3AQ4A

Molecular insights into plant cell proliferation disturbance by agrobacterium protein 6b
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
177
structure length
170
Chain Sequence
SFGKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIASK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular insights into plant cell proliferation disturbance by Agrobacterium protein 6b
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Toxin
molecule keywords ADP-ribosylation factor 1
total genus 57
structure length 170
sequence length 177
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3aq4A00
4LJ9A 3PUVA 1GL6A 3VKHA 2P5SA 4TMKA 2ZREA 2V6IA 4YMUA 1ESNA 2CDNA 1COWA 2ZRKA 4JYBA 2R9VA 3KQLA 1WE2A 1WF3A 4H1UA 4TLBA 1JEEA 1E2IA 3OIVA 4AKHA 1Q12A 5AUQA 4B73A 1OXSC 4JLBA 1E2KA 2C9YA 2BDTA 1RRPA 1RE0A 2GJ8A 3PIRA 1P9WA 2ZI5A 4KAXA 1VYVA 3RANA 2Q9AA 1XD2A 2DWQA 2OILA 1JAIA 4IVPA 3OF5A 2JLZA 1KNQA 4OQLA 3SHWA 2ZE7A 1A82A 2FGJA 2W0SA 4XSHA 1VIYA 4MITA 2D3WA 1TPZA 1BMFA 2QSYA 5AK0A 1QHNA 2A9KA 3ONWA 5DN6A 1KIMA 4C7OA 3KDSE 4LJ4A 3SC3A 3GLFA 1WMSA 3EASA 1XPRA 1MKYA 5FL3A 4M9XA 3LLUA 3GLGA 5BWMA 4RCYA 4ARZA 3THOA 1WBBA 1JJ7A 4URUR 1SKYB 1Q22A 1XCMA 3B9PA 5TV2A 5C4MA 1U0HC 3GJ6A 3PEWA 3ASYA 1KI3A 3DL0A 4BRWA 2B7CA 2P67A 5HPYB 1XFAA 2FJUA 2FX3A 1XB2A 2G77B 2W6JD 2GKSA 4DLTA 3CPEA 2YZ2A 3O8CA 3BORA 4E22A 3GEIA 4DLZA 3F5FA 2A5GA 4ARZB 1O87A 4Z8XA 4XJXA 4M9ZA 4EAQA 5CK4A 2D7DA 1IY1A 3CWZA 2GXSA 4EIWA 1P61B 2RKOA 3GLFB 4Q9HA 4C7OB 4NYJR 1YZUA 3ADKA 4UKDA 3CM0A 2ASEA 4PFSA 3KKQA 3OAAD 3QE0A 3FTQA 5GJWC 1YU9A 4XWKA 1G8FA 1FUUA 3SU8A 5FBVB 1FFHA 1E2JA 1UKYA 2W58A 4BEBA 1S3GA 2B6HA 4NKRA 3UK6A 5KTYA 3WBJA 3GCGA 3K70C 1NVVR 2CNWA 4URYR 2V7QD 1G7TA 1NLFA 2PEYA 3PV0A 1YE8A 3NH9A 1E2HA 5FOWA 4JSTA 4WOPA 4YXWD 2NO6A 4OBEA 2C5LA 1F48A 1IY0A 1GKIA 1W0JA 4Q01A 4S2EA 1ELOA 3ZVMA 2O8DB 2J7PD 2B21A 2GK6A 1OSNA 4OQFA 1D2NA 2XTZA 2ORVA 3I5XA 1N5IA 2QPAA 2VHCA 4LYFA 3W9YA 1ZIPA 4JLVA 3MMPA 1N2CE 2XTNA 4AK9A 4ERNA 1G3IA 2P0EA 2ODEA 4A6XA 3BE4A 1SVOA 1A4RA 1ZD9A 4ASUA 4ZKDA 5LD2C 4LDJA 4AWXA 3ZD6A 3QI2A 3D7MA 1JQJC 1SVMA 2OCPA 2ZI9A 1KK3A 3DM9B 5L8VA 2BVNA 4MDFA 1OHHD 2CLSA 2R62A 5JBQA 4CEJB 3SFVA 4JLMA 1P6XA 2CK3A 3A1TA 4MGYR 1KI6A 4A0RA 4ZI3A 1QVRA 4FMCB 4KLZA 4DSUA 1GTVA 3U5ZB 4QGAA 1CBUA 1R7RA 4QG7A 3RSLA 2AHOA 1EGAA 4FCVA 1CULC 1SKYE 1X86B 3CF2A 1KO1A 2J3EA 1DEKA 4B3GA 1JB1A 3U44B 2R6AA 4DIEA 5E95A 4MRPA 3W5JA 2XZLA 1ZM9A 4QBIA 5J40A 4EUNA 2FFHA 4I1UA 5G40A 5BYJA 3PUZA 1AQUA 3AKYA 3WMEA 3AVTA 5G53C 4KBGA 3K1JA 5CM8B 1AJEA 3TUJC 4CEHB 1FX0B 1ZU5A 1KY2A 3D6TB 1ONBA 2QNRA 2ZIAA 3LH5A 4QBGB 4G5QA 1T0HB 2OM2A 2WSSD 4NCIA 4W7SA 2ZS9A 1ZD1A 1W1WA 4QGGA 1XMSA 3C15C 2HJVA 4D4LA 3QXJA 2ZJ5A 2R6FA 3M1IA 2N1BA 2QE7D 1VCMA 4NP6A 1BH2A 4W5JA 2VHTA 5HCNA 1AIPA 2MMGA 4JVLA 4PHFA 2C77A 1TADA 1PUJA 1FMLA 4JT4A 3B78A 5F2EA 1O3YA 3MGCA 5FI0B 1HTWA 4XOIA 2X8AA 1U81A 2OEPA 5FBWB 2GAOA 1T3LA 2WM9B 3PFIA 1Z0FA 4F91B 1PJRA 4G1UC 1FNMA 1GUAA 4ILEA 4LZZA 2UKDA 4XD7D 2WV9A 1EXMA 3QKRA 4IHQA 4OHXA 5KOYA 1D9XA 3MWJA 1UPTA 3R7WB 2Q3FA 3SFZA 4L5BA 1DOAA 2ZRHA 3LXXA 4KU4A 5CJ2A 4LK2A 2VEDA 4YMWA 2O5VA 1P60A 2R6CA 2FV8A 2C2HA 5FPKA 1TQ6A 2XZPA 1E79D 4TMVA 4MYTA 5BXQC 4IDQA 5TMPA 3U7EB 2IS2A 4RFSA 2AR7A 3E5HA 5AJXA 3VHXA 4C0BA 1I4TD 5J4KA 3P32A 2CE7A 1XEWX 3TAUA 4L9WA 2ZSFA 4Q1CA 4HB0A 4DWJA 3PJRA 1U98A 4GOJA 2A2ZA 2IW3A 4TSFA 1U90A 4G5RA 4BECA 4AURA 5EQTA 1D8TA 4GMXA 3OE7D 1WRBA 3T1OA 4E07A 1FX0A 2ZTSA 2FE4A 2ZE6A 4JS0A 3FHTA 1KZ7B 4MRRA 2F6RA 4Q9IA 3C7KA 4PZYA 4QJ4A 2PJRA 4EPRA 4KBFA 4D26A 3Q8XB 4V0KA 1Z22A 2VL7A 4HUQA 4P32A 1TUEA 1Z28A 1S1MA 4Q1EA 3OFNA 4UXHA 4Q9KA 3U44A 2GDJA 4TLAA 3MCAA 5C1BA 4QJ3A 3IEVA 5EUMA 1IN8A 1NJFA 1N0UA 1CR0A 1P9NA 4PO1A 1E9CA 2KB0A 1OKKA 3U60B 4US1R 1XXHA 1QHHA 2BMFA 2F1HA 2MSCB 2FMXA 1KI6B 2W0MA 2YOFA 4M1WA 2EFEB 1E1RD 1KJYA 3KKMA 3MD0A 4W5WA 5AJYA 3BJIC 3WXMA 2G1JA 4CEJA 2QENA 3U3KA 4FMDF 2PT7A 2ZYWX 1W0KD 1M34E 1TNDA 4DLRA 3ZVRA 1AN0A 2GVZC 2BEKA 3KJEA 5JJKA 3A37A 2BWJA 1S1CA 4JLKA 4HUTA 4NONA 1W47A 3L0SA 3HDTA 2QAGA 3EX7C 4DZZA 3H86A 2P65A 1NG1A 4WZ6A 1QHXA 3B1VA 3NXSA 4N0EA 1AZSC 4Q7JB 4HSEA 4FWIB 1Z06A 2ZYTX 1TQDA 1E3MA 5K8UA 3VR4A 4BFTA 2O52A 2AD5A 2FSHA 5JS7A 3LBIA 2W83A 3QPUA 4LI0A 5L3SA 1YR8A 3P4XA 1SXJD 5EP1A 4PR0A 4QOSA 1EFRD 3HPQA 1VYUA 3LY5A 3FYHA 4HDCA 1HUQA 3IGFA 1VIAA 4IXMA 3AVWA 2RHDA 2HT6A 5FTMA 3K09A 4DCVA 4EDHA 2YC2C 1TF5A 1U0LA 1W4RA 1OKKD 3BERA 2XOKA 5DNYB 1RFLA 2W2XA 2IT1A 1J70A 5IT5A 3ZQ6A 5JFGA 3CF0A 2BM0A 1P5ZB 3BIFA 3PITA 3K0CA 4Y0AA 3LW8A 2PCJA 2VSOA 2UVQA 3OFND 1W44A 2D2FA 4IDNA 4P31A 5KSZA 3FKQA 1D5CA 3KQUA 2ODWA 2ZJAA 5KDDA 4JVSB 3RYTC 3FFBA 2OZEA 1NIPA 1E2LA 2IXEA 2ZJZA 5J4LA 2GZDA 4B35A 1FTNA 3N5CA 1R5BA 3KQHA 3THXB 2ZITA 4OJQA 2O0HA 1SHZA 3JVVA 2AWNA 3ZQJA 3SJCA 3EZ7A 1CKEA 2GCOB 4Z1MA 1Q1BA 4D0LB 3TJZA 4HLDA 4QNMA 4PTLA 2F9MA 1YZGA 5KPJA 3ICEA 1YKSA 1Z0DA 3D8BA 2IYRA 2W00A 1E94E 2NOAA 3GLHB 4CZ2A 5TARA 1A7JA 1ZNWA 2H16A 3SNHA 3W90A 1H8ED 2BBOA 4I99A 2A78A 4GFDA 3TLXA 4G01B 1IM2A 1E98A 2G3YA 3CB4A 5BW8A 5K8IA 2FNAA 3KUDA 3R9WA 4QM7A 1NY6A 4C2TA 4C0SA 4CEHA 1N6KA 3BBPA 3SJZA 2OCYC 2D74A 4TYNA 1MOZA 3OEEA 4MRVA 2JLQA 3IO3A 4RFVA 1EWQA 3ZDQA 3V9PA 4X8OA 1GSIA 3TRFA 5KSYA 2JLSA 4PO8A 3HJNA 4YQFA 2GXAA 4QKQA 2ZRJA 1NVXQ 1A2KC 2A7QA 3CX7A 3UANA 2JATA 3CNOA 2IL1A 2BHRA 2QE7A 4KV9A 1DARA 4DDVA 1N6IA 1ETUA 3IPYA 5JHHB 1NG9A 5EUQB 2GWHA 2QP4A 221PA 4F93B 4JIMA 2QM7A 1XX6A 5JI3E 1E2DA 1JBKA 1L2TA 1GZSA 4B3FX 3R8CA 3M6AA 4BFZA 2QBYA 4NTZA 3VNVA 3F0TA 4TN1A 2IS1A 1CXZA 1FL9A 1ZUHA 1Q1ZA 4DXAA 1CRPA 2J7KA 2P6RA 1P2SA 3LAWA 3UMRA 2IA5A 3B7GA 3GLGB 3RS7A 3W34A 121PA 5FBRB 1KSGA 3THWA 2O8EA 4DJTA 3L0PA 4RCZA 4DLWA 2R2AA 4O3MA 1NVWQ 4A6PA 3PEVA 2PCLA 1LS6A 4LHXA 4GRAA 2ZUBA 1IN6A 3BB1A 3DOFA 3QG1A 3TVDA 3CO5A 2CJWA 2GBLC 2UZIR 4PXAA 1PVOA 3KKPA 3OIUA 5B64A 4EJSA 1YZKA 4G5GA 2PLRA 4AI6A 4TLEA 3CX6A 1AKYA 1G3QA 4DLUA 1DAFA 2WIAA 4LPSA 4WVFA 2F9LA 2CCKA 3ZH9B 1AQYA 4RD6A 3E70C 4Q5IA 1XD2B 4WA7A 3SJBA 4B6EA 3T61A 2JASA 4EPTA 3KXLA 1JR3D 4RD0A 3RRYA 4BQSA 3ZLJA 3CWQA 2FOLA 5EXXA 3BC1A 2JJ8A 1MT0A 2BCJQ 3JZAA 3L8YA 3C8UA 4QM6A 1OFIA 2ZJ8A 1WP9A 4D81A 1ZVQA 4H9GA 5KPDA 5FUXA 3LX8A 5CM9C 5C4GB 3RS4A 4ZDJA 4B3XA 1FOEB 4CGZA 1HV8A 1GILA 1JPJA 3C5CA 1VCOA 2IYYA 4G5OA 4NL4H 5EXTA 1DG3A 3PQCA 3THXA 4MYHA 2DFKB 2IYUA 2LKDA 4PHHA 5DISB 1XEWY 5CB8A 2H57A 5H68A 2V7QA 4PO9A 3TW4A 1QHSA 4CEIA 3FMOB 3ZGXA 1DAMA 5TXGA 1FP6A 1E79A 3UG7A 4BLTA 4GZMA 4KFRA 4YMTA 2V55B 3AF3A 1G8PA 2ZRIA 3ZVLA 1LF5A 3HR7A 1LTQA 5CIWA 4FCTA 1R6BX 4WZAE 2VHJA 3NDBB 4CT5A 1GAJA 1G18A 1CJUC 1XEFA 5JZVA 2GEDA 1FQKA 4PQFA 4OI0A 1J8MF 3I61A 1NJGA 3B5JA 4BFSA 1LB1B 4WZBE 1JAHA 3FE2A 2GRJA 2Q6TA 5DO9A 2CCJA 2BBSA 2L0XA 2OCBA 1YR9A 2V54A 4A2PA 4A0FA 1LS1A 3Q5DA 1G17A 2VQSA 5CB6A 4BASA 3IIJA 1IXZA 5L3SB 3AH8A 1QVAA 3SBEA 4PZZA 4XH9B 1Z6YA 1KO5A 2O0JA 3NBFA 3SYKA 1DAKA 1HQCA 2GNOA 2OFXA 3P26A 5FOVA 3ZS8A 1M2OB 3AKCA 3U4QA 3MJRA 2Z4SA 1R0YA 2DR3A 4M21A 5IDVA 3AF2A 1DS6A 3C41J 4KVAA 5KUTA 4YDHB 2AX4A 2REOA 1F6BA 2BMJA 4HLUA 4UJ3A 3DKVA 4L16A 1E9EA 2EU8A 4NPHA 1TEVA 621PA 5L3QB 2C9OA 1R8QA 1XXHE 3QBVA 1FUKA 5CLQA 4GZLA 5JSZB 1NN5A 3MWKA 1GG2A 3T5GA 5JCPA 4TT3D 1NMXA 4GMDA 5D3MA 4JL6A 4KVGA 2N42A 2G0NA 3OESA 2QN6A 1G16A 4DRZA 1RVDA 3CIOA 2R44A 2Q3HA 2NO9A 1SVSA 3ADBA 3E1SA 2ZPTX 4HZUA 1MABA 1GWNA 3ETLA 1JPNA 4HAXA 1W36C 4BFVA 1TL7C 1UEIA 1P62B 4PHGA 3AV0B 3BFVA 3HYTA 2D7CA 4NCNA 4HB3A 3WBKA 1W46A 4DBLC 1QBKC 2J46A 1UEJA 3AP1A 2B8TA 2IYVA 4NMMA 1Z6GA 2ZEJA 4GNKA 1Z07A 3QBTA 3KX2A 1OFHA 4JT2A 5JECA 4PAOA 4ZV4A 1Y63A 3FMPB 2Z0MA 4RJLA 1M7GA 1NP6A 1Q57A 4X8MA 5FOSA 5CDFA 4B2LA 4A36A 1KDTA 2Q9CA 2ANCA 3SE0A 3EC2A 3LRPA 1NRJB 3M4YA 3NEJA 1XEXB 2O8BB 5CITA 3EC1A 4C0AC 5DYIA 1IJEA 4LHWA 2WJJA 3TQFA 4DVGA 4B3BA 3CONA 4ZDIA 1YR7A 4E5UA 2ZRLA 2QTFA 3DO6A 3WP0A 5UKDA 1KI7A 1NN1A 3MAAC 1SXJB 2DFTA 3UPUA 2XSZA 1HYQA 1P7CA 1Z5ZA 3LBNA 1IQPA 2YWEA 5JEEA 4NCKA 2VF8A 3IHWA 4TZ0A 2PZFA 3ADCA 4NYIR 2H5EA 1XTJA 1HH4A 3DM5A 3FKSA 3SR0A 2W2VA 4KCGA 2O8FA 3QVVA 4QJ5A 1Q1QA 2WICA 1W0JD 3BFKA 4Q1DA 2QMOA 3VAAA 5FR1A 4YONB 4EFLA 1T5IA 2ZI4A 3RLFA 2BIFA 3SEAA 4Q21A 2GILA 4Q9LA 5FBLB 1T91A 1TU3A 2JLYA 1XNJA 3WRYC 1D2EA 3VKWA 1YRAA 2RGDA 1KMQA 4JJKA 4QGHA 3HR8A 2CL7X 4WXRA 4BLOA 1ZM3A 3L82B 2QP3A 1L8QA 3S1AB 2DFNA 3IBGA 4EPYA 1U0JA 2N46A 1R5NA 1G5TA 5FTKA 2RGNC 3OAAA 2C9CA 2HEIA 2NTYC 1QRAA 5DI9A 2IWRA 2ZSDA 2JJ2D 1VCIA 2FA9A 3OEED 2G0TA 2HCJB 1BYUA 4M1MA 1OIVA 2QGZA 5LBIA 4BZXA 3O8RA 1GFIA 1W2GA 3V00A 4QXAA 3THYB 1AGRA 4BGDA 2LKCA 3LDAA 4Q4HA 2D62A 4O2RA 1EFTA 1I4LD 2PLFA 4W5HA 4NE2A 2X2FA 4D2IA 2PMKA 2O0KA 1H8EA 1R2QA 2OBMA 1ZMXA 2P6UA 1Q3TA 2KE5A 3SI7A 3FHCB 5JEDA 1NNEA 4Q47A 2FSGA 2D06A 4OYHA 2CHQA 2HV8A 3AKEA 2DY1A 3L0OA 4R98A 4LC0A 2CBZA 2RAPA 1N3BA 3FWYA 2DB3A 1J8YF 2JEOA 3U6KA 2GCPA 2CLCX 2J5XA 2C96A 4LSGA 1JXOA 5FPSA 5FPTA 1YR6A 1P9RA 2J9RA 3QY0A 4GOXA 3I4LA 3MWLA 3CRVA 4JBXA 1Z8FA 3C14C 1S9HA 1BMFD 2RCNA 1L4UA 4M4SA 3LVRE 1S96A 1OFTA 1Z08A 4P33A 1KSHA 2ZRGA 1T8TA 1VG9B 4MUAA 1XMIA 4ZIRA 3KQKA 2X19A 1Z0AA 4UNRA 3TE6A 1SVKA 1A2BA 1GNPA 2C03A 2XX3A 3Q7PA 4PC6A 3SYNA 1OXUA 3WYAA 3R9XA 2FFAA 3AEZA 4P4SB 1IOZA 3VR1A 3H4MA 3DPUA 4DCSA 5LD2B 2LWIA 2NQ2C 2OBLA 3C5HA 4DUGA 4FINA 4TL7A 4TTPA 1JQLB 2QEQA 4DB4A 2BEJA 4NHOA 1KMHB 1OIWA 1GRQA 2RB4A 1T5LA 1XTKA 4IFBA 4Z54A 2ZM5A 4YDSA 4RZ3A 2GZHA 4ZO4A 4TWZA 1KO4A 1EWRA 2VHUA 2QZ4A 4BFWA 2WTUA 5KNBA 1E4YA 3GMTA 1G3UA 2QGNA 2WOJA 3UIEA 1CU1A 2CCGA 3B9QA 4HAUA 4F4IA 4C0KA 1UBCA 3GJ4A 3HU2A 1NSFA 3B60A 1IHUA 5E4FA 2JJ1A 4JBWA 2I4IA 4PQRA 3HP1A 2D4HA 4L9SA 1FNNA 3LQQA 4X8HA 2BKEA 2CL0X 3RC3A 4JKYA 1DO0A 1IN7A 1WDTA 4M9SA 3TK1A 3QKUA 3HU1A 2I3BA 4FWTA 1RRGA 5CYPA 4KI0A 2WSMA 4D25A 5K8LA 4IJMA 1VHTA 2O8CA 2OHFA 1X8LA 5AR1A 2Z43A 4P4UA 4ESHA 4D4JA 3D31A 3IIKA 1D9ZA 2A3RA 1E1QA 2ZI6A 5JJIA 4Q18A 3FDIA 3G5UA 4V03A 5DI3B 3A1UA 1GKYA 4LJYA 1U8ZA 3W6NA 4XVQA 3CH4B 4F7WA 1XTRA 3RS2A 4D0NA 3QKSA 4JLPA 4D80A 2W6IA 3A1WA 3KJGA 5E7JA 3PUYA 4OQMA 4RSGA 4MRSA 1MH1A 4RKFA 3BXZA 3Q9LA 2YWHA 4PC3A 1UJ2A 3HU3A 4RD1A 4BLPA 4FMBB 2IF0A 2KWIA 3KFVA 3OE7A 5EE9A 3L8ZA 4QGFA 3VU9A 3V4FA 1TF7A 2IUSA 1RYFA 3QNUA 3X1WA 2IEZA 2ORIA 3IQWA 1DPFA 4M1KA 3IHLA 4LYHA 4DLVA 1RKBA 2NO7A 1XCGB 4EQ6A 1G8YA 1BYIA 2ZRPA 2V9PA 1J7KA 1G8HA 3FMIA 5KSOA 5ANRB 4DIDA 2XNSA 4K81B 1T9HA 3QEJA 1VG0B 3NDPA 3W5IA 4IDOA 5HKKD 4I1SA 2XXAB 4AYWA 1KO7A 4EJSC 2ZETA 2XSZD 4NU0A 4IVRA 1IJFA 1HT2E 3EAQA 5J5CA 2RGBA 2QG6A 5BQ5A 3RSOA 1HEIA 2BBWA 2FSIA 3RRZA 3P27A 5J4YA 2NZJA 1KSJA 2XJ9A 4M1SA 1S9DA 2YJTD 3FFAA 4JJZA 2QMHA 2EWWA 4LCBA 4FD2A 4PSAA 4Q7KA 2ZVQX 1XD9A 5LB2A 3LLMA 4M1TA 4CVNA 1HURA 3CRMA 2DPXA 2QP9X 5IK2A 2WZQA 3ZIAD 1LVGA 4DT1B 2OG2A 2PJZA 1FPMA 5G3ZA 3TMKA 3WHKA 5JS8A 3PR1A 4LJ8A 4I81A 4V0MA 4MQBA 3MWYW 1G21E 1XTIA 3TAHA 1Z47A 2DYKA 1LY1A 3EZFA 5DLQC 4D4KA 1J2JA 4II7A 4M53A 2XITA 4IOLA 2JLWA 1SVIA 4NCJA 1M74A 3GFPA 3SJAA 1CR2A 2ZRNA 3Q5EA 3VHLB 1NVVQ 1RJ9A 2X2EA 4Q7MB 2JLUA 2F43A 2ZSEA 2ZAMA 2ZRAA 1NF3A 1VG8A 1KAGA 4FMCF 1CP2A 2ZUCA 4IFEA 4JLDA 4B76A 1K5DA 1MR3F 2H18A 4JLOA 4F4CA 3A6PC 3I73A 1PLJA 2HXSA 1NMYA 2QI9C 3X2SA 3PEYA 3DKPA 3PEUA 3WYGA 3PVSA 2DWOA 3IDQA 5HZHA 4G0NA 3BD9A 4ZKEA 1OXTA 1S0UA 2BJWA 5GVRA 4DSNA 1W2HA 3N2IA 2FSFA 3ND8A 4QL3A 5J4VA 4A2QA 2QAJA 3TSWA 5FR2A 1R8SA 5CYOA 2JDID 3K9HA 1WBDA 1VDZA 3P20A 4HI0E 3ECCA 2EQBA 2WBLC 3U3RA 4DCUA 3K09C 4A0HA 3TH5A 1KKMA 1KNXA 2QT1A 1G3RA 4B71A 3AUYA 4XTRA 4QHTA 2Z5FA 2F7SA 3UATA 1XRJA 3X1DA 3CNNA 1SHKA 821PA 5B2ZA 2VPPA 3AP2A 2XJ4A 3NIBA 2OBNA 1U94A 5TB5A 3DEFA 4BPBA 3ZIAA 4DHEA 4B32A 1C4OA 1UKZA 2VLIA 5FH9A 3SQXA 2J7PA 2VYFA 3R20A 3RWMB 2EYQA 1G4AE 1TU4A 3B1YA 1OT3A 2HLDD 1AS2A 1NY5A 4KYIB 5KDOA 3GJXC 4A0GA 1E96A 2CNWD 4QHSA 4XSGA 4DSTA 5AJWA 4A8JA 1II0A 4IEEA 2DBYA 1XPUA 1M1YE 3EW9A 1G5PA 2B92A 4UNNA 2GESA 1IN5A 4L4UA 1I4DD 2QSZA 4LBZA 5BN4A 4LBWA 2YOHA 4MGIR 1S2MA 2W6ID 1QG2A 4FN5A 3TGPA 1EFUA 3T06B 3MUFA 3TSOA 2HLDA 3U2QA 2GBLA 1UBGA 4ZDWA 2GJSA 3CRRA 4JBYA 3H2YA 3A4MA 1XD8A 4PAMA 1UBEA 5FOXA 2WJHA 3VR2A 3W8RA 2RGAA 2HF9A 1ZC4A 2FU5C 2FEMA 4H1VA 1U99A 3QXSA 2G9NA 4C0JA 2VP5A 4V0NA 3IEUA 3MLEA 4DLSA 3PXGA 1Q44A 3B1XA 2IHYA 2W6JA 1ZRHA 1KTVA 2A5DA 1RRCA 1ZCBA 3QF4A 4O0MA 2QMUA 1CF4A 2Z83A 1G7CA 4TTRA 5TDHA 1ZD8A 1E1QD 1XWIA 1GDDA 1N6LA 2MSEB 2JJ1D 2R8RA 4Q4AA 4PQYA 1G7SA 5EE0A 4GPTA 3O8DA 3KTAB 3LV8A 3TUZC 2I1QA 4A8JB 2DWPA 2IEYA 4BUJA 4E09A 1BKDR 1Q21A 4LJAA 4G5SA 1M8PA 3CF6R 3NWJA 3WYFA 2GK7A 5DIFA 1R10A 2J0UA 4HAVA 3U3JA 3EZ2A 4B44A 5BN3A 2QQ0A 4FW9A 2ZRMA 4ZPXA 2C8VA 2IYLD 2PL3A 5G3YA 3I72A 5EE1A 1AM4D 1GNQA 3KB2A 4NH0A 1TQ2A 4BLSA 5SZHB 1R0XA 1DELA 1N0VC 2GJKA 4Q00A 3QOFA 1IAQA 2P5TB 3GJ7A 3QF4B 3VFDA 4GP7A 2NMVA 2F1JA 5FTNA 4Q4JA 1DO2A 2J41A 4AG6A 1AZTA 1JALA 3PG5A 1KI4A 3ND9A 5JWRA 4AYTA 2B8WA 2FFBA 4OK3A 3JVUA 1NL3A 2PX3A 2IXGA 1TTTA 2ZR0A 1X3SA 4EPXA 1ZAKA 2HYIC 4AKGA 3SDZA 1N25A 2HJGA 4NYJQ 4Y0VA 5KSPA 4GL2A 1D6JA 1AKEA 1OYWA 1ZJ6A 1DAIA 2A5FA 2ZU0C 4POAA 4BE7B 2D2EA 2AK2A 3O47A 4DSOA 3QPWA 4PSVA 5HCIA 1OB5A 2WKQA 2AD1A 3W8NA 4R9UC 5HR5A 2FG5A 1MO6A 1LW7A 2WWXA 4IDPA 1Z63A 1G1MA 4MYCA 1P73A 4A92A 3NHBA 2EFDB 3REGA 1E9AA 1JXMA 5TY0A 1RPZA 3KQNA 4LRWA 5AUPB 2A30A 1D2MA 2H7VA 3GJ0A 4D6PA 5FL7D 5B57C 5BN5A 5CLLA 2GZAA 2FF7A 4LJ7A 3QUSA 2EW1A 2F43B 4RZUA 4DDUA 1ZUIA 1RJ9B 1E6CA 4P4TA 4B47A 3SS8A 1GRRA 1XP8A 3LFUA 2CLDX 2VO1A 1C1YA 2J0UB 2GAAA 4IOKA 3GJ8A 1S3SA 421PA 3BS4A 2CEAA 1Q0UA 3AM1A 3K70D 2AFIE 1F2TB 1MABB 4HZUB 1T3SA 2CHVA 3NTUA 2QPOA 3BWDD 4LHZA 4UXJA 3W3ZB 4ACBA 4URWR 4LYJA 4C9BA 1E0AA 4LHYA 4YLGA 5FFMA 4OK6A 3BAFA 3I92A 1BO6A 3B13B 2ERXA 5JMTA 5D3MB 4NDZA 2RMKA 1S4QA 1IXRC 4CYMA 4Q1FA 2Q0HA 1MRNA 4HYYA 4KHZA 4P0TA 3VR6A 1U8AA 3DVLA 4WW0A 5JCZA 4LHVA 2BV3A 4KLNA 2EFCB 4A15A 1SKQA 3QJYA 2WPDD 1G4UR 4LV5B 4TQUS 1SVWA 4NYIQ 2WWYA 2WVJA 1G291 1F2UA 3QENA 3FOZA 4M0LA 3RS3A 2XEXA 5SZKB 5JI2E 2WJIA 3U7GA 2FWRA 2JJ2A 2J87A 3AVVA 1E0JA 2OT3B 4I1OA 1MO3A 4K46A 1XTSA 3PUWA 2H1LA 1CS4C 1DG1G 4OHZA 2AWOA 4OI1A 2OXRA 2KBFA 2ODBA 4TQ9A 3U7HB 3ZS9A 1E2GA 5C2JB 1VPLA 2R65A 1AS3A 5FBQB 3K0FB 1QHYA 1PLLA 2ATVA 1BIFA 3AB3A 4U02A 4UNSA 3SN6A 1K8RA 1HY3A 3K9NA 4B3CA 1E2NA 4G3XA 3UMSA 4LBYA 1NKSA 2G88A 5FUVA 1KDRA 4GBMA 2KSQA 2V3CC 1ESMA 4KYUA 1VG1A 2WKRA 4R2HA 5EE3A 2OLJA 5SZIA 5F3WB 1TX4B 4JLJA 4C3ZA 1T3HA 5L3RA 2WMOB 3DOEA 3DZ8A 2EVWX 3C16C 2PBRA 1UAAA 4OI4A 3L2OB 4ON9A 1NI3A 3IKJA 4GOKA 1FQJA 2GXQA 5EZ5A 3VNUA 2IS6A 3GFOA 2F55A 3LWNA 1E2EA 4TLDA 1GVNB 3REFA 3TKLA 1B0UA 3KXIA 1CJMA 1P75A 4F92B 3J81k 4LBVA 4WBSA 2G83A 2NPFA 3G82C 3L43A 3K53A 1TAGA 4IOJA 2FN4A 2RGXA 2IK8A 4FIDA 4TMXA 2WWHA 1XMJA 3GLIE 2JLXA 5A0FA 1OH8A 2WJYA 3GPLA 3OIYA 2OSBA 1E2MA 2JAQA 3FMFA 3GLIA 5JLJA 3T15A 5DSZA 4IEIA 1HQYE 3BB3A 1R5OA 2IYZA 2OFOA 4M2LA 2XXAA 4GI7A 2GETA 3KL4A 1PZNA 2GVDC 4B48A 1HT1E 2ZSAA 2IS4A 3B8HA 1ZYUA 5CK5A 3U6BA 3X1YA 1KKLA 3GLIB 1UKVY 2GTPA 3B82A 1NIJA 4LOAA 2IUUA 1OH7A 3RC8A 1Y3AA 5AUNB 2KBEA 2Y8EA 1ODFA 2FH5B 2XNDD 3K0AB 2WHXA 1NLYA 4JYCA 4BLRA 4MA4A 4ZCLA 3VR5A 2ZUDA 3ZZ0A 3CNLA 2BJVA 2BM1A 2C95A 1EFHA 1GM5A 2PH1A 3QSYA 2CJWB 2IF2A 2BC9A 2F1IA 2QM8A 2IYWA 1Z0KA 2YKGA 1OB2A 1F2TA 3QKSB 2ZI3A 2AL7A 3U61B 1QHGA 3CLVA 4DCTA 1VECA 4P4SA 3DMDA 2HT1A 4XWAA 1XJCA 3QIAA 2V4ZA 3F8TA 4LC1A 4OHVA 5EJEA 1UKEA 2IUTA 3A1SA 4W9MC 3UG6A 5F98A 4ZIRB 4RZXA 4NYMR 4CDGA 3RHFA 2O8CB 1SXJC 1NLZA 2ZAOA 3AF1A 2IYXA 3BH7A 1OFUX 1KSFX 4NYMQ 5FI1B 3TR0A 4BFXA 3QF7A 2YNMA 3OEHD 2QRNA 4IRUB 4XD7A 2J0VA 3VX3A 4OQXA 4CW7A 4ZDKA 5FOUA 2NZ8A 2XB2A 3K0FA 4LV8B 1U9IA 2GXUA 4A8JC 2ZYVX 1NMZA 2QTVB 4US0R 3DZDA 2OAQ1 4Q4LA 1T0JB 3QG5A 2WWIA 2V6JA 2H17A 4MH0R 3EPLA 1CJVC 4KFTA 4IOMA 1E9FA 1V5WA 3U3MA 4TL8A 1NBMA 4JKIA 2IYQA 2VH5R 3ZZTA 5KU1A 3LO5A 2G6BA 2QROA 1F2UB 3KUCA 1KI8A 2DCUA 2RGCA 2OLKA 4L15A 1E9DA 3QPVA 3SQWA 3I62A 1W5SA 4PHTA 4A2WA 2PMDA 3GFTA 2XTMA 4EQ6B 3FKSD 4R2IA 2GCNA 1SGWA 3CRQA 5IRCD 1KDPA 2E9SA 4PAQA 2V1UA 3ZJYA 3SZRA 1HA3A 3WNCA 4CRWB 2ZJOA 1E2FA 1BOFA 3ZVNA 5M04A 3CX8A 4Q19A 4BZQA 4PC1A 1E0SA 4C30A 4C0QC 3EARA 3TBKA 1DAEA 3RS0A 1T8UA 1WQ1R 1DAGA 2AKYA 4IDHA 2CMKA 2CXXA 2QL6A 1KHTA 2MMCA 5GJBA 2WKPA 4BFUA 3KKNA 1CIPA 5FUYA 1NN3A 3H0KA 4A9AA 3W6PA 2QY9A 3EIQA 5DI3A 2ANBA 4OHWA 3IILA 2J1LA 3RDPA 2HF8A 1XMVA 4WAUA 1G9XA 1TMKA 3Q85A 4Q48A 1ANKA 1G6OA 3EPKA 2JCSA 4HDQB 4XIGS 3AKDA 4B2PA 1GIAA 4QRHA 3VX4A 1AK2A 3K0SA 1DE0A 2QRZA 1KZGB 4HAZA 3SOPA 1RW4A 1N6OA 1EX7A 1W36D 1OH5A 1T6NA 1YVDA 4AG5A 4LPKA 5AUOB 4P3YA 1OHHA 2R6DA 4AKIA 4OJKA 3CZPA 4OI2A 1E2PA 2Z4RA 3BK7A 3AGPA 4ITRC 4RVCA 3FB4A 4NCHA 3B6EA 5IF9A 3AVOA 4D4MA 1UF9A 1XCPA 3T12A 3ADDA 2QTHA 1G7RA 5TVKA 2FGKA 1V43A 4TL6A 5LPNA 5H70A 1XEXA 3KZ1E 2WWWA 4TT3A 2ERYA 4TYPA 4DLXA 3GJ5A 3R9IA 4AIIA 3I3SR 5JRZA 1E4VA 3D3QA 1E2QA 2P2LA 1P72A 5AJVB 5H8WA 4NZYA 3CZQA 5E3HA 4QFMA 4PC2A 2G1KA 5H1YA 4MKIA 3EA5A 4DDWA 1CJTC 3EIHA 1TUIA 3GLFE 2VP2A 3QXHA 1W36B 2ONKA 2OESA 4RZ2A 5DH9A 1W4AA 3LVQE 1QZXA 3VKGA 2H92A 5KHOC 2QUZA 1E9RA 1JEDA 1OXXK 4JLAA 5GADl 2EFGA 5DYGA 1L7VC 1S8FA 3VTKA 1PV4A 2FZ4A 2VA8A 4HATA 3V4RA 2WAXA 3T35A 2EYUA 1R0WA 2AFHE 2WPDA 1N6NA 1TF2A 3U3OA 1EG7A 3F3YA 1P2VA 1E0KA 3MFYA 3VQTA 2VRWA 3NG1A 2OAP1 4IXNA 4TTQA 4BFYA 1G8GA 2Q3MA 2ZANA 4F38A 3EXAA 1LNZA 1T4GA 1XXHB 4C2UA 5A5GA 4U00A 3HWSA 1OV4A 4WXPA 1OYYA 1X6VA 2YOGA 1E9SA 2FPMA 4GT1A 3CRW1 1F5NA 3UWOA 1MRSA 2JA1A 5JRJA 4AKEA 4HAWA 2PX0A 2VHQA 2JGNA 1FZQA 2ECKA 4HUQB 4N0DA 4IVQA 4QC2A 4PPFA 5LB4A 2A5JA 1TQ4A 4CIDA 2WWFA 2ZJBA 3U4QB 3ZZUA 5DN6D 1VCNA 2GHIA 2ZR7A 4B74A 1RC8A 1E69A 2IXFA 2FEOA 2RGGA 1IBRA 2DHRA 1UFQA 1Z2CA 2ZR9A 1YZQA 2RHMA 3K9LA 3WY9A 5KNDA 1Z6AA 8OHMA 2FFQA 3AF0A 5EXSA 5EZ6B 1W49A 2UZ3A 2XOKD 4V0ME 2XNDA 4ABYA 2HXYA 4UNQA 3IBYA 3MG9A 1N0WA 1JR3A 1KY3A 3CKLA 4HB4A 1ZM4A 3X1ZA 2REXB 1VKJA 5AWFC 2KJQA 1VYTA 1R4AA 4U7DA 1JR3E 3EG5A 3R7WA 4A1FA 1A1VA 1GRNA 1Z6XA 3K8YA 3KTAA 4AC9A 2PZGA 3HPRA 4UXIA 2HYDA 1E32A 1N5KA 1R0ZA 2ZQ5A 4MKHA 2GEVA 1OPXA 1KYIA 1OW3B 3EPJA 3H84A 3TSZA 1MV5A 5JHGB 2IX3A 1EFRA 2ZROA 4ZCIA 1SXJA 1QF9A 5CDFE 3GEEA 4B6FA 3M0EA 4Q1AA 4OKSA 1B23P 3SYLA 1N5LA 4HDOB 1LFDB 2V1XA 2ZI7A 4V0LA 4M8NE 1XDBA 1EESA 1G5RA 4V02A 3W3AA 2VSXA 4DEXA 1Z3IX 4D0GA 3UWKA 4KITB 1Q1EA 4PZLA 4D82A 1CLUA 2YINC 1XTQA 1N6RA 3OZXA 1DAHA 5IHPA 1P2UA 1W5TA 1GKUB 4KFUA 4EFNA 4Q9JA 3T1QA 4XWOA 1XJQA 2CL6X 3NVAA 4B43A 4JL5A 4O25A 1RZ3A 1JR6A 3BFXA 4TMZA 1X8JA 5FTJA 2ZJ2A 3A58B 3AP3A 1Z2AA 4L8GA 4GP6A 3PUXA 4UQOA 3VU9B 4LY6A 1E1RA 4DC9A 2BOVA 5J4HA 1IN4A 3DMNA 2C99A 4TQAA 4ZI2A 4MKGA 1GL9B 1XZQA 4BWYA 3O8BA 4BEJA 1OLOA 3H1TA 4N1AA 3TQCA 1UBFA 3FGNA 2ZE8A 3BH6A 3THWB 3NBYC 4O2LA 5B30A 6Q21A 4MYUA 2EWVA 1GITA 4JZKA 1ZM2A 2YYZA 1UDXA 3LW7A 3FVQA 2VF7A 3AVXA 1YJ5A 2ZJYA 1GL7A 1W4CA 3P4YA 4N3NA 4NBSA 1KO8A 3E2IA 3PCRB 4A82A 4PPQA 3KKOA 2IC5A 3KJIA 5SZJA 4R71A 4URXR 5JSZA 3K0AA 3KXKA 1DTSA 5HZKA 3U7FB 1YRBA 5L3VA 3X1XA 3AF4A 2ZRCA 4YMSA 1SZPA 2GF9A 4C0LA 4TZ6A 3CUEF 1A5TA 3RRNA 3QXXA 2PT5A 1CEEA 4R7ZA 2ZVPX 3AQ4A 1XZPA 2VTKA 2VIIA 4Z1MD 4JSYA 3RABA 4TYYA 4RD2A 3IO5A 2O8DA 4OL0A 5FL7A 2OXCA 2J0SA 3DDCA 1FMJA 1Z0JA 1PLKA 3QEOA 4IKEA 4OK5A 2NIPA 2HDNB 3CR8A 3LA6A 4QNRA 2GJ9A 1K6MA 3B85A 2F3TA 3IQXA 1Q3HA 3B1ZA 4JLNA 1Z0IA 1ZW6A 2ZSBA 3QVUA 1ZIOA 1J90A 4FI3C 1YZTA 2MSDB 1YQTA 1G19A 1W48A 1PUIA 5J47A 4HAYA 4DLYA 4PX9A 4OHYA 1QHIA 1AS0A 1H8HD 5KDLA 2QT0A 3CPJB 4HLCA 2P3SA 1OIXA 3B1WA 4TL9A 4FMDB 3EWAA 1GNRA 2YVUA 4B34A 1NN0A 5EXPA 2JDIA 4TYWA 4AYXA 2WSSA 1EK0A 1JNYA 1HE8B 1P3JA 4EPWA 4ESVA 3ZD7A 1KK1A 1UDWA 3EA0A 4OQNA 2GCOA 4UJ5A 1MO4A 2NO0A 3JZMA 5BYKA 3SBDA 2QBYB 4HEJA 1G6HA 2Q9BA 3BGWA 2J59A 1WCV1 2ONJA 3N70A 4JVNA 3VR3A 5HE9A 3BH0A 5FTLA 2C98A 2RH5A 2P6NA 2W2TA 2BBTA 2QA5A 2QAGC 3ASZA 2J45A 2ZU6A 3WNBA 1YZNA 1KI2A 1Z83A 1N6HA 3EWSA 4Z8YA 3WHLA 1NKTA 2HUPA 4DCNA 1YHNA 2WWGA 4FCWA 2V8OA 3UKDA 4GDFA 3VMFA 2GJAA 1ZCAA 2VP4A 5EE5B 1I2MA 2X1VA 3IIMA 1SQ5A 4JMPA 1W0KA 4UNPA 2YV5A 1XPOA 3LX5A 4S35A 1J99A 1ZBDA 1VHLA 1TEXA 2ZS7A 5CIQA 3I8SA 2QU8A 3NH6A 2H8KA 2ZXUA 4CT4B 2E1RA 3TUIC 1FW6A 4LJ6A 4M1YA 2JLVA 1LV7A 2JIZD 3MSXA 3Q3JB 2AN9A 1ZINA 5CJPA 4EJSB 2IHBA 3NEYA 4GSYA 2IYSA 4LYAA 3QKTA 1KMHA 2BKUA 1F3OA 3WP1B 4I4LA 3RAPR 5E7IA 4C4PA 2CK3D 1GOTA 2C78A 5FOTA 2CVFA 1XU4A 2BMEA 4MRNA 1CTQA 4HLUC 2F1RA 4URVR 3LD9A 1E9BA 3LBHA 2QAGB 2YHSA 4YXWA 4EKDA 3EPHA 3AVPA 4DB2A 2O8EB 1H65A 3AVYA 4Z51A 5FPHA 2ZRFA 5DHFA 3EZ6A 1WXQA 1M6NA 1UM8A 3GD7A 3LXRA 3IPXA 1DVRA 4KXFB 3GLGE 2RGNA 1DBSA 4KO8A 2CHGA 1ZNYA 2PEZA 4XVRA 1X8KA 5KO2A 1G41A 1NVUQ 4JVMA 1OJLA 2VBCA 5GJVC 1KGDA 2QORA 1E99A 4TSFD 1KK2A 5DGXA 2LCFA 3T1VA 4LX0A 5K8TA 2I1VB 2O8FB 3B2EA 4JL8A 4Q02A 2WAYA 1U9IC 3TIFA 3WNDA 4B33A 1EFCA 1VMAA 2OFWA 2ZS8A 4MGKR 3TVTA 2GEUA 3KB1A 3KFXA 1CR4A 5HTKA 1WB9A 4V0OA 1JECA 3NBXX 1NBMD 2AK3A 2FZLA 2VSFA 2YWFA 3L0IB 5E7MA 1II8B 2ZE5A 5EP2A 2FPKA 1QG4A 1JI0A 1IY2A 4PC7A 4TMWA 4U5XA 4QBFA 2B7BA 2ZYUX 4AD8A 5JWOA 5C46F 5GVSA 5F9HA 4QHYA 1FP7A 3DHWC 3OEHA 1C9KA 1XJ0A 2TMKA 3T5DA 3AUXA 2PZEA 1OE0A 4KJZA 4DDTA 4CF7A 4Q4JB 2R6GA 4TLCA 3NHAA 2AKAB 2OCAA 1G64A 3UXMA 1I2DA 4PPNA 3ZYCA 5HE8A 4BLQA 3MRSA 2JIZA 1WA5A 1XBTA 5KYKA 3G0HA 3T34A 5LDDC 3PENA 2E87A 4C0HA 3GLHA 3I32A 4LV6A 5AJZA 4RFSB 3GQBA 3FPAA 4BRUA 4YMVA 3AVQA 3C4JA 5D3QA 5EP4A 2QQEA 3GLHE 3NBZC 3K0CC 3UMFA 1AA9A 3CPHA 4B3DA 3P1JA 1RYHA 2BCGY 5C18A 3NC1C 4US2R 2VP6A 4E03A 5F9FA 4Q4AB 3TW8B 1JJVA 1Q20A 3IUYA 1M7BA 4Q1BA 2HCBA 1SVLA 1M7HA 1SXJE 5FUWA 1VTKA 1K5GA 4PPGA 3K70B 5EP3A 4RD4A 1CJKC 3EZ9A 2GA8A 5KNCA 5B58C 2K5UA 4KFSA 1OF1A 3QQ5A 2ATXA 2C04A 2YC4C 4HB2A 1P2TA 1OXVA 1G3MA 2OUKA 1ZM7A 1US8B 3CH5A 4HLQB 1XF9A 4TMTA 5IK2D 4M1OA 3WMGA 2NG1A 2Q21A 4DKXA 3A4NA 4TYQA 4XTCS 4EPVA 1FTSA 1KOFA 5A4JA 3K9GA 3NC0C 3RVBA 1H8HA 1KI9A 4MGZR 3A36A 1COWD 1P4SA 4M9QA 3Q72A 4Q4HB 1L4YA 2REBA 2XAUA 2YWGA 521PA 3THYA 1KJWA 4ZCMA 3WMFA 4LUCA 4KSCA 2XGJA 4ACAA 2J0QA 3TNFA 4ASUD 5G41A 2RGEA 4RKEA 3WRXC 5DHAA 1U8YA 2WMNB 2DFLA 5HKKA 5JWHA 2CE2X 1US8A 2FPLA 2CVHA 3QXCA 3S1AA 4M22A 5JJLA 4Q03A 5GJCA 3GEHA 5FPYA 3OHMA 3LQRA 4A4DA 4B2IA 3RRMA 1N5JA 3QKRB 2NPIA 1KK0A 1UADA 4B75A 2VP9A 4RD3A 2ODNA 2ZRDA 3RNLA 2WJVA 2XZOA 721PA 3I8XA 5ELXA 4YC7A 1G20E 4J0QA 3GJ3A 3K0EA 5DE3A 4URZR 2NO1A 3KJHA 1QDEA 3W6OA 2SHKA 1IXSB 1X1SA 1RRFA 3NKVA 4MKFA 3R8FA 3A8TA 3CBQA 1QHHB 3ICQB 3CR7A 1KI1A 1GP2A 4Q66C 3A1VA 2OO7A 2OV2A 4EFMA 2NGRA 3HYRA 3AGQA 4MUBA 4RY2A 2BMDA 3TR5A 4PANA 1KJZA 1YZLA 5L3QA 3BRWD 3N2EA 2GF0A 2OE2A 1MO5A 1ZUNB 2ORWA 3EIEA 3Q7QA 3T1TA 1NBME 3LNCA 2O8BA 4LGMA 1W7AA 2QPTA 2X77A 2XB4A 3CW2A 4I1VA 2IYTA 4HZIA 4LWZA 1DADA 4DEYA 1AGPA 5P21A 2KI5A 1CRQA 4FXPA 4KODA 2IWHA 3OIWA 3A4LA 1NSTA 2ZRBA 3FHOA 2VP0A 3BOSA 1N6PA 4X8LA 2EFHB 1W4BA 2WOOA 2JLRA 1SULA 3GP8A 1U2RA 4WIAA 3RWOA 1BS1A 4K8OA 4BZPA 4KSBA 1II9A 2F3RA 4XVUA 1OH6A 1ZC3A 1CR1A 2FDCA 1HE1C 3AVUA 1KAOA 2QMEA 2WIBA 1EX6A 1II8A 3SHFA 3RS5A 4AY2A 1ZU4A 1RIFA 1ZNZA 3I1FA 3I5YA 2AXNA 4Q7LA 2WJGA 1LF0A 1Z6TA 4PSKA 1X1RA 4LJ5A 4QBHA 1KDOA 3BB4A 2Z6VA 1ZP6A 4DUGD 1Z29A 2AXPA 3MJHA 4CEIB 1ZNXA 2IBMA 4F4JA 4DT1A 1F60A 4MDEA 1IONA 4IW3B 2A5YB
chains in the Genus database with same CATH superfamily
4QA9A 4LJ9A 1G21A 1NAHA 3PUVA 4RKYA 5CTAA 2XE6A 3VKHA 2PSDA 1TE2A 1DRVA 3LCCA 5FPQA 4X7MA 1YIDA 5B3AA 4JR2A 3RUCA 1B3RA 4YMUA 4RK6A 4Z2YA 1ULZA 3RBXA 4ESEA 2FZWA 4M9UA 4YTEA 4YP5A 5FLKA 1AHPA 2Z6QA 1U1DA 4RVOA 3CMCO 1WF3A 4BU1A 4O4JF 2BTQA 4ZYYA 1CERA 2BP7A 3OMXA 3M3PA 1NMSA 4AKHA 2ISCA 4J90A 3C3WA 2RI6A 2M98A 3D3WB 3GNSA 1BQ4A 4JLBA 1JFVA 2PZJA 4BKRA 5BT9A 3UCXA 1QE5A 2JCYA 1RE0A 1P33A 2GJ8A 3PIRA 5AIAA 3DBHB 2ZI5A 1V3QE 2Q9AA 2DWQA 3Q8LA 3P9NA 1WCIB 4L0CA 1HK7A 1CSEE 4IVPA 3OF5A 4PZ0A 2XOXA 4EO4A 4OQLA 4LHSA 3SHWA 2PSSA 3MJSA 5BQFA 1LSJA 4TTIA 4MXDA 1XMXA 4MA0A 1TPZA 2A9KA 1E5VA 1C3JA 1IBCA 3R40A 2O2ZA 1HG0A 4KXYA 3I64A 2AUNA 4RZIA 3CZ9A 3CW9A 1N7IA 1KIMA 3GLFA 1WMSA 3MQFA 3OPQA 2EARA 5BSEA 1OI7A 4V2IA 1A27A 4BNLA 3KL2A 4AS1A 3LDFA 4PYIA 4B8YA 5BWMA 2WVHA 1JJ7A 1TAQA 3ITKA 4IAOA 1DKPA 3WK6A 1UOOA 1T8RA 4IO1A 5C4MA 1MIOB 2QZPA 5FNVA 3PEWA 3E15A 2EJWA 2LTAA 2QY6A 3UQZA 4BRWA 1VA4A 3DEYX 2BSQA 5CNIA 2FJUA 1Y1LA 4BJ1A 4F5DA 1XB2A 2G77B 2W6JD 1FP2A 3NBKA 5F7ZA 3AUSA 4Z5XA 4DLTA 3R3ZA 4P93A 2RIRA 1BVHA 4E22A 3IUJA 4F2WA 2O8NA 4MCIA 5LYJB 4O4IA 4CM5A 2I3AA 2YJ5A 4Z8XA 1XHLA 3H9UA 4XJXA 3OPYB 2P1ZA 4EAQA 3HHEA 2D7DA 1O6GA 3LLVA 1C8KA 3L8MA 4Q9HA 3PUKA 4IO0A 2H48A 4C7OB 5I7UA 2RCYA 4L74A 3GRPA 3RJZA 2MR6A 3ADKA 4KGZA 4UKDA 1SUFA 3OOHA 3VO9A 2ASEA 4FGKA 3HBAA 4PFSA 3LMKA 3AKZA 4JWKA 3VR4H 1WZEA 1UZUA 1S8NA 2R751 2VPIA 3AINA 3QVKA 3R3UA 1IN1A 1QIEA 2CV2A 3K96A 4DR2B 5I4KA 2Z6UA 1CUEA 1F4LA 2MSWA 1YU9A 1G8FA 5GP1A 2P6PA 5E6UB 2JAOA 5FBVB 1CUVA 4MHOA 1E2JA 1EE1A 4UUQA 4P22A 4QEDA 3ILHA 4DLPA 3UK6A 3STTA 1FVXA 5CX4A 3OA0A 1RZRA 1WS6A 5KNBH 2V7QD 2ZYIA 3TECE 1LWOA 3KZCA 1ISHA 4IKPA 3OZEA 3GRAA 3S40A 1OLSA 5KYWB 2Z2XA 1E2HA 2VDWB 4JSTA 2F4VB 2NO6A 3D3WA 1N33B 5KYYA 4J0IA 4ZYUA 3ABSB 4UDOA 3L4JA 2GAIA 1YBFA 1OBCA 3VSEA 2IOQA 2GF2A 4OQFA 2AA3A 4OXNA 1AHIA 3QPAA 3W9YA 4ZQHA 5MN5A 2WZCA 3NIDB 4PCUA 4ERNA 1U2TA 1A9ZA 4A6XA 3BE4A 1A4RA 1I2CA 3LYHA 1RJEA 5LD2C 3OCCA 4AMVA 3ISTA 1DIBA 4F86A 4DMKA 1S02A 2XODA 3CLRD 3QI2A 2HJRA 4DIKA 5L8VA 3ZW8A 2QMQA 1OHHD 4YYZA 3TBHA 4QEKA 3E9YA 4N65A 5LP6C 3SFVA 4GI1A 1EX1A 4F3RA 1U6KA 4MGYR 4BBJA 3VYTB 3V1KA 4KLZA 4BB5A 3EBOA 4DSUA 2UUCB 1P8AA 1E5QA 3DKRA 3U3XA 3U5ZB 3ADPA 1KQPA 2ZIWB 2DF8A 1NRWA 5E4TA 4RQAA 4L8LA 1ZGZA 1XAIA 2JIMA 1X86B 3SX0A 3CF2A 4ND5A 4TGLA 1KO1A 5MF6A 1DEKA 3OT4A 5LYYA 3WL7A 4DIEA 2XZLA 2NW6A 3CZCA 3HZHA 4WOCA 2AS0A 1GFWA 3VO8A 2RHBA 1FPQA 5JS1A 1M2WA 4PYRA 3CLSD 3LO8A 4HGQA 1XZDA 4RLHA 1IG0A 4I1UA 4LA4A 2VJMB 4YPFA 3PUZA 3WMEA 3AKYA 3QE4A 2GBGA 3WGYA 1T9KA 4RJKA 1G5FA 3K1JA 3OA2A 4XJSA 5CM8B 3LF2A 1AJEA 3HJBA 1HTTA 4J0GA 5EQJB 5A06A 2DFVA 3RUEA 3LH5A 5TPZA 1VBNA 3MT8A 1T0HB 2OM2A 2WSSD 4G5QA 4QLOA 4D98A 4ED9A 5CDUA 1IATA 3FBGA 4RPCA 2WHQA 1W1WA 1NV9A 1WMDA 1YQ9A 3D8TA 3KSDO 3KD3A 4H4EA 1KYTA 2QRMA 4L4ZA 4LEIA 2NSDA 3EN0A 3JWIA 3KUUA 3LBYA 5I9BA 5C31A 1XN1A 5G4KB 3M1IA 2N1BA 3HV2A 4CCYB 3CKMA 1AF7A 1E6EA 2RHRA 4NP6A 1BH2A 4W5JA 4N18A 3A3NA 4MUNA 3BE6A 3SE7A 3HLKA 5FA5A 4NFYA 4CLHA 3AF5A 1R12A 2J08A 2PZBA 2QN2A 3NBMA 4Y6QA 3D3EA 3I30X 2HNBA 2MMGA 3K0KA 4GPAA 2AIRA 1FTYA 1TQ8A 1PUJA 2C77A 3PE4A 2C97A 2QAIA 4RANA 2H31A 3HUEA 4BBAA 3QX7A 5EIAA 3ZTYA 3NX4A 5CB0A 3TZEA 4QLBA 5ED4A 1KVSA 4KTVE 4KOAA 5C34B 3R23A 1N8TA 1E1NA 2WM9B 3P96A 3HSYA 2CMDA 4F91B 1PJRA 3CJTA 5T4FA 2VHWA 2I4MA 4YQYA 5A9SA 1FNMA 3DMGA 2ZCUA 1O6FA 2O2SA 3B9BA 2C3MA 2XYGA 3NATA 4OHXA 3EQ2A 5DBEX 5FYQA 1UPTA 5DXAA 1EJ2A 3CRZA 3JXEA 4L5BA 4DR5B 5IVHA 1ZKMA 1ADGA 3GGDA 3P9RA 1L4GA 1QZ3A 2GN6A 4DOMA 4Y1RA 2VAVA 4LK2A 1I4WA 1A4XA 4WY8A 4KYVA 1CW2B 2C2HA 4UVIA 4MYSA 3ROEA 1X7HA 4YFYA 3VYWA 4C29A 2ZW9A 5BXQC 1BRMA 4IDQA 1YFLA 2PG3A 1J97A 1GPH1 1WR8A 2A1UA 3RVJA 3U7EB 5IFKA 2C31A 4J0DA 1H1TA 2Y4OA 2PDAA 4Q82A 2VOEA 3RU2A 3P32A 3TTTA 1XCBA 2CE7A 3TAUA 4EK9A 1VE9A 3HNRA 1U98A 2ZYDA 2IW3A 1NMQA 2D1RA 1U90A 2Q5JA 1KJQA 1UPXA 2J3IA 2CJFA 4IF6A 1D8TA 5K03A 1RQGA 2I62A 3NM6B 4KGXA 2FX2A 2VRCA 2GO7A 2DG2A 1XVIA 4JS0A 3FHTA 3KZVA 5JW6A 1KZ7B 3GVCA 3P45A 4Q9IA 3C7KA 3UVEA 4HGZA 4EARA 4PZYA 1J2RA 2GPBA 2YWJA 4C6SA 4EPRA 5TJHA 4KBFA 4XRRA 4NU8X 2R8BA 4V0KA 1Z22A 1E3LA 2VL7A 3CBGA 3TJMA 2DLDA 4KE6A 1IBLB 1FFXB 2FJ0A 4Q1EA 4ZEVA 3VPCA 3SJ7A 5C1BA 3IPAA 3VV3A 1I6KA 1VLVA 1JKJB 1NJFA 4XQCA 3O9MA 4N6GA 3Q8MA 2H51A 1N0UA 1CR0A 1QUFA 1N77A 3B38A 4NAHA 3NTOA 2KB0A 5CFZA 5LZ4A 1PHPA 2ZR8A 4CV1A 4C5AA 4JCOA 2PWBA 3D0QA 3TM4A 1P4JA 2H0AA 5DK4A 4E5SA 3VH4A 5A9SB 4HK4A 4G9EA 3T4UA 3QYAA 1EUCB 5IT9A 2GHTA 2H2FA 4MVJI 4RMGA 1UJ6A 4NU6A 3U3KA 4TKVB 4IGFA 4W7IA 3AUAA 1WDWB 3EUEA 3DAGA 2VT3A 3KP1A 4ZK2A 4RULA 2I6TA 3QEAZ 2K6GA 4OSEA 1GSOA 1I1QB 3JD3A 3GUVA 4HEHA 5HQTA 4MB2A 2I4OA 2LPMA 5BR8B 2HWYA 5A3SA 4CUJA 2QAGA 4K2AA 4G5FA 2YL2A 1RI1A 3ZG6A 1PZXA 2P65A 1T29A 2XBLA 3H86A 4WZ6A 3EEOA 1QHXA 2QJRA 1UZNA 1AZSC 2JI8A 3DTVD 2ZBGA 1KIAA 1U2PA 4H08A 4QUIA 2HWXA 4TROA 3NBAA 4JP2A 4RHUA 4Y1FA 1YQQA 4Q3BA 3PPYA 4MS1B 4YRPA 2AD5A 3FB1A 3LBIA 5B1DA 5AI9A 1V3UA 3N0XA 4IV8A 2W83A 3GYBA 5L3SA 4PR0A 4QOSA 1RWQA 4OHBA 2YFHA 5EIOA 4HDCA 1HUQA 2OTCA 5JSQA 4QDXA 3IGFA 4JUFA 1E3IA 3AVWA 2PXXA 3GRYA 1VGQA 1BWSA 4YREA 3K09A 4DCVA 5FDFA 2ACKA 3B52X 1U0LA 1XKTA 5C0OE 4CMKA 2VNIA 1Q84A 2XOKA 1RFLA 2W2XA 3ESBA 4KWTA 4NIMA 4OAPA 5DNYB 4R54A 3MTJA 5IT5A 5JFGA 3JR3A 4EYQA 1ISRA 2YIVX 3PITA 3Q6IA 3A11A 1Y8QB 4OTZA 1HORA 1GY8A 3MQ2A 4G67A 1QRDA 4BMOB 2PCJA 5BW5A 4Q3EA 1QGDA 2HF2A 1KJIA 2RAVA 3QSGA 4LFCB 4D41A 5E9AA 1ZGGA 4PWYA 1U7HA 2QRPA 5ALMA 2ZTLA 2ODWA 4HGYA 5E3IA 4BBPA 3RYTC 3T5AA 2WSLA 5KQGA 3A2LA 3CB2A 3VDRA 2GZDA 4INJA 5LP6A 1K7YA 4MLPA 3IV9A 1J00A 1FTNA 1LBQA 2OVFA 3WGHA 1GAWA 3CGWA 3GGSA 3I28A 4HMPA 4IUBS 4OU5A 4DCCA 1THTA 1SHZA 4QG3A 1I4OA 3THXB 4D8UA 1QRTA 1GQYA 4X61A 2AXQA 2HCFA 1KQFA 3E9MA 1L4EA 1QOPB 1F38A 3E7XA 3SJCA 1U9CA 3UWSA 3EZ7A 1CKEA 2GCOB 2I4TA 3DE0X 2X0IA 4JXJA 4RXMA 4D0LB 5AW8A 1YZGA 3ICEA 1YKSA 1MW8X 2I66A 1A9QA 3TQQA 4TV9B 3AW8A 1EKXA 1QYDA 1XXLA 2QTGA 3FN4A 3MN1A 4I4TB 4WBXC 4CZ2A 5G4KA 3CWCA 3HBMA 2PRKA 1A7JA 2I80A 1JHXA 5JYDA 3KEQA 1HNXB 3KNZA 2H29A 2WFLB 4UTVA 4ZCRA 5C3UA 3TLXA 4ND8B 3NASA 2YY5A 4ZANA 1B8PA 4X60A 1T0IA 1MC5A 3D02A 3OBIA 3TLGB 3CMMA 3I2JA 2VDWA 2GASA 1NY6A 5TMEA 3RFCA 2O19A 2FEWB 1N6KA 1WQ4A 4XGNA 4PLGA 1J5XA 1W9MA 1MOZA 4TYNA 4EYGA 2G67A 5EKTA 2O3RA 1DIOB 4FFLA 2QJFA 4TM7A 1QP7A 2JLQA 3HACA 3ME5A 4AJJA 4L07A 3R3YA 1EWQA 2ZCVA 3PA8A 1UMDB 1J4AA 1K2WA 1V71A 3L1HA 3PWZA 3WQRA 5H9WA 2WHRA 4A1OA 2OBYA 5E6SA 3TRFA 3RUFA 4AWAA 4FWBA 2ZRJA 2ZYSA 1UK7A 1A2KC 2A7QA 2HSDA 3GN2A 2EHDA 2JCVA 3UANA 5KYXA 3PVZA 5LWHA 4M0FA 1DAOA 4MPJA 4C6RA 5JY6A 1A0OA 1L6RA 2OCIA 2YXLA 4DN6A 1I7SB 4G1CA 4U6QA 5G4LA 4I3FA 1FFAA 2FRDC 2XCLA 2ZULA 2WDZA 4BO1A 2R47A 1ODTC 3IPYA 1NVGA 5JHHB 1AURA 1KBOA 1UC8A 4FOSA 2QP4A 4ND2A 221PA 4RQTA 3V5NA 3QTLA 4O1HA 3SQOA 5IBPA 1P4HA 4DNOA 2QM7A 4F93B 3WWPA 1QU3A 3KCNA 2QDXA 1JBKA 4B3FX 4EHBA 2F8LA 1K5PA 3CUVA 4ZJZA 5DGIA 1QO0D 2A9OA 2QMZA 3Q10A 1CXZA 1FL9A 2IS1A 4X20A 2DECA 1P2SA 3VBCA 4D0SA 2Q0XA 3QLVC 1M72A 1ZUD1 4PYLA 3THWA 4DJTA 3AJDA 2X0NA 4O3MA 1F2VA 5KTNA 1MEOA 2FLVA 4GLJA 3DKIA 4GMHA 4XR4A 4LHXA 1TAUA 2ZUBA 3BB1A 4H4CA 2W8BA 2CJWA 3ZY6A 2Q0SA 1OLSB 4OLFA 5BV2P 2UZIR 1PT7A 2ZIVB 3DVRX 4TRMA 1D4ZA 1SRQA 2B1IA 4W8GA 1BS9A 1JAZA 1YZKA 4AI6A 4CM8B 1Y5LA 1LLFA 3L0ZA 1L5VA 1NOKA 2HMSA 3UYKA 1AKYA 3TQOA 1G3QA 2YUIA 3ZH9B 4LPSA 1LFAA 1Y6JA 2IU6A 1TC1A 5FI5A 2OCGA 3E70C 3NR2A 4OP3A 5IAKA 3WYDA 2WHPA 3RKUA 4YRBA 1DBQA 4KIGA 4ZEMA 3I6QA 1V8DA 3A14A 2I0FA 2JASA 4S1VA 4Y2TA 4ETMA 2O59A 1R0LA 1FXUA 3FFTA 4QDJA 2PU5A 4RD0A 1M3SA 4D8YA 5EVJA 3RVDA 2FOLA 1W76A 2JJ8A 3LXMA 4S1WA 5DBIA 2H2IA 3IV7A 4I4TA 2FN3A 3HADA 3C8UA 3FZQA 1DKNA 2ZJ8A 5KPDA 1POWA 1BX0A 4C3OB 5A0VA 1XT6A 2P9GA 3EVFA 5FUXA 2LIPA 3TIGA 1UPCA 1DX4A 1FOEB 2CBXA 2X1MA 2GPWA 3HXPA 2VJNA 1HV8A 5DNVA 4B3XA 3C5CA 4RQUA 3CSUA 3RYIA 3ZKWA 3PQCA 2BH2A 1G20B 3DB1A 4QPPA 5LNK6 3T7DA 4QRDA 4PHHA 3I2IA 1MIOA 1XEWY 1H2RS 5CVVA 3TW4A 4B5KA 2V7QA 4PO9A 4B31A 4DCOA 3F2IA 3UG7A 1E79A 2ACWA 4GZMA 4KFRA 4MQ4A 4QSMA 4YMTA 2J5BA 1TOAA 1G8PA 2FW0A 3EOBI 4WL0A 1EA7A 4BNNA 1KKUA 3HR7A 4WCFC 2VPTA 1R6BX 4FCTA 1R4NB 1PFGA 3AEQA 2BN4A 2YDXA 2G76A 4XFKA 4J75A 5TF4A 3RPEA 3W9BA 1HNNA 2ZWPA 1P2FA 4PG6A 4MULA 1QORA 2AN5A 2V7GA 1MG5A 2GEDA 3PT9A 2AOTB 4HWTA 3T3HA 3I9V6 1J8MF 1P44A 3QWHA 5K99A 4AZ3B 2BEWA 3T6KA 1ZICA 4R9VA 4XLLA 4WBNA 5BSWA 2Y1KA 2H5JA 2BBSA 2L0XA 3OLYA 1T8PA 1CY4A 1YR9A 4A0FA 4JI3B 2VQSA 4M87A 1JHOA 4G1MB 5CB6A 2I9KA 1NA5A 1SHLA 1PG5A 1IOVA 3AH8A 1KZ4A 1U7TA 4QDTA 4PZZA 1DT3A 4UQLA 1KO5A 1H2HA 1R4MB 2C0CA 2ZP1A 4JGIA 4RIHA 2GNOA 4UU8A 5CBPB 3WDLA 4FDVA 3FTPA 4NOLA 4RY0A 2GGSA 1MJGM 1DP4A 2Z30A 4EMSA 4M21A 1LDEA 1I80A 1Z35A 2VTVA 3QYJA 4KAFA 4DJEC 3TTYA 4RTKA 3C41J 4KVAA 3AFHA 1C3OA 4QNNA 4LIPD 4EW2A 1OI2A 3FY4A 5DTJA 4UJ3A 1ZBQA 2RIPA 4L16A 4HNUA 3RU3A 2K7FA 1QOQB 1JLSA 1P7WA 2EXXA 3EDYA 3O3MB 1TEVA 1XRPA 3DA8A 1LPAB 3ONNA 4RL4A 5CCEA 621PA 2MCFA 2COEA 3BM5A 4YDQA 4TKVA 1CQIA 3UM9A 1W19A 1I1HA 4OHRA 4GRIA 3HJGA 3MWKA 1T2UA 3ZHRA 5JCPA 4YAUA 2MINB 4TT3D 2HPHA 3H11A 4JL6A 1UIRA 4JBIA 2N42A 2H11A 3JRNA 5K2MA 1JQKA 1WMEA 3PQ4A 4UCWA 4H1HA 3CF4A 3DMFA 4OQEA 4U2FA 2C4NA 1MABA 3HVJA 4KQFA 2D5AA 3NHZA 2X5XA 3G3EA 4HNAA 1QV7A 3RM3A 4DA8A 1TL7C 3KIPA 3PDHA 4CTJA 1P62B 2FPIA 1JS1X 3MB8A 3BFVA 4PEVA 1U8CB 5EMKA 4NCNA 3JSAA 4F97A 2AOVA 2X8JA 4HB3A 1GNVA 2QUIA 2R60A 1QBKC 3IMEA 3BSSA 3QMPA 4XX0B 3TDNA 2Y6UA 4IX9A 4KNYA 3AP1A 1LJ8A 4F72A 3W1EA 1IU9A 2CF5A 5BOVA 2ESRA 2ZEJA 1ZAYA 2DUNA 2PKXA 2B1JA 3IQGX 3FXAA 4GH5A 2C20A 5AT1A 4LW8A 4QJIA 4JT2A 4EI7A 1OZ0A 5C37A 3AV3A 3DZHA 3PNVA 4O2BB 3OCZA 1M7GA 1Q57A 1PKEA 4X8MA 4FYIA 2HMVA 2QD4A 2IYPA 3EXFA 5CDFA 3ZJ5A 4ZGWA 2P9JA 1CYEA 2RBEA 1ZEMA 2R2GA 3SE0A 5GJWC 3OPYI 3JQ7A 3LRPA 1O6ZA 3SR4A 2O8BB 2NZWA 3EC1A 4C0AC 1GU7A 5CITA 4NZOA 5DYIA 4C4ZA 2V7BA 3ZHUA 4D57A 1IJEA 2C07A 3GN1A 3CONA 1GU1A 1HM5A 4E5UA 3FPLA 2ZRLA 2GNPA 3R6WA 4HGOA 5HS6A 3UOAB 3ND5A 4M7RA 4QTYA 1UWVA 3PWSA 2DFTA 3FX2A 2XSZA 3OPXA 1HYQA 3D2AA 1P7CA 4E46A 3UMYA 4MLCA 4NCKA 2Y9PB 3TZBA 2VF8A 4EYEA 2EG5A 5CB4F 5K5EA 3ADCA 4NYIR 2VT6A 3I9V1 1HH4A 1NTRA 3WKAA 1JHVA 5DYTA 4PSCA 1Q1QA 2IYOA 2WICA 3FNBA 1PD0A 5EEHA 4Y9TA 5HHTA 1M5UA 3AUFA 3OLWA 4L2IB 3RLFA 1LNQA 4PINA 1ECFA 5FBLB 3HBNA 2JLYA 4NG5A 1FY2A 1F8GA 3U19A 2BFFA 1D2EA 3VKWA 1YRAA 2RGDA 4FN4A 3HR8A 2CL7X 2CXUA 2Q46A 2VF5X 5H7XA 2QP3A 3IBGA 4CMHA 4YT4A 1R5NA 4ZJYA 4QDUA 1G5TA 5ESXA 2NTYC 1FEZA 3HDJA 1RKVA 2ZSDA 2PGDA 2JJ2D 2RSLA 5HP4A 2FA9A 2B8JA 2G0TA 3QHQA 3EXHC 1MX9A 3T7TA 1OIVA 2QGZA 5LBIA 1GFIA 1T34A 2PS0A 4QXAA 1AGRA 3R5TA 4BGDA 3A06A 3CCCA 4X00A 1EFTA 1I4LD 1JNXX 4W5HA 4DIMA 3NGXA 4NE2A 5H3LA 3ZE2B 3VU0A 5HF6A 2QW0X 2PMKA 4G0YA 4CODB 2QRKA 3EGWA 4ZOAA 1R2QA 4UCFA 3PF8A 2OBMA 5TS2A 2AYZA 3QA9A 4DLKA 5B3KA 4WKBA 1QFZA 3T95A 4BCCA 1FX1A 1ACJA 2CHQA 4XYMA 5K0ZA 3L0OA 4LC0A 2CBZA 3EMVA 4Z99A 2EHJA 3EF3A 3KZMA 2JEOA 1Z15A 2JFWA 1U9JA 4LSGA 2OB2A 1XDWA 4LXUA 5FPTA 4MUKA 1RQXA 1F1JA 1P9RA 2VG8A 3LHDA 1CRWG 1RTTA 1ZOPA 4CF3A 4ZVOA 3KLMX 2O1XA 2NP7A 4O4LA 2HK6A 1ZO8A 3CRVA 3DYBA 3GA0A 3T0FA 5FWNA 1Z8FA 3L9WA 1YUNA 1L4UA 2ACVA 1E3QA 4HNRA 2ZIUB 4IHJA 1N2HA 1V4BA 3JYOA 3R7AA 5J2TB 1EZ4A 1Y4SA 4GLBA 4P33A 3LUFA 4ZT5A 3URMA 1T8TA 4ERXA 1TRHA 4BJ5A 5AW2A 4I08A 4MV6A 1SG0A 5T7BA 4ZIRA 4QXRA 3D4LA 1HEYA 3O5AA 1ZD5A 4UVEA 4KAJA 2C03A 4R1UA 5IU6A 2XX3A 3L8DA 5H59A 1IBSA 2VKTA 3C6MA 1J8VA 3HV0A 4FR0A 5M2QA 1LVHA 1U2QA 1GTZA 4YACA 5CYFA 5IDXA 4LN1A 3R9XA 4GLFA 1C0LA 3E61A 4LZJA 1YULA 4P4SB 1PL7A 4U9UA 3VR1A 1HT0A 4DCMA 3P0EA 1FFWA 2NQ2C 2P2ZA 4RCVA 1TJYA 2UZ1B 5ILOA 4CM4B 4TTPA 2QEQA 1FUYB 1YQEA 1C3VA 3E35A 3HSSA 2BEJA 4M0CA 2CT8A 3RAGA 2VNKA 1KMHB 4AICA 1DWOA 1GRQA 1NX9A 2HRDA 4NWIA 1KBZA 3FHLA 3FPFA 4UBLA 4XW2A 3U31A 2X4IA 4XPIA 4DA6A 1EFKA 2QX6A 1MGOA 2G6TA 4LE1A 1X7XB 5J9FA 3VR6H 1NUQA 4ZO4A 5IJ0A 1ZLYA 2RHTA 3IB3A 3QI7A 3WMRA 5IFLA 1SD1A 1DJLA 2QZ4A 3LK7A 1XRRA 1YB4A 1E4YA 2OGUA 5AK5A 3QFRA 5DX8A 3WC4A 5T6MA 5BUQA 3LOQA 2YHUA 1EB9A 1V96A 2O0LA 2QR3A 3C3CA 3SP1A 5ICSA 3DEHA 1SCQA 3B60A 3OCVA 3SIWA 5CFQA 4LJRA 2BE7A 4IFTA 2WG0A 3SMQA 4L9SA 1QC5B 2D4HA 2HLHA 2GPTA 3LQQA 4KZPA 5LJIA 4H6VA 3IALA 4CQMA 1RBMA 1E1LA 4I66A 1IN7A 2BT4A 2I55A 2QXYA 4M9SA 5H02A 1XVTA 5HF9A 4C6HA 2AW5A 3HU1A 2M9MA 2Z3ZA 4RXTA 5KOIA 5THQA 2FW8A 3GJZA 4Q9NA 4QOHA 4AKTA 1A76A 1Z5NA 1VHWA 1VHTA 4IFIA 2O8CA 2Z43A 5LQAA 4OMDA 4X54A 3F1KA 4K6OA 3DKKA 3IIKA 1DJNA 4M37A 4QUGA 2ADOA 1U63A 4YRTA 1KP9A 4Q18A 3OLXA 4E5YA 4U3JA 4V03A 2V7VA 1NBIA 3MK31 3ITEA 3OCXA 3FLMA 1UBHS 4LJYA 2C3YA 1E8DA 4NNOA 2GS9A 1JFRA 2D5CA 3B2NA 3VRHA 3Q3HA 1XTRA 1M54A 5BVGA 2WUGA 2PANA 3LUDA 3A1WA 4LQCA 4MRMA 4D9EA 3IXLA 3DOUA 2D0IA 3WLJA 4WZBA 4MRSA 5EYPB 2YZKA 2POCA 5I8WA 3H1GA 2JFVA 2R3SA 3PX2A 2KWIA 1H3EA 1T4CA 4RGVA 5EE9A 1VMEA 2BEVA 1J2EA 4QGFA 2VH1A 3VU9A 1Q16A 3BHJA 1TF7A 4R1NA 4CM1A 2GBFA 4HADA 5B7GA 5KYUB 4II3A 4V39A 3TBFA 3FLAA 4R9RA 3WS7A 5L7WA 1NBEA 4EYKA 2EJVA 1DPFA 3LYUA 4M1KA 1UKCA 2AW3A 2XLBA 4RHXA 1RKBA 5DK6A 3TOXA 1V6CA 4DLVA 1BYIA 2G40A 4XX1A 4E6PA 5JARA 1SKMA 1AHNA 2C3PA 2R1UA 1QK3A 2ODTX 3B2QA 3HVHA 3IXQA 4YCAA 4G0XA 3OVMA 5ANRB 3C3BA 4DIDA 2XNSA 2R6ZA 3G9XA 3NDPA 3RUPA 3W5IA 5HKKD 4HDSA 1KPHA 5TGDA 3RJTA 3VH3A 3R1IA 4AYWA 4EJSC 2VYCA 4NU0A 5L53A 4JV5B 2QRJA 2O14A 2BTQB 2FK8A 4PBSA 7YASA 5BQ5A 1NQAO 1B0AA 1HEIA 4R4JA 4I50A 5CA0B 2XAAA 5H4HA 4LK3A 4QARA 3VDMA 3NANA 5TC4A 3LHKA 2PKQO 1XZCA 3LCRA 3JRXA 4M1SA 1WXXA 4XLZA 2YJTD 1TMGE 2QMHA 4E7OA 4FD2A 5C7OO 4Q7KA 1H2WA 2VUIB 3BXXA 1YCFA 3LZDA 4X85A 4AS2A 5HW0A 4W5TA 3AF6A 2L2QA 4Z4EA 1UPFA 4OHFA 3ZIAD 1W4ZA 2N1MA 2WZQA 3G0OA 1LRLA 1RHJA 3WWEA 4OHMA 1KFBB 1BG6A 4IICA 2R6JA 1I6MA 1WXFA 3HRIA 4JUBA 3BGVA 2F3PA 5G3ZA 3TMKA 4AXXA 5IJ9A 3ELBA 3HEBA 1ZSNA 4Q1VA 4I81A 5JZ9A 3IT0A 4MQBA 4WJLA 3MWYW 3OQ1A 4JWTA 3F4BA 3FVRA 5F2KA 1XTIA 1Z6ZA 4ISBA 3TAHA 1BEZA 2FKNA 4PGHA 3LPCA 1CZUA 4MMXB 4M53A 1V8ZA 2WV7A 3ESCA 3IDOA 3H2JA 3TRDA 1G0NA 1MOPA 2HTFA 3I2KA 5EWMA 1UZMA 1PNRA 1JHPA 1BXKA 1FIUA 4PBTA 2ZIZA 1N3LA 1M74A 3C48A 3K4PA 2JK1A 2G9UA 1CR2A 3NDRA 3Q5EA 5TPZD 4J0FA 2B83A 3HCRA 3RJMA 2X2EA 5DHQA 3LT2A 4U0JA 3IVXA 3MGGA 1B16A 2ZSEA 1T9DA 1X0VA 4GI2A 4ZEXA 1VG8A 4WERA 4O08A 1WNTA 2XNHA 3E3OA 2IKSA 1CP2A 2ZIXB 4FOLA 5ITSA 3A6PC 2OZKA 1U2ZA 3DEZA 1T1JA 1E8MA 1Z36A 3X2SA 6PFKA 1YS7A 2Z2IA 4MPPA 3FGPA 3VR3D 5D1NA 5L6LB 5JAPA 1DC7A 3SD7A 2CD9A 5KI6A 5LN1A 4GW3A 3PL5A 3SXUA 2DWOA 2OYRA 5HZHA 4LF4B 3NXKA 2UXBB 1XLWA 5GVRA 3TFOA 1GA6A 1W2HA 1XZAA 2Q4EA 5J4VA 5D2CA 1HDCA 3KS9A 1K8XB 1NBHA 3LC1O 3OU2A 4MWEA 5IC5A 4IIJB 1PJAA 1SC1A 1PFKA 1E3WA 1Q50A 1JDVA 2NSLA 3FFXA 1QR6A 3G7UA 1WBDA 4HI0E 1ZOOA 3ECCA 4DNQA 3WMWA 1J24A 1D6SA 1G5IA 2I4LA 4RK0A 5IT4A 1YD7A 2NSYA 4RK4A 1KNXA 4D42A 4UE2A 2JLAA 4GMFA 2NZXA 1Y34E 3PE6A 4XTRA 1ZWKA 3A7DA 3UAOA 2Z5FA 2ECOA 3DD1A 4UMVA 4MRAA 1WJGA 1MV8A 5KKNB 3PX7A 3BICA 3CNNA 3BFPA 3GB9A 3BSYA 3U16A 3QKWA 1VL5A 3S55A 1IVSA 1UOQA 1HO3A 4HV4A 3AM5A 1GYQA 3I9LA 1XCLA 1U94A 2YXPX 4BPBA 5B3JA 1O6BA 4B32A 1C4OA 1KEPA 5FH9A 3H5VA 1J9GA 5LZ5A 3DOOA 5JVDF 4KRFA 2VYFA 1CV2A 2P68A 2EYQA 2FCAA 1ISJA 2E5FA 1P0CA 3VPBA 4X92A 4KH0A 4KYIB 5KDOA 2AEMA 4A0GA 1E96A 1BWRA 3HCCA 4CDMA 2CNOA 1OX6A 4NBNA 2RKBA 2WAOA 4QO8A 5AJWA 4HDMA 2NUPB 1XPUA 5DBGA 3AY7A 4Y6SA 2YJGA 1W5AA 3OZVA 5HS4A 2GESA 4L4UA 4ZVSA 3WWYA 1DJMA 2YOHA 1S2MA 4IZ6A 1QG2A 1UFVA 2GRUA 3A0UA 4M0DA 3J7TA 3SHTA 3UTDA 1LPMA 1GAXA 3MUFA 1Q7EA 4PICA 1H3FA 3PNLA 4MGEA 1IEXA 4LDRA 1SWWA 5PNTA 2GJSA 1H0HA 4JBYA 3A4MA 1FRQA 3B6KA 4PAMA 3W8RA 2DT8A 2RGAA 2HF9A 3S0JA 3VYUB 1X38A 4RA6B 1HLGA 5DCYA 2XOEA 1T25A 3ED5A 1U99A 5KX5B 1JHUA 2EAUA 3KJQA 2IYAA 1EE2A 4NAVA 4XVHA 3PXGA 3QNWA 1ULHA 4PQEA 4FW8A 5DF1A 1AK9A 4II2A 1CFZA 2W6JA 2WC1A 3GMIA 5ARBA 3ZJVA 2FW6A 1KTVA 1NW9B 1ZXBA 2XDQB 2X1LA 3C87A 4MR8B 5C5CA 3DS8A 4YCSA 3R3WA 2VWGA 4U39A 3QLTA 1OBFO 1MB9A 2UYGA 1J09A 1N9ZA 4BTEA 1E1QD 3HO6A 3OY2A 2RB5A 3JWPA 1EQAA 4X0EA 4XDYA 4PQYA 1TYEB 4JGGA 3O8DA 4WPGA 3H6HA 2I6QA 2J9FA 4KXQA 3TUZC 4YO7A 2CJXA 1GCAA 3D3KA 5LQMA 5EWJA 4COKA 4N3AA 4NBLA 3HCPA 4CM6A 2G08A 3KQYA 3DR3A 2IHJA 1EB8A 1V39A 7ABPA 2IEAA 4HAVA 1YTLA 2P62A 3EJWA 4NENA 2C8VA 5EL0A 5G3YA 3SIRA 3ADOA 5TLSA 3I72A 2BFWA 1IY9A 2FOXA 4WLEA 2AJTA 4Y0NA 5K45A 1FXSA 4NH0A 3PWKA 4DJAA 1N1GA 1SU8A 1DELA 5JPCA 5AI6A 3S2IA 2YJNA 1JG6A 3BZBA 1Z13A 1T1EA 4Q00A 4M0KA 4F2GA 2C5BA 3QOFA 2YWXA 4BQQA 1ONSA 3ZTWA 1ZD2P 3VFDA 3MT7A 1YJ8A 3QF4B 4GP7A 2NMVA 5FD8A 5K6AC 1QK4A 5L40A 5FTNA 4Q4JA 5CUQA 4AG6A 1AZTA 1SIOA 3VU1A 3IERA 1MP0A 4NFSA 3PG5A 1EDDA 2AG1A 1KI4A 3L6UA 1QNLA 3VZSA 4AMUA 4IJUA 4JENA 2FFBA 3H8SA 2JD0A 2JGLA 1JDJA 3DWEX 3NHMA 1VLZA 2OBXA 4BO2A 4ALMA 3E22A 1NXTA 3F98A 3OUUA 2HJGA 4GU5A 5KSPA 4DDHA 4EDFA 4CIVA 3R24A 1GV0A 1B4DA 3NHSA 2ZFUA 4RA6A 4GL2A 2O6LA 1V9LA 3FVVA 1VIDA 1D6JA 1ZJ6A 2NAFA 1CF9A 2PT9A 2QVZX 4RENA 5KHAA 1UXKA 1H22A 1XF1A 3QEMA 4JDUA 3V1NA 4BE7B 1KEEA 2QD5A 4G0PA 3D64A 3RAJA 4K1XA 1OB5A 1ZG3A 2NTVA 5CXUA 2FG5A 3FAKA 1C2TA 2O20A 3G8AA 1AKTA 4MYCA 2WMDA 1PUXA 3NHBA 2EFDB 4GNRA 1CNFA 1YC2A 2DKOA 2LE0A 3S1LA 3GEGA 3ZW9A 2PRJA 2WABA 2EX4A 2WFMA 4M9RA 2ZIXA 4RO0A 5AUPB 3GJ0A 3FWPA 1HKUA 2A94A 1L5LA 2CFTA 4RTPA 4OO3A 2G5CA 2QQGA 1BWQA 5DM4A 2RC5A 2EV9A 4ZMBA 3H1AA 3FGOA 5JAMA 3D0RA 1G5QA 1F0PA 2WLSA 2XVMA 3LFUA 3PC6A 4ANFA 5ECWA 2XUFA 2PAFA 3TFWA 3IKTA 3GJ8A 1D09A 5AOAA 2BR5A 2ZXFA 3UWMA 4HNAB 2BD0A 5HMLA 3GDWA 1WZUA 1CHDA 1JSLA 3B3QA 3ESRA 4K9QA 3WA6A 5BVHA 4EO9A 1F2TB 2ZGVA 1FBTA 5ICEA 2JD2A 4ACBA 4YPVA 3W3ZB 3BWDD 4LHZA 4UXJA 3A27A 3MTIA 5EMJA 5ALWA 4YJ3B 4JBHA 4YLGA 1WZIA 2EC5A 4OK6A 4A23A 5EJ5A 1DIHA 3OTWA 5ALHA 2HMWA 2W90A 1OQAA 3KU1A 4XM0A 3H11B 4B40A 2PWAA 2AC7A 1S4QA 3PUIA 4FK8A 3DP7A 4RNCA 1O5IA 3HXKA 2R1VA 3AU8A 4LXXA 3P5BA 3KYIB 5FBHA 3VOBA 2Q0HA 1CQIB 4HYYA 4KHZA 4OHKA 4AY6A 5JS2A 1U8AA 6LDHA 4B84A 1NUUA 4RPHA 2JFXA 3FHJA 5D51S 2BV3A 1L5QA 3QX9A 2EBFX 2EFCB 1QFSA