3AP7A

Crystal structure of the galectin-8 n-terminal carbohydrate recognition domain in complex with lactose sialic acid
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
151
structure length
151
Chain Sequence
b'SLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSVKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-8
publication title Galectin-8-N-domain recognition mechanism for sialylated and sulfated glycans
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 34
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2010-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ap7A00
1FV2A 4XE9A 1FATA 4LBLA 3IKWA 4BMBA 3ILRA 5DXDA 1BYHA 3ZXKA 4Z8BA 2R0HA 1UN1A 1LU1A 1DQ6A 3AX4A 4P9WA 4YFWA 4YM1A 4AGGA 3ZYPA 1W6MA 3ZXJA 2H0BA 2AREA 4FPYA 3RMYA 1KDKA 2WSUA 3VKOA 3IM0A 1GYKA 1BJQA 1S0JA 4KBBA 2ZGRA 4XJZA 4AYUA 4FQZA 1N1YA 1H30A 3N7KA 3BTAA 5CBLA 2D6MA 1WD4A 3AJYA 1QOSA 3QLQA 4Y1XA 4FOQA 2OVUA 2ERFA 1AX2A 1VIWB 3FLPA 5T5JA 2R0FA 4CRQA 1Y7BA 3WUCA 2W68A 2D6NA 3V0AB 1HQLA 2ZHLA 3MEPA 1FNZA 2GN7A 1DLLA 3T1MA 3KQRA 4Y22A 2P3KA 1IS6A 3N35A 2GDFA 2DVGA 3ILFA 1GZWA 4YW5A 2EF6A 1ZM1A 3M3EA 4M3CE 3B01A 1N3QA 1QDCA 4YLZA 1YO8A 2V5YA 2W39A 1JHNA 3R05A 1SBDA 1AX0A 1SLLA 2LALA 4YW1A 5GLWA 2GNDA 4C1WA 2KM2A 1CJPA 1W6QA 3WG2A 4DRRA 4UW4A 2A3WA 2VXRA 4XJ8A 4YM2A 4YZ5A 1IKPA 1LHOA 4ISRA 4FPCA 1LOBA 2W52A 3AYDA 3WZ1A 1F31A 5L73A 3SNMA 2XG3A 5JMCA 2EAKA 2P37A 3FFZA 3APBA 1SCSA 1MS1A 1GKBA 3ZXEA 1JXNA 1N1VA 4HANA 3OYWB 3FUOA 4DS0A 3AK0A 2C5DA 3OBRA 3WG4A 4XIOA 4BPZA 3BIWE 2ZGUA 1UAIA 5CNAA 2DU0A 2Q5TA 2WSVA 1AVBA 1LODA 5T5LA 1LESA 3B9CA 2E53A 4XZPA 3AYEA 5KXBA 4XXAA 2DUPA 3ZSLA 4HL0A 5BYNA 3VKNA 3WVJA 1EPWA 3AFKA 4XMIA 2AUYA 2WKKA 3AZXA 1W6MB 2WLQA 4AWDA 4I30A 5T52A 1DQ4A 4Q1RA 2R49A 5IK5A 2D44A 4WVWA 1JUIA 2WT2A 4YZ2A 2EXIA 1KJRA 2ARXA 3QCWA 4TZDA 2I2SA 1LCLA 4Y1YA 1PZ7A 1QF3A 1Z0HA 1IKQA 4XJUA 1AX1A 1QNWA 2WNEA 5T50A 4YG6A 2GMPA 2RHPA 2ZKNA 2A3YA 2PHUA 1ZA4A 2CTVA 2D6KA 3WLUA 2CWMA 1Q8PA 1YYNA 1UKGA 1FX5A 5GALA 2D6OX 4Y26A 1DBNA 1SLBA 3O0WA 4GKXA 1QOTA 2DWRA 2PHRA 4Q2FA 1B09A 2AR6A 2AGSA 5JOYA 1ENRA 4Y22B 1N47A 3ZSJA 4AVTA 4JRAA 2A7AA 1DQ2A 1GZ9A 4AVSA 2AYHA 3R4SA 3WV6A 4BM8A 4GWNA 1GZWB 3T2TA 1ULFA 1UPSA 5JDBA 1ULGA 1LGNA 1I3HA 3WG1A 1W6PA 1C4RA 3AZWA 1YIFA 1S1AA 2NMOA 4UW6A 3WDYA 3MW3A 5HCFA 3FBYA 2UWCA 2ZA9A 3N7JA 1MS9A 3I4IA 4U2AA 1W6QB 1KJLA 2PHTA 5F9TA 1IS4A 4FOVA 1MACA 1GBGA 3M1HA 3Q9OA 5F5QA 3D4KA 1MVEA 1W6OB 2OUHA 1A78A 3M3QA 2DV9A 1UX6A 3W59A 2ZGPA 3M3CA 2E7TA 4XHXA 1SLIA 4H55A 3UJOA 2JD4A 1G7YA 2R1BA 4JCKA 4YZ3A 2B7YA 5H9PA 5CB7A 1GICA 5E89A 3SH5A 1WW6A 1LGBA 2VU9A 2DTWA 4WV8A 4XJWA 4ISQA 5GZFA 2ZGMA 3LSDA 4UW5A 3RQ0A 1DQ0A 2BQPA 5IUQA 3WDVA 2ES3A 2EXHA 3B00A 2EXKA 4DPNA 1LOGA 1SLTA 1PZ8A 3OPZA 1BQPA 2DVDA 4FQ4A 4GA9A 3N3HA 4BMEA 3INAA 4GWMA 2ENRA 2JE7A 2UWAA 1JOJA 1OFSA 1WW4A 2D3PA 3GNEA 1DQ5A 1A3KA 1JYCA 4XXPA 5GJ6A 4DFSA 3ASIA 3AYAA 1H9PA 1V6JA 4M01A 4K1ZA 1LHUA 2VW0A 4LBQA 4BLIA 3MW2A 3AP5A 1CR7A 4LBOA 3VKMA 3PJQA 4CZSA 1G9CA 1GNZA 1S0DA 1LOAA 4PCRA 2GMMA 2OUJA 2YY1A 1PZ9A 5DUUA 4YW4A 3WHUA 1S0FA 4BOWA 1CESA 1GZCA 3N36A 4K20A 2YROA 2UU8A 4ASMB 2YV8A 2D6LX 1I1EA 2XB6C 1CN1A 2FHRA 4AGRA 4BQ1A 4XYXA 3OJBA 3O5SA 1V6NA 1QNYA 4FP3A 2A75A 3ATGA 4U36A 5H9RA 2E51A 1WBFA 3NV3A 3WDWA 3ZXFA 1KQRA 1RIRA 1W6PB 1GLHA 1AJKA 1O4ZA 3SH4A 1Q8SA 3AXEA 3AXDA 4FPOB 3D6EA 3GALA 4FPLA 4YZ1A 3A4UA 2NMNA 3AZZA 3OY8A 2A6XA 4YZ4A 2ZHKA 4Y20B 1KITA 3AP7A 1C1FA 4PF5A 3USUA 2OW4A 3VUOA 4M3CA 1QU0A 1WUVA 5H9QA 2YMZA 4LBQD 4K21A 3A0KA 1JYIA 4XTPA 2DYCA 1WCSA 4ATEA 1JN2P 1VALA 2ZGQA 3PVEA 1WW7A 4AVVA 4LBKA 3M2MA 1SLCA 2A70A 2W08A 4XJAA 1LEMA 2HYKA 4YGDA 2WQZC 3FLRA 2WT0A 5T54A 1W6NA 2YXSA 4PQ9A 2CNAA 3AJZA 1V6OA 4LBNA 1DYKA 1DIWA 2UWBA 3ILNA 5EYXA 2EIGA 3O0XA 5AVAA 3AZYA 3WNXA 4YM0A 1IOAA 3ZVXA 3FLTA 1MS5A 2PHFA 1ULEA 1LENA 3IPVA 2DVFA 4RL7A 3V65A 1H9WA 3WDTA 1MZ6A 1G9AA 2DUQA 2Z42A 1LGCA 1DQ1A 1LECA 1VAVA 1FAYA 2NN8A 2D7FA 3OBTA 4TYSA 2D3RA 1R1ZA 4Q26A 4XMAA 3RRDA 1GNHA 3LSEA 1CIWA 4MYEA 2ZGNA 1Q8VA 1ULCA 2CY6A 5GLVA 4CTEA 1U0AA 5IK4A 3ZPYA 3POWA 1SBEA 2DU1A 1HLCA 4ZXKA 1SBFA 3NV1A 5GZCA 2ZMNA 1X50A 4D69A 1V00A 4XJ9A 3AP6A 1QKQA 2ZBJA 3LCPA 4YW2A 1BZWA 4FPJA 1MR5A 1BXHA 3AP9A 4XTMA 2EXJA 1V6KA 3RG0A 3WDUA 5IK8A 3D5OA 1FNYA 2EALA 3CNAA 3IMNA 1LTEA 1QOOA 1XQNA 2GMEA 3RSJA 1FV3A 4C1XA 5KXEA 4WVVA 1D2SA 2ZABA 5E88A 2D43A 1S0CA 4P9XA 2PELA 1DHKB 4FPHA 5GLUA 3TAYA 3RS6A 5DUVA 3DUIA 3V0BA 3O12A 2JECA 4L8QA 1LU2A 1NXD1 2DVAA 2FMDA 2P2KA 4XBQA 5DG2A 2P3JA 5T5OA 5JOWA 3TB0A 1HKDA 1O4YA 1Q56A 3PVNA 4ITCA 1DGLA 4RA0A 4YG0A 1G9BA 3UK9A 1MS4A 4ZKTB 5H9SA 3OY8B 4ATFA 4YFZA 4LBJA 1QMJA 5DUXA 2PHWA 2A3XA 1CQ9A 4M3CB 4R9CA 1LHWA 1DZQA 3ZSKA 1FYUA 2A6ZA 2E6VA 1AZDA 1CPMA 1LHNA 3N7LA 4UW3A 2ARBA 4XBNA 3IN9A 2A6WA 3R4UA 4YGBA 1G86A 4Y24A 1W6NB 3UL2A 2DTYA 1WD3A 4R9BA 1G9DA 1UZYA 4OZXA 1NLSA 3I8TA 1N3OA 3M3OA 3SITA 3DGTA 1AXKA 4YM3A 5IT6A 5LK5A 5HCBA 4W65A 1N1TA 4LBMA 1W0PA 1N3PA 4R9DA 1G8WA 3IPVB 4YGEA 2GNBA 2NYYA 3B3QE 1CVNA 5DZGA 1CPNA 1N1SA 2NM1A 1F9KA 3POYA 2ZMKA 4WZFA 1LJ7A 1LHVA 1WW5A 2AENA 3VKFC 2V73A 4R9AA 5GLZA 3U4XA 2YZ4A 2R1DA 4Y1VA 1C57A 3WOGA 1LOEA 1ENQA 3WHTA 4P9YA 2VH9A 4FOYA 4XHBA 3FUQA 2P34A 1SFYA 4XBLA 3WG3A 4GKYA 3T1LA 1IS3A 1LOFC 4FOWA 1MZ5A 5KXDA 4FPKA 5GZEA 2E7QA 3L2YA 3NWKA 5GM0A 5T55A 1WLCA 1J1TA 2D6PA 3NV4A 3H0OA 3SH3A 4F83A 1G9FA 3KM5A 1C1LA 1S0BA 4NO4A 3VKLA 3V0BB 1VAMA 2VW2A 2ZZJA 3AP4A 2VUAA 3JU9A 3WCRA 1V6LA 2ZHNA 1Z78A 5T5PA 1ULDA 2ZHMA 5EXOA 5CAZA 2WJSA 1KRIA 4XDQA 2ZAAA 3N7MA 4DQAA 1KDMA 1URXA 2WT1A 4K1YA 1S0IA 3HR9A 2VW1A 1D0HA 1SCRA 4GXLA 3HMYA 3B69A 3C2UA 5DZEA 3ZSMA 2C9AA 4PBPA 2ZGLA 1JBCA 1DYPA 2JJ6A 3BOPA 4DRVA 4FPFA 1LOFA 5JLVA 1SLAA 4XILA 4Q8LA 1W6OA 3ZYRA 1GV9A 1GANA 1YI7A 2DUOA 3W58A 1DFQA 2G4IA 2SBAA 1AJOA 4YW3A 1V6IA 4XOGA 3WDXA 1WBLA 2D3SA 2TEPA 1RINA 5GZDA 2NZ9A 2UURA 5JOXA 1UMZA 1S0GA 1VLNA 2JKBA 2PHXA 3O0VA 1UZZA 1TEIA 3AYCA 4LBQB 3VV1A 2A5ZA 3ZXLA 1AXYA 1QGLA 1QDOA 4Y1UA 3WUDA 2JDZA 2SLIA 3ENRA 2ZGSA 2ZMLA 5GZGA 1LOCA 3V64A 3SISA 5CA6A 2GN3A 3POSA 5DUWA 2ZGTA 3JUUA 3PMEA 1HQWA 2CYFA 2CWSA 2ZGOA 1UL9A 4YGCA 3RMXA 1AXZA 2A6VA 1MVQA 1MS0A 4AGVA 2GNMA 1YRZA 1F5FA 4JC1A 3MPPG 4YG3A 5IK7A 4PBOA 3HN1A 4P14A 4BLJA 3V0AA 4M3CF 1WLWA 1HDKA 3UJQA 4Y1ZA 1YXWA 1OKQA 1SACA 3MW4A 1V6MA 2ZGKA 2GNTA 2VY0A 1ONAA 5EYYA 1RITA 1ENSA 3BODA 1AF9A 1LEDA 4FPGA 5FREA 2ZACA 5HCAA 1S0EA 5JVVA 2JE9A 4M00A 3PVOA 2CL2A 2DURA 4NOTA 1CONA 1Q8OA 1WLDA 4XIKA 3USUB 1IS5A 1MS8A 4Q27A 5E8AA 5DZFA 1APNA 3NV2A 4IQPA 1GSLA 1BKZA 5EWSA 2P3IA 2A6YA 1MS3A 2AH2A 1Q8QA 5JOZA 2GALA 2DVBA 2R16A 4Y20A 5DG1A 5GLTA 3AZVA 3A0NA 2NP0A 3OGGA 1JW6A 3OYWA 4FP2A 2LTNA 1A8DA 4Q1PA 5FRAA 3SLIA 4GALA 1LULA 5SV8A 4FVVA 4Q8KA 4FPEA 1W0OA 2A71A 1OQ1A 4SLIA 3WCSA 5KXCA
chains in the Genus database with same CATH superfamily
4UFMA 4DEVA 1VB2A 4LBLA 3IMMA 3ILRA 3VD7A 5F5AA 1JODA 1JZ6A 2R0HA 1H2MA 3DV8A 3A7QA 2VUJA 1UOBA 3FN9A 1NCQC 4P9WA 5K7PA 2AREA 1U5IA 1H4HA 2WSUA 4MZUA 1AYM1 1GYKA 3U10A 3NAPC 1BJQA 3WF3A 5J36A 4KBBA 4AYUA 1HX6A 1RUD2 3I97A 3BTYA 2QQNA 3QLQA 1GQGA 1SPPB 1QOSA 3NNJA 4Y1XA 1ENXA 4LORA 1RUE2 2ERFA 4GQ7A 5FKBA 2R0FA 3RZKA 4AL9A 3DYOA 4CRQA 1J84A 3B02A 3WF0A 3WUCA 1NA1B 5EP9A 5T5LA 3ZDVA 1VAKA 1A6CA 2D6NA 2J1EA 1OA4A 2ZEWA 4JRLA 3SKVA 3ZYGA 4OI2A 1H2NA 2ZHLA 1FNZA 1RUOA 1OLME 2QVSB 3LZZA 3BI3A 1OBNA 1W04A 2BVBA 2WNUB 4LT5A 3FHQA 2X5IB 3ILFA 1HRI1 1W3XA 5FZ1A 2EF6A 3S7IA 3M3EA 4HSLA 4LK6A 4PLNA 1PVC2 4HG6B 4YPJA 3ZFFC 5DMYA 3BKZA 2VOWA 4YLZA 1W03A 2R043 2V5YA 5AVPA 4AOCA 3WINE 2W39A 1JHNA 5C33A 3R05A 1DGWA 3GHMA 1SBDA 1AX0A 1SLLA 2AACA 2EICA 4A4AA 2GNDA 5FZGA 1CJPA 3VBUA 5A32B 1O4TA 2R073 4QM9A 4YZ5A 1LHOA 3OD4A 4ISRA 3WZ1A 4QQHA 2IFWA 5C3PA 1CX1A 2XG3A 1DF0A 1MEC3 5A7OA 3FFZA 4D94A 1WGPA 1OA3A 2BBAA 1XU2A 5KC6A 3OYWB 1TMF3 5IYYA 2VR4A 5LCWL 3A22A 3AK0A 3CLPA 4PJYA 3LOBA 5BNNC 2ZJCA 1XYNA 4XIOA 2HWF2 1PO11 2Y0IA 4OZOA 4ZONA 3UYJA 4A44A 5EJ1B 2VZUA 2DU0A 3AMHA 1AVBA 5EFUA 5BV6A 4CXYA 1ZA7A 3B9CA 3F95A 3KV9A 3ZSLA 1AL22 5BYNA 1VBD1 1K12A 4HOOA 1PO22 4RD7A 3ZYBA 3OEAA 3AFKA 4QPYA 4XMIA 4ZZ8A 2PFWA 4JX0A 4NVPA 3JB4C 5A3PA 1KGYA 4A3ZA 1DQ4A 4Z2WA 4WVWA 4E2QA 2WT2A 2EXIA 1KJRA 3BALA 4UI9L 1V70A 5FY8A 4LKDA 5C6CA 4ZHNA 4MVTA 2YC2A 2VZPA 4COYA 1UY3A 4YG6A 2A3YA 2BDRA 2CTVA 3KB5A 3POBA 1D4M2 5C3SA 1C5IA 5KHGA 5FZ3A 5JI9A 3THCA 3U4SA 3LEMA 4GD4A 1DBNA 1R091 4TZDA 4P00B 2PHRA 1B09A 2AR6A 3CF6E 2YDEA 3ZM8A 5FR3A 4JRAA 3RZMA 2MEV2 2RMU2 5HPOA 2AYHA 1UNBA 4BM8A 5A7NA 4QD2A 4PI2A 3LQCA 1ASJ1 1ULFA 1ND2C 4GH4C 1ULGA 1LGNA 1I3HA 1XNTA 1NCRC 1W6PA 5A3NA 5FYBA 3BTXA 3WF1A 4BYYA 3ECQA 3MW3A 3CZJA 3OEBA 2RG4A 1MS9A 4TXWA 3HBZA 1NLQA 4J1WA 3RYRA 4G4FA 1GBGA 3Q9OA 4ZY9A 2R32A 3D4KA 4AEMA 1MVEA 2B5HA 2OUHA 1A78A 1QWRA 3M3QA 3IDEA 5IW0A 2B45X 1WCUA 2NPIA 2V09A 5AC91 3H8OA 3W59A 4HMZA 5F3IA 2A1XA 1SLIA 3PURA 3U11A 1VRH3 1W8FA 1QH7A 5HV0A 2R1BA 4YZ3A 4Q4Y2 2C4XA 1LRHA 2VXJA 3ELNA 5H9PA 2ARAA 1VB4A 2WRAA 4WV8A 4YVSC 5CG9A 4XJWA 5GZFA 3LSDA 3RQ0A 2D93A 3O1RA 4XC9A 3IWZA 2VMFA 1CAWA 2EXKA 2PYTA 4DPNA 3J8F3 4BQXA 2DVDA 5L9RA 4CDQA 2VMEA 1F15A 3JD71 2JDYA 4D7TA 1BVVA 1ZRFA 3ETQA 4MOAA 2ENRA 1JYCA 4XXPA 4L0PA 4P08A 3VBSA 2IC1A 4M01A 3LOIA 4JDMA 5GKAC 2MNGA 1V9U3 2Y6GA 4NIIA 2RJ2A 1RUJ3 4JV4A 3I2DA 3MICA 1AL21 3KSCA 3THTA 3VKMA 3ZFEA 5LY1A 1JYNA 1S0DA 2NLRA 1LOAA 1W8HA 5DDJ3 4YARA 1PZ9A 4FCAA 3WR0A 2Q1FA 4RYDA 2WNOA 5DAQA 5A3UA 3P3PA 4IXLA 4K20A 2YROA 4FFGA 1E57A 1JZ7A 4RHV2 4ASMB 2YV8A 5FYVA 4OI0A 3UT0A 3WW1A 1I1EA 4AGRA 3C7FA 4CDUC 3T4VA 3OJBA 5FPZA 2LROA 1U5ZA 4AVAA 1OI6A 1RVF3 4SBVA 1VBE1 4U36A 4S2DA 2ETEA 2WS92 3C7GA 3VHOA 1W6PB 1VBB3 1NZCA 2JDKA 2ORXA 2PLV2 1L7RA 3MFAA 3SH4A 4ZS3A 2LM3A 4JDNA 1UPIA 4Q0SA 2GSYA 4AI2A 4FPLA 1H8VA 1OLRA 4YZ1A 3CQOA 4YZ4A 1PIV3 1L7QA 1XB9A 1YLLA 1KS4A 3VD9A 3W5NA 4PF5A 3ME2A 4M3CA 2JKXA 2UYBA 5DAWA 1JYIA 4Q4V1 1QJX2 4CXXA 4NIHA 1WCSA 2OT7A 4AEDA 5LWBA 3PVEA 2WLPA 4LBKA 5LEKA 2W08A 1C3HA 5AFBA 4TLGA 4ARXA 4AVCA 1OPOA 2DCJA 3FLRA 4YGDA 3LF7A 1RUE3 3DXTA 1WMDA 3FHIB 4ASLA 2BOJA 2CNAA 4WM8A 3MI8A 1DIWA 2VCMA 1CAWB 3ACHA 1PGSA 1NA1C 1AUYA 1PMHX 2FZ1A 1KS5A 1RHI1 1NY71 4V2VA 4AR2A 3ZVXA 2FDKA 4HPKA 2VNGA 1COV2 2HEYF 2RM21 4AEKA 4MGZE 3J7HA 5FXXA 5LZ6A 4GMP3 2DVFA 5CU1A 3ZYIB 2AEYA 1MZ6A 2VZ1A 5E6HA 2WNUC 4QXBA 5I8TA 3WNKA 3LD8A 3T2OA 3LFMA 3FFQA 4CUAA 4LO7A 3I49A 4Y5SA 3VBSB 1CIWA 4MYEA 1ULCA 4CTEA 1AR72 2XGXA 1H6XA 3VHPA 3LEGA 1ZZ7A 1OOPB 5FIXA 3BVCA 3NV1A 5GZCA 2ZMNA 1WMEA 2YBSA 3ZFEB 4D69A 4IEWA 5A7QA 4XJ9A 3WSOA 2ZBJA 4I0AA 4IEQA 1BXHA 1ZZCA 3J7LA 3WDUA 1V6KA 4DIQA 4ZPIA 3GDBA 4W8JA 3AC0A 3RPQA 2OQ6A 1LTEA 2XVLA 4AAPA 2GMEA 2HWE2 1FV3A 1MZFA 2ZX1A 5LW9A 4WVVA 2WYSA 2QQWA 2ZABA 4WBBA 1JZ8A 1NUKA 1LB2A 5A33A 4P9XA 4FTSA 5A80A 2RJKA 1SDDB 3RJ2X 1DCSA 1VMJA 4NHLA 2HWC2 3B7MA 2F17A 2KD7A 3UKNA 2DVAA 2FMDA 2GAUA 4P02B 2YG0A 3ZMOA 5JOWA 1POV1 3QBQA 4CDXA 2RE9A 4ET7A 4FBFA 2ET7A 5C8CA 3MV01 2WQ8A 4G9SB 4XF1A 1TNFA 1R082 2B9UA 1FMD1 2Y6JA 4NIDA 4M3CB 4OMDA 4TN7A 1UY2A 5F32A 1DZQA 2A6ZA 1LHNA 1NLRA 2ARBA 3MIEA 4AEDB 2B39A 3MIBA 5CZKA 1X9PA 4DO0A 2A6WA 3R0RA 4HK8A 1AR82 3WP5A 4IL7A 2R7EB 3BPZA 1NG0A 3IT8A 1WCQA 4Y24A 5FZEA 3ACFA 3ZXAC 4XFFA 4YWAA 1D0GA 4WM8B 4XF0A 3EYPA 5JSRA 3W20A 1D4M3 1C8M3 3HNMA 4LHLA 4EE2A 5JXGA 1LR5A 1NLSA 3I8TA 5JXIA 2X53S 3BTZA 2VG9A 2WNVA 5FP4A 4W65A 5EHDA 3KLSA 4QX2A 1N3PA 1QJU2 1G8WA 4D6QA 4EWEA 2XQXA 2IVIB 5FZKA 3B3QE 1CVNA 2RMU3 2BPA2 1NQDA 3V0BA 1F9KA 2LRPA 2AENA 2VZSA 2BP6A 3NJXA 4HVOA 3KV5A 3W9AA 2R1DA 1MQTC 3RDIA 1O3TA 5C3RA 1NXMA 1RUI3 1OQEA 3H1WA 1EYBA 3FUQA 3IBMA 4B4RA 3ZN5A 4AFCA 3WG3A 3GJBA 3S30A 3EHKA 1RXFA 4FOWA 4J6GA 4XUTA 1Z7S3 3R6SA 3U75A 4FPKA 5KXDA 2E7QA 4GJYA 4MSVA 4CA9A 1WLCA 3N9PA 1E5SA 5FYMA 1XNDA 5A33B 3NV4A 1BK0A 1G9FA 1C1LA 4CUBA 3IZOA 4I02A 4NO4A 2Q1MA 4NR1A 2VW2A 4Q4Y3 2IUWA 3AP4A 4YRDA 3IDCB 2VUAA 2WO7A 1V6LA 2ZHNA 4LKSA 4LA3A 5C8CB 3ZIXA 1IZ3A 1ZZ6A 2WJSA 1ZZBA 3C7HA 1HB4A 4BISA 2BFUL 1URXA 1ZBA2 3HR9A 1Q5OA 4K1YA 5FK7A 2JENA 4GXLA 4A45A 4QB1A 4BXSV 2XVKA 3LDBA 4QT6A 3VBHA 1UYZA 5J7MA 3TNQA 5DZEA 4AFAA 2C9AA 4PBPA 3RZGA 3SEPA 5IVVA 1B35A 1SFPA 1TZOA 2HBUA 2RS12 2HEWF 3SCFA 5FO9B 4I3PA 4XUNA 2JICA 1AYN2 2PN5A 1O59A 4CDWC 1W2NA 1W8UA 3TEZA 5FWJA 3B9IA 4D3WA 1U12A 4BQ3A 1IPSA 2VCBA 3RI8A 5L36A 4YW3A 1H1AA 4CU9A 5FBZA 4BIOA 3JBG3 2DCZA 2NZ9A 5F39A 2ZX4A 1UZZA 2EVXA 4N9IA 1VJ2A 1FOD2 1UOGA 2Q4SA 1W9WA 3KV6A 3ZXLA 4M4RA 4LIVA 2BGOA 2HLEA 1O6UA 2OPWA 2R061 3ENRA 3M4FA 2D5FA 4GWJA 5FMDA 1LOCA 2XBO2 3U14A 3SISA 5CA6A 5FXVA 3PDQA 2GN3A 2WZR1 2ZGTA 2GH2A 4QQ2A 4W4ZA 4COWA 2BW8A 1AXZA 1ZVFA 2A6VA 3QH7A 2WWUA 1MVQA 4URTA 4JGZC 2GNMA 4MGQA 3P3NA 2DCKA 3X29B 4Q0UA 3ZFGA 2I45A 2RS33 1H6YA 4P14A 2X05A 1CAVA 5CYYA 2C24A 3OUHA 2VD7A 4LOSA 2BZDA 4LMFA 4BJ0A 1V6MA 2I74A 2Q1ZB 2ZGKA 3E5QA 1ONAA 3BODA 5A3TA 3BN6A 1YQ6A 3VBOA 5HCAA 2I07B 3JZVA 4IE7A 4M00A 2BFUS 1Y9GA 5FDBA 3MIFA 2DURA 4NHYA 1CONA 1Q8OA 1IG3A 4TTGA 3EMRA 4W6WA 3VBRC 1EV11 4Q27A 1W28A 3LIHA 1COV3 5E8AA 1RUF1 2XL9A 3WT3A 1MZEA 1UU5A 4OUSA 4OLLA 4QQOA 1UYPA 2A6YA 1B35B 4Q0PA 2GALA 4COVA 5GJ6A 4CPBA 4QU1A 2DVBA 3UV9A 1HXS3 2NP0A 3OGGA 3BGAA 3GHNA 3PIJA 4IETA 2Y6LA 1XRUA 4FP2A 5FO7B 5IVEA 3SLIA 4DUXA 1OOPC 1PGL1 2HBTA 3AB0A 3CBNA 1W0OA 2A71A 3ZFEC 4Q8KA 2ORZA 1O8PA 5KXCA 1FT9A 5C71A 2TUNA 4UFHA 2IVJA 4XE9A 1BBT1 1X9TA 3IKWA 4NROA 2HWE3 4N53C 5K0UA 2DDUA 1MEC2 3ZO0B 3ZXKA 1UN1A 5FWEA 4DZGA 4NRPA 1DQ6A 4QX1A 2WINB 3U07A 3JXSA 1KDKA 3IM0A 1BHGA 1BEV1 5JSOA 4XJZA 4FQZA 3I2IA 3LE0A 5FXZA 5FFOC 5CISA 3BTAA 4Q4W1 5L9BA 1WD4A 5CBLA 1PNGA 4EN8B 2DCYA 3E97A 4X6RB 3VDCA 2OVUA 2BYVE 5FZ6A 4CCOA 1VIWB 4A7ZA 1GZTA 3W5MA 1HRV2 4HETA 4MH0E 3ZFGB 3K46A 2ZXQA 3ZN6A 1CAVB 2XDVA 4RR3A 3H1MA 2GN7A 4QB6A 4BK4A 1OKOA 3T1MA 3KQRA 2W87A 1ULPA 4HN0A 4Y22A 1NE6A 3N35A 4AEDC 3ST7A 1AR83 2JX9A 4Z82A 2C1FA 5FYTA 2Z4FA 2WAOA 4X6QB 3BPSA 4RFT0 3QOPA 1VMHA 5FCCA 3KT7A 3LWCA 3NSTA 3VBOB 1QDCA 2YFZA 3CJXA 1XSQA 4HXCA 1DYOA 4ZU4A 5FPLA 3CU7A 5CFDA 4YW1A 1RUH2 5FUIA 5GLWA 2KM2A 1VBC2 4AVBA 2FCTA 4UW4A 4QX8A 2A3WA 4A7YA 1WKYA 5FZCA 3LDRA 3RWNA 4UBGA 1I5ZA 5A1FA 5KBFA 4FPCA 1LOBA 2WA4A 4XF9A 4R52A 3UESA 5JMCA 3GBFA 2EAKA 1E5IA 2P37A 3AM2A 4KWLA 4QGMA 1SCSA 1HB1A 1OA2A 4YVWA 1N1VA 5ACA3 3T4HB 2JG9C 4EV0A 2VQ0A 4MXWA 4EN9B 5CFCB 4Y4YA 3OBRA 3GCXA 3MGUA 2ZGUA 2QQJA 2Q5TA 1XNAA 2HWB2 2E53A 1R1A1 3AMPA 4W6YA 4HL0A 3C3VA 3PNAA 3WVJA 2R041 2OA2A 3O1UA 5CIRA 4CSWA 2X8KA 4I30A 5T52A 2PAKA 5FZ4A 2R49A 2W3JA 2W9XA 3H1YA 5IHRA 1HV0A 1QQP1 5IK5A 3KMHA 3I59A 4XCBA 2ARXA 2R071 3QCWA 3NNLA 4AHXA 2I2SA 3VL9A 4BQ5A 5C8CC 3KZ4C 5FPUA 1QF3A 1IKQA 3LPFA 2ZX0A 4HKLA 3SCGA 4AI3A 1RTVA 5FY1A 3O1OA 3Q8EA 1C5HA 2HWD1 1ZBA3 1ZA4A 2ADDA 4NN0A 2CWMA 4AEJA 1Q8PA 5J96B 3O1PA 2WO1A 1GOFA 2WN2A 1TMF1 3B93A 3DN7A 3AVRA 5F6LB 1FX5A 2VZVA 4GIQA 3ZN6B 1O3QA 2BOIA 4RR3B 4Y26A 4Q2FA 1QOTA 4I01A 4Y22B 3WF4A 1XU1A 2RS13 1GZ9A 4LIUA 4NAMA 4WVMA 4JQTA 1AYN3 4GWNA 4IGPA 2J42A 4LLFA 5FBJA 4HONA 1RUJ2 1V0AA 5LK7B 1XE0A 4CEWC 4K8RB 4KI5M 3WG1A 1ZBE1 2JE8A 2XWJB 3HD8B 1YIFA 3N9QA 5DDJ2 5F3EA 5CFDB 2UWCA 4GAZA 5LA1A 2JDNA 3N7JA 4B4PA 2Q30A 1X36A 5F9TA 1EAH2 2QQPA 4LULA 2WQ4A 4FOVA 4AQ2A 3S7EA 2ATFA 3D0JA 4ES8A 1EUTA 3M1HA 4QU2A 3BU7A 1RVF2 2JG8A 1ODNA 3I54A 1HJFA 4NHXA 1VBB2 2ZGPA 2OZJA 1PX4A 1ZRRA 4GMP0 4YVWB 3UJOA 1D2QA 1MPXA 1BK1A 1XYOA 2JD4A 2ID4A 1ZNPA 4L2NA 4AQSA 3KGZA 4MXWB 2WFF1 5KHIA 1O5UA 1WW6A 3H9AA 3E1F1 2DTWA 3K48A 1PIV2 3NJYA 4AZZA 1KFXL 2Y26A 2ZAHA 1DQ0A 2BQPA 2BWAA 1UY0A 4UW5A 5IUQA 3WDVA 4D7SA 4OQ8A 2ES3A 2FDIA 3WNPA 4NIGA 1RUC2 4DY5A 3MIDA 3S0MA 4N8MA 2C6SA 1J3RA 1STMA 4BMEA 4GWMA 5CVRA 4UXAA 5A3OA 2YPDA 3WP4A 3POIA 5FXWA 1OQDA 2JE7A 1AR61 1OFSA 1WW4A 2D3PA 2RS51 2JB4A 1WCKA 2UWAA 3OGRA 4QQLA 3ZYHA 2X29A 3ASIA 3BCWA 4DFSA 1H9PA 4MUVA 1QXRA 1AR91 1YFWA 1V6JA 3I59B 4QKFA 2E7AA 2BGCA 3AKSA 4MGTA 4LBQA 4RGAA 5SV5A 1HJGA 4QHBA 1OUXA 2O14A 4AFBA 4LO4B 3AP5A 2IXHA 3NW4A 4P5HA 1GNZA 3KF5A 1BLZA 3DYMA 1VRH1 4YW4A 4BOWA 2W5FA 2J1VA 4E4DX 2UU8A 2VECA 1D4VB 2UY9A 1B35C 2F6BA 1KXGA 5FO8B 2FHRA 2VZOA 4BIFA 3SKJE 5FYSA 1QNYA 2Y60A 2A75A 2JIJA 2YFUA 1J59A 2KXLA 3J8F1 3K51A 1WBFA 3NV3A 4AG4A 5FY0A 4I09A 2P17A 2J1AA 4B4QA 1S2BA 2ZX3A 1O4ZA 4FTEA 2WYFA 1E5RA 3VLBB 3WP3A 4LHSA 3JQWA 2CSGA 1Y4WA 2QTWB 4FPOB 5F2SA 5T3NA 5A70A 1H8TA 3AZZA 5EPAA 2ZHKA 1SFNA 4BZ4A 3VD4A 1V9U1 3IDAA 1C1FA 3MIGA 3USUA 1T2XA 1QU0A 1WUVA 5C5TA 5H9QA 5ABJA 2FDGA 1W3VA 2JG8B 4DUVA 4KU8A 3KQ4B 1JN2P 2ZGQA 1F4HA 2IWGB 4QDRA 1REDA 4RQPA 4K8FA 1A34A 2WQZC 1SEFA 5FP8A 1E5HA 4K7JA 4PLOA 1UZWA 1OPMA 2YXSA 5LEJA 4LO6B 3G7DA 1PVXA 2VPVA 3AJZA 1V6OA 3AKRA 2YHJA 5C7GA 3FC0A 3CEWA 1HRV3 3BB6A 3ZFGC 2VOKA 2UYAA 4UWDA 3CL1A 4BK5A 3WNXA 3I3DA 1YNAA 1MS5A 2PA7A 4AFMA 5CKNA 2H0VA 4RL7A 1QJZA 2JDUA 4NRMA 3RJRA 5CG8A 2BBVA 2NN8A 1P8JA 1FAYA 4RSUA 3V56A 4ARYA 4ZXEA 3EJKA 5FMCA 5BXXA 1QHDA 3VBOC 1QJY3 2WZ8A 1Q8VA 1C8M2 1ULOA 2ZGNA 5FYUA 5GLVA 1U0AA 5FZ8A 1FPN3 3POWA 4XDOA 5FPBA 5JPMB 1RUH3 4QGLA 1DP0A 2VMGA 2BERA 3LCPA 1VBC3 1VBA3 3PIGA 5FK8A 4DNYA 3D8CA 4HSJA 1MR5A 1RUD1 1W8OA 2EXJA 1H2LA 3I2JA 2EALA 3ON7A 1RUE1 1QOOA 3HPNA 3RSJA 5KXEA 1D2SA 2VULA 3TAYA 2EIBA 5LASA 2XUMA 2Z5WA 2W46A 4JKMA 5DUVA 5HBAA 1RUI2 3JCIA 5A1LA 3LB9A 4L8QA 1NXD1 2P2KA 4XBQA 2WWSA 4LQRA 4GMP1 4N9HA 3TB0A 3NO8A 3VBUB 1WMXA 4CCJA 4NMIA 1Q56A 3CZUA 3PVNA 3GZEA 2D40A 4RA0A 3UK9A 4Q29A 1Z7S2 2HWB3 4ZKTB 5H9SA 1H8TB 2XONA 1PVC1 4YFZA 2VQTA 3NNMA 2A3XA 2XXZA 1YI9A 1AYM3 1CPMA 2E33A 2WUHA 3N7LA 4JGYA 2QKDA 3GZTB 3MYXA 3RZZA 4JTOA 4YGBA 3KVAA 1G86A 1JU4A 1W2AX 5LBEA 3IB3A 3WP6A 1Y43B 1GWKA 1CZVA 3VZJA 4XFIA 3UL2A 5BUVA 2K0GA 1WD3A 4R9BA 4A6SA 1G9DA 4XAEA 4WVZA 3M3OA 2B9VA 4OHZA 3SITA 3AL6A 5EJZB 1JZ3A 1XBFA 4RR3C 1ODMA 4R9DA 5FZHA 4ZZ5A 2Z69A 1DZRA 1W2OA 2HWF1 2GNBA 3C8XA 2NYYA 3WEZA 5F6KA 4AK3A 3R4DB 3TEYA 4WZFA 3GZAA 1IPKA 1IPJA 2E32A 4QB2A 4B7EA 1SDWA 4RFRB 2FDHA 4R9AA 5GLZA 1PO21 5CFCA 5J09A 4FFIA 4IV1C 3KCCA 5JR2A 4BE3A 4IUGA 2QJVA 1LOEA 4XQWA 5FYZA 3WOGA 3D82A 3GCWA 3JBG2 1EAH3 4GKYA 4MHUA 1ND3A 4R4XA 3T1LA 2XJQA 1LOFC 2VOTA 4JHTA 3ES4A 5GM0A 4QWNA 4KGQA 3ZKYA 1D4M1 4CPBD 2WZPP 3H0OA 4F83A 3KM5A 3LAGA 4HZFA 3K3OA 1JZ4A 1PGW2 1WCDJ 2ZZJA 3LIGA 5JI7A 3JU9A 5BPXA 2VGDA 4ZU7A 3WCRA 4XQDA 2MEV1 1PO13 1ULDA 2RMU1 2VTFA 1POQA 3K2OA 4A41A 5FZFA 2QQMA 2RS32 3N7MA 3PTRB 4R4ZA 4O7XA 1KDMA 1RUC3 4BA6A 1VBD3 3ES1A 4N43A 1CX4A 3K4DA 2OPKA 4DRVA 1DYPA 2JJ6A 3DEMA 3NKGA 4JGYB 3U78A 5I0DA 1OVPA 4QXHA 2VTXA 1W6OA 4EJRA 3ZYRA 5BNOA 5KR7A 5C5UA 2XUEA 2VCAA 4CDQB 3MPBA 1U5YA 2PAMA 4CCDA 1VE0A 4LNVA 3N4MA 3WNOA 1V6IA 4XOGA 4Q4Y1 5D8AA 1WBLA 2D3SA 1R093 2GP5A 4GZ9A 1TME2 5BY5A 2X5IC 1S2EA 2P6CA 1S0GA 3S5QA 2JKBA 3THDA 1HXS2 4IV3A 1TEIA 2PAEA 4XF3A 1JI6A 4B29A 1O3RA 1ASJ3 3FWEA 3KS7A 4F8AA 4XVHA 1AXYA 2Y38A 3N9MA 3VDBA 3VD3A 4PDWA 3WUDA 3EO6A 2ZGSA 4EN6B 3VZOA 3DPRA 3V64A 5C4WA 1OD3A 1XPWA 2RR12 1H1MA 2HEVF 2OQ7A 1UU4A 3ETPA 1JZ2A 5F3CA 2ZGOA 2CWSA 4YGCA 4WM7A 3LKJA 1ND3B 1ZRCA 1J58A 2V4AA 3PU3A 5IK7A 4B1LA 3HN1A 1PHMA 5AC93 1ZRDA 1UY4A 4J1XA 4M3CF 3UJQA 2JG8C 4Y1ZA 5A3LA 4UBHA 2W94A 5C9AA 4XDPA 2GNTA 5EYYA 1JMUB 1W8ZA 1ENSA 3VGIA 4FPGA 3MZHA 2Q0AA 4IESA 4RHV1 2ZACA 2XH6A 5TSWA 5JVVA 1OH4A 3U0ZA 2JE9A 5E16A 3ACGA 1XYPA 3PVOA 2FMYA 1RJ7A 1FXZA 4NOTA 1WLDA 4XETA 4IEXA 5IVCA 5L7OA 2WS91 1M4WA 4QDSA 5FJKA 3OG2A 4N43B 5EIYB 3OF1A 1APNA 2PLV1 3WXPA 3UNPA 3IIAA 2XMLA 4COZA 2D98A 5F3GA 2AH2A 4WZCA 5A7SA 4Y20A 2R16A 3I3EA 3AZVA 1RYYA 1L7LA 2WL1A 2LTNA 4FXGB 4UOJA 5BNOB 1DU3D 1H0BA 2Y34A 1Y9QA 1QJX1 2ZCWA 5SV8A 4E4ZA 2GC3A 4HPKB 4FPEA 4MO3M 3DKWA 1OQ1A 3BIEA 2Y6HA 1UMIA 4QPIA 2IXKA 4Q0QA 1FV2A 5F8PA 1F4AA 1YC61 1OH3A 1SMVA 2V5DA 3H8UA 4N7UA 5D8AB 4EZHA 5DAXA 5DXDA 3MLJA 2J1SA 2G9FA 4NPRA 2PQQA 4IV3B 4OHWA 4Z8BA 2VAUA 3T2PA 3AX4A 4L92A 1W6MA 2VVEA 2H0BA 1H2KA 5DABA 5ACA2 4FPYA 3RMYA 5FUNA 1COV1 1XE7A 4PDWB 3RWKX 3OGJA 1X8MA 4J25A 2RDNA 3T0AA 1N1YA 5C4WB 4MGKE 3VBUC 3GJAA 3AJYA 1J83A 2CGPA 3HEIA 1AX2A 2YU1A 3I7DA 4IE6A 5T5JA 1H8TC 1AR71 3CJIA 4CU8A 2Z2SB 4KNCA 4ONUA 5FMOL 3NQHA 4M0NA 4AHWA 4M4PA 4LUKA 1Q3EA 3MEPA 5C70A 4QPGA 1HW5A 4NAOA 1W2UA 2P3KA 5C9AB 4NPLA 4CDXB 1Y3TA 2GDFA 4E2SA 3H7YA 5FZIA 1GZWA 3CIHA 2HWE1 3I2FA 5F7UA 4M3CE 1OUSA 3B01A 1N3QA 1W05A 1NCQA 3H3ZA 3KV4A 4E9KA 2XHNA 3CKHA 1LNSA 2QQOA 4GJZA 2HWC1 3EXUA 5L7OB 2LALA 2W1UA 3NAPA 3DCQA 4O9EA 4C1WA 2RM23 4CVUA 3MIHA 3WG2A 3VZLA 4YM2A 3PUSA 1IKPA 3AYDA 2UY8A 2W52A 3PU8A 4IW3A 1F31A 1R081 4KU7A 4DINB 1JYWA 2RV9A 2VMCA 2XOMA 3ABZA 4OYUA 3APBA 1MS1A 4NE9A 3ZXEA 2XWBB 1IHMA 1JXNA 2XKPA 3A23A 4BHPA 4XPVA 2WNVB 4DS0A 3FMGA 5FZOA 1IGOA 2VOXA 1OD5A 1UMHA 3WG4A 4QPIB 1AR81 4XABA 3BIWE 4L11A 5B4NA 1X82A 4A6OA 5JUVA 1UQXA 2WSVA 3VB9A 1LODA 3DF0A 1LESA 1W2TA 2CHHA 2KR2A 2P5BA 2YBPA 4JTNA 4MADA 2P1BA 4XZPA 4JQRA 3ZFFA 2DUPA 5KHKA 5KXBA 3RYPA 3AKTA 3VKNA 3I2GA 4QX0A 2GC0A 4S2FA 5ERLA 5LRRA 1W6MB 4FFFA 1BMV2 5EV7A 2E26A 3UKTA 2BV4A 5LA9A 5JXJA 1UYYA 4YZ2A 1POV3 1QJU1 2VC9A 4UYBA 5I0UA 2V72A 4B1MA 1LCLA 4INDA 1Z0HA 1CGPA 3ITQA 2BEOA 4K40A 5T50A 4CP1A 2GMPA 2RHPA 2ZKNA 1FMD3 5FMOS 4BXFA 4FTBA 3WLUA 2D6KA 3KVBA 2WZEA 5FLIA 5I0SA 1RXGA 3CJIB 4D6RA 2EIDA 3H7JA 3I3MA 3GZUC 5GALA 4TWTA 1NT0A 2D6OX 5BNNA 1SLBA 3O0WA 1REFA 4GKXA 2DWRA 4QPGB 1OXCA 5JPNB 4D6SA 1O91A 1N47A 3VN4A 4AVTA 2A7AA 4AVSA 3HQUA 1HIXA 1UD1A 1UO9A 2O8OA 1GZWB 1SG3A 3TYJA 3T2TA 1UPSA 2H6CA 2WR9A 3NNFA 5BNQA 1GU3A 1I6XA 3ZKUA 5C3OA 2VNRA 4IGOA 2O8QA 3T2QA 1S1AA 4CDQC 4Q4X2 3WDYA 5HCFA 3VBHB 3ZXDA 3POEA 3NAPB 4NIAA 3RNSA 4F3JA 3LGRA 5IVJA 2FDJA 1JH5A 1TME3 1KJLA 2XR4A 4U2AA 3ZR5A 3HJRA 4HVQA 4ZU5A 2QQUA 3UGFA 1Q43A 4A42A 4JAAA 3E5UA 3VBSC 5A6ZA 2FQPA 4E8DA 4GB32 2XLAA 4LPLA 4YW6A 1ZBA1 3CDZB 1SQ4A 2WA3A 3T0DA 4XHXA 2E7TA 1IQAA 3GGLA 3KWVA 1W9TA 4PT6A 4H55A 4EZ4A 2QQLA 2QUOA 1G7YA 2RR13 1S4CA 4JCKA 4AQTA 3AVSA 5CB7A 5FZOB 2XHKA 3GM8A 4W50A 1WMFA 5A6YA 2VU9A 2RS11 1F5JA 2ZGMA 3Q8FA 1W06A 4GH4A 1ND2A 2G1MA 1AYN1 1F35A 2JEMA 4XCAA 3TOJA 4EN7B 5A3MA 5K8SA 3ZFFB 1NCRA 2X09A 1SLTA 1PZ8A 1XE8A 3OPZA 1BQPA 4GA9A 1JYVA 2XVGA 1GQHA 1H1IA 4MGSA 1HV1A 4LKFA 4EWAA 1RUG2 3WNNA 1DQ5A 1A3KA 4Y4RA 4BQWA 3AYAA 1K45A 5IWFA 4LR4A 4F7ZA 2V4VA 1M06G 3NL1A 2VW0A 5BNPA 1FOD1 5B2GB 1RMU2 5FTTC 4B8EA 2X10A 1YFUA 3MUY1 1G9CA 2YGMA 3PTYA 4PCRA 1L3JA 1S55A 2XBO1 1GZCA 3N36A 1HQNA 4AAXA 5BNNB 4YVSA 5FZ9A 1S2KA 2Y64A 4B3NA 3N9NA 2BUKA 2XB6C 1CN1A 2YC0A 2QZ2A 3PHMA 4XYXA 4O9GA 1QJY2 1V6NA 4WM8C 1FPN2 3ATGA 2J1RA 1JTZX 2E51A 5FZ0A 5JIAA 3WDWA 3ZN4A 5BNOC 2VMIA 1Y9MA 1UOJA 1AJKA 1OURA 1VBA2 4C0BA 3NVCA 2JDMA 1W9YA 1BCXA 3AXEA 5FYYA 1OLMA 1XNCA 1DGWX 1QJEA 3AXDA 2K9ZA 3D6EA 3J26N 2QCSB 5D8AC 5JIUA 3OY8A 4XFAA 4RN5A 1QXJA 1UX7A 5I0TA 3N9LA 4IV3C 3K75B 3VUOA 3ZYFA 5D2AA 2ZPXA 2YMZA 4OVEA 3A0KA 4NHKA 1NOVA 2J1TA 2DYCA 2OKXA 3MDPA 3K4ZA 4PI0A 2VNVA 4XJAA 1AL0G 2C0ZA 2HYKA 3SMHA 5C4WC 2PXJA 1KEXA 3ACLA 5T54A 1W6NA 2XKOA 5IFTA 5K0UB 2QQKA 2WAAA 3BOWA 3P1IA 1DYKA 2UWBA 2BRTA 4GH4B 1ND2B 4H7MA 4Q5OA 3O14A 5FQ0A 3O0XA 3GF6A 4NRQA 1JS9A 4BH9A 2BGPA 1IOAA 1AYM2 3FLTA 4HN1A 2PHFA 3Q8BA 1LENA 3V65A 1H9WA 1RL3A 3WDTA 4AI1A 5C9AC 2Z42A 5LA2A 3ZXGA 4CDXC 1LGCA 1DQ1A 1LECA 1VAVA 4LA2A 4HK9A 4Q26A 1R1ZA 2O0OA 2E31A 5FPAA 4AHZA 2J7MA 5FY7A 1MEC1 3IIIA 1UYXA 1VR3A 2RVAA 2VJXA 2CY6A 4NPMA 4CEYA 5BNPB 3H8RA 5FPXA 5IK4A 1NX9A 3ZPYA 4EWDA 1SBEA 4LOTA 4ZXKA 5LB6A 5FLHA 4RGGA 1VMFA 1OC1A 4OUMA 4EN0A 5L7OC 1V00A 1RUF3 1QKQA 4YW2A 2OZ6A 1JZ5A 2W47A 4JVAA 1DDLA 3D5OA 1FNYA 4GWIA 5IATA 3IMNA 1XNKA 4YVSB 1XQNA 4I2OA 4XURA 5I8SA 2J22A 3I2KA 3NMBA 4H2AA 1S0CA 4LO8A 4XW3A 1HRV1 4FPHA 3MO4A 4OFGA 4RS5A 3OUJA 3HN3A 3OGSA 3DUIA 3C7OA 1LU2A 4BQ2A 2WNVC 5T5OA 4P9GA 2P3JA 4E8CA 4UF0A 3M70A 2ADEA 3I3QA 2VZRA 3N9OA 4ITCA 1DGLA 4YG0A 3WW2A 1BBT3 1G9BA 2W1SA 3MV11 4KWJA 1US2A 4R8HA 4IEZA 3TN93 3OY8B 4ATFA 1QXPA 4LBJA 2G9GA 1GFF2 4XUOA 1OFNA 5DUXA 2GZWA 1PMIA 4DXZA 1WLTA 1CQ9A 2JXAA 4R9CA 1UZ0A 1LHWA 2VUCA 4NUBA 3ZSKA 3O1MA 3TEXA 4PHZA 5FV3A 1RUH1 4UW3A 4X8NA 1VBC1 3PUQA 4XBNA 3ZIWA 3LPGA 3OBZA 3IN9A 4M0HA 2BTVC 3R4UA 2VZ3A 5FMBA 1PO12 4QX7A 3FX3A 4Q4W3 4LJHA 3ZDSA 5AFEA 4K6BA 2VMHA 3D3AA 1W6NB 1X7NA 2K46A 3L9JT 1C28A 1UZYA 1VBD2 4OHVA 4OZXA 1C8NA 1QJFA 2ZEXA 5FP3A 5FQ0B 2VUDA 3CJIC 1R64A 3VDDA 5IT6A 3UETA 3O7OA 2W95A 2VQUA 1N1TA 1DG6A 2Z79A 4LBMA 5G05L 2JDPA 4LUMA 3QD6A 4JHZA 4QKDA 4YGEA 5JXHA 5DZGA 1G6NA 3K3NA 2HWB1 1CPNA 1N1SA 2ZMKA 5FZLA 1LJ7A 3S5AA 1XOYA 4COUA 5I93A 2V73A 3NRUA 2BWCA 3WQ0A 4OHYA 4JDOA 1UF2C 4CEYB 2YZ4A 4AE2A 3U4XA 3MFCA 1NE4A 4UFIA 4Y1VA 4Q4X3 2QQVA 3POJA 4K9SA 1RB8G 1KD7A 3VDAA 1YFYA 3VBHC 3WHTA 4AQ6A 2BU9A 1R092 2VH9A 4FOYA 4XHBA 4A2UA 4QMAA 3WD5A 1IS3A 4WVMB 4NJ4A 4OI4A 1MZ5A 5GZEA 1ASJ2 1J3QA 4GB33 3TNPB 4PIZA 5T55A 3ZMNA 1HB3A 3NJZA 4HVRA 2G19A 3SH3A 4RS5B 4E2GA 2WN3A 3MBWA 3ZR6A 1VAMA 3T30A 3S57A 2CGOA 4PQQA 4UF0B 4JKKA 2OIIA 1O8SA 1Z78A 5T5PA 4QHZA 2ZHMA 5CAZA 3Q8CA 4QM8A 2CAUA 4LHNA 4N90A 2DCTA 1EPZA 2YC4A 2ZAAA 4OQ9A 1R1A3 1RUJ1 4DQAA 5AC92 4LE3A 4BQ4A 1S0IA 4NWWA 2VW1A 1MQTA 2VVDA 3HQXA 5DDJ1 3F2ZA 3B69A 1JUHA 4Q0VA 3VZKA 2BNMA 1GQPA 3C2UA 4IE0A 3ZSMA 2GC2A 1RUG3 1OSGA 2D97A 3BOPA 4CP9A 2XLFA 1QQP3 5J37A 1EAH1 4FPFA 2Q8OA 1YUDA 3ZOIA 5JLVA 1ACCA 1SLAA 3LEKA 2VOVA 3AMMA 1OLQA 1CIYA 4Q8LA 1RVF1 2B4KA 2GU9A 4XILA 3WY6A 4BQYA 1RMU3 1UXZA 5ABJB 4V2WA 3I3BA 1GV9A 1GANA 2HWD3 2Y6KA 4MHRA 4IE4A 1VBB1 3JD72 2G4IA 2SBAA 5I8YA 1AJOA 1W9SA 2VZQA 3VDDB 4XFGA 4IE5A 1O3SA 2VQAA 2QE3A 2ZEYA 2UURA 3H3LA 3MUZ1 1GP5A 1UMZA 1PIV1 1VLNA 4PLMA 4X8PA 4DXRA 3O0VA 4Z2AA 2WABA 3AYCA 4LBQB 1W90A 4ASKA 2B46X 3AMQA 3K77A 2Y8KA 2A5ZA 3P6BA 1RUC1 3JQXA 1QGLA 2ARCA 1ZBE3 4Y1UA 1GP4A 2EIEA 4KWKA 4QPGC 4CP0A 1UOFA 5J3UA 1OMIA 3POSA 5DUWA 5A3WA 3JUUA 3PMEA 4PIXA 5FY5A 5LA0A 3KCYA 3BU0A 2JDHA 3RMXA 4MV2A 1JYXA 2FCVA 4H14A 2DFCA 2TBVA 4AGVA 4CDWA 2DF7A 4Y5TA 1YRZA 4JC1A 3MPPG 4IEPA 3LDKA 4PBOA 2G9ZA 2VBPA 1VBE2 5APAA 5M0TA 3V0AA 2O1QA 1HDKA 2LS6A 1PM7A 5B4XA 2P4EA 1SACA 3ROUA 3VBFA 3MW4A 1UY1A 2WFPA 3HQRA 3DKQA 1RITA 4W6XA 1AF9A 2WFF3 2XJSA 4G3YC 3T08A 2VO5A 2FD8A 3EB7A 4KGGA 5J48A 2YYOA 2CL2A 5K0UC 4XIKA 3USUB 1K5MA 1IS5A 3KGLA 1MS8A 2IXJA 4KH9A 4NHMA 3FHAA 3LA3A 1ZYBA 1GMMA 4Q4V2 4Z92B 1MQTB 2EA7A 4P5YA 3M8LA 1PMJX 1YHFA 5DZFA 3NV2A 4GULA 5FOBB 2IXLA 4AF9A 1GSLA 2AZ5A 4RQPB 1BKZA 1AR63 2RS53 4CP9B 3SEEA 5JOZA 1MS3A 4HKOA 1OF4A 3KF3A 5FOJB 1AR93 4JGZA 3LA2A 5I91A 1W99A 5DG1A 1UW8A 5GLTA 3A0NA 1YWKA 2VCCA 3DECA 2GC1A 5FAXA 1JW6A 4UFLA 1A8DA 1JYTA 1RHI2 1NY72 4GALA 1LULA 4Y5Z0 1CWPA 1POV0 2RM22 3VL8A 1W8NA 4YSFA 3OPWA 4KBZA 1W39A 4L9BA 1FATA 4PIYA 4P9LA 1HRI3 4BMBA 5LY2A 2PQSA 1BYHA 4MGIE 2WO2A 4LE4A 1LU1A 3VBRA 4YFWA 3ZYJB 5FPVA 4L97A 4YM1A 1CZSA 5LATA 3ZYPA 3TWIA 3ZXJA 4AGGA 4QGNA 3GYDA 2B8MA 4KG0A 4EROA 3ACIA 3VKOA 5CFDC 4LLOA 2WIIB 2QDRA 4H7LA 1S0JA 2ZGRA 2PTMA 5EJ3A 3CHXA 1H30A 3N7KA 4CCKA 3ZX7A 2D6MA 3OUIA 4FOQA 2NQYA 4AXOA 4KMQA 1JOPA 1PM4A 1O5LA 3FLPA 1J1LA 5FYCA 1Y7BA 3WF2A 1C8M1 4CDWB 4LK7A 4FT8A 3KT4A 2MPFA 2W68A 2HKXA 3FL7A 1PX3A 4FXKB 1OOPA 1RGSA 4LITA 4YVWC 5A7WA 3V0AB 5FY4A 3J4UH 3OTFA 5K9YA 1WWYA 1HQLA 1GR3A 2Y0OA 4XZUG 5CKMA 3VBFB 1DLLA 1SHWB 5IVFA 1LAJA 1IS6A 3OB8A 5IAVA 4EQVA 2DVGA 3O1VA 4N53A 2W91A 1T6GC 5A7PA 3QH6A 4YW5A 4AI9A 1W0NA 1ZM1A 3B5LB 3SCHA 5FYIA 3LFIA 4N7IA 1FMD2 4CCNA 5IAXA 1K42A 2OS2A 1JOBA 1HN0A 2XQRA 1ZREA 1YO8A 3HAGA 5F5CA 3JB8A 3VZNA 5KC5A 1DGRN 1K5MB 3J7MA 3NJVA 2ZTNA 4QXKA 2VBDA 1K5JA 3NKTA 1RUI1 4AI0A 4Z1VA 4IEOA 4LO5B 4FSJA 3UKVA 3MHZA 1W6QA 4DRRA 4URAA 3SQOA 4I0WB 3AL5A 2VXRA 2WC2A 4XJ8A 1Z7S1 2RDRA 5L73A 3SNMA 2C26A 4JGZB 3POGA 4LTAA 5FZ7A 2VL4A 1GKBA 4HFSA 4CEYC 3L2HA 4KQ7A 4HANA 2PMWB 1D7PM 2W1QA 4XQ4A 1PK6A 3FUOA 2RJLA 4XFHA 2C5DA 5CKQA 1RUD3 2JD9A 1ZZ8A 4MX3A 1UAIA 2P3YA 5JCTA 5CNAA 3B94A 3FJSA 3HT2A 1UIJA 1U5XA 3AYEA 1YCIA 4XXAA 2CGNA 4LKEA 5J98B 1EPWA 1W8WA 3RFRA 3VBRB 2AUYA 2QDNA 2W0XA 2WKKA 2WLQA 3AZXA 5DPNA 4AWDA 4DMIA 4RS5C 3OD0A 4Q1RA 2CDOA 2D44A 1GWMA 2AEZA 1GUIA 2R30A 1JUIA 3TEWA 3PUHA 2W1WA 3DL3A 3S6PA 1W8TA 3MLLA 4Y1YA 3FE5A 1PZ7A 1GNYA 5EZWA 4XJUA 1AX1A 1QH6A 1QNWA 1YQ8A 2F4LA 2AC1A 2WNEA 1PVC3 3POFA 2PHUA 2XJVA 1J3PA 1DLCA 2WBKA 1VRBA 1XC6A 1YYNA 4XUPA 2JG9A 4DOUA 3SC7X 4CU7A 1UKGA 5A7WB 2OYZA 3JBG1 3SHRA 5JMOA 3G6JB 5JOYA 4JKLA 2AGSA 1ENRA 3ZSJA 2QQIA 1DQ2A 3M3IA 3R4SA 3USSA 1UCXA 1I9RA 4N53B 3WV6A 4CCEA 3OCPA 5JZGA 3IAQA 1NKGA 1RJ8A 1XNBA 2JDAA 1C4RA 3AZWA 4KL1A 2NMOA 3JD73 4UW6A 3AFGA 2Q8EA 1ZRIA 1UZVA 3FBYA 3RVHA 4QHOA 1UU6A 2ZA9A 4P9IA 1PGW1 1YQCA 2VNOA 3VDDC 3HT1A 2VTXJ 1X33A 3I4IA 1W6QB 5F1RA 2PHTA 1OHFA 1IS4A 1GP6A 4QXCA 4DUWA 3O1SA 5FZBA 1MACA 2HWF3 2ILMA 4KWUA 3HWJA 2FDFA 2WDBA 3HNBM 4XFBA 5F5QA 2RS31 1W6OB 2LUWA 5CADA 2DV9A 1AL23 4CP2A 1CD3G 1UX6A 3ZSEA 1PO23 4IEVA 3M3CA 4OMCA 4O61A 3EQEA 1GOHA 3HVDA 4NWVA 3EBRA 3CMGA 1PK6B 3MF6A 5I0RA 2B7YA 4D0QA 1GICA 2WO3A 5E89A 3SH5A 2YB7A 1LGBA 2DBIA 4ISQA 2A73B 4BPZA 2P6HA 2IXCA 1NQJA 5DQ0A 2EXHA 3B00A 3LA7A 3J7NA 2XLGA 3CO2A 4CEWA 2Y33A 1LOGA 1VBE3 2ZKLA 2HJIA 5JSPA 4FQ4A 2R062 3N3HA 5ANQA 3INAA 4D7YA 5HCHA 4QKNA 3DPRB 3THPA 5DG2A 4XAAA 1JOJA 3GNEA 2WZR2 3GXUA 1TME1 4C91A 1ST8A 2F4PA 2W92A 4K3UA 1HXS1 1REEA 1UXXX 2MEV3 4WM7B 4Z07A 4K1ZA 1LHUA 4EYUA 2GP3A 3D0SA 4BLIA 4QX5A 3MW2A 4MGYE 5J1XA 1AHSA 1CR7A 5BNPC 4LBOA 2RDSA 3PJQA 4Q4V3 4CZSA 4E27A 4BU2A 5ABJC 2GMMA 2OUJA 2YY1A 2JG9B 4P9JA 5DUUA 2RR11 5IJRA 1S0FA 3WHUA 4BDVB 1CESA 1NAEA 2KA3A 4RQPC 2D6LX 4CE8A 4MLOA 4BQ1A 3OOXA 3IAPA 3O5SA 2H6BA 3UGGA 4FP3A 5C8WA 4AW7A 3TBDA 5IFPA 5JZGB 2ZZQA 5H9RA 1EV12 1RHI3 3ZXFA 1KQRA 1RIRA 1TG7A 1GLHA 1RUF2 1YEWA 1A8MA 1UKRA 4CUGA 1Q8SA 2E63A 2RDQA 2Q8DA 4C0HA 3GALA 5EQUA 2J1UA 4LHKA 3A4UA 2NMNA 2VE1A 3I2HA 2A6XA 4XF4A 3URFA 5KWRA 4Y20B 1CAXA 1KITA 2YBKA 1JHJA 3SXWA 1CAUA 3BYWA 3AP7A 3IDBB 2OW4A 1GOGA 4BB3A 2XJUA 4LEJA 4IDZA 1O7FA 4LBQD 2PHDA 4IERA 4K21A 4XTPA 5FZAA 4MXVA 1PGL2 1KFUL 4UT5A 4ATEA 1HN1A 1VALA 4AVVA 1WW7A 4ZS2A 3M2MA 1SLCA 2A70A 1LEMA 1DGRA 4DY3A 1BBT2 2WT0A 4PF1A 3TN92 5DAVA 4CCMA 1QEXA 4PQ9A 4LBNA 4A3XA 1TVGA 3ILNA 5EYXA 4B7KA 4FAHA 3RZJA 2EIGA 5JAXA 1WZXA 4CEWB 4C90A 3OBAA 3QACA 1XJAA 1WA4A 5AVAA 3AZYA 3OSDA 4YM0A 5F2WA 5D1IA 2JIGA 2XJTA 1ULEA 1BEV2 3KCXA 3IPVA 2PHLA 3KHBA 4FO9A 4QDQA 5LBFA 1NZIA 3VBFC 1G9AA 2DUQA 1XXNA 4Q4W2 3OBTA 1ZX5A 3RZHA 3RRDA 2D7FA 4TYSA 4RHV3 2D3RA 2BJSA 4XMAA 1F8VA 1GNHA 3PUIA 2YGLA 3LSEA 4MG2A 1IG0A 5LRSA 2YU2A 2XPJA 5DAPA 1YIPA 1CJDA 4KG8A 3WX5A 2GH8A 5ACA1 2DU1A 1HLCA 5HI0A 5KHJA 1SBFA 2LW8A 1K5MC 2WS93 2XL7A 1X50A 5FP7A 1IQDC 3AP6A 5HXMA 1BZWA 4FPJA 1EY2A 2PLV3 3AP9A 4JGYC 4RGKA 2QFEA 4XTMA 4I3GA 3RG0A 4CXWA 5IK8A 1HB2A 3CNAA 3HBKA 3KT1A 1OF3A 4C1XA 3U37A 4OULA 5E88A 3W21A 5JWPA 1NCQB 2D43A 2YPJA 4FFHA 2PELA 1DHKB 3C7EA 5GLUA 4HT1T 4FAGA 2TNFA 2VZTA 3RS6A 2FZ2A 3MLKA 4CCLA 3O12A 1QJX3 2JECA 4HLTA 4UFJA 2BNNA 2XJRA 4DXSA 2HH9A 3LEIA 2FBEA 4Y3OA 1HKDA 1O4YA 5KHHA 1QIQA 1WA6X 2VM9A 5FZDA 3WQ1A 1TNRA 1MS4A 5ANNA 1US3A 1LKNA 1OVSA 3KD4A 1BVP1 1CAXB 1QMJA 2EAAA 1CAUB 2PHWA 3NNGA 5CFCC 5FUPA 5LBBA 1FYUA 2HYXA 1TE1B 2E6VA 1AZDA 3K4AA 5D21A 1YFXA 4TLFA 3RZLA 4IEYA 3ZLIA 3AKPA 4S2GA 1ND3C 4S2HA 1OT5A 2WWJA 1R1A2 4HBNA 2DTYA 3VHRA 2VBBA 1AR73 1UIKA 1W9FA 2R042 4BCUA 1N3OA 5FY9A 3DGTA 1AXKA 5L9VA 4YM3A 2QNKA 3HOBA 2Y6FA 1YJKA 5HCBA 5LK5A 3WQ7A 3WNLA 3E5XA 5JR7B 1QQP2 5E1RA 1W0PA 3IPVB 3VZMA 2R072 3Q8AA 1X8EA 5ISLA 4IGQA 4D8MA 4ORFA 2NM1A 3AMNA 3TN91 3POYA 3VKFC 1LHVA 1WW5A 2HWD2 4XUQA 5DN2A 4H3WA 2MHFA 3DXUA 4N43C 5HXVA 3T09A 1C57A 1TMF2 2HWC3 3VD5A 1YQ2A 3WW3A 5A6QA 1ENQA 1BMV1 4P9YA 1EP0A 1SZBA 3OPTA 5K4LA 2P34A 1JU3A 1SFYA 4XBLA 4YW7A 3UGHA 2JB8A 1H4GA 4OUEA 4QKBA 2OXBA 4ES9A 4AHYA 4AI8A 3H42B 1R083 1T6BX 3L2YA 3NWKA 4CCCA 4DB5A 2VMDA 1J1TA 2D6PA 1ZBE2 3H8XA 1YQ5A 3HNYM 3TRSB 1S0BA 4OCTA 3KHCA 2D5HA 3VKLA 3V0BB 5IVYA 3P5BA 1CZTA 1PK6C 2K2SA 3ALQA 1RC6A 3PUAA 2QZ3A 5EXOA 1KRIA 5F5IA 4XDQA 4A7KA 2XJPA 2CDPA 4META 4Y33A 3RYKA 2WT1A 4IV1A 5L19A 4OI1A 1D0HA 1SCRA 2R063 4QAWA 3HMYA 4XACA 1K3IA 5A1AA 4PDWC 4Q4X1 1ZZ9A 2ZGLA 1JBCA 3DPRC 2WZR3 3E6BA 2WFF2 5CEHA 1QJU3 4CDUA 1NYWA 1LOFA 4XEZA 4WM7C 3FBMA 3WQBA 4C8DA 4GB31 5C3QA 4HKWA 1NCRB 4FI9A 4JZRA 3PVBB 1YI7A 4O65A 5FP9A 4UAPA 2DUOA 3RGBA 5A6XA 3W58A 1DFQA 2JWPA 1PNFA 3PL0A 2Q8CA 2YUEA 4IEUA 2DFBA 2IZWA 3GBWA 5FYHA 3O1TA 3WDXA 2C9KA 2RS52 3T3YA 1AR62 2B42B 2TEPA 1RINA 5GZDA 1F2NA 4YNIA 4CUCA 1I5PA 5FLJA 5JOXA 1AR92 2PHXA 4UFKA 1QY4A 2ZOEB 3A21A 4LXLA 5JDBA 3VV1A 1DZTA 4QX3A 2N7GA 5JZGC 1EV13 2L9LA 1GWLA 1QDOA 2JDZA 2SLIA 4CYDA 3HIFA 2FCUA 2ZMLA 2BVVA 5GZGA 3ORJA 1VRH2 3OGVA 1RUG1 2VVFA 1SPPA 5IVBA 5F37A 2BNOA 5LBCA 1HRI2 1HQWA 3MF9A 2CYFA 3J9SA 1UWWA 1UL9A 4AFDA 1MS0A 5FJHA 1NA1A 1F5FA 4DEQA 3PLQA 4I0BA 4YG3A 4E4SA 3E6DA 1VP6A 1RMU1 3J8F2 4BLJA 3WW4A 1WLWA 3H50A 1YXWA 1OKQA 2OX0A 3GBGA 3M7AA 2CU5A 2WNUA 3T0BA 2VY0A 1ALYA 2IFRA 4QPIC 1FI2A 2X5IA 2CAVA 4L99A 3H3UA 1LEDA 3U1XA 2DBNA 3PJYA 5FREA 2ET1A 1S0EA 4CU6A 1QJY1 1V9U2 2CV6A 5FZMA 1FPN1 1XSRA 1EUUA 4V1PA 1TQ5A 3FZ3A 3RI9A 2ZEZA 4IV1B 3PMSA 4BWOA 3I2OA 1VBA1 1BEV3 4OHXA 5A32A 4IQPA 3BUCA 4DXTA 5EWSA 2P3IA 4XFCA 5G04L 4E4HA 3E6CC 1Q8QA 3AKQA 2W2IA 4CDUB 5HV4A 2QBXA 1VPHA 1YJLA 3ZPOA 1RUNA 3VHNA 2IXIA 1FOD3 2ZS6B 2ZX2A 3DYPA 4QQPA 2E9QA 4QPWA 3OYWA 4TSVA 5FRAA 4Q1PA 3WNMA 4YYOA 4FVVA 3WCSA 4SLIA 2R6QA 5FKCA 2XBO3
chains in the Genus database with same CATH topology
1VB2A 4LBLA 3ILRA 2R0HA 1H2MA 3DV8A 2VUJA 4P9WA 1NCQC 5K7PA 2AREA 1U5IA 1H4HA 2WSUA 4MZUA 1AYM1 1GYKA 3U10A 3NAPC 1BJQA 5J36A 4KBBA 4AYUA 1HX6A 1RUD2 3QLQA 1GQGA 1QOSA 4Y1XA 1ENXA 1RUE2 2ERFA 4GQ7A 2R0FA 4CRQA 3B02A 3WUCA 1NA1B 1VAKA 1A6CA 2D6NA 3ZYGA 1OA4A 4JRLA 4OI2A 1H2NA 2ZHLA 1FNZA 1RUOA 2QVSB 3LZZA 2WNUB 2BVBA 4LT5A 2X5IB 3ILFA 1HRI1 2EF6A 3S7IA 3M3EA 4HSLA 4PLNA 1PVC2 3ZFFC 2VOWA 4YLZA 2R043 2V5YA 5AVPA 3WINE 2W39A 1JHNA 5C33A 3R05A 1DGWA 3GHMA 1SBDA 1AX0A 1SLLA 2GNDA 1CJPA 3VBUA 5A32B 1O4TA 2R073 4QM9A 4YZ5A 1LHOA 3OD4A 4ISRA 3WZ1A 4QQHA 2IFWA 2XG3A 1DF0A 1MEC3 3FFZA 4D94A 1WGPA 1OA3A 5KC6A 1XU2A 3OYWB 1TMF3 3AK0A 3CLPA 4PJYA 3LOBA 5BNNC 2ZJCA 1XYNA 4XIOA 2HWF2 1PO11 2Y0IA 4BPZA 2DU0A 3AMHA 1AVBA 5EFUA 5BV6A 3B9CA 3ZSLA 1AL22 5BYNA 1VBD1 4RD7A 1PO22 3AFKA 4QPYA 4XMIA 2PFWA 4NVPA 3JB4C 1DQ4A 4Z2WA 4WVWA 4E2QA 2WT2A 2EXIA 1KJRA 3BALA 1V70A 5C6CA 4MVTA 4COYA 4YG6A 2A3YA 2CTVA 3KB5A 1D4M2 1C5IA 5KHGA 5JI9A 1DBNA 1R091 4TZDA 2PHRA 1B09A 2AR6A 3CF6E 2YDEA 4JRAA 2MEV2 2RMU2 2AYHA 4BM8A 4QD2A 1ASJ1 1ULFA 1ND2C 4GH4C 1ULGA 1LGNA 1I3HA 1NCRC 1W6PA 4BYYA 3ECQA 3MW3A 1MS9A 3HBZA 4J1WA 3RYRA 4G4FA 1GBGA 3Q9OA 4AEMA 2R32A 3D4KA 1MVEA 2B5HA 2OUHA 1A78A 1QWRA 3M3QA 3IDEA 5AC91 2B45X 2NPIA 2V09A 5BNPC 3W59A 4HMZA 1SLIA 3U11A 1VRH3 1QH7A 2R1BA 4YZ3A 4Q4Y2 1LRHA 3ELNA 5H9PA 1VB4A 4WV8A 4YVSC 5CG9A 4XJWA 5GZFA 3LSDA 3RQ0A 2D93A 3IWZA 1CAWA 2EXKA 2PYTA 4DPNA 3J8F3 2DVDA 4CDQA 3JD71 4D7TA 1BVVA 1ZRFA 3ETQA 2ENRA 1JYCA 4XXPA 3VBSA 2IC1A 4M01A 3LOIA 4JDMA 5GKAC 2MNGA 1V9U3 1RUJ3 4JV4A 3I2DA 3MICA 1AL21 3KSCA 3THTA 3VKMA 3ZFEA 1S0DA 2NLRA 1LOAA 5DDJ3 4YARA 1PZ9A 4FCAA 3WR0A 3P3PA 4IXLA 4K20A 2YROA 1E57A 4RHV2 4ASMB 2YV8A 4OI0A 1I1EA 3WW1A 4AGRA 4CDUC 3OJBA 5FPZA 1U5ZA 4AVAA 1OI6A 1RVF3 4SBVA 1VBE1 4U36A 4S2DA 2ETEA 2WS92 3VHOA 1W6PB 1VBB3 1NZCA 2PLV2 3MFAA 3SH4A 2LM3A 4JDNA 1UPIA 4Q0SA 2GSYA 4AI2A 4FPLA 1H8VA 1OLRA 4YZ1A 4YZ4A 1PIV3 1YLLA 1KS4A 4PF5A 3ME2A 4M3CA 2UYBA 1JYIA 4Q4V1 1QJX2 1WCSA 4AEDA 3PVEA 2WLPA 4LBKA 5LEKA 2W08A 1C3HA 5AFBA 4AVCA 1OPOA 2DCJA 3FLRA 4YGDA 1RUE3 4ASLA 1WMDA 3FHIB 2CNAA 4WM8A 3MI8A 1DIWA 1CAWB 1PGSA 1NA1C 1AUYA 2FZ1A 1KS5A 1RHI1 1NY71 3ZVXA 4HPKA 2VNGA 1COV2 2HEYF 2RM21 4AEKA 4MGZE 4GMP3 2DVFA 5CU1A 3ZYIB 1MZ6A 2WNUC 5I8TA 3FFQA 4LO7A 3VBSB 1CIWA 4MYEA 1ULCA 4CTEA 1AR72 2XGXA 3VHPA 1ZZ7A 1OOPB 5GZCA 3NV1A 2ZMNA 1WMEA 3ZFEB 4D69A 4IEWA 4XJ9A 2ZBJA 4I0AA 4IEQA 1BXHA 1ZZCA 3WDUA 1V6KA 3RPQA 2XVLA 1LTEA 2GMEA 2HWE2 1FV3A 1MZFA 2ZX1A 4WVVA 2ZABA 4WBBA 1LB2A 5A33A 4P9XA 4FTSA 2RJKA 3RJ2X 4NHLA 2HWC2 3B7MA 3UKNA 2DVAA 2FMDA 2GAUA 3ZMOA 5JOWA 1POV1 3QBQA 4CDXA 2RE9A 4FBFA 5C8CA 2ET7A 4G9SB 4XF1A 1TNFA 1R082 2B9UA 1FMD1 4M3CB 1DZQA 2A6ZA 1LHNA 1NLRA 2ARBA 3MIEA 4AEDB 2B39A 3MIBA 2A6WA 3R0RA 4HK8A 1AR82 3WP5A 4IL7A 3BPZA 1NG0A 3IT8A 4Y24A 3ZXAC 4XFFA 1D0GA 4WM8B 4XF0A 5JSRA 1D4M3 1C8M3 4LHLA 1LR5A 1NLSA 3I8TA 2X53S 2VG9A 2WNVA 4W65A 3KLSA 1N3PA 1QJU2 1G8WA 4EWEA 3B3QE 1CVNA 2RMU3 2BPA2 1NQDA 1F9KA 2AENA 4HVOA 3W9AA 2R1DA 1MQTC 3RDIA 1O3TA 1NXMA 1RUI3 1OQEA 3H1WA 1EYBA 3FUQA 3IBMA 4B4RA 3ZN5A 4AFCA 3WG3A 3S30A 3EHKA 4FOWA 4J6GA 1Z7S3 3R6SA 5KXDA 4FPKA 2E7QA 4MSVA 1WLCA 5A33B 1XNDA 3NV4A 1G9FA 1C1LA 4I02A 4NO4A 2Q1MA 4NR1A 2VW2A 4Q4Y3 3AP4A 4YRDA 3IDCB 2VUAA 1V6LA 2ZHNA 5C8CB 4LA3A 3ZIXA 1IZ3A 1ZZ6A 2WJSA 1ZZBA 2BFUL 1URXA 1ZBA2 3HR9A 1Q5OA 4K1YA 2JENA 4GXLA 2XVKA 4QT6A 3VBHA 5J7MA 3TNQA 5DZEA 4AFAA 2C9AA 4PBPA 1B35A 2RS12 2HEWF 3SCFA 5FO9B 4I3PA 2JICA 1AYN2 2PN5A 4CDWC 3B9IA 4D3WA 1U12A 3RI8A 5L36A 4YW3A 1H1AA 5FBZA 4BIOA 3JBG3 2DCZA 2NZ9A 2ZX4A 1UZZA 2EVXA 4N9IA 1VJ2A 1FOD2 2Q4SA 3ZXLA 2R061 3ENRA 3M4FA 2D5FA 1LOCA 2XBO2 5CA6A 3SISA 2GN3A 2WZR1 2ZGTA 2GH2A 4QQ2A 4COWA 2BW8A 1AXZA 1ZVFA 2A6VA 3QH7A 4URTA 1MVQA 4JGZC 2GNMA 3P3NA 2DCKA 3X29B 4Q0UA 3ZFGA 2I45A 2RS33 4P14A 1CAVA 1V6MA 2I74A 2Q1ZB 2ZGKA 3E5QA 1ONAA 3BODA 3VBOA 5HCAA 2I07B 3JZVA 4M00A 2BFUS 5FDBA 3MIFA 2DURA 1CONA 1Q8OA 4W6WA 3VBRC 1EV11 4Q27A 1COV3 5E8AA 1RUF1 2XL9A 3WT3A 1MZEA 1UU5A 4OUSA 4OLLA 4QQOA 2A6YA 1B35B 4Q0PA 2GALA 4COVA 2DVBA 3UV9A 1HXS3 2NP0A 3OGGA 3GHNA 4IETA 1XRUA 4FP2A 5FO7B 3SLIA 1OOPC 1PGL1 5KXCA 3AB0A 4Q8KA 1W0OA 2A71A 3ZFEC 1FT9A 2TUNA 4XE9A 1BBT1 3IKWA 2HWE3 4N53C 5K0UA 1MEC2 3ZO0B 3ZXKA 1UN1A 4DZGA 1DQ6A 2WINB 3U07A 1KDKA 3IM0A 1BEV1 5JSOA 4XJZA 4FQZA 5FFOC 3BTAA 4Q4W1 5CBLA 1WD4A 1PNGA 4EN8B 2DCYA 3E97A 4X6RB 2OVUA 2BYVE 1VIWB 4A7ZA 1HRV2 4HETA 4MH0E 3ZFGB 3ZN6A 1CAVB 4RR3A 3H1MA 2GN7A 3T1MA 3KQRA 4Y22A 4HN0A 4AEDC 1NE6A 3N35A 3ST7A 1AR83 2JX9A 4Z82A 2C1FA 4X6QB 4RFT0 3QOPA 5FCCA 3VBOB 3KT7A 3LWCA 3NSTA 1QDCA 3CJXA 4ZU4A 3CU7A 5CFDA 4YW1A 1RUH2 5GLWA 2KM2A 1VBC2 4AVBA 4UW4A 2A3WA 4A7YA 3RWNA 4UBGA 1I5ZA 5KBFA 4FPCA 1LOBA 2WA4A 4XF9A 4R52A 5JMCA 3GBFA 2EAKA 2P37A 3AM2A 4QGMA 4KWLA 1SCSA 4YVWA 1OA2A 1N1VA 5ACA3 2JG9C 4EV0A 2VQ0A 4MXWA 4EN9B 4Y4YA 3OBRA 3MGUA 2ZGUA 2Q5TA 2HWB2 2E53A 1R1A1 3AMPA 4W6YA 4HL0A 3C3VA 3PNAA 3WVJA 2R041 2OA2A 5CIRA 2X8KA 4I30A 5T52A 2PAKA 2R49A 3H1YA 5IK5A 1HV0A 1QQP1 3KMHA 3I59A 2ARXA 2R071 3QCWA 4AHXA 2I2SA 3VL9A 5C8CC 3KZ4C 1QF3A 1IKQA 2ZX0A 4HKLA 3SCGA 4AI3A 1RTVA 1C5HA 2HWD1 1ZBA3 1ZA4A 4NN0A 2CWMA 4AEJA 1Q8PA 5J96B 3DN7A 1TMF1 3B93A 5F6LB 3ZN6B 1FX5A 4GIQA 1O3QA 4Y26A 4RR3B 4Q2FA 1QOTA 4I01A 4Y22B 1XU1A 2RS13 1GZ9A 4WVMA 1AYN3 4GWNA 4LLFA 1RUJ2 5LK7B 4CEWC 3WG1A 1ZBE1 2XWJB 3HD8B 1YIFA 5DDJ2 5CFDB 2UWCA 3N7JA 4B4PA 2Q30A 1X36A 5F9TA 1EAH2 2QQPA 4LULA 2WQ4A 4FOVA 4AQ2A 3S7EA 2ATFA 3D0JA 4ES8A 3M1HA 4QU2A 3BU7A 1RVF2 2JG8A 3I54A 1VBB2 2ZGPA 2OZJA 1ZRRA 4GMP0 4YVWB 3UJOA 1D2QA 4AQSA 1BK1A 1XYOA 2JD4A 4L2NA 1ZNPA 3KGZA 4MXWB 2WFF1 5KHIA 1O5UA 1WW6A 3H9AA 2DTWA 3K48A 1PIV2 1KFXL 2Y26A 2ZAHA 1DQ0A 2BQPA 2BWAA 4UW5A 5IUQA 3WDVA 4D7SA 2ES3A 1RUC2 4DY5A 3MIDA 3S0MA 1J3RA 4BMEA 4GWMA 5CVRA 4UXAA 3WP4A 1OQDA 2UWAA 1AR61 1OFSA 1WW4A 2D3PA 2RS51 2JE7A 1WCKA 5GJ6A 4QQLA 4DFSA 2X29A 3ASIA 3BCWA 1H9PA 4MUVA 1QXRA 1AR91 1YFWA 1V6JA 3I59B 2E7AA 2BGCA 3AKSA 4LBQA 4RGAA 5SV5A 4QHBA 4AFBA 4LO4B 3AP5A 2IXHA 3NW4A 4P5HA 1GNZA 1VRH1 4YW4A 4BOWA 4E4DX 2UU8A 2VECA 1D4VB 2UY9A 1B35C 2F6BA 1KXGA 5FO8B 2FHRA 4BIFA 1QNYA 2A75A 1J59A 2KXLA 3J8F1 3K51A 1WBFA 3NV3A 4AG4A 4I09A 2P17A 4B4QA 1S2BA 2ZX3A 1O4ZA 4FTEA 3VLBB 3WP3A 3JQWA 5T3NA 4FPOB 1H8TA 3AZZA 2ZHKA 1SFNA 4BZ4A 1V9U1 1C1FA 3MIGA 3USUA 1QU0A 1WUVA 5H9QA 5ABJA 2JG8B 4KU8A 1JN2P 2ZGQA 2IWGB 1REDA 4RQPA 4K8FA 2WQZC 1SEFA 4K7JA 4PLOA 1OPMA 2YXSA 5LEJA 4LO6B 3G7DA 1PVXA 2VPVA 3AJZA 1V6OA 3AKRA 2YHJA 3FC0A 3CEWA 1HRV3 3BB6A 3ZFGC 2VOKA 2UYAA 3CL1A 3WNXA 1YNAA 1MS5A 2PA7A 4AFMA 2H0VA 4RL7A 1QJZA 5CG8A 3RJRA 2BBVA 2NN8A 1FAYA 4RSUA 3V56A 3EJKA 5BXXA 3VBOC 1QHDA 1QJY3 2ZGNA 1Q8VA 1C8M2 5GLVA 1U0AA 1FPN3 3POWA 5JPMB 1RUH3 4QGLA 2VMGA 3LCPA 4DNYA 1VBC3 1VBA3 3D8CA 4HSJA 1MR5A 1RUD1 2EXJA 1H2LA 2EALA 1RUE1 1QOOA 3RSJA 5KXEA 1D2SA 2VULA 3TAYA 2XUMA 2Z5WA 5DUVA 5HBAA 1RUI2 3JCIA 3LB9A 4L8QA 1NXD1 2P2KA 4XBQA 2WWSA 4GMP1 4N9HA 3TB0A 3NO8A 3VBUB 1Q56A 3PVNA 2D40A 4RA0A 3UK9A 4Q29A 1Z7S2 2HWB3 4ZKTB 5H9SA 1H8TB 1PVC1 4YFZA 2A3XA 1YI9A 1AYM3 1CPMA 3N7LA 4JGYA 2QKDA 3GZTB 3MYXA 3RZZA 4JTOA 4YGBA 1G86A 3WP6A 1Y43B 3VZJA 4XFIA 3UL2A 5BUVA 2K0GA 1WD3A 4R9BA 1G9DA 4WVZA 3M3OA 4OHZA 3SITA 4RR3C 4R9DA 2Z69A 1DZRA 2HWF1 2GNBA 2NYYA 5F6KA 4AK3A 3R4DB 4WZFA 3GZAA 1IPKA 1IPJA 4B7EA 1SDWA 4R9AA 5GLZA 1PO21 5CFCA 5J09A 4IV1C 3KCCA 4BE3A 2QJVA 1LOEA 4XQWA 3WOGA 3D82A 3JBG2 1EAH3 4GKYA 3T1LA 1ND3A 4R4XA 2XJQA 1LOFC 3ES4A 5GM0A 4KGQA 1D4M1 2WZPP 3H0OA 4F83A 3KM5A 3LAGA 4HZFA 1PGW2 1WCDJ 2ZZJA 5JI7A 3JU9A 5BPXA 2VGDA 4ZU7A 3WCRA 4XQDA 2MEV1 1PO13 1ULDA 2RMU1 2RS32 3N7MA 4R4ZA 1KDMA 1RUC3 4BA6A 1VBD3 3ES1A 4N43A 1CX4A 2OPKA 4DRVA 1DYPA 2JJ6A 3NKGA 4JGYB 1W6OA 4EJRA 3ZYRA 5BNOA