3AP3A

Crystal structure of human tyrosylprotein sulfotransferase-2 complexed with pap
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
292
structure length
282
Chain Sequence
VYRYGKAMPLIFVGGVPRSGTTLMRAMLDAHPEVRCGEETRIIPRVLAMRQAWSEAGVTDEVLDAAMQAFILEVIAKHGEPARVLCNKDPFTLKSSVYLSRLFPNSKFLLMVRDGRASVHSMITRKVTIAGFDLSSYRDCLTKWNKAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVLHHEDLIGKPGGVSLSKIERSTDQVIKPVNLEALSKWTGHIPGDVVRDMAQIAPMLAQLGYDPYANPPNYGNPDPFVINNTQRVLKGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of human tyrosylprotein sulfotransferase-2 reveals the mechanism of protein tyrosine sulfation reaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Protein-tyrosine sulfotransferase 2
total genus 89
structure length 282
sequence length 292
chains with identical sequence B, C, D
ec nomenclature ec 2.8.2.20: Protein-tyrosine sulfotransferase.
pdb deposition date 2010-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13469 Sulfotransfer_3 Sulfotransferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ap3A01
5B30A 2C9OA 5E7JA 3PR1A 2WAXA 3GJ0A 5L3VA 2P67A 1CLUA 5HKKA 4C2UA 1W4BA 2QI9C 4AG5A 3AVUA 2DFKB 4D2IA 2NO0A 2NTYC 4UXJA 2HT6A 2EYUA 3T61A 5HR5A 4TMXA 4IDHA 5SZJA 1AS0A 2ZE8A 4M53A 2LKCA 3RS7A 1Z07A 3N2EA 4JLKA 4F92B 3T1QA 5A0FA 2ZM5A 5FPTA 2Q9CA 3AVTA 2Q9BA 1OYYA 4A9AA 1OXVA 3U3OA 1A7JA 3K0AB 1G8HA 2XB2A 3R9XA 1Y63A 4FIDA 2BMEA 3MMPA 2XSZA 3AKDA 4RZUA 1G5PA 1ZD8A 2G1JA 1Z6XA 1QVRA 4XVRA 2XAUA 1EWRA 3KZ1E 3EZ7A 2IS6A 2JJ2A 4PO9A 2DFTA 4ZPXA 2CDNA 3REFA 1R10A 5KNDA 2R6FA 1GKYA 5FPYA 3IO3A 4TYWA 1CS4C 1XXHE 3QF4A 4CEHB 4Q9IA 1OXXK 4DLWA 5KYKA 4IJMA 2H16A 3WMFA 2GAAA 3T15A 1KTVA 3MFYA 2GCOA 1U8YA 2GXUA 1GRRA 3AF4A 4EJSC 1FP6A 1KDTA 4NYJR 1F60A 2QQ0A 2NIPA 1M7GA 4CEJB 5HE9A 1XPOA 1Q1EA 1XCGB 4DCSA 1DBSA 4TZ6A 2F6RA 5FBLB 2F43A 4Y0AA 1NVVR 4PSVA 1DS6A 4ASUA 3WHKA 4CT4B 3DKPA 2K5UA 5EE5B 4NE2A 3NBZC 5AWFC 5GJBA 4ZCLA 1YZQA 3KUDA 4A0GA 1X8JA 2ODEA 2GCNA 1NLFA 1GRNA 3WBJA 4PTLA 1W2HA 2ZSBA 3PCRB 3TSWA 1ZYUA 2OESA 5DN6D 1QHIA 3B6EA 4WA7A 3U44A 4M4SA 4KFRA 5EE9A 3RRZA 2EVWX 2VHTA 4D4KA 3F0TA 1VKJA 3NH9A 1OHHD 4DCTA 4GZLA 5JCZA 4F93B 1WA5A 1SKQA 1CKEA 1A2BA 2J7PD 1NN0A 4EQ6B 3GLGE 4ZDJA 2IYTA 4A6XA 1NIPA 5HPYB 4PAQA 2LWIA 1GNPA 2ZJOA 4EIWA 1NVUQ 1IY1A 2FFHA 1Q3HA 1GTVA 1HURA 2RGXA 3QNUA 4IOJA 3U3JA 2XSZD 2P5SA 4GP7A 2GXAA 4LBZA 4LJYA 3SBDA 4Q21A 4ACBA 3KJHA 5EUMA 3T06B 3RSLA 5BQ5A 3A4LA 4TMKA 1XTSA 3BFKA 4IFBA 3U3RA 2WJIA 3AKYA 3B78A 1N6HA 5FPHA 2IXEA 1Z0JA 1DAGA 1NN3A 1YZLA 2B7CA 3BH6A 3T35A 2B8WA 3C5HA 2QU8A 3VR4A 2OFOA 1ZNWA 5CB6A 1G5RA 1OIWA 3BS4A 4JJZA 2JA1A 4HAXA 3A1VA 2Q9AA 3KXKA 3ADKA 4E5UA 1S3SA 2V7QD 1TPZA 3SJBA 4QJ3A 1L8QA 2WJJA 1IN7A 1I2MA 2I3BA 3GPLA 3U60B 1KI1A 2ZRBA 4QM7A 3TLXA 2QMOA 2ZS8A 2XZOA 4WVFA 3AP2A 2OLKA 2A5GA 3SQXA 1TQDA 3N70A 5DI9A 1TEXA 4RY2A 3Q85A 3TVTA 4A1FA 4ACAA 2GEVA 1ZD9A 4D0GA 1ZP6A 4KFSA 2ZUBA 3CNOA 2WWXA 4OK6A 1Q0UA 5BN4A 4QGFA 1BKDR 1KJWA 2ZUDA 3ZZTA 1XTRA 1G8FA 3RABA 4ZIRB 4RVCA 1NLZA 3AUYA 3GJ7A 3FTQA 4BFTA 1OYWA 1WB9A 2WPDA 2FZLA 2DBYA 2HV8A 4A36A 1DTSA 2FSIA 3IQWA 2FG5A 4HB3A 2J0VA 2DR3A 5FL3A 1KSFX 1G17A 2RGCA 2A5JA 2ZRIA 4TYNA 1EXMA 4GZMA 1DO0A 1DAHA 2YNMA 2BHRA 3F3YA 5GJCA 4XWOA 2J45A 2C77A 2XEXA 4AKIA 3M6AA 5F98A 1GAJA 4R2IA 2VL7A 1GL9B 2RB4A 1E9FA 1N0VC 2R9VA 3WBKA 2HLDA 3QKRB 2B92A 1E4VA 4BLPA 5JBQA 1RZ3A 2QP3A 5TV2A 1UBFA 2BMJA 3AGPA 4LI0A 5FTLA 1LVGA 1FUUA 2IC5A 2ZJ5A 4GT1A 4YMVA 2IYUA 5IDVA 4ZKDA 5TMPA 2V8OA 3QKTA 1EK0A 5HCIA 3KQKA 2ZPTX 4P4UA 4GL2A 4YDSA 3ZD6A 4DSOA 1T6NA 2V3CC 3DMDA 1I2DA 5JWRA 3K9GA 1CXZA 3PJRA 2IL1A 1NVVQ 1S1MA 3J81k 1YJ5A 3AVPA 2OV2A 1II8A 4M9SA 2JLQA 2XJ9A 2YOFA 4C9BA 1T3SA 4A82A 1RW4A 2FNAA 2XXAB 1WQ1R 4MYCA 1MH1A 3KJGA 1EFUA 1K5DA 1XZPA 2CK3A 3CW2A 1U9IA 3CPJB 3FKQA 3L43A 1FOEB 3LBIA 5AR1A 4BZXA 2ZEJA 1NN1A 3THXA 3NDBB 4M1TA 4PHTA 3TAHA 4NZYA 4QBFA 2HUPA 2RH5A 2JAQA 3U44B 2NMVA 2ODWA 1E96A 5FH9A 2YWEA 4Q19A 3ASZA 3CR8A 1II0A 5D3MB 2BJWA 2P6NA 2OCBA 2GJ8A 3H1TA 3LY5A 1UKVY 3A1UA 4FWIB 5E7IA 2QUZA 3WYGA 1S3GA 2PEYA 1CR4A 1G3RA 4EPYA 3CRRA 4PZLA 4EUNA 2FSHA 2QEQA 3QBVA 4A0HA 5FUYA 4OHYA 3I4LA 5E3HA 2OBNA 3MWYW 4URXR 4I1OA 1T0HB 2X2EA 4HB0A 4C0BA 4TYPA 4F7WA 4UKDA 1HEIA 5FBWB 2FN4A 4ITRC 4AKGA 2QTHA 2IEZA 1WXQA 4KYUA 1E2QA 1XXHA 1H65A 1UKZA 4MRVA 4CF7A 4YC7A 1E2IA 4EKDA 1NRJB 4O0MA 5G3YA 3DZDA 2A2ZA 1TX4B 2YHSA 4CEIB 2KB0A 4HAVA 2V1UA 2OEPA 1SXJE 2B6HA 1N5JA 4NCNA 1KO8A 3IIMA 1Z6AA 2WOOA 2UKDA 1F48A 2HCBA 2O52A 1LNZA 4FI3C 5JEDA 3T1VA 1KJZA 1II9A 1RYHA 2ONKA 2XTZA 4U00A 3SI7A 2QRNA 3IDQA 3WP0A 3ZD7A 3BD9A 3CNNA 3FWYA 1MABB 1BYIA 2J0UB 1XU4A 3AF2A 4F4CA 1JJ7A 1W4AA 4ABYA 4Z54A 4TQ9A 2KE5A 2GRJA 2WBLC 2HLDD 3WYFA 3IEUA 1F2UA 1KSHA 1N6IA 4QL3A 3C41J 1G21E 3QVVA 1Z6YA 1ZC3A 3ND8A 4ZIRA 2PT7A 1IOZA 1FMLA 1N5KA 1E4YA 3FMOB 4ESHA 1G16A 4E09A 2XXAA 4QHSA 1AA9A 3B5JA 4LYJA 3W34A 3B13B 4RZ2A 2CBZA 2BCGY 1IN4A 1KNQA 1OFUX 4US0R 1SXJB 1IHUA 5JWOA 2OFXA 1NKTA 3BIFA 3K0FA 4QXAA 2H1LA 4DLRA 1W4CA 3W8RA 1RRGA 5KUTA 4DDTA 2WPDD 1YR7A 4ZDKA 2YOHA 2B8TA 1SKYB 3NXSA 5KSZA 1ZU4A 2RGNA 2GCOB 5E7MA 5B57C 4NDZA 1OFHA 4B47A 3PVSA 4JS0A 3OIUA 4O3MA 4XTRA 1S9HA 3CRMA 2IWHA 4JL8A 3D3QA 4QC2A 4HZIA 1NY6A 1NSTA 4QHYA 3UIEA 4GNKA 5J4KA 2YWFA 3TUJC 1Z22A 3LD9A 1U99A 3NBXX 1JR6A 2PBRA 4JT2A 2JDIA 2O8FA 3U4QA 1Y3AA 3KKMA 2OSBA 2ERXA 3ZGXA 4URYR 1MT0A 1O3YA 1JPNA 5AJWA 2WVJA 2HDNB 1M2OB 1JQJC 3PUXA 1HV8A 3R8CA 2ZJAA 2FPKA 2KJQA 1PLKA 1V43A 3BB4A 5CYPA 5EXXA 4B43A 5J4YA 5AUPB 1OIVA 1M7BA 4LSGA 4BFVA 2ECKA 2O8BB 1BOFA 1GZSA 2R8RA 5FUXA 3OZXA 2EFEB 4C0LA 1KZGB 4XD7A 1C4OA 5FFMA 4V0ME 5TB5A 2AWNA 4G01B 3MSXA 5AJYA 1PVOA 1U0HC 1ESNA 2GJ9A 2UZIR 2WWYA 4Q9KA 4C0KA 2RCNA 1P6XA 2CVHA 5DIFA 1E2DA 1FMJA 1LW7A 3U7GA 4R2HA 1XWIA 5ANRB 2ZRPA 5DYGA 1XX6A 4KBGA 2AFHE 3CNLA 4B74A 2J7PA 1DE0A 3EC2A 4HATA 2VSOA 5AJXA 3IUYA 3TSZA 1CRPA 2FSGA 1G3IA 1N6PA 4RD4A 3IBGA 1OHHA 3X2SA 3BB1A 2BC9A 2WJVA 2WKPA 1U0JA 3CM0A 4KAXA 1E2HA 1TNDA 4DCUA 2ZJ2A 5H68A 4A0RA 5C18A 1D2NA 4QGHA 1G8GA 3MWKA 2I1QA 3HYRA 3FVQA 2FDCA 2EFDB 4TLDA 3V9PA 4X8HA 5JFGA 4G5RA 4HLUC 3FHCB 4V03A 5J40A 2IXGA 4EFMA 1NLYA 1HUQA 1G19A 4V0NA 5TXGA 4UXHA 3Q7QA 3UMSA 1FX0B 3I92A 1YR6A 2WMNB 1E1RD 1P72A 1UF9A 1GDDA 1UEIA 2ZSAA 4Q9HA 4M9XA 3FPAA 2CVFA 1IN5A 1E2PA 4UQOA 2GEUA 2J5XA 1VTKA 1XMJA 3CF0A 2AXPA 4LC1A 4EJSA 2EFGA 3ND9A 4MUAA 2FJUA 5J47A 1E94E 1UPTA 2J41A 5AUOB 2QL6A 3RRYA 3UG6A 1Q20A 1ZMXA 1G5TA 1OB2A 1BMFD 2ODNA 2WWHA 2WWFA 4JYBA 4II7A 1SVOA 4B2IA 5L3QA 3B7GA 3V4FA 4LK2A 4URUR 3W90A 1CIPA 3X1WA 1XEXB 4UNSA 1R8QA 2QM7A 1U94A 3QXHA 3SJZA 4U7DA 1KI3A 2FGKA 1NMZA 4XIGS 1JALA 5EUQB 5DGXA 1TF7A 1X86B 1KDOA 5D3QA 1QHGA 1IN6A 1E2KA 4M1SA 4PC1A 2MSCB 3NWJA 2OCYC 2FV8A 2HXSA 2J7KA 1OLOA 1S8FA 2ZRGA 4JZKA 2IXFA 5BN3A 5JHHB 4PHFA 4EPTA 1LS1A 3K70C 2OZEA 3CRW1 1Z0FA 2BM1A 5BWMA 3OEHA 2KBFA 3TUIC 1E2GA 1CBUA 2QT0A 1ZUHA 4KFUA 1F6BA 4A6PA 4TMVA 2QP4A 4FMCB 4GSYA 4JLBA 2HEIA 5AK0A 1W4RA 3GLHB 4PPFA 5FR1A 1JAHA 2QTVB 5FUWA 3UATA 3W3ZB 1QHHA 2OBLA 1N6OA 2OFWA 3NEYA 3S1AB 3TAUA 2H8KA 2V1XA 4HDQB 4LGMA 4TQAA 1N5IA 3WXMA 5J4LA 2GNOA 4D25A 1RRCA 2QMHA 1RKBA 1F2TB 1VHTA 2GXSA 3K0AA 3I5XA 3CX8A 2W0SA 3IO5A 4KVGA 1AIPA 4MKFA 3REGA 3TSOA 1O87A 1TQ2A 4PQRA 4QFMA 4TLEA 1C9KA 1LF0A 3CLVA 1KI6A 1R0YA 3VR1A 4Q03A 5FI1B 1H8HD 3LX5A 1J90A 3LV8A 1Q12A 4C0QC 4JL6A 4JLPA 3SFZA 5KOYA 4K81B 4LHWA 3TMKA 2HJGA 4BGDA 2NPIA 3TGPA 2FPLA 1Q1QA 2ZIAA 4P3YA 1W0JD 4GDFA 4WXPA 4I99A 3AVWA 1EGAA 4CYMA 2AX4A 2A5DA 1NI3A 1YZTA 3BGWA 3SHFA 4KCGA 2OLJA 4ILEA 4MUBA 2A5FA 4BZPA 1ELOA 4FMCF 4WOPA 2ZRFA 2RAPA 1FTSA 3CKLA 2OCPA 4EFNA 5JWHA 4Q7MB 4PSKA 1P3JA 2LCFA 1SKYE 4KVAA 2IW3A 4DLUA 4TLBA 1MV5A 2VHCA 3ZVNA 4GP6A 1GVNB 4B3XA 3PG5A 5DYIA 2OT3B 5C4GB 1ZUIA 1KO4A 1EX7A 1XP8A 4C0AC 3R20A 4M1WA 2PCJA 5FL7D 2VIIA 3AVOA 4B73A 1KSJA 5B64A 2ZI9A 3MG9A 1E9BA 5BYJA 3QKSA 3U3MA 1AQYA 4HLQB 1OH8A 3LA6A 1TF5A 3EWSA 5EE1A 3RS4A 3WYAA 2PCLA 3K0FB 3FFAA 1JAIA 2C78A 2ZROA 3WRYC 4IDNA 4B44A 2ZRJA 1KIMA 4AG6A 3WMEA 1NKSA 4HZUA 4AD8A 2NGRA 2G77B 4HEJA 4FCVA 5H1YA 4KSCA 1COWD 5HCNA 2BMFA 3ZZ0A 2ZYTX 3NG1A 3DKVA 3IKJA 3PUZA 4OI0A 1EFCA 1JPJA 3K0SA 1U2RA 1HA3A 2C99A 3CBQA 3KDSE 3QVUA 1E9AA 4NU0A 3MLEA 5EXPA 3SN6A 3V4RA 1JXOA 1SVMA 2QP9X 1E9CA 2FX3A 4FCWA 4KYIB 2DY1A 3CF6R 2BEKA 2BWJA 4QNMA 3RS2A 4BASA 3VU9B 1R5OA 1CP2A 2B21A 3A4MA 4LUCA 4EPXA 3OF5A 4W5WA 5BYKA 1P9RA 3RYTC 3LW7A 3W6NA 1MO3A 3HDTA 2PMDA 2TMKA 3PEUA 1M8PA 2A7QA 3GJXC 1UDWA 4LPKA 2FWRA 2AN9A 4GOKA 4M1YA 4MGYR 3KXIA 1G7SA 3C4JA 1VDZA 3GLIB 4URWR 1G6OA 3AKEA 4CZ2A 1BMFA 3P32A 3ICEA 4LY6A 2F9LA 2ZRNA 4PPNA 4LRWA 2C03A 1FNMA 4P31A 4Z8YA 2NO1A 3W8NA 5IK2D 4UXIA 3BC1A 1W36C 2RHMA 1Z28A 1K6MA 3VKWA 1E2EA 2J87A 5L8VA 4JT4A 3U7HB 3E5HA 1EFRD 1OKKD 1EWQA 4RKFA 2I4IA 1L2TA 2HCJB 4M1KA 1MO5A 1YZKA 4Q4AA 1SHKA 3LAWA 2CE7A 2JATA 4V0KA 1QDEA 5K8LA 2GJKA 2VP4A 4TWZA 5C2JB 3VR5A 1NBMD 4ERNA 4KI0A 2FF7A 4LJ8A 3SJCA 1JR3A 2WSSA 3PEVA 4OQLA 2IX3A 2YYZA 4I1SA 1Z8FA 2PH1A 2P0EA 1KAGA 3ZYCA 1N25A 3I72A 4KV9A 3EIHA 3NBFA 1T9HA 2IF0A 2FA9A 3ZVMA 3U6KA 2CL6X 2GETA 2ZJBA 2HYIC 2IEYA 4M21A 4US1R 2OXRA 3K09A 4PC7A 5G41A 2Q0HA 2XOKA 3CONA 2GKSA 2J59A 1RC8A 4MYHA 5BW8A 3PQCA 1Z63A 2R6DA 3QKUA 5DSZA 2ZVQX 1SVIA 4TMWA 4BFWA 1W36D 3T12A 1Q21A 4A8JB 4GMXA 3H2YA 3RDPA 2G9NA 1AS2A 3OE7D 5IT5A 2ATXA 4DXAA 4MRPA 2OG2A 2J1LA 4HI0E 2PLRA 4MRSA 4PFSA 1CTQA 3W3AA 1YHNA 4YXWA 4BRWA 3H84A 1OFTA 1PLLA 4TMZA 3ZLJA 1UFQA 4OL0A 3K1JA 5FOSA 4CGZA 3FKSA 3WHLA 4BFZA 5GJWC 4IOMA 1P60A 2CNWA 2W2XA 3QG1A 4CEIA 4RFSB 2VHJA 3MGCA 2PJZA 1GITA 2QT1A 3RWMB 2FH5B 2REBA 1QF9A 2QPAA 5FR2A 3DHWC 4UNPA 4RJLA 2N1BA 2RGAA 1HTWA 3ZZUA 4OK3A 3E1SA 3GLFE 4I1VA 1U0LA 3K70D 2LKDA 1OFIA 3BERA 3EARA 2ZR9A 121PA 4B33A 3VKHA 1LY1A 4LX0A 4CW7A 2GK7A 3UMFA 2XZLA 1ZNZA 1P9NA 4Q18A 4NCIA 1T91A 4Q1DA 4W9MC 2RGDA 2DWOA 2W6IA 3VNUA 1R8SA 4WW0A 2X1VA 1CJKC 2NZJA 1PUIA 3EASA 4LJ7A 4Y0VA 1WBDA 3GJ4A 1MKYA 2J0UA 1W46A 2I1VB 3B8HA 4HAUA 4FWTA 1IJEA 3RNLA 2XB4A 2R2AA 2WMOB 5DISB 1E9DA 5DH9A 4TL8A 3B1VA 2D06A 3QIAA 3NVAA 4C0HA 2NZ8A 2VYFA 4KLNA 2PZFA 2OHFA 3QEOA 4LV8B 2QGZA 2O0KA 5JRJA 2BMDA 2RKOA 2E87A 4YLGA 2YV5A 4MDFA 3TJZA 4B3BA 4W7SA 4YMUA 1KAOA 1XPUA 1ZVQA 4DEYA 4TT3D 4B3FX 4GMDA 2XNDA 3DM5A 4TLAA 4DLXA 1UADA 3VTKA 1XEFA 1G6HA 4KXFB 4RD2A 4DT1B 3QKSB 4Z1MA 4F38A 4Q5IA 1QHHB 4F4JA 4M2LA 2KI5A 3ZVLA 2P65A 4MGKR 4ZDWA 5CIWA 5KO2A 4W5HA 1R0WA 1RE0A 3DL0A 2WSSD 4D4LA 4E03A 1L4YA 2R6AA 1KDPA 4PPGA 4ARZA 1Z0AA 5JMTA 2PZEA 3OEED 2R65A 1G41A 1XJ0A 3VMFA 1YZUA 4H1VA 2VO1A 1KI2A 2DHRA 1E69A 1JJVA 1NG1A 1OKKA 4LJ6A 3ZQJA 2ONJA 1ZW6A 4GOXA 3T34A 1KK1A 4DB4A 3L2OB 1EFRA 1Z29A 1OH6A 3ADDA 1DAMA 2R62A 3LLUA 4HSEA 2WICA 1DO2A 3I3SR 4R9UC 1J2JA 4DEXA 2O0HA 3DZ8A 4IXNA 2JJ8A 1XF9A 4IDPA 5IK2A 5KTYA 2W0MA 4UNNA 3SR0A 2OILA 2QBYA 2ZE7A 3RLFA 1PUJA 3NEJA 1E9RA 4RCYA 2G83A 1EG7A 1E2FA 3FGNA 5SZHB 5P21A 2G1KA 3SYKA 3ADCA 3KKQA 4HUQB 4N0DA 1E0KA 3BORA 3R7WA 4JLOA 4IFEA 2HXYA 2JLVA 4JKIA 4DLZA 1KMQA 1P2UA 4NKRA 4EJSB 2MMGA 1B23P 5CK4A 1QG4A 4RD1A 1SVWA 821PA 1R5BA 5JSZB 5KPJA 1G7RA 1N0WA 5FOVA 3WY9A 4B75A 4D0NA 4OI2A 1N5LA 1E0SA 1XJCA 3CIOA 3NC0C 3OHMA 1AM4D 1ZCAA 4TTRA 3A36A 2G6BA 1NSFA 2HF8A 3TQCA 4C4PA 2Z83A 4TMTA 3MJHA 3AVXA 2GA8A 3C7KA 5JI2E 1IY2A 4FMDF 1E9EA 4B48A 2VLIA 1W48A 2G88A 3LFUA 4JVNA 5L3SA 2RGEA 1DVRA 1X3SA 2D7CA 1ZBDA 2GTPA 2V6JA 2NG1A 4ZKEA 5KPDA 1KY3A 3M0EA 2WJGA 1IBRA 3GLGB 3TKLA 3P26A 2OBMA 4LWZA 4EFLA 4D26A 2ZJ8A 4G1UC 3GCGA 4LPSA 1QBKC 5C46F 1T3HA 2AKYA 1MOZA 2WWGA 3U5ZB 1GNQA 2AWOA 4YONB 1JEDA 1OE0A 5EE3A 3QJYA 4HAWA 2EQBA 4PC6A 1P61B 1X8KA 3H0KA 3RS3A 2FU5C 3GJ5A 2IYSA 3PUYA 4TLCA 2F1JA 2O8EA 2ZU0C 1XMVA 2V55B 4TSFA 1TAGA 2YINC 2O0JA 4LBYA 3T1TA 1NJGA 3N5CA 3OESA 4Z8XA 2RGNC 3BFVA 1UM8A 2CHGA 3KUCA 2CCGA 4LJ4A 4BFUA 4KO8A 4GBMA 1FFHA 1YZNA 4HLCA 2F55A 1ZM3A 4P4SB 2CL0X 2OAQ1 2O8CA 3GLHE 5EZ5A 3QY0A 1TU3A 2ZI4A 5LB4A 3VNVA 1MRSA 4DWJA 3I8SA 3AP3A 4G5SA 3TIFA 3KL4A 5TARA 3T5GA 4Z51A 1TQ6A 2IUTA 3PEYA 1Z3IX 2BKEA 3X1DA 4BEJA 2VP6A 4DUGD 2ZRCA 4D80A 3AVYA 2CXXA 1P73A 4KFTA 2ZYUX 1XTJA 2OM2A 5B2ZA 2GZAA 3HJNA 1P5ZB 1J8MF 1TUEA 3SS8A 1NY5A 2A9KA 5KHOC 5CLLA 4LJ5A 4QBHA 4OK5A 5CLQA 5JJLA 1FP7A 1G7TA 3AKCA 3EAQA 1YZGA 3LRPA 3A4NA 3WP1B 2JLSA 2QSYA 4IKEA 1VCOA 3NKVA 2WAYA 4Q66C 4DSTA 4P4SA 2VP0A 3HPRA 3K0CA 5JJKA 5J4HA 1AKEA 1XJQA 3HR8A 4FN5A 3GQBA 5CJPA 2L0XA 1LFDB 4IDQA 4Q4HA 4G5OA 2GZDA 4I81A 1UAAA 5FBQB 3MRSA 2F7SA 4B6FA 3OEHD 3PV0A 1II8B 2D4HA 4LYHA 4FW9A 4PO8A 1DG1G 4DKXA 1X1SA 1IQPA 1QG2A 3CZQA 1R0XA 2PLFA 3VAAA 5BXQC 2DWPA 3DVLA 4JBWA 1CF4A 2F9MA 4Q4HB 1KKMA 5DE3A 2AK2A 5GADl 5K8IA 3CH4B 1CULC 3PEWA 1UKEA 1KJYA 2WHXA 4YQFA 2QENA 4OI1A 2C9YA 4UJ3A 3AEZA 4G5GA 4GOJA 5HTKA 3ZS8A 4DLYA 3DMNA 4OI4A 4EDHA 1E3MA 2X8AA 2ZETA 4OQNA 3AVVA 3LLMA 1D8TA 1ZM9A 4NH0A 2XX3A 1W0KA 2AKAB 2BOVA 3HR7A 3OIVA 1KI8A 1E6CA 4GI7A 4MH0R 3FYHA 3D31A 3SQWA 1DG3A 2D74A 2VTKA 2AXNA 4C2TA 4PXAA 5FOTA 3BXZA 5KSYA 5L3RA 2IA5A 3QXJA 4YMWA 5L3SB 2SHKA 4LV5B 1VCIA 2D3WA 1E2NA 1VYVA 2GF0A 1B0UA 2BVNA 3HU1A 1Q22A 1N2CE 1VIAA 2X2FA 4A8JA 1E1RA 1KY2A 4DCVA 2W83A 3ZQ6A 3CB4A 2C5LA 3IHLA 5GVSA 1KMHA 3U6BA 5FTJA 4NYJQ 2W58A 1E98A 5A4JA 4HUQA 3TH5A 1NMXA 3SJAA 1J99A 2AR7A 1QVAA 2BBTA 3QG5A 1Q57A 4BLSA 4OHWA 1Q44A 4JYCA 2A30A 5FBVB 3I32A 2ZVPX 4A4DA 4Q4LA 2BBWA 4WIAA 4EQ6A 2ERYA 4KU4A 2QAGB 3LXXA 3SNHA 4DIEA 5C4MA 5FBRB 5FTMA 1EESA 3K0EA 1QHYA 1UJ2A 2J9RA 2IYYA 3ASYA 5AJVB 3GD7A 1HT1E 1UBEA 4WZAE 4IHQA 3MWLA 5EJEA 2QPOA 2J0QA 1W2GA 3RS5A 5SZIA 4MKIA 5JLJA 5EP4A 2QQEA 2ZAOA 5FTKA 1U9IC 4NCHA 1BS1A 5J4VA 2CLSA 4F91B 4PR0A 4W5JA 4AYTA 1ANKA 2VPPA 4NPHA 2WWIA 2KSQA 3VR2A 4L4UA 1XPRA 3L0IB 3A1TA 2F43B 2QAJA 2F3RA 1QHSA 3GFPA 3IPXA 3MJRA 4P32A 3OIYA 4PPQA 3Q72A 5DLQC 2G3YA 4R98A 2JLXA 4XD7D 1OH5A 2BKUA 3EA5A 1SULA 1G7CA 2G0TA 1TUIA 2OE2A 3W5IA 5KSOA 5DI3A 4E22A 2RMKA 5CITA 3K9NA 3GLFA 4QBIA 5FI0B 1IY0A 2QAGC 2VQSA 1OV4A 1QHXA 2WJHA 3FMIA 1Z2CA 4ZCIA 1YKSA 4FCTA 3EPLA 1VYTA 2VSXA 621PA 2DWQA 2FMXA 4M1OA 5K8UA 3WMGA 1SXJD 2Z5FA 3GFTA 1D2EA 1CJMA 4JLJA 5JSZA 3FMFA 2JDID 3C8UA 1OW3B 3NTUA 4P0TA 2C9CA 4RKEA 2CJWB 2V54A 1HE1C 3KTAA 3QPUA 1VYUA 4TL9A 3T5DA 4ESVA 2EU8A 2CE2X 3JZMA 1LB1B 4B6EA 3AB3A 1VPLA 1FUKA 5E4FA 5H8WA 3PUWA 1IAQA 2IYQA 4ON9A 1XRJA 3OAAD 3NHAA 4C0JA 4IOLA 1LV7A 5EXSA 4ZCMA 4A2QA 4QKQA 4O2RA 3JVUA 1N6NA 4JLNA 1AS3A 1ZM7A 2O8FB 3CUEF 2N46A 3RHFA 1BH2A 2EFHB 3QOFA 1C1YA 2WIBA 1ZNXA 1SQ5A 1AKYA 3FB4A 1WRBA 1IXZA 3KTAB 1Z5ZA 3WNBA 2GK6A 3ECCA 3IQXA 5AUQA 3BRWD 2FFBA 2F3TA 1DAIA 1WDTA 4PSAA 5G3ZA 3U3KA 3ZH9B 2BM0A 3A1SA 4G5QA 1KDRA 1YE8A 2O5VA 5EXTA 1OXUA 2ZUCA 1E2LA 1E79A 4RZXA 1TEVA 2PZGA 2N42A 4QRHA 1US8B 5CDFE 3Q8XB 1G3MA 1EFTA 1DAFA 3TRFA 1I4LD 1KI7A 2OCAA 3Q5DA 1KHTA 4P33A 3TW8B 3EPJA 4YMSA 2D62A 3QUSA 3RANA 4RSGA 3ZJYA 2ORIA 1H8ED 5B58C 4DRZA 1NG9A 2NQ2C 3EXAA 3JVVA 5JCPA 4DHEA 4J0QA 2ZRKA 3LW8A 3GFOA 1U8ZA 2WV9A 4Q48A 1ONBA 2BBSA 1FL9A 1UBCA 2IF2A 2Z43A 4H1UA 1CR1A 3NHBA 2VBCA 1JQLB 1IXRC 1XCPA 2ZJYA 3TVDA 4YMTA 2P6RA 1AK2A 5CYOA 1Z6TA 2ZRDA 2IYXA 3U2QA 1RIFA 3LO5A 5HZHA 4N3NA 4V0LA 4Q01A 1NL3A 1A1VA 3VX4A 1HQYE 1KZ7B 2R6GA 1KI4A 4A0FA 1HQCA 3GEEA 3PENA 3C15C 1XTKA 2QN6A 3C16C 2D7DA 1XFAA 2PJRA 1Z0IA 4B3DA 1AN0A 1Z83A 2DPXA 1SHZA 2QM8A 3NBYC 4KJZA 4PANA 6Q21A 1MO6A 3KQNA 1D9ZA 1ZIOA 2WZQA 3A6PC 2JIZD 1RRFA 4NMMA 2JLYA 3EPKA 1XDBA 2O8DA 1U90A 3VHXA 3G82C 5C1BA 4B76A 1ZD1A 4MDEA 2EW1A 2AK3A 2WKRA 1AZSC 3CH5A 4URZR 3THWB 3AH8A 4DT1A 4JSYA 4L15A 4EPWA 3SYLA 5AUNB 2JEOA 1RPZA 4IVRA 1Z08A 3SDZA 1PLJA 2CMKA 4Q9LA 3UPUA 3IIKA 2CK3D 4JLAA 2XNSA 4JL5A 2W6JD 3A37A 1S96A 1AGRA 1OJLA 5KNBA 3M1IA 3T1OA 4ZDIA 3CX7A 4JMPA 4NHOA 3QEJA 4LV6A 1XEWY 5FTNA 4PZZA 1E32A 3B82A 4Q7LA 4L16A 3D6TB 3L8YA 2DFLA 3UG7A 4FMBB 2YWHA 1GL6A 3TBKA 4BLOA 3BK7A 3W6PA 1NIJA 1KKLA 2JGNA 1M1YE 3GMTA 4MITA 2GILA 4QGGA 4ZO4A 3SOPA 4KLZA 1KYIA 4PC2A 2YC2C 4DCNA 1NVWQ 4JLVA 3M4YA 2IYZA 4XWKA 1KOFA 4F4IA 3UXMA 1E99A 3HU2A 3BH7A 4D81A 5FOWA 1H8EA 3NC1C 4Z1MD 1F2TA 5CJ2A 2QROA 2VP5A 4BFXA 3B1ZA 3OIWA 4FMDB 1VIYA 5IF9A 3E70C 3S1AA 4QOSA 1OSNA 1FTNA 3EZ2A 2IYWA 3DEFA 3MD0A 4URVR 4KBFA 2VSFA 1ZC4A 3B9QA 5AJZA 2VF7A 1Z06A 1EX6A 4IEIA 2CHQA 1KMHB 1QHNA 2Q3MA 5EE0A 1MR3F 3EA0A 3EIEA 3RVBA 1XB2A 4KITB 4CEJA 4PHHA 4HDCA 4WAUA 1CR2A 2UZ3A 2VHQA 521PA 5JI3E 3SHWA 4D0LB 5KDOA 2VF8A 3QXXA 2IS1A 2R44A 4AKHA 2MMCA 3PIRA 1SGWA 3X1YA 3QKRA 1BO6A 1YRAA 3U7FB 3GLGA 2GWHA 3OAAA 1NBME 4N0EA 4C0SA 2XTNA 1JI0A 3B1XA 4CRWB 4M9QA 1NVXQ 3OFND 4TN1A 2Z4SA 2XITA 4LYFA 2GBLA 2WSMA 3EZ6A 2BJVA 2WM9B 2X77A 2A78A 1BIFA 3AF1A 1X1RA 2XGJA 2V7QA 2AFIE 2H18A 5M04A 1SXJA 1GNRA 2IHBA 1XD2B 1WE2A 2AL7A 3I62A 221PA 4OHXA 3LWNA 2C8VA 3Q3JB 2CNWD 3PITA 2JCSA 3H4MA 4L9SA 4Q02A 3RWOA 4FD2A 5DO9A 3FKSD 4GFDA 1Z0DA 1L7VC 4I1UA 3GP8A 2OXCA 2PMKA 4NYIQ 4QG7A 3D7MA 3TW4A 3KXLA 4G0NA 4YXWD 4US2R 4ZV4A 3EW9A 2Z6VA 2ZRMA 2QBYB 1G3QA 4LJAA 2QRZA 4ZI2A 1VHLA 3SC3A 1Q1ZA 1W44A 2PT5A 3B2EA 4EAQA 1XD8A 2MSDB 4AIIA 4WXRA 1IXSB 3B9PA 1G4AE 1G18A 2YJTD 3UKDA 4AYWA 1XTQA 2P3SA 1A82A 4BQSA 1K5GA 5F2EA 4B2LA 1WP9A 4Q1FA 8OHMA 3VX3A 4BFSA 1W5SA 5F9FA 3JZAA 2ZANA 2CEAA 2RGBA 3KX2A 3BBPA 2FFAA 5SZKB 4AYXA 2NO7A 4IRUB 4GPTA 4AURA 4JLDA 1YU9A 2PL3A 3RS0A 3V00A 3KJIA 4PHGA 5DN6A 5CDFA 1S4QA 2HYDA 1SVKA 4RD6A 1P2VA 4BLQA 4BLRA 1Q1BA 2ZREA 3CO5A 4M22A 4DLVA 2GAOA 5K8TA 2GVZC 4P4TA 3K9LA 1R2QA 1NBMA 4ASUD 1LTQA 4IEEA 4JIMA 3BWDD 3IHWA 1E2MA 1DELA 3HPQA 3AF3A 3I5YA 3U7EB 1WF3A 3W5JA 4S2EA 4D4MA 5G40A 2Q3FA 3QBTA 1W36B 2ZAMA 4HLDA 3SE0A 5L3QB 3TUZC 1X6VA 3LXRA 2ANCA 4HB4A 1S2MA 2NPFA 3CPEA 4IW3B 2Q21A 2D2EA 3ETLA 4LCBA 1MABA 2OUKA 1UKYA 4DC9A 3IEVA 2YKGA 1KK3A 1DARA 1RVDA 2V4ZA 3WRXC 5F3WB 2G0NA 1D2MA 1XD2A 1W0KD 3BE4A 4UNRA 4TYQA 2ZSEA 4Q00A 4M9ZA 3FOZA 4O25A 3TQFA 1TF2A 1XNJA 2JJ2D 1G1MA 1U81A 3CR7A 4IVPA 1UDXA 3UWOA 1ZUNB 4MA4A 1CJUC 1VECA 2HF9A 4RZ3A 5EP2A 3KQLA 4DVGA 1U98A 3LDAA 1GSIA 4R7ZA 4DDWA 3WNDA 5H70A 4D4JA 1JBKA 1ETUA 3CX6A 2GHIA 2ZR0A 2W00A 4BUJA 3SEAA 4JJKA 1UEJA 3C14C 3Q7PA 2Z0MA 3IPYA 3R9WA 2BEJA 4L5BA 3W9YA 4L8GA 3LQRA 1DAKA 3BAFA 4FINA 5UKDA 4C30A 5KU1A 1SXJC 5HKKD 4PAMA 3KJEA 4PZYA 4M0LA 5TY0A 4AWXA 5IRCD 1A2KC 3THYA 1E2JA 4NBSA 4DSUA 1QRAA 3TR0A 2FZ4A 5A5GA 1Z0KA 1TMKA 2ZE5A 3DO6A 3L0PA 3AV0B 4XH9B 2C98A 1TADA 2R6CA 3GJ8A 1CEEA 3CF2A 1RRPA 4TL6A 2CCJA 2BIFA 4HLUA 3ZIAD 1NNEA 2QAGA 3ICQB 721PA 1JB1A 1KO7A 4Q47A 2F1HA 2QY9A 1P2SA 1ZM4A 1WMSA 2H57A 2QG6A 1A4RA 2W2TA 3X1XA 4A15A 3QXCA 4MGIR 1W47A 3O8CA 3HP1A 3RSOA 4MYUA 4DIDA 1N6KA 1GM5A 1CJVC 1GWNA 2ZS9A 2ZYWX 2Q3HA 3EIQA 1XZQA 5LB2A 4K8OA 2C04A 4LOAA 4ARZB 4LYAA 4CT5A 4DUGA 4DB2A 2J46A 1M34E 1P2TA 2F1RA 1T3LA 3ONWA 5KSPA 3P4XA 2YOGA 1ZAKA 1GG2A 3AM1A 4FXPA 2MSEB 4B71A 3R9IA 1FQJA 3D8BA 4LHXA 4TL7A 3K09C 1R7RA 3THYB 2IS2A 2WTUA 3QF4B 1SVSA 1ZNYA 1RJ9B 5HE8A 1W0JA 1A5TA 1RFLA 5DI3B 4XWAA 1D5CA 4BWYA 1VG9B 4K46A 3BFXA 5G53C 1PZNA 2C95A 5FUVA 2IK8A 4PC3A 2H7VA 1XCMA 3I8XA 3SU8A 3H86A 1IONA 5KDDA 3GEHA 2ZS7A 3KKPA 4DDUA 4TSFD 3E2IA 2UVQA 2IT1A 2C2HA 5GJVC 1ZCBA 1P7CA 3AVQA 1R0ZA 4GRAA 1ZIPA 1F3OA 1Q3TA 4B3CA 3ZIAA 4JSTA 1G3UA 4MQBA 1ODFA 3KFVA 1HY3A 1L4UA 2QPTA 1IJFA 4UNQA 5LPNA 3CWQA 1YR8A 4OBEA 1LF5A 3LBNA 2KBEA 4JLMA 2XJ4A 1ZU5A 2Z4RA 4B32A 5DHFA 2ZRAA 3GLIA 2IYRA 4XSHA 1AGPA 4NONA 1OIXA 2JLUA 3R8FA 4BPBA 4LJ9A 1SZPA 3B1YA 1KO1A 2JJ1D 4QGAA 1XEWX 3VFDA 1I4DD 4OHZA 2JLRA 1DAEA 1VCMA 3P27A 4B3GA 1W5TA 4XTCS 1M6NA 1CR0A 1P4SA 5DHAA 1D9XA 4WZBE 1HE8B 3GEIA 3VHLB 1KO5A 4LHVA 1XD9A 4QJ4A 3DPUA 3BB3A 5FPSA 2IHYA 3FFBA 1PV4A 2IUSA 4BECA 1PJRA 4D82A 3VR3A 2ORVA 3U4QB 5GVRA 3KKOA 1D6JA 4AK9A 1GRQA 1T8TA 1VMAA 5CIQA 3FMPB 4CVNA 1P62B 2ZI6A 2DFNA 4JKYA 2DYKA 1YQTA 1TQ4A 2ZRHA 4XOIA 4M8NE 3EPHA 1AQUA 2H17A 2DB3A 3CWZA 1UBGA 4RCZA 1EFHA 2FFQA 4NYMR 1E1QA 1RYFA 1T5LA 2JLZA 4AC9A 2YC4C 4IVQA 4I4LA 1WCV1 2WOJA 2EWWA 3W6OA 4D6PA 2OAP1 2OO7A 2QTFA 2ZR7A 4X8OA 1RJ9A 4Q9JA 3B60A 3L8ZA 1GILA 3O8DA 4MGZR 3IILA 3TNFA 4B35A 1CU1A 3EZ9A 3VR6A 1AZTA 4Q4JB 3THOA 4LHZA 4HDOB 2EYQA 2ZTSA 4E07A 2IYLD 1NP6A 3VU9A 3N2IA 1ZM2A 3CZPA 3OEEA 4WBSA 2QMUA 3FHOA 1G8YA 3HYTA 2A3RA 2QGNA 4LBWA 2F1IA 1TTTA 4DLTA 1FQKA 2GEDA 4R71A 1IM2A 1G8PA 3UWKA 1NJFA 3MWJA 2O8EB 2VEDA 1V5WA 3TK1A 2Q6TA 2RHDA 4BZQA 1MRNA 4C3ZA 2JLWA 3EG5A 1G64A 4NYMQ 4L9WA 2CHVA 3KFXA 3KB1A 2ORWA 5D3MA 4HZUB 4RD3A 2ANBA 1S9DA 1DPFA 1W1WA 2WJYA 2ZU6A 2XNDD 2RGGA 5JZVA 2ZE6A 3AUXA 4TT3A 2GCPA 3K70B 4MYTA 3K9HA 3QSYA 4DDVA 2ZYVX 4B2PA 3P4YA 5JHGB 2PX0A 3L82B 3B1WA 1FNNA 2ASEA 1Z47A 2IBMA 4RFVA 3F8TA 1N0UA 2CLDX 3PUVA 2H5EA 1R5NA 2Y8EA 1F5NA 1VG8A 3AQ4A 4X8LA 3DDCA 1FX0A 1AJEA 3KB2A 3ADBA 3AF0A 2REXB 421PA 4DZZA 1S0UA 2W2VA 2VHUA 3QPVA 1VG0B 1CJTC 2W6ID 2B7BA 1GFIA 3RC3A 2VH5R 4CEHA 2EWVA 4HAYA 1K8RA 1N6LA 3UMRA 5F9HA 3VKGA 2QE7A 2FOLA 2EFCB 1GUAA 4TZ0A 1FZQA 1NMYA 1X8LA 4WZ6A 5FOUA 1ZINA 1Z6GA 1JXMA 4C7OB 2XTMA 4KODA 2PEZA 5EZ6B 4IXMA 2QE7D 4QNRA 5HZKA 1BYUA 3VQTA 4V0MA 1G20E 3OFNA 2GVDC 1OXSC 3A58B 2H92A 5DNYB 3THXB 1HH4A 4DSNA 3DOEA 1R4AA 3FE2A 1F2UB 3QPWA 4JVMA 4NTZA 2AD1A 4OHVA 2GBLC 5CM9C 1XEXA 5CK5A 1J70A 2ZJZA 1YVDA 3RRNA 3PFIA 1G291 4IOKA 1M7HA 1E9SA 4QHTA 4EPRA 1YRBA 1R6BX 2CL7X 4BLTA 5E95A 4Q1AA 1G9XA 3GJ3A 2GXQA 4YDHB 1OXTA 4LDJA 4TQUS 4PQFA 3OE7A 4POAA 2QSZA 1GKUB 3O8RA 1XXHB 3O47A 1I4TD 4S35A 4Q7KA 3LH5A 3IIJA 4O2LA 2E1RA 4BFYA 3BH0A 4G3XA 2V9PA 1TL7C 1W49A 2WKQA 4JBXA 4A92A 2CCKA 2XOKD 4NCKA 3KQHA 2FGJA 2YVUA 5EQTA 1ESMA 2FSFA 3SFVA 3GLHA 2FPMA 4V02A 4CIDA 4PQYA 2QA5A 4OQMA 2GZHA 4PAOA 1WBBA 5LBIA 1KK0A 2IYVA 2XZPA 4XVUA 2JASA 3QI2A 2E9SA 3ZDQA 2NOAA 1OPXA 1T0JB 3RC8A 1KK2A 5IHPA 2GJAA 2BCJQ 1JR3D 4Q7JB 3PXGA 3UANA 4BEBA 1E0JA 2ODBA 4BE7B 1GKIA 4KHZA 3BJIC 1VG1A 4MKHA 3KQUA 4A2PA 3RRMA 2BBOA 3LQQA 3R7WB 3RAPR 1M74A 4OYHA 1KI6B 1KGDA 3SYNA 5JS7A 4BRUA 2REOA 4KSBA 1W7AA 2J0SA 2ZXUA 3MCAA 1N6RA 1GIAA 4U5XA 4DLSA 2C96A 2W6JA 3X1ZA 3GLIE 2QZ4A 1OT3A 3DOFA 3Q5EA 4JVLA 4AKEA 2O8BA 1OF1A 4XVQA 1TU4A 3WNCA 2CJWA 5TDHA 1S1CA 4X8MA 4C7OA 4QBGB 2AHOA 5ELXA 3IGFA 4M1MA 1DOAA 3QXSA 4DBLC 1KSGA 4XJXA 3K0CC 2QORA 3I61A 3QF7A 1GOTA 5KDLA 2IWRA 2AD5A 1E1QD 4IDOA 1VCNA 5FPKA 4DJTA 2WIAA 3LVQE 4TTPA 5EP1A 3C5CA 4JBYA 4Q1CA 4OQXA 2X19A 1GP2A 3LX8A 3I1FA 4AY2A 1P9WA 2JIZA 4QJ5A 1T8UA 3LBHA 3ZS9A 5JECA 2FEMA 3EC1A 2ZSFA 3NIBA 2NO9A 3EWAA 4Q4JA 1IN8A 4Q1EA 5LDDC 4OKSA 3CRVA 3NH6A 4AI6A 4N1AA 1J8YF 5JJIA 2DCUA 1FW6A 3FHTA 1KI9A 4JVSB 4NYIR 2HT1A 3BOSA 2IS4A 1G4UR 1N3BA 1US8A 2JJ1A 4MRRA 1ZJ6A 4CDGA 2ZI5A 4NP6A 5BN5A 3G5UA 1COWA 1HYQA 2VP2A 1U8AA 4H9GA 4LC0A 3U61B 1KNXA 1MO4A 3EX7C 2P2LA 4LHYA 1FPMA 1Z2AA 3K53A 3F5FA 1HT2E 2J3EA 3AGQA 4OJQA 1E0AA 3L0OA 2PX3A 5JS8A 1J7KA 3Q9LA 4V0OA 4LBVA 3GJ6A 3TR5A 2ATVA 5LD2C 1NF3A 2P6UA 2D2FA 2ZSDA 3QENA 2WWWA 3CRQA 3SZRA 3EZFA 3TE6A 4A8JC 1XBTA 4MRNA 4OJKA 1T5IA 5FL7A 3MAAC 1JECA 2CLCX 1JR3E 5CB8A 3A8TA 2QMEA 2YWGA 3P20A 2ZI7A 3I73A 1P75A 2GF9A 2IUUA 4RD0A 5KNCA 3IBYA 2ZITA 1ZRHA 1NN5A 2VA8A 1E79D 2YZ2A 4A2WA 5J5CA 2ZI3A 3LVRE 2ZQ5A 3DM9B 5CM8B 3QE0A 2A5YB 1GL7A 4HUTA 4XSGA 4Q1BA 3ZVRA 4LZZA 4HAZA 1JNYA 1XMIA 2VRWA 2P5TB 3A1WA 4HB2A 4PX9A 2FEOA 1DEKA 2FE4A 5FOXA 4PO1A 4Q4AB 1CRQA 1JEEA 2ZRLA 4OQFA 1LS6A 1OB5A 5LD2B 4NL4H 4RFSA 3UK6A 2GDJA 2BDTA 3KKNA 3B85A 5JEEA 1DADA 3GLFB 5TVKA 2HJVA 3CPHA 1H8HA 3K8YA 1SVLA 4NCJA 4UJ5A 3SBEA 4MKGA 3THWA 4U02A 4EPVA 4QM6A 3AP1A 3L0SA 3FDIA 2BV3A 1YR9A 2NO6A 3MUFA 5JRZA 2O8CB 2O8DB 2GJSA 4TTQA 5EP3A 4ZI3A 1XMSA 2VP9A 3NDPA 1T4GA 4HYYA 1XTIA 2QNRA 2V6IA 3QQ5A 1QZXA 4B34A 3HU3A 1OH7A 3LNCA 3HWSA 3G0HA 2GESA 2KWIA 4TYYA 3P1JA 3O8BA
chains in the Genus database with same CATH superfamily
1J8FA 1XZFA 5DHTA 1UDAA 3UA3A 1EX9A 2ZK7A 1M6WA 4WCFA 2VZ9A 4NZMA 5HKKA 1RXVA 2EKBA 3DEIA 2QI9C 2W6CX 4MHSA 4G37A 4ED9A 3A04A 3JALA 4UXJA 1E89A 1D0IA 3T61A 2QY6A 4IDHA 1CNEA 5SZJA 4CMGA 3QTLA 2OHHA 2VAPA 2W2OA 3RS7A 1TEHA 3N2EA 3I2KA 3OTIA 3RVJA 1EBFA 3TJMA 4EX7A 4EZIA 1JVSA 2ZM5A 1G0OA 1ZD4A 2PK3A 4Q0MA 5LLDA 3LWZA 3RPEA 3FLMA 3AVTA 1QUFA 3OCYA 1AN9A 4YR7A 2OCKA 2ZYIA 4PLHA 1R15A 4MEAA 4CMKA 2XB2A 2XUHA 2JANA 5IJZA 3CRZA 4UU1A 2G1JA 2YICA 4ILKA 1JAXA 1EWRA 2HOQA 3AHCA 3P2OA 1W73A 3A6HA 4IH9A 1Z6ZA 2IYEA 3EZ7A 4JB2A 2HMYB 2OBXA 5E38A 2CFIA 4PO9A 3ZXXA 4WXHA 4RA6A 4OHRA 1L4BA 1QTIA 3PE3A 2ODTX 4IHAA 4BV3A 5BMVA 1R10A 2R6FA 3CY6A 3ZH2A 3SY8A 4DQKA 3CVUA 3LP5A 2DQZA 3KETA 1CS4C 1XXHE 2C5FA 5KQSA 3FPBA 3GYBA 3UJPA 2PE5A 1U0FA 2G7ZA 3GEMA 1OXKB 3DXZA 3I6ZA 4GPD1 5KYKA 5DHSA 3VVBA 2YYYA 4OB8A 3PX2A 2GAAA 3UMYA 1Z8HA 2GCOA 1OBHA 3OE4A 3SMVA 3BJMA 2BGIA 4JB0A 1GRRA 4EJSC 2XF8A 1KDTA 4P80A 2QQ0A 4UBIA 2E4AA 1QYXA 3D8RA 1WSAA 1Q1EA 13PKA 2HV9A 2P30A 3HMQA 1V11A 3S5UA 3USES 3WK4A 1E3DA 5BNZA 1Z5NA 2FPGA 4Q3DA 5J5VA 3V8PA 3QPAA 2PMCA 3BK2A 2I6FA 4KQGA 4AF8A 2IHTA 3I6MA 4PSVA 1GTL1 1DS6A 1C0EA 2O1EA 1WXHA 1TRKA 3NBZC 1E5TA 1WXXA 1FVHA 2P35A 4J7AA 1QG6A 4ZCLA 4A0GA 1X8JA 4B7ZA 4JI7B 1T8WA 4HEA1 3GOHA 4GM4A 3PCRB 1OWPA 5M2QA 2XMDA 4Y1RA 3B6EA 1T1GA 1UC5B 2A9FA 1Y5LA 3R7SA 3BE8A 3A6DA 3U44A 1YJ8A 5FEMA 2EVWX 2HY7A 3A1FA 5J2UF 3NH9A 2PT9A 4HAIA 1WZUA 3QYFA 3G0DA 4DCTA 2XNJA 2FKAA 2JH8A 1DJLA 3GLSA 3O21A 4W9RA 5T8KA 5CCXA 1XRMA 3AXTA 1CKEA 4QDZA 1UK8A 5F5NA 3WS7A 2PVSA 4FPXA 4G23A 4YAOA 5I7OA 1V5EA 3VO1A 5C32A 1U0RA 2ZJOA 1GNPA 4RPCA 1KYQA 3K1ZA 4BBZA 4EIWA 3ACDA 3MSCA 1SAYA 2QLLA 2XSZD 1FNDA 4XIJA 4IXTA 3ZEIA 1P3Y1 4LBZA 3MLBA 4LJYA 5AHOA 3VH4A 1NSYA 3HNOA 4U63A 4ZT5A 3X3HA 2KMLA 2P1DA 1KTIA 3IMEA 4X64B 1RC0A 3U3RA 3G5MA 3GO4A 2YFHA 1N6HA 1G5FA 5FPHA 1NULA 1Z0JA 3H8SA 3PGLA 2I3AA 3FYUA 5FPPA 2UZ4A 2CV1A 3URMA 5IKPA 2Z5VA 3OC0A 4RXMA 1YZLA 2B7CA 4LZPA 3DE7X 2FMUA 1QG0A 2QTMA 3Q7EA 5BW6B 2OFOA 3AL2A 4LK3A 5FFFA 2HWUA 5HK8A 5KX5B 3ZEAA 1ABBA 3PUKA 4QO7A 3ZW8A 5BSMA 1C9NA 1JSXA 1OIWA 1QK4A 1V5GA 5F1OA 3RGWS 5AVQA 1UAGA 2WI8A 1L7OA 1R0SA 2QVLA 1ZH6A 3G2PA 4UMEA 4C4TA 1AQLA 3F96A 1S3SA 1TPZA 3KEGA 1IUKA 2ZT7A 4GM0A 1QM5A 4JNCA 4CL0A 4QJ3A 2WJJA 5BSEA 4EVSA 4WWHA 1IN7A 2G7MC 3IAUA 2B20A 4PEVA 4H0NA 4BLPA 2EKPA 3H6HA 5F33A 4GI1A 4PN7A 5AM3A 2XPCA 2ZS8A 4QM7A 3NIWA 3E82A 1SFRA 2XMQA 4WVFA 2OLKA 3S2SA 5C7LO 1SHTX 1TEXA 2I66A 4HWGA 3CZAA 4IUBS 2GK3A 3Q85A 3SM3A 2PL1A 1QQAA 1KOGA 2GEVA 1ZD9A 1SBNE 3E3NA 1ZP6A 3AJ8A 3KB6A 4FMPA 4W1PA 3LL7A 3DBHA 2ID4A 1KH3A 4B09A 1KVUA 3ANXA 5CNIA 3ENWA 1XTRA 2PIDA 3BGVA 1G8FA 1MQAA 1RR6A 2VJNA 4UMDA 4YRRA 2VTVA 4HGRA 1NLZA 5LNK6 1KVQA 1ZK1A 3G2KA 4BFTA 4CM9D 2QYTA 2XMGA 2WPDA 4M0MA 1K6EA 1ZFNA 3MT8A 4RH3A 1IATA 5AI0A 3BXEA 2CNDA 1XTBA 5D7NA 4C4AA 2FG5A 4JJ8A 3IP3A 2DR3A 2DT5A 2ENUA 3HR4A 5JW6A 1IB6A 3FBGA 4GWGA 2NP7A 4RSHA 2D5BA 1AKRA 4XWOA 2BHRA 1QTQA 2PUTA 4G4JA 2PQ0A 2NTNA 3M6AA 1L5FA 4N39A 2NTEA 2R2GA 2CZCA 1GAJA 3MF4A 4R2IA 3MJFA 1H2XA 4K9DA 3CSUA 2RB4A 1E9FA 1GQ2A 2R9VA 3WBKA 4KNWA 3FNBA 1SKMA 4HLNA 1R8YA 3N2KB 3UYKA 2JG3A 2AH5A 4LI0A 4AKEA 3JYHA 2QXUA 1KAHA 3H4VA 1J0BA 2IY9A 1IZ7A 4HS9A 4HAOA 1AZWA 1WKBA 4MK4A 1XA4A 1CYDA 2V8OA 2A88A 3OUZA 3HYNA 4R01A 5HCIA 3TKAA 2XT6A 4OU5A 3WK8A 2ZGVA 1D3AA 4P4UA 1XUOA 3AFGA 2FZEA 4GGOA 4JIGA 1OX5A 4DSOA 4RE5A 3ZD6A 3DW1X 3O92A 1XFDA 2JAOA 2PBZA 3RU2A 4ZU3A 4HGOA 3GRVA 3T7IA 4GOMD 4YCMA 4WEQA 4DL9A 1DCKA 1X14A 3HN7A 1DQSA 4P36A 4ZOLA 3AU9A 3HB0A 3EGDB 2PDAA 4RVNA 1X7WA 1DFGA 5KOJA 1FVXA 1NV9A 3K72B 1L4NA 2JFFA 2PS1A 2XJ9A 3TRJA 1KWKA 3DMPA 3MFQA 1BXRB 4JQYA 2PY6A 4Z1OA 5AW8A 1CRZA 2IYNA 2JAXA 2ZATA 1T5DX 3ZNNA 5E2BA 3KJGA 1K5DA 1XZPA 4Q9HA 2NXEA 3EYAA 3MUEA 3OLCX 5AR1A 8LDHA 2WT9A 2YXEA 3PNBA 3T9CA 3U44B 2RH5A 4JLUA 2VT2A 1K7CA 2J6HA 1KEZA 2WJPA 3OBBA 4Y6PA 2ODWA 4TKVB 4FSHA 5IKOA 3B36A 4F2GA 2RAFA 1CDEA 2GNPA 2B8EA 3ASZA 3D1LA 3QUCA 3HKEB 4JCCA 4MUXA 2LZ0A 2P6NA 2R7LA 5IJXA 3H1TA 1MO2A 4IPTA 3EGWA 1K6JA 4FWIB 1UFRA 1Y1LA 4H7PA 4K6OA 4ZVKA 2IP4A 4MRAA 1YK1A 1RRVA 3QUTA 4MEJA 4UZFA 1CR4A 1YCGA 4XASA 1M72A 3PEEA 5FAXA 3U4CA 3D6AA 1K5PA 1SC1A 2GPWA 3M9LA 3ER6A 4JY7A 4BJHB 4EUFA 4YV0A 3I4LA 4LYYA 4OHYA 3OQIB 2BGRA 1SK8A 3W7BA 1YAJA 3MWYW 4EEXA 1QKJA 1T0HB 3PCXA 4HB0A 4C0BA 3QVJA 3EGDA 1YS4A 4UHDA 2WZBA 5BRNA 3NBUA 4F7WA 4QTYA 2AMFA 3GG9A 4NNPA 3IEKA 2FN4A 1WCXA 1EXWA 2C54A 1PFKA 3GX1A 3KPWA 4MW1A 3R5SA 5JLAA 4NCAA 1N2EA 4Q9AA 3KKZA 1VKRA 2BFEA 1EGHA 3VDMA 4KYUA 3RIYA 3T99A 1A71A 1H65A 1P0PA 2IE8A 3Q2OA 4N54A 3KOZA 4YEDA 4CF7A 4IX1A 4YC7A 2MSNA 2ZIFA 1VKZA 1E2IA 1VRWA 3HJCA 2YV4A 1TX4B 4B4KA 4HAVA 2ZZNA 1IQRA 3BBLA 1HE2A 3LWBA 2Z8XA 4BQFA 2D5AA 3JQFA 3O74A 6ABPA 1ADJA 2UKDA 2HCBA 3JY6A 3FDZB 1LNZA 1XIVA 1RWXA 2GERA 5FOQA 5JEDA 3DLHA 4G0WA 2ECQA 2AE1A 4U00A 3SI7A 2XTZA 3WGIA 2WFLB 4MAMA 4RX1A 1OBVA 4TVOA 3WP0A 4F5ZA 3CO0S 2QD1A 2GLTA 3BD9A 3AF2A 4JODA 4ZAVA 4O2AA 4F4CA 4Z54A 3A9WA 3NW9A 2OCGA 3IDZA 4WJLA 2L82A 3NONA 4R8KA 2HLDD 1W9MA 3N07A 1PT5A 1WNFA 2QW1A 1F2UA 3CSDA 1H2YA 1MG5A 3EXEB 3BFPA 3C41J 5CVJA 4AF7A 1FXSA 1Z6YA 1EYZA 2PT7A 3RKRA 2XXAA 3DMTC 3WK9A 3EY4A 2VJDA 5G0SA 3OQJA 1RRMA 3MPOA 1AK9A 1GN9A 1PJ8A 4WH0A 1Q14A 1BD4A 5K7SA 1SXJB 2R4TA 1ADYA 3E18A 1W5AA 1VKHA 3OZDA 4ZVTA 5JWOA 3Q0TA 1KDYA 1M75A 4YRLA 2A84A 3CU5A 3HRIA 3LX6A 4NLLA 4NZZA 4OO3A 5COQA 1UL1X 3IVRA 3QX8A 2HWWA 1EFLA 1RRGA 4DDTA 1EDBA 4NOKA 4QXRA 4CQMA 1G9TA 4ZDKA 2B8TA 2IU4A 4K9SA 2H2HA 3H65A 4RJ2A 5JH7A 3ESDA 4WZAA 4NDZA 1DCFA 4CU2A 3ZCXA 2O19A 1H2FA 2JBAA 4B47A 1GCIA 1KS9A 4JS0A 4MR9A 3USZA 3KUXA 1E2BA 5B12A 4XTRA 1S9HA 4O3MA 1JPUA 2IWHA 1E0DA 3OP1A 3IYLW 4QC2A 3OBIA 1NQXA 5NLLA 1EWVA 1Q77A 4OP2A 4UFPA 2PQMA 1E5XA 3QVSA 4QHYA 3UIEA 1PNRA 4GNKA 4QDKA 5KTRA 2ZUEA 1M2JA 1Z22A 1XMQB 2D2IA 2NT4A 1IOVA 4G24A 1P91A 2YBDA 1K3UB 4ABTA 2JDIA 3I1YA 3AHEA 4H77A 4RPKA 3X0DA 4WY2A 4P3PA 4BE9A 3NORA 3ERCA 1C0KA 1HRKA 2ZYSA 2ZIUB 3OJLA 4OU4A 1SVNA 3AESA 3ETNA 2VZ8A 3JWPA 5AJWA 5M34A 2JRLA 3RAGA 3A4VA 1LWNA 2FOXA 2QWXA 1UQTA 1V8OA 4U6QA 5D8DA 4B3SB 2V7TA 2LGJA 1ENZA 4IG9A 5DGTA 5B53A 2FPKA 3D4OA 1PLKA 2HNKA 4AO6A 4IL5A 3MCTA 1U7DA 2VK4A 1TA9A 3FDZA 4RPJA 4M98A 1MT3A 2R8RA 3H0EA 3RE1A 5LP6A 3OZXA 1OAOC 1DV1A 1QKKA 4I36A 4RESA 1G5QA 5FFMA 4V0ME 1L5RA 5JO9A 1EH5A 3W3AD 2AWNA 1A5AB 1CZLA 4UVHA 1U0HC 4GKAA 4OGWA 2GJ9A 5ALKA 2FQYA 4RTPA 2WWYA 5G4KB 2N1MA 4TV8F 5EG5A 1ZZEA 4U3JB 1P1JA 3Q1LA 1RQLA 3LP8A 4HRXA 1XX6A 2GS9A 3PDHA 2P3QA 2J7PA 3MJCA 3EC2A 1OT5A 3MYYA 4G97A 3IUYA 2XDQB 5BSRA 4JQZA 1CRPA 1G3IA 3NP9A 4BNWA 3RRJA 2BC9A 3KZOA 1MZVA 1AGXA 2OPBA 3L4EA 4FK8A 4E51A 4BDTA 5D5PA 5BN5B 3CF4G 5H68A 2EJVA 2IS4A 1D2NA 1SNYA 4PONA 1F1BA 1EUZA 3HO6A 1UBOS 2ZT6A 4ND3A 4NZ9A 1G8GA 3MWKA 2I1QA 4ZRDA 2C1XA 2WDZA 3AJRA 2HDWA 3FVQA 3WB1A 5E1DA 2WILA 3PR2B 4X8HA 3V9PA 1JR2A 2W2LD 4G5RA 4L7VA 1ZUNA 4ZQBA 2PH5A 3BTSA 2WWVD 1GLNA 1YVPA 1X1AA 3PDCA 3R2JA 4MAAA 1QONA 2EERA 3L3BA 3LFTA 2GN8A 4RK4A 3S3TA 3UMSA 3FDXA 3HVIA 4AICA 2VWGA 2AG8A 1P29A 4R51A 1U5CA 3JAKB 4NBWA 1JHQA 2YWRA 2ZSAA 3R7BA 1BMQA 1N2HA 2YVLA 5BN4B 4CL2A 1B7GO 1OI7A 1U4SA 1E2PA 2CVFA 4H4EA 4X7RA 5JXWA 4X92A 1XMJA 3CF0A 3PX7A 2AXPA 4KDEA 1CJCA 2FEKA 2PSHA 1QS0A 3BMQB 4KXQA 1Y1QA 3ND9A 1N9ZA 2DECA 3CYFA 3IXLA 1PW7A 3C6ZA 1E94E 2Y77A 3FR7A 1DQRA 2J41A 2ZJ4A 4K6CA 1GDHA 1MIOB 3WAGA 4IHJF 4BATA 1P6QA 1NVEA 3OT1B 4KJXA 3UG6A 3EUEA 1ZMXA 2ODNA 2B69A 2WWHA 3IQIX 3QVMA 3MCZA 3DHYA 3W7AA 2ESRA 3G79A 4URUR 5EZYB 3X1MA 1FYXA 1SCJA 1NJ6A 1UOPA 1XEXB 3C74A 3HCPA 5DVZA 3T94A 4IJ6A 4DEVA 1U94A 1KI3A 4ZVPA 1M2EA 5BUCA 1JALA 3DBLA 5EUQB 2BI4A 8MHTA 3ZWDA 1KDOA 3F6SA 2IODA 1PTJC 3LRTA 3TTVA 1A9PA 4ZP1A 4C3OB 4DG5A 2GHRA 4EF6A 4EKEA 1OLOA 1IRXA 1S8FA 4JI4B 5FP0A 5IC4A 2DMRA 3O90A 1OU0A 1NJ8A 4L02A 5KAPA 3ZHZA 4W5NA 1RLMA 2H1RA 2IXFA 5BN3A 3AIIA 4HWTA 4PHFA 5ECGC 1FK8A 1LS1A 3R0QA 2QLBA 4G84A 1Y5IA 3V4PB 3CRW1 3FZQA 2BM1A 3UH1A 3CJTA 1JX6A 1QXSA 1UP4A 5B37A 4D41A 1XRPA 2WNSA 1PZEA 1ZUHA 2ZSIA 5ITWA 3SQMA 5LMZA 4UDOA 2ORED 5TX7A 1O97C 3ZXSA 4PPFA 1UJBA 2JB9A 1T2UA 5WRFA 2A4MA 5K0BA 3ILSA 1RXEA 3DTYA 1YU6A 3S1AB 1T6BY 2AUMA 4E4YA 1C4KA 2V1XA 3L05A 4HBZA 2AIRA 4HDQB 1QAMA 3IPLA 4LGMA 4TQAA 1RRCA 1WU7A 4D25A 2BZ1A 4V0QA 3A4YA 2QMHA 4NBLA 4S1WA 2IPOA 1YMVA 1VHTA 3NT2A 4DW8A 4EEKA 2VK2A 1I3NA 4CLRB 3TSOA 1VCHA 1M2OA 4C29A 3PPWA 3OLWA 4TLEA 4KFCA 3UJ9A 3X43A 2VJQA 3M4XA 2JAWA 2ZWMA 3LX5A 3OSUA 4JL6A 3SFZA 4XCXA 3N0RA 3NGMA 3PHLA 4K81B 3IJPA 2HJGA 2ZIAA 1Q1QA 3OOYA 1GTRA 4LZWA 1W0JD 3D4BA 3Q40A 2VLBA 2HCRA 1EGAA 3AT1A 3EIWA 3NUZA 4L6AA 4YMHA 5AH0A 3SHFA 1YZTA 2D4AA 5ICEA 3JQ9A 5BN1A 1GKKA 2I6GA 2JAHA 1VMIA 5CAEA 2WTAA 4MWCA 1JKIA 4TX1A 2RAPA 4LNUB 3NDRA 4H1WA 4X91A 4DA0A 1BQEA 1RIIA 1TJ3A 1M66A 3NHFA 4INPA 4EJFA 4MGHA 3STHA 4JKOA 3U0BA 1Y6FA 5D01A 2MSLA 3GIDA 5CDTA 1HSZA 1MV5A 3AOGA 5F1KA 3ZCQA 1IK4A 2XV1A 4R3NA 4LFAB 5B3LA 5CEEA 1SC4A 2OT3B 4BP9A 2IKQA 2PL9A 3PVZA 1U3FA 2RGYA 4BZWA 1THMA 4M1WA 2FHPA 1C9EA 3FSEA 1ATZA 5KJEA 4O5AA 3AZPA 4PAWA 2OXIA 2I9PA 3B7WA 4NNJA 4RO0A 1S5PA 3GUZA 1CQZA 4IHKA 3U3MA 3WGKA 2Q29A 2FQWA 3H0CA 4HLQB 4CKWA 4BFCA 3LA6A 1TJ5A 4FYKA 4QDXA 4EFKA 1CUEA 1NXPA 1TQ8A 3K0FB 5TF0A 5BSWA 1JIUA 1X7XA 1T15A 2ZRJA 4DCJA 3QEMA 4WZZA 4A1OA 5ELLA 4K6KA 4AD8A 2NGRA 1C0IA 2G77B 2DXIA 2NTJA 3RJ5A 5KTNA 3HVJA 4HHEA 2HMTA 4R2KA 3NG1A 2JARA 1X80B 2VRBA 4MA5A 1JKXA 1NHGA 2WYOA 3T9AA 1SRQA 3OO1A 4GWLA 3C3AA 3A3PA 4CLOB 3L41A 1L3IA 4OI0A 3I0NA 2MYNA 3BCSA 3UGTA 4CKZA 4RJJA 4WRRA 3ZU5A 1ZDMA 2IITA 3CBQA 3KDSE 4LI3X 1E9AA 4QA9A 3MLEA 5EXPA 4PZPA 4PNHA 2WJAA 2D1RA 2DY1A 2QX4A 1NMSA 4R1OA 4AZSA 1N5RA 1RKQA 2JHCA 1DEOA 2EARA 1CP2A 5ERYA 1SB9A 1TYBE 3I9LA 2GFQA 1QFZA 4W5WA 3RTBA 4EPXA 5BYKA 5KNCH 3KPVA 2UZ0A 1OI3A 5KVAA 3FB1A 3RYTC 1A98A 2W11A 3PEUA 4OBXA 2F59A 5IKEA 1UDWA 1CJBA 2AN9A 2O50A 4M1YA 3KXIA 9LDBA 1T4CA 4RK0A 2ET6A 1BXKA 4L3VA 4C7XA 2X4GA 1T1RA 3DAGA 4CF3A 4BQQA 5AMXA 4G0XA 4G09A 5LNK1 1KQPA 3C7AA 3P32A 4LY6A 2AJCA 4P31A 4FR2A 2NO1A 3M9XA 3I2HA 1BX0A 1F9EA 3NR2A 3M1YA 2E7ZA 3BC1A 1JAYA 3OD1A 5AIAA 2RHMA 1K6MA 2OK8A 2TMDA 1E2EA 3SZ3A 1ISHA 2IXBA 2YHUA 3OICA 3NBAA 3V6MA 3U7HB 2VAWA 2WUFA 1ZJWA 4FLMA 2QW8A 1W94A 2C5HA 4JU8A 4O2BF 1E60A 4L2IB 4LY9A 4JU9A 1L2TA 2HCJB 3HXPA 1YZKA 4OB6A 4Q1VA 4V0KA 4WADA 1GPLA 2C82A 2P91A 2VP4A 3A6LA 3FNHA 4V3CA 5C2JB 3RVQA 3VR5A 2Y1KA 3HZZA 2X0KA 5LVAA 1OTHA 1C3XA 1NT2A 1PD1A 4KI0A 2WSIA 4LJ8A 3K1TA 4DLPA 3ZJVA 4BP8A 3PEVA 1WXWA 2YYZA 5JDIA 4B8ZA 4ZHQF 1Z8FA 2PH1A 3R75A 5BW4A 3W9SA 3Q8WA 4INJA 3ZY2A 1ZOSA 5K4GA 2JIQA 3GDOA 1S02A 5LXTA 3PGXA 4O1MA 3EIHA 4KYVA 1LSUA 3C2QA 3V8MA 3VZPA 5DHPA 5ALEA 3H7AA 3KZCA 1TYEB 3V55A 3AUKA 2BFOA 2FPIB 3IURA 2IEYA 2IEDA 3NM6B 4DBLE 1AUOA 2OXRA 4PC7A 5GOTA 4B6RA 4IWYA 3CVJA 4HYEA 1KZHA 3UJBA 1M6YA 4JBLA 4RMJA 4I2NA 3VOSA 4DIKA 2OQVA 4D1YA 2ZVQX 2JFNA 2YZMA 4DR5B 2VR1A 2Y68A 5FCDA 3L7MA 3TCKA 4A8JB 3H2YA 3RDPA 1H4QA 2G9NA 2Q2OA 4PW0A 1UOEA 3VU0A 4NCXA 3TZCA 4FOOA 4JVOA 2NVUA 4MRPA 4XPIB 5SYMA 3U4GA 3ZQ4A 4HI0E 1LVUA 5AW3A 1GUFA 4PFSA 3SAJA 1XGKA 1CTQA 3FF1A 3L04A 1V4BA 4OQZA 4X3OA 2VTEA 3LKBA 5GAJA 3TTXA 3UW1A 4BTLA 1Y1SA 5GMOA 4W8HA 3GMIA 1YK0A 4C20A 2O2XA 1UFQA 3GLKA 5KKNB 3K1JA 2W6OA 1IAVA 1QDUA 3FKSA 3HKCA 3TE7A 2X0RA 5GJWC 1RC1A 4IOMA 3REQB 1QPZA 1KPIA 4D6XA 1DX4A 1CG6A 4RENA 1PQ4A 4RFSB 4BNGA 4BUCA 4NULA 5DU2A 4OLJA 3WAJA 2QT1A 3RWMB 4IDCA 3H9EO 1FDVA 4PNZA 3OM1A 5FR2A 1MN6A 3Q7IA 3DKRA 4C7OB 3OY2A 3PFGA 4I9UA 4E2YA 3ZZUA 4P84A 4C6RA 1XMXA 2PANA 1KEVA 3GLFE 2CYCA 2CFTA 1JHRA 2XKBA 3EEYA 3O1IC 2VNAA 4I1VA 3ZU3A 1QRUA 3L1UA 3BERA 3EARA 2ZR9A 4FHCA 3DB2A 1QGAA 3EF3A 4J6FA 3T3NA 1QGUB 3MQFA 2ZTMA 4B33A 2V5UA 2ZSHA 1Z25A 1L5QA 1FYWA 2GK7A 3FJOA 3KKKA 4L0QA 4LX0A 5H3HA 4CJXA 4NCIA 2YHAA 5LJIA 3FWZA 2GN2A 2DWOA 2W6IA 2IZ6A 2WG0A 5DEOA 3ONDA 4WW0A 5DN9A 5IDYA 2VDJA 3ETCA 1CJKC 1CR6A 3GV0A 4KE8A 1K75A 3TECE 1LPPA 2JLBA 2QUKA 1X9IA 5GZ6A 3VSDA 1WBDA 2IXTA 2YY5A 1FLAA 1MKYA 1U2EA 1UXJA 4O2BA 1YRLA 3B8HA 2Z3ZA 1PR2A 1MXFA 1IJEA 3ISVA 3WL4A 5ICGA 4JYZA 2FQQA 2WMOB 5DISB 4OV6B 3M4JA 4TL8A 5G2OA 2X7XA 1U4OA 3QIAA 3A26A 3D0QA 3VDXA 1EWYA 2Q5EA 4R9NA 1BWQA 3QEOA 4NF2A 1TM1E 4LV8B 4C7JA 2JCGA 1GARA 1U7OA 2VOJA 3H16A 1L5SA 2BMDA 4XM0A 2RKOA 4FXOA 4A16A 1JDSA 1M2KA 4FNAA 4YLGA 2JGLA 4ZCSA 2VJCA 3WDKA 4W7SA 1KAOA 2O3TA 4DEYA 4H3VA 1PWZA 4TT3D 4GMDA 1XHFA 2VA9A 3KD2A 4C0XA 3EWIA 4XD2A 4DLXA 1SHLA 1U31A 4RD2A 3ZBQA 4PZ0A 1U6KA 1QHHB 3AM4A 3K32A 3U26A 3BEOA 1AC5A 4EUKA 4F4JA 5DOZA 2P65A 1P18A 4R2JA 3MIZA 1AY0A 1HOXA 4G0YA 4BRWA 2Q3DA 1P7PA 1XXLA 4NR0A 4YP5A 2IYAA 3HGTA 1RHMA 1OU4A 1T24A 3OOSA 5IZCC 5EWJA 2CKMA 1IZZA 3CUYA 1BMTA 4EHAA 1RWBA 2BFFB 1KR5A 3PLAE 1KDPA 1SCKA 4YJ3B 2P2GA 2PZEA 3TAXA 1C50A 1XJ0A 2AV6A 1BFKA 3UK7A 1E61A 4UVGA 2CJFA 2CXOA 2Y1OA 3R6GA 4H1VA 4GLJA 2FRVA 1QIKA 1RHRA 4YCJA 4YN3A 5JV5A 3PS9A 1JJVA 1HNNA 5KNBD 3O5AA 3WQBA 1OH6A 1P7VA 1TVKB 3L2OB 1DAMA 3V80A 1V1RB 3OM9A 1H93A 4L07A 2O0HA 3DZ8A 4IXNA 1TKRA 3F1LA 3VPAA 2BSQA 1BHQ1 5ALTA 3EZXA 2W0MA 3LPAA 5HM6A 4PS0A 2B78A 2PZMA 1PUJA 5CTJA 2OZPA 1O96B 3TTWA 1E9RA 1O03A 1Z0UA 1Z56C 3AR6A 4RCYA 3S40A 1DXYA 1E2FA 3KLOA 4YIKA 1N2SA 4W5RA 4R9VA 2WFMA 5HFAA 5SZHB 2G1KA 3SYKA 2CC2A 5BUSA 5BSGA 5EJ5A 3KKQA 1X3LA 4Z2YA 1K0UA 4UDYX 4IFEA 3I2IA 4UU7A 1O94D 4MJ3A 1KMQA 3GEBA 1IC6A 2W2QA 1B23P 1JEOA 5BUZA 2H2AA 5BSKA 3AEKA 2V4UA 1F9AA 1U0BB 2MT9A 4REQA 3DWIA 1N0WA 2JLAA 3A10A 1IZ8A 4MDFA 4D0NA 4EHBA 2IOFA 1N2IA 3NC0C 5HRUA 5F7OA 1AM4D 1AMUA 2G6BA 1NSFA 2EC5A 4WZBA 1H69A 4C4PA 4TMTA 5HS6A 3GU3A 3MJHA 3IIIA 2GA8A 2Q27A 4LFBB 1XZMA 4EG0A 2N47A 1OOEA 4MVWA 1IY2A 1DBIA 3OPYB 4MAFA 4EG7A 5ES4B 3LF2A 4B48A 2VLIA 2H1OA 2J31A 1B2LA 4AIRA 3PNMA 3T4PA 1DVRA 1X3SA 2D7CA 1K68A 2GTPA 3AM5A 2NG1A 3E2PA 3NTOA 2D1SA 1TCVA 3OQVA 3EDQA 3M0EA 4PXSA 1IBRA 5I4KA 4D26A 2WP0A 4LWZA 3ZE7A 4PVCA 3JSXA 5KYYA 2HPAA 1I4OA 3D3WB 4ND2A 3RH0A 2DUNA 3C3YA 2HI0A 4W4TA 2Z6QA 2ACEA 3M5CA 1WU8A 1ZH0A 2TS1A 4B3HA 1XJ5A 1Y3BE 1Z5PA 1ZKDA 2O06A 4HAWA 1A69A 4OXYA 3V3TA 4XX0B 2JGJA 3L6CA 2GN6A 4QYSA 1ISPA 4MVJP 3OT5A 1JU3A 1HQKA 4LZNA 1XDZA 4KHPB 1A88A 4TLCA 2O8EA 1PYDA 4FYJA 1XMVA 4U9IS 4TSFA 2IX9A 3U81A 3VPGA 1GUYA 1UPXA 3DEZA 1UM9A 4M3NA 4JUDX 2Z9CA 1I2ZA 3F6RA 3O2NA 3N5CA 4ZEWA 5U1PA 2Y6VA 4G63A 4BEWA 3WYDA 3DDNA 3BFVA 5B1SA 3I05A 1Y8QA 1A2OA 1RWWA 3KUCA 1CD5A 4LJ4A 1QGZA 3CZ5A 2YYAA 4KAFA 4KO8A 1WV0A 4PV7A 2F55A 4N3CA 2HL6A 2VF5X 3BUSA 3P97A 1MRZA 3BRWA 2E1PA 3PPYA 4RVSA 3ZY5A 3DG9A 4EUEA 3BTUA 3LE8A 1TU3A 2UXCB 3TF5A 3VNVA 4KR0A 3GZ4A 3HP4A 4ZOLB 3LCRA 3IH5A 1UXGA 4D56A 3VVMA 4E13A 3NT4A 1GG5A 2JFXA 4KKXB 4ERXA 1L7EA 1TT5B 2PKYX 4P82A 3IPAA 1TQ6A 2OGZA 2NU6A 5JSHA 4X66B 4ZYVA 4DUGD 2ZRCA 4LJKA 5C1DA 2VXYA 2DC1A 5I7AA 3HRKA 3PKJA 1ZEMA 1U2TA 1YI1A 1VHJA 2XBMA 2Q2VA 4WLOA 2G9ZA 2K87A 4M99A 1GZ6A 4YROA 2FN7A 4OM8A 5CLQA 3KYJB 4BGEA 2C2YA 2NO4A 2NU6B 1G7TA 4IWXA 3AKCA 3ZDXB 2XNCA 4IH4A 1GCGA 1EQUA 3ZI4A 5A6VA 2WG1A 3GT7A 4RMNA 3WGGA 2JLSA 3MVEA 4XJSA 2GB4A 4N5HX 1U8TA 4QU9A 5AW0A 1VCOA 1C4XA 2P5UA 2HM7A 3OETA 1JTVA 4Q66C 5E3JA 4DSTA 4YA6A 4DFDA 2PXXA 3LNTA 3HPRA 4EB8A 1PJSA 3RSCA 3HR8A 3P2JA 2PD4A 5GZ1A 1IVNA 1LFDB 5E8RA 5H02A 5LCXA 4IDQA 3D2AA 5CUQA 5C34B 1E64A 4Q4HA 4HV4A 5E6SB 1Y6QA 5JU6A 2F7SA 4GX0A 3H9UA 5KYNA 3OEYA 3SM9A 4OUKX 4PO8A 2JGAA 4F3TA 3CZQA 1R0XA 3PA6A 4R81A 5D51S 5ALUA 4CMIA 4FJ0A 1RWOA 3DBRB 2DWPA 3IKMB 2CXPA 3P4UA 2WAAA 4MP3A 2ERCA 4P92A 2EX4A 4JBWA 1SU7A 3ZK9A 1XI2A 1JDBC 1CF4A 5A05A 4WASA 5TIIA 4I1PA 5DE3A 2AEEA 2Q5OA 3CH4B 3F7MA 1CK4A 4IZHA 5K8IA 4EP1A 5MFZA 1HDOA 4YQFA 3BXPA 4Y9DA 3UHPA 1Z6PA 3ITNA 4G5GA 5KWEA 2R6R1 4DV7B 4MI6A 2CUTA 1JHOA 5EKDA 1E3MA 1TC1A 1BKYA 4IUCS 2X8AA 3BTOA 4OQNA 1TYZA 2MSWA 3GROA 3GMDA 4Q7QA 5B7NA 2ZTHA 4NH0A 5CDUA 2BOVA 2AKAB 1A9XA 1VSVA 4BNVA 1H2HA 1MJ5A 5DFAA 5EMMA 2ETXA 3ED1A 3L9WA 4MV9A 3JR7A 5IAGA 1DG3A 4LMAA 2D74A 2HMAA 4AO8A 4BWFB 9ATCA 4JOQA 3NAMA 4Y1GA 1NBWB 3AU8A 5B1EA 4NJEA 2SHKA 4LV5B 1G2QA 3QI7A 3JVEA 4TTSA 4AZVA 5L3SB 3ZDBA 3QYAA 4MOWA 4HGQA 1VIAA 2X2FA 4RKQA 4F84A 3KQQA 4ZZ3A 4DCVA 2XD9A 4P81A 4X71A 3IODA 1R9NA 3JU3A 4XRGA 4HP8A 4TWBA 4EW3A 2J85A 2XTAA 4NYJQ 5A4JA 3M7IA 3M33A 3UXHA 1NUQA 2BKAA 3D9QX 3BGSA 2JFUA 2YMQA 3A4IA 3ULKA 1J99A 3G1WA 1B6GA 4BB0A 1JJFA 1ZRSA 2HZ7A 2XODA 3KQMA 3PXBA 3VH3A 4XOUA 3LDGA 5DP1A 3ZLJA 3P9XA 3QE2A 8GPBA 3I32A 1V2HE 4EQ6A 4F12A 2BBWA 4KU4A 1TEZA 2VN8A 3LXXA 4KO1S 2XCRB 1CY0A 5FBRB 4PQEA 1EESA 1DSSG 1OWLA 2Q5FA 4FFDA 1UJ2A 1NOKA 5A2QA 2OBYA 4W8OA 1PHPA 2JI9A 2PM8A 3C5EA 3GD7A 3M3HA 1OZGA 4O63O 1TO1E 4N9QA 3TL6A 1K98A 4LXYA 1DWUA 1PJQA 5AW4A 1ZO8A 3L7CA 3RS5A 4KVFA 1A5SB 4II3A 5JNTA 1YJCA 5EP4A 3TXAA 2QQEA 5HF8A 4E5YA 5JLJA 2YDYA 5FTKA 3LBFA 5DLPA 3WB9A 1KORA 1WXIA 2M98A 4FNMA 5ESWA 1UWKA 3OLVA 3QPDA 1NFRA 1NNSA 1SCIA 3A6KA 3NAGA 4IIDA 3TIIA 3OOWA 2ORYA 5KOIA 2GD1O 2RHRA 4MWGA 1N75A 1XALA 2P9YA 2I4NA 3EY9A 4RHEA 4F3YA 4OAPA 4HDNA 2GGSA 3MTEA 5BNIA 3L0IB 1MC8A 4MWSA 4ZVLA 4JFAA 1GRVA 3OIYA 3AFNA 1ORHA 2IJGX 1J25A 3ITDA 2G3YA 4N6NA 4NI5A 4WFIA 4XD7D 5DLQC 1P2FA 2G0TA 1SULA 5KSOA 3QX3A 4MW7A 1Z88A 1HORA 1QZTA 2PMWB 4FDMA 3K05A 4UBOA 4FFWA 1W1UA 1M8GA 3K9NA 3KYBA 3SE0A 2D8MA 3GLFA 2VDQB 5E9QA 4CUKA 2C20A 1OV4A 3AUJB 1KP2A 1S6YA 1XZDA 3GZTB 4DARA 2I7XA 2PZ8A 3GA5A 1F2DA 5EGNA 5KC9A 2HZBA 5L6LB 3ETDA 1LSOA 3PHGA 1ARZA 2VYVD 2ZIWB 4GMFA 4QQKA 3WFJA 2Z5FA 1SUIA 1I7QB 2X3UA 4BBJA 5IANA 4G0UA 4WERA 1F3LA 2H0AA 2HAEA 1FFEA 4F8EA 3S28A 1NJ2A 1OLUA 3ITKA 5JSZA 2G76A 3I0ZA 5DCYA 2SCUA 2F67A 1OW3B 3NTUA 1SG9A 1TCCA 2C9CA 2V54A 1VGQA 1L4MA 1HL7A 1ZHHA 3ITEA 4QECA 3T5DA 2EU8A 3JZMA 4MVJD 4NX2A 4B6EA 1SR8A 1GO2A 1U3DA 1UBRS 2QTGA 4LGYA 4O2AB 5E4FA 4B7AA 1CWUA 3EFBA 5ICMA 2IYQA 2XUAA 1PKEA 1YQDA 1MC1A 2VT7A 4IOLA 5DM60 2I34A 1E63A 1U7XA 3GGGA 1W8IA 3BMNB 4JBNA 4O2RA 2UYHA 3I6IA 5CTAA 4KX3A 4G9BA 3FY4A 1CUIA 1A5ZA 3CUEF 3W04A 4R2WA 4A8HA 3S8YA 4ZARA 1ZZGA