3AQ7A

Crystal structure of truncated hemoglobin from tetrahymena pyriformis, y25f mutant, fe(iii) form
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
117
structure length
117
Chain Sequence
QTIYEKLGGENAMKAAVPLFFKKVLADERVKHFFKNTDMDHQTKQQTDFLTMLLGGPNHYKGKNMTEAHKGMNLQNLHFDAIIENLAATLKELGVTDAVINEAAKVIEHTRKDMLGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A hydrogen-bonding network formed by the B10-E7-E11 residues of a truncated hemoglobin from Tetrahymena pyriformis is critical for stability of bound oxygen and nitric oxide detoxification.
pubmed doi rcsb
source organism Tetrahymena pyriformis
molecule tags Oxygen binding
molecule keywords Group 1 truncated hemoglobin
total genus 44
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01152 Bac_globin Bacterial-like globin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.490.10 Mainly Alpha Orthogonal Bundle Globin-like Globins 3aq7A00
2VLXA 3A59A 1RVWA 4FWXA 1Y0DA 2DHBB 4O2GA 2GL3A 5CNGA 2QSSA 1WMUB 1MBAA 3OK5A 2NRLA 3D17B 1QSHA 3M3BA 2LH1A 4ROMB 1DM1A 1OUTB 2MHBB 3NMMA 3UI0A 1SWMA 4YU4B 1Y22B 112MA 4M4AA 1Y5KB 2RI4A 3SDNA 2NX0A 3BA2A 1PMBA 1Y4GB 3NG6B 1BZZA 4UURA 1YEVA 1KR7A 3DHRA 1DWSA 1J40A 1HDBA 1Y5JA 2D2ND 2Z6TA 1HGBB 1YOIA 1FAWB 1A9WA 2GKMA 2OH9A 4U8UB 1MBDA 1C40A 1V07A 3H58A 4F6BA 1J3YB 2QFKA 2D2MC 1MLGA 2MYCA 1S5YA 4IROA 2W6YA 1NZ2A 1XZ2B 1YHEB 1G09A 2D5XB 4L7YA 4HSWA 2D5XA 1S6AA 1G09B 4LPIA 1Y7CA 1LFVB 4NXAA 1YEUA 1J3YA 5CN4A 2FALA 1JZLA 4NK2A 4MQCB 3AQ6A 1Y35A 1HDSB 2XYKA 2GNVA 1HGBA 4PQBA 102MA 1HDBB 2HHDB 2XKGA 1Y4QA 1MYGA 3GQPB 1OJ6A 1YENB 1BZZB 3NG6A 1Y4GA 1MNKA 2LH6A 2QSPA 2D2MA 3PIAA 4M4AB 4M4BB 2G11A 1Y22A 1BABA 4YU4A 3WCUB 3NMMB 3W4UB 1Y4RB 101MA 3ZOLA 1FLPA 1RSEA 2MHBA 1JZKA 3ARKA 1FSXA 3WCTA 1CQXA 1DKEA 4UZVA 1NQPB 3D17A 1YHRA 3AT6B 1O16A 1JY7B 1HACA 2DHBA 5F0BA 1O1LA 1RVWB 4MXLA 3VREB 5AZQA 4HRTA 1K1KB 2RAOA 2FAMA 3MBAA 1JW8A 1GBUB 2MYEA 2EB9A 1DLWA 4ROLB 2V1JA 1S0HB 4NK1A 1Y8IA 1X9FB 2OLPA 3CIUB 1QXDA 1S5XB 2MGGA 2BMMA 3HF4B 1CBLA 1FSLA 3PI8B 2O5SX 1BIJB 1JP6A 1CLSB 1BUWB 3D1KB 1Y4VA 1M9PB 2HCOB 1Y46A 2HBSA 1Y8IB 3UH6A 4AVDA 3O89A 1S0HA 2PEGA 1Y85A 3ZJLA 5CN7A 1O1JA 1C7DA 3ONZB 1URVA 1B0BA 4HRTB 1JPBA 3IXFA 1CG8B 4O35A 3VREA 1LFQB 1DXCA 5CNEA 1W92A 1YCBA 1HV4B 1HACB 1JY7A 1F5PA 4FH6A 1YHRB 5KDQA 1WLAA 4FC3B 1C7CA 4O4ZA 3SDHA 1FSXB 3WCTB 1FHJA 5CN8A 4ZVBA 1Y4RA 3W4UA 3ECXA 3D7OA 1PBXA 1EWAA 3GQGB 2G12A 3BCQB 3PIAB 1YG5B 2D2MB 2SPOA 2HBDB 3ARLA 1O1IA 1Y0WB 1IOPA 3BOMB 1V9QA 3QMAA 1XZ5A 3VRFA 1LH6A 2VYWA 1VRFA 2IN4A 5CN5A 3MVCA 1Y09A 1O1NB 3QQRA 3UHNA 1RQ3B 1J52A 2ZSOA 3S1IA 1Y35B 1CO8A 1XY0B 2ZLXB 3GKVB 4MQKA 1XXTA 1LFTB 5C6EA 3ORDA 3AQ7A 3NL7A 1JDOA 1LFVA 2R50A 1Y7CB 1NZ4A 4F6GA 3WCWB 4L7YB 2G10A 1MKOB 1M6MA 3WTGB 107MA 3QJBB 3HYUB 2HZ3A 1THBA 1HLMA 3DR9A 1GDKA 3WFXA 110MA 3PI9A 1FAWA 2MGJA 1N9IA 2GNWA 2O5BX 3QJBA 4QAUA 1S61A 1Y5JB 2ZS1B 1YOGA 3DHRB 1L2KA 3NL7B 2D2NB 1Y4PA 1LFTA 2ZLVA 1CH4A 4H07A 1LH1A 4GZGA 1A01A 3ZH0A 1O1NA 1CIOA 1CH1A 3PT7B 1Y4BB 5CNCA 1MYMA 1NS9A 1DUOA 4ROMA 2H35A 1RTEA 1Y8HB 3QM7A 3VRFB 3M38A 1JF3A 4DWUA 3BOMA 1AJGA 2H8FA 7HBIA 1J7SA 1IRDB 3ZHWA 2LH5A 3BCQA 1DWRA 1HBSB 1Y0DB 2V1GA 4TWUA 3S65A 2NSSA 4H2LB 1Y45B 3AT5B 1ECDA 1HBGA 1FHJB 5KKKA 1LJWB 1MDNA 3HC9A 1OUUB 1FN3A 3UHBA 5EQMA 1MLFA 1MOCA 1BBBA 1Y7DA 4X0LB 1YZIB 1MTKA 3KMFC 4N7PA 2G0VA 4B3WA 4C0NA 3A0GB 1NAZA 3EDAA 1Y8WA 4G51A 3ZJMA 2GRHA 1YDZA 3HRWB 1G0BB 1O1KB 2HHBB 1O1JB 4NXCA 2H8DB 2PEGB 4MQHA 3QM9A 3OVUC 1ABYB 3QZXA 5SW7A 1Y46B 2HBSB 1M9PA 2HCOA 3ZJIA 1AJHA 1Y4VB 3AQ8A 1HBAA 1CLSA 3D1KA 5ILMA 1CG5B 1CP5A 2AUQA 2E2YA 3WR1B 1COHB 1H1XA 1R1YB 4F4OB 2VHBA 3PI1A 1D8UA 2ZFBA 3CY5A 1LFZB 4MQGA 3UHSA 1QXDB 3UHHA 1XCHA 4YU3B 3WCVA 1A3OB 1YIEB 2B7HB 2MGKA 4ESAB 5MBAA 1FCSA 2AV0A 3A5AA 3WCPA 1GCVA 3D1AA 1Y7GA 1GBUA 1GDIA 3DUTA 1A0UB 5B84A 2YRSB 1K1KA 2HBFB 1QSIB 2AUPA 1MYZA 1Z8UB 3MYMA 1XQ5A 1YEOB 3UH5A 1AZIA 1NQPA 3B75A 4F68A 3BJ3A 1DKEB 2MYDA 2ZS1C 2VYZA 1BABB 3S1JA 1A3NA 106MA 1A00B 4KJTA 4M4BA 4MXKA 5EUIB 2QSPB 3FS4B 5ILEA 2VEEA 1QXEA 1QPWA 1YENA 1Y7ZB 2ZFOC 3K8BA 3GQPA 2BNLA 1HABB 4N7OB 109MA 1Y4QB 1RPSA 4OODA 3A2GA 2MGBA 3GOUB 1K0YA 1DXUB 2GKNA 4MQCA 2D60B 1EBTA 1VXFA 3RJ6A 1CO9A 1YEUB 5HY8B 5E29B 1VXBA 1M6CA 2GDMA 1BJEA 4PQ6A 1YHEA 3WCVC 2FRIX 1C7BB 2W6WA 4IROB 3IC0A 1B86B 1C40B 2R4YA 5ILPA 2C0KA 2V1KA 1HGAA 2ZFOA 2G0ZA 2XKHA 4NI0B 1A0ZA 1A9WE 3VAUA 2ZSPA 1V75A 1XZ7B 1MYJA 1MLMA 1J40B 1YGFB 1IBEA 4XS0B 5JDOD 2D2MD 3LB1A 4VHBA 1Y4FA 2VRYA 3K9ZA 1Y5KA 2G14A 2RI4B 3ZJQA 1MODA 1SDLA 1LH7A 5KERB 5EU2A 2W72C 1CQ2A 1YVTB 1IRCA 1J41B 1MYHA 1JZMA 1MOAA 1QSHB 3ZJPA 5B85A 1NWIA 3UHYA 3QJCA 2QSSB 1HRMA 1YE2B 1BVDA 2Z6NB 3PI2A 1MYFA 1LFLA 1N9HA 2G3HA 2ZT0A 1AJ9A 3OJ1A 3TM3A 3EU1A 3G46A 1MWDA 3QJDB 4MBAA 3NFEA 1KD2A 1T1NA 2R4ZA 3WFTA 1Y2ZB 3BJ1A 2M6ZA 3QJEA 4MPMA 2GTLA 1CMYB 1SPGA 2HBEA 1RQAA 3WCWD 1A4FA 1G0AA 1UIWB 1Y0CA 2KSCA 6HBWA 1QI8B 1R1XA 3V2VA 3ZJOA 2DN1B 1O1MA 1FDHA 3E55A 1V4XB 1V4WB 104MA 1CH7A 1DLYA 1VWTA 2ZLWA 1JP9A 1YFFB 3R0GA 1LFYA 1IWHA 1VREA 3KUNA 2MB5A 5ILRA 4ILZA 2MGHA 1MNOA 3VRGA 2W72A 5CN9A 1NEJA 1MGNA 3A9MA 4F6FA 3HHBB 3OGBA 3G4YA 4MU5A 4HHBA 1JWNA 3IC2A 1GJNA 1MCYA 2GLNA 1HDAA 2FRJX 2MYAA 1LH3A 3S66A 3E5OA 1BZ0B 3ODQA 2DN3A 4TWVA 2SPLA 1HCOA 1HHOB 1G9VB 1YEQB 1CH2A 3WCUC 1ABWA 3WHMA 1HGCB 2ZS0A 5EV5A 2R4WA 1JL7A 2ZSZA 1VXCA 3ECZA 2DN2A 3P5QA 2GTLC 2MGEA 1YH9A 2ZS0D 2G0SA 2MGCA 2SPMA 2D5ZA 1YE0B 1J3ZB 3OO4B 5JDOF 3LB4A 4MQIB 3PT8B 3G4QA 1BZ1A 1YE0A 4WCHD 2D5ZB 2QMBB 3OO5A 1OFJA 3EOKA 3UHRA 3UHEA 1NIHB 1A6KA 2ZLTA 4KMWA 1IT2A 1Y0AA 3P5QB 1Y31A 1Y01B 2DN2B 2R80B 1MYIA 4UIQA 2LHBA 3ZOMA 3G4RA 1G9VA 1HHOA 3QZZA 2ZS0C 3OZUA 4IT8A 3MJUB 4N7NA 1XZVB 1OFKA 5E83A 3PI3A 1N9FA 2Z6SA 1JEBA 1LH5A 1HBHB 3S66B 1LA6A 2PGHA 2ZT4A 3DHTA 4HRRB 1XZ4B 3IC2B 2ZLUB 1YGDB 3HHBA 3GYSB 3UHGA 5C6YA 1NS6B 3MKBA 1GVHA 2QLSB 2O58X 1BINA 5AB8A 1DXTB 1EBCA 3ZJJA 1J7WA 1RQ4B 4B4YA 2MGFA 1HBRA 2LH3A 2W6VA 3UHVA 5CNFA 2VEBA 2OIFA 3K3UA 1V4UA 4XDIA 1VWTB 2ZLWB 2HBCB 1UX8A 4MQJA 3UGYA 1YHUB 4WJGA 3UH3A 4N8TB 3WI8A 1JP8A 1GCWB 3GDJB 1O1MB 1R1XB 4HBIA 1UX9A 1QI8A 4NI1B 1UFPA 1YOHA 1Y0CB 2QU0A 1IT3A 1SPGB 3V2ZA 5D1VA 1O1OA 2QRWA 3MJPB 1SI4B 3LHBA 3UHUA 3QJDA 1XZUA 3RGKA 3PELA 1BZRA 3EU1B 2BLJM 2VLYA 1MLNA 5CN6A 5EETA 3SZKB 5CMVA 1LFLB 4NS2A 3UBVA 4F69A 1GLIA 1YE2A 2O5TX 2AA1A 4NZIA 4FH7A 3QJCB 1UMOA 5JGGA 2BW9M 1UVXA 2HHEB 2ZFOD 3A5GA 2NRMA 4N8TA 1VHBA 1GBVB 1YVTA 3LB3A 2MGAA 5KERA 2HBCA 1URYA 1SDLB 5M3SA 2MYBA 1YVQA 1FDHG 2R1HA 4F6DA 4F6IA 3BJ2A 3UHWA 4WJG1 108MA 3ZJHA 3ECLA 4ODCA 1RQ4A 1UT0A 4XS0A 2DXMB 1DXTA 2QLSA 1WVPA 1HLBA 2O5LX 1V75B 1DWTA 1IDRA 3GYSA 1A0ZB 2ZSTA 1S56A 2Z85A 3UHDA 1OR4A 1XZ4A 2ZFOB 1Y83B 1Y8KB 4FWZA 3GQRA 1YIHA 1MOHA 1A6GA 1B86A 1SHRA 1O1PA 1MLHA 1NZ3A 3ZJSA 5E29A 1EMYA 1UC3A 3D4XB 2R80A 2ZSXA 1Y31B 1KFRA 1YMCA 1ITHA 1NIHA 3G53A 3WFWA 3QM5A 3WFUA 1DTIA 1LTWA 1RPSB 3H57A 1UVYA 4C44A 3IA3B 4MQIA 1O1PB 3LB2A 4DC7A 2MGMA 1Y0TA 1NGKA 3UHXA 1YH9B 1Y83A 1OBMA 1DXVA 1HBIA 4KMVA 4JYQA 2DC3A 2DXMA 1Y5FB 1YCAA 3LR7A 3R5IB 3BJ3B 4ODCB 1HBBA 3ODQB 1XQ5B 2W31A 2BK9A 1ECAA 5D5RA 3BJ2B 3FH9A 1YVQB 1QSIA 2ZSRA 1N9XA 1MLRA 2YRSA 2NSRA 1Y7GB 1GCVB 3D1AB 1GBVA 4FWYA 5EE4D 1MBIA 5HU6B 1DXDA 5JGGB 1A3OA 1YIEA 1YMAA 2AA1B 1GLIB 1IWHB 3G52A 4F4OA 1ECOA 2LH2A 1CG5A 3PELB 5SW7B 5E6EB 1V4WA 1ABYA 2HZ2A 3HEPA 3UHCA 2ZT1A 2HHBA 3HXNA 5HLXA 1YDZB 3MJPA 1O1OB 2LH7A 5CNDA 3A0GA 3ED9A 3GK9A 4AVEA 1NWNA 111MA 2V1HA 5EYSA 1DO3A 2FRKX 4NI1A 3HXNB 2M6ZB 2AV3A 1FN3B 2R4XA 3BJ1B 3A5BA 3GDJA 1OUUA 4DC8A 2BKMA 3NFEB 1A6MA 5E6EA 2ZWJA 3ZJNA 3HENA 1YHUA 3UHQA 3MN0A 4MQJB 3UHKA 4H2LA 1MLQA 1MLOA 2Z6NA 1J7SB 1VXAA 3EDBA 2W6VB 1ECNA 1HBRB 5HU6A 1U7SA 2O5MX 1Y8HA 1J7WB 1TU9A 2H35B 2MGLA 1NS9B 3MKBB 2EKUA 1Y4BA 1NS6A 1CPWA 2ZSYA 3HEOA 3NMLA 3FH9B 2V1FA 1MBCA 2PGHB 1LA6B 1Y4PB 1JL6A 1HBHA 1CH3A 2D2NA 1JEBB 3G4UA 1HBBB 1MNJA 1XZVA 3R5IA 3ZJRA 1Y5FA 1MNHA 1YGFA 2ZS1A 3AG0A 2HBGA 4NI0A 1BZPA 3M3AA 1VXDA 1DXVB 1BVCA 1Y0AB 1HGAB 1NXFA 2GRZA 3PI9B 1F63A 2ZLTB 1DO1A 1F5OA 1THBB 2QMBA 3AQ5A 3OO5B 3HYUA 1Y0TB 3IC0B 3ARJA 3WTGA 1BZ1B 1C7BA 2ZSSA 1MLJA 2BLIA 1J3ZA 1BZ6A 2VLZA 1XXTB 1J3FA 4PNJA 1LHTA 3G4VA 4MQKB 1GDJA 3WCTC 1MBSA 3D4XA 1DXUA 1ASHA 3GOUA 1Y09B 5AZRA 1MTIA 1HCOB 1HABA 2DN3B 3K8BB 3KMFA 1OR6A 1Y7ZA 1SHRB 2OHAA 1BZ0A 1X9FD 1DO7A 4DWTA 2MBWA 3QM8A 1Y0WA 1YIHB 3GQRB 3FS4A 2VYYA 2FRFA 1Y8KA 5EUIA 3WCTD 5CHRA 1A00A 4HHBB 1PBXB 2MGDA 1A3NB 4F6JA 2O5QX 2JHOA 4JACA 1CBMA 2EKTA 1LH2A 3OZVA 1YHUC 1MWBA 3UHTA 2EVKA 2G0RA 2R1HB 1LFQA 1YFFA 2ZS1D 3DUTB 5HLUA 1C7DB 3RJNB 3GLNA 1H97A 1Y85B 2HHEA 6HBIA 2B7HA 4ESAA 2DN1A 4YU3A 3O7NA 3QM6A 1LFZA 4MQGB 5HBIA 5JDOC 2ZFBB 3CY5B 1G0AB 2BLHA 1A4FB 1BUWA 3UGZA 1A6NA 3WR1A 2HBEB 5JDOE 3UHZA 1CMYA 3SZKA 2GTLB 2WTHA 3HF4A 2V1EA 4KN3A 1XZUB 3CIUA 2V1IA 1Y2ZA 1T1NB 1KD2B 1MBOA 4H0BA 1G0BA 1O1KA 3HRWA 1SI4A 3UBCA 1CH9A 3E5IA 1I3EA 5HAVA 5EOHA 3LR9A 2QFNA 2OH8A 3QQQA 2AURA 1O1LB 2QU0B 1YZIA 2CMMA 1BBBB 1Y7DB 3M39A 105MA 3WCWC 3AT6A 1HJTA 1GCWA 3WCUD 4HSXA 2WTGA 1LJWA 1U7RA 2WY4A 3TLDA 3G4WA 1J41A 3PI4A 1LHSA 3WCUA 1Y45A 1X46A 3S65B 4MBNA 1V4UB 1HBSA 1MWCA 1RTXA 1IRDA 2SPNA 2H8FB 2IG3A 1Y4FB 2ZSQA 2D6CA 1EW6A 4ZVAA 3KUOA 1VXGA 2ZT2A 1IBEB 2HHDA 4O4TA 4PQCA 3GKTA 1MNIA 1XZ7A 3PT7A 5HLQA 103MA 1YGDA 1HDSA 2ZLUA 1A01B 1NPFA 5CNBA 2ZT3A 4HRRA 3DHTB 4BJAA 2ZLVB 1DUKA 5E83B 3MJUA 4N7NB 1X9FC 1XZ2A 1S5YB 4U8UD 1DTMA 5HY8A 2Z8AA 1DO4A 3MYNA 2XKIA 1V5HA 2D60A 4OF9A 3EOKB 1VXHA 4U8UA 1MLUA 1CIKA 1K0YB 2GTLD 3ASEA 1MKOA 4MAXA 1YHUD 3PT8A 5EE4C 3WCWA 3TM9A 4N7OA 1YEVB 3OO4A 1NPGA 1X3KA 5C6EB 1QPWB 2BWHA 1QXEB 3GKVA 1HSYA 2ZLXA 1XY0A 2D2NC 1MBNA 2EVPA 1RQ3A 2ZS0B 1HGCA 3WHMB 1ABSA 1ABWB 1YMBA 1OUTA 1YEQA 1TESA 5MBNA 3B75B 4SDHA 1YEOA 1XZ5B 1LUEA 2W6XA 3UH7A 1WMUA 1O1IB 1HDAB 5F2AA 2HBDA 2MGIA 1YG5A 2GRFA 2ZSNA 3A59B 3GQGA 3D7OB 2HBFA 2EF2A 5JOMA 1A0UA 2O5OX 1C7CB 3WCPB 1MOBA 1NEJB 2OHBA 3U3EA 2VM0A 1NZ5A 3AQ9A 1CP0A 4FC3A 2W72B 1GZXB 1SDKB 3VRGB 5EYJA 3OZWA 3WCVB 5KDQB 1CH5A 1MLSA 1XYEA 3LQDA 3S48C 5CHQA 1MZ0A 1HV4A 1LFYB 1R1YA 1J7YB 1COHA 1G08A 1VXEA 1MTJA 1CG8A 1MLLA 2AUOA 1HBAB 4TYXA 4O1TA 3ONZA 4U8UC 1UFJA 3MOUA 1V4XA 2EB8A 4MQHB 2H8DA 4G1VA 2HZ1A 2G0XA 1MLKA 6HBWB 1Y8WB 4G51B 1MYTA 1UIWA 3UHIA 1F65A 1BIJA 3PI8A 1RQAB 3VHBA 3WCVD 1G08B 1JF4A 1J7YA 4N7PB 4X0LA 1I3DA 3E4NA 3QJEB 1S5XA 3LQDB 1X9FA 1XYEB 1Q1FA 1GZXA 1SDKA 1S69A 4L2MA 4ROLA 1GDLA 1SPEA 4G1BA 3AT5A 2RAOB 5IKSA 1AJ9B
chains in the Genus database with same CATH superfamily
2VLXA 3A59A 1RVWA 4FWXA 1Y0DA 4H0MA 2DHBB 4O2GA 1KTPA 2GL3A 5CNGA 2QSSA 1WMUB 1MBAA 3OK5A 2NRLA 3D17B 1QSHA 3M3BA 2LH1A 4ROMB 4ERVA 1DM1A 1OUTB 3FEWX 2MHBB 3NMMA 3UI0A 1SWMA 4YU4B 1Y22B 112MA 4M4AA 1Y5KB 2RI4A 3SDNA 2NX0A 3BA2A 1PMBA 1Y4GB 3NG6B 1BZZA 4UURA 1YEVA 1KR7A 3DHRA 1DWSA 1J40A 1HDBA 1I7YA 1Y5JA 4HH1A 2D2ND 2Z6TA 1HGBB 1YOIA 1FAWB 1A9WA 2GKMA 2OH9A 4U8UB 1MBDA 1C40A 2UUND 1V07A 3H58A 4F6BA 1J3YB 2QFKA 2D2MC 1MLGA 2MYCA 1S5YA 4IROA 2W6YA 1NZ2A 1XZ2B 1YHEB 1G09A 2D5XB 4L7YA 4HSWA 2D5XA 1S6AA 1G09B 4LPIA 1Y7CA 1LFVB 2VJRB 4NXAA 1YEUA 1J3YA 5CN4A 2FALA 1JZLA 3L0FB 4NK2A 1F0LA 4MQCB 3AQ6A 1Y35A 4B02A 1HDSB 2XYKA 2GNVA 1HGBA 4PQBA 102MA 1HDBB 2HHDB 2XKGA 1Y4QA 1MYGA 3GQPB 1OJ6A 1YENB 1BZZB 3NG6A 1ON7B 1Y4GA 1MNKA 2LH6A 2QSPA 1EYXA 2D2MA 3PIAA 4M4AB 4M4BB 2G11A 1Y22A 1BABA 4YU4A 3WCUB 3NMMB 3W4UB 1Y4RB 101MA 3ZOLA 1FLPA 1RSEA 2MHBA 1JZKA 3ARKA 1FSXA 3WCTA 1CQXA 1DKEA 4UZVA 1NQPB 3D17A 3GUQA 1YHRA 3AT6B 1O16A 2JLGA 1JY7B 1HACA 2DHBA 5F0BA 1O1LA 1RVWB 4MXLA 3VREB 5AZQA 4HRTA 1K1KB 5AQDA 2RAOA 2FAMA 3MBAA 1JW8A 1GBUB 2MYEA 2EB9A 1A87A 1DLWA 4ROLB 2V1JA 1S0HB 4NK1A 1Y8IA 1X9FB 2OLPA 3CIUB 1QXDA 1S5XB 2MGGA 2BMMA 3HF4B 1CBLA 1FSLA 3PI8B 2O5SX 1BIJB 1JP6A 1CLSB 1BUWB 3D1KB 1Y4VA 1B33A 1M9PB 2HCOB 1Y46A 2HBSA 1Y8IB 3UH6A 4AVDA 3O89A 1S0HA 2PEGA 1Y85A 3ZJLA 5CN7A 1O1JA 1C7DA 3ONZB 1URVA 2UULH 1B0BA 4HRTB 1JPBA 4F0UA 3IXFA 1CG8B 4O35A 3VREA 1LFQB 1DXCA 5CNEA 1W92A 1YCBA 1HV4B 1HACB 1JY7A 1F5PA 2YSKA 4FH6A 1YHRB 5KDQA 1WLAA 4FC3B 1C7CA 4O4ZA 3SDHA 1FSXB 3WCTB 1FHJA 5CN8A 4ZVBA 1Y4RA 3W4UA 3ECXA 1DDTA 3D7OA 1PBXA 1EWAA 3GQGB 2G12A 3BCQB 3PIAB 1YG5B 2D2MB 2SPOA 2HBDB 3ARLA 1O1IA 1Y0WB 1IOPA 3BOMB 1V9QA 3QMAA 1XZ5A 3VRFA 1LH6A 2VYWA 1VRFA 2IN4A 5CN5A 3MVCA 1Y09A 1O1NB 3QQRA 3UHNA 1RQ3B 1J52A 2ZSOA 3S1IA 1Y35B 3L0FA 1CO8A 1XY0B 2ZLXB 3GKVB 4MQKA 1XXTA 1LFTB 5C6EA 3ORDA 3AQ7A 3NL7A 1JDOA 1LFVA 2R50A 1UVLA 1Y7CB 1NZ4A 1HI1A 4F6GA 3WCWB 4L7YB 2G10A 1MKOB 1M6MA 3WTGB 107MA 3QJBB 3HYUB 1HA7B 2HZ3A 1THBA 1HLMA 2UUMA 3DR9A 1GDKA 3WFXA 110MA 3PI9A 4XXIA 1FAWA 1HA7A 2MGJA 1N9IA 2GNWA 2O5BX 3QJBA 4QAUA 2UULC 1I7YB 1S61A 1Y5JB 2ZS1B 1YOGA 3DHRB 4YJJA 1L2KA 3NL7B 2D2NB 1QGWC 1Y4PA 1LFTA 2ZLVA 1CH4A 2X49A 4H07A 4PO5A 1UVKA 1LH1A 4GZGA 1A01A 3ZH0A 1O1NA 1CIOA 1CH1A 3PT7B 1Y4BB 5CNCA 1MYMA 1NS9A 1DUOA 4ROMA 2H35A 1RTEA 1Y8HB 3QM7A 3VRFB 3M38A 1JF3A 4DWUA 3BOMA 1AJGA 2H8FA 7HBIA 1J7SA 1IRDB 3ZHWA 2LH5A 3BCQA 1DWRA 1HBSB 1Y0DB 2V1GA 4TWUA 4XXKA 3S65A 2NSSA 4H2LB 1Y45B 3AT5B 1ECDA 2C7JB 1HBGA 1FHJB 4LM6B 2J96A 5KKKA 1LJWB 2JL9A 1MDNA 3HC9A 1OUUB 1FN3A 3UHBA 5EQMA 1MLFA 1MOCA 1BBBA 1Y7DA 4X0LB 1YZIB 1MTKA 1GH0B 3KMFC 4N7PA 2G0VA 4B3WA 4C0NA 4A8MP 4F0UB 3A0GB 1NAZA 3EDAA 1Y8WA 4G51A 3ZJMA 2GRHA 1YDZA 3HRWB 1G0BB 1O1KB 2HHBB 1O1JB 4A8YA 4NXCA 2H8DB 2PEGB 4MQHA 3QM9A 3OVUC 1ABYB 2V8AB 3QZXA 5SW7A 1Y46B 2HBSB 1M9PA 2HCOA 3ZJIA 1AJHA 1Y4VB 3AQ8A 1HBAA 1CLSA 3D1KA 5ILMA 1CG5B 1CP5A 2AUQA 2E2YA 3WR1B 1COHB 1H1XA 1R1YB 4F4OB 2VHBA 3PI1A 1D8UA 2ZFBA 3CY5A 4LMSB 1LFZB 4MQGA 3UHSA 1QXDB 3UHHA 1XCHA 4YU3B 3WCVA 1A3OB 1YIEB 2B7HB 2MGKA 4ESAB 5MBAA 1FCSA 2AV0A 3A5AA 3WCPA 1GCVA 3D1AA 1Y7GA 1GBUA 1GDIA 3DUTA 1A0UB 2WCRA 5B84A 2YRSB 1K1KA 2HBFB 1QSIB 4ESUA 1UVIA 2AUPA 1MYZA 1Z8UB 3MYMA 1XQ5A 1YEOB 3UH5A 1AZIA 1NQPA 3B75A 4F68A 3PMDA 3BJ3A 1DKEB 2MYDA 1MDTA 2ZS1C 2VYZA 1BABB 3S1JA 1A3NA 106MA 1A00B 4KJTA 4M4BA 4MXKA 5EUIB 1EYXB 2QSPB 3FS4B 5ILEA 2VEEA 1QXEA 2VMLA 1ON7A 1QPWA 4AE1A 1KN1B 2VJHA 1YENA 1Y7ZB 2ZFOC 3DBJA 3K8BA 3GQPA 2BNLA 1HABB 4N7OB 109MA 1Y4QB 4LMXB 1SGKA 1RPSA 1JBOA 4OODA 3A2GA 2MGBA 3GOUB 4Q70A 1K0YA 1DXUB 2GKNA 4MQCA 2D60B 1EBTA 1VXFA 3RJ6A 1CO9A 1YEUB 5HY8B 5E29B 2VJRA 1VXBA 1M6CA 2GDMA 1BJEA 4PQ6A 1YHEA 3WCVC 2FRIX 1C7BB 2W6WA 4IROB 3IC0A 1LIAA 1B86B 1C40B 2R4YA 5ILPA 2C0KA 2V1KA 1HGAA 2ZFOA 2G0ZA 2XKHA 4NI0B 1A0ZA 1A9WE 5AQDM 1HI0P 3VAUA 2ZSPA 1V75A 1XZ7B 1MYJA 1MLMA 4F0TB 1J40B 1YGFB 1IBEA 4XS0B 5JDOD 2D2MD 3LB1A 4A8WA 4VHBA 1Y4FA 2VRYA 3K9ZA 1Y5KA 2G14A 2RI4B 3ZJQA 1MODA 1SDLA 1LH7A 5KERB 5EU2A 2W72C 1CQ2A 1YVTB 1IRCA 1J41B 1MYHA 1JZMA 1MOAA 1QSHB 3ZJPA 5B85A 1NWIA 3UHYA 3QJCA 2QSSB 1HRMA 1YE2B 1KTPB 1BVDA 4H0MB 1RH1A 2Z6NB 3PI2A 1MYFA 1LFLA 1N9HA 2G3HA 2ZT0A 1AJ9A 3OJ1A 3TM3A 3EU1A 3G46A 1MWDA 3QJDB 4BJUA 4MBAA 3NFEA 1KD2A 1T1NA 2R4ZA 3WFTA 1Y2ZB 3BJ1A 2M6ZA 2X4AA 3QJEA 4MPMA 2GTLA 1CMYB 1SPGA 2HBEA 1RQAA 3WCWD 1A4FA 3GIOA 1G0AA 1UIWB 1Y0CA 2KSCA 1CPCA 6HBWA 1QI8B 1R1XA 3V2VA 3ZJOA 2DN1B 1O1MA 1FDHA 3E55A 1V4XB 1V4WB 104MA 3BRPA 1CH7A 1DLYA 1VWTA 2ZLWA 1JP9A 1YFFB 3R0GA 1LFYA 1IWHA 2WCQA 1VREA 3KUNA 2MB5A 5ILRA 4N6SB 4ILZA 2MGHA 1MNOA 3VRGA 2W72A 5CN9A 1NEJA 1MGNA 3A9MA 4F6FA 3HHBB 3OGBA 3G4YA 4MU5A 4HHBA 1JWNA 3IC2A 1UVMA 4TMAB 1GJNA 1MCYA 2GLNA 1HDAA 2FRJX 2MYAA 1LH3A 3S66A 3E5OA 1BZ0B 3ODQA 2DN3A 4TWVA 2SPLA 1HCOA 1HHOB 1G9VB 1YEQB 1CH2A 3WCUC 1ABWA 3WHMA 3V57B 1HGCB 2ZS0A 5EV5A 2R4WA 1JL7A 2ZSZA 1VXCA 3ECZA 2DN2A 3P5QA 2GTLC 2MGEA 1YH9A 2ZS0D 2G0SA 2MGCA 2SPMA 2D5ZA 1YE0B 1J3ZB 3OO4B 5JDOF 3V58A 4GXEB 3LB4A 2UUNB 4MQIB 3PT8B 2UUNA 3G4QA 1BZ1A 1YE0A 4WCHD 2D5ZB 2QMBB 3OO5A 2VJTA 1OFJA 3EOKA 3UHRA 3UHEA 1NIHB 1A6KA 2ZLTA 4KMWA 4RMPA 1IT2A 1Y0AA 3P5QB 1Y31A 1Y01B 2DN2B 2R80B 1MYIA 4UIQA 2LHBA 3ZOMA 3G4RA 3V57A 2C7KA 2BV8B 1G9VA 1HHOA 3QZZA 2ZS0C 3OZUA 4IT8A 4N7NA 3MJUB 1XZVB 1OFKA 5E83A 3PI3A 1N9FA 2Z6SA 1JEBA 1LH5A 1F99A 1HBHB 3S66B 1LA6A 2PGHA 2ZT4A 3DHTA 2UULB 4HRRB 1XZ4B 3IC2B 2ZLUB 1YGDB 3HHBA 3GYSB 3UHGA 5C6YA 1NS6B 4AE0A 3MKBA 1GVHA 2QLSB 2O58X 1BINA 5AB8A 1DXTB 1EBCA 3ZJJA 1J7WA 1RQ4B 4B4YA 2MGFA 1HBRA 2UULD 2LH3A 2W6VA 1COLA 3UHVA 5CNFA 2DKCA 4A8QA 2VEBA 1PHNA 2OIFA 3K3UA 1V4UA 4XDIA 1VWTB 2ZLWB 2HBCB 1UX8A 4MQJA 3UGYA 1YHUB 4WJGA 3UH3A 4N8TB 3WI8A 3KVSA 1JP8A 1GCWB 3GDJB 1O1MB 1R1XB 4HBIA 1UX9A 1QI8A 4NI1B 1UFPA 1YOHA 1Y0CB 2QU0A 1IT3A 1SPGB 3V2ZA 5D1VA 1O1OA 2QRWA 3MJPB 1SI4B 3LHBA 3UHUA 3QJDA 1XZUA 3RGKA 3PELA 1BZRA 3EU1B 2BLJM 2VLYA 1MLNA 5CN6A 5EETA 3SZKB 5CMVA 1LFLB 4NS2A 3UBVA 4F69A 1GLIA 1YE2A 2O5TX 2AA1A 4GY3B 4NZIA 4FH7A 3QJCB 1UMOA 5JGGA 2BW9M 1UVXA 2HHEB 2ZFOD 3KVSB 3A5GA 2NRMA 4N8TA 1VHBA 4ZIZB 1GBVB 1YVTA 3LB3A 1HHTP 2MGAA 5KERA 2HBCA 1URYA 1SDLB 5M3SA 2MYBA 1YVQA 1FDHG 2R1HA 1PHNB 4F6DA 4F6IA 3BJ2A 3UHWA 4WJG1 108MA 3ZJHA 3ECLA 3O2CA 4ODCA 1RQ4A 1UT0A 4XS0A 2DXMB 1DXTA 2QLSA 1WVPA 1HLBA 2O5LX 1V75B 1DWTA 1IDRA 3GYSA 3ZTAA 1A0ZB 2ZSTA 1S56A 2Z85A 3UHDA 1OR4A 1XZ4A 2ZFOB 1Y83B 1Y8KB 4FWZA 3GQRA 1ALLA 1YIHA 1MOHA 1A6GA 1B86A 1LIAB 1SHRA 4L1EB 1O1PA 2C7LA 2C7KB 1MLHA 1NZ3A 3ZJSA 5E29A 1EMYA 1UC3A 3D4XB 2R80A 2ZSXA 1Y31B 1KFRA 1YMCA 1ITHA 1NIHA 3PMCA 3G53A 3WFWA 3QM5A 3WFUA 1B8DB 1NY9A 1DTIA 1LTWA 1RPSB 3H57A 1UVYA 4C44A 3MWNA 3IA3B 2C7LB 4MQIA 1O1PB 3V58B 3LB2A 3DBJB 4DC7A 2VJHB 1KN1A 2MGMA 1Y0TA 1NGKA 2VMLB 4Z8KB 3UHXA 1ALLB 1YH9B 1Y83A 1OBMA 1DXVA 1HBIA 4ETTA 4KMVA 4JYQA 2DC3A 2DXMA 1Y5FB 1YCAA 3LR7A 3NUHB 3R5IB 3BJ3B 4ODCB 1HBBA 3ODQB 1XQ5B 3O18B 2W31A 3O2CB 2BK9A 1ECAA 5D5RA 3BJ2B 3FH9A 1YVQB 1QSIA 2ZSRA 1N9XA 1MLRA 2YRSA 2NSRA 1Y7GB 1GCVB 3D1AB 1GBVA 4FWYA 5EE4D 1MBIA 5HU6B 1DXDA 5JGGB 1A3OA 1YIEA 1YMAA 2AA1B 1GLIB 1IWHB 3G52A 4F4OA 1ECOA 2LH2A 5B13G 1CG5A 3PELB 5SW7B 3RQRA 5E6EB 2V8AA 1V4WA 1ABYA 2HZ2A 3HEPA 3UHCA 2ZT1A 2HHBA 1XG0C 3HXNA 5HLXA 1YDZB 3MJPA 4A8OA 1O1OB 2LH7A 5CNDA 3A0GA 3ED9A 3GK9A 4AVEA 1UVJA 1NWNA 1GH0A 111MA 2V1HA 5EYSA 1DO3A 2FRKX 4NI1A 3HXNB 2M6ZB 2AV3A 1FN3B 2R4XA 3BJ1B 3A5BA 3GDJA 1OUUA 4DC8A 2BKMA 3NFEB 1A6MA 5E6EA 2ZWJA 1TOXA 3ZJNA 3HENA 1YHUA 3UHQA 3MN0A 4MQJB 3UHKA 4H2LA 1MLQA 1MLOA 2Z6NA 1J7SB 1VXAA 3EDBA 2W6VB 1ECNA 1HBRB 5HU6A 1U7SA 2O5MX 1Y8HA 1J7WB 1TU9A 2H35B 2MGLA 5B13A 1NS9B 3MKBB 2EKUA 1Y4BA 1NS6A 1CPWA 2ZSYA 3VNCA 3HEOA 3NMLA 3FH9B 2UULA 1HHSA 2V1FA 1MBCA 2PGHB 1LA6B 1Y4PB 1JL6A 1HBHA 1CH3A 2D2NA 3O18A 1JEBB 3G4UA 1HBBB 1MNJA 1XZVA 4YJJB 3R5IA 3ZJRA 1Y5FA 1MNHA 1YGFA 2BV8A 2ZS1A 3AG0A 2HBGA 4NI0A 1BZPA 3M3AA 1VXDA 1DXVB 1BVCA 1Y0AB 1HGAB 1NXFA 2GRZA 3PI9B 1F63A 2ZLTB 4RMPB 1DO1A 1F5OA 1THBB 4Z8KA 2QMBA 3AQ5A 3OO5B 3HYUA 1Y0TB 3IC0B 3ARJA 3WTGA 1BZ1B 1C7BA 2ZSSA 4ETVA 4A8FA 1MLJA 4GXEA 2BLIA 1J3ZA 1BZ6A 2VLZA 1B8DA 1XXTB 1J3FA 4PNJA 1LHTA 3G4VA 4MQKB 2JLFA 1GDJA 3WCTC 1MBSA 3D4XA 1DXUA 1ASHA 3GOUA 1Y09B 5AZRA 1XDTT 1MTIA 1HCOB 1HABA 2DN3B 3K8BB 3KMFA 1OR6A 1Y7ZA 1SHRB 2OHAA 1BZ0A 4L1EA 1X9FD 1DO7A 4DWTA 2MBWA 3QM8A 1Y0WA 1YIHB 3GQRB 3FS4A 2VYYA 2FRFA 1Y8KA 5EUIA 3WCTD 5CHRA 1A00A 4HHBB 1PBXB 2MGDA 1A3NB 4F6JA 2O5QX 2JHOA 4JACA 1CBMA 2EKTA 1LH2A 3OZVA 1YHUC 1MWBA 3UHTA 4A8KA 2EVKA 2G0RA 2R1HB 1LFQA 1YFFA 2ZS1D 3DUTB 5HLUA 1C7DB 4ZIZA 3RJNB 3BRPB 1WACA 3GLNA 1H97A 1Y85B 2HHEA 6HBIA 2B7HA 4ESAA 2DN1A 4YU3A 3O7NA 4GY3A 5FVBA 3QM6A 1LFZA 4MQGB 5HBIA 5JDOC 2ZFBB 3CY5B 1G0AB 2BLHA 1A4FB 1BUWA 3UGZA 1A6NA 3WR1A 2HBEB 5JDOE 3UHZA 1CMYA 4A8SA 3SZKA 2GTLB 2WTHA 3HF4A 2V1EA 4KN3A 1XZUB 3CIUA 2V1IA 1Y2ZA 2UUMX 1T1NB 1KD2B 1MBOA 4H0BA 1G0BA 1O1KA 3HRWA 1SI4A 3UBCA 1CH9A 3E5IA 1I3EA 5HAVA 4HH0A 5EOHA 3LR9A 2QFNA 2OH8A 3QQQA 2AURA 1O1LB 2QU0B 1YZIA 2CMMA 1BBBB 1Y7DB 3M39A 105MA 3WCWC 3AT6A 1HJTA 1GCWA 3WCUD 4HSXA 2WTGA 2I88A 1LJWA 1U7RA 2WY4A 3TLDA 3G4WA 1J41A 3PI4A 1LHSA 2C7JA 3WCUA 1Y45A 1X46A 3S65B 4MBNA 1V4UB 1HBSA 1MWCA 1RTXA 1IRDA 2SPNA 2H8FB 2IG3A 1Y4FB 1UVNA 2ZSQA 2D6CA 1EW6A 4ZVAA 3KUOA 1VXGA 2ZT2A 1IBEB 2HHDA 4F0TA 4O4TA 4PQCA 3GKTA 1MNIA 1XZ7A 3PT7A 5HLQA 103MA 1YGDA 1HDSA 2ZLUA 1A01B 1NPFA 5CNBA 2ZT3A 4PO5B 4HRRA 3DHTB 4BJAA 2ZLVB 1F99B 1DUKA 2DKAA 5E83B 3MJUA 4N7NB 1X9FC 4ERTA 1XZ2A 1S5YB 4U8UD 3LQ9A 1DTMA 5HY8A 2Z8AA 1DO4A 3MYNA 2XKIA 1V5HA 2D60A 4OF9A 3EOKB 1VXHA 4U8UA 2UUMB 1MLUA 2VJTB 1CIKA 1XF6C 1K0YB 4Q70B 2GTLD 1JBOB 3ASEA 1MKOA 1HI8A 1YHUD 4MAXA 3PT8A 5EE4C 3WCWA 3TM9A 4N7OA 1YEVB 3OO4A 1NPGA 1X3KA 5C6EB 1QPWB 2BWHA 1QXEB 3GKVA 1HSYA 2ZLXA 1XY0A 2D2NC 4ETUA 1MBNA 2EVPA 1RQ3A 2ZS0B 1HGCA 3WHMB 1ABSA 1ABWB 1YMBA 1OUTA 1YEQA 1TESA 5MBNA 3B75B 4SDHA 1YEOA 1XZ5B 1LUEA 2W6XA 3UH7A 1WMUA 1O1IB 1HDAB 5F2AA 2HBDA 2MGIA 1YG5A 2GRFA 2ZSNA 3A59B 3GQGA 3D7OB 2HBFA 2EF2A 5JOMA 1A0UA 2O5OX 2DKDA 1C7CB 3WCPB 1MOBA 1NEJB 2OHBA 3U3EA 2VM0A 1NZ5A 3AQ9A 1CP0A 4FC3A 2W72B 1GZXB 1SDKB 3VRGB 5EYJA 3OZWA 3WCVB 5KDQB 1CH5A 1MLSA 1XYEA 3LQDA 4N6SA 3S48C 5CHQA 1MZ0A 1HV4A 1LFYB 1R1YA 1J7YB 1COHA 1G08A 1VXEA 5FVBM 1MTJA 1CG8A 1MLLA 2AUOA 1HBAB 4TYXA 4O1TA 3ONZA 4U8UC 1UFJA 3MOUA 1V4XA 2EB8A 4MQHB 2H8DA 4G1VA 2HZ1A 2G0XA 1MLKA 1CPCB 6HBWB 1Y8WB 4G51B 1MYTA 1UIWA 1B33B 3UHIA 1F65A 1BIJA 3PI8A 1RQAB 3VHBA 3WCVD 1G08B 1JF4A 1J7YA 4N7PB 4X0LA 1I3DA 3E4NA 3QJEB 1S5XA 3LQDB 1X9FA 1XYEB 1Q1FA 1GZXA 1SDKA 1S69A 1CIIA 4L2MA 4ROLA 1GDLA 1SPEA 4G1BA 3AT5A 2RAOB 4BS9A 5IKSA 1AJ9B
chains in the Genus database with same CATH topology
2VLXA 3A59A 1RVWA 4FWXA 1Y0DA 2DHBB 4O2GA 2GL3A 5CNGA 2QSSA 1WMUB 1MBAA 3OK5A 2NRLA 3D17B 1QSHA 3M3BA 2LH1A 4ROMB 1DM1A 1OUTB 2MHBB 3NMMA 3UI0A 1SWMA 4YU4B 1Y22B 112MA 4M4AA 1Y5KB 2RI4A 3SDNA 2NX0A 3BA2A 1PMBA 1Y4GB 3NG6B 1BZZA 4UURA 1YEVA 1KR7A 3DHRA 1DWSA 1J40A 1HDBA 1Y5JA 2D2ND 2Z6TA 1HGBB 1YOIA 1FAWB 1A9WA 2GKMA 2OH9A 4U8UB 1MBDA 1C40A 1V07A 3H58A 4F6BA 1J3YB 2QFKA 2D2MC 1MLGA 2MYCA 1S5YA 4IROA 2W6YA 1NZ2A 1XZ2B 1YHEB 1G09A 2D5XB 4L7YA 4HSWA 2D5XA 1S6AA 1G09B 4LPIA 1Y7CA 1LFVB 4NXAA 1YEUA 1J3YA 5CN4A 2FALA 1JZLA 4NK2A 4MQCB 3AQ6A 1Y35A 1HDSB 2XYKA 2GNVA 1HGBA 4PQBA 102MA 1HDBB 2HHDB 2XKGA 1Y4QA 1MYGA 3GQPB 1OJ6A 1YENB 1BZZB 3NG6A 1Y4GA 1MNKA 2LH6A 2QSPA 2D2MA 3PIAA 4M4AB 4M4BB 2G11A 1Y22A 1BABA 4YU4A 3WCUB 3NMMB 3W4UB 1Y4RB 101MA 3ZOLA 1FLPA 1RSEA 2MHBA 1JZKA 3ARKA 1FSXA 3WCTA 1CQXA 1DKEA 4UZVA 1NQPB 3D17A 1YHRA 3AT6B 1O16A 1JY7B 1HACA 2DHBA 5F0BA 1O1LA 1RVWB 4MXLA 3VREB 5AZQA 4HRTA 1K1KB 2RAOA 2FAMA 3MBAA 1JW8A 1GBUB 2MYEA 2EB9A 1DLWA 4ROLB 2V1JA 1S0HB 4NK1A 1Y8IA 1X9FB 2OLPA 3CIUB 1QXDA 1S5XB 2MGGA 2BMMA 3HF4B 1CBLA 1FSLA 3PI8B 2O5SX 1BIJB 1JP6A 1CLSB 1BUWB 3D1KB 1Y4VA 1M9PB 2HCOB 1Y46A 2HBSA 1Y8IB 3UH6A 4AVDA 3O89A 1S0HA 2PEGA 1Y85A 3ZJLA 5CN7A 1O1JA 1C7DA 3ONZB 1URVA 1B0BA 4HRTB 1JPBA 3IXFA 1CG8B 4O35A 3VREA 1LFQB 1DXCA 5CNEA 1W92A 1YCBA 1HV4B 1HACB 1JY7A 1F5PA 4FH6A 1YHRB 5KDQA 1WLAA 4FC3B 1C7CA 4O4ZA 3SDHA 1FSXB 3WCTB 1FHJA 5CN8A 4ZVBA 1Y4RA 3W4UA 3ECXA 3D7OA 1PBXA 1EWAA 3GQGB 2G12A 3BCQB 3PIAB 1YG5B 2D2MB 2SPOA 2HBDB 3ARLA 1O1IA 1Y0WB 1IOPA 3BOMB 1V9QA 3QMAA 1XZ5A 3VRFA 1LH6A 2VYWA 1VRFA 2IN4A 5CN5A 3MVCA 1Y09A 1O1NB 3QQRA 3UHNA 1RQ3B 1J52A 2ZSOA 3S1IA 1Y35B 1CO8A 1XY0B 2ZLXB 3GKVB 4MQKA 1XXTA 1LFTB 5C6EA 3ORDA 3AQ7A 3NL7A 1JDOA 1LFVA 2R50A 1Y7CB 1NZ4A 4F6GA 3WCWB 4L7YB 2G10A 1MKOB 1M6MA 3WTGB 107MA 3QJBB 3HYUB 2HZ3A 1THBA 1HLMA 3DR9A 1GDKA 3WFXA 110MA 3PI9A 1FAWA 2MGJA 1N9IA 2GNWA 2O5BX 3QJBA 4QAUA 1S61A 1Y5JB 2ZS1B 1YOGA 3DHRB 1L2KA 3NL7B 2D2NB 1Y4PA 1LFTA 2ZLVA 1CH4A 4H07A 1LH1A 4GZGA 1A01A 3ZH0A 1O1NA 1CIOA 1CH1A 3PT7B 1Y4BB 5CNCA 1MYMA 1NS9A 1DUOA 4ROMA 2H35A 1RTEA 1Y8HB 3QM7A 3VRFB 3M38A 1JF3A 4DWUA 3BOMA 1AJGA 2H8FA 7HBIA 1J7SA 1IRDB 3ZHWA 2LH5A 3BCQA 1DWRA 1HBSB 1Y0DB 2V1GA 4TWUA 3S65A 2NSSA 4H2LB 1Y45B 3AT5B 1ECDA 1HBGA 1FHJB 5KKKA 1LJWB 1MDNA 3HC9A 1OUUB 1FN3A 3UHBA 5EQMA 1MLFA 1MOCA 1BBBA 1Y7DA 4X0LB 1YZIB 1MTKA 3KMFC 4N7PA 2G0VA 4B3WA 4C0NA 3A0GB 1NAZA 3EDAA 1Y8WA 4G51A 3ZJMA 2GRHA 1YDZA 3HRWB 1G0BB 1O1KB 2HHBB 1O1JB 4NXCA 2H8DB 2PEGB 4MQHA 3QM9A 3OVUC 1ABYB 3QZXA 5SW7A 1Y46B 2HBSB 1M9PA 2HCOA 3ZJIA 1AJHA 1Y4VB 3AQ8A 1HBAA 1CLSA 3D1KA 5ILMA 1CG5B 1CP5A 2AUQA 2E2YA 3WR1B 1COHB 1H1XA 1R1YB 4F4OB 2VHBA 3PI1A 1D8UA 2ZFBA 3CY5A 1LFZB 4MQGA 3UHSA 1QXDB 3UHHA 1XCHA 4YU3B 3WCVA 1A3OB 1YIEB 2B7HB 2MGKA 4ESAB 5MBAA 1FCSA 2AV0A 3A5AA 3WCPA 1GCVA 3D1AA 1Y7GA 1GBUA 1GDIA 3DUTA 1A0UB 5B84A 2YRSB 1K1KA 2HBFB 1QSIB 2AUPA 1MYZA 1Z8UB 3MYMA 1XQ5A 1YEOB 3UH5A 1AZIA 1NQPA 3B75A 4F68A 3BJ3A 1DKEB 2MYDA 2ZS1C 2VYZA 1BABB 3S1JA 1A3NA 106MA 1A00B 4KJTA 4M4BA 4MXKA 5EUIB 2QSPB 3FS4B 5ILEA 2VEEA 1QXEA 1QPWA 1YENA 1Y7ZB 2ZFOC 3K8BA 3GQPA 2BNLA 1HABB 4N7OB 109MA 1Y4QB 1RPSA 4OODA 3A2GA 2MGBA 3GOUB 1K0YA 1DXUB 2GKNA 4MQCA 2D60B 1EBTA 1VXFA 3RJ6A 1CO9A 1YEUB 5HY8B 5E29B 1VXBA 1M6CA 2GDMA 1BJEA 4PQ6A 1YHEA 3WCVC 2FRIX 1C7BB 2W6WA 4IROB 3IC0A 1B86B 1C40B 2R4YA 5ILPA 2C0KA 2V1KA 1HGAA 2ZFOA 2G0ZA 2XKHA 4NI0B 1A0ZA 1A9WE 3VAUA 2ZSPA 1V75A 1XZ7B 1MYJA 1MLMA 1J40B 1YGFB 1IBEA 4XS0B 5JDOD 2D2MD 3LB1A 4VHBA 1Y4FA 2VRYA 3K9ZA 1Y5KA 2G14A 2RI4B 3ZJQA 1MODA 1SDLA 1LH7A 5KERB 5EU2A 2W72C 1CQ2A 1YVTB 1IRCA 1J41B 1MYHA 1JZMA 1MOAA 1QSHB 3ZJPA 5B85A 1NWIA 3UHYA 3QJCA 2QSSB 1HRMA 1YE2B 1BVDA 2Z6NB 3PI2A 1MYFA 1LFLA 1N9HA 2G3HA 2ZT0A 1AJ9A 3OJ1A 3TM3A 3EU1A 3G46A 1MWDA 3QJDB 4MBAA 3NFEA 1KD2A 1T1NA 2R4ZA 3WFTA 1Y2ZB 3BJ1A 2M6ZA 3QJEA 4MPMA 2GTLA 1CMYB 1SPGA 2HBEA 1RQAA 3WCWD 1A4FA 1G0AA 1UIWB 1Y0CA 2KSCA 6HBWA 1QI8B 1R1XA 3V2VA 3ZJOA 2DN1B 1O1MA 1FDHA 3E55A 1V4XB 1V4WB 104MA 1CH7A 1DLYA 1VWTA 2ZLWA 1JP9A 1YFFB 3R0GA 1LFYA 1IWHA 1VREA 3KUNA 2MB5A 5ILRA 4ILZA 2MGHA 1MNOA 3VRGA 2W72A 5CN9A 1NEJA 1MGNA 3A9MA 4F6FA 3HHBB 3OGBA 3G4YA 4MU5A 4HHBA 1JWNA 3IC2A 1GJNA 1MCYA 2GLNA 1HDAA 2FRJX 2MYAA 1LH3A 3S66A 3E5OA 1BZ0B 3ODQA 2DN3A 4TWVA 2SPLA 1HCOA 1HHOB 1G9VB 1YEQB 1CH2A 3WCUC 1ABWA 3WHMA 1HGCB 2ZS0A 5EV5A 2R4WA 1JL7A 2ZSZA 1VXCA 3ECZA 2DN2A 3P5QA 2GTLC 2MGEA 1YH9A 2ZS0D 2G0SA 2MGCA 2SPMA 2D5ZA 1YE0B 1J3ZB 3OO4B 5JDOF 3LB4A 4MQIB 3PT8B 3G4QA 1BZ1A 1YE0A 4WCHD 2D5ZB 2QMBB 3OO5A 1OFJA 3EOKA 3UHRA 3UHEA 1NIHB 1A6KA 2ZLTA 4KMWA 1IT2A 1Y0AA 3P5QB 1Y31A 1Y01B 2DN2B 2R80B 1MYIA 4UIQA 2LHBA 3ZOMA 3G4RA 1G9VA 1HHOA 3QZZA 2ZS0C 3OZUA 4IT8A 3MJUB 4N7NA 1XZVB 1OFKA 5E83A 3PI3A 1N9FA 2Z6SA 1JEBA 1LH5A 1HBHB 3S66B 1LA6A 2PGHA 2ZT4A 3DHTA 4HRRB 1XZ4B 3IC2B 2ZLUB 1YGDB 3HHBA 3GYSB 3UHGA 5C6YA 1NS6B 3MKBA 1GVHA 2QLSB 2O58X 1BINA 5AB8A 1DXTB 1EBCA 3ZJJA 1J7WA 1RQ4B 4B4YA 2MGFA 1HBRA 2LH3A 2W6VA 3UHVA 5CNFA 2VEBA 2OIFA 3K3UA 1V4UA 4XDIA 1VWTB 2ZLWB 2HBCB 1UX8A 4MQJA 3UGYA 1YHUB 4WJGA 3UH3A 4N8TB 3WI8A 1JP8A 1GCWB 3GDJB 1O1MB 1R1XB 4HBIA 1UX9A 1QI8A 4NI1B 1UFPA 1YOHA 1Y0CB 2QU0A 1IT3A 1SPGB 3V2ZA 5D1VA 1O1OA 2QRWA 3MJPB 1SI4B 3LHBA 3UHUA 3QJDA 1XZUA 3RGKA 3PELA 1BZRA 3EU1B 2BLJM 2VLYA 1MLNA 5CN6A 5EETA 3SZKB 5CMVA 1LFLB 4NS2A 3UBVA 4F69A 1GLIA 1YE2A 2O5TX 2AA1A 4NZIA 4FH7A 3QJCB 1UMOA 5JGGA 2BW9M 1UVXA 2HHEB 2ZFOD 3A5GA 2NRMA 4N8TA 1VHBA 1GBVB 1YVTA 3LB3A 2MGAA 5KERA 2HBCA 1URYA 1SDLB 5M3SA 2MYBA 1YVQA 1FDHG 2R1HA 4F6DA 4F6IA 3BJ2A 3UHWA 4WJG1 108MA 3ZJHA 3ECLA 4ODCA 1RQ4A 1UT0A 4XS0A 2DXMB 1DXTA 2QLSA 1WVPA 1HLBA 2O5LX 1V75B 1DWTA 1IDRA 3GYSA 1A0ZB 2ZSTA 1S56A 2Z85A 3UHDA 1OR4A 1XZ4A 2ZFOB 1Y83B 1Y8KB 4FWZA 3GQRA 1YIHA 1MOHA 1A6GA 1B86A 1SHRA 1O1PA 1MLHA 1NZ3A 3ZJSA 5E29A 1EMYA 1UC3A 3D4XB 2R80A 2ZSXA 1Y31B 1KFRA 1YMCA 1ITHA 1NIHA 3G53A 3WFWA 3QM5A 3WFUA 1DTIA 1LTWA 1RPSB 3H57A 1UVYA 4C44A 3IA3B 4MQIA 1O1PB 3LB2A 4DC7A 2MGMA 1Y0TA 1NGKA 3UHXA 1YH9B 1Y83A 1OBMA 1DXVA 1HBIA 4KMVA 4JYQA 2DC3A 2DXMA 1Y5FB 1YCAA 3LR7A 3R5IB 3BJ3B 4ODCB 1HBBA 3ODQB 1XQ5B 2W31A 2BK9A 1ECAA 5D5RA 3BJ2B 3FH9A 1YVQB 1QSIA 2ZSRA 1N9XA 1MLRA 2YRSA 2NSRA 1Y7GB 1GCVB 3D1AB 1GBVA 4FWYA 5EE4D 1MBIA 5HU6B 1DXDA 5JGGB 1A3OA 1YIEA 1YMAA 2AA1B 1GLIB 1IWHB 3G52A 4F4OA 1ECOA 2LH2A 1CG5A 3PELB 5SW7B 5E6EB 1V4WA 1ABYA 2HZ2A 3HEPA 3UHCA 2ZT1A 2HHBA 3HXNA 5HLXA 1YDZB 3MJPA 1O1OB 2LH7A 5CNDA 3A0GA 3ED9A 3GK9A 4AVEA 1NWNA 111MA 2V1HA 5EYSA 1DO3A 2FRKX 4NI1A 3HXNB 2M6ZB 2AV3A 1FN3B 2R4XA 3BJ1B 3A5BA 3GDJA 1OUUA 4DC8A 2BKMA 3NFEB 1A6MA 5E6EA 2ZWJA 3ZJNA 3HENA 1YHUA 3UHQA 3MN0A 4MQJB 3UHKA 4H2LA 1MLQA 1MLOA 2Z6NA 1J7SB 1VXAA 3EDBA 2W6VB 1ECNA 1HBRB 5HU6A 1U7SA 2O5MX 1Y8HA 1J7WB 1TU9A 2H35B 2MGLA 1NS9B 3MKBB 2EKUA 1Y4BA 1NS6A 1CPWA 2ZSYA 3HEOA 3NMLA 3FH9B 2V1FA 1MBCA 2PGHB 1LA6B 1Y4PB 1JL6A 1HBHA 1CH3A 2D2NA 1JEBB 3G4UA 1HBBB 1MNJA 1XZVA 3R5IA 3ZJRA 1Y5FA 1MNHA 1YGFA 2ZS1A 3AG0A 2HBGA 4NI0A 1BZPA 3M3AA 1VXDA 1DXVB 1BVCA 1Y0AB 1HGAB 1NXFA 2GRZA 3PI9B 1F63A 2ZLTB 1DO1A 1F5OA 1THBB 2QMBA 3AQ5A 3OO5B 3HYUA 1Y0TB 3IC0B 3ARJA 3WTGA 1BZ1B 1C7BA 2ZSSA 1MLJA 2BLIA 1J3ZA 1BZ6A 2VLZA 1XXTB 1J3FA 4PNJA 1LHTA 3G4VA 4MQKB 1GDJA 3WCTC 1MBSA 3D4XA 1DXUA 1ASHA 3GOUA 1Y09B 5AZRA 1MTIA 1HCOB 1HABA 2DN3B 3K8BB 3KMFA 1OR6A 1Y7ZA 1SHRB 2OHAA 1BZ0A 1X9FD 1DO7A 4DWTA 2MBWA 3QM8A 1Y0WA 1YIHB 3GQRB 3FS4A 2VYYA 2FRFA 1Y8KA 5EUIA 3WCTD 5CHRA 1A00A 4HHBB 1PBXB 2MGDA 1A3NB 4F6JA 2O5QX 2JHOA 4JACA 1CBMA 2EKTA 1LH2A 3OZVA 1YHUC 1MWBA 3UHTA 2EVKA 2G0RA 2R1HB 1LFQA 1YFFA 2ZS1D 3DUTB 5HLUA 1C7DB 3RJNB 3GLNA 1H97A 1Y85B 2HHEA 6HBIA 2B7HA 4ESAA 2DN1A 4YU3A 3O7NA 3QM6A 1LFZA 4MQGB 5HBIA 5JDOC 2ZFBB 3CY5B 1G0AB 2BLHA 1A4FB 1BUWA 3UGZA 1A6NA 3WR1A 2HBEB 5JDOE 3UHZA 1CMYA 3SZKA 2GTLB 2WTHA 3HF4A 2V1EA 4KN3A 1XZUB 3CIUA 2V1IA 1Y2ZA 1T1NB 1KD2B 1MBOA 4H0BA 1G0BA 1O1KA 3HRWA 1SI4A 3UBCA 1CH9A 3E5IA 1I3EA 5HAVA 5EOHA 3LR9A 2QFNA 2OH8A 3QQQA 2AURA 1O1LB 2QU0B 1YZIA 2CMMA 1BBBB 1Y7DB 3M39A 105MA 3WCWC 3AT6A 1HJTA 1GCWA 3WCUD 4HSXA 2WTGA 1LJWA 1U7RA 2WY4A 3TLDA 3G4WA 1J41A 3PI4A 1LHSA 3WCUA 1Y45A 1X46A 3S65B 4MBNA 1V4UB 1HBSA 1MWCA 1RTXA 1IRDA 2SPNA 2H8FB 2IG3A 1Y4FB 2ZSQA 2D6CA 1EW6A 4ZVAA 3KUOA 1VXGA 2ZT2A 1IBEB 2HHDA 4O4TA 4PQCA 3GKTA 1MNIA 1XZ7A 3PT7A 5HLQA 103MA 1YGDA 1HDSA 2ZLUA 1A01B 1NPFA 5CNBA 2ZT3A 4HRRA 3DHTB 4BJAA 2ZLVB 1DUKA 5E83B 3MJUA 4N7NB 1X9FC 1XZ2A 1S5YB 4U8UD 1DTMA 5HY8A 2Z8AA 1DO4A 3MYNA 2XKIA 1V5HA 2D60A 4OF9A 3EOKB 1VXHA 4U8UA 1MLUA 1CIKA 1K0YB 2GTLD 3ASEA 1MKOA 4MAXA 1YHUD 3PT8A 5EE4C 3WCWA 3TM9A 4N7OA 1YEVB 3OO4A 1NPGA 1X3KA 5C6EB 1QPWB 2BWHA 1QXEB 3GKVA 1HSYA 2ZLXA 1XY0A 2D2NC 1MBNA 2EVPA 1RQ3A 2ZS0B 1HGCA 3WHMB 1ABSA 1ABWB 1YMBA 1OUTA 1YEQA 1TESA 5MBNA 3B75B 4SDHA 1YEOA 1XZ5B 1LUEA 2W6XA 3UH7A 1WMUA 1O1IB 1HDAB 5F2AA 2HBDA 2MGIA 1YG5A 2GRFA 2ZSNA 3A59B 3GQGA 3D7OB 2HBFA 2EF2A 5JOMA 1A0UA 2O5OX 1C7CB 3WCPB 1MOBA 1NEJB 2OHBA 3U3EA 2VM0A 1NZ5A 3AQ9A 1CP0A 4FC3A 2W72B 1GZXB 1SDKB 3VRGB 5EYJA 3OZWA 3WCVB 5KDQB 1CH5A 1MLSA 1XYEA 3LQDA 3S48C 5CHQA 1MZ0A 1HV4A 1LFYB 1R1YA 1J7YB 1COHA 1G08A 1VXEA 1MTJA 1CG8A 1MLLA 2AUOA 1HBAB 4TYXA 4O1TA 3ONZA 4U8UC 1UFJA 3MOUA 1V4XA 2EB8A 4MQHB 2H8DA 4G1VA 2HZ1A 2G0XA 1MLKA 6HBWB 1Y8WB 4G51B 1MYTA 1UIWA 3UHIA 1F65A 1BIJA 3PI8A 1RQAB 3VHBA 3WCVD 1G08B 1JF4A 1J7YA 4N7PB 4X0LA 1I3DA 3E4NA 3QJEB 1S5XA 3LQDB 1X9FA 1XYEB 1Q1FA 1GZXA 1SDKA 1S69A 4L2MA 4ROLA 1GDLA 1SPEA 4G1BA 3AT5A 2RAOB 5IKSA 1AJ9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VLX A;  3A59 A;  1RVW A;  4FWX A;  1Y0D A;  2DHB B;  4O2G A;  2GL3 A;  5CNG A;  2QSS A;  1WMU B;  1MBA A;  3OK5 A;  2NRL A;  3D17 B;  1QSH A;  3M3B A;  2LH1 A;  4ROM B;  1DM1 A;  1OUT B;  2MHB B;  3NMM A;  3UI0 A;  1SWM A;  4YU4 B;  1Y22 B;  112M A;  4M4A A;  1Y5K B;  2RI4 A;  3SDN A;  2NX0 A;  3BA2 A;  1PMB A;  1Y4G B;  3NG6 B;  1BZZ A;  4UUR A;  1YEV A;  1KR7 A;  3DHR A;  1DWS A;  1J40 A;  1HDB A;  1Y5J A;  2D2N D;  2Z6T A;  1HGB B;  1YOI A;  1FAW B;  1A9W A;  2GKM A;  2OH9 A;  4U8U B;  1MBD A;  1C40 A;  1V07 A;  3H58 A;  4F6B A;  1J3Y B;  2QFK A;  2D2M C;  1MLG A;  2MYC A;  1S5Y A;  4IRO A;  2W6Y A;  1NZ2 A;  1XZ2 B;  1YHE B;  1G09 A;  2D5X B;  4L7Y A;  4HSW A;  2D5X A;  1S6A A;  1G09 B;  4LPI A;  1Y7C A;  1LFV B;  4NXA A;  1YEU A;  1J3Y A;  5CN4 A;  2FAL A;  1JZL A;  4NK2 A;  4MQC B;  3AQ6 A;  1Y35 A;  1HDS B;  2XYK A;  2GNV A;  1HGB A;  4PQB A;  102M A;  1HDB B;  2HHD B;  2XKG A;  1Y4Q A;  1MYG A;  3GQP B;  1OJ6 A;  1YEN B;  1BZZ B;  3NG6 A;  1Y4G A;  1MNK A;  2LH6 A;  2QSP A;  2D2M A;  3PIA A;  4M4A B;  4M4B B;  2G11 A;  1Y22 A;  1BAB A;  4YU4 A;  3WCU B;  3NMM B;  3W4U B;  1Y4R B;  101M A;  3ZOL A;  1FLP A;  1RSE A;  2MHB A;  1JZK A;  3ARK A;  1FSX A;  3WCT A;  1CQX A;  1DKE A;  4UZV A;  1NQP B;  3D17 A;  1YHR A;  3AT6 B;  1O16 A;  1JY7 B;  1HAC A;  2DHB A;  5F0B A;  1O1L A;  1RVW B;  4MXL A;  3VRE B;  5AZQ A;  4HRT A;  1K1K B;  2RAO A;  2FAM A;  3MBA A;  1JW8 A;  1GBU B;  2MYE A;  2EB9 A;  1DLW A;  4ROL B;  2V1J A;  1S0H B;  4NK1 A;  1Y8I A;  1X9F B;  2OLP A;  3CIU B;  1QXD A;  1S5X B;  2MGG A;  2BMM A;  3HF4 B;  1CBL A;  1FSL A;  3PI8 B;  2O5S X;  1BIJ B;  1JP6 A;  1CLS B;  1BUW B;  3D1K B;  1Y4V A;  1M9P B;  2HCO B;  1Y46 A;  2HBS A;  1Y8I B;  3UH6 A;  4AVD A;  3O89 A;  1S0H A;  2PEG A;  1Y85 A;  3ZJL A;  5CN7 A;  1O1J A;  1C7D A;  3ONZ B;  1URV A;  1B0B A;  4HRT B;  1JPB A;  3IXF A;  1CG8 B;  4O35 A;  3VRE A;  1LFQ B;  1DXC A;  5CNE A;  1W92 A;  1YCB A;  1HV4 B;  1HAC B;  1JY7 A;  1F5P A;  4FH6 A;  1YHR B;  5KDQ A;  1WLA A;  4FC3 B;  1C7C A;  4O4Z A;  3SDH A;  1FSX B;  3WCT B;  1FHJ A;  5CN8 A;  4ZVB A;  1Y4R A;  3W4U A;  3ECX A;  3D7O A;  1PBX A;  1EWA A;  3GQG B;  2G12 A;  3BCQ B;  3PIA B;  1YG5 B;  2D2M B;  2SPO A;  2HBD B;  3ARL A;  1O1I A;  1Y0W B;  1IOP A;  3BOM B;  1V9Q A;  3QMA A;  1XZ5 A;  3VRF A;  1LH6 A;  2VYW A;  1VRF A;  2IN4 A;  5CN5 A;  3MVC A;  1Y09 A;  1O1N B;  3QQR A;  3UHN A;  1RQ3 B;  1J52 A;  2ZSO A;  3S1I A;  1Y35 B;  1CO8 A;  1XY0 B;  2ZLX B;  3GKV B;  4MQK A;  1XXT A;  1LFT B;  5C6E A;  3ORD A;  3AQ7 A;  3NL7 A;  1JDO A;  1LFV A;  2R50 A;  1Y7C B;  1NZ4 A;  4F6G A;  3WCW B;  4L7Y B;  2G10 A;  1MKO B;  1M6M A;  3WTG B;  107M A;  3QJB B;  3HYU B;  2HZ3 A;  1THB A;  1HLM A;  3DR9 A;  1GDK A;  3WFX A;  110M A;  3PI9 A;  1FAW A;  2MGJ A;  1N9I A;  2GNW A;  2O5B X;  3QJB A;  4QAU A;  1S61 A;  1Y5J B;  2ZS1 B;  1YOG A;  3DHR B;  1L2K A;  3NL7 B;  2D2N B;  1Y4P A;  1LFT A;  2ZLV A;  1CH4 A;  4H07 A;  1LH1 A;  4GZG A;  1A01 A;  3ZH0 A;  1O1N A;  1CIO A;  1CH1 A;  3PT7 B;  1Y4B B;  5CNC A;  1MYM A;  1NS9 A;  1DUO A;  4ROM A;  2H35 A;  1RTE A;  1Y8H B;  3QM7 A;  3VRF B;  3M38 A;  1JF3 A;  4DWU A;  3BOM A;  1AJG A;  2H8F A;  7HBI A;  1J7S A;  1IRD B;  3ZHW A;  2LH5 A;  3BCQ A;  1DWR A;  1HBS B;  1Y0D B;  2V1G A;  4TWU A;  3S65 A;  2NSS A;  4H2L B;  1Y45 B;  3AT5 B;  1ECD A;  1HBG A;  1FHJ B;  5KKK A;  1LJW B;  1MDN A;  3HC9 A;  1OUU B;  1FN3 A;  3UHB A;  5EQM A;  1MLF A;  1MOC A;  1BBB A;  1Y7D A;  4X0L B;  1YZI B;  1MTK A;  3KMF C;  4N7P A;  2G0V A;  4B3W A;  4C0N A;  3A0G B;  1NAZ A;  3EDA A;  1Y8W A;  4G51 A;  3ZJM A;  2GRH A;  1YDZ A;  3HRW B;  1G0B B;  1O1K B;  2HHB B;  1O1J B;  4NXC A;  2H8D B;  2PEG B;  4MQH A;  3QM9 A;  3OVU C;  1ABY B;  3QZX A;  5SW7 A;  1Y46 B;  2HBS B;  1M9P A;  2HCO A;  3ZJI A;  1AJH A;  1Y4V B;  3AQ8 A;  1HBA A;  1CLS A;  3D1K A;  5ILM A;  1CG5 B;  1CP5 A;  2AUQ A;  2E2Y A;  3WR1 B;  1COH B;  1H1X A;  1R1Y B;  4F4O B;  2VHB A;  3PI1 A;  1D8U A;  2ZFB A;  3CY5 A;  1LFZ B;  4MQG A;  3UHS A;  1QXD B;  3UHH A;  1XCH A;  4YU3 B;  3WCV A;  1A3O B;  1YIE B;  2B7H B;  2MGK A;  4ESA B;  5MBA A;  1FCS A;  2AV0 A;  3A5A A;  3WCP A;  1GCV A;  3D1A A;  1Y7G A;  1GBU A;  1GDI A;  3DUT A;  1A0U B;  5B84 A;  2YRS B;  1K1K A;  2HBF B;  1QSI B;  2AUP A;  1MYZ A;  1Z8U B;  3MYM A;  1XQ5 A;  1YEO B;  3UH5 A;  1AZI A;  1NQP A;  3B75 A;  4F68 A;  3BJ3 A;  1DKE B;  2MYD A;  2ZS1 C;  2VYZ A;  1BAB B;  3S1J A;  1A3N A;  106M A;  1A00 B;  4KJT A;  4M4B A;  4MXK A;  5EUI B;  2QSP B;  3FS4 B;  5ILE A;  2VEE A;  1QXE A;  1QPW A;  1YEN A;  1Y7Z B;  2ZFO C;  3K8B A;  3GQP A;  2BNL A;  1HAB B;  4N7O B;  109M A;  1Y4Q B;  1RPS A;  4OOD A;  3A2G A;  2MGB A;  3GOU B;  1K0Y A;  1DXU B;  2GKN A;  4MQC A;  2D60 B;  1EBT A;  1VXF A;  3RJ6 A;  1CO9 A;  1YEU B;  5HY8 B;  5E29 B;  1VXB A;  1M6C A;  2GDM A;  1BJE A;  4PQ6 A;  1YHE A;  3WCV C;  2FRI X;  1C7B B;  2W6W A;  4IRO B;  3IC0 A;  1B86 B;  1C40 B;  2R4Y A;  5ILP A;  2C0K A;  2V1K A;  1HGA A;  2ZFO A;  2G0Z A;  2XKH A;  4NI0 B;  1A0Z A;  1A9W E;  3VAU A;  2ZSP A;  1V75 A;  1XZ7 B;  1MYJ A;  1MLM A;  1J40 B;  1YGF B;  1IBE A;  4XS0 B;  5JDO D;  2D2M D;  3LB1 A;  4VHB A;  1Y4F A;  2VRY A;  3K9Z A;  1Y5K A;  2G14 A;  2RI4 B;  3ZJQ A;  1MOD A;  1SDL A;  1LH7 A;  5KER B;  5EU2 A;  2W72 C;  1CQ2 A;  1YVT B;  1IRC A;  1J41 B;  1MYH A;  1JZM A;  1MOA A;  1QSH B;  3ZJP A;  5B85 A;  1NWI A;  3UHY A;  3QJC A;  2QSS B;  1HRM A;  1YE2 B;  1BVD A;  2Z6N B;  3PI2 A;  1MYF A;  1LFL A;  1N9H A;  2G3H A;  2ZT0 A;  1AJ9 A;  3OJ1 A;  3TM3 A;  3EU1 A;  3G46 A;  1MWD A;  3QJD B;  4MBA A;  3NFE A;  1KD2 A;  1T1N A;  2R4Z A;  3WFT A;  1Y2Z B;  3BJ1 A;  2M6Z A;  3QJE A;  4MPM A;  2GTL A;  1CMY B;  1SPG A;  2HBE A;  1RQA A;  3WCW D;  1A4F A;  1G0A A;  1UIW B;  1Y0C A;  2KSC A;  6HBW A;  1QI8 B;  1R1X A;  3V2V A;  3ZJO A;  2DN1 B;  1O1M A;  1FDH A;  3E55 A;  1V4X B;  1V4W B;  104M A;  1CH7 A;  1DLY A;  1VWT A;  2ZLW A;  1JP9 A;  1YFF B;  3R0G A;  1LFY A;  1IWH A;  1VRE A;  3KUN A;  2MB5 A;  5ILR A;  4ILZ A;  2MGH A;  1MNO A;  3VRG A;  2W72 A;  5CN9 A;  1NEJ A;  1MGN A;  3A9M A;  4F6F A;  3HHB B;  3OGB A;  3G4Y A;  4MU5 A;  4HHB A;  1JWN A;  3IC2 A;  1GJN A;  1MCY A;  2GLN A;  1HDA A;  2FRJ X;  2MYA A;  1LH3 A;  3S66 A;  3E5O A;  1BZ0 B;  3ODQ A;  2DN3 A;  4TWV A;  2SPL A;  1HCO A;  1HHO B;  1G9V B;  1YEQ B;  1CH2 A;  3WCU C;  1ABW A;  3WHM A;  1HGC B;  2ZS0 A;  5EV5 A;  2R4W A;  1JL7 A;  2ZSZ A;  1VXC A;  3ECZ A;  2DN2 A;  3P5Q A;  2GTL C;  2MGE A;  1YH9 A;  2ZS0 D;  2G0S A;  2MGC A;  2SPM A;  2D5Z A;  1YE0 B;  1J3Z B;  3OO4 B;  5JDO F;  3LB4 A;  4MQI B;  3PT8 B;  3G4Q A;  1BZ1 A;  1YE0 A;  4WCH D;  2D5Z B;  2QMB B;  3OO5 A;  1OFJ A;  3EOK A;  3UHR A;  3UHE A;  1NIH B;  1A6K A;  2ZLT A;  4KMW A;  1IT2 A;  1Y0A A;  3P5Q B;  1Y31 A;  1Y01 B;  2DN2 B;  2R80 B;  1MYI A;  4UIQ A;  2LHB A;  3ZOM A;  3G4R A;  1G9V A;  1HHO A;  3QZZ A;  2ZS0 C;  3OZU A;  4IT8 A;  3MJU B;  4N7N A;  1XZV B;  1OFK A;  5E83 A;  3PI3 A;  1N9F A;  2Z6S A;  1JEB A;  1LH5 A;  1HBH B;  3S66 B;  1LA6 A;  2PGH A;  2ZT4 A;  3DHT A;  4HRR B;  1XZ4 B;  3IC2 B;  2ZLU B;  1YGD B;  3HHB A;  3GYS B;  3UHG A;  5C6Y A;  1NS6 B;  3MKB A;  1GVH A;  2QLS B;  2O58 X;  1BIN A;  5AB8 A;  1DXT B;  1EBC A;  3ZJJ A;  1J7W A;  1RQ4 B;  4B4Y A;  2MGF A;  1HBR A;  2LH3 A;  2W6V A;  3UHV A;  5CNF A;  2VEB A;  2OIF A;  3K3U A;  1V4U A;  4XDI A;  1VWT B;  2ZLW B;  2HBC B;  1UX8 A;  4MQJ A;  3UGY A;  1YHU B;  4WJG A;  3UH3 A;  4N8T B;  3WI8 A;  1JP8 A;  1GCW B;  3GDJ B;  1O1M B;  1R1X B;  4HBI A;  1UX9 A;  1QI8 A;  4NI1 B;  1UFP A;  1YOH A;  1Y0C B;  2QU0 A;  1IT3 A;  1SPG B;  3V2Z A;  5D1V A;  1O1O A;  2QRW A;  3MJP B;  1SI4 B;  3LHB A;  3UHU A;  3QJD A;  1XZU A;  3RGK A;  3PEL A;  1BZR A;  3EU1 B;  2BLJ M;  2VLY A;  1MLN A;  5CN6 A;  5EET A;  3SZK B;  5CMV A;  1LFL B;  4NS2 A;  3UBV A;  4F69 A;  1GLI A;  1YE2 A;  2O5T X;  2AA1 A;  4NZI A;  4FH7 A;  3QJC B;  1UMO A;  5JGG A;  2BW9 M;  1UVX A;  2HHE B;  2ZFO D;  3A5G A;  2NRM A;  4N8T A;  1VHB A;  1GBV B;  1YVT A;  3LB3 A;  2MGA A;  5KER A;  2HBC A;  1URY A;  1SDL B;  5M3S A;  2MYB A;  1YVQ A;  1FDH G;  2R1H A;  4F6D A;  4F6I A;  3BJ2 A;  3UHW A;  4WJG 1;  108M A;  3ZJH A;  3ECL A;  4ODC A;  1RQ4 A;  1UT0 A;  4XS0 A;  2DXM B;  1DXT A;  2QLS A;  1WVP A;  1HLB A;  2O5L X;  1V75 B;  1DWT A;  1IDR A;  3GYS A;  1A0Z B;  2ZST A;  1S56 A;  2Z85 A;  3UHD A;  1OR4 A;  1XZ4 A;  2ZFO B;  1Y83 B;  1Y8K B;  4FWZ A;  3GQR A;  1YIH A;  1MOH A;  1A6G A;  1B86 A;  1SHR A;  1O1P A;  1MLH A;  1NZ3 A;  3ZJS A;  5E29 A;  1EMY A;  1UC3 A;  3D4X B;  2R80 A;  2ZSX A;  1Y31 B;  1KFR A;  1YMC A;  1ITH A;  1NIH A;  3G53 A;  3WFW A;  3QM5 A;  3WFU A;  1DTI A;  1LTW A;  1RPS B;  3H57 A;  1UVY A;  4C44 A;  3IA3 B;  4MQI A;  1O1P B;  3LB2 A;  4DC7 A;  2MGM A;  1Y0T A;  1NGK A;  3UHX A;  1YH9 B;  1Y83 A;  1OBM A;  1DXV A;  1HBI A;  4KMV A;  4JYQ A;  2DC3 A;  2DXM A;  1Y5F B;  1YCA A;  3LR7 A;  3R5I B;  3BJ3 B;  4ODC B;  1HBB A;  3ODQ B;  1XQ5 B;  2W31 A;  2BK9 A;  1ECA A;  5D5R A;  3BJ2 B;  3FH9 A;  1YVQ B;  1QSI A;  2ZSR A;  1N9X A;  1MLR A;  2YRS A;  2NSR A;  1Y7G B;  1GCV B;  3D1A B;  1GBV A;  4FWY A;  5EE4 D;  1MBI A;  5HU6 B;  1DXD A;  5JGG B;  1A3O A;  1YIE A;  1YMA A;  2AA1 B;  1GLI B;  1IWH B;  3G52 A;  4F4O A;  1ECO A;  2LH2 A;  1CG5 A;  3PEL B;  5SW7 B;  5E6E B;  1V4W A;  1ABY A;  2HZ2 A;  3HEP A;  3UHC A;  2ZT1 A;  2HHB A;  3HXN A;  5HLX A;  1YDZ B;  3MJP A;  1O1O B;  2LH7 A;  5CND A;  3A0G A;  3ED9 A;  3GK9 A;  4AVE A;  1NWN A;  111M A;  2V1H A;  5EYS A;  1DO3 A;  2FRK X;  4NI1 A;  3HXN B;  2M6Z B;  2AV3 A;  1FN3 B;  2R4X A;  3BJ1 B;  3A5B A;  3GDJ A;  1OUU A;  4DC8 A;  2BKM A;  3NFE B;  1A6M A;  5E6E A;  2ZWJ A;  3ZJN A;  3HEN A;  1YHU A;  3UHQ A;  3MN0 A;  4MQJ B;  3UHK A;  4H2L A;  1MLQ A;  1MLO A;  2Z6N A;  1J7S B;  1VXA A;  3EDB A;  2W6V B;  1ECN A;  1HBR B;  5HU6 A;  1U7S A;  2O5M X;  1Y8H A;  1J7W B;  1TU9 A;  2H35 B;  2MGL A;  1NS9 B;  3MKB B;  2EKU A;  1Y4B A;  1NS6 A;  1CPW A;  2ZSY A;  3HEO A;  3NML A;  3FH9 B;  2V1F A;  1MBC A;  2PGH B;  1LA6 B;  1Y4P B;  1JL6 A;  1HBH A;  1CH3 A;  2D2N A;  1JEB B;  3G4U A;  1HBB B;  1MNJ A;  1XZV A;  3R5I A;  3ZJR A;  1Y5F A;  1MNH A;  1YGF A;  2ZS1 A;  3AG0 A;  2HBG A;  4NI0 A;  1BZP A;  3M3A A;  1VXD A;  1DXV B;  1BVC A;  1Y0A B;  1HGA B;  1NXF A;  2GRZ A;  3PI9 B;  1F63 A;  2ZLT B;  1DO1 A;  1F5O A;  1THB B;  2QMB A;  3AQ5 A;  3OO5 B;  3HYU A;  1Y0T B;  3IC0 B;  3ARJ A;  3WTG A;  1BZ1 B;  1C7B A;  2ZSS A;  1MLJ A;  2BLI A;  1J3Z A;  1BZ6 A;  2VLZ A;  1XXT B;  1J3F A;  4PNJ A;  1LHT A;  3G4V A;  4MQK B;  1GDJ A;  3WCT C;  1MBS A;  3D4X A;  1DXU A;  1ASH A;  3GOU A;  1Y09 B;  5AZR A;  1MTI A;  1HCO B;  1HAB A;  2DN3 B;  3K8B B;  3KMF A;  1OR6 A;  1Y7Z A;  1SHR B;  2OHA A;  1BZ0 A;  1X9F D;  1DO7 A;  4DWT A;  2MBW A;  3QM8 A;  1Y0W A;  1YIH B;  3GQR B;  3FS4 A;  2VYY A;  2FRF A;  1Y8K A;  5EUI A;  3WCT D;  5CHR A;  1A00 A;  4HHB B;  1PBX B;  2MGD A;  1A3N B;  4F6J A;  2O5Q X;  2JHO A;  4JAC A;  1CBM A;  2EKT A;  1LH2 A;  3OZV A;  1YHU C;  1MWB A;  3UHT A;  2EVK A;  2G0R A;  2R1H B;  1LFQ A;  1YFF A;  2ZS1 D;  3DUT B;  5HLU A;  1C7D B;  3RJN B;  3GLN A;  1H97 A;  1Y85 B;  2HHE A;  6HBI A;  2B7H A;  4ESA A;  2DN1 A;  4YU3 A;  3O7N A;  3QM6 A;  1LFZ A;  4MQG B;  5HBI A;  5JDO C;  2ZFB B;  3CY5 B;  1G0A B;  2BLH A;  1A4F B;  1BUW A;  3UGZ A;  1A6N A;  3WR1 A;  2HBE B;  5JDO E;  3UHZ A;  1CMY A;  3SZK A;  2GTL B;  2WTH A;  3HF4 A;  2V1E A;  4KN3 A;  1XZU B;  3CIU A;  2V1I A;  1Y2Z A;  1T1N B;  1KD2 B;  1MBO A;  4H0B A;  1G0B A;  1O1K A;  3HRW A;  1SI4 A;  3UBC A;  1CH9 A;  3E5I A;  1I3E A;  5HAV A;  5EOH A;  3LR9 A;  2QFN A;  2OH8 A;  3QQQ A;  2AUR A;  1O1L B;  2QU0 B;  1YZI A;  2CMM A;  1BBB B;  1Y7D B;  3M39 A;  105M A;  3WCW C;  3AT6 A;  1HJT A;  1GCW A;  3WCU D;  4HSX A;  2WTG A;  1LJW A;  1U7R A;  2WY4 A;  3TLD A;  3G4W A;  1J41 A;  3PI4 A;  1LHS A;  3WCU A;  1Y45 A;  1X46 A;  3S65 B;  4MBN A;  1V4U B;  1HBS A;  1MWC A;  1RTX A;  1IRD A;  2SPN A;  2H8F B;  2IG3 A;  1Y4F B;  2ZSQ A;  2D6C A;  1EW6 A;  4ZVA A;  3KUO A;  1VXG A;  2ZT2 A;  1IBE B;  2HHD A;  4O4T A;  4PQC A;  3GKT A;  1MNI A;  1XZ7 A;  3PT7 A;  5HLQ A;  103M A;  1YGD A;  1HDS A;  2ZLU A;  1A01 B;  1NPF A;  5CNB A;  2ZT3 A;  4HRR A;  3DHT B;  4BJA A;  2ZLV B;  1DUK A;  5E83 B;  3MJU A;  4N7N B;  1X9F C;  1XZ2 A;  1S5Y B;  4U8U D;  1DTM A;  5HY8 A;  2Z8A A;  1DO4 A;  3MYN A;  2XKI A;  1V5H A;  2D60 A;  4OF9 A;  3EOK B;  1VXH A;  4U8U A;  1MLU A;  1CIK A;  1K0Y B;  2GTL D;  3ASE A;  1MKO A;  4MAX A;  1YHU D;  3PT8 A;  5EE4 C;  3WCW A;  3TM9 A;  4N7O A;  1YEV B;  3OO4 A;  1NPG A;  1X3K A;  5C6E B;  1QPW B;  2BWH A;  1QXE B;  3GKV A;  1HSY A;  2ZLX A;  1XY0 A;  2D2N C;  1MBN A;  2EVP A;  1RQ3 A;  2ZS0 B;  1HGC A;  3WHM B;  1ABS A;  1ABW B;  1YMB A;  1OUT A;  1YEQ A;  1TES A;  5MBN A;  3B75 B;  4SDH A;  1YEO A;  1XZ5 B;  1LUE A;  2W6X A;  3UH7 A;  1WMU A;  1O1I B;  1HDA B;  5F2A A;  2HBD A;  2MGI A;  1YG5 A;  2GRF A;  2ZSN A;  3A59 B;  3GQG A;  3D7O B;  2HBF A;  2EF2 A;  5JOM A;  1A0U A;  2O5O X;  1C7C B;  3WCP B;  1MOB A;  1NEJ B;  2OHB A;  3U3E A;  2VM0 A;  1NZ5 A;  3AQ9 A;  1CP0 A;  4FC3 A;  2W72 B;  1GZX B;  1SDK B;  3VRG B;  5EYJ A;  3OZW A;  3WCV B;  5KDQ B;  1CH5 A;  1MLS A;  1XYE A;  3LQD A;  3S48 C;  5CHQ A;  1MZ0 A;  1HV4 A;  1LFY B;  1R1Y A;  1J7Y B;  1COH A;  1G08 A;  1VXE A;  1MTJ A;  1CG8 A;  1MLL A;  2AUO A;  1HBA B;  4TYX A;  4O1T A;  3ONZ A;  4U8U C;  1UFJ A;  3MOU A;  1V4X A;  2EB8 A;  4MQH B;  2H8D A;  4G1V A;  2HZ1 A;  2G0X A;  1MLK A;  6HBW B;  1Y8W B;  4G51 B;  1MYT A;  1UIW A;  3UHI A;  1F65 A;  1BIJ A;  3PI8 A;  1RQA B;  3VHB A;  3WCV D;  1G08 B;  1JF4 A;  1J7Y A;  4N7P B;  4X0L A;  1I3D A;  3E4N A;  3QJE B;  1S5X A;  3LQD B;  1X9F A;  1XYE B;  1Q1F A;  1GZX A;  1SDK A;  1S69 A;  4L2M A;  4ROL A;  1GDL A;  1SPE A;  4G1B A;  3AT5 A;  2RAO B;  5IKS A;  1AJ9 B; 
#chains in the Genus database with same CATH topology
 2VLX A;  3A59 A;  1RVW A;  4FWX A;  1Y0D A;  4H0M A;  2DHB B;  4O2G A;  1KTP A;  2GL3 A;  5CNG A;  2QSS A;  1WMU B;  1MBA A;  3OK5 A;  2NRL A;  3D17 B;  1QSH A;  3M3B A;  2LH1 A;  4ROM B;  4ERV A;  1DM1 A;  1OUT B;  3FEW X;  2MHB B;  3NMM A;  3UI0 A;  1SWM A;  4YU4 B;  1Y22 B;  112M A;  4M4A A;  1Y5K B;  2RI4 A;  3SDN A;  2NX0 A;  3BA2 A;  1PMB A;  1Y4G B;  3NG6 B;  1BZZ A;  4UUR A;  1YEV A;  1KR7 A;  3DHR A;  1DWS A;  1J40 A;  1HDB A;  1I7Y A;  1Y5J A;  4HH1 A;  2D2N D;  2Z6T A;  1HGB B;  1YOI A;  1FAW B;  1A9W A;  2GKM A;  2OH9 A;  4U8U B;  1MBD A;  1C40 A;  2UUN D;  1V07 A;  3H58 A;  4F6B A;  1J3Y B;  2QFK A;  2D2M C;  1MLG A;  2MYC A;  1S5Y A;  4IRO A;  2W6Y A;  1NZ2 A;  1XZ2 B;  1YHE B;  1G09 A;  2D5X B;  4L7Y A;  4HSW A;  2D5X A;  1S6A A;  1G09 B;  4LPI A;  1Y7C A;  1LFV B;  2VJR B;  4NXA A;  1YEU A;  1J3Y A;  5CN4 A;  2FAL A;  1JZL A;  3L0F B;  4NK2 A;  1F0L A;  4MQC B;  3AQ6 A;  1Y35 A;  4B02 A;  1HDS B;  2XYK A;  2GNV A;  1HGB A;  4PQB A;  102M A;  1HDB B;  2HHD B;  2XKG A;  1Y4Q A;  1MYG A;  3GQP B;  1OJ6 A;  1YEN B;  1BZZ B;  3NG6 A;  1ON7 B;  1Y4G A;  1MNK A;  2LH6 A;  2QSP A;  1EYX A;  2D2M A;  3PIA A;  4M4A B;  4M4B B;  2G11 A;  1Y22 A;  1BAB A;  4YU4 A;  3WCU B;  3NMM B;  3W4U B;  1Y4R B;  101M A;  3ZOL A;  1FLP A;  1RSE A;  2MHB A;  1JZK A;  3ARK A;  1FSX A;  3WCT A;  1CQX A;  1DKE A;  4UZV A;  1NQP B;  3D17 A;  3GUQ A;  1YHR A;  3AT6 B;  1O16 A;  2JLG A;  1JY7 B;  1HAC A;  2DHB A;  5F0B A;  1O1L A;  1RVW B;  4MXL A;  3VRE B;  5AZQ A;  4HRT A;  1K1K B;  5AQD A;  2RAO A;  2FAM A;  3MBA A;  1JW8 A;  1GBU B;  2MYE A;  2EB9 A;  1A87 A;  1DLW A;  4ROL B;  2V1J A;  1S0H B;  4NK1 A;  1Y8I A;  1X9F B;  2OLP A;  3CIU B;  1QXD A;  1S5X B;  2MGG A;  2BMM A;  3HF4 B;  1CBL A;  1FSL A;  3PI8 B;  2O5S X;  1BIJ B;  1JP6 A;  1CLS B;  1BUW B;  3D1K B;  1Y4V A;  1B33 A;  1M9P B;  2HCO B;  1Y46 A;  2HBS A;  1Y8I B;  3UH6 A;  4AVD A;  3O89 A;  1S0H A;  2PEG A;  1Y85 A;  3ZJL A;  5CN7 A;  1O1J A;  1C7D A;  3ONZ B;  1URV A;  2UUL H;  1B0B A;  4HRT B;  1JPB A;  4F0U A;  3IXF A;  1CG8 B;  4O35 A;  3VRE A;  1LFQ B;  1DXC A;  5CNE A;  1W92 A;  1YCB A;  1HV4 B;  1HAC B;  1JY7 A;  1F5P A;  2YSK A;  4FH6 A;  1YHR B;  5KDQ A;  1WLA A;  4FC3 B;  1C7C A;  4O4Z A;  3SDH A;  1FSX B;  3WCT B;  1FHJ A;  5CN8 A;  4ZVB A;  1Y4R A;  3W4U A;  3ECX A;  1DDT A;  3D7O A;  1PBX A;  1EWA A;  3GQG B;  2G12 A;  3BCQ B;  3PIA B;  1YG5 B;  2D2M B;  2SPO A;  2HBD B;  3ARL A;  1O1I A;  1Y0W B;  1IOP A;  3BOM B;  1V9Q A;  3QMA A;  1XZ5 A;  3VRF A;  1LH6 A;  2VYW A;  1VRF A;  2IN4 A;  5CN5 A;  3MVC A;  1Y09 A;  1O1N B;  3QQR A;  3UHN A;  1RQ3 B;  1J52 A;  2ZSO A;  3S1I A;  1Y35 B;  3L0F A;  1CO8 A;  1XY0 B;  2ZLX B;  3GKV B;  4MQK A;  1XXT A;  1LFT B;  5C6E A;  3ORD A;  3AQ7 A;  3NL7 A;  1JDO A;  1LFV A;  2R50 A;  1UVL A;  1Y7C B;  1NZ4 A;  1HI1 A;  4F6G A;  3WCW B;  4L7Y B;  2G10 A;  1MKO B;  1M6M A;  3WTG B;  107M A;  3QJB B;  3HYU B;  1HA7 B;  2HZ3 A;  1THB A;  1HLM A;  2UUM A;  3DR9 A;  1GDK A;  3WFX A;  110M A;  3PI9 A;  4XXI A;  1FAW A;  1HA7 A;  2MGJ A;  1N9I A;  2GNW A;  2O5B X;  3QJB A;  4QAU A;  2UUL C;  1I7Y B;  1S61 A;  1Y5J B;  2ZS1 B;  1YOG A;  3DHR B;  4YJJ A;  1L2K A;  3NL7 B;  2D2N B;  1QGW C;  1Y4P A;  1LFT A;  2ZLV A;  1CH4 A;  2X49 A;  4H07 A;  4PO5 A;  1UVK A;  1LH1 A;  4GZG A;  1A01 A;  3ZH0 A;  1O1N A;  1CIO A;  1CH1 A;  3PT7 B;  1Y4B B;  5CNC A;  1MYM A;  1NS9 A;  1DUO A;  4ROM A;  2H35 A;  1RTE A;  1Y8H B;  3QM7 A;  3VRF B;  3M38 A;  1JF3 A;  4DWU A;  3BOM A;  1AJG A;  2H8F A;  7HBI A;  1J7S A;  1IRD B;  3ZHW A;  2LH5 A;  3BCQ A;  1DWR A;  1HBS B;  1Y0D B;  2V1G A;  4TWU A;  4XXK A;  3S65 A;  2NSS A;  4H2L B;  1Y45 B;  3AT5 B;  1ECD A;  2C7J B;  1HBG A;  1FHJ B;  4LM6 B;  2J96 A;  5KKK A;  1LJW B;  2JL9 A;  1MDN A;  3HC9 A;  1OUU B;  1FN3 A;  3UHB A;  5EQM A;  1MLF A;  1MOC A;  1BBB A;  1Y7D A;  4X0L B;  1YZI B;  1MTK A;  1GH0 B;  3KMF C;  4N7P A;  2G0V A;  4B3W A;  4C0N A;  4A8M P;  4F0U B;  3A0G B;  1NAZ A;  3EDA A;  1Y8W A;  4G51 A;  3ZJM A;  2GRH A;  1YDZ A;  3HRW B;  1G0B B;  1O1K B;  2HHB B;  1O1J B;  4A8Y A;  4NXC A;  2H8D B;  2PEG B;  4MQH A;  3QM9 A;  3OVU C;  1ABY B;  2V8A B;  3QZX A;  5SW7 A;  1Y46 B;  2HBS B;  1M9P A;  2HCO A;  3ZJI A;  1AJH A;  1Y4V B;  3AQ8 A;  1HBA A;  1CLS A;  3D1K A;  5ILM A;  1CG5 B;  1CP5 A;  2AUQ A;  2E2Y A;  3WR1 B;  1COH B;  1H1X A;  1R1Y B;  4F4O B;  2VHB A;  3PI1 A;  1D8U A;  2ZFB A;  3CY5 A;  4LMS B;  1LFZ B;  4MQG A;  3UHS A;  1QXD B;  3UHH A;  1XCH A;  4YU3 B;  3WCV A;  1A3O B;  1YIE B;  2B7H B;  2MGK A;  4ESA B;  5MBA A;  1FCS A;  2AV0 A;  3A5A A;  3WCP A;  1GCV A;  3D1A A;  1Y7G A;  1GBU A;  1GDI A;  3DUT A;  1A0U B;  2WCR A;  5B84 A;  2YRS B;  1K1K A;  2HBF B;  1QSI B;  4ESU A;  1UVI A;  2AUP A;  1MYZ A;  1Z8U B;  3MYM A;  1XQ5 A;  1YEO B;  3UH5 A;  1AZI A;  1NQP A;  3B75 A;  4F68 A;  3PMD A;  3BJ3 A;  1DKE B;  2MYD A;  1MDT A;  2ZS1 C;  2VYZ A;  1BAB B;  3S1J A;  1A3N A;  106M A;  1A00 B;  4KJT A;  4M4B A;  4MXK A;  5EUI B;  1EYX B;  2QSP B;  3FS4 B;  5ILE A;  2VEE A;  1QXE A;  2VML A;  1ON7 A;  1QPW A;  4AE1 A;  1KN1 B;  2VJH A;  1YEN A;  1Y7Z B;  2ZFO C;  3DBJ A;  3K8B A;  3GQP A;  2BNL A;  1HAB B;  4N7O B;  109M A;  1Y4Q B;  4LMX B;  1SGK A;  1RPS A;  1JBO A;  4OOD A;  3A2G A;  2MGB A;  3GOU B;  4Q70 A;  1K0Y A;  1DXU B;  2GKN A;  4MQC A;  2D60 B;  1EBT A;  1VXF A;  3RJ6 A;  1CO9 A;  1YEU B;  5HY8 B;  5E29 B;  2VJR A;  1VXB A;  1M6C A;  2GDM A;  1BJE A;  4PQ6 A;  1YHE A;  3WCV C;  2FRI X;  1C7B B;  2W6W A;  4IRO B;  3IC0 A;  1LIA A;  1B86 B;  1C40 B;  2R4Y A;  5ILP A;  2C0K A;  2V1K A;  1HGA A;  2ZFO A;  2G0Z A;  2XKH A;  4NI0 B;  1A0Z A;  1A9W E;  5AQD M;  1HI0 P;  3VAU A;  2ZSP A;  1V75 A;  1XZ7 B;  1MYJ A;  1MLM A;  4F0T B;  1J40 B;  1YGF B;  1IBE A;  4XS0 B;  5JDO D;  2D2M D;  3LB1 A;  4A8W A;  4VHB A;  1Y4F A;  2VRY A;  3K9Z A;  1Y5K A;  2G14 A;  2RI4 B;  3ZJQ A;  1MOD A;  1SDL A;  1LH7 A;  5KER B;  5EU2 A;  2W72 C;  1CQ2 A;  1YVT B;  1IRC A;  1J41 B;  1MYH A;  1JZM A;  1MOA A;  1QSH B;  3ZJP A;  5B85 A;  1NWI A;  3UHY A;  3QJC A;  2QSS B;  1HRM A;  1YE2 B;  1KTP B;  1BVD A;  4H0M B;  1RH1 A;  2Z6N B;  3PI2 A;  1MYF A;  1LFL A;  1N9H A;  2G3H A;  2ZT0 A;  1AJ9 A;  3OJ1 A;  3TM3 A;  3EU1 A;  3G46 A;  1MWD A;  3QJD B;  4BJU A;  4MBA A;  3NFE A;  1KD2 A;  1T1N A;  2R4Z A;  3WFT A;  1Y2Z B;  3BJ1 A;  2M6Z A;  2X4A A;  3QJE A;  4MPM A;  2GTL A;  1CMY B;  1SPG A;  2HBE A;  1RQA A;  3WCW D;  1A4F A;  3GIO A;  1G0A A;  1UIW B;  1Y0C A;  2KSC A;  1CPC A;  6HBW A;  1QI8 B;  1R1X A;  3V2V A;  3ZJO A;  2DN1 B;  1O1M A;  1FDH A;  3E55 A;  1V4X B;  1V4W B;  104M A;  3BRP A;  1CH7 A;  1DLY A;  1VWT A;  2ZLW A;  1JP9 A;  1YFF B;  3R0G A;  1LFY A;  1IWH A;  2WCQ A;  1VRE A;  3KUN A;  2MB5 A;  5ILR A;  4N6S B;  4ILZ A;  2MGH A;  1MNO A;  3VRG A;  2W72 A;  5CN9 A;  1NEJ A;  1MGN A;  3A9M A;  4F6F A;  3HHB B;  3OGB A;  3G4Y A;  4MU5 A;  4HHB A;  1JWN A;  3IC2 A;  1UVM A;  4TMA B;  1GJN A;  1MCY A;  2GLN A;  1HDA A;  2FRJ X;  2MYA A;  1LH3 A;  3S66 A;  3E5O A;  1BZ0 B;  3ODQ A;  2DN3 A;  4TWV A;  2SPL A;  1HCO A;  1HHO B;  1G9V B;  1YEQ B;  1CH2 A;  3WCU C;  1ABW A;  3WHM A;  3V57 B;  1HGC B;  2ZS0 A;  5EV5 A;  2R4W A;  1JL7 A;  2ZSZ A;  1VXC A;  3ECZ A;  2DN2 A;  3P5Q A;  2GTL C;  2MGE A;  1YH9 A;  2ZS0 D;  2G0S A;  2MGC A;  2SPM A;  2D5Z A;  1YE0 B;  1J3Z B;  3OO4 B;  5JDO F;  3V58 A;  4GXE B;  3LB4 A;  2UUN B;  4MQI B;  3PT8 B;  2UUN A;  3G4Q A;  1BZ1 A;  1YE0 A;  4WCH D;  2D5Z B;  2QMB B;  3OO5 A;  2VJT A;  1OFJ A;  3EOK A;  3UHR A;  3UHE A;  1NIH B;  1A6K A;  2ZLT A;  4KMW A;  4RMP A;  1IT2 A;  1Y0A A;  3P5Q B;  1Y31 A;  1Y01 B;  2DN2 B;  2R80 B;  1MYI A;  4UIQ A;  2LHB A;  3ZOM A;  3G4R A;  3V57 A;  2C7K A;  2BV8 B;  1G9V A;  1HHO A;  3QZZ A;  2ZS0 C;  3OZU A;  4IT8 A;  4N7N A;  3MJU B;  1XZV B;  1OFK A;  5E83 A;  3PI3 A;  1N9F A;  2Z6S A;  1JEB A;  1LH5 A;  1F99 A;  1HBH B;  3S66 B;  1LA6 A;  2PGH A;  2ZT4 A;  3DHT A;  2UUL B;  4HRR B;  1XZ4 B;  3IC2 B;  2ZLU B;  1YGD B;  3HHB A;  3GYS B;  3UHG A;  5C6Y A;  1NS6 B;  4AE0 A;  3MKB A;  1GVH A;  2QLS B;  2O58 X;  1BIN A;  5AB8 A;  1DXT B;  1EBC A;  3ZJJ A;  1J7W A;  1RQ4 B;  4B4Y A;  2MGF A;  1HBR A;  2UUL D;  2LH3 A;  2W6V A;  1COL A;  3UHV A;  5CNF A;  2DKC A;  4A8Q A;  2VEB A;  1PHN A;  2OIF A;  3K3U A;  1V4U A;  4XDI A;  1VWT B;  2ZLW B;  2HBC B;  1UX8 A;  4MQJ A;  3UGY A;  1YHU B;  4WJG A;  3UH3 A;  4N8T B;  3WI8 A;  3KVS A;  1JP8 A;  1GCW B;  3GDJ B;  1O1M B;  1R1X B;  4HBI A;  1UX9 A;  1QI8 A;  4NI1 B;  1UFP A;  1YOH A;  1Y0C B;  2QU0 A;  1IT3 A;  1SPG B;  3V2Z A;  5D1V A;  1O1O A;  2QRW A;  3MJP B;  1SI4 B;  3LHB A;  3UHU A;  3QJD A;  1XZU A;  3RGK A;  3PEL A;  1BZR A;  3EU1 B;  2BLJ M;  2VLY A;  1MLN A;  5CN6 A;  5EET A;  3SZK B;  5CMV A;  1LFL B;  4NS2 A;  3UBV A;  4F69 A;  1GLI A;  1YE2 A;  2O5T X;  2AA1 A;  4GY3 B;  4NZI A;  4FH7 A;  3QJC B;  1UMO A;  5JGG A;  2BW9 M;  1UVX A;  2HHE B;  2ZFO D;  3KVS B;  3A5G A;  2NRM A;  4N8T A;  1VHB A;  4ZIZ B;  1GBV B;  1YVT A;  3LB3 A;  1HHT P;  2MGA A;  5KER A;  2HBC A;  1URY A;  1SDL B;  5M3S A;  2MYB A;  1YVQ A;  1FDH G;  2R1H A;  1PHN B;  4F6D A;  4F6I A;  3BJ2 A;  3UHW A;  4WJG 1;  108M A;  3ZJH A;  3ECL A;  3O2C A;  4ODC A;  1RQ4 A;  1UT0 A;  4XS0 A;  2DXM B;  1DXT A;  2QLS A;  1WVP A;  1HLB A;  2O5L X;  1V75 B;  1DWT A;  1IDR A;  3GYS A;  3ZTA A;  1A0Z B;  2ZST A;  1S56 A;  2Z85 A;  3UHD A;  1OR4 A;  1XZ4 A;  2ZFO B;  1Y83 B;  1Y8K B;  4FWZ A;  3GQR A;  1ALL A;  1YIH A;  1MOH A;  1A6G A;  1B86 A;  1LIA B;  1SHR A;  4L1E B;  1O1P A;  2C7L A;  2C7K B;  1MLH A;  1NZ3 A;  3ZJS A;  5E29 A;  1EMY A;  1UC3 A;  3D4X B;  2R80 A;  2ZSX A;  1Y31 B;  1KFR A;  1YMC A;  1ITH A;  1NIH A;  3PMC A;  3G53 A;  3WFW A;  3QM5 A;  3WFU A;  1B8D B;  1NY9 A;  1DTI A;  1LTW A;  1RPS B;  3H57 A;  1UVY A;  4C44 A;  3MWN A;  3IA3 B;  2C7L B;  4MQI A;  1O1P B;  3V58 B;  3LB2 A;  3DBJ B;  4DC7 A;  2VJH B;  1KN1 A;  2MGM A;  1Y0T A;  1NGK A;  2VML B;  4Z8K B;  3UHX A;  1ALL B;  1YH9 B;  1Y83 A;  1OBM A;  1DXV A;  1HBI A;  4ETT A;  4KMV A;  4JYQ A;  2DC3 A;  2DXM A;  1Y5F B;  1YCA A;  3LR7 A;  3NUH B;  3R5I B;  3BJ3 B;  4ODC B;  1HBB A;  3ODQ B;  1XQ5 B;  3O18 B;  2W31 A;  3O2C B;  2BK9 A;  1ECA A;  5D5R A;  3BJ2 B;  3FH9 A;  1YVQ B;  1QSI A;  2ZSR A;  1N9X A;  1MLR A;  2YRS A;  2NSR A;  1Y7G B;  1GCV B;  3D1A B;  1GBV A;  4FWY A;  5EE4 D;  1MBI A;  5HU6 B;  1DXD A;  5JGG B;  1A3O A;  1YIE A;  1YMA A;  2AA1 B;  1GLI B;  1IWH B;  3G52 A;  4F4O A;  1ECO A;  2LH2 A;  5B13 G;  1CG5 A;  3PEL B;  5SW7 B;  3RQR A;  5E6E B;  2V8A A;  1V4W A;  1ABY A;  2HZ2 A;  3HEP A;  3UHC A;  2ZT1 A;  2HHB A;  1XG0 C;  3HXN A;  5HLX A;  1YDZ B;  3MJP A;  4A8O A;  1O1O B;  2LH7 A;  5CND A;  3A0G A;  3ED9 A;  3GK9 A;  4AVE A;  1UVJ A;  1NWN A;  1GH0 A;  111M A;  2V1H A;  5EYS A;  1DO3 A;  2FRK X;  4NI1 A;  3HXN B;  2M6Z B;  2AV3 A;  1FN3 B;  2R4X A;  3BJ1 B;  3A5B A;  3GDJ A;  1OUU A;  4DC8 A;  2BKM A;  3NFE B;  1A6M A;  5E6E A;  2ZWJ A;  1TOX A;  3ZJN A;  3HEN A;  1YHU A;  3UHQ A;  3MN0 A;  4MQJ B;  3UHK A;  4H2L A;  1MLQ A;  1MLO A;  2Z6N A;  1J7S B;  1VXA A;  3EDB A;  2W6V B;  1ECN A;  1HBR B;  5HU6 A;  1U7S A;  2O5M X;  1Y8H A;  1J7W B;  1TU9 A;  2H35 B;  2MGL A;  5B13 A;  1NS9 B;  3MKB B;  2EKU A;  1Y4B A;  1NS6 A;  1CPW A;  2ZSY A;  3VNC A;  3HEO A;  3NML A;  3FH9 B;  2UUL A;  1HHS A;  2V1F A;  1MBC A;  2PGH B;  1LA6 B;  1Y4P B;  1JL6 A;  1HBH A;  1CH3 A;  2D2N A;  3O18 A;  1JEB B;  3G4U A;  1HBB B;  1MNJ A;  1XZV A;  4YJJ B;  3R5I A;  3ZJR A;  1Y5F A;  1MNH A;  1YGF A;  2BV8 A;  2ZS1 A;  3AG0 A;  2HBG A;  4NI0 A;  1BZP A;  3M3A A;  1VXD A;  1DXV B;  1BVC A;  1Y0A B;  1HGA B;  1NXF A;  2GRZ A;  3PI9 B;  1F63 A;  2ZLT B;  4RMP B;  1DO1 A;  1F5O A;  1THB B;  4Z8K A;  2QMB A;  3AQ5 A;  3OO5 B;  3HYU A;  1Y0T B;  3IC0 B;  3ARJ A;  3WTG A;  1BZ1 B;  1C7B A;  2ZSS A;  4ETV A;  4A8F A;  1MLJ A;  4GXE A;  2BLI A;  1J3Z A;  1BZ6 A;  2VLZ A;  1B8D A;  1XXT B;  1J3F A;  4PNJ A;  1LHT A;  3G4V A;  4MQK B;  2JLF A;  1GDJ A;  3WCT C;  1MBS A;  3D4X A;  1DXU A;  1ASH A;  3GOU A;  1Y09 B;  5AZR A;  1XDT T;  1MTI A;  1HCO B;  1HAB A;  2DN3 B;  3K8B B;  3KMF A;  1OR6 A;  1Y7Z A;  1SHR B;  2OHA A;  1BZ0 A;  4L1E A;  1X9F D;  1DO7 A;  4DWT A;  2MBW A;  3QM8 A;  1Y0W A;  1YIH B;  3GQR B;  3FS4 A;  2VYY A;  2FRF A;  1Y8K A;  5EUI A;  3WCT D;  5CHR A;  1A00 A;  4HHB B;  1PBX B;  2MGD A;  1A3N B;  4F6J A;  2O5Q X;  2JHO A;  4JAC A;  1CBM A;  2EKT A;  1LH2 A;  3OZV A;  1YHU C;  1MWB A;  3UHT A;  4A8K A;  2EVK A;  2G0R A;  2R1H B;  1LFQ A;  1YFF A;  2ZS1 D;  3DUT B;  5HLU A;  1C7D B;  4ZIZ A;  3RJN B;  3BRP B;  1WAC A;  3GLN A;  1H97 A;  1Y85 B;  2HHE A;  6HBI A;  2B7H A;  4ESA A;  2DN1 A;  4YU3 A;  3O7N A;  4GY3 A;  5FVB A;  3QM6 A;  1LFZ A;  4MQG B;  5HBI A;  5JDO C;  2ZFB B;  3CY5 B;  1G0A B;  2BLH A;  1A4F B;  1BUW A;  3UGZ A;  1A6N A;  3WR1 A;  2HBE B;  5JDO E;  3UHZ A;  1CMY A;  4A8S A;  3SZK A;  2GTL B;  2WTH A;  3HF4 A;  2V1E A;  4KN3 A;  1XZU B;  3CIU A;  2V1I A;  1Y2Z A;  2UUM X;  1T1N B;  1KD2 B;  1MBO A;  4H0B A;  1G0B A;  1O1K A;  3HRW A;  1SI4 A;  3UBC A;  1CH9 A;  3E5I A;  1I3E A;  5HAV A;  4HH0 A;  5EOH A;  3LR9 A;  2QFN A;  2OH8 A;  3QQQ A;  2AUR A;  1O1L B;  2QU0 B;  1YZI A;  2CMM A;  1BBB B;  1Y7D B;  3M39 A;  105M A;  3WCW C;  3AT6 A;  1HJT A;  1GCW A;  3WCU D;  4HSX A;  2WTG A;  2I88 A;  1LJW A;  1U7R A;  2WY4 A;  3TLD A;  3G4W A;  1J41 A;  3PI4 A;  1LHS A;  2C7J A;  3WCU A;  1Y45 A;  1X46 A;  3S65 B;  4MBN A;  1V4U B;  1HBS A;  1MWC A;  1RTX A;  1IRD A;  2SPN A;  2H8F B;  2IG3 A;  1Y4F B;  1UVN A;  2ZSQ A;  2D6C A;  1EW6 A;  4ZVA A;  3KUO A;  1VXG A;  2ZT2 A;  1IBE B;  2HHD A;  4F0T A;  4O4T A;  4PQC A;  3GKT A;  1MNI A;  1XZ7 A;  3PT7 A;  5HLQ A;  103M A;  1YGD A;  1HDS A;  2ZLU A;  1A01 B;  1NPF A;  5CNB A;  2ZT3 A;  4PO5 B;  4HRR A;  3DHT B;  4BJA A;  2ZLV B;  1F99 B;  1DUK A;  2DKA A;  5E83 B;  3MJU A;  4N7N B;  1X9F C;  4ERT A;  1XZ2 A;  1S5Y B;  4U8U D;  3LQ9 A;  1DTM A;  5HY8 A;  2Z8A A;  1DO4 A;  3MYN A;  2XKI A;  1V5H A;  2D60 A;  4OF9 A;  3EOK B;  1VXH A;  4U8U A;  2UUM B;  1MLU A;  2VJT B;  1CIK A;  1XF6 C;  1K0Y B;  4Q70 B;  2GTL D;  1JBO B;  3ASE A;  1MKO A;  1HI8 A;  1YHU D;  4MAX A;  3PT8 A;  5EE4 C;  3WCW A;  3TM9 A;  4N7O A;  1YEV B;  3OO4 A;  1NPG A;  1X3K A;  5C6E B;  1QPW B;  2BWH A;  1QXE B;  3GKV A;  1HSY A;  2ZLX A;  1XY0 A;  2D2N C;  4ETU A;  1MBN A;  2EVP A;  1RQ3 A;  2ZS0 B;  1HGC A;  3WHM B;  1ABS A;  1ABW B;  1YMB A;  1OUT A;  1YEQ A;  1TES A;  5MBN A;  3B75 B;  4SDH A;  1YEO A;  1XZ5 B;  1LUE A;  2W6X A;  3UH7 A;  1WMU A;  1O1I B;  1HDA B;  5F2A A;  2HBD A;  2MGI A;  1YG5 A;  2GRF A;  2ZSN A;  3A59 B;  3GQG A;  3D7O B;  2HBF A;  2EF2 A;  5JOM A;  1A0U A;  2O5O X;  2DKD A;  1C7C B;  3WCP B;  1MOB A;  1NEJ B;  2OHB A;  3U3E A;  2VM0 A;  1NZ5 A;  3AQ9 A;  1CP0 A;  4FC3 A;  2W72 B;  1GZX B;  1SDK B;  3VRG B;  5EYJ A;  3OZW A;  3WCV B;  5KDQ B;  1CH5 A;  1MLS A;  1XYE A;  3LQD A;  4N6S A;  3S48 C;  5CHQ A;  1MZ0 A;  1HV4 A;  1LFY B;  1R1Y A;  1J7Y B;  1COH A;  1G08 A;  1VXE A;  5FVB M;  1MTJ A;  1CG8 A;  1MLL A;  2AUO A;  1HBA B;  4TYX A;  4O1T A;  3ONZ A;  4U8U C;  1UFJ A;  3MOU A;  1V4X A;  2EB8 A;  4MQH B;  2H8D A;  4G1V A;  2HZ1 A;  2G0X A;  1MLK A;  1CPC B;  6HBW B;  1Y8W B;  4G51 B;  1MYT A;  1UIW A;  1B33 B;  3UHI A;  1F65 A;  1BIJ A;  3PI8 A;  1RQA B;  3VHB A;  3WCV D;  1G08 B;  1JF4 A;  1J7Y A;  4N7P B;  4X0L A;  1I3D A;  3E4N A;  3QJE B;  1S5X A;  3LQD B;  1X9F A;  1XYE B;  1Q1F A;  1GZX A;  1SDK A;  1S69 A;  1CII A;  4L2M A;  4ROL A;  1GDL A;  1SPE A;  4G1B A;  3AT5 A;  2RAO B;  4BS9 A;  5IKS A;  1AJ9 B; 
#chains in the Genus database with same CATH homology
 2VLX A;  3A59 A;  1RVW A;  4FWX A;  1Y0D A;  2DHB B;  4O2G A;  2GL3 A;  5CNG A;  2QSS A;  1WMU B;  1MBA A;  3OK5 A;  2NRL A;  3D17 B;  1QSH A;  3M3B A;  2LH1 A;  4ROM B;  1DM1 A;  1OUT B;  2MHB B;  3NMM A;  3UI0 A;  1SWM A;  4YU4 B;  1Y22 B;  112M A;  4M4A A;  1Y5K B;  2RI4 A;  3SDN A;  2NX0 A;  3BA2 A;  1PMB A;  1Y4G B;  3NG6 B;  1BZZ A;  4UUR A;  1YEV A;  1KR7 A;  3DHR A;  1DWS A;  1J40 A;  1HDB A;  1Y5J A;  2D2N D;  2Z6T A;  1HGB B;  1YOI A;  1FAW B;  1A9W A;  2GKM A;  2OH9 A;  4U8U B;  1MBD A;  1C40 A;  1V07 A;  3H58 A;  4F6B A;  1J3Y B;  2QFK A;  2D2M C;  1MLG A;  2MYC A;  1S5Y A;  4IRO A;  2W6Y A;  1NZ2 A;  1XZ2 B;  1YHE B;  1G09 A;  2D5X B;  4L7Y A;  4HSW A;  2D5X A;  1S6A A;  1G09 B;  4LPI A;  1Y7C A;  1LFV B;  4NXA A;  1YEU A;  1J3Y A;  5CN4 A;  2FAL A;  1JZL A;  4NK2 A;  4MQC B;  3AQ6 A;  1Y35 A;  1HDS B;  2XYK A;  2GNV A;  1HGB A;  4PQB A;  102M A;  1HDB B;  2HHD B;  2XKG A;  1Y4Q A;  1MYG A;  3GQP B;  1OJ6 A;  1YEN B;  1BZZ B;  3NG6 A;  1Y4G A;  1MNK A;  2LH6 A;  2QSP A;  2D2M A;  3PIA A;  4M4A B;  4M4B B;  2G11 A;  1Y22 A;  1BAB A;  4YU4 A;  3WCU B;  3NMM B;  3W4U B;  1Y4R B;  101M A;  3ZOL A;  1FLP A;  1RSE A;  2MHB A;  1JZK A;  3ARK A;  1FSX A;  3WCT A;  1CQX A;  1DKE A;  4UZV A;  1NQP B;  3D17 A;  1YHR A;  3AT6 B;  1O16 A;  1JY7 B;  1HAC A;  2DHB A;  5F0B A;  1O1L A;  1RVW B;  4MXL A;  3VRE B;  5AZQ A;  4HRT A;  1K1K B;  2RAO A;  2FAM A;  3MBA A;  1JW8 A;  1GBU B;  2MYE A;  2EB9 A;  1DLW A;  4ROL B;  2V1J A;  1S0H B;  4NK1 A;  1Y8I A;  1X9F B;  2OLP A;  3CIU B;  1QXD A;  1S5X B;  2MGG A;  2BMM A;  3HF4 B;  1CBL A;  1FSL A;  3PI8 B;  2O5S X;  1BIJ B;  1JP6 A;  1CLS B;  1BUW B;  3D1K B;  1Y4V A;  1M9P B;  2HCO B;  1Y46 A;  2HBS A;  1Y8I B;  3UH6 A;  4AVD A;  3O89 A;  1S0H A;  2PEG A;  1Y85 A;  3ZJL A;  5CN7 A;  1O1J A;  1C7D A;  3ONZ B;  1URV A;  1B0B A;  4HRT B;  1JPB A;  3IXF A;  1CG8 B;  4O35 A;  3VRE A;  1LFQ B;  1DXC A;  5CNE A;  1W92 A;  1YCB A;  1HV4 B;  1HAC B;  1JY7 A;  1F5P A;  4FH6 A;  1YHR B;  5KDQ A;  1WLA A;  4FC3 B;  1C7C A;  4O4Z A;  3SDH A;  1FSX B;  3WCT B;  1FHJ A;  5CN8 A;  4ZVB A;  1Y4R A;  3W4U A;  3ECX A;  3D7O A;  1PBX A;  1EWA A;  3GQG B;  2G12 A;  3BCQ B;  3PIA B;  1YG5 B;  2D2M B;  2SPO A;  2HBD B;  3ARL A;  1O1I A;  1Y0W B;  1IOP A;  3BOM B;  1V9Q A;  3QMA A;  1XZ5 A;  3VRF A;  1LH6 A;  2VYW A;  1VRF A;  2IN4 A;  5CN5 A;  3MVC A;  1Y09 A;  1O1N B;  3QQR A;  3UHN A;  1RQ3 B;  1J52 A;  2ZSO A;  3S1I A;  1Y35 B;  1CO8 A;  1XY0 B;  2ZLX B;  3GKV B;  4MQK A;  1XXT A;  1LFT B;  5C6E A;  3ORD A;  3AQ7 A;  3NL7 A;  1JDO A;  1LFV A;  2R50 A;  1Y7C B;  1NZ4 A;  4F6G A;  3WCW B;  4L7Y B;  2G10 A;  1MKO B;  1M6M A;  3WTG B;  107M A;  3QJB B;  3HYU B;  2HZ3 A;  1THB A;  1HLM A;  3DR9 A;  1GDK A;  3WFX A;  110M A;  3PI9 A;  1FAW A;  2MGJ A;  1N9I A;  2GNW A;  2O5B X;  3QJB A;  4QAU A;  1S61 A;  1Y5J B;  2ZS1 B;  1YOG A;  3DHR B;  1L2K A;  3NL7 B;  2D2N B;  1Y4P A;  1LFT A;  2ZLV A;  1CH4 A;  4H07 A;  1LH1 A;  4GZG A;  1A01 A;  3ZH0 A;  1O1N A;  1CIO A;  1CH1 A;  3PT7 B;  1Y4B B;  5CNC A;  1MYM A;  1NS9 A;  1DUO A;  4ROM A;  2H35 A;  1RTE A;  1Y8H B;  3QM7 A;  3VRF B;  3M38 A;  1JF3 A;  4DWU A;  3BOM A;  1AJG A;  2H8F A;  7HBI A;  1J7S A;  1IRD B;  3ZHW A;  2LH5 A;  3BCQ A;  1DWR A;  1HBS B;  1Y0D B;  2V1G A;  4TWU A;  3S65 A;  2NSS A;  4H2L B;  1Y45 B;  3AT5 B;  1ECD A;  1HBG A;  1FHJ B;  5KKK A;  1LJW B;  1MDN A;  3HC9 A;  1OUU B;  1FN3 A;  3UHB A;  5EQM A;  1MLF A;  1MOC A;  1BBB A;  1Y7D A;  4X0L B;  1YZI B;  1MTK A;  3KMF C;  4N7P A;  2G0V A;  4B3W A;  4C0N A;  3A0G B;  1NAZ A;  3EDA A;  1Y8W A;  4G51 A;  3ZJM A;  2GRH A;  1YDZ A;  3HRW B;  1G0B B;  1O1K B;  2HHB B;  1O1J B;  4NXC A;  2H8D B;  2PEG B;  4MQH A;  3QM9 A;  3OVU C;  1ABY B;  3QZX A;  5SW7 A;  1Y46 B;  2HBS B;  1M9P A;  2HCO A;  3ZJI A;  1AJH A;  1Y4V B;  3AQ8 A;  1HBA A;  1CLS A;  3D1K A;  5ILM A;  1CG5 B;  1CP5 A;  2AUQ A;  2E2Y A;  3WR1 B;  1COH B;  1H1X A;  1R1Y B;  4F4O B;  2VHB A;  3PI1 A;  1D8U A;  2ZFB A;  3CY5 A;  1LFZ B;  4MQG A;  3UHS A;  1QXD B;  3UHH A;  1XCH A;  4YU3 B;  3WCV A;  1A3O B;  1YIE B;  2B7H B;  2MGK A;  4ESA B;  5MBA A;  1FCS A;  2AV0 A;  3A5A A;  3WCP A;  1GCV A;  3D1A A;  1Y7G A;  1GBU A;  1GDI A;  3DUT A;  1A0U B;  5B84 A;  2YRS B;  1K1K A;  2HBF B;  1QSI B;  2AUP A;  1MYZ A;  1Z8U B;  3MYM A;  1XQ5 A;  1YEO B;  3UH5 A;  1AZI A;  1NQP A;  3B75 A;  4F68 A;  3BJ3 A;  1DKE B;  2MYD A;  2ZS1 C;  2VYZ A;  1BAB B;  3S1J A;  1A3N A;  106M A;  1A00 B;  4KJT A;  4M4B A;  4MXK A;  5EUI B;  2QSP B;  3FS4 B;  5ILE A;  2VEE A;  1QXE A;  1QPW A;  1YEN A;  1Y7Z B;  2ZFO C;  3K8B A;  3GQP A;  2BNL A;  1HAB B;  4N7O B;  109M A;  1Y4Q B;  1RPS A;  4OOD A;  3A2G A;  2MGB A;  3GOU B;  1K0Y A;  1DXU B;  2GKN A;  4MQC A;  2D60 B;  1EBT A;  1VXF A;  3RJ6 A;  1CO9 A;  1YEU B;  5HY8 B;  5E29 B;  1VXB A;  1M6C A;  2GDM A;  1BJE A;  4PQ6 A;  1YHE A;  3WCV C;  2FRI X;  1C7B B;  2W6W A;  4IRO B;  3IC0 A;  1B86 B;  1C40 B;  2R4Y A;  5ILP A;  2C0K A;  2V1K A;  1HGA A;  2ZFO A;  2G0Z A;  2XKH A;  4NI0 B;  1A0Z A;  1A9W E;  3VAU A;  2ZSP A;  1V75 A;  1XZ7 B;  1MYJ A;  1MLM A;  1J40 B;  1YGF B;  1IBE A;  4XS0 B;  5JDO D;  2D2M D;  3LB1 A;  4VHB A;  1Y4F A;  2VRY A;  3K9Z A;  1Y5K A;  2G14 A;  2RI4 B;  3ZJQ A;  1MOD A;  1SDL A;  1LH7 A;  5KER B;  5EU2 A;  2W72 C;  1CQ2 A;  1YVT B;  1IRC A;  1J41 B;  1MYH A;  1JZM A;  1MOA A;  1QSH B;  3ZJP A;  5B85 A;  1NWI A;  3UHY A;  3QJC A;  2QSS B;  1HRM A;  1YE2 B;  1BVD A;  2Z6N B;  3PI2 A;  1MYF A;  1LFL A;  1N9H A;  2G3H A;  2ZT0 A;  1AJ9 A;  3OJ1 A;  3TM3 A;  3EU1 A;  3G46 A;  1MWD A;  3QJD B;  4MBA A;  3NFE A;  1KD2 A;  1T1N A;  2R4Z A;  3WFT A;  1Y2Z B;  3BJ1 A;  2M6Z A;  3QJE A;  4MPM A;  2GTL A;  1CMY B;  1SPG A;  2HBE A;  1RQA A;  3WCW D;  1A4F A;  1G0A A;  1UIW B;  1Y0C A;  2KSC A;  6HBW A;  1QI8 B;  1R1X A;  3V2V A;  3ZJO A;  2DN1 B;  1O1M A;  1FDH A;  3E55 A;  1V4X B;  1V4W B;  104M A;  1CH7 A;  1DLY A;  1VWT A;  2ZLW A;  1JP9 A;  1YFF B;  3R0G A;  1LFY A;  1IWH A;  1VRE A;  3KUN A;  2MB5 A;  5ILR A;  4ILZ A;  2MGH A;  1MNO A;  3VRG A;  2W72 A;  5CN9 A;  1NEJ A;  1MGN A;  3A9M A;  4F6F A;  3HHB B;  3OGB A;  3G4Y A;  4MU5 A;  4HHB A;  1JWN A;  3IC2 A;  1GJN A;  1MCY A;  2GLN A;  1HDA A;  2FRJ X;  2MYA A;  1LH3 A;  3S66 A;  3E5O A;  1BZ0 B;  3ODQ A;  2DN3 A;  4TWV A;  2SPL A;  1HCO A;  1HHO B;  1G9V B;  1YEQ B;  1CH2 A;  3WCU C;  1ABW A;  3WHM A;  1HGC B;  2ZS0 A;  5EV5 A;  2R4W A;  1JL7 A;  2ZSZ A;  1VXC A;  3ECZ A;  2DN2 A;  3P5Q A;  2GTL C;  2MGE A;  1YH9 A;  2ZS0 D;  2G0S A;  2MGC A;  2SPM A;  2D5Z A;  1YE0 B;  1J3Z B;  3OO4 B;  5JDO F;  3LB4 A;  4MQI B;  3PT8 B;  3G4Q A;  1BZ1 A;  1YE0 A;  4WCH D;  2D5Z B;  2QMB B;  3OO5 A;  1OFJ A;  3EOK A;  3UHR A;  3UHE A;  1NIH B;  1A6K A;  2ZLT A;  4KMW A;  1IT2 A;  1Y0A A;  3P5Q B;  1Y31 A;  1Y01 B;  2DN2 B;  2R80 B;  1MYI A;  4UIQ A;  2LHB A;  3ZOM A;  3G4R A;  1G9V A;  1HHO A;  3QZZ A;  2ZS0 C;  3OZU A;  4IT8 A;  3MJU B;  4N7N A;  1XZV B;  1OFK A;  5E83 A;  3PI3 A;  1N9F A;  2Z6S A;  1JEB A;  1LH5 A;  1HBH B;  3S66 B;  1LA6 A;  2PGH A;  2ZT4 A;  3DHT A;  4HRR B;  1XZ4 B;  3IC2 B;  2ZLU B;  1YGD B;  3HHB A;  3GYS B;  3UHG A;  5C6Y A;  1NS6 B;  3MKB A;  1GVH A;  2QLS B;  2O58 X;  1BIN A;  5AB8 A;  1DXT B;  1EBC A;  3ZJJ A;  1J7W A;  1RQ4 B;  4B4Y A;  2MGF A;  1HBR A;  2LH3 A;  2W6V A;  3UHV A;  5CNF A;  2VEB A;  2OIF A;  3K3U A;  1V4U A;  4XDI A;  1VWT B;  2ZLW B;  2HBC B;  1UX8 A;  4MQJ A;  3UGY A;  1YHU B;  4WJG A;  3UH3 A;  4N8T B;  3WI8 A;  1JP8 A;  1GCW B;  3GDJ B;  1O1M B;  1R1X B;  4HBI A;  1UX9 A;  1QI8 A;  4NI1 B;  1UFP A;  1YOH A;  1Y0C B;  2QU0 A;  1IT3 A;  1SPG B;  3V2Z A;  5D1V A;  1O1O A;  2QRW A;  3MJP B;  1SI4 B;  3LHB A;  3UHU A;  3QJD A;  1XZU A;  3RGK A;  3PEL A;  1BZR A;  3EU1 B;  2BLJ M;  2VLY A;  1MLN A;  5CN6 A;  5EET A;  3SZK B;  5CMV A;  1LFL B;  4NS2 A;  3UBV A;  4F69 A;  1GLI A;  1YE2 A;  2O5T X;  2AA1 A;  4NZI A;  4FH7 A;  3QJC B;  1UMO A;  5JGG A;  2BW9 M;  1UVX A;  2HHE B;  2ZFO D;  3A5G A;  2NRM A;  4N8T A;  1VHB A;  1GBV B;  1YVT A;  3LB3 A;  2MGA A;  5KER A;  2HBC A;  1URY A;  1SDL B;  5M3S A;  2MYB A;  1YVQ A;  1FDH G;  2R1H A;  4F6D A;  4F6I A;  3BJ2 A;  3UHW A;  4WJG 1;  108M A;  3ZJH A;  3ECL A;  4ODC A;  1RQ4 A;  1UT0 A;  4XS0 A;  2DXM B;  1DXT A;  2QLS A;  1WVP A;  1HLB A;  2O5L X;  1V75 B;  1DWT A;  1IDR A;  3GYS A;  1A0Z B;  2ZST A;  1S56 A;  2Z85 A;  3UHD A;  1OR4 A;  1XZ4 A;  2ZFO B;  1Y83 B;  1Y8K B;  4FWZ A;  3GQR A;  1YIH A;  1MOH A;  1A6G A;  1B86 A;  1SHR A;  1O1P A;  1MLH A;  1NZ3 A;  3ZJS A;  5E29 A;  1EMY A;  1UC3 A;  3D4X B;  2R80 A;  2ZSX A;  1Y31 B;  1KFR A;  1YMC A;  1ITH A;  1NIH A;  3G53 A;  3WFW A;  3QM5 A;  3WFU A;  1DTI A;  1LTW A;  1RPS B;  3H57 A;  1UVY A;  4C44 A;  3IA3 B;  4MQI A;  1O1P B;  3LB2 A;  4DC7 A;  2MGM A;  1Y0T A;  1NGK A;  3UHX A;  1YH9 B;  1Y83 A;  1OBM A;  1DXV A;  1HBI A;  4KMV A;  4JYQ A;  2DC3 A;  2DXM A;  1Y5F B;  1YCA A;  3LR7 A;  3R5I B;  3BJ3 B;  4ODC B;  1HBB A;  3ODQ B;  1XQ5 B;  2W31 A;  2BK9 A;  1ECA A;  5D5R A;  3BJ2 B;  3FH9 A;  1YVQ B;  1QSI A;  2ZSR A;  1N9X A;  1MLR A;  2YRS A;  2NSR A;  1Y7G B;  1GCV B;  3D1A B;  1GBV A;  4FWY A;  5EE4 D;  1MBI A;  5HU6 B;  1DXD A;  5JGG B;  1A3O A;  1YIE A;  1YMA A;  2AA1 B;  1GLI B;  1IWH B;  3G52 A;  4F4O A;  1ECO A;  2LH2 A;  1CG5 A;  3PEL B;  5SW7 B;  5E6E B;  1V4W A;  1ABY A;  2HZ2 A;  3HEP A;  3UHC A;  2ZT1 A;  2HHB A;  3HXN A;  5HLX A;  1YDZ B;  3MJP A;  1O1O B;  2LH7 A;  5CND A;  3A0G A;  3ED9 A;  3GK9 A;  4AVE A;  1NWN A;  111M A;  2V1H A;  5EYS A;  1DO3 A;  2FRK X;  4NI1 A;  3HXN B;  2M6Z B;  2AV3 A;  1FN3 B;  2R4X A;  3BJ1 B;  3A5B A;  3GDJ A;  1OUU A;  4DC8 A;  2BKM A;  3NFE B;  1A6M A;  5E6E A;  2ZWJ A;  3ZJN A;  3HEN A;  1YHU A;  3UHQ A;  3MN0 A;  4MQJ B;  3UHK A;  4H2L A;  1MLQ A;  1MLO A;  2Z6N A;  1J7S B;  1VXA A;  3EDB A;  2W6V B;  1ECN A;  1HBR B;  5HU6 A;  1U7S A;  2O5M X;  1Y8H A;  1J7W B;  1TU9 A;  2H35 B;  2MGL A;  1NS9 B;  3MKB B;  2EKU A;  1Y4B A;  1NS6 A;  1CPW A;  2ZSY A;  3HEO A;  3NML A;  3FH9 B;  2V1F A;  1MBC A;  2PGH B;  1LA6 B;  1Y4P B;  1JL6 A;  1HBH A;  1CH3 A;  2D2N A;  1JEB B;  3G4U A;  1HBB B;  1MNJ A;  1XZV A;  3R5I A;  3ZJR A;  1Y5F A;  1MNH A;  1YGF A;  2ZS1 A;  3AG0 A;  2HBG A;  4NI0 A;  1BZP A;  3M3A A;  1VXD A;  1DXV B;  1BVC A;  1Y0A B;  1HGA B;  1NXF A;  2GRZ A;  3PI9 B;  1F63 A;  2ZLT B;  1DO1 A;  1F5O A;  1THB B;  2QMB A;  3AQ5 A;  3OO5 B;  3HYU A;  1Y0T B;  3IC0 B;  3ARJ A;  3WTG A;  1BZ1 B;  1C7B A;  2ZSS A;  1MLJ A;  2BLI A;  1J3Z A;  1BZ6 A;  2VLZ A;  1XXT B;  1J3F A;  4PNJ A;  1LHT A;  3G4V A;  4MQK B;  1GDJ A;  3WCT C;  1MBS A;  3D4X A;  1DXU A;  1ASH A;  3GOU A;  1Y09 B;  5AZR A;  1MTI A;  1HCO B;  1HAB A;  2DN3 B;  3K8B B;  3KMF A;  1OR6 A;  1Y7Z A;  1SHR B;  2OHA A;  1BZ0 A;  1X9F D;  1DO7 A;  4DWT A;  2MBW A;  3QM8 A;  1Y0W A;  1YIH B;  3GQR B;  3FS4 A;  2VYY A;  2FRF A;  1Y8K A;  5EUI A;  3WCT D;  5CHR A;  1A00 A;  4HHB B;  1PBX B;  2MGD A;  1A3N B;  4F6J A;  2O5Q X;  2JHO A;  4JAC A;  1CBM A;  2EKT A;  1LH2 A;  3OZV A;  1YHU C;  1MWB A;  3UHT A;  2EVK A;  2G0R A;  2R1H B;  1LFQ A;  1YFF A;  2ZS1 D;  3DUT B;  5HLU A;  1C7D B;  3RJN B;  3GLN A;  1H97 A;  1Y85 B;  2HHE A;  6HBI A;  2B7H A;  4ESA A;  2DN1 A;  4YU3 A;  3O7N A;  3QM6 A;  1LFZ A;  4MQG B;  5HBI A;  5JDO C;  2ZFB B;  3CY5 B;  1G0A B;  2BLH A;  1A4F B;  1BUW A;  3UGZ A;  1A6N A;  3WR1 A;  2HBE B;  5JDO E;  3UHZ A;  1CMY A;  3SZK A;  2GTL B;  2WTH A;  3HF4 A;  2V1E A;  4KN3 A;  1XZU B;  3CIU A;  2V1I A;  1Y2Z A;  1T1N B;  1KD2 B;  1MBO A;  4H0B A;  1G0B A;  1O1K A;  3HRW A;  1SI4 A;  3UBC A;  1CH9 A;  3E5I A;  1I3E A;  5HAV A;  5EOH A;  3LR9 A;  2QFN A;  2OH8 A;  3QQQ A;  2AUR A;  1O1L B;  2QU0 B;  1YZI A;  2CMM A;  1BBB B;  1Y7D B;  3M39 A;  105M A;  3WCW C;  3AT6 A;  1HJT A;  1GCW A;  3WCU D;  4HSX A;  2WTG A;  1LJW A;  1U7R A;  2WY4 A;  3TLD A;  3G4W A;  1J41 A;  3PI4 A;  1LHS A;  3WCU A;  1Y45 A;  1X46 A;  3S65 B;  4MBN A;  1V4U B;  1HBS A;  1MWC A;  1RTX A;  1IRD A;  2SPN A;  2H8F B;  2IG3 A;  1Y4F B;  2ZSQ A;  2D6C A;  1EW6 A;  4ZVA A;  3KUO A;  1VXG A;  2ZT2 A;  1IBE B;  2HHD A;  4O4T A;  4PQC A;  3GKT A;  1MNI A;  1XZ7 A;  3PT7 A;  5HLQ A;  103M A;  1YGD A;  1HDS A;  2ZLU A;  1A01 B;  1NPF A;  5CNB A;  2ZT3 A;  4HRR A;  3DHT B;  4BJA A;  2ZLV B;  1DUK A;  5E83 B;  3MJU A;  4N7N B;  1X9F C;  1XZ2 A;  1S5Y B;  4U8U D;  1DTM A;  5HY8 A;  2Z8A A;  1DO4 A;  3MYN A;  2XKI A;  1V5H A;  2D60 A;  4OF9 A;  3EOK B;  1VXH A;  4U8U A;  1MLU A;  1CIK A;  1K0Y B;  2GTL D;  3ASE A;  1MKO A;  4MAX A;  1YHU D;  3PT8 A;  5EE4 C;  3WCW A;  3TM9 A;  4N7O A;  1YEV B;  3OO4 A;  1NPG A;  1X3K A;  5C6E B;  1QPW B;  2BWH A;  1QXE B;  3GKV A;  1HSY A;  2ZLX A;  1XY0 A;  2D2N C;  1MBN A;  2EVP A;  1RQ3 A;  2ZS0 B;  1HGC A;  3WHM B;  1ABS A;  1ABW B;  1YMB A;  1OUT A;  1YEQ A;  1TES A;  5MBN A;  3B75 B;  4SDH A;  1YEO A;  1XZ5 B;  1LUE A;  2W6X A;  3UH7 A;  1WMU A;  1O1I B;  1HDA B;  5F2A A;  2HBD A;  2MGI A;  1YG5 A;  2GRF A;  2ZSN A;  3A59 B;  3GQG A;  3D7O B;  2HBF A;  2EF2 A;  5JOM A;  1A0U A;  2O5O X;  1C7C B;  3WCP B;  1MOB A;  1NEJ B;  2OHB A;  3U3E A;  2VM0 A;  1NZ5 A;  3AQ9 A;  1CP0 A;  4FC3 A;  2W72 B;  1GZX B;  1SDK B;  3VRG B;  5EYJ A;  3OZW A;  3WCV B;  5KDQ B;  1CH5 A;  1MLS A;  1XYE A;  3LQD A;  3S48 C;  5CHQ A;  1MZ0 A;  1HV4 A;  1LFY B;  1R1Y A;  1J7Y B;  1COH A;  1G08 A;  1VXE A;  1MTJ A;  1CG8 A;  1MLL A;  2AUO A;  1HBA B;  4TYX A;  4O1T A;  3ONZ A;  4U8U C;  1UFJ A;  3MOU A;  1V4X A;  2EB8 A;  4MQH B;  2H8D A;  4G1V A;  2HZ1 A;  2G0X A;  1MLK A;  6HBW B;  1Y8W B;  4G51 B;  1MYT A;  1UIW A;  3UHI A;  1F65 A;  1BIJ A;  3PI8 A;  1RQA B;  3VHB A;  3WCV D;  1G08 B;  1JF4 A;  1J7Y A;  4N7P B;  4X0L A;  1I3D A;  3E4N A;  3QJE B;  1S5X A;  3LQD B;  1X9F A;  1XYE B;  1Q1F A;  1GZX A;  1SDK A;  1S69 A;  4L2M A;  4ROL A;  1GDL A;  1SPE A;  4G1B A;  3AT5 A;  2RAO B;  5IKS A;  1AJ9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...