3AP7A

Crystal structure of the galectin-8 n-terminal carbohydrate recognition domain in complex with lactose sialic acid
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
151
structure length
151
Chain Sequence
SLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSVKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-8
publication title Galectin-8-N-domain recognition mechanism for sialylated and sulfated glycans
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 34
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2010-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3ap7A00
4KBBA 4Y20A 1MVQA 1MS4A 2ES3A 4WV8A 1MS1A 3AYDA 3V65A 1HQLA 5LK5A 1KDKA 4FOVA 1S1AA 2ZABA 2D43A 1SCSA 3ZPYA 5IT6A 4K1ZA 3RMYA 3W58A 2A70A 1AVBA 1VALA 4FPOB 4PCRA 1FNZA 2E51A 4XDQA 3RMXA 3LSEA 4YZ4A 4Q8KA 4XBNA 2ARXA 5DZGA 4ASMB 2D3RA 4XXPA 1SFYA 4XTMA 1UPSA 1Q8QA 3POSA 1IS6A 1CESA 1MS3A 4GWMA 4WVVA 2KM2A 3OY8B 4DRRA 1QF3A 5DXDA 1AXKA 1DZQA 2B7YA 2PHUA 1A8DA 1J1TA 3MW2A 2SBAA 1MS9A 2ZGNA 4FOWA 2R1BA 5T54A 1G9BA 3V64A 2TEPA 3SISA 4LBNA 1AX0A 1KRIA 4P9XA 5DUWA 3VUOA 3R05A 1SLCA 2E7QA 3U4XA 4AVTA 1CVNA 2ZA9A 3OJBA 3WVJA 2R1DA 4LBLA 1ENRA 1UZYA 4YW1A 3SH5A 4M3CA 1YYNA 3WLUA 2D6LX 3APBA 2Q5TA 5DZFA 3WDTA 1AXZA 2AUYA 2DURA 2VW2A 2WT2A 4FOQA 4Q26A 3D4KA 1IS3A 2CTVA 2CYFA 5HCAA 5GJ6A 2YZ4A 1LENA 1N1YA 2A3WA 2JJ6A 2GALA 1W6NA 3BOPA 2ZMKA 2D6NA 2NP0A 3FLTA 4LBKA 3SLIA 4XZPA 4XBLA 1DYKA 4CRQA 2VU9A 4R9DA 1MS5A 3OYWA 1ENSA 4AYUA 3A0NA 3AJZA 3M3CA 2WLQA 1ULCA 5T5PA 3N7JA 1HLCA 2JECA 2XG3A 3ASIA 3BIWE 4YW4A 5IUQA 1LHNA 4BLIA 3AXDA 4YM1A 4YW5A 3A0KA 4DFSA 1DQ1A 1N3QA 3D6EA 5T5LA 3O0XA 3WUDA 1HDKA 4YM2A 4C1WA 4Y20B 1LCLA 4BQ1A 4NO4A 5FRAA 2G4IA 1LJ7A 1LU1A 5GLWA 3M1HA 1FYUA 4FQZA 5GALA 2AH2A 4DQAA 4XBQA 1AF9A 1QDCA 3RG0A 2DTWA 4K21A 2A6WA 2NN8A 2YV8A 4XMAA 1CN1A 5KXBA 4XHXA 2EF6A 3VKNA 2EIGA 3D5OA 1GLHA 4FPCA 4MYEA 3AJYA 5GZFA 3NWKA 3AZYA 2RHPA 4YZ3A 2GMMA 3WHTA 2ZGPA 1WW7A 2A3YA 2EALA 4LBJA 1H9PA 1WD3A 2JKBA 3JUUA 4PF5A 3WDVA 1QGLA 4ITCA 4W65A 3UJOA 4YM0A 3OBRA 1LGCA 4M01A 2PELA 4AGGA 5T55A 4LBQA 1Q8VA 4P14A 2ZAAA 3WNXA 3SNMA 5IK7A 2JDZA 2A6XA 2NYYA 2GN3A 5FREA 3WG3A 1G9DA 4FVVA 1F9KA 1GYKA 4M3CB 1ZA4A 4XMIA 2NMNA 1BJQA 3BODA 2ZGKA 4BPZA 1JN2P 1QDOA 2Z42A 1S0BA 1G9CA 4FPFA 3FUQA 3N7MA 5JMCA 4XOGA 2JE7A 5T5OA 2DYCA 1SBEA 3TB0A 4H55A 1S0FA 2D3SA 1ZM1A 2ZGMA 3QCWA 1JHNA 2OUJA 5GLZA 3ZSJA 1D2SA 1W6NB 3DUIA 3M2MA 1VLNA 4M3CF 5IK4A 1AX2A 3R4UA 2OW4A 3INAA 1GICA 1MS8A 1LHWA 2DVBA 5CB7A 4M3CE 4JC1A 1KITA 5GLTA 4YZ5A 1WLWA 3B9CA 3MPPG 3OYWB 2D6OX 3IPVA 1GV9A 1Q8OA 5JOZA 1DQ0A 2UWCA 3ZVXA 1LODA 2A71A 4IQPA 4ISRA 4YZ2A 3AYAA 3WZ1A 3B3QE 1O4ZA 1S0JA 3M3EA 1G86A 1UZZA 3ZXLA 1WW5A 1C1LA 2AENA 3I8TA 1QMJA 2CWSA 4XJUA 1W6OA 2C9AA 1F5FA 4FPLA 5DZEA 1W6PA 1S0DA 2UURA 1DIWA 2GNMA 1JUIA 1RINA 1ULEA 3AZZA 4U36A 4BOWA 5H9PA 1A78A 2UWAA 4XILA 3AFKA 4Y1VA 4FQ4A 1DQ4A 4Y1YA 1CPMA 3FUOA 3SH3A 1LOGA 3KM5A 2GNTA 4RA0A 2ZGUA 4TYSA 5JOXA 4R9BA 2C5DA 4M00A 5IK8A 1DGLA 1PZ8A 1APNA 1B09A 5KXCA 3AZXA 5CNAA 3I4IA 2ZZJA 2VXRA 1LEMA 1Q8PA 1UMZA 3RS6A 5CA6A 1V6KA 3DGTA 4YG0A 3N35A 3NV3A 4YG6A 4WVWA 4Q1RA 4YGBA 5JOYA 1YRZA 3AP7A 4FPHA 5SV8A 3AP5A 3PMEA 5IK5A 1Q56A 1ULFA 1BXHA 3ZYPA 5DUXA 1V6OA 2AR6A 2E6VA 4LBQB 3ZSKA 2UU8A 1GNZA 4CTEA 5GM0A 2D6KA 1AZDA 3OBTA 1V6NA 4FPKA 1A3KA 1YIFA 2ZGOA 1JW6A 3WCSA 1YI7A 2PHTA 1JOJA 2R0HA 2WSVA 2AREA 4FOYA 4Q27A 4RL7A 2LTNA 3AXEA 3MW3A 1RIRA 1SCRA 4Q2FA 4XIKA 2E53A 1VAVA 3AZWA 1V6MA 2W39A 3R4SA 3UJQA 4XJZA 3WG2A 2SLIA 3AYEA 3SITA 3LCPA 3T1MA 3UK9A 2DWRA 5KXEA 2V73A 1DBNA 2GDFA 4FPGA 4OZXA 1LTEA 5JDBA 1MACA 1SLAA 1UX6A 1F31A 2DUQA 1SLBA 4DS0A 4Y1UA 4Q1PA 1BQPA 5HCBA 3VKMA 1BZWA 3PJQA 3C2UA 5E8AA 1AJKA 1ULGA 2W52A 1UAIA 2ZHLA 4YFWA 2ZGSA 1JYIA 3IPVB 3WDYA 2WSUA 4JRAA 3OPZA 4Y1XA 1ENQA 1Z0HA 1LULA 1Q8SA 2W08A 3B00A 4FP3A 2DTYA 1DQ6A 2A75A 5H9RA 4YM3A 1N3PA 3T2TA 1XQNA 2ZMLA 3USUA 4DPNA 5EWSA 1DHKB 4R9AA 2EXHA 2ERFA 3NV4A 3POWA 4HL0A 3WDUA 2ZGLA 1Z78A 5JLVA 1W6OB 4FPYA 1W6PB 1WD4A 1UKGA 1FAYA 3N7LA 3PVEA 3W59A 1TEIA 3FFZA 3KQRA 4XE9A 3ZSMA 1WUVA 3NV2A 3ZYRA 3VKOA 3FBYA 3WG4A 3WCRA 4FPEA 5DG2A 2ZHKA 2P37A 4ATEA 5GLUA 5E89A 1W6QA 1V6JA 2P3KA 4XIOA 1U0AA 4I30A 4ZXKA 1X50A 1QOOA 2A6VA 3TAYA 1OKQA 3IMNA 3HN1A 3JU9A 2OVUA 3B01A 1DYPA 1N47A 3FLPA 3QLQA 4GKYA 2W68A 4DRVA 4HANA 2VH9A 4ZKTB 2H0BA 1GANA 1LOFA 1W6MA 5T50A 1GZWA 3WOGA 5EYXA 2D7FA 4YGCA 1VAMA 2PHFA 4YGEA 2D6MA 3AP6A 1C4RA 2NM1A 2PHWA 1QU0A 1SLTA 1FX5A 2ZKNA 5DUUA 2DU1A 1YO8A 5EYYA 2DU0A 1BYHA 3L2YA 5HCFA 4Q8LA 1URXA 2DVGA 4P9WA 1GZCA 1GBGA 1CPNA 1FV2A 1OFSA 2DVFA 5L73A 5GLVA 1PZ7A 2WQZC 1WLDA 2VY0A 4YG3A 1JBCA 4XJ8A 1ONAA 2DV9A 2AGSA 1IKQA 2ZHNA 1CQ9A 2R0FA 5E88A 2FHRA 1WBFA 4BLJA 3AP4A 1AXYA 1KQRA 3PVOA 4PBOA 1DLLA 3M3QA 3T1LA 1GKBA 1DFQA 4JCKA 1W0PA 3CNAA 3AYCA 1QNYA 4C1XA 5F5QA 2P34A 2BQPA 3H0OA 3AK0A 3AZVA 1BKZA 3O0VA 1JYCA 1SBDA 4L8QA 2GMPA 2GMEA 4PBPA 4GA9A 3LSDA 4GWNA 3USUB 4K20A 5H9QA 1MZ5A 1N1VA 3FLRA 5CAZA 2VW1A 2ARBA 2WT0A 4UW6A 1S0EA 5DG1A 3N3HA 3IM0A 1CR7A 3V0BA 4K1YA 1FV3A 1NLSA 4F83A 3RRDA 4GKXA 4FP2A 3ILNA 1CONA 3O0WA 2A6YA 4PQ9A 3VKLA 1MR5A 1GSLA 1S0IA 1KJLA 3BTAA 2OUHA 3V0AA 1WLCA 3IKWA 3IN9A 1VIWB 3WHUA 4CZSA 3MEPA 3ILFA 2NMOA 4XHBA 1W6QB 3B69A 4AGRA 2YROA 4FPJA 1MS0A 2AYHA 4LBMA 1JXNA 1LOBA 3WDXA 2DVDA 5DUVA 1SLLA 3Q9OA 2CY6A 2ZACA 3UL2A 3WV6A 4UW5A 1LECA 2CL2A 1MVEA 3ZXEA 2FMDA 3HR9A 4BMEA 4GXLA 1W6MB 3AX4A 4UW3A 5KXDA 1GZWB 2YXSA 3POYA 4AVVA 1SLIA 3GNEA 5GZGA 2VUAA 1LU2A 3O5SA 3VV1A 3GALA 1S0GA 1I3HA 1N3OA 2A6ZA 1IKPA 3ILRA 1ULDA 1WW6A 2DUPA 1R1ZA 4Y22A 1YXWA 2NZ9A 1IOAA 1LOCA 5GZCA 3WG1A 2WNEA 4BM8A 2GN7A 3M3OA 2A7AA 3WDWA 2EAKA 2LALA 1FNYA 1RITA 3AP9A 2WJSA 3NV1A 3ATGA 4YZ1A 2P2KA 4YFZA 4XJ9A 2EXKA 4BMBA 1SACA 2ZGTA 4XTPA 1UL9A 2VW0A 4XXAA 1CJPA 1LGBA 3ZXJA 1V6IA 1EPWA 1GZ9A 1H9WA 2PHXA 1LESA 1S0CA 1N1SA 2EXIA 1O4YA 3N7KA 1DQ5A 1NXD1 2D3PA 3O12A 4XYXA 1C1FA 5GZEA 1QOTA 2ENRA 1QOSA 2UWBA 3OY8A 3OGGA 3N36A 4P9YA 1DQ2A 2ZGRA 3A4UA 4ATFA 1QKQA 5CBLA 2HYKA 2DUOA 1WW4A 3HMYA 2ZHMA 1Y7BA 1PZ9A 4AVSA 1QNWA 1KJRA 5T5JA 2D44A 1G8WA 2E7TA 4GALA 1LGNA 4LBQD 5H9SA 5AVAA 3WUCA 2GNBA 1OQ1A 4LBOA 5T52A 1N1TA 1LEDA 1V00A 2A3XA 5F9TA 4SLIA 2CWMA 4Y24A 3V0BB 3RSJA 2R16A 4YGDA 1WCSA 4YW3A 2PHRA 1G9AA 1LOFC 2XB6C 2WKKA 1C57A 4Y26A 5EXOA 3V0AB 3ZXKA 5GZDA 4U2AA 2YY1A 4D69A 1CIWA 3ENRA 4Z8BA 1D0HA 1G9FA 1LOEA 1SBFA 2R49A 2YMZA 4NOTA 2EXJA 1H30A 2CNAA 2DVAA 2JE9A 4WZFA 4TZDA 3PVNA 1IS5A 2GNDA 1G7YA 2ZBJA 1LHVA 1UN1A 1IS4A 1HQWA 3ZSLA 2ZGQA 4XJAA 1V6LA 4YW2A 1MZ6A 3RQ0A 1I1EA 3VKFC 4UW4A 4YLZA 4AWDA 1HKDA 2JD4A 4AGVA 5JVVA 1FATA 2I2SA 1KDMA 5JOWA 5BYNA 1W0OA 1LHOA 4ISQA 2P3IA 4Y22B 4XJWA 1AX1A 2A5ZA 3SH4A 3MW4A 2P3JA 4R9CA 2ZMNA 4Y1ZA 1LOAA 2D6PA 1LHUA 1WBLA 2V5YA 1AJOA 1GNHA 2WT1A 3ZXFA
chains in the Genus database with same CATH superfamily
4Q4Y3 4I01A 3WF2A 1UZVA 4QPIA 1PO22 1MQTA 1EAH3 1WMEA 2B42B 3AYDA 1W8ZA 1HQLA 1OBNA 4IV3B 1CAVB 3T2QA 4FOVA 2ZABA 3M8LA 1FOD2 3AMPA 4NIHA 4GJYA 3AVRA 4YPJA 1JYTA 5IT6A 3GDBA 2E32A 5FPUA 5FXWA 2A70A 4PCRA 4PT6A 4BDVB 1ZA7A 5C4WA 4YZ4A 4XBNA 2IFWA 3MI8A 4ASMB 5JCTA 1SFYA 4QX3A 4IEZA 4E8DA 4WVVA 2ARAA 4RR3C 2B7YA 1DZQA 1QJFA 1O3QA 1J1TA 1D4VB 2XOMA 3S0MA 5DQ0A 1UY2A 3HVDA 3NAPB 3P3NA 4CCJA 3V64A 2WUHA 1IGOA 1VRH1 3KWVA 3LEGA 4UBHA 5I0UA 2RMU2 1K5JA 4O9GA 1GZTA 5F5AA 4KNCA 1SLCA 3H7YA 5A33A 1RUJ1 1TNRA 4K8RB 3VBRA 3I2DA 5FIXA 4AVTA 3CKHA 2ZA9A 4BHPA 1UZYA 3NO8A 5BNOC 3ELNA 4RN5A 5F39A 1NT0A 3BTYA 4LO4B 4UFLA 3APBA 4UBGA 5DZFA 3WDTA 3TEYA 2DDUA 2LUWA 2PLV1 2AUYA 3CJIB 3PLQA 4M0HA 4Q26A 1D2QA 4E2GA 2BW8A 1YI9A 3EJKA 5GJ6A 2YZ4A 2GALA 1AUYA 1W6NA 3BTZA 1O7FA 3NNFA 3GF6A 2VULA 3LOIA 1ZRRA 4N43B 2V4VA 1ZBA1 4KI5M 4IV3C 1JU3A 3ZXGA 4CRQA 2VU9A 5F6KA 1MS5A 3L2HA 3LA3A 3TYJA 2I74A 4A7YA 4XETA 3UV9A 1ENSA 4EN7B 3RZHA 4GB33 3VD9A 2WLQA 4I02A 4X6QB 5F2SA 5T5PA 2XJQA 4EV0A 3BIWE 4YW4A 4BLIA 1ZVFA 2GU9A 2VZPA 3AXDA 4YM1A 4CDWB 4GZ9A 4UT5A 2EIDA 2FCTA 2NQYA 4HSLA 1HV1A 5HI0A 3WUDA 4V2WA 4C1WA 3ZXAC 1XB9A 4BQ1A 3WP6A 2HWC1 4QPIB 1MQTB 3NAPC 1LU1A 4QMAA 1FYUA 2XBO2 5FZHA 5GALA 5JI9A 2VAUA 4QB2A 5G04L 3WF3A 3R4DB 1QDCA 4AI0A 4K21A 2NN8A 2DCTA 2YHJA 3T0BA 4GH4C 2WA3A 2CHHA 2UY8A 1IZ3A 2W92A 1G6NA 2R6QA 5FPLA 3THPA 2W87A 4UI9L 4LPLA 4W50A 3NWKA 5GZFA 3FHQA 4IEYA 2GMMA 3WHTA 5FQ0A 3BVCA 4DUWA 2A3YA 1H9PA 3QOPA 3JUUA 3W5NA 3BALA 3ZM8A 1QGLA 2VZOA 3LEIA 2BPA2 4QXCA 1JYVA 1L7LA 2HWB3 4M01A 1RUOA 1E57A 2DBIA 4B4RA 2VNRA 1Q8VA 4P14A 2ZAAA 4QQ2A 2A6XA 3S5QA 5A33B 4UWDA 5A7NA 2DFBA 1QH6A 1ZA4A 1RUE2 1X82A 4PIYA 4FAHA 1OURA 1YFUA 2ILMA 1JN2P 1QDOA 1W06A 1RUI2 2Z42A 4AZZA 2FZ1A 4C8DA 1OF3A 5JMCA 2JE7A 5T5OA 2W1QA 4CXXA 1SBEA 3WQ7A 1RXFA 4H3WA 2XVLA 1NCRA 1S0FA 2D3SA 2W1UA 4XFHA 4EN6B 2D5HA 2HWE1 1FMD3 1JHNA 4CDWC 4ARYA 2F4PA 1D2SA 1W6NB 3CZUA 1X9TA 3GJBA 4J1WA 4BQ3A 4OI4A 4DXZA 1PNGA 1GICA 4QPIC 4Z2AA 1MQTC 2XLFA 2VZ3A 2C9KA 5CEHA 4GIQA 5GLTA 4BH9A 3U07A 5IVEA 1W9WA 1O91A 1UMIA 2D6OX 4NPRA 1GV9A 1Q8OA 1ZZCA 3LZZA 3ZVXA 1LODA 4FTEA 3JD72 4AI2A 5E6HA 5C4WC 2FBEA 3SQOA 2MEV3 3HWJA 1ZRDA 2Y34A 2AENA 1QMJA 4AK3A 2G19A 1W6OA 3ACIA 3IMMA 1F5FA 2YC2A 1YUDA 5DZEA 2EICA 3I2OA 4JAAA 4PLMA 1O3RA 4KQ7A 1W2AX 1YQ8A 1PX4A 1PIV3 3AMQA 1CJDA 4S2FA 5H9PA 3K4AA 4CP2A 4RQPA 1AYM3 1C8M2 2ET7A 5ACA2 4XILA 2CU5A 4FQ4A 3DECA 2OIIA 4Y1YA 1RGSA 2E26A 1CPMA 3FUOA 2ZX2A 2VPVA 3GGLA 2AACA 2D93A 3K4ZA 1W2OA 3MIDA 5TSWA 1VBC3 2QZ2A 3VBRC 4R9BA 4QGMA 4O61A 4LHNA 2O0OA 3KT7A 1RUC2 3JB4C 4LOTA 1DGLA 2BDRA 1NLQA 2WFF3 3LEKA 4QXBA 5FQ0B 2WDBA 3AZXA 3SCHA 4YVWA 2HEVF 2B8MA 4Q0PA 3RS6A 2JKXA 2WYSA 3SC7X 5JOXA 3DGTA 3N35A 4NR1A 4YG6A 4YGBA 5L9BA 5IK5A 1REEA 1RMU2 1RUH3 2VMEA 3ZYPA 2KR2A 4Y3OA 2VOVA 3JXSA 2D6KA 3DYOA 4FPKA 1A3KA 4CPBA 1LAJA 3OGJA 2ZGOA 4R8HA 3WNPA 1L7RA 3GZEA 4CVUA 3WCSA 1OD5A 3AMNA 1H1AA 4ARXA 4RL7A 3O1OA 2CGNA 1EV13 4QQOA 1WZXA 2Q1FA 4TLGA 4XIKA 4NWVA 1K5MA 2RS52 1YQ2A 4Q4Y1 1KFXL 1V6MA 1FOD3 2W39A 3C7FA 2QQMA 1EAH1 2XDVA 1NCRB 4A2UA 3KD4A 2Q1ZB 3AC0A 5K7PA 1CWPA 2DWRA 5KXEA 4LK6A 3LQCA 4OZXA 2B39A 5A6QA 1LTEA 3DL3A 1UX6A 1OA3A 4OMCA 4H7LA 5FY0A 4A7KA 1K42A 4NHYA 3RJRA 3FHAA 3VLBB 5A6XA 5CZKA 4GMP0 4OHVA 3P6BA 2ZHLA 5C9AB 4YFWA 1XNBA 2WSUA 2Y8KA 1ENQA 4KWLA 1LULA 3B00A 4AHXA 4DO0A 2DTYA 2MNGA 3ZYJB 1XU1A 3WNMA 1IPSA 3T2TA 1XQNA 2P4EA 3H3LA 4DPNA 5EWSA 1GFF2 5AFEA 4R9AA 4CXYA 1FPN2 2EXHA 5CKMA 5FOJB 4NIDA 2ZGLA 1Z78A 3VZMA 1W6OB 3OSDA 4FPYA 2KD7A 4UFMA 4AVBA 4LMFA 1U5IA 1WD4A 3W59A 5L19A 1WMDA 3MDPA 3PVEA 3ITQA 2QZ3A 1F35A 3DF0A 3ZSMA 2VMDA 4L9BA 3ST7A 5A6ZA 2LM3A 5C70A 3LDKA 3FBYA 2H6BA 2BVBA 3VKOA 3WG4A 3ZN6A 1OOPA 5DG2A 1NZIA 2P37A 1JYXA 5GLUA 5IVCA 5E89A 5D21A 4Q4X3 1V6JA 4EZHA 3WX5A 1U0AA 4I30A 4ZXKA 5E16A 3DV8A 4YNIA 1AL0G 5BUVA 4E2SA 4YVWB 4CCLA 1DGWX 2WWSA 2C0ZA 5C8CA 2H0BA 4QQLA 1GZWA 3WOGA 3HT1A 1NCRC 2WN3A 1CX1A 2AEYA 3ZYIB 2OYZA 1QU0A 1SLTA 4OQ9A 1S2KA 3AKPA 4GB31 4NPMA 3PJYA 1W8OA 1YO8A 4BZ4A 4KU7A 3RZZA 5C5TA 1QJU2 5K9YA 1URXA 2WO1A 3GCXA 3J7MA 2DVGA 2JEMA 2Z2SB 3OBAA 4C0HA 5KWRA 4QU2A 1J1LA 1OFSA 3FWEA 1K5MB 4LUMA 5GLVA 2WQZC 1GQGA 2WABA 1TE1B 4BB3A 1JBCA 3VBOA 4A41A 4G4FA 1IKQA 2VZRA 2X53S 3IAQA 1CQ9A 5J09A 2O1QA 1H6YA 3VBSC 2GH2A 5F32A 2WZPP 1AXYA 1CGPA 3S7IA 3BB6A 3LDBA 3IZOA 3ETQA 3M3QA 3ZMOA 3OEAA 5FPXA 2K9ZA 5A80A 2VQUA 1AR82 4G9SB 3AYCA 1Y3TA 1XXNA 2AZ5A 3MIFA 4QHOA 5FLHA 1RB8G 1JS9A 4RQPC 3H8RA 1JYCA 1PGL1 4CCMA 3UESA 3I49A 2GMPA 4OI2A 4Z92B 5FO9B 5JWPA 3PTYA 1N1VA 2WRAA 3CL1A 3FLRA 3M3IA 5DDJ2 1ZBE2 5CAZA 2WT0A 2RG4A 3NNGA 5FZ0A 2HWB1 5C8WA 1HB2A 5DG1A 1NQDA 3GXUA 3V0BA 4YVWC 4RGAA 4BK4A 2XLGA 3ILNA 1CZVA 1W8WA 2Q8OA 4ES8A 2RJ2A 1CONA 4LKEA 2W46A 1O6UA 3HNBM 1GSLA 3CZJA 1DZTA 1KJLA 5F8PA 3T3YA 3ZN6B 1OOPB 4AQ6A 1S2EA 4NPLA 3VBFC 3W20A 3SMHA 4Z07A 5BV6A 2RJLA 4A4AA 1EYBA 2NMOA 1ZZ6A 2AEZA 3CO2A 4G3YC 4LE3A 4BWOA 4IE0A 5SV5A 2YROA 4FPJA 4MLOA 2DVDA 5DUVA 1FMD1 4B8EA 2ARCA 2OXBA 2VOXA 1UW8A 3DN7A 2Y6GA 4B29A 5A70A 4LIVA 2PA7A 1LECA 3I59A 1H0BA 3H42B 2C24A 3GHMA 4B4QA 1UYPA 4BMEA 5C8CB 1GZWB 1H8TA 1SLIA 1XPWA 1R083 1NX9A 3GALA 4HKLA 1E5SA 1I3HA 3JD73 4IE5A 1IKPA 1ULDA 2AC1A 5GZCA 5FYSA 3IIIA 3SKJE 2XVKA 5KHIA 4LTAA 3ZYHA 1OH4A 4CYDA 3VZLA 4D7TA 4K40A 2MEV1 1ODNA 3WDWA 1HRV3 1QXPA 2WO7A 3ES4A 3GBFA 3PUAA 2QQNA 3T2PA 1TVGA 1FNYA 2O8OA 2Y6FA 5CG8A 3POEA 4XJ9A 3THCA 4AFMA 2ZGTA 3J9SA 5EFUA 1C8M3 4B3NA 3VBOB 5ACA3 4XQDA 2EA7A 1DF0A 3H3UA 1PIV1 1POV3 1O4TA 2PHXA 4TSVA 1AYM1 4QGLA 1O4YA 2D3PA 4XYXA 4E4HA 1RUC3 4KG8A 1IPJA 1DP0A 4NJ4A 1VBC1 2UWBA 4Q4Y2 4UOJA 3VGIA 1ULOA 2IXHA 4MH0E 4I3GA 2OZJA 4Y33A 5CYYA 5FYBA 2WFF1 1OOPC 3K46A 1GWLA 1QHDA 4DIQA 3BKZA 3WF0A 1YLLA 1PZ9A 2RJKA 4K6BA 1RMU3 1SDWA 4AVSA 4TWTA 5CG9A 5T5JA 3VHOA 3FBMA 4CDXC 1LGNA 2GNBA 5T52A 2XKOA 1V00A 1RUH1 4ORFA 1YHFA 4CEYA 4C90A 3V0BB 2F6BA 1XC6A 3RSJA 1U12A 1BBT3 2XWBB 3MIHA 2EAAA 1G9AA 5C8CC 2PHDA 2XB6C 4IEQA 5J1XA 2VMGA 3JZVA 4Y26A 4QB6A 2J1UA 3LEMA 2RS53 4BA6A 1NAEA 1CAWA 2JX9A 1EV11 2W94A 3MF9A 4NE9A 4QKNA 4XAAA 1HX6A 4U2AA 2YY1A 3OB8A 4AI9A 4JKMA 4XF4A 5FPZA 4URAA 1CIWA 4AHZA 4BU2A 1FOD1 1G9FA 1DYOA 4B1LA 1LOEA 1W39A 4IGQA 2ATFA 1NE4A 2R49A 1ND2A 3IBMA 1H30A 4OI0A 3WW1A 5C71A 2GZWA 4BISA 1G7YA 1GQHA 3KT4A 2ZBJA 3TBDA 5BNNA 3I59B 3NMBA 1HQWA 1X9PA 2GP3A 2ZGQA 1V6LA 4FCAA 1H8TB 1I1EA 3VBOC 5A32A 4AWDA 4AVAA 2YGMA 3WNOA 4SBVA 2PYTA 1FPN3 4EN8B 4XJWA 3LA2A 5FYVA 4KGGA 5A7WA 3FJSA 4JX0A 5FBJA 1ULPA 1M06G 4R9CA 1YJKA 2RMU1 4QQHA 3IDAA 4MXVA 3OTFA 5H9SA 2JE8A 1GNHA 4KBBA 3HJRA 4HLTA 5LY1A 1H2LA 2ES3A 4Q0QA 2EVXA 1MS1A 2BERA 1UD1A 2YBKA 4JKKA 1OA4A 5LK5A 3FC0A 1V70A 2D43A 4EWAA 1SCSA 3NNJA 3MV11 5CISA 2QCSB 4QD2A 4AHYA 4RD7A 1FNZA 2PAKA 4XDOA 4XDQA 3RMXA 5FR3A 3LSEA 4Q8KA 5FP9A 3B94A 3W9AA 2D3RA 4Q4X1 1UPSA 1MS3A 5FPAA 3MLJA 4DRRA 2WWUA 1VBA3 3J26N 1HRI3 4ZU4A 4AFDA 4AVCA 4UFIA 3NKTA 1MS9A 5J37A 2ZGNA 4Y4RA 4FOWA 2R1BA 3NL1A 1G9BA 4MGKE 5FZIA 3HQXA 2VZVA 5FY7A 4WM7B 4LBNA 3SISA 2HEWF 4CDUA 3CEWA 2X5IA 5FP8A 3VUOA 1YCIA 1KRIA 3RDIA 2QKDA 4D8MA 3DCQA 1S55A 2J22A 4CEYB 1QJU3 2E7QA 2BZDA 3U4XA 1NYWA 3OJBA 3N9QA 3WVJA 3SH5A 2JDMA 2ORXA 2Z4FA 4PIXA 4UF0A 1VP6A 1YYNA 3OUJA 1H8TC 1GOFA 3BI3A 5I8TA 3JCIA 3MBWA 5CVRA 1CAWB 2VW2A 4FOQA 2UYBA 3H1WA 2HWB2 1IS3A 2DF7A 3KCYA 3I2JA 4MGSA 5FYZA 5HCAA 1EUTA 1LENA 4QKBA 3OD4A 3NJZA 1ND2B 3BOPA 4NUBA 4XZUG 1J3QA 2W0XA 2D6NA 2YPJA 4IGOA 4XFBA 3QH6A 1AR83 1RUF3 5BNNB 1XBFA 4AFBA 3ZO0B 2BWAA 3DYPA 4XBLA 4FBFA 5F37A 3TEWA 1VR3A 5EJ3A 5CIRA 4CUBA 4QDQA 4COWA 5A32B 1H2MA 3WQ0A 5A7QA 2ZEXA 1ULCA 3CLPA 4HT1T 3U10A 1HLCA 2JECA 3RZLA 5IUQA 2VZUA 3OG2A 1JTZX 1JH5A 4HVQA 1NZCA 5DDJ3 1ZBE3 4OUSA 4N9HA 4YW5A 1RHI2 3A0KA 5FK7A 5A7WB 3Q8CA 1ZREA 3AMMA 3TOJA 3D6EA 2BNNA 5T5LA 3T2OA 5FDBA 4OFGA 4B1MA 1LCLA 3WSOA 2I07B 4NAOA 4WVMA 5FRAA 2G4IA 5FZBA 1W04A 1YQ6A 2QE3A 4HKWA 5FLJA 1JYNA 2AH2A 1YFWA 3WY6A 3KGLA 2DTWA 2PFWA 1RUI1 3MIBA 4OZOA 5F5CA 2A6WA 3UKVA 2YV8A 4XMAA 3N9OA 4JGYA 4PHZA 5KXBA 2MEV2 5FMOS 2ID4A 2OS2A 3WNKA 4CEYC 2FD8A 4HKOA 4MYEA 2IXCA 1RUD2 4WZCA 5A1FA 3AZYA 1ZRFA 5FTTC 2VO5A 3RI8A 3CU7A 4DEQA 2EALA 2DCJA 1VMJA 3MO4A 2J1TA 5KHGA 4ITCA 1TG7A 3USSA 3QBQA 4W65A 5CKNA 2Z69A 2ZX1A 2OQ6A 2RS12 1F4HA 2E33A 2RVAA 3IDBB 3JB8A 4AGGA 1VBB2 1ND2C 1R081 2X5IB 4GD4A 4AG4A 4LBQA 2WWJA 2VZSA 4NAMA 4QB1A 3WNXA 3SNMA 4BE3A 4LO7A 2NYYA 2GN3A 3ABZA 3JD71 5FK8A 4XAEA 5B4XA 1U5ZA 4FVVA 3UGHA 4L0PA 2WFF2 1F9KA 3WG3A 5BNNC 3VDAA 3ZFGA 1ST8A 3NVCA 3EQEA 4UF0B 2NMNA 4WBBA 2VCBA 2ZGKA 4XF3A 2GSYA 3AMHA 1G9CA 3B9IA 1HRV1 4PIZA 3FUQA 1HV0A 3H1MA 3N7MA 4IXLA 4H7MA 2JWPA 3TB0A 2WN2A 1HB3A 5IVVA 3EO6A 3QCWA 1DGRN 2WNOA 1C8M1 5ACA1 5C5UA 1POV1 4AR2A 5FZ6A 5FCCA 3INAA 5FMOL 1AYN3 3ZLIA 1EV12 2YC4A 1LHWA 5KHHA 3LA7A 3KVBA 1RUC1 1DZRA 4P08A 4YZ5A 1B35B 1YWKA 1UF2C 2A1XA 2OA2A 3IPVA 3ZFFA 5JOZA 3IT8A 1UWWA 5FP4A 3FE5A 2BBVA 2UWCA 1HN1A 1ODMA 4ISRA 3AYAA 3WZ1A 1NQJA 1K45A 2K46A 1A8MA 4E2QA 3M3EA 1S0JA 1OC1A 2HKXA 4LK7A 4QX0A 2ZEYA 3I8TA 5IWFA 1RMU1 5B2GB 2I45A 4A3ZA 3ORJA 2YDEA 4XJUA 2Q8DA 3ZOIA 1UU6A 3M7AA 3WXPA 1PVXA 4QX8A 4WVMB 2UURA 1H1IA 2ADEA 3W21A 3KHBA 1BBT1 1BEV2 3PTRB 4A3XA 1RINA 2JXAA 4MO3M 4OVEA 5A1LA 3E6BA 3AFKA 1OQDA 2RS51 3GZAA 2X5IC 2XHNA 4CDUC 1DQ4A 4BQ5A 4JGYB 4QDSA 5F3CA 4RA0A 3RJ2X 2BOIA 3OUHA 5FZ8A 2JICA 2C5DA 1ZNPA 3G6JB 1PZ8A 4URTA 1BK0A 3JQWA 3I4IA 2ZZJA 3EB7A 4RS5B 5FYTA 1Q8PA 1IQDC 5FWJA 3NV3A 4WVWA 4Q1RA 1OH3A 4W6WA 1O8PA 5JOYA 2Y6HA 3LD8A 4FPHA 5SV8A 3AP5A 2QQOA 3QD6A 1Q56A 4Q4X2 1V6OA 2AR6A 4LBQB 3ETPA 3ZSKA 2UU8A 1GNZA 5HXVA 1V6NA 1FT9A 2CGOA 1YIFA 1XYPA 2QJVA 4P9GA 3SHRA 4ES9A 2HLEA 4EYUA 1RUNA 1FPN1 3ZFGB 2PHTA 1JOJA 2R0HA 1R092 1JI6A 2AREA 4P9LA 4XFGA 2R042 3Q8AA 4YRDA 3RNSA 4AOCA 1RIRA 2FDKA 1SCRA 4Q2FA 2JIJA 5FMCA 2E53A 3WW3A 3ALQA 1PMIA 3AZWA 1T6GC 3WNLA 3PL0A 4XJZA 2GC2A 2JDNA 2SLIA 3AYEA 5JXGA 3GJAA 5C33A 3VBHA 3T1MA 1UPIA 2RM22 1DBNA 2WAAA 5IVFA 3GHNA 3SCGA 4F7ZA 3GM8A 2WS93 3IWZA 2DUQA 1HB4A 1F31A 3NSTA 4DS0A 4Y1UA 5IHRA 3M70A 1BQPA 5HCBA 1BZWA 2QQVA 2VMFA 3WD5A 4KWJA 4IEUA 1AJKA 5LBBA 5FZDA 4QM9A 3KQ4B 1POV0 3H8OA 2Q4SA 3IPVB 5GKAC 5F2WA 3ZFFB 3OPZA 4COZA 1VBA1 1SFNA 1HRI1 3FN9A 1Z0HA 1Q8SA 4YM3A 4JGYC 5H9RA 1R64A 3USUA 5B4NA 5D8AB 1I6XA 1CX4A 3I3DA 4HL0A 2OX0A 2PQQA 1UOGA 3WDUA 3E6CC 1GP6A 3R0RA 4GAZA 5JLVA 4Q4V2 1OVSA 4L97A 4A6SA 4ZS3A 1HW5A 1FAYA 1UKGA 2PAEA 1QJU1 3KMHA 3FFZA 3KQRA 3LAGA 4JTNA 4XE9A 3CJIC 3ZN5A 4AEDB 4CDUB 5AVPA 3ZYRA 3ZMNA 3WCRA 1WCQA 2JDAA 3KCCA 2ZHKA 4I3PA 3LKJA 1REDA 3IB3A 3MF6A 1QJZA 2E63A 4XIOA 4CCCA 4N43C 3ZFGC 1QOOA 2V4AA 3IMNA 5FY4A 3VDDA 2IXJA 4MOAA 2P5BA 3JU9A 4QKDA 3T4VA 1DYPA 3QLQA 4MVTA 4HN1A 4ZKTB 3GZTB 1GANA 1LOFA 1W6MA 1AR81 1RUF1 4NIGA 2D7FA 4ZXEA 2D6MA 5F6LB 3AP6A 2NM1A 1UXXX 4LLFA 1XOYA 2XL7A 2PHWA 1UQXA 4HONA 1DCSA 1DG6A 4N9IA 3VD4A 1RHI3 4JQRA 1BYHA 1NCQA 3IDCB 3L2YA 1W28A 2QQIA 1IPKA 3C7GA 1ZBE1 5DDJ1 4BJ0A 4F8AA 3NQHA 1UMHA 2BNOA 3PUHA 5DPNA 5C9AA 3ZFFC 2VMCA 2Y6LA 3GCWA 4CEWA 1PZ7A 1R082 5CFDA 2FDHA 3FHIB 2CAVA 5I93A 3H9AA 3VBHB 2ZHNA 5FYCA 1HN0A 4D7SA 1XNKA 2FCVA 3K3OA 4LO8A 2FMYA 4PBOA 5F1RA 3ME2A 4OHYA 4FFIA 1RUD3 1HRV2 5FY8A 1QNYA 2WQ8A 4MZUA 3ZR6A 4OYUA 2P34A 3H0OA 3ZPOA 1REFA 1BKZA 1T6BX 1OT5A 4RGKA 5JIUA 3USUB 1WCDJ 2RS13 5AC92 5IVBA 1VBB3 4FSJA 1WGPA 1UO9A 2VW1A 5FZ1A 1XYOA 3K77A 1H8VA 1FV3A 4LO5B 3MZHA 3RRDA 4FP2A 5FKBA 1C28A 1UX7A 2RDSA 2JG8A 1F15A 3ACGA 3O0WA 3MPBA 4LULA 3GBGA 4NHLA 1NLRA 4CCKA 3FFQA 3P3PA 3VKLA 3BU0A 4YSFA 4R52A 1SPPA 1WLCA 2Q0AA 3IKWA 1W0NA 5LB6A 5L9RA 4ZONA 1WLTA 4PDWA 1GWKA 2JDUA 1W2UA 4AGRA 5JMOA 5A7PA 2AYHA 1VB4A 1JXNA 4LBMA 2XONA 3DYMA 2RR12 3VDDB 1BBT2 2CY6A 2ZACA 3UL2A 1QJX2 3WV6A 3Q8BA 4META 4FAGA 1MVEA 1IG3A 5DAWA 2FMDA 3HR9A 3NJXA 5CU1A 1W6MB 4UW3A 1AYN1 1XRUA 2YXSA 1X7NA 3POYA 4AVVA 3GNEA 4EWEA 2V72A 3VD3A 3VBHC 4DEVA 4XW3A 2Y26A 2A6ZA 4JDNA 1ALYA 1WW6A 2DUPA 2RDNA 4Y22A 1YXWA 3Q8FA 1IOAA 1LOCA 2RDQA 4QXHA 3SXWA 1NCQB 5FV3A 4BM8A 5FZ9A 2XJPA 3I3BA 2EAKA 1LKNA 1O5LA 2WJSA 3VZNA 4EQVA 5CADA 3HQUA 3NW4A 3QACA 4Q0SA 1BEV3 4CEWB 2IFRA 2PQSA 2EXKA 3I7DA 2CDPA 5CFDB 3H8UA 4QX1A 4E4ZA 5L9VA 4XTPA 2VW0A 4XXAA 3ZYBA 2D97A 1UYXA 1D4M2 1EPWA 1VBD3 1H9WA 2XGXA 3L9JT 2J1EA 3N7KA 2ETEA 2IC1A 1QOTA 4QGNA 2ENRA 4COUA 5DN2A 4P9YA 3VHRA 4O7XA 3A4UA 3UKNA 1T2XA 3T09A 1QKQA 2W9XA 5J98B 2DUOA 2XQRA 4NRMA 3OCPA 1UU4A 4Z2WA 2XJSA 1KJRA 1G8WA 2E7TA 4GALA 4LBQD 4C91A 1Z7S2 4LBOA 3VDDC 1N1TA 2A3XA 1JODA 5FZOA 4SLIA 4AXOA 1PMHX 1VBA2 1R093 1HRI2 2IUWA 2JG8B 2N7GA 1LOFC 2PHRA 2R043 5EP9A 1WA6X 4A6OA 4FTBA 1C57A 1ND3A 3BPSA 1XJAA 4COYA 1SPPB 5GZDA 1HXS2 5J36A 4KG0A 3ZYFA 5HV4A 4R4ZA 4D69A 3ENRA 4CE8A 1LRHA 5FMDA 5KHJA 3ES1A 4PDWB 4XC9A 2RM23 1NCQC 1OLMA 4TN7A 1YQCA 5C3OA 2JE9A 4BLJA 5DMYA 3PUQA 1TZOA 3RYPA 4MXWA 2WS91 5C9AC 1ASJ3 1IS4A 3A23A 4CEWC 4XJAA 1GWMA 5CFDC 1W9FA 4I09A 4IEPA 2OKXA 1VPHA 3DKQA 4D6RA 5JSOA 1HKDA 2JD4A 2WZR2 5JVVA 5IVYA 4BIFA 2FDGA 1FATA 2X10A 2I2SA 4GQ7A 3U0ZA 1W0OA 4S2GA 1ZZ8A 4XDPA 4Y22B 3BUCA 4F3JA 4N53A 2A5ZA 1YIPA 4OCTA 3MW4A 4Q4V3 2ZMNA 3WF4A 1RUF2 1BMV2 2HWF2 1JOPA 1WBLA 2HEYF 4QX7A 4MGYE 4UXAA 4XEZA 3OGRA 4E9KA 4ZZ8A 2VUJA 2W47A 2P6HA 5D1IA 3CF6E 2XLAA 3V65A 5C3SA 2CGPA 1KDKA 3ZPYA 2B46X 4K1ZA 5J96B 3O1UA 3RMYA 3W58A 3N9PA 2WYFA 3AKRA 2LROA 4BQ2A 1PNFA 2BTVC 2MPFA 3S57A 3AKSA 1JZ7A 2ARXA 1JHJA 1U5YA 3HBZA 2R7EB 4XXPA 4XTMA 4DUXA 3POSA 1Q8QA 1CESA 2VZTA 4FXKB 4GWMA 4LHKA 2KM2A 5IW0A 3ZIXA 3T0DA 5J7MA 1AXKA 1NY72 1IQAA 1OMIA 2PHUA 4EWDA 1A8DA 3VHPA 2X8KA 2SBAA 2VTFA 3ECQA 1AL22 1PMJX 3WP5A 2TEPA 4QDRA 1GOGA 1W9SA 3HAGA 4PDWC 5FLIA 5LBEA 1AX0A 4FTSA 1QQP3 3R05A 2ZKLA 5FZOB 1TMF2 1UKRA 1CVNA 3BYWA 3RZMA 3EYPA 4LR4A 2R1DA 4WM8A 3VDCA 4BQYA 1RHI1 1K5MC 1PGSA 3AKQA 2J1RA 4M3CA 1DDLA 2D6LX 3VHNA 2Q5TA 1VJ2A 1ND3B 2WNUA 4N7UA 4IESA 2WT2A 3I2GA 2DCZA 3D4KA 3KV5A 4LLOA 2CTVA 2CYFA 3POGA 3PIJA 5HCHA 1N1YA 2JJ6A 2A3WA 4NHKA 4UAPA 2R30A 4LHLA 4RFT0 4A44A 3H7JA 2G9GA 2P3YA 3KSCA 1US3A 4IE4A 4OI1A 2J42A 5FOBB 3FLTA 4LBKA 3SLIA 3ACHA 4IL7A 4MXWB 3ZXDA 1RUD1 4D3WA 2XKPA 1H1MA 4LQRA 4R9DA 3BPZA 2ZAHA 3OYWA 4XUQA 1W8FA 3POBA 4MX3A 4AYUA 3A0NA 2O14A 3AJZA 3KV6A 3N7JA 4JTOA 5AC93 4QU1A 3KVAA 4DMIA 3VZJA 3VL8A 4IE6A 1MPXA 1OLME 4JRLA 4N53B 2Y33A 5A7OA 2RS11 4DFSA 4AEKA 1VBB1 1DGRA 1AYN2 1CZSA 1PM7A 3O0XA 1HDKA 2GH8A 2OPWA 5FXVA 1OPOA 5FZFA 1ZYBA 1E5RA 2YC0A 4NO4A 1J59A 1LJ7A 1QY4A 5GLWA 3M1HA 4FQZA 3D82A 5EQUA 1UOBA 4DQAA 1LNSA 3RWKX 4EN0A 4CA9A 5J3UA 1AF9A 3RG0A 2VBBA 4TXWA 2VZQA 3ZDSA 2BWCA 4WVZA 4IGPA 1Y9QA 4WM7A 1CN1A 1OKOA 2EF6A 1O3TA 1SZBA 2EIGA 3D5OA 1ZX5A 3UKTA 3VKNA 1GLHA 4W8JA 4CU7A 5KR7A 1YQ5A 3J4UH 5IATA 2RR13 4LIUA 2RHPA 5HBAA 1QJX3 3CMGA 3LPGA 4AFAA 4NHMA 5BNQA 2P6CA 1ND3C 5KC5A 4PF5A 2JKBA 3WDVA 2F4LA 4BQXA 5D2AA 4UFKA 1WMXA 4YM0A 5L7OA 4X6RB 4EE2A 2MHFA 5FY1A 1OQEA 4AEMA 5LA0A 2PELA 2BNMA 2BV4A 3RPQA 3MUY1 2JDZA 3MYXA 4GWIA 5FREA 1J58A 2HYXA 1G9DA 1C5IA 1JOBA 4WM8B 4Y4YA 3LPFA 3EMRA 4M3CB 2DFCA 5LBCA 1BJQA 3BODA 4LEJA 4BPZA 1I5PA 1NOVA 1U5XA 1S0BA 2VL4A 2WC2A 2BYVE 2WNUB 4ONUA 4ZPIA 3SEEA 5IFPA 4ZHNA 4OUEA 2DYCA 2RS32 3A22A 1BEV1 1ZM1A 2VNVA 3I2FA 3T0AA 1D4M3 2ZGMA 4QPWA 4N53C 5GLZA 3MHZA 3ZSJA 2VD7A 3MFCA 4M3CF 1HIXA 1VLNA 3H8XA 3WW4A 4BK5A 1AX2A 1OA2A 1UOJA 2VG9A 3R4UA 1VBD1 5FAXA 5LEKA 3D3AA 2X09A 1MS8A 4LA2A 4RYDA 5CB7A 4FFGA 1ZRCA 4MG2A 1XNTA 4M3CE 5ERLA 5APAA 4DXRA 2WLPA 2Z79A 4CUCA 1WLWA 3OYWB 3MPPG 5LASA 1VB2A 2YU2A 5LEJA 3WP4A 3MUZ1 5HXMA 2B45X 3U75A 1FXZA 1UZZA 3ZXLA 1UY1A 3I3QA 2WS92 1C1LA 1Z7S3 3AVSA 2Y60A 5FZ4A 2CWSA 2C9AA 5LA9A 4CDQA 1W6PA 3I2HA 3BCWA 3RFRA 2ZX4A 5FZEA 5IAVA 2Y38A 1KXGA 5C3PA 1DIWA 4DUVA 3AZZA 4CU8A 1R091 4KH9A 2R041 1R1A2 1A78A 3S30A 1HXS3 2YFZA 3ZFEA 1AR62 2VGDA 4DXTA 1TME2 3KM5A 1W3VA 2GNTA 2QFEA 3ACLA 3KS7A 1VE0A 3QH7A 2X05A 2C4XA 3CIHA 4CPBD 5A3TA 4MGTA 4WM8C 2W1WA 4M00A 5IK8A 4GULA 2RM21 3ACFA 4I0BA 4P5HA 4JVAA 5KXCA 3BOWA 1QEXA 2WNUC 5CNAA 5DAXA 2VXRA 4FO9A 4KMQA 2YPDA 1LEMA 5IJRA 5BXXA 4BXFA 1UIJA 2GC0A 3FZ3A 5LY2A 4CCEA 3J7NA 5L7OB 5IFTA 1ASJ1 4V2VA 3LOBA 2HBTA 3AP7A 2WZR3 3K3NA 3N4MA 3PMEA 2QNKA 2VUDA 2Q8CA 5C3QA 1ULFA 2XH6A 5DUXA 1XNDA 2E6VA 2TNFA 2VJXA 1NE6A 4HFSA 1AZDA 1K3IA 4KWKA 5ANNA 2WINB 1JW6A 1TNFA 1W8HA 4N90A 4LNVA 1LR5A 1YI7A 2HWF3 4FFHA 1JU4A 4MHUA 4FOYA 5FZCA 1UU5A 2LTNA 5LBFA 4Q4V1 1XYNA 2PAMA 1B35A 1VAVA 2XJRA 2VECA 2VVDA 4DY5A 3UJQA 5I0RA 3O1SA 2RE9A 3SITA 1L7QA 2IVJA 2GC1A 1XE8A 1CAXA 3LCPA 5I91A 4IE7A 4QQPA 1HJFA 2GDFA 4HOOA 3O1TA 4INDA 1SLAA 5F3GA 4L11A 3MV01 2YYOA 3PJQA 2ZJCA 4E4DX 4CCDA 4NMIA 1ULGA 2ZGSA 4LA3A 1YEWA 2XJUA 4R4XA 3WDYA 4JRAA 4B4PA 2W3JA 4Y1XA 4WM7C 2W08A 1AL23 2CDOA 4GMP3 1DQ6A 1N3PA 2QDNA 2VNGA 4IEWA 1UY3A 1PK6A 4XUTA 1TMF3 3HOBA 3PU3A 4CDQB 1W6PB 1QQP1 1OPMA 3HBKA 4RS5A 3IIAA 2D40A 1TEIA 5FZAA 2VBPA 1O59A 2ADDA 3KZ4C 3K75B 3NV2A 4DZGA 1HQNA 3B93A 4FPEA 4MGIE 2LS6A 4N8MA 3JBG2 3ZFEB 3U37A 4ATEA 4NRPA 4L99A 1W6QA 2VXJA 2C1FA 4AQTA 4LO6B 4NRQA 3WF1A 4BYYA 4CSWA 2WFPA 2J7MA 1X50A 3RYRA 4GH4A 1UOFA 3O14A 3C7HA 3TAYA 3RYKA 5C7GA 1AR72 1OD3A 3HN1A 2YB7A 3RZGA 1OUSA 3FLPA 5HV0A 1N47A 3B02A 4GKYA 1W2NA 1F5JA 1YNAA 2R062 3AM2A 2VH9A 4M0NA 5FZLA 4DRVA 4K7JA 2B9UA 3F95A 1F2NA 1KS5A 1EY2A 4N7IA 4YGCA 5EYXA 3PIGA 3WEZA 1C4RA 1FX5A 2ZKNA 4DY3A 2DU1A 3LWCA 4AAPA 2DU0A 3O1MA 3H50A 5HCFA 5AC91 5F5IA 4AW7A 3WT3A 4MV2A 2W2IA 2QQUA 3N9NA 4W6YA 1GBGA 1F4AA 4LOSA 4HXCA 5FY9A 2DVFA 4CP1A 4LT5A 1F8VA 2FQPA 1S2BA 1WLDA 2IZWA 1UZWA 3EHKA 4OQ8A 3D0JA 4IW3A 4OUMA 4XJ8A 2DV9A 1SFPA 1CAXB 5KHKA 2AGSA 2TUNA 5D8AA 4E27A 4A7ZA 3DPRA 1ZZ9A 2FHRA 4JZRA 5JI7A 1KQRA 3E6DA 1W8NA 4PJYA 1VMHA 3T1LA 3U1XA 2HJIA 1E5IA 1GKBA 3I2KA 2JENA 3MLLA 3OGVA 4XUNA 4Q5OA 4DNYA 1BLZA 3CNAA 4C1XA 2RR11 1PGW2 1RYYA 1W05A 2E7AA 2KXLA 5DABA 1QJY2 4AEDA 2BQPA 3AK0A 1QJX1 2XHKA 5JSRA 1EP0A 3ZFEC 5AFBA 3LFMA 3ZX7A 4D6SA 1SBDA 5FJHA 5KC6A 2GMEA 4PBPA 4GA9A 3KB5A 1VBD2 4GWNA 4MHRA 2VOWA 3B7MA 2Q1MA 1PVC2 1S0EA 3HN3A 1PK6B 3N3HA 3C8XA 3AL6A 1CD3G 4K1YA 2JB4A 4XFAA 4E4SA 2UYAA 1OSGA 2X29A 3T30A 2OPKA 4ZU5A 3KCXA 3DEMA 1S0IA 1UCXA 3OD0A 2Y6JA 3BTAA 5EV7A 1JZ8A 4UFHA 3V0AA 4O9EA 2EIEA 3VDBA 3IN9A 3WHUA 2RS33 4CZSA 3MEPA 1W90A 1VBE2 4OLLA 1W6QB 2ET1A 3B69A 2XR4A 2JB8A 1J3PA 1MS0A 1W2TA 2JDPA 1LOBA 2P17A 3OUIA 1FI2A 5L36A 4I2OA 1D4M1 4GH4B 3SEPA 2Q8EA 3WQ1A 4QPGA 4UW5A 4BXSV 2YUEA 1B35C 2CL2A 4QPYA 5KXDA 1WCKA 2QTWB 5GZGA 4FFFA 4KU8A 4HG6B 4I0WB 1O3SA 4FXGB 1LU2A 3O5SA 1XE7A 1S0GA 4Y5Z0 3NJYA 3PURA 1UXZA 1N3OA 3ILRA 1R1ZA 1IG0A 2GC3A 2ZCWA 3C3VA 4L2NA 3WG1A 4KL1A 4AQ2A 2GN7A 2VBDA 2BGOA 3M3OA 3VB9A 2A7AA 1ASJ2 1Z7S1 3DKWA 3HD8B 4GWJA 4PI0A 3WR0A 4PLNA 3NV1A 4P02B 3ATGA 2VMIA 4IERA 4YZ1A 5FO8B 4BMBA 5JPNB 1R1A3 1SACA 2VQTA 1RUG2 1UL9A 1YJLA 3PDQA 2G9ZA 1AR63 4NHXA 2H6CA 4RHV2 2VUCA 1GZ9A 2VMHA 1TME3 3DPRB 1S0CA 2OQ7A 1HXS1 1OI6A 1OUXA 1PK6C 2EXIA 4LUKA 5LCWL 1DQ5A 2HH9A 3O12A 1C1FA 2VOTA 4XUPA 5FZGA 5GZEA 4RS5C 2QBXA 3U11A 2J1AA 3OY8A 2FCUA 2BBAA 3LIHA 1DQ2A 3CQOA 4AI8A 5A3UA 4XURA 4NN0A 5CBLA 3T4HB 1WW4A 1A6CA 2ZHMA 1Y7BA 5HPOA 3OPTA 4BIOA 2WZR1 1OFNA 5AVAA 3J8F2 1OQ1A 5FP7A 1SDDB 4NIAA 1LEDA 4LKFA 3WUCA 4YVSA 2CWMA 4Y24A 4Y5SA 4YGDA 1OHFA 1WCSA 3V56A 4HK8A 3PHMA 1WWYA 2B9VA 3FMGA 3WW2A 2OZ6A 2R072 2WKKA 1BMV1 2HWF1 4EN9B 3LE0A 2Q30A 3DXUA 2PTMA 2ZOEB 3HEIA 4QX2A 1RJ8A 3UGGA 3ZXKA 4QHZA 3V0AB 5EJ1B 3UT0A 1KS4A 1JMUB 1GR3A 5F3IA 4Z1VA 1D0HA 5LA2A 4MADA 1SBFA 1QQP2 2YMZA 1RVF3 1RTVA 2V09A 2EXJA 2CNAA 4WZFA 3U4SA 4HPKA 4IETA 5K4LA 3VBRB 4TZDA 1NA1A 2BP6A 3PVNA 1IS5A 4QPGB 2BU9A 1LHVA 1UN1A 1VRBA 2GAUA 2FDIA 4DOUA 2B4KA 3MLKA 1MZ6A 1RL3A 1TQ5A 4XABA 3RQ0A 3VKFC 1NY71 4YLZA 4AGVA 5D8AC 3CJXA 3MIGA 1JYWA 2YBPA 3DPRC 5JXIA 2XXZA 1KDMA 4QX5A 5JOWA 5BYNA 4HN0A 1LHOA 1AL21 2P3IA 1AX1A 1NKGA 4GMP1 3I54A 2J1SA 1P8JA 3SH4A 3J7HA 4H14A 3TN92 1KGYA 2D6PA 2H0VA 2E31A 1PM4A 3KV9A 2WT1A 3ZXFA 4AEDC 1PO12 1J84A 1MVQA 1MS4A 4Y20A 3LFIA 3NNLA 4CCNA 4WV8A 1TMF1 3D8CA 2DBNA 1S1AA 2BVVA 3ON7A 3JBG3 2NPIA 2YU1A 1JZ4A 3THDA 2QDRA 1AVBA 1VALA 2PHLA 4FPOB 2E51A 1C8NA 5DZGA 3VBSA 4A42A 2UY9A 2WA4A 1IS6A 1MEC2 1AR73 4CU9A 1H2KA 3OY8B 1COV3 1OXCA 1QF3A 2W91A 2XWJB 5DXDA 2PMWB 2R063 1BHGA 2VVEA 2WZ8A 4Q4W2 3ZIWA 3MW2A 4HK9A 4XFIA 3ZYGA 4AE2A 1V9U2 4S2HA 1DU3D 1UNBA 3K2OA 4FT8A 5T54A 2RDRA 2XL9A 1AR93 3NRUA 4LITA 5A3OA 2XJTA 2CAUA 1UY4A 3PU8A 2V5DA 4P9XA 5DUWA 4D6QA 4QWNA 5FFOC 2HBUA 5JIAA 5JZGA 2L9LA 1UY0A 4YVSB 4QPGC 3WNNA 2WO2A 5A3NA 5KBFA 4LBLA 1ENRA 3MFAA 4YW1A 5T3NA 2ZEZA 4HZFA 2J1VA 1Y9GA 3HT2A 3WLUA 4I0AA 4ZY9A 3MIEA 3HNYM 4OHZA 1AXZA 1CZTA 2DURA 3P5BA 3VD7A 1KEXA 5EPAA 3O1RA 4MUVA 1UIKA 3BTXA 3VBFA 4DINB 1OF4A 5I8YA 1D7PM 1VAKA 2LRPA 1VMFA 1UYZA 2ZMKA 4HPKB 5CKQA 1NA1B 3CBNA 2NP0A 3URFA 2G9FA 4TTGA 2HWD3 4XZPA 1J3RA 5FJKA 1QJY3 2VM9A 5DAQA 1DYKA 1PO23 1VRH2 2ZS6B 3G7DA 4IEVA 3CDZB 2JG9A 3M3CA 2ZTNA 3TRSB 1ZZBA 2JD9A 3CHXA 3ZKYA 1PHMA 2XG3A 1RUJ2 2BFUS 3ASIA 1WA4A 1LHNA 2PXJA 4YW7A 5JAXA 3E5UA 3GZUC 1PVC3 3K48A 5FYUA 2IVIB 1DQ1A 1N3QA 1AHSA 1UYYA 4NROA 1HJGA 2Y0IA 4YM2A 2PLV2 4Y20B 5FKCA 1GP5A 4YYOA 5FYIA 4LXLA 4XBQA 4IEOA 2WAOA 1W8UA 3E5XA 3VZKA 2XMLA 1VBE3 3HQRA 4XHXA 3T08A 4LHSA 2RMU3 2KA3A 4YVSC 2RS31 4FPCA 3AJYA 1ZBA2 3VBSB 5JUVA 3THTA 4RSUA 4YZ3A 4BQ4A 4Q0UA 1JZ2A 4ASLA 2BGCA 2ZGPA 3TNPB 1BCXA 1WW7A 1D0GA 2W5FA 1Q5OA 4LBJA 1WD3A 2Y6KA 5JXHA 5A3WA 3UJOA 4EROA 5A3LA 1YC61 2CV6A 3OBRA 4RQPB 3MICA 4ZZ5A 1LGCA 1H4GA 5FPBA 5T55A 1SEFA 5JZGB 3NNMA 2WQ4A 3PNAA 5IK7A 1OLQA 1NA1C 2IXLA 2HWC2 1DLCA 3GYDA 1MZFA 4OHXA 4CDXA 4DB5A 1IHMA 2BFUL 1GYKA 4XMIA 5FYMA 4P00B 4XCAA 3R6SA 4CXWA 4LKSA 3BN6A 5A6YA 4FPFA 4XOGA 2BJSA 5I8SA 1RUG3 4H55A 3WINE 2QUOA 4O65A 4ASKA 4D94A 4CUAA 1NXMA 4XCBA 2WZEA 4RHV3 5K0UA 1R1A1 2OUJA 3OOXA 3VBFB 1XNAA 4XVHA 4OULA 4IV1A 1AR61 3DUIA 3M2MA 2ORZA 5IK4A 2VQ0A 4Z82A 2CSGA 2IXIA 2OW4A 1TME1 1V0AA 4UYBA 4ET7A 3DXTA 3H3ZA 2W95A 2FDJA 2YG0A 5A3PA 2DVBA 5FXXA 3AL5A 1E5HA 1GP4A 4JC1A 1KITA 3O7OA 3KLSA 3BGAA 4RFRB 5FY5A 3B9CA 2O8QA 1QH7A 2XBO3 1QIQA 2JG9B 2VZ1A 1DQ0A 1PX3A 4YZ2A 3VZOA 2A71A 4IQPA 3IAPA 3ZKUA 1GUIA 3B3QE 1O4ZA 1G86A 3EBRA 4LJHA 1O5UA 1WW5A 5IYYA 3J8F3 5I0SA 3LDRA 4XQWA 4YARA 2JG8C 5BY5A 3O1VA 4FPLA 4COVA 4IEXA 4AF9A 3E97A 3K51A 1BK1A 1S0DA 3ZR5A 2R073 5FBZA 3OF1A 2GNMA 5FWEA 1JUIA 1ULEA 2XQXA 2TBVA 4U36A 2HWE2 3A21A 3LF7A 2VNOA 3SCFA 4BOWA 4J1XA 4JKLA 2UWAA 3HNMA 4Y1VA 5JZGC 2VVFA 3KT1A 5LATA 3SH3A 1LOGA 4QHBA 3PVBB 3C7OA 5JPMB 5LZ6A 2ZGUA 4TYSA 5LA1A 4FI9A 2WO3A 4XPVA 3E1F1 1APNA 1B09A 1RVF1 5C6CA 1RUE3 2VQAA 5CA6A 1UMZA 3KHCA 1V6KA 1RUI3 4YG0A 4KGQA 1OLRA 5J48A 1YRZA 4NIIA 4XQ4A 2D5FA 4JHZA 1BXHA 4XFFA 5DAPA 5LRRA 2XPJA 5ABJA 4AFCA 4CTEA 1XU2A 5GM0A 2QQPA 1BVVA 3OBTA 4XFCA 4CDXB 3TN93 2XVGA 4C0BA 4QM8A 1O8SA 2VC9A 2WSVA 3TNQA 4Q27A 1H4HA 1PO13 1POQA 4JGZA 3VN4A 3AXEA 3BU7A 3MW3A 4JQTA 3WQBA 5LRSA 2JG9C 1BVP1 1X36A 1W03A 5G05L 3I2IA 3R4SA 4JHTA 3WG2A 5JXJA 4BQWA 5A1AA 3UK9A 2E9QA 5K0UB 3W5MA 2VE1A 3PUIA 2V73A 4FPGA 4EJRA 3S5AA 1CAUA 3JBG1 1QXRA 4IV1B 5JDBA 1X8EA 1MACA 3ZDVA 5BNPA 1SLBA 1XNCA 4LKDA 5FUPA 5CFCA 4Q1PA 3HPNA 1MEC3 3VKMA 1RC6A 4S2DA 5E8AA 3C2UA 4OHWA 1EPZA 3VBUA 2W52A 1UAIA 1YFYA 4Q4W3 5JSPA 1AR71 5FZ7A 1JYIA 2DCKA 1V9U3 1COV1 1US2A 3AKTA 2VR4A 5BPXA 2R061 5FO7B 4FP3A 5ANQA 2A75A 4YW6A 2ZMLA 4XF1A 3RGBA 4D7YA 1DHKB 4MGZE 4XF0A 2ERFA 4CUGA 3NV4A 3OBZA 3KF5A 3POWA 1AR91 5EIYB 4XUOA 4LE4A 4V1PA 5FPVA 2EIBA 2JDKA 2LW8A 3N7LA 3UETA 1W99A 1JZ5A 1QXJA 1JZ6A 1W9TA 5FZMA 2ZX0A 1EAH2 4HSJA 1WUVA 4X8NA 5LW9A 1ZRIA 4CCOA 4Q0VA 3F2ZA 5EZWA 3POFA 2ZEWA 1LB2A 2VOKA 1I5ZA 1SQ4A 3KV4A 2JIGA 3OEBA 3MGUA 2P3KA 1UZ0A 3KGZA 2QQKA 2A6VA 1OKQA 1S4CA 1H2NA 1GMMA 2OVUA 2WIIB 3B01A 5FMBA 4XACA 2W68A 4K3UA 4HANA 4YWAA 1W9YA 5T50A 1VRH3 4OMDA 2HWD1 1XSQA 1VAMA 1PGW1 2DCYA 2PHFA 4YGEA 3LIGA 5EHDA 1QJY1 5K0UC 1PO21 2PN5A 1GOHA 1MZEA 1RUJ3 4IV1C 2BEOA 3J7LA 5ABJB 5DUUA 5EYYA 4PI2A 5FZKA 2G1MA 5JR7B 4CP9A 2B5HA 4Q8LA 5K8SA 1X8MA 3B5LB 3I3EA 1GZCA 1PVC1 2PLV3 3OGSA 4H2AA 4JGZB 4P9WA 4Q29A 1CPNA 5LWBA 1FV2A 2XUEA 5L73A 3FL7A 2WNVA 3ZSEA 3RZKA 3N9LA 2VY0A 4YG3A 3VD5A 1ONAA 2ZZQA 4XF9A 3OPWA 1EUUA 2OT7A 4J6GA 4QT6A 2R0FA 2YBSA 3POIA 5E88A 1CAUB 1WBFA 3TEXA 3AP4A 2VCCA 2WBKA 1RJ7A 3LGRA 1DLLA 3PVOA 1VBE1 4IUGA 3UGFA 1XSRA 1ZBA3 2BOJA 5BNPB 5CFCB 1DFQA 1OVPA 1Y43B 2ZPXA 3AFGA 1WMFA 2Y0OA 2JDYA 1W0PA 4J25A 4JCKA 3ZN4A 1Q43A 4QAWA 5F5QA 3VBUB 1Q3EA 2QQJA 2F17A 4PF1A 4K9SA 4UFJA 3ROUA 1A34A 1ENXA 2JDHA 3AZVA 3O0VA 4P9JA 5FZ3A 4CP0A 4AI1A 4GB32 1RXGA 4L8QA 4AL9A 5FUIA 2XUMA 5C3RA 3LSDA 4K20A 5H9QA 1MZ5A 3E5QA 2ARBA 3PMSA 4UW6A 4KBZA 2HWC3 1CIYA 3IM0A 1CR7A 1GU3A 4RGGA 4GJZA 4TLFA 1NLSA 4F83A 3I3MA 4GKXA 5IVJA 4A45A 2A6YA 4PQ9A 4RR3A 1W3XA 1MR5A 2P1BA 5EJZB 4EZ4A 2OUHA 5FYHA 1VIWB 3UYJA 2XJVA 3P1IA 3ILFA 5ABJC 4XHBA 5JR2A 5E1RA 4AEJA 1RUG1 4JDOA 2K0GA 3RZJA 3TWIA 3VL9A 3WDXA 4NVPA 1SLLA 4RHV1 1WKYA 3Q9OA 4W4ZA 4JGZC 1NUKA 4M4PA 1PGL2 1ZZ7A 2IXKA 3ZXEA 5BNOA 1J83A 4GXLA 3AX4A 1C5HA 5DAVA 2GP5A 2YGLA 3IDEA 2R32A 2K2SA 2QQWA 2VUAA 4W6XA 3VV1A 5FYYA 3BIEA 1L3JA 1YFXA 4ZS2A 1X33A 2VCAA 2XBO1 3A7QA 5F7UA 1GNYA 3N9MA 5M0TA 2WR9A 5BNPC 4P9IA 1RVF2 2NZ9A 2FDFA 4D0QA 4PLOA 5CFCC 4CP9B 3SKVA 2WNEA 3S7EA 4E8CA 5F3EA 3AB0A 3VBUC 4X8PA 3J8F1 1H6XA 4QXKA 3U14A 3PUSA 2LALA 2BRTA 1RITA 3AP9A 3X29B 3UNPA 1JZ3A 2WNVB 2P2KA 4Y5TA 1W8TA 4IV3A 5FUNA 1CAVA 4YFZA 2C26A 2HWE3 1ACCA 1DGWA 2R071 5I0TA 1CJPA 1LGBA 1HB1A 2IWGB 2ZX3A 2C6SA 1JUHA 1V6IA 3GBWA 2WL1A 3ZXJA 1WCUA 1FMD2 2QVSB 4L92A 1LESA 1N1SA 1SMVA 1Y4WA 4JV4A 2VCMA 4NWWA 1NXD1 3K4DA 4HETA 4HMZA 1NG0A 5I0DA 3POJA 4AHWA 2VTXJ 1QOSA 4MSVA 4M4RA 4KWUA 4MGQA 3WP3A 3OGGA 3N36A 2Y64A 2W1SA 2ZGRA 5L7OC 3NAPA 4ATFA 2NLRA 2HYKA 1RUE1 2RV9A 3HMYA 3Q8EA 1QNWA 3C7EA 1SHWB 2D44A 5LK7B 3O1PA 1QWRA 5F9TA 2A73B 5FXZA 2R16A 3EXUA 4YW3A 1COV2 1XE0A 4RR3B 4HVOA 3TN91 4DXSA 3I97A 4LORA 2BGPA 1PIV2 1QJEA 5EXOA 4JDMA 1PO11 2VTXA 4ZU7A 5A3MA 2BUKA 2ZXQA 3CJIA 3KF3A 1AYM2 3D0SA 1AR92 4K8FA 4PQQA 4B7EA 5IAXA 5FP3A 4AQSA 2D98A 1KFUL 4Z8BA 3FX3A 4P5YA 3H1YA 1VBC2 4HBNA 5ISLA 1STMA 4CU6A 4NOTA 5A7SA 5C4WB 4BCUA 2DVAA 3JQXA 2FZ2A 1Y9MA 2GNDA 1KD7A 4N43A 3RVHA 2WNVC 1GQPA 4QKFA 2Z5WA 1M4WA 2QQLA 3HIFA 3NJVA 3ZSLA 5BNOB 4YW2A 3RWNA 1MEC1 4HVRA 3RI9A 4AAXA 1SG3A 4UW4A 2YFUA 1K12A 4Q4W1 4B7KA 4IDZA 3TEZA 1RUH2 1V9U1 3LB9A 4ISQA 1I9RA 3NKGA 3M4FA 4CDWA 3U78A 4CDQC 2P3JA 4AI3A 4Y1ZA 3S6PA 1LOAA 2V5YA 1LHUA 1C3HA 1AJOA 2HWD2
chains in the Genus database with same CATH topology
4Q4Y3 4I01A 4QPIA 1PO22 1MQTA 1EAH3 1WMEA 2B42B 3AYDA 1HQLA 4IV3B 1CAVB 4FOVA 2ZABA 3M8LA 1FOD2 3AMPA 5IT6A 2A70A 4PCRA 5C4WA 4YZ4A 4XBNA 2IFWA 3MI8A 4ASMB 5JCTA 1SFYA 4IEZA 4WVVA 4RR3C 2B7YA 1DZQA 1O3QA 1J1TA 1D4VB 3S0MA 3NAPB 3P3NA 3V64A 1IGOA 1VRH1 5I0UA 4UBHA 2RMU2 4O9GA 4KNCA 1SLCA 3H7YA 5A33A 1RUJ1 1TNRA 3VBRA 3I2DA 4AVTA 2ZA9A 4BHPA 1UZYA 3NO8A 5BNOC 3ELNA 4LO4B 3APBA 4UBGA 5DZFA 3WDTA 2LUWA 2PLV1 2AUYA 3CJIB 3PLQA 4M0HA 4Q26A 1D2QA 4E2GA 2BW8A 1YI9A 3EJKA 5GJ6A 2YZ4A 2GALA 1AUYA 1W6NA 1O7FA 3GF6A 2VULA 3LOIA 1ZRRA 4N43B 1ZBA1 4IV3C 3ZXGA 4CRQA 2VU9A 5F6KA 1MS5A 3L2HA 3LA3A 3TYJA 2I74A 4A7YA 4XETA 3UV9A 1ENSA 4EN7B 4GB33 2WLQA 4I02A 4X6QB 5T5PA 2XJQA 4EV0A 3BIWE 4YW4A 4BLIA 1ZVFA 2GU9A 3AXDA 4YM1A 4CDWB 2NQYA 4HSLA 1HV1A 5HI0A 3WUDA 4C1WA 3ZXAC 4BQ1A 3WP6A 2HWC1 4QPIB 1MQTB 3NAPC 1LU1A 4QMAA 1FYUA 2XBO2 5GALA 5JI9A 4AI0A 3R4DB 1QDCA 4K21A 2NN8A 2DCTA 2YHJA 4GH4C 2WA3A 2UY8A 5C4WB 1IZ3A 1G6NA 2R6QA 5GZFA 3NWKA 4IEYA 2GMMA 3WHTA 5FQ0A 2A3YA 1H9PA 3QOPA 3JUUA 3BALA 1QGLA 2BPA2 2HWB3 4M01A 1RUOA 1E57A 4B4RA 2VNRA 1Q8VA 4P14A 2ZAAA 4QQ2A 2A6XA 5A33B 2DFBA 1QH6A 1ZA4A 1RUE2 1X82A 4PIYA 4FAHA 1YFUA 2ILMA 1JN2P 1QDOA 2Z42A 1RUI2 2FZ1A 5JMCA 2JE7A 5T5OA 1SBEA 3WQ7A 4H3WA 2XVLA 1NCRA 1S0FA 2D3SA 4XFHA 4EN6B 2D5HA 2HWE1 1JHNA 1FMD3 4CDWC 2F4PA 1D2SA 1W6NB 4J1WA 4OI4A 4DXZA 1PNGA 1GICA 4QPIC 1MQTC 2XLFA 4GIQA 5GLTA 3U07A 1O91A 4NPRA 2D6OX 1GV9A 1Q8OA 1ZZCA 3LZZA 3ZVXA 1LODA 4FTEA 3JD72 4AI2A 5C4WC 2FBEA 2MEV3 3HWJA 1ZRDA 2AENA 1QMJA 4AK3A 1W6OA 1F5FA 1YUDA 5DZEA 4JAAA 4PLMA 1O3RA 4KQ7A 1PIV3 3AMQA 1CJDA 4S2FA 5H9PA 4CP2A 4RQPA 1AYM3 1C8M2 2ET7A 5ACA2 4XILA 4FQ4A 2OIIA 4Y1YA 1RGSA 1CPMA 3FUOA 2ZX2A 2VPVA 2D93A 3MIDA 5TSWA 1VBC3 2QZ2A 3VBRC 4R9BA 4QGMA 4LHNA 2O0OA 3KT7A 1RUC2 3JB4C 1DGLA 5FQ0B 3SCHA 2WFF3 3AZXA 4YVWA 2HEVF 2B8MA 4Q0PA 3RS6A 3DGTA 3N35A 4NR1A 4YG6A 4YGBA 5IK5A 1REEA 1RMU2 1RUH3 3ZYPA 2VOVA 2D6KA 4FPKA 1A3KA 3OGJA 2ZGOA 4R8HA 3WCSA 1OD5A 3AMNA 1H1AA 4RL7A 2CGNA 1EV13 4QQOA 4XIKA 4NWVA 1K5MA 2RS52 4Q4Y1 1KFXL 1V6MA 1FOD3 2W39A 1EAH1 1NCRB 4A2UA 3KD4A 2Q1ZB 5K7PA 2DWRA 5KXEA 4OZXA 2B39A 1LTEA 3DL3A 1UX6A 1OA3A 4H7LA 4A7KA 3RJRA 3VLBB 4GMP0 4OHVA 2ZHLA 5C9AB 4YFWA 1XNBA 2WSUA 4KWLA 1ENQA 1LULA 3B00A 4AHXA 2DTYA 2MNGA 3ZYJB 1XU1A 3T2TA 1XQNA 4DPNA 5AFEA 5EWSA 1GFF2 4R9AA 1FPN2 2EXHA 5FOJB 2ZGLA 1Z78A 3VZMA 1W6OB 4FPYA 4AVBA 1U5IA 1WD4A 3W59A 5L19A 1WMDA 3MDPA 3PVEA 2QZ3A 3DF0A 3ZSMA 4L9BA 3ST7A 2LM3A 3VKOA 3FBYA 2H6BA 2BVBA 3WG4A 3ZN6A 1OOPA 5DG2A 2P37A 5GLUA 5E89A 4Q4X3 1V6JA 3WX5A 1U0AA 4I30A 4ZXKA 5E16A 3DV8A 4YNIA 1AL0G 5BUVA 4E2SA 4YVWB 1DGWX 2WWSA 2C0ZA 5C8CA 2H0BA 4QQLA 1GZWA 3WOGA 3HT1A 1NCRC 3ZYIB 2OYZA 1QU0A 1SLTA 1S2KA 3AKPA 4GB31 4BZ4A 3PJYA 1YO8A 4KU7A 3RZZA 1QJU2 5K9YA 1URXA 4C0HA 2DVGA 2JEMA 2Z2SB 5KWRA 4QU2A 1J1LA 1OFSA 3FWEA 1K5MB 4LUMA 5GLVA 2WQZC 1GQGA 1TE1B 1JBCA 3VBOA 4G4FA 1IKQA 2X53S 1CQ9A 5J09A 2O1QA 3VBSC 2GH2A 2WZPP 1AXYA 1CGPA 3S7IA 3BB6A 3ETQA 3M3QA 3ZMOA 5FPXA 2K9ZA 1AR82 4G9SB 3AYCA 1Y3TA 1XXNA 2AZ5A 3MIFA 5FLHA 1RB8G 4RQPC 1JYCA 1PGL1 2GMPA 4OI2A 4Z92B 5FO9B 5JWPA 3PTYA 1N1VA 3CL1A 3FLRA 3M3IA 5DDJ2 1ZBE2 5CAZA 2WT0A 5C8WA 2HWB1 5DG1A 1NQDA 3V0BA 4YVWC 4RGAA 2XLGA 3ILNA 2Q8OA 4ES8A 1CONA 1GSLA 1DZTA 1KJLA 3ZN6B 1OOPB 4AQ6A 3VBFC 3SMHA 4Z07A 5BV6A 2RJLA 1EYBA 2NMOA 1ZZ6A 3CO2A 4G3YC 4LE3A 4BWOA 5SV5A 2YROA 4FPJA 4MLOA 2DVDA 5DUVA 1FMD1 4B8EA 2VOXA 1UW8A 3DN7A 4B29A 2PA7A 1LECA 3I59A 1H0BA 3GHMA 4B4QA 4BMEA 5C8CB 1GZWB 1H8TA 1SLIA 1R083 3GALA 4HKLA 1I3HA 3JD73 1IKPA 1ULDA 5GZCA 2XVKA 5KHIA 4LTAA 4CYDA 3VZLA 4D7TA 4K40A 2MEV1 3WDWA 1HRV3 1QXPA 3ES4A 3GBFA 1FNYA 2O8OA 5CG8A 4XJ9A 4AFMA 2ZGTA 3J9SA 5EFUA 1C8M3 4B3NA 3VBOB 5ACA3 4XQDA 2EA7A 1DF0A 3H3UA 1PIV1 1POV3 1O4TA 2PHXA 4TSVA 1AYM1 4QGLA 1O4YA 2D3PA 4XYXA 1RUC3 4KG8A 1IPJA 1VBC1 2UWBA 4Q4Y2 3VGIA 4MH0E 2IXHA 4I3GA 2OZJA 2WFF1 1OOPC 1QHDA 1YLLA 1PZ9A 2RJKA 4K6BA 1RMU3 1SDWA 4AVSA 4TWTA 5CG9A 5T5JA 3VHOA 3FBMA 4CDXC 1LGNA 2GNBA 5T52A 2XKOA 1V00A 1RUH1 4ORFA 1YHFA 4CEYA 4C90A 3V0BB 2F6BA 3RSJA 1U12A 1BBT3 2XWBB 3MIHA 2EAAA 1G9AA 5C8CC 2PHDA 2XB6C 4IEQA 2VMGA 3JZVA 4Y26A 2RS53 4BA6A 1CAWA 2JX9A 1EV11 3MF9A 1HX6A 4U2AA 2YY1A 4XF4A 5FPZA 1CIWA 4AHZA 1FOD1 1G9FA 1LOEA 1W39A 2ATFA 1NE4A 2R49A 1ND2A 3IBMA 1H30A 4OI0A 3WW1A 2GZWA 1G7YA 1GQHA 3KT4A 2ZBJA 3TBDA 5BNNA 3I59B 1HQWA 2ZGQA 1V6LA 4FCAA 1H8TB 1I1EA 3VBOC 5A32A 4AWDA 4AVAA 2YGMA 4SBVA 2PYTA 1FPN3 4EN8B 4XJWA 3LA2A 4KGGA 1M06G 3FJSA 4R9CA 1YJKA 2RMU1 4QQHA 4MXVA 3OTFA 5H9SA 1GNHA 4KBBA 4HLTA 1H2LA 2ES3A 4Q0QA 2EVXA 1MS1A 1UD1A 1OA4A 5LK5A 3FC0A 1V70A 2D43A 4EWAA 1SCSA 2QCSB 4QD2A 4AHYA 4RD7A 1FNZA 2PAKA 4XDQA 3RMXA 3LSEA 4Q8KA 3B94A 3W9AA 2D3RA 4Q4X1 1UPSA 1MS3A 3MLJA 4DRRA 3J26N 1VBA3 4ZU4A 1HRI3 4AFDA 4AVCA 2FZ2A 3NKTA 1MS9A 5J37A 2ZGNA 4FOWA 2R1BA 3NL1A 1G9BA 4MGKE 3HQXA 4WM7B 4LBNA 3SISA 2HEWF 4CDUA 3CEWA 2X5IA 1KRIA 3VUOA 1YCIA 3RDIA 2QKDA 1S55A 4CEYB 1QJU3 2E7QA 3U4XA 1NYWA 3OJBA 3WVJA 3SH5A 4PIXA 1VP6A 1YYNA 1H8TC 5I8TA 3JCIA 5CVRA 1CAWB 2VW2A 4FOQA 2UYBA 3H1WA 2HWB2 1IS3A 2DF7A 3KCYA 5HCAA 1LENA 3OD4A 3NJZA 1ND2B 3BOPA 1J3QA 2W0XA 2D6NA 2YPJA 4XFBA 3QH6A 1AR83 1RUF3 5BNNB 4AFBA 3ZO0B 2BWAA 4XBLA 4FBFA 1VR3A 5EJ3A 5CIRA 4COWA 5A32B 1H2MA 3WQ0A 1ULCA 3CLPA 4HT1T 3U10A 1HLCA 2JECA 5IUQA 1JTZX 1JH5A 4HVQA 1NZCA 5DDJ3 1ZBE3 4OUSA 4N9HA 4YW5A 1RHI2 3A0KA 1ZREA 3AMMA 3TOJA 3D6EA 2BNNA 5T5LA 5FDBA 4OFGA 1LCLA 2I07B 4WVMA 5FRAA 2G4IA 2QE3A 4HKWA 5FLJA 2AH2A 1YFWA 3WY6A 3KGLA 2DTWA 2PFWA 1RUI1 3MIBA 2A6WA 3UKVA 2YV8A 4XMAA 4JGYA 5KXBA 2MEV2 5FMOS 4CEYC 4HKOA 4MYEA 2IXCA 1RUD2 4WZCA 3AZYA 1ZRFA 5FTTC 3RI8A 3CU7A 2EALA 2DCJA 5KHGA 4ITCA 3USSA 3QBQA 4W65A 2Z69A 2ZX1A 3JB8A 2RS12 4AGGA 3IDBB 4CDUB 1VBB2 1ND2C 1R081 2X5IB 4AG4A 4LBQA 3WNXA 3SNMA 4BE3A 4LO7A 2NYYA 2GN3A 3JD71 3WG3A 1U5ZA 4FVVA 5BNNC 2WFF2 1F9KA 3ZFGA 3NVCA 3EQEA 2NMNA 4WBBA 4XF3A 2ZGKA 2GSYA 3AMHA 1G9CA 3B9IA 1HRV1 4PIZA 3FUQA 1HV0A 3H1MA 3N7MA 4IXLA 4H7MA 3TB0A 3EO6A 3QCWA 1DGRN 1C8M1 5ACA1 1POV1 5FCCA 3INAA 5FMOL 1AYN3 1EV12 1LHWA 5KHHA 3LA7A 1RUC1 1DZRA 4YZ5A 1B35B 1YWKA 1UF2C 2OA2A 3IPVA 3ZFFA 5JOZA 3IT8A 2BBVA 3FE5A 2UWCA 4ISRA 3AYAA 3WZ1A 1NQJA 1A8MA 4E2QA 3M3EA 1S0JA 2HKXA 3I8TA 1RMU1 5B2GB 2I45A 2YDEA 4XJUA 1UU6A 3M7AA 3WXPA 1PVXA 4WVMB 2UURA 1H1IA 4A3XA 1BBT1 1BEV2 1RINA 2JXAA 4OVEA 3E6BA 3AFKA 1OQDA 2RS51 3GZAA 2X5IC 4CDUC 1DQ4A 4JGYB 4RA0A 3RJ2X 2JICA 2C5DA 1ZNPA 3G6JB 1PZ8A 4URTA 3JQWA 3I4IA 2ZZJA 4RS5B 1Q8PA 3NV3A 4WVWA 4Q1RA 5JOYA 4W6WA 4FPHA 5SV8A 3AP5A 3QD6A 1Q56A 4Q4X2 1V6OA 2AR6A 4LBQB 3ZSKA 2UU8A 1GNZA 5HXVA 1V6NA 1FT9A 2CGOA 1YIFA 1XYPA 2QJVA 4P9GA 3SHRA 4ES9A 1RUNA 1FPN1 3ZFGB 2PHTA 2R0HA 1JOJA 1R092 2AREA 4P9LA 4XFGA 4YRDA 2R042 3RNSA 1RIRA 1SCRA 4Q2FA 2E53A 3WW3A 3ALQA 1PMIA 3AZWA 1T6GC 4XJZA 2GC2A 2SLIA 3AYEA 5C33A 3VBHA 3T1MA 1UPIA 2RM22 1DBNA 3GHNA 3SCGA 4F7ZA 2WS93 3IWZA 2DUQA 1F31A 3NSTA 4DS0A 4Y1UA 3M70A 1BQPA 5HCBA 1BZWA 3WD5A 4KWJA 4IEUA 1AJKA 4QM9A 1POV0 2Q4SA 3IPVB 5GKAC 3ZFFB 3OPZA 4COZA 1VBA1 1SFNA 1HRI1 1Z0HA 1Q8SA 4YM3A 4JGYC 5H9RA 3USUA 5D8AB 1I6XA 1CX4A 4HL0A 3WDUA 2PQQA 3E6CC 3R0RA 5JLVA 4Q4V2 4L97A 1HW5A 1FAYA 1UKGA 2PAEA 1QJU1 3KMHA 3FFZA 3KQRA 3LAGA 4JTNA 4XE9A 3CJIC 3ZN5A 4AEDB 5AVPA 3ZYRA 3ZMNA 3WCRA 3KCCA 2ZHKA 4I3PA 3LKJA 1REDA 3MF6A 1QJZA 2E63A 4XIOA 4N43C 3ZFGC 1QOOA 3IMNA 3VDDA 2IXJA 3JU9A 1DYPA 3QLQA 4MVTA 4HN1A 4ZKTB 3GZTB 1GANA 1LOFA 1W6MA 1AR81 1RUF1 2D7FA 2D6MA 5F6LB 3AP6A 2NM1A 4LLFA 2XL7A 2PHWA 4N9IA 1DG6A 1RHI3 4JQRA 1BYHA 1NCQA 3IDCB 3L2YA 1IPKA 5DDJ1 1ZBE1 4F8AA 2BNOA 5C9AA 3ZFFC 4CEWA 1PZ7A 1R082 5CFDA 3FHIB 2CAVA 5I93A 3H9AA 3VBHB 2ZHNA 4D7SA 1XNKA 4LO8A 2FMYA 4PBOA 5F1RA 3ME2A 4OHYA 1RUD3 1HRV2 1QNYA 4MZUA 2P34A 3H0OA 1REFA 1BKZA