ZZ0A 2FH5B 4DDWA 4TZ0A 1ESNA 2BKEA 1G3QA 4TWZA 1KI1A 4LPSA 4ESHA 5EJEA 1OH7A 1MO5A 1ZIOA 3EPLA 1A4RA 3N5CA 1KI3A 3QKUA 2F3TA 1ZM3A 2DR3A 3HDTA 4JKIA 5FL3A 3KXKA 4PANA 4C30A 2C9YA 4R9UC 621PA 2J0SA 2GEDA 3LBHA 2Z6VA 2J7PD 5DN6D 1ZM2A 2ZETA 2IS4A 2W6IA 3QG5A 1E9AA 1AA9A 1XBTA 3QBVA 2DFNA 1M2OB 1QHYA 1CRPA 3ADCA 3LAWA 3X1ZA 1XZPA 2VLIA 3DMNA 1XZQA 2ODBA 3GLIA 3K0SA 1IBRA 5TMPA 1YR6A 2LWIA 2H92A 3F0TA 3LXXA 2JLSA 1E2GA 2JLUA 3BB1A 2OCYC 4LDJA 3CH5A 2RMKA 2I1VB 1B0UA 3NIBA 2NTYC 1M7GA 4B34A 1TL7C 2GWHA 4M9QA 5FOSA 2JIZD 2YVUA 4BWYA 3EAQA 1E32A 4DT1B 1NG1A 3VU9B 1BYIA 2F7SA 4B32A 1XTQA 1IN4A 5JECA 1NBME 5JJKA 1D2MA 1HQYE 1X1RA 5H1YA 5G53C 5H70A 1M6NA 1QHXA 1ZU5A 3EPKA 2C96A 2HUPA 4TQUS 1K8RA 3RC3A 4TL8A 1UBFA 4Q7MB 5GVRA 3MAAC 4ARZA 1CRQA 3U3JA 2REOA 1EFHA 3ZGXA 4TYWA 4LCBA 4Q1AA 3LDAA 5HZHA 3ZYCA 2YC2C 2GVDC 2XNDA 2HLDA 4ASUD 3TNFA 3A4LA 1Q12A 4IXMA 5K8LA 3U7FB 4AKIA 1R0XA 1S4QA 3KUCA 2YNMA 3VKWA 2A5GA 5JWRA 2F1HA 3OEEA 3Q72A 3VKGA 3L8ZA 5JFGA 3LWNA 1KMQA 4PO8A 2W6JD 2ZRHA 2W2VA 2EFDB 4M1YA 2YOFA 4OJKA 4QKQA 4P33A 1QVAA 3IO5A 2CLDX 4ZI3A 4JL5A 1MR3F 4LJ8A 2REXB 1G8HA 3SHWA 2H17A 4DLTA 2NO0A 1NBMA 1E9BA 1UPTA 2XTZA 1E9RA 5DISB 4A0HA 1M34E 4NE2A 3N2IA 1FNMA 5DIFA 4CDGA 2ZRKA 3KQKA 3DO6A 1C4OA 4PAOA 4A6PA 1QG2A 2GJ9A 3LLMA 1G6HA 1IXSB 3I32A 4NYJR 1N5JA 3AH8A 1P2UA 4JJZA 1GIAA 1F2UB 1UBCA 4RD6A 4B3GA 1DOAA 2W2TA 4B3CA 1JQLB 2FA9A 3V00A 3NBYC 1X3SA 1AS0A 5FBRB 2F43A 1X86B 2XSZA 4LHXA 1KNXA 4MRPA 4V02A 4QNMA 1K6MA 1AZTA 5TDHA 2QBYB 2ZYUX 4GOKA 4EIWA 3QKSB 1NLZA 2GJAA 1GNPA 4Q4AB 5KO2A 2XTNA 1U0JA 1CTQA 4Z1MA 3W5JA 1H8HD 2RHDA 2P5SA 1SVLA 2ZU6A 4TMXA 5L8VA 2NO6A 4KITB 2G77B 3Q3JB 1ZVQA 4RD3A 5BQ5A 3SU8A 2YWFA 2GILA 4QFMA 3FE2A 2WJIA 3RRNA 4S35A 2GZAA 1D6JA 4LYHA 5J4VA 2QZ4A 1NVVQ 2P3SA 4LC0A 5IK2D 5JRJA 4IOMA 4XTCS 3CH4B 4PPQA 4TMVA 2WWIA 4B35A 4BZPA 2DFTA 4D4KA 3HPRA 4URUR 1P7CA 2ECKA 4Q00A 1P9RA 4FWIB 4DJTA 2ZE8A 4BLRA 4RKEA 5A4JA 5CM9C 2QUZA 1VYTA 3R8FA 4F7WA 5FPYA 5FTMA 4CEHA 3A1TA 1JQJC 4DSTA 1UFQA 3ZDQA 5DH9A 1XPOA 1KMHB 1OB5A 4PTLA 5JHGB 1XTSA 5CLLA 5D3MB 2QTHA 1JEDA 4D4JA 5FBVB 3VFDA 4KU4A 4HAVA 1W36B 1TU3A 3CX6A 4Q48A 4BFSA 1X8KA 3B9PA 3PV0A 5LB4A 2LCFA 4ZPXA 4L5BA 5LD2B 4XJXA 1ZJ6A 3BXZA 1OV4A 3ZIAA 2DFLA 3TW4A 4FMDB 1JR6A 1CKEA 3HYRA 5JSZA 1FPMA 4ZCIA 5BXQC 2G83A 1CBUA 3AP3A 4MRSA 4F4CA 2A78A 3NDBB 1KKMA 3A8TA 3GJ8A 3SFVA 1X6VA 4KLNA 3ECCA 2W0MA 5EXTA 2IYZA 5L3VA 3AF4A 4E03A 4CF7A 4TLDA 4LOAA 1UEJA 3MJHA 4HAUA 2ZI3A 2C04A 1DS6A 2CL0X 4XTRA 5FR2A 5C18A 3FVQA 3BD9A 5TARA 4LYFA 3BWDD 1F2UA 5E95A 4AKGA 1UKYA 3ADKA 4W5HA 3U61B 4NYIR 1W5SA 1WMSA 1E6CA 1T8UA 3GLHA 3H2YA 2VQSA 4Q47A 2XX3A 4V0LA 3B5JA 3RS5A 2EQBA 3U7EB 1TUEA 2WSMA 3IGFA 1L8QA 4RZ3A 4AYTA 2EW1A 3IPXA 1OFUX 1RYFA 1XD8A 1TAGA 1WA5A 3IBGA 1QHIA 2GZDA 2J1LA 3EZ2A 3QY0A 2QMOA 4QL3A 3DOFA 3VX3A 2QE7D 1G3RA 1R0YA 3RDPA 4I1SA 3G5UA 2DWPA 2FEOA 3WP0A 2V4ZA 4TTRA 4U5XA 5SZHB 3GP8A 1H65A 2NIPA 4BECA 5DLQC 4QBHA 4EPVA 2AKAB 4Q7LA 1ANKA 3KKPA 2X2EA 1IJEA 4IDOA 5F3WB 3MMPA 5KSPA 5FI1B 2CE7A 1G41A 2EFGA 4GL2A 1E69A 1CR4A 4LBVA 2PH1A 3OIVA 5HTKA 4JL6A 2Q21A 4G3XA 5KNBA 3GLFB 3QNUA 5J40A 1KO4A 3TUJC 1SZPA 2O8FA 4PHGA 1VG8A 1Z0FA 1WP9A 1DVRA 3BE4A 3REGA 3CF6R 1I2DA 4Q1EA 2NMVA 1O3YA 4HZIA 2BJVA 3BGWA 4JYBA 1D9ZA 3FDIA 5EP3A 1GSIA 1Z07A 1U94A 2ZSDA 2R6DA 4C3ZA 3GEEA 1F6BA 1OIVA 4UNRA 3X1YA 5GJWC 4BFZA 1Z6GA 3AVYA 1W46A 3UWKA 1YE8A 2MSCB 2WM9B 3CWQA 2VA8A 5HKKD 1L7VC 1AJEA 5CIWA 4YMWA 1I2MA 3GJ4A 4JKYA 4JBWA 4ERNA 3K1JA 1MO6A 2ZREA 2FOLA 5TB5A 5CITA 4HAXA 5B64A 2P2LA 3I5XA 3B1XA 1DAIA 3B1WA 4PZYA 1TQ2A 3VQTA 4FMDF 2BBWA 2G1JA 3ICQB 3FKSD 1QHGA 1W36C 4BLSA 3KXIA 1JECA 4HZUA 2FPLA 3A4MA 3L2OB 5FL7D 4BLPA 1UDXA 2WWXA 2IYQA 1F5NA 3B8HA 1GKYA 4U7DA 2HF8A 4HLCA 2P67A 2DWQA 2J7KA 5FPSA 3X2SA 3GFTA 5CLQA 4B6FA 2MSDB 4BPBA 2IYUA 2XITA 4DSUA 3AVWA 2IYWA 4EDHA 3EIHA 4LZZA 4D26A 2IK8A 1W7AA 2R6AA 2BOVA 4LBWA 2ZVPX 1COWA 2Z0MA 3MWKA 1U9IA 4XSHA 4JIMA 4H1UA 4LYAA 2GRJA 1XX6A 5ELXA 1HV8A 1Q1EA 3A1SA 1EGAA 2WBLC 4OI1A 2GXSA 3A58B 3IEVA 4OBEA 4MYCA 5JEEA 1NG9A 2IYYA 1L2TA 2QBYA 1COWD 2YV5A 3X1WA 2O8EA 1S3GA 2BMDA 2XJ9A 4KJZA 1A5TA 1B23P 3WNBA 5L3SB 4EJSB 2CVFA 2FV8A 3LVRE 3CF0A 2AD1A 2JA1A 2QM7A 3EWAA 1RRPA 2GDJA 1CJVC 3GJ7A 1JNYA 2YINC 5AJVB 1U90A 2YJTD 3KTAB 4UJ5A 3B1VA 2JDIA 1UBEA 4OI2A 1G8YA 3PCRB 3RRYA 1W1WA 1HT1E 3KKMA 1IY2A 1CEEA 2VL7A 1LS6A 2IHBA 1XPRA 2ZJZA 1G17A 3AUYA 3C41J 1JAIA 1W2HA 4UXJA 3OE7D 4TQAA 5FOTA 4DT1A 4TYPA 1R8QA 2FFHA 4C4PA 4C2TA 4BEJA 4EAQA 3IQXA 4XD7A 4NPHA 4Q7KA 1AQYA 1IY0A 1W48A 1GRNA 4TMKA 3SDZA 4M9XA 5JMTA 3PQCA 3FMIA 3EPJA 4KFUA 1N0UA 2WJYA 3F5FA 1JAHA 5GJVC 3ZD6A 3QXJA 4LI0A 1SKQA 4B44A 3PFIA 1MKYA 4RJLA 4TQ9A 5K8IA 1PUJA 3VMFA 3RC8A 1NIJA 2QTVB 1AGRA 4XD7D 2GBLC 1GILA 3AQ4A 2FZLA 4BFYA 2ZUBA 2H8KA 5AK0A 4OQMA 3OFNA 3K0FB 4TMWA 2Z4SA 3ASYA 2ZR0A 1R8SA 4LJAA 1AKEA 5EUMA 1TUIA 4IW3B 1R0WA 2XXAB 2QSYA 1P60A 4WVFA 4B74A 2X8AA 2RCNA 2GA8A 4JLJA 4MKHA 1SVMA 3AVUA 2ZRLA 1ZRHA 4D0NA 4QJ4A 4DLRA 2IS1A 5C46F 2QMUA 4M1WA 4LJYA 4OK6A 1E1RD 5C4MA 1E98A 2PJZA 4DLWA 4IKEA 4I4LA 2IS6A 3LRPA 1AN0A 3EG5A 4MKFA 5UKDA 1E1QD 1RZ3A 3K70C 2EYQA 3K0AA 5FUXA 3E70C 1HTWA 3LLUA 2Q3HA 4O0MA 1RRFA 1YR9A 1MRSA 4OK3A 1ZNYA 4MRVA 1N2CE 1OYYA 1LB1B 4Q02A 2BCGY 2FN4A 1XCGB 3RWMB 2O8CB 3X1XA 3P20A 2H16A 1IAQA 2C9CA 2J87A 2A3RA 3HJNA 4Q66C 3SS8A 4US1R 2CMKA 4DWJA 3DVLA 221PA 2GK6A 3SYKA 3THYA 2R6FA 1V43A 3WY9A 5JHHB 2V6JA 1XWIA 4KVAA 1OXTA 2OBLA 3BH0A 2EFEB 2OLJA 3NTUA 4AY2A 1N6PA 5AUNB 1P5ZB 4N3NA 2GEVA 1F2TA 1IXZA 2FX3A 2ZI6A 3OAAD 4RY2A 3TE6A 1JR3D 4YQFA 3A6PC 4IOJA 2QEQA 2QAJA 5EZ6B 3VR2A 4M2LA 3QQ5A 3VTKA 1WRBA 3WRXC 4B3BA 4US2R 2ZYWX 2ZPTX 4KHZA 4BFUA 5J5CA 1QZXA 5CDFE 1T9HA 1RIFA 2OCPA 5DHAA 3THOA 4PC2A 2JJ8A 1ZYUA 2O8CA 3R7WA 1Q3TA 3W6PA 2QQ0A 3OIYA 1UAAA 2A5DA 1G6OA 2OHFA 1YRAA 4L15A 1T4GA 2BVNA 4KAXA 1TF5A 1QHNA 1XD9A 3ZD7A 3M0EA 1U2RA 1F60A 1DG1G 1NVVR 1Z28A 4II7A 5CK4A 3QF4A 4OHYA 3R8CA 5CJPA 3DL0A 5CB8A 1GRQA 3PEWA 2WWFA 3TIFA 3K0AB 5J4HA 3T35A 2J9RA 4GZMA 1XF9A 4EFMA 3FPAA 3QE0A 2C95A 4Z51A 3FWYA 4NONA 2ATXA 1GL6A 2JGNA 2QQEA 3AB3A 3QKRA 5DYGA 2FG5A 1NN5A 1R5BA 3O8RA 1UJ2A 2ZJ8A 4YC7A 4EFNA 1XP8A 1FFHA 2GCOB 3HP1A 2D62A 3GLFA 1VHLA 2EVWX 1ZNZA 2QRZA 1UEIA 3TQCA 4B2LA 2I3BA 1S1CA 4FMCF 3GLHE 4D4LA 3LBNA 3RABA 3REFA 2W00A 1Z47A 1G18A 2IYLD 1Z6AA 3TSWA 1XMJA 5HE8A 5CDFA 2F9LA 2OCAA 2LKCA 4NBSA 3L0PA 4JLMA 1P2SA 4OJQA 2UZ3A 1N5IA 2OESA 1FQJA 3EXAA 4JLPA 2H7VA 1YZGA 3FGNA 5JWHA 2IF0A 5FPHA 2Q0HA 1Z8FA 2PCJA 4V0NA 5FUWA 1T3HA 3ICEA 4XH9B 3EIEA 2B21A 2VHUA 2GZHA 4DRZA 4TN1A 3WMFA 1EG7A 1KSFX 1GL9B 3AEZA 2ZANA 1CJMA 3SJBA 1CF4A 1SXJC 1HUQA 3K53A 2O8FB 1VCNA 4QHTA 3TKLA 1OT3A 1RYHA 2GNOA 2AK2A 3BB3A 1E2LA 1W4RA 4Z1MD 1N6LA 2IEZA 1IOZA 4QGHA 5GJCA 2RGAA 3KTAA 1NVWQ 1Z6TA 4HDCA 5HCIA 2ZRCA 1EFRA 5L3QB 4MUAA 2B7CA 2H1LA 3SC3A 3EASA 3ZVNA 2NO7A 1FTNA 2WKPA 4QC2A 1JJVA 4TTQA 5LPNA 4F4JA 2F1IA 1VG9B 4V0OA 5JWOA 4LHYA 1VCMA 4GI7A 1DPFA 5CJ2A 1W0KD 1KDRA 4NCNA 2HJGA 4BQSA 4JLKA 3ZQJA 4Q21A 1II9A 4UKDA 3Q7PA 1E99A 1L4YA 1Q1QA 2NGRA 5H68A 3GFPA 1RFLA 3QEJA 4FMBB 1XRJA 2A9KA 3GFOA 4C2UA 5DO9A 3U3MA 3W90A 4RZUA 1WCV1 3L0OA 2C9OA 4TSFA 3ADBA 2QL6A 4HB2A 1G16A 2GEUA 2QN6A 3DKVA 4Q5IA 2PMKA 3T5GA 1KSGA 1NI3A 1W0KA 3QXCA 5AJZA 4N1AA 5E7JA 3LQQA 1JI0A 1W4CA 4CGZA 2FPKA 4PZZA 1SXJB 5LB2A 1EFTA 2N42A 3LX5A 1YHNA 4HUQB 3GQBA 4KYUA 1YR7A 2VP9A 5FI0B 1CJKC 1KO5A 2DCUA 2ZROA 3B13B 3C5CA 1OSNA 4LWZA 4HAZA 4GSYA 3E5HA 1KI4A 2PX0A 3U44A 5EE3A 3MGCA 2FZ4A 1OIXA 2B92A 2JJ2A 2PEYA 3N2EA 3F8TA 4MGYR 3BFKA 2RGEA 5DSZA 3C5HA 5FPKA 1E2IA 4IJMA 1U98A 3TRFA 5AUPB 1J8MF 3F3YA 1AK2A 4OHZA 1N0VC 1T3SA 3LW7A 4LSGA 1XU4A 2JEOA 2GBLA 3TSZA 1HQCA 2O8DB 2ZJYA 4WAUA 5KNCA 4F4IA 1KKLA 1P73A 2IL1A 2D74A 3O47A 4A8JB 1XPUA 1FQKA 1RE0A 1SHZA 5KDLA 3T1TA 2Q9CA 4YMSA 4AI6A 5JJLA 4DDTA 1CP2A 1Q20A 1ZUIA 4YMTA 2W0SA 3UIEA 4ABYA 1Q3HA 2RHMA 3EIQA 1ZD9A 3HWSA 4Q19A 1QVRA 3K8YA 1TU4A 4DLSA 3FOZA 1D2NA 1EESA 3CX7A 4FCWA 2IXGA 3H0KA 1I4LD 1ZINA 1GWNA 4A1FA 3NHBA 2WIBA 1DG3A 5FOXA 4DCNA 5FPTA 2BBSA 4HAYA 3GLHB 1NMYA 1AQUA 2AR7A 5K8UA 2GKSA 2X1VA 1GM5A 2ZRGA 5SZKB 5KU1A 2JLWA 1GVNB 1F3OA 4FCVA 1NMXA 4URYR 4GOXA 1J99A 2E87A 1FP6A 1DARA 1FZQA 2OV2A 1UM8A 1TEVA 2FPMA 2VYFA 4E09A 1E2EA 1E2HA 5TY0A 1XJQA 1E79A 1DAEA 1GL7A 3WMEA 4HUQA 3I61A 1T5IA 1ZC3A 1YZTA 3RS2A 3IILA 3QEOA 1RC8A 4W7SA 1TADA 2J7PA 3LH5A 1Q22A 4GFDA 2C8VA 3VHLB 1E0SA 2XOKD 4HUTA 1MT0A 1VCIA 1FP7A 4L9SA 2ZQ5A 2VPPA 3OAAA 2AK3A 2J0UB 2BV3A 4Y0AA 3Q9LA 4Q4AA 3SHFA 3U7GA 1KI6B 3D6TB 3CRRA 2VP2A 3B1ZA 4A2WA 1V5WA 3NH6A 1G8GA 3HR8A 2XSZD 2MMCA 3HPQA 4TYNA 3IUYA 2R62A 5KOYA 3CBQA 5D3QA 1G19A 3U5ZB 3CZPA 4U00A 4I1VA 4B75A 2QMHA 2FF7A 5E4FA 2A5JA 4A4DA 4ZV4A 5DNYB 1EX6A 5M04A 4Q7JB 2J46A 2ASEA 4K46A 4URZR 1XMSA 2D7DA 5JCPA 1T0HB 3BORA 5P21A 4DVGA 2KJQA 3WHLA 2VF7A 3SEAA 2X2FA 4KXFB 4J0QA 3IO3A 4DXAA 2P6UA 5KDDA 1R2QA 2WV9A 2LKDA 3KJIA 4FI3C 4M1OA 4RKFA 3WP1B 3OZXA 3DEFA 4MGIR 1ZMXA 2KBFA 5E7IA 5KSYA 2JLZA 2FSGA 3EC1A 5FFMA 2E1RA 5EXPA 3RSOA 3VU9A 3W8NA 3G0HA 3KXLA 3QKTA 4NDZA 2BMJA 1SXJE 2SHKA 2WVJA 3PXGA 1RRGA 2GETA 2WHXA 3GJ3A 1E2KA 2R8RA 3PENA 3KB1A 4B3FX 2OFWA 3AF1A 2NZJA 3CM0A 3IKJA 2XAUA 1N6OA 2XZOA 1KAGA 4Q4HB 4PSAA 1W2GA 1DAHA 2ODWA 2IHYA 2PCLA 5JLJA 2OZEA 3RRZA 1G5RA 2JIZA 1HH4A 3MLEA 2F3RA 3FMPB 3IDQA 1DE0A 1SVSA 2J0VA 2IF2A 1VCOA 2WOJA 3ZLJA 2J3EA 4EPYA 3MWYW 4ZIRB 4P4TA 5IHPA 1KK0A 1OH5A 3CW2A 1EFUA 1CJTC 3BK7A 1FUKA 3Q85A 3HU3A 3CWZA 1E0KA 3LY5A 4URWR 3NEJA 5B2ZA 5IK2A 2J0QA 1E79D 4RD4A 3QKRB 4JLBA 1KJWA 1Z0AA 4KSBA 4HDQB 1W4BA 4PPNA 3OIUA 6Q21A 4A15A 2IYTA 4Q9LA 1A1VA 1HYQA 2Q9BA 3LVQE 1N5LA 2ODEA 2VTKA 3A37A 5CK5A 4G5QA 2GXUA 1SXJA 1DBSA 1SGWA 2P6NA 4DLYA 5KSOA 4W5JA 2JLRA 3QF4B 1MH1A 4M1MA 4QM6A 2IUUA 1PVOA 4HATA 3ZZUA 2FFAA 2YZ2A 5HCNA 1LS1A 3QF7A 1EFRD 1QBKC 2ONKA 1SULA 4GZLA 1Y63A 4G5SA 2QP4A 5F98A 2DBYA 5J4LA 3SJAA 2QPAA 4IVQA 5DN6A 1PUIA 1P61B 1U8YA 1ONBA 1P75A 3LV8A 1G3MA 5EUQB 1W0JD 1TF7A 5DYIA 4Q01A 4BEBA 3GLFE 4WW0A 3QOFA 1NBMD 1KI7A 1U8ZA 1DTSA 4FMCB 3SFZA 4ZDJA 4A2QA 2RB4A 3PUYA 2ZRIA 4JVSB 3SJCA 4C7OB 3CRVA 3X1DA 4DZZA 4A0GA 5L3QA 2B7BA 3MCAA 1GP2A 4ILEA 1C9KA 1PV4A 1OKKA 2WWWA 4IDNA 4YMUA 2VO1A 3UMRA 5E3HA 2XXAA 2QA5A 4OQNA 4TLAA 2FGJA 3RHFA 4FWTA 4LHZA 4GPTA 3GCGA 2CDNA 4UNNA 1E9SA 1G64A 1ZIPA 4IOLA 4DSOA 5FBLB 3ASZA 2BHRA 3OFND 4D2IA 2IX3A 1QHSA 3PUXA 3CRW1 2O5VA 1J8YF 2QAGA 1OF1A 2RGBA 4BFTA 3RLFA 1G21E 2A7QA 2ZRNA 2ZEJA 1QDEA 2YYZA 2QGZA 3I73A 4TT3D 4Z54A 1G291 3W3AA 5LDDC 3GLIE 3BB4A 1FX0A 2GXQA 3BFXA 1Z06A 1E9CA 2WKQA 3T1QA 1MV5A 4V0ME 4KVGA 3TBKA 4C0QC 2WSSD 4B76A 4P4SB 4LV6A 3MSXA 3NEYA 1W36D 3CF2A 1XD2A 1QG4A 2AN9A 3GJ6A 1JB1A 4U02A 3W9YA 5KHOC 3MWJA 2MSEB 5TV2A 3SQWA 1E2DA 4QM7A 5KUTA 1W44A 3IEUA 1XCPA 3KDSE 4DIDA 2G88A 4HYYA 4LHWA 2JCSA 5IT5A 3CRQA 1DELA 4C7OA 3QG1A 4AD8A 3PEYA 1IXRC 4R2IA 5AUQA 2I1QA 1TEXA 2C03A 3THWB 4MDFA 4JS0A 2JDID 1IN6A 2VP5A 4JLOA 5FTJA 5AJXA 1ZCBA 3NXSA 1TPZA 1US8B 5SZIA 4ACBA 5BWMA 1IQPA 1YZQA 4CEIA 1JPNA 3K70D 1WB9A 1N0WA 2E9SA 3L8YA 5JI3E 1DAMA 3KB2A 3GLGA 1KK1A 1JR3A 3EZ6A 2W58A 1R10A 2NZ8A 4JMPA 4DBLC 2GXAA 1GNRA 1NF3A 3UANA 5EP4A 1E3MA 1DADA 3L0IB 2ZAOA 1XEWX 2VSXA 1R4AA 3K0CA 2QT1A 4TZ6A 1AZSC 2ZAMA 4PX9A 4V0MA 4NYJQ 1DO2A 3EARA 3RAPR 2JASA 1MOZA 4D0LB 1CLUA 2ZS8A 4O2RA 3TJZA 1Z29A 1XXHE 4NKRA 1KAOA 5LD2C 2X19A 3PUVA 1ZAKA 3WXMA 4D0GA 2NO9A 1S9HA 3T1OA 1NJGA 2A30A 2FSFA 2V1UA 3FHCB 3ONWA 1AS2A 1N5KA 4IFBA 1HT2E 5EZ5A 421PA 2P0EA 2XOKA 2Y8EA 1FOEB 2AXNA 1YR8A 2KWIA 4MITA 2PMDA 2ZSBA 2F9MA 4FN5A 1BO6A 1WF3A 3LW8A 4PO1A 2O8BB 3CUEF 4JLVA 2Q3MA 1XD2B 3B9QA 1UF9A 4Q4JB 4HDOB 2HXYA 4ZO4A 3SNHA 1WQ1R 3Q5DA 3ZZTA 4C0HA 3ETLA 1FL9A 2CCJA 2CNWD 2ZUDA 3ZQ6A 1II8A 2A2ZA 1AS3A 4WXPA 3B6EA 5A0FA 2FSIA 4F92B 2HF9A 3KFVA 3IPYA 1NIPA 1U99A 1SHKA 2P6RA 3H84A 2HEIA 4TMTA 4B33A 2BKUA 1ZUNB 1D8TA 2CEAA 1NRJB 1G5PA 3T1VA 1XTIA 4MYTA 3TLXA 2ODNA 4NHOA 2WWHA 2KSQA 3K0CC 4EPWA 1A2KC 3NBXX 5KPJA 2QP9X 1TMKA 2CL7X 4M53A 4A9AA 1GRRA 1XEXB 1PJRA 3AKDA 3Q7QA 4B47A 2QG6A 4GT1A 2YWEA 2CE2X 3W8RA 4BFXA 2ZM5A 3EX7C 1G20E 3CONA 3BERA 2QM8A 2W6ID 1OB2A 1OHHA 1XTRA 4PC7A 3NH9A 4Q9JA 3ADDA 3G82C 4MUBA 3FB4A 4PO9A 2YWGA 1S8FA 3TGPA 3LX8A 3MRSA 2PEZA 4KFRA 4DLZA 1FMJA 4FD2A 4PQYA 2V7QD 1Q1BA 3AVOA 4RFVA 1P2VA 1FX0B 1RKBA 4KBFA 1KO7A 4WXRA 1YU9A 1LNZA 2ZJ5A 5FUVA 2FE4A 1LF5A 3SQXA 3AF3A 1QHHB 1Q0UA 4QJ5A 4JLDA 4MGZR 1OIWA 3WNCA 4CYMA 1KIMA 3TR0A 5F2EA 3TVDA 1G7CA 2HXSA 1KNQA 3DZ8A 4RZ2A 1LTQA 2EFHB 1IN8A 1E4YA 1X8LA 4AIIA 3CIOA 3THXB 3V9PA 4W9MC 3QPUA 4F91B 3KX2A 3QBTA 4KBGA 4EQ6B 2WMOB 4IRUB 2ANBA 4TL7A 4UXIA 1WXQA 2ZRDA 4M9ZA 2ZS7A 4X8LA 3WRYC 5C1BA 1WBDA 2REBA 4JZKA 1VTKA 3VHXA 5BN5A 3KQUA 3TMKA 5JCZA 2RAPA 3C4JA 2CHGA 4MQBA 3MG9A 2YKGA 1OH6A 1OJLA 3MWLA 1IHUA 4B2IA 4TL6A 3PG5A 2PL3A 4FIDA 3KKQA 4TLCA 4QJ3A 3PVSA 3RS4A 4B73A 4JSYA 1R5OA 2IWRA 2VSFA 1SVWA 2FDCA 2D2EA 3GJXC 3U2QA 5AUOB 4F38A 2PZFA 2OCBA 3PJRA 3IBYA 2FEMA 3K09A 5JRZA 2D06A 1KGDA 2EWVA 1W4AA 1P62B 3ND8A 5EXXA 4F93B 1U9IC 4KFTA 4C9BA 1PLJA 2ZE6A 721PA 2IWHA 2OUKA 3UK6A 5IRCD 2QAGC 4A8JA 5KPDA 2IYSA 1C1YA 4G0NA 3UXMA 4US0R 1E2FA 3UMSA 3QSYA 1RPZA 1A7JA 4HSEA 1J7KA 3JZMA 3RANA
chains in the Genus database with same CATH superfamily
1TLLA 3JALA 2YWXA 2Y0PA 1Q2XA 2C2HA 2R25B 2VJBA 1R6XA 2AD5A 1AC5A 1G5FA 1D7OA 4MYHA 1P9LA 3OE7A 1ETUA 2Z83A 1PL8A 5HKKA 3VGPA 3DKPA 2ZUSA 3HR7A 2M1XA 3DWIA 2OHOA 3LT5A 2VCHA 2VEDA 2VDVE 3HVIA 2R44A 2FRDA 2XA1A 5ADVA 4EQZA 1RXUA 2BEKA 3JQ7B 3K9NA 1GG9A 3B7WA 2BMEA 3LRTA 1MPTA 4UAVA 3VM6A 1JI3A 2VAWA 2YTZA 3L8HA 4RJTA 5KB3A 1C7FA 3MTBA 1TEZA 3RS3A 3DKIA 2JKZA 5B1HA 4XWAA 2GMWA 3V34A 4DV7B 4EA8A 2VJDA 4M1SA 3IAEA 3KV1A 3LCVB 2J6CA 3MIIA 2X8BA 2VNKA 4B4VA 2YL2A 2CK3A 2FMXA 3AFIA 3CX8A 4ZMBA 2PFGA 4GR4A 3BK2A 3HCBA 5KYNA 2QIOA 2H63A 1YS1X 3HBAA 1MB2A 2VNIA 3IOBA 2QE7A 4Q3AA 4EG0A 4KKVA 3AR6A 4IF4A 3G3EA 2C5AA 2OM2A 3G0IA 5CM8B 5BUQA 2C5SA 2GN6A 1H1LA 4F8EA 1PDWA 1TM4E 4AK9A 1UMDA 3K09C 3IUQA 4B4DA 1H69A 5FQNA 1BSVA 3P2EA 4C1BA 1KEUA 2RE8A 3FY4A 4NCIA 4TL9A 3GT3A 2GBPA 2MYTA 2PRKA 3DJFA 3GB9A 4PM4A 3ENQA 4Q82A 2QTZA 4QO8A 3VC1A 4B09A 4UVDA 3DXZA 3L7JA 3W5VA 1DMRA 2GHTA 1JLRA 2X9LA 2RHOA 3TZLA 3HADA 2H1SA 4EY4A 3I9JA 3WGLA 2I65A 3N70A 2K5UA 2G82A 1R74A 1CJCA 3DAGA 3G8BA 3Q7RA 5DM4A 3TW8A 1SKMA 3GWGA 1BXGA 3MXTA 4W8OA 1HSOA 2FGKA 2D2FA 3TNDA 1JA0A 1E1CB 2HYDA 2Y93A 2GJSA 3PUWA 1I14A 3UTDA 2XNSA 1BMDA 3OEHD 5B4VA 3PXAA 4NBUA 1XMQB 4DS3A 3QENA 2P40A 1DEKA 4KAJA 2ZRMA 5FEUA 1IHYA 3KU1A 4NBNA 4R1MA 3H5LA 5J4KA 5JS6A 5KX5F 5F33A 2PLRA 4R68A 2FLVA 4ZO7A 4MPJA 1U2GC 3GL9A 3IL2A 3FIJA 3SVLA 3I9KA 4YJHB 3UWDA 1X0VA 3QKSA 5EQTA 1P4GA 2PGXA 2W6JA 3EZ7A 4MA4A 2QL7A 3TK1A 4BFWA 1XN4A 3O1IC 1NJFA 3QMWA 3ROFA 5HKOA 3ND9A 3FD8A 3NBAA 5T3YA 4NLLA 3JATB 3W3ZB 3ANXA 4CM9A 4XASA 4Y1EA 4XIGS 4DHEA 5GADl 1PGJA 1NQWA 8ATCA 4BO5A 2Z4TA 1SCIA 5HCUA 5H9VA 5K7SA 2ISQA 4DR2B 1ODTC 1Y6RA 4YUZA 4TTPA 3GX1A 2YN2A 3TVTA 2B1JA 4O2BA 3AXTA 3LSTA 1KOLA 5C1OA 2PRIA 3GEIA 4O25A 3S3TA 4BJHB 2IEGA 2ZP1A 3U7HB 3VNVA 3E3NA 3UPUA 2Q99A 5J63A 3L4JA 1EFAA 1DJOA 3PXBA 4JIGA 2C5LA 4FHDA 2HLDD 3E4CA 1AKYA 2XHEA 1T9GR 4B71A 5GVSA 1SN7A 2HPHA 3K2BA 4J0DA 2QD1A 3I9MA 2PUWA 4UM5A 1QMGA 5G40A 5EIWA 2IXAA 1U2DC 1OLSB 3KKOA 3MRTA 4HNHA 5ED4A 5D6NA 1HR0B 3H04A 2AOVA 4UQOA 5HX7A 2FQQA 2DPGA 2PE5A 2XCUA 4OI4A 5EFZA 2NUPA 3FFAA 5LP6A 2Z30A 1JLLB 1ZEMA 2F2TA 1PK8A 4G2TA 4RACA 4JI1B 3UICA 2B34A 4EZIA 3EFOA 5K01A 5CPBA 2OQIA 1SQSA 4JXZA 2B1GA 1B8NA 4H18A 3U9SA 3GP5A 2E82A 1P19A 1I94B 4OIFA 2CL6X 1ML3A 2VNAA 3I42A 2P9FA 4TLBA 5JCXA 2BZ0A 1H8EA 2ACKA 3AETB 2J45A 2IEYA 1G3IA 4LZPA 4G0MA 4JGIA 3A9UA 1P2GA 4EJFA 2PNFA 4UM9B 1PGQA 3BMCB 4BIIA 3B3JA 2NZUG 3T61A 2Q6LA 5FO0A 5E6SA 4URVR 4YYZA 3IODA 2OBNA 5B4TA 5A9SA 4N5HX 3HKDB 7REQB 4JDPA 3T3MB 1UDRA 4D02A 2JFHA 2R9VA 2V97A 2CC2A 1TJNA 5FJIA 4M9RA 5I9LA 2HYIC 2OAP1 4GIBA 2PO5A 1ZRSA 2DPYA 3K6JA 3RK4A 3GGPA 3EXHA 3KD3A 4HQLA 4OYLA 2HK8A 1UKVY 1MRZA 1PFQA 3OZSA 2FWPA 3OQIB 3L1KA 4IF6A 4RFSB 4XIJA 1G8PA 1KY5A 2OLKA 2QJTA 5TVGA 4EAAA 3ZVMA 3DPUA 3S1AB 3AF6A 3U60B 4XX0B 3C6XA 1L5NA 4P7BA 1SOWA 3FWKA 1GT6A 3TLMA 2ETVA 5KAPA 5KNBD 5CB6A 2D1RA 1E58A 3W5AA 2VXBA 4I4TB 1ZIDA 2CJWB 3FBGA 4JH0A 5LU8A 5C4GB 3AVVA 1RM5A 1PLKA 5TXGA 2GCNA 2QQGA 1FSGA 1SCJA 5IJ0A 3TI9A 5IW8A 4L28A 4XYMA 1N1DA 3ZE7A 3LNCA 1IK4A 4L8GA 2ZZMA 2HPVA 3WNDA 1GKUB 5AK3A 1RACA 2XZPA 3WGKA 2OO7A 3D4NA 4AO8A 1UK9A 4DLBA 4PHFA 2WINI 1VE1A 2OFXA 3DHEA 3DAPA 4FTWA 4PIPA 2W5UA 4WFQA 5KQLA 4PR0A 2EKQA 1R8YA 1QAMA 1TLTA 2O7VA 3GGDA 4JJ4A 4L22A 4QD3A 4JZYA 5D8DA 1YB5A 5DK4A 4C0LA 2HQRA 2WR8A 1L7OA 4LJ5A 3O38A 3G2MA 5KYGA 3Q8KA 1LLCA 4RZXA 4HYEA 4QLAA 3WFZA 1U3UA 5C8YA 2VXOA 4B2PA 1Y48E 1SCBA 2VIIA 3BA6A 3Q9UA 2OBMA 1KI9A 5IMSA 3THXA 1XAHA 4TOIA 4B43A 1YIDA 2VR1A 4GEKA 2OYRA 3CEMA 4EUSA 1ISFA 4Y18A 3KUKA 1CHNA 4KUGA 3WGGA 1A4XA 4OBXA 5DTJA 5A6SA 3CVWA 2ZYSA 3DAYA 3PL1A 2H1CA 3PLRA 3WHPA 3MSCA 4C3OB 3PE6A 4HD8A 1KRWA 3DEIA 1PHRA 5DHFA 3UWSA 4I4NA 1Q7CA 5EE9A 4E5DA 2HQ1A 1G66A 2HK6A 4BAGA 1EFDN 3KQVA 3WB0A 3PQFA 4L0CA 3D31A 3A9SA 2NVUA 1RHUA 4D9HA 1KWGA 4FW9A 3DZJA 3OP1A 5FWXB 1M7HA 1QP8A 2ZDQA 3NRBA 4X0EA 2RGXA 1N3BA 4YONB 1OFTA 4P22A 5M3BA 1GD1O 3HLTA 3MUEA 4KIGA 4RK5A 4ZJZA 4GMXA 1N8TA 4REQB 4W1QA 2ZUVA 3GLKA 1DAPA 4HB0A 2NP7A 1XXHB 5TMDA 3OQNA 4HDNA 2ZE5A 1WD7A 1MO3A 2DWUA 1ECJA 4Z49A 5JISA 5LVAA 3IP1A 2WTNA 1G4UR 1NM5A 5DLPA 8LDHA 1GGJA 5B30A 3GZNA 1R7RA 4GX5A 3M49A 4MP6A 5G4KA 3N6XA 4TUYB 2OHHA 4W5WA 2X5KO 5K5EA 1OFGA 2V96A 3LGXA 4YRRA 2BYTA 2ZS9A 3MRXA 1XELA 1M2JA 2I3DA 4ITRC 1SCUB 4JT2A 4L76A 4NCJA 3RK0A 4DF3A 4I81A 1T9DA 3IV7A 5A2GA 2Z98A 1HM5A 1PGPA 3FROA 4FOPA 4RZIA 4QTYA 1EVLA 4QBFA 1KO1A 1WABA 4ZQIA 4YCMA 5MN4A 4E07A 1B8PA 2Y3IA 4Q7EA 2I91A 4A82A 2V6MA 2NUAA 3I3SR 3T3OA 3THYB 1WXEA 2CFRA 1KOFA 3A6LA 3ZS9A 4RV5A 4F5EA 4EHIA 3BMOB 3IHWA 4TSFD 4P34A 1CZOA 4YAOA 1QIJA 1U81A 1A9ZA 2Q29A 3VA7A 1RJ9B 3BEDA 4KK3A 4TMZA 2XF8A 4URXR 2O23A 1E3DA 3R23A 1HORA 3LC1O 3O8DA 5IWAB 4L6AA 4NF2A 5A0VA 4I4TA 1Z5ZA 2BFAA 4H0NA 1VP3A 4QG7A 2R00A 5C34B 4NR0A 1H2AS 1MDBA 4Q4DA 4LMRA 2Q8NA 1QF9A 3HB9A 3O2NA 3H8JA 2NUAB 3S1AA 3W2HA 3SLGA 1TD1A 2HOQA 3GV0A 1KU6A 3HACA 1VLJA 3UJHA 4B9EA 821PA 2GAOA 2PXCA 3DLTA 3IJ5A 3HZOA 1Y82A 4M9SA 4I3HA 2Q6OA 3HDGA 4XVCA 1M2GA 4JI4B 3JARA 3P9ZA 1PR5A 3A2NA 4ACAA 1GNQA 1WWKA 2A5FA 3HN6A 1ZR4A 2XTMA 2ZI7A 4WQMA 3TLJA 5A9SB 7REQA 4KJXA 4L72A 4ZT6A 4KFSA 3G9QA 1JSCA 1OYWA 1U31A 4GMDA 4O2LA 3QZUA 4UHBA 2A1UA 2VHYA 4Z86A 4XWOA 5L9AA 4RJKA 4MJ3A 3ENNA 2UYGA 3NFRA 4FDMA 1G9XA 2R7NA 4IOKA 4WINA 1QGDA 5YASA 2A7XA 2O2YA 3U4CA 1N2ZA 1XXHA 3RG8A 4C0SA 4KC0A 2YVQA 3KAKA 1JG4A 1CR2A 1LNSA 4NK5A 3VPGA 1KETA 3BGVA 4DLXA 4NBVA 2JPDA 3HB4X 3RD5A 1MC5A 1KY3A 4PTYA 3QEBZ 1RCFA 3LIIA 5JH7B 2XE7A 3MJRA 2H5LA 1E8NA 3DUFB 5FBQB 1ZW6A 4AN1A 5KNDH 2BBOA 4D25A 3FDJA 3PVCA 1SXIA 5BNWA 4KPFC 3C8MA 2NVUB 1JLLA 3TIGA 4ZCTA 2WM3A 2WMNB 3STUA 1D4AA 2NUPB 2VPQA 4KXWA 2G5GX 1CUDA 4ZOLB 3WB9A 1I10A 1LPSA 2WAOA 1E6LA 1PJ3A 5HZKA 5FBWB 3C7TA 1W5BA 2IY9A 3ZU4A 2HA5A 2VNHA 4Y2XA 1JDSA 1W8DA 1RJFA 1YRBA 1NN0A 2D1YA 4H3VA 3QIAA 2QYHA 3AM3A 1MX1A 1NRWA 2HDNB 3RYHA 1BWPA 1XRRA 1KJZA 1UZAA 3LZCA 1O03A 3MRVA 3VR1A 1KK3A 1ZN9A 3A11A 5FUYA 4CDRA 2HV9A 1QYDA 4G0YA 3SE0A 5G0WA 3CNLA 2YHIB 1P17A 4YDSA 4KOEC 1E5VA 4P31A 1ABEA 1K97A 5JBQA 2DB3A 1ZMTA 2ADOA 2ES4A 2TYSB 4YRSA 4GOMD 4OB7A 2ZYVX 1UC5B 2OVBA 2ZR8A 3BJMA 1JDBB 1EXMA 2FSHA 1DUIA 1HRKA 2FRVA 1NY5A 2GS9A 2PIAA 1A69A 2IOYA 3GWZA 3H2ZA 4FFBA 4XWWA 4QWWA 1YVPA 4QOSA 2VPYA 5LJIA 3CE9A 1LRKA 1X7DA 2LR0A 1E89A 1PL6A 2DR2A 3WQBA 2M2IA 3Q2IA 3HJFA 2C2KA 3UT5B 3RS8A 4WDQA 3ZY6A 3ZWMA 3NPAA 2UZ1B 4OJNA 4ZAYA 2HUNA 4EW6A 3ZDDA 1KI6A 1V8OA 1E2QA 1OX6A 4FXPA 3KZNA 4PHHA 2QGNA 2YVLA 4DCSA 3F5QA 4YAJA 4IZIA 4X1KA 4YQEA 4ARVA 1R9NA 1SA0A 4D5EA 3NLLA 3NALA 1KDZA 3EG9B 3CRMA 3TTSA 2ILVA 4NDAA 2G0TA 4WVLA 4D9FA 3ABSB 5JARA 4OHCA 4LF6B 1R4NB 1HEYA 1Q0HA 4NPAA 5F9MA 4BLQA 1GSAA 2OD2A 1ZRMA 3AXSA 4GBED 3CISA 1VL2A 2POQX 1G3UA 5BO5A 3KWJA 2YNMC 1I5RA 2NU6B 1SWVA 3WMGA 1GCGA 3EUFA 1G7SA 3IPRA 2JHAA 3OQIA 1JS1X 3NT4A 1DKRA 4RFSA 3P9RA 1J42A 6AT1A 4CEJA 3VR6H 4LNHA 3B2EA 1Z6XA 4TTJA 3M7IA 1GZSA 2CUKA 1FSSA 1GHTA 2AHOA 2WKRA 3OEED 2XB9A 5KJCA 1HDEA 2XQVA 4X84A 3SKVA 3PFGA 1XF1A 3TE7A 1D5CA 2XE6A 4L07A 4U7WA 3NDIA 1O6FA 3OUUA 4JVMA 5DHRA 1Z88A 3NHFA 1JHYA 1QNLA 2NXCA 3UK7A 1P80A 3QGMA 2XODA 3DEJA 2VTBB 1BHQ1 2EG5A 4BN0A 2YS7A 2C82A 3BRSA 1KH3A 2KLHA 4WOKA 3HRHA 2ZT6A 3HA2A 4BAZA 3OEHA 2VT3A 3K5IA 2WQ6A 2PLAA 1TLFA 4IBOA 1BCSB 5ABPA 1SC6A 2I0FA 3T5PA 4CV1A 3K9HA 3BXOA 1M5UA 2VHVA 2XVZA 4KLZA 4WIAA 4DLLA 3UUFA 5DI3B 4N39A 5GWXA 1KFCB 4J16C 4P3YA 4MULA 2ORVA 2O50A 1AQIA 2AYYA 3LK7A 1I8TA 2ZJFA 3C3WA 5AFSA 1AGPA 2F9FA 3OLWA 1H93A 1P2BA 1QTNA 5FNZA 4TT3A 4ZN6A 2O6HA 1AM4D 1W35A 2QPOA 2RGNA 2GF0A 3GPDG 4MZXA 5I7HA 5L45A 3M6AA 4EG3A 5EPEA 2A58A 2EKBA 4XIIA 3VOAA 1YJAA 4MWOA 3BXPA 4DMUB 6CHYA 4D4MA 5IAEA 3IBTA 2PKEA 1ISIA 1OREA 4P53A 4BNMA 1J0CA 2PNJA 1QF6A 1R00A 5F9FA 2P7HA 4EMUA 4WJLA 4ZZ3A 3A2MA 4KW7A 4FXOA 2EU8A 3GRKA 5F23A 1KXZA 1XJCA 2EW8A 2KI5A 3EE6A 4KYIB 3DMYA 3FAKA 3O4IA 1TFUA 4V0RA 2Q5FA 3BXFA 3OFSA 4OQ4A 3P7MA 5CX1A 1UP6A 3B6IA 1VPEA 4JB2A 1M8PA 4PYQA 4Q4HA 5IKMA 2B4YA 3PICA 5REQA 1GDDA 2JJ1A 4NV1A 4OYHA 5B7QA 4X7PA 1NVUQ 2WSIA 3H2JA 3TUIC 4EO9A 3EMDA 1TM1E 5K3EA 4UUOA 1V9LA 4FT2A 1DINA 4RMGA 2FPIA 1ACMA 1NY6A 5CT9A 2E55A 1IM2A 1EDEA 4CKBB 4BVAA 4H6PA 3BWXA 3M82A 3S6JA 4DWVA 4DB2A 1JEEA 2QD3A 3L92A 2Q27A 4JHXA 2UYHA 5EMNA 2G9NA 1KRXA 1QKIA 2VJYA 4BU0A 3ZNQA 1SQ5A 4FINA 2PGNA 1QB8A 4EG5A 1G6KA 4KQWA 1ZNWA 1NYRA 3PUHA 4OQPA 5EA2A 2G6TA 4HEA6 2JBWA 1U8AA 2V55B 2AL7A 3BSWA 3T7EA 3TKAA 5AM2A 3E5NA 4X8MA 2WYWA 5CAEA 1Z35A 1Y7HA 2D7CA 1VB3A 2H57A 3D7SA 4M8SA 3IA7A 2O8NA 3A4NA 1CULC 3GLTA 1CJBA 5EL0A 1BS1A 3HXTA 1VLLA 3F96A 2YC4C 3ZKWB 5AVVA 5EP2A 4EO7A 2IBTA 2F64A 4GDMA 1YUBA 4DSZA 4QQFA 2J5QA 2I6QA 2PAFA 1MHPA 1V3VA 1L4BA 1M74A 2I76A 2AFIE 4OK5A 5FUQA 2BGNA 4KQMA 2BFFA 4G67A 5KJ1A 2ENWA 3VAAA 4TKLA 3OZUA 3MT7A 2QP3A 4JLAA 5FUMA 2V4UA 3IPLA 2EWWA 3L9WA 4H3KB 1NA5A 1V1JA 4PFJA 5CA1B 5K3AA 3FKSA 5CRIA 2QW8A 3ILSA 5DMXA 4M4SA 5E1OA 4RVGA 3WWYA 4YIHA 3WYNA 5KSZA 5BW6B 5T6MA 4AKEA 4EI7A 3HR4A 2JI4A 4L8WB 4Y9RA 5K0GA 2GUGA 4MWEA 1NLMA 1E3JA 3TQOA 4WY5A 1XVUA 1PTJA 2C2GA 4XX1A 1YMUA 4X8OA 3GELA 5HHTA 2YHSA 2X3UA 4BUJA 1XV5A 4JJ6A 3KOOA 2J5BA 1KVSA 4GWGA 2A9PA 1DDOA 2C8LA 2CJYA 2V9PA 4QPJC 1SUSA 3R7BA 1YRWA 3SQOA 2ANCA 2XNKA 4FBGA 4RW0A 5IDWA 1VRWA 2OMKA 3RUFA 1G38A 1QCYA 1T8TA 2PD3A 2E49A 2HSGA 2ZIZA 3E81A 3KYDA 3VJLA 5K3SA 2JZOA 4IVNA 4ZOEA 1MAHA 1N2GA 2P78A 2BT4A 4RA9A 1E0DA 1YVEI 4S24A 4IDPA 4J3NA 4W5OA 2O4UX 1AV6A 3LHFA 2HO5A 2ZJBA 4Y3UA 5A4KA 3ZJTA 2W2PA 1GTVA 4RIHA 1L4KA 4BP9A 1Z4OA 4O8CA 4MQ5A 4PG4A 4Z2AA 3C1UA 3FCXA 3QFSA 1MABA 3SSNA 5JR3A 3QEAZ 5I51A 4JP5A 3UBTA 5GZ1A 1OA0A 5BRJA 2X5XA 3JVUA 4J2HA 3E5MA 2GCPA 1H5UA 2ZKLA 3IURA 4M21A 2PSEA 4MICA 1L6IA 2EBUA 2F1JA 3C24A 4LWOA 3P1JA 4PRLA 3KS9A 4BEVA 4MDEA 1QIHA 1K7YA 1Q57A 3HN2A 5EJ6A 1YA4A 2OG2A 1OMOA 1YH3A 2B36A 2FWRA 3QHAA 4LJSA 4PBTA 4U9HS 4AUMA 4BNYA 1U0LA 5JD5A 3MB8A 1YCHA 1M8KA 2ZB3A 3DLCA 3FLMA 4B0PA 2ZXUA 4KPYA 3A04A 4WD3A 3A28A 2FDRA 3CT6A 5A3JA 4KB5A 3KJEA 4RKQA 4OLAA 4BQEA 4R1UA 3MD0A 1NSTA 5HPYB 3B6KA 1YBAA 4S05A 3LBIA 3OPVA 4RXTA 2NG1A 1I4TD 4DCPA 1QX3A 1UBHS 2FUG1 4IQGA 2D1FA 2QU8A 4M54A 4LJ7A 3V1MA 3NHJA 4G5GA 2W71A 2QZ9A 1YR1A 4BP8A 3IESA 5JQGA 1O7JA 1JALA 2BM0A 2HBQA 3OF5A 3UGKA 3RB8A 2N0SA 2P2CA 5FWDA 2VSOA 3KALA 2HRBA 3DVRX 5DGXA 3ZE9A 3WG9A 2H3HA 3FUTA 2OCIA 3GAAA 2ZSEA 2V7VA 1V1RA 1OXVA 3QYFA 4D9CA 5KYWA 1MRNA 3LGSA 1USVA 2Q3CA 2QROA 4IEEA 5LUBA 5FDFA 4A27A 4BKRA 4QICA 1XNRB 5CA0A 2C77A 2YHUA 3U44B 1E96A 1II0A 2QMZA 3IIEA 1J00A 1EWYA 2OECA 3WGIA 1CUYA 3VR5A 3ZLTA 3KQNA 2PS9A 4ZHQF 3L8DA 1EAMA 1YB4A 1QM5A 2Q3FA 2X3FA 2P9YA 3C6QA 3GQBB 5E38A 3RE1A 1NI4B 4P35A 3A4VA 4MNTA 3MT0A 4X7MA 1XLVA 2YMQA 1T0JB 2CFIA 2B8JA 2AOUB 2YVKA 3D0KA 3MS2A 1O95C 4FEEA 4B2YA 3WRVA 2I2FA 1OKKD 3BPSA 1CETA 3D8BA 1MZPA 4LXGA 2BGKA 2R47A 5EZSA 4RPHA 2PLFA 2DULA 1BCSA 4HH3C 1R4MA 1VE3A 4UBJA 5GOZA 4JI3B 4UBMA 4I1UA 3X2EA 3CB2A 3X2FA 1XU7A 3U3OA 3I62A 2BGUA 1NASA 3TTWA 5CCXA 4RJJA 2A14A 3T7IA 2H1OA 2RIPA 4FSXA 5F7XA 1TKBA 3N0WA 1H1TA 1NVXQ 3MWGA 3OHSX 3IIMA 1CUAA 3ZE6A 2J31A 1B74A 2OBFA 1KY4A 1ZCZA 1XOIA 3EF3A 3QI2A 1YCFA 2IT1A 1TZJA 2IUTA 1RLUA 3WOVA 3U7IA 2P6PA 4IIUA 3G2HA 3KBBA 1S96A 4GKBA 1PSDA 1S4MA 6YASA 1M72A 2WAYA 3DQQA 1PJ8A 2BY4A 2G9QA 1A8PA 3GFBA 3VPXA 3AKCA 2AC7A 3OM1A 4AMBA 2FLWA 1GUDA 4HLUA 4PVCA 3NHAA 2NZYA 4NCHA 1Z18A 3CQ9A 4YTEA 1COZA 2XCIA 3BAFA 4I46A 1QBGA 3IKTA 1KEVA 1C0LA 3TM4A 5C37A 2R2GA 2VP0A 1OTXA 2N1MA 2D3WA 4AMGA 4B4KA 1Z8HA 4CUKA 3OOSA 1E7SA 3G0DA 1IY8A 5NLLA 3FTPA 4ERXA 4ZGBA 1TCBA 3BHJA 3RT1A 4MCAA 1VBMA 1WIWA 2VT2A 3KE9A 3S99A 4F12A 4JB3A 2CLFB 4PSUA 2MSNA 4A8HA 3EB9A 3FHOA 3ZBTA 2QY9A 2UVPB 4Y1FA 1Z63A 2P6MA 1JMKC 3BULA 1VYVA 1JMYA 4R7ZA 4ZXFA 4C6TA 4LNUA 2I4MA 1QIKA 3SBDA 5M2QA 1U1DA 3A9WA 1KS9A 3HY4A 3I4LA 2IXFA 1KEEB 4XJVA 2VHZA 3M4YA 1LV7A 1NUPA 4KACA 2FZCA 5A6VA 2GK4A 5ED0A 1P3DA 4KOAA 4KPGA 4S2EA 1ZFNA 4Q93A 1OFHA 4BLOA 2WU0A 2ZIXA 3UMGA 2R11A 2WIFA 1PWEA 5DE3A 2ZAYA 3ND5A 4ID9A 5DKFA 1IN1A 1KDTA 1K27A 1VZ2A 4PZLA 4JXXA 4MRNA 3B82A 4P5EA 2GN2A 4LJ4A 1ZD3A 2NU9A 4IJ6A 4TS3A 3OZRA 1S1MA 3U17A 2OWEA 4O3MA 4BRZA 4JEUA 5B37A 3HKCA 4GP7A 4Q9KA 4EA7A 5CT5A 3S4YA 5IASA 3K0FA 3KL4A 4LXHA 3SN6A 4BO9A 2H2WA 1R6BX 5HA5A 4MKZA 2HIHA 5BUZA 3S29A 3LDUA 3U13A 4Y8VA 3ZGVA 1E4VA 1KC1A 4Q39A 2O2EA 2IODA 1TPYA 2Q2NA 5B58C 4JUBA 1YDFA 3DHVA 1HE2A 2IS2A 5LBUA 1A4IA 4R54A 3TTTA 1F48A 4LYGA 1X70A 2HT6A 2TMGA 3DE0X 3E3MA 2ZJ0A 2XIJA 2RC6A 2FUG6 2NSYA 4FPXA 4RH0A 2R7KA 1LDBA 3WWDA 4CT5A 1I4DD 1T10A 3OTGA 5AVKA 3NKVA 1B2LA 4XJTA 5JH7A 2O19A 1BVRA 2O8VA 5MGBA 2AG5A 1OXBB 5EHNA 1ZP6A 3SEZA 4PAMA 3NKLA 3SZRA 5L51A 4KDCA 3RIYA 2FPSA 1AA6A 1PX2A 2G5PA 4A92A 1DRUA 4BV2A 4G81A 4C7KA 1ESZA 2FJ0A 2FH5B 3KZCA 2FWBA 2FUCA 2IRWA 4WZAB 1VXRA 4ZEMA 2ZUFA 1EX9A 1KI1A 1GL3A 4LPSA 4RHUA 1MO5A 5EJEA 3EPLA 1I0ZA 4J4TA 2IOHA 4AQYB 3SZ3A 3N5CA 1N3LA 1KI3A 3NTVA 1QUEA 2DR3A 1ZM3A 1J0BA 1LBHA 1N2CB 3QKUA 4D7AA 1KMCA 5T6BA 2JVIA 4X61A 5C3MA 4PANA 2J0SA 1QGZA 1EHCA 3AHCA 2GEDA 2PBFA 4MB6A 5DDIP 1A88A 3ZY2A 2VUIB 1LPAB 5I3ZA 1Y8RB 1FUIA 1T5SA 4FNMA 2IS4A 4LAFA 1B93A 3EISA 1UL1X 2C2ZA 4NBRA 4O4JA 3DMTC 4H17A 4R2MA 2QDXA 3U40A 5HZGA 3H99A 3AHJA 2FE1A 3IC5A 2XUGA 4O63O 3JSAA 1XZPA 2GPAA 3X1ZA 4BKQA 3GLIA 5B3AA 2IYOA 1YR6A 2WWTA 2I4OA 3G89A 4JC5A 3ZEAA 4GH5A 5DWVA 3O4HA 2H52A 1E2GA 1RAEA 3WDKA 2JLUA 1PZXA 1WDMA 3BB1A 1EFVA 3RV4A 3QX7A 5CCBA 1TM3E 2DAPA 3BMOA 4NAUA 2NYRA 4XUGB 1B0UA 1ISMA 3R5JA 4NX2A 5IUKC 1M7GA 1GZ7A 1QIEA 1WY7A 3GAFA 4ZVKA 4F3NA 1WMAA 1BE6A 1J2EA 5CJJA 3G6WA 4RTNA 5I4BA 1TGVA 5KTRA 2F7SA 1CE8B 4GZ3A 2DUNA 1IN4A 3LKBA 5EXEA 4B32A 5JECA 2Y0CA 4DPKA 1M34A 1HDIA 4AN0A 5H1YA 1RQXA 2G71A 1PNRA 2YJNA 3FX2A 3HJTA 1NF8A 4UOZA 3GZNB 4IWYA 4U7FA 3U31A 1ZG3A 1EGHA 1Q0LA 1T5OA 3UAVA 1PEYA 5IUJC 3NHLA 2I34A 4Q7MB 4WNYA 5G1NA 1MW8X 3GA7A 2XYPA 1Q92A 4ND2A 4Z3OA 2FUKA 2Y1DA 3ABOB 3N87A 3R6LA 3U3JA 1T1GA 1T8PA 2REOA 3NV9A 4IJWA 5I9MA 1Z4PX 4TYWA 1YZYA 1Z7EA 2YJ6A 4I1RA 4X94A 1NVFA 4Q1AA 5F1PA 1AY0A 3ONEA 4NOJA 4BO4A 2C4VA 1DQNA 1Q12A 1EVJA 2XHZA 2A4KA 5K8LA 1NI5A 4AKIA 1A72A 2VT7A 1D6MA 2WE7A 4X6LA 2XUOA 4ND6A 4XPIA 4MLDA 3RIXA 1A50B 1RZVA 5JWRA 5I4CA 3GMDA 3BHIA 1V8PA 1Z2NX 2MSWA 4GRDA 5KBYA 1NVTA 4HKTA 4TVKA 4X1YA 1CUWA 2CF6A 4DCGA 2C7PA 3QBEA 3QKIA 1OU0A 3LWNA 4EARA 1Q16A 4A0SA 1TJPB 4M1YA 3H42B 3QBJA 3HO8A 4AY6A 4P33A 1UJMA 1BEZA 1CRLA 2CLDX 1U0OC 4OMDA 2AH5A 3C3CA 3R4VA 3S70A 3WI7A 1ADYA 4ZI3A 1UK6A 1W96A 2ZQZA 2ZBEA 4G4IA 4LJ8A 3FTFA 5EZYB 4EG8A 2LUOA 5F2OA 2NO0A 2R00C 2PYZA 2XTZA 2OO3A 5DIFA 4IHKA 2VF4X 2W11A 4CDGA 2ZRKA 1OYOA 2HX1A 3LLVA 2NU7B 1EQ2A 1QG2A 2GJ9A 2R8PA 1NPDA 1RKVA 2X6RA 2H0RA 4JUCA 4UZSA 1F2UB 1BH6A 1UBCA 4TV8F 4KXNA 4B3CA 3GUCA 3HTXA 4UM8B 2FA9A 4E94A 1QIIA 3P45A 4HZGA 2R1VB 1Y3IA 2JNWA 2F43A 1X86B 3AQIA 4G23A 3UA4A 4Z4IA 3A9TA 4V02A 4D46A 1HDOA 1EM8A 4QNMA 1E4EB 2Q5EA 4O59O 5IVPA 1USWA 5TDHA 1HBJA 2O7SA 4FYVA 5H02A 4I6JA 3REOA 2VAXA 3VV3A 3ZHTA 3PBKA 5JNWA 5LKAA 2ZYUX 4EIWA 3SIXA 1YDEA 1G5QA 3L1VA 3WLFA 1E3IA 4KX3A 3S2FA 1U0JA 3LCJA 4CQJA 1CTQA 2Q1SA 3F3KA 3UV6A 1ZGBA 3CC8A 5BSVA 3JS5A 4DG8A 1VSTA 2XMBA 1LLUA 1SVLA 5JU6A 5JG7A 1NE2A 4LY3A 4KITB 2WV7A 2G77B 1B6RA 1CDOA 3VUFA 4M76B 2WHRA 4BX8A 1ZVQA 2VQEB 1IVSA 1XQ6A 3RBAA 1I4OA 4YJ3A 4E09A 3DLAA 5BQ5A 2YWFA 2W4MA 4XWYA 5JSQA 3LF1A 4X5OA 5AW3A 4QFMA 2WJIA 4IKOA 2OV3A 3IOMA 4G85A 4LYHA 1LQ2A 5J4VA 2QZ4A 2HY7A 5AW2A 3AEYA 3PHBE 1HDYA 4MWZA 4UU8A 2BFFB 2BR5A 1XZKA 1HT3A 3L1UA 3R41A 5TNXA 4CI0B 3HPRA 1YJQA 4UTOA 1YGYA 4JBHA 3UHJA 4FWIB 2O3TA 1T1SA 1JYSA 5C5DA 3KLPX 3FOEC 3HKDA 5CM9C 1DOHA 1EBBA 2QUZA 1LZKA 2VHEA 4HWTA 4JP1A 1R27A 1TYZA 1P0FA 2Y67A 3A6ZA 3D59A 2X0KA 1TRKA 1Z62A 3HLYA 1GZ4A 1U9ZA 3GPBA 3Q2KA 3I53A 2YIMA 4FS3A 1LLDA 4MIOA 1RLMA 3DHNA 2FXIA 4RABA 4DSTA 3EAFA 4ZTZB 4QDXA 5DH9A 3AETA 3G13A 1TZ2A 5JHGB 1U02A 3MNFA 5CLLA 3TDNA 3TQQA 5FV7A 2PKCA 5D3MB 1JEDA 3I1YA 3N2NA 4WZBB 5FBVB 3VFDA 4HAVA 1NC1A 5AHXA 1W36B 1K3FA 4Q48A 3I04M 1VHDA 1JSZA 2XA9A 3C4QA 1X8KA 4RMJA 1Y81A 5LB4A 2A9RA 2JFQA 1ZJ6A 3BXZA 1U7WA 4XJXA 3V1UA 3ZIAA 1UQTA 2A84A 1CHDA 2NQ8A 3UW3A 2AFIB 4IFIA 5CDYA 3NWPA 1IZ9A 1UC8A 1XMOB 4CR8A 3IIIA 3ICVA 1BFKA 1WVGA 3GO4A 2OHIA 4MR8A 4P5PA 3T3NA 1BJTA 3TRHA 1V6AA 3A8TA 3KYJB 1I1HA 5D5QA 2BP7A 3SFVA 2VF5X 3ONFA 4KLNA 3F7OA 3LVFO 4PIVA 3URKA 1KZ1A 1K75A 5EXTA 2B4RO 3CA8A 2IYZA 1SXQA 3UMJA 2OO5A 5EERA 1L7PA 4TLDA 5K8JB 3I09A 3QEKA 1RC1A 1ZXXA 4CFZA 1D6NA 4JC4A 2DU8A 3R7FA 2JZCA 1FYDA 1JX6A 5TARA 4X24A 4LYFA 3IMCA 1SRQA 4AKGA 3OOYA 4XLZA 1UKYA 3BKXA 4YHBA 5DBGA 3EFBA 7ADHA 3EXFB 1MJNA 1JIXA 3ADKA 1WUHS 5A1JA 4W5HA 4QTUB 5HEKA 1WMSA 1QH1A 1IEWA 2QRUA 5B6IA 2J85A 3WBFA 1MFZA 5H4HA 4DJAA 2PO7A 1AGXA 1TVKB 2VQSA 4J0JA 1T8WA 4Q47A 3I2JA 2LDXA 2XX3A 3B5JA 3RS5A 2EQBA 3U7EB 5CHYA 1XDWA 1IHDA 1RKUA 3RKRA 4MR8B 1IRIA 5DTEA 4IIBA 4OBWA 4LQDA 3F6RA 4RZ3A 3ZNOA 4AYTA 1O6ZA 1W4LA 2EF1A 2AFIA 3EEQA 1OFUX 1QH9A 1RYFA 4F2WA 3LZDA 1J0XO 2IHTA 3IBGA 1QHIA 2I6TA 5FKJA 5BNIA 1ENOA 3DMGA 2WWVD 2Y1GA 3WXBA 1R0YA 3WJ7A 1XRSB 2PTGA 2K2QB 2QUHA 2DWPA 2EATA 3ENWA 3WP0A 1EU1A 3SWWA 5ENDA 2V4ZA 1L7MA 4QELA 3HA7A 2VEOA 5ITWA 4RUKA 4YX9A 2PS0A 2NIPA 2V3VA 1N0HA 4HH1A 5DLQC 3O91A 4G4SO 5I7SA 4YFYA 5ALSA 3KKPA 2X2EA 2PR7A 5DYTA 3PEEA 4Y9UA 3IE1A 5KSPA 1RS0A 2KW5A 4J2TA 5JV5A 1G41A 1E3WB 2UYOA 3CVJA 3U19A 1U0BB 2H65A 1FMTA 5AVYA 5LXTA 2QNBA 4B31A 4MPPA 2DECA 1N1MA 3L79A 5I7UA 1L8AA 1P2FA 1PW7A 1P0QA 3IQEA 3BZBA 1UMDB 1BN6A 2QIPA 2V74B 1JZQA 1SB9A 2C4TA 5E8JA 1Z0FA 1IB6A 1DT5A 2E0IA 3BE4A 4BMXA 4LYEA 2E4WA 3R0JA 4INAA 4Q1EA 3M6XA 1QVVA 4QUEA 2Y99A 3TR6A 3JRWA 3O93A 1GLVA 3DWGA 4AZ0B 1GSIA 4BNDA 4J7AA 3HXLA 4MINA 4CL0A 1E3EA 3D3EA 4X9XA 1ISHA 2CHFA 3DGFC 4K3UA 4N5IX 4RLSA 3V80A 5IXYA 2RGYA 3F4KA 4MPDA 2OPBA 3VO9A 3IEKA 3V3TA 3AVYA 1CJSA 1XQWA 1JQ5A 4MW2A 3FUXA 3SEQA 1E7QA 3UWKA 4E5MA 2MSCB 4K9RA 2FETA 2VA8A 3NDJA 3T3HA 1L7VC