3AQBB

M. luteus b-p 26 heterodimeric hexaprenyl diphosphate synthase in complex with magnesium
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
321
structure length
321
Chain Sequence
SYKAFLNPYIIEVEKRLYECIQSDSETINKAAHHILSSGGKRVRPMFVLLSGFLNDTQKDDLIRTAVSLELVHMASLVHDDYIDNSDMRRGNTSVHIAFDKDTAIRTGHFLLARALQNIATINNSKFHQIFSKTILEVCFGEFDQMADRFNYPVSFTAYLRRINRKTAILIEASCHLGALSSQLDEQSTYHIKQFGHCIGMSYQIIDDILDYTSDEATLGKPVGSDIRNGHITYPLMAAIANLKEQDDDKLEAVVKHLTSTSDDEVYQYIVSQVKQYGIEPAELLSRKYGDKAKYHLSQLQDSNIKDYLEEIHEKMLKRVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Component A of hexaprenyl diphosphate synthase
publication title Crystal structure of heterodimeric hexaprenyl diphosphate synthase from Micrococcus luteus B-P 26 reveals that the small subunit is directly involved in the product chain length regulation.
pubmed doi rcsb
source organism Micrococcus luteus
molecule tags Transferase
total genus 131
structure length 321
sequence length 321
chains with identical sequence D
ec nomenclature ec 2.5.1.83: Hexaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific).
pdb deposition date 2010-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3aqbB00
5B0MA 1N24A 2AEKA 3W7FA 3P5RA 3SAEA 1VG6A 4LZCA 2OPNA 1EZFA 3M0GA 5HN9A 1YYQA 3MZVA 2Z4VA 4K10A 4EA0A 3VJDA 4OKZA 3ICZA 3KRFB 5B02A 5JV2F 3LZ9A 3S4JA 4KUXA 5ILKA 1V4KA 3LK5A 4MC8A 1YV5A 1N20A 5DJRF 3ICMA 5CG6A 5B01A 2ZCSA 1YYSA 3UCAA 5I1UA 3RYWA 4DEMF 4LLSA 2FTZA 4E9ZA 1WL2A 2RAHA 4GAXA 4RNQA 5E8KA 5AELA 4Q23A 2OPMA 3WSAA 3VJAA 5E8LA 4XQRF 4XQTF 3G4FA 4DI5A 5IMNA 4KVDA 3ACXA 3WCEA 3WCGA 5HNAA 3N1WF 2Z4YA 3WEHA 3ZL6A 3OACA 4OGUA 3WCIA 5HN7A 2Q9ZA 2AZKA 1KIYA 1HXAA 2Z4ZA 4LIXA 1VG4A 2FORA 4PVYF 4KVYA 3LVSA 4QXSF 3SDUA 2E8WA 2Z4XA 4LPHF 4GA3A 3OABB 4KQUA 3LOMA 4OMGA 4RXEA 3Q2QA 3S9VA 4LOBA 1UBYA 4F6VA 3QKCA 1JFGA 5ILJA 2Q58A 3IBAA 2Z78A 3ZCDA 4KWDA 2F94F 4GP2A 1UBWA 4RXAA 1HX9A 4ZQ8A 1WL1A 3VJBA 2PS8A 3LEEA 4KK2A 4KVWA 3CC9A 1WL0A 1KIZA 1YHLA 4DWGA 2E8TA 4LLTA 3N0GA 2Q80A 4JXYA 2E8VA 3CKEA 3ZMCA 3ACYA 5IMPA 3KROA 5H9DA 5DHIA 1N22A 3M02A 5C05A 3KRPB 3VJ8A 2AELA 3P5PA 4RXCA 5EAUA 2E8XA 5B0LA 3SDTA 4KQ5A 4KQSA 5IN8A 4RYPA 4H5CF 3WC9A 2Z7HA 1N23A 3BNYA 3WEGA 3WCDA 5KSXF 3N0FA 3Q30A 4H5EF 3WE9A 5DGNF 4FP4A 3LSNA 5E8HA 2J1OA 5B0KA 3N5JF 1YHMA 4JZBA 3VJEA 5EASA 3V66A 4LFVF 5ERMA 4F6XA 4NFJF 4DWBA 2Q9YA 3KRFA 5IK6A 5DIQF 2DH4A 4JYXA 2E4OA 3Q1OA 3ADZA 3LG5A 1YQ7A 4NKFA 3DYHA 3B7LA 5IK0A 2ZY1A 3PH7A 4DZWA 5JUZF 3N5HF 4XQSF 3N3DA 3MAVA 3V1VA 3KRCA 3CP6A 1RTRA 4EA2A 3WEFA 1HXGA 2Z52A 3OACB 4HD1A 3RBMA 3ACWA 3BNXA 4NFIF 3NPRA 2F92F 1DI1A 2E90A 2I19A 5ILIA 5ILYA 2O1OA 4P0XA 3KBKA 5DGSF 3WJOA 2PS5A 3VJ9A 2ZCOA 4GP1A 2E92A 4LZ0A 3DYGA 3N1VF 1RQIA 5EATA 3KRAA 4NG6A 3WEIA 3WCHA 3LGKA 4OKMA 1RQJA 4NUAA 4QPFA 3LJIA 1YYTA 4LA6A 5DGMF 5EROA 4KPJA 3WCCA 5IL3A 4LTZA 4MC0A 3M00A 3ASXA 3OABA 4WK5A 3LMDA 4E1EA 2F89F 3AE0A 3P8LA 3VJCA 1WMWA 2AZLA 5IKAA 3WEJA 5A0IA 4N1ZF 4NKEA 3KROB 1HM7A 2H8OA 3EFQA 2ZEUA 4DXJA 2QISA 3NF2A 3SDRA 3WCJA 5JV1F 3M01A 3P8RA 5AFXA 3ICKA 4LTVA 2E93A 4P0VA 3ICNA 3NRIA 5B0IA 2Z4WA 3WJKA 3DYFA 5ILHA 5ERNA 4KKMA 1ZW5A 4JVJF 1V4IA 4JXNA 3TFPA 3M9UA 5IVGA 1V4JA 3LLWA 3Q2ZA 5IM1A 3PDEA 4LFGA 1WY0A 3N3LF 1YYUA 2E95A 4F62A 5AYPA 4LPGF 5ILDA 4MC3A 4KFAA 1V4HA 1YHKA 3EZ3A 4UMJA 3N45F 4EA1A 5JA0F 5B03A 3P41A 5A0JA 5DJVF 3RYEA 2OGDA 4KPDA 2Z7IA 1UBVA 3TFVA 3WSBA 3WCAA 4H5DF 4LA5A 4LFEA 3IPIA 3NPKA 3PYAA 4PVXF 3AQCB 3AQBB 3PKOA 4RXDA 5DZ2A 5IK9A 3LDWA 3KRCB 3TC1A 5A0KA 3TS7A 3ID0A 1VG3A 1VG7A 4N9UA 3OYRA 5DJPF 3PYBA 5ILZA 2OA6A 3N46F 1UBXA 3EGTA 1VG2A 3WCLA 5IKHA 4NFKF 3WCFA 3V1XA 3N6KF 5AHUB 3WCBA 1JFAA 4E9UA 1HXCA 5B0JA 3KB9A 3KRAB 4JZXA 3QQVA 3LGZB 3APZA 2ZEVA 2F9KF 4LZ3A 2F8ZF 4L2XF 2ZCRA 2AETA 1HM4A 2E94A 1DGPA 2ONHA 2E8UA 3AQ0A 5HN8A 4KVIA 1WKZA 2P1CA 2PS6A 1N1ZA 1N21A 1WL3A 5CG5A 2ONGA 3RMGA 5DW7A 2VF6A 1V4EA 3TFNA 2ZCQA 3ZMBA 2J5CA 1YYRA 3WJNA 1PS1A 3SDVA 5JV0F 2J1PA 4LUUA 3ZOUA 5DHKA 2AZJA 4P0WA 1YJ4A 2F8CF 3SDQA 3N49F 2PS4A 2PS7A 2F7MF 4FJQA 5ER8A 5B00A 2Z50A 5IL8A 1N1BA 4OMHA 3G4DA 2EWGA 4LXWA 1FPSA 2E91A 3WCMA 4DHDA 3KRPA 3WEKA 5IMIA
chains in the Genus database with same CATH superfamily
5B0MA 1N24A 2AEKA 3W7FA 3P5RA 3SAEA 1VG6A 4LZCA 2OPNA 1EZFA 3M0GA 5HN9A 1YYQA 3MZVA 2Z4VA 4K10A 4EA0A 3VJDA 4OKZA 3ICZA 3KRFB 5B02A 5JV2F 3LZ9A 3S4JA 4KUXA 5ILKA 1V4KA 3LK5A 4MC8A 1YV5A 1N20A 5DJRF 3ICMA 5CG6A 5B01A 2ZCSA 1YYSA 3UCAA 5I1UA 3RYWA 4DEMF 4LLSA 2FTZA 4E9ZA 1WL2A 2RAHA 4GAXA 4RNQA 5E8KA 5AELA 4Q23A 2OPMA 3WSAA 3VJAA 5E8LA 4XQRF 4XQTF 3G4FA 4DI5A 5IMNA 4KVDA 3ACXA 3WCEA 3WCGA 5HNAA 3N1WF 2Z4YA 3WEHA 3ZL6A 3OACA 4OGUA 3WCIA 5HN7A 2Q9ZA 2AZKA 1KIYA 1HXAA 2Z4ZA 4LIXA 1VG4A 2FORA 4PVYF 4KVYA 3LVSA 4QXSF 3SDUA 2E8WA 2Z4XA 4LPHF 4GA3A 3OABB 4KQUA 3LOMA 4OMGA 4RXEA 3Q2QA 3S9VA 4LOBA 1UBYA 4F6VA 3QKCA 1JFGA 5ILJA 2Q58A 3IBAA 2Z78A 3ZCDA 4KWDA 2F94F 4GP2A 1UBWA 4RXAA 1HX9A 4ZQ8A 1WL1A 3VJBA 2PS8A 3LEEA 4KK2A 4KVWA 3CC9A 1WL0A 1KIZA 1YHLA 4DWGA 2E8TA 4LLTA 3N0GA 2Q80A 4JXYA 2E8VA 3CKEA 3ZMCA 3ACYA 5IMPA 3KROA 5H9DA 5DHIA 1N22A 3M02A 5C05A 3KRPB 3VJ8A 2AELA 3P5PA 4RXCA 5EAUA 2E8XA 5B0LA 3SDTA 4KQ5A 4KQSA 5IN8A 4RYPA 4H5CF 3WC9A 2Z7HA 1N23A 3BNYA 3WEGA 3WCDA 5KSXF 3N0FA 3Q30A 4H5EF 3WE9A 5DGNF 4FP4A 3LSNA 5E8HA 2J1OA 5B0KA 3N5JF 1YHMA 4JZBA 3VJEA 5EASA 3V66A 4LFVF 5ERMA 4F6XA 4NFJF 4DWBA 2Q9YA 3KRFA 5IK6A 5DIQF 2DH4A 4JYXA 2E4OA 3Q1OA 3ADZA 3LG5A 1YQ7A 4NKFA 3DYHA 3B7LA 5IK0A 2ZY1A 3PH7A 4DZWA 5JUZF 3N5HF 4XQSF 3N3DA 3MAVA 3V1VA 3KRCA 3CP6A 1RTRA 4EA2A 3WEFA 1HXGA 2Z52A 3OACB 4HD1A 3RBMA 3ACWA 3BNXA 4NFIF 3NPRA 2F92F 1DI1A 2E90A 2I19A 5ILIA 5ILYA 2O1OA 4P0XA 3KBKA 5DGSF 3WJOA 2PS5A 3VJ9A 2ZCOA 4GP1A 2E92A 4LZ0A 3DYGA 3N1VF 1RQIA 5EATA 3KRAA 4NG6A 3WEIA 3WCHA 3LGKA 4OKMA 1RQJA 4NUAA 4QPFA 3LJIA 1YYTA 4LA6A 5DGMF 5EROA 4KPJA 3WCCA 5IL3A 4LTZA 4MC0A 3M00A 3ASXA 3OABA 4WK5A 3LMDA 4E1EA 2F89F 3AE0A 3P8LA 3VJCA 1WMWA 2AZLA 5IKAA 3WEJA 5A0IA 4N1ZF 4NKEA 3KROB 1HM7A 2H8OA 3EFQA 2ZEUA 4DXJA 2QISA 3NF2A 3SDRA 3WCJA 5JV1F 3M01A 3P8RA 5AFXA 3ICKA 4LTVA 2E93A 4P0VA 3ICNA 3NRIA 5B0IA 2Z4WA 3WJKA 3DYFA 5ILHA 5ERNA 4KKMA 1ZW5A 4JVJF 1V4IA 4JXNA 3TFPA 3M9UA 5IVGA 1V4JA 3LLWA 3Q2ZA 5IM1A 3PDEA 4LFGA 1WY0A 3N3LF 1YYUA 2E95A 4F62A 5AYPA 4LPGF 5ILDA 4MC3A 4KFAA 1V4HA 1YHKA 3EZ3A 4UMJA 3N45F 4EA1A 5JA0F 5B03A 3P41A 5A0JA 5DJVF 3RYEA 2OGDA 4KPDA 2Z7IA 1UBVA 3TFVA 3WSBA 3WCAA 4H5DF 4LA5A 4LFEA 3IPIA 3NPKA 3PYAA 4PVXF 3AQCB 3AQBB 3PKOA 4RXDA 5DZ2A 5IK9A 3LDWA 3KRCB 3TC1A 5A0KA 3TS7A 3ID0A 1VG3A 1VG7A 4N9UA 3OYRA 5DJPF 3PYBA 5ILZA 2OA6A 3N46F 1UBXA 3EGTA 1VG2A 3WCLA 5IKHA 4NFKF 3WCFA 3V1XA 3N6KF 5AHUB 3WCBA 1JFAA 4E9UA 1HXCA 5B0JA 3KB9A 3KRAB 4JZXA 3QQVA 3LGZB 3APZA 2ZEVA 2F9KF 4LZ3A 2F8ZF 4L2XF 2ZCRA 2AETA 1HM4A 2E94A 1DGPA 2ONHA 2E8UA 3AQ0A 5HN8A 4KVIA 1WKZA 2P1CA 2PS6A 1N1ZA 1N21A 1WL3A 5CG5A 2ONGA 3RMGA 5DW7A 2VF6A 1V4EA 3TFNA 2ZCQA 3ZMBA 2J5CA 1YYRA 3WJNA 1PS1A 3SDVA 5JV0F 2J1PA 4LUUA 3ZOUA 5DHKA 2AZJA 4P0WA 1YJ4A 2F8CF 3SDQA 3N49F 2PS4A 2PS7A 2F7MF 4FJQA 5ER8A 5B00A 2Z50A 5IL8A 1N1BA 4OMHA 3G4DA 2EWGA 4LXWA 1FPSA 2E91A 3WCMA 4DHDA 3KRPA 3WEKA 5IMIA
chains in the Genus database with same CATH topology
5B0MA 1N24A 2AEKA 3W7FA 3P5RA 3SAEA 1VG6A 4LZCA 2OPNA 1EZFA 3M0GA 5HN9A 1YYQA 3MZVA 2Z4VA 4K10A 4EA0A 3VJDA 4OKZA 3ICZA 3KRFB 5B02A 5JV2F 3LZ9A 3S4JA 4KUXA 5ILKA 1V4KA 3LK5A 4MC8A 1YV5A 1N20A 5DJRF 3ICMA 5CG6A 5B01A 2ZCSA 1YYSA 3UCAA 5I1UA 3RYWA 4DEMF 4LLSA 2FTZA 4E9ZA 1WL2A 2RAHA 4GAXA 4RNQA 5E8KA 5AELA 4Q23A 2OPMA 3WSAA 3VJAA 5E8LA 4XQRF 4XQTF 3G4FA 4DI5A 5IMNA 4KVDA 3ACXA 3WCEA 3WCGA 5HNAA 3N1WF 2Z4YA 3WEHA 3ZL6A 3OACA 4OGUA 3WCIA 5HN7A 2Q9ZA 2AZKA 1KIYA 1HXAA 2Z4ZA 4LIXA 1VG4A 2FORA 4PVYF 4KVYA 3LVSA 4QXSF 3SDUA 2E8WA 2Z4XA 4LPHF 4GA3A 3OABB 4KQUA 3LOMA 4OMGA 4RXEA 3Q2QA 3S9VA 4LOBA 1UBYA 4F6VA 3QKCA 1JFGA 5ILJA 2Q58A 3IBAA 2Z78A 3ZCDA 4KWDA 2F94F 4GP2A 1UBWA 4RXAA 1HX9A 4ZQ8A 1WL1A 3VJBA 2PS8A 3LEEA 4KK2A 4KVWA 3CC9A 1WL0A 1KIZA 1YHLA 4DWGA 2E8TA 4LLTA 3N0GA 2Q80A 4JXYA 2E8VA 3CKEA 3ZMCA 3ACYA 5IMPA 3KROA 5H9DA 5DHIA 1N22A 3M02A 5C05A 3KRPB 3VJ8A 2AELA 3P5PA 4RXCA 5EAUA 2E8XA 5B0LA 3SDTA 4KQ5A 4KQSA 5IN8A 4RYPA 4H5CF 3WC9A 2Z7HA 1N23A 3BNYA 3WEGA 3WCDA 5KSXF 3N0FA 3Q30A 4H5EF 3WE9A 5DGNF 4FP4A 3LSNA 5E8HA 2J1OA 5B0KA 3N5JF 1YHMA 4JZBA 3VJEA 5EASA 3V66A 4LFVF 5ERMA 4F6XA 4NFJF 4DWBA 2Q9YA 3KRFA 5IK6A 5DIQF 2DH4A 4JYXA 2E4OA 3Q1OA 3ADZA 3LG5A 1YQ7A 4NKFA 3DYHA 3B7LA 5IK0A 2ZY1A 3PH7A 4DZWA 5JUZF 3N5HF 4XQSF 3N3DA 3MAVA 3V1VA 3KRCA 3CP6A 1RTRA 4EA2A 3WEFA 1HXGA 2Z52A 3OACB 4HD1A 3RBMA 3ACWA 3BNXA 4NFIF 3NPRA 2F92F 1DI1A 2E90A 2I19A 5ILIA 5ILYA 2O1OA 4P0XA 3KBKA 5DGSF 3WJOA 2PS5A 3VJ9A 2ZCOA 4GP1A 2E92A 4LZ0A 3DYGA 3N1VF 1RQIA 5EATA 3KRAA 4NG6A 3WEIA 3WCHA 3LGKA 4OKMA 1RQJA 4NUAA 4QPFA 3LJIA 1YYTA 4LA6A 5DGMF 5EROA 4KPJA 3WCCA 5IL3A 4LTZA 4MC0A 3M00A 3ASXA 3OABA 4WK5A 3LMDA 4E1EA 2F89F 3AE0A 3P8LA 3VJCA 1WMWA 2AZLA 5IKAA 3WEJA 5A0IA 4N1ZF 4NKEA 3KROB 1HM7A 2H8OA 3EFQA 2ZEUA 4DXJA 2QISA 3NF2A 3SDRA 3WCJA 5JV1F 3M01A 3P8RA 5AFXA 3ICKA 4LTVA 2E93A 4P0VA 3ICNA 3NRIA 5B0IA 2Z4WA 3WJKA 3DYFA 5ILHA 5ERNA 4KKMA 1ZW5A 4JVJF 1V4IA 4JXNA 3TFPA 3M9UA 5IVGA 1V4JA 3LLWA 3Q2ZA 5IM1A 3PDEA 4LFGA 1WY0A 3N3LF 1YYUA 2E95A 4F62A 5AYPA 4LPGF 5ILDA 4MC3A 4KFAA 1V4HA 1YHKA 3EZ3A 4UMJA 3N45F 4EA1A 5JA0F 5B03A 3P41A 5A0JA 5DJVF 3RYEA 2OGDA 4KPDA 2Z7IA 1UBVA 3TFVA 3WSBA 3WCAA 4H5DF 4LA5A 4LFEA 3IPIA 3NPKA 3PYAA 4PVXF 3AQCB 3AQBB 3PKOA 4RXDA 5DZ2A 5IK9A 3LDWA 3KRCB 3TC1A 5A0KA 3TS7A 3ID0A 1VG3A 1VG7A 4N9UA 3OYRA 5DJPF 3PYBA 5ILZA 2OA6A 3N46F 1UBXA 3EGTA 1VG2A 3WCLA 5IKHA 4NFKF 3WCFA 3V1XA 3N6KF 5AHUB 3WCBA 1JFAA 4E9UA 1HXCA 5B0JA 3KB9A 3KRAB 4JZXA 3QQVA 3LGZB 3APZA 2ZEVA 2F9KF 4LZ3A 2F8ZF 4L2XF 2ZCRA 2AETA 1HM4A 2E94A 1DGPA 2ONHA 2E8UA 3AQ0A 5HN8A 4KVIA 1WKZA 2P1CA 2PS6A 1N1ZA 1N21A 1WL3A 5CG5A 2ONGA 3RMGA 5DW7A 2VF6A 1V4EA 3TFNA 2ZCQA 3ZMBA 2J5CA 1YYRA 3WJNA 1PS1A 3SDVA 5JV0F 2J1PA 4LUUA 3ZOUA 5DHKA 2AZJA 4P0WA 1YJ4A 2F8CF 3SDQA 3N49F 2PS4A 2PS7A 2F7MF 4FJQA 5ER8A 5B00A 2Z50A 5IL8A 1N1BA 4OMHA 3G4DA 2EWGA 4LXWA 1FPSA 2E91A 3WCMA 4DHDA 3KRPA 3WEKA 5IMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B0M A;  1N24 A;  2AEK A;  3W7F A;  3P5R A;  3SAE A;  1VG6 A;  4LZC A;  2OPN A;  1EZF A;  3M0G A;  5HN9 A;  1YYQ A;  3MZV A;  2Z4V A;  4K10 A;  4EA0 A;  3VJD A;  4OKZ A;  3ICZ A;  3KRF B;  5B02 A;  5JV2 F;  3LZ9 A;  3S4J A;  4KUX A;  5ILK A;  1V4K A;  3LK5 A;  4MC8 A;  1YV5 A;  1N20 A;  5DJR F;  3ICM A;  5CG6 A;  5B01 A;  2ZCS A;  1YYS A;  3UCA A;  5I1U A;  3RYW A;  4DEM F;  4LLS A;  2FTZ A;  4E9Z A;  1WL2 A;  2RAH A;  4GAX A;  4RNQ A;  5E8K A;  5AEL A;  4Q23 A;  2OPM A;  3WSA A;  3VJA A;  5E8L A;  4XQR F;  4XQT F;  3G4F A;  4DI5 A;  5IMN A;  4KVD A;  3ACX A;  3WCE A;  3WCG A;  5HNA A;  3N1W F;  2Z4Y A;  3WEH A;  3ZL6 A;  3OAC A;  4OGU A;  3WCI A;  5HN7 A;  2Q9Z A;  2AZK A;  1KIY A;  1HXA A;  2Z4Z A;  4LIX A;  1VG4 A;  2FOR A;  4PVY F;  4KVY A;  3LVS A;  4QXS F;  3SDU A;  2E8W A;  2Z4X A;  4LPH F;  4GA3 A;  3OAB B;  4KQU A;  3LOM A;  4OMG A;  4RXE A;  3Q2Q A;  3S9V A;  4LOB A;  1UBY A;  4F6V A;  3QKC A;  1JFG A;  5ILJ A;  2Q58 A;  3IBA A;  2Z78 A;  3ZCD A;  4KWD A;  2F94 F;  4GP2 A;  1UBW A;  4RXA A;  1HX9 A;  4ZQ8 A;  1WL1 A;  3VJB A;  2PS8 A;  3LEE A;  4KK2 A;  4KVW A;  3CC9 A;  1WL0 A;  1KIZ A;  1YHL A;  4DWG A;  2E8T A;  4LLT A;  3N0G A;  2Q80 A;  4JXY A;  2E8V A;  3CKE A;  3ZMC A;  3ACY A;  5IMP A;  3KRO A;  5H9D A;  5DHI A;  1N22 A;  3M02 A;  5C05 A;  3KRP B;  3VJ8 A;  2AEL A;  3P5P A;  4RXC A;  5EAU A;  2E8X A;  5B0L A;  3SDT A;  4KQ5 A;  4KQS A;  5IN8 A;  4RYP A;  4H5C F;  3WC9 A;  2Z7H A;  1N23 A;  3BNY A;  3WEG A;  3WCD A;  5KSX F;  3N0F A;  3Q30 A;  4H5E F;  3WE9 A;  5DGN F;  4FP4 A;  3LSN A;  5E8H A;  2J1O A;  5B0K A;  3N5J F;  1YHM A;  4JZB A;  3VJE A;  5EAS A;  3V66 A;  4LFV F;  5ERM A;  4F6X A;  4NFJ F;  4DWB A;  2Q9Y A;  3KRF A;  5IK6 A;  5DIQ F;  2DH4 A;  4JYX A;  2E4O A;  3Q1O A;  3ADZ A;  3LG5 A;  1YQ7 A;  4NKF A;  3DYH A;  3B7L A;  5IK0 A;  2ZY1 A;  3PH7 A;  4DZW A;  5JUZ F;  3N5H F;  4XQS F;  3N3D A;  3MAV A;  3V1V A;  3KRC A;  3CP6 A;  1RTR A;  4EA2 A;  3WEF A;  1HXG A;  2Z52 A;  3OAC B;  4HD1 A;  3RBM A;  3ACW A;  3BNX A;  4NFI F;  3NPR A;  2F92 F;  1DI1 A;  2E90 A;  2I19 A;  5ILI A;  5ILY A;  2O1O A;  4P0X A;  3KBK A;  5DGS F;  3WJO A;  2PS5 A;  3VJ9 A;  2ZCO A;  4GP1 A;  2E92 A;  4LZ0 A;  3DYG A;  3N1V F;  1RQI A;  5EAT A;  3KRA A;  4NG6 A;  3WEI A;  3WCH A;  3LGK A;  4OKM A;  1RQJ A;  4NUA A;  4QPF A;  3LJI A;  1YYT A;  4LA6 A;  5DGM F;  5ERO A;  4KPJ A;  3WCC A;  5IL3 A;  4LTZ A;  4MC0 A;  3M00 A;  3ASX A;  3OAB A;  4WK5 A;  3LMD A;  4E1E A;  2F89 F;  3AE0 A;  3P8L A;  3VJC A;  1WMW A;  2AZL A;  5IKA A;  3WEJ A;  5A0I A;  4N1Z F;  4NKE A;  3KRO B;  1HM7 A;  2H8O A;  3EFQ A;  2ZEU A;  4DXJ A;  2QIS A;  3NF2 A;  3SDR A;  3WCJ A;  5JV1 F;  3M01 A;  3P8R A;  5AFX A;  3ICK A;  4LTV A;  2E93 A;  4P0V A;  3ICN A;  3NRI A;  5B0I A;  2Z4W A;  3WJK A;  3DYF A;  5ILH A;  5ERN A;  4KKM A;  1ZW5 A;  4JVJ F;  1V4I A;  4JXN A;  3TFP A;  3M9U A;  5IVG A;  1V4J A;  3LLW A;  3Q2Z A;  5IM1 A;  3PDE A;  4LFG A;  1WY0 A;  3N3L F;  1YYU A;  2E95 A;  4F62 A;  5AYP A;  4LPG F;  5ILD A;  4MC3 A;  4KFA A;  1V4H A;  1YHK A;  3EZ3 A;  4UMJ A;  3N45 F;  4EA1 A;  5JA0 F;  5B03 A;  3P41 A;  5A0J A;  5DJV F;  3RYE A;  2OGD A;  4KPD A;  2Z7I A;  1UBV A;  3TFV A;  3WSB A;  3WCA A;  4H5D F;  4LA5 A;  4LFE A;  3IPI A;  3NPK A;  3PYA A;  4PVX F;  3AQC B;  3AQB B;  3PKO A;  4RXD A;  5DZ2 A;  5IK9 A;  3LDW A;  3KRC B;  3TC1 A;  5A0K A;  3TS7 A;  3ID0 A;  1VG3 A;  1VG7 A;  4N9U A;  3OYR A;  5DJP F;  3PYB A;  5ILZ A;  2OA6 A;  3N46 F;  1UBX A;  3EGT A;  1VG2 A;  3WCL A;  5IKH A;  4NFK F;  3WCF A;  3V1X A;  3N6K F;  5AHU B;  3WCB A;  1JFA A;  4E9U A;  1HXC A;  5B0J A;  3KB9 A;  3KRA B;  4JZX A;  3QQV A;  3LGZ B;  3APZ A;  2ZEV A;  2F9K F;  4LZ3 A;  2F8Z F;  4L2X F;  2ZCR A;  2AET A;  1HM4 A;  2E94 A;  1DGP A;  2ONH A;  2E8U A;  3AQ0 A;  5HN8 A;  4KVI A;  1WKZ A;  2P1C A;  2PS6 A;  1N1Z A;  1N21 A;  1WL3 A;  5CG5 A;  2ONG A;  3RMG A;  5DW7 A;  2VF6 A;  1V4E A;  3TFN A;  2ZCQ A;  3ZMB A;  2J5C A;  1YYR A;  3WJN A;  1PS1 A;  3SDV A;  5JV0 F;  2J1P A;  4LUU A;  3ZOU A;  5DHK A;  2AZJ A;  4P0W A;  1YJ4 A;  2F8C F;  3SDQ A;  3N49 F;  2PS4 A;  2PS7 A;  2F7M F;  4FJQ A;  5ER8 A;  5B00 A;  2Z50 A;  5IL8 A;  1N1B A;  4OMH A;  3G4D A;  2EWG A;  4LXW A;  1FPS A;  2E91 A;  3WCM A;  4DHD A;  3KRP A;  3WEK A;  5IMI A; 
#chains in the Genus database with same CATH topology
 5B0M A;  1N24 A;  2AEK A;  3W7F A;  3P5R A;  3SAE A;  1VG6 A;  4LZC A;  2OPN A;  1EZF A;  3M0G A;  5HN9 A;  1YYQ A;  3MZV A;  2Z4V A;  4K10 A;  4EA0 A;  3VJD A;  4OKZ A;  3ICZ A;  3KRF B;  5B02 A;  5JV2 F;  3LZ9 A;  3S4J A;  4KUX A;  5ILK A;  1V4K A;  3LK5 A;  4MC8 A;  1YV5 A;  1N20 A;  5DJR F;  3ICM A;  5CG6 A;  5B01 A;  2ZCS A;  1YYS A;  3UCA A;  5I1U A;  3RYW A;  4DEM F;  4LLS A;  2FTZ A;  4E9Z A;  1WL2 A;  2RAH A;  4GAX A;  4RNQ A;  5E8K A;  5AEL A;  4Q23 A;  2OPM A;  3WSA A;  3VJA A;  5E8L A;  4XQR F;  4XQT F;  3G4F A;  4DI5 A;  5IMN A;  4KVD A;  3ACX A;  3WCE A;  3WCG A;  5HNA A;  3N1W F;  2Z4Y A;  3WEH A;  3ZL6 A;  3OAC A;  4OGU A;  3WCI A;  5HN7 A;  2Q9Z A;  2AZK A;  1KIY A;  1HXA A;  2Z4Z A;  4LIX A;  1VG4 A;  2FOR A;  4PVY F;  4KVY A;  3LVS A;  4QXS F;  3SDU A;  2E8W A;  2Z4X A;  4LPH F;  4GA3 A;  3OAB B;  4KQU A;  3LOM A;  4OMG A;  4RXE A;  3Q2Q A;  3S9V A;  4LOB A;  1UBY A;  4F6V A;  3QKC A;  1JFG A;  5ILJ A;  2Q58 A;  3IBA A;  2Z78 A;  3ZCD A;  4KWD A;  2F94 F;  4GP2 A;  1UBW A;  4RXA A;  1HX9 A;  4ZQ8 A;  1WL1 A;  3VJB A;  2PS8 A;  3LEE A;  4KK2 A;  4KVW A;  3CC9 A;  1WL0 A;  1KIZ A;  1YHL A;  4DWG A;  2E8T A;  4LLT A;  3N0G A;  2Q80 A;  4JXY A;  2E8V A;  3CKE A;  3ZMC A;  3ACY A;  5IMP A;  3KRO A;  5H9D A;  5DHI A;  1N22 A;  3M02 A;  5C05 A;  3KRP B;  3VJ8 A;  2AEL A;  3P5P A;  4RXC A;  5EAU A;  2E8X A;  5B0L A;  3SDT A;  4KQ5 A;  4KQS A;  5IN8 A;  4RYP A;  4H5C F;  3WC9 A;  2Z7H A;  1N23 A;  3BNY A;  3WEG A;  3WCD A;  5KSX F;  3N0F A;  3Q30 A;  4H5E F;  3WE9 A;  5DGN F;  4FP4 A;  3LSN A;  5E8H A;  2J1O A;  5B0K A;  3N5J F;  1YHM A;  4JZB A;  3VJE A;  5EAS A;  3V66 A;  4LFV F;  5ERM A;  4F6X A;  4NFJ F;  4DWB A;  2Q9Y A;  3KRF A;  5IK6 A;  5DIQ F;  2DH4 A;  4JYX A;  2E4O A;  3Q1O A;  3ADZ A;  3LG5 A;  1YQ7 A;  4NKF A;  3DYH A;  3B7L A;  5IK0 A;  2ZY1 A;  3PH7 A;  4DZW A;  5JUZ F;  3N5H F;  4XQS F;  3N3D A;  3MAV A;  3V1V A;  3KRC A;  3CP6 A;  1RTR A;  4EA2 A;  3WEF A;  1HXG A;  2Z52 A;  3OAC B;  4HD1 A;  3RBM A;  3ACW A;  3BNX A;  4NFI F;  3NPR A;  2F92 F;  1DI1 A;  2E90 A;  2I19 A;  5ILI A;  5ILY A;  2O1O A;  4P0X A;  3KBK A;  5DGS F;  3WJO A;  2PS5 A;  3VJ9 A;  2ZCO A;  4GP1 A;  2E92 A;  4LZ0 A;  3DYG A;  3N1V F;  1RQI A;  5EAT A;  3KRA A;  4NG6 A;  3WEI A;  3WCH A;  3LGK A;  4OKM A;  1RQJ A;  4NUA A;  4QPF A;  3LJI A;  1YYT A;  4LA6 A;  5DGM F;  5ERO A;  4KPJ A;  3WCC A;  5IL3 A;  4LTZ A;  4MC0 A;  3M00 A;  3ASX A;  3OAB A;  4WK5 A;  3LMD A;  4E1E A;  2F89 F;  3AE0 A;  3P8L A;  3VJC A;  1WMW A;  2AZL A;  5IKA A;  3WEJ A;  5A0I A;  4N1Z F;  4NKE A;  3KRO B;  1HM7 A;  2H8O A;  3EFQ A;  2ZEU A;  4DXJ A;  2QIS A;  3NF2 A;  3SDR A;  3WCJ A;  5JV1 F;  3M01 A;  3P8R A;  5AFX A;  3ICK A;  4LTV A;  2E93 A;  4P0V A;  3ICN A;  3NRI A;  5B0I A;  2Z4W A;  3WJK A;  3DYF A;  5ILH A;  5ERN A;  4KKM A;  1ZW5 A;  4JVJ F;  1V4I A;  4JXN A;  3TFP A;  3M9U A;  5IVG A;  1V4J A;  3LLW A;  3Q2Z A;  5IM1 A;  3PDE A;  4LFG A;  1WY0 A;  3N3L F;  1YYU A;  2E95 A;  4F62 A;  5AYP A;  4LPG F;  5ILD A;  4MC3 A;  4KFA A;  1V4H A;  1YHK A;  3EZ3 A;  4UMJ A;  3N45 F;  4EA1 A;  5JA0 F;  5B03 A;  3P41 A;  5A0J A;  5DJV F;  3RYE A;  2OGD A;  4KPD A;  2Z7I A;  1UBV A;  3TFV A;  3WSB A;  3WCA A;  4H5D F;  4LA5 A;  4LFE A;  3IPI A;  3NPK A;  3PYA A;  4PVX F;  3AQC B;  3AQB B;  3PKO A;  4RXD A;  5DZ2 A;  5IK9 A;  3LDW A;  3KRC B;  3TC1 A;  5A0K A;  3TS7 A;  3ID0 A;  1VG3 A;  1VG7 A;  4N9U A;  3OYR A;  5DJP F;  3PYB A;  5ILZ A;  2OA6 A;  3N46 F;  1UBX A;  3EGT A;  1VG2 A;  3WCL A;  5IKH A;  4NFK F;  3WCF A;  3V1X A;  3N6K F;  5AHU B;  3WCB A;  1JFA A;  4E9U A;  1HXC A;  5B0J A;  3KB9 A;  3KRA B;  4JZX A;  3QQV A;  3LGZ B;  3APZ A;  2ZEV A;  2F9K F;  4LZ3 A;  2F8Z F;  4L2X F;  2ZCR A;  2AET A;  1HM4 A;  2E94 A;  1DGP A;  2ONH A;  2E8U A;  3AQ0 A;  5HN8 A;  4KVI A;  1WKZ A;  2P1C A;  2PS6 A;  1N1Z A;  1N21 A;  1WL3 A;  5CG5 A;  2ONG A;  3RMG A;  5DW7 A;  2VF6 A;  1V4E A;  3TFN A;  2ZCQ A;  3ZMB A;  2J5C A;  1YYR A;  3WJN A;  1PS1 A;  3SDV A;  5JV0 F;  2J1P A;  4LUU A;  3ZOU A;  5DHK A;  2AZJ A;  4P0W A;  1YJ4 A;  2F8C F;  3SDQ A;  3N49 F;  2PS4 A;  2PS7 A;  2F7M F;  4FJQ A;  5ER8 A;  5B00 A;  2Z50 A;  5IL8 A;  1N1B A;  4OMH A;  3G4D A;  2EWG A;  4LXW A;  1FPS A;  2E91 A;  3WCM A;  4DHD A;  3KRP A;  3WEK A;  5IMI A; 
#chains in the Genus database with same CATH homology
 5B0M A;  1N24 A;  2AEK A;  3W7F A;  3P5R A;  3SAE A;  1VG6 A;  4LZC A;  2OPN A;  1EZF A;  3M0G A;  5HN9 A;  1YYQ A;  3MZV A;  2Z4V A;  4K10 A;  4EA0 A;  3VJD A;  4OKZ A;  3ICZ A;  3KRF B;  5B02 A;  5JV2 F;  3LZ9 A;  3S4J A;  4KUX A;  5ILK A;  1V4K A;  3LK5 A;  4MC8 A;  1YV5 A;  1N20 A;  5DJR F;  3ICM A;  5CG6 A;  5B01 A;  2ZCS A;  1YYS A;  3UCA A;  5I1U A;  3RYW A;  4DEM F;  4LLS A;  2FTZ A;  4E9Z A;  1WL2 A;  2RAH A;  4GAX A;  4RNQ A;  5E8K A;  5AEL A;  4Q23 A;  2OPM A;  3WSA A;  3VJA A;  5E8L A;  4XQR F;  4XQT F;  3G4F A;  4DI5 A;  5IMN A;  4KVD A;  3ACX A;  3WCE A;  3WCG A;  5HNA A;  3N1W F;  2Z4Y A;  3WEH A;  3ZL6 A;  3OAC A;  4OGU A;  3WCI A;  5HN7 A;  2Q9Z A;  2AZK A;  1KIY A;  1HXA A;  2Z4Z A;  4LIX A;  1VG4 A;  2FOR A;  4PVY F;  4KVY A;  3LVS A;  4QXS F;  3SDU A;  2E8W A;  2Z4X A;  4LPH F;  4GA3 A;  3OAB B;  4KQU A;  3LOM A;  4OMG A;  4RXE A;  3Q2Q A;  3S9V A;  4LOB A;  1UBY A;  4F6V A;  3QKC A;  1JFG A;  5ILJ A;  2Q58 A;  3IBA A;  2Z78 A;  3ZCD A;  4KWD A;  2F94 F;  4GP2 A;  1UBW A;  4RXA A;  1HX9 A;  4ZQ8 A;  1WL1 A;  3VJB A;  2PS8 A;  3LEE A;  4KK2 A;  4KVW A;  3CC9 A;  1WL0 A;  1KIZ A;  1YHL A;  4DWG A;  2E8T A;  4LLT A;  3N0G A;  2Q80 A;  4JXY A;  2E8V A;  3CKE A;  3ZMC A;  3ACY A;  5IMP A;  3KRO A;  5H9D A;  5DHI A;  1N22 A;  3M02 A;  5C05 A;  3KRP B;  3VJ8 A;  2AEL A;  3P5P A;  4RXC A;  5EAU A;  2E8X A;  5B0L A;  3SDT A;  4KQ5 A;  4KQS A;  5IN8 A;  4RYP A;  4H5C F;  3WC9 A;  2Z7H A;  1N23 A;  3BNY A;  3WEG A;  3WCD A;  5KSX F;  3N0F A;  3Q30 A;  4H5E F;  3WE9 A;  5DGN F;  4FP4 A;  3LSN A;  5E8H A;  2J1O A;  5B0K A;  3N5J F;  1YHM A;  4JZB A;  3VJE A;  5EAS A;  3V66 A;  4LFV F;  5ERM A;  4F6X A;  4NFJ F;  4DWB A;  2Q9Y A;  3KRF A;  5IK6 A;  5DIQ F;  2DH4 A;  4JYX A;  2E4O A;  3Q1O A;  3ADZ A;  3LG5 A;  1YQ7 A;  4NKF A;  3DYH A;  3B7L A;  5IK0 A;  2ZY1 A;  3PH7 A;  4DZW A;  5JUZ F;  3N5H F;  4XQS F;  3N3D A;  3MAV A;  3V1V A;  3KRC A;  3CP6 A;  1RTR A;  4EA2 A;  3WEF A;  1HXG A;  2Z52 A;  3OAC B;  4HD1 A;  3RBM A;  3ACW A;  3BNX A;  4NFI F;  3NPR A;  2F92 F;  1DI1 A;  2E90 A;  2I19 A;  5ILI A;  5ILY A;  2O1O A;  4P0X A;  3KBK A;  5DGS F;  3WJO A;  2PS5 A;  3VJ9 A;  2ZCO A;  4GP1 A;  2E92 A;  4LZ0 A;  3DYG A;  3N1V F;  1RQI A;  5EAT A;  3KRA A;  4NG6 A;  3WEI A;  3WCH A;  3LGK A;  4OKM A;  1RQJ A;  4NUA A;  4QPF A;  3LJI A;  1YYT A;  4LA6 A;  5DGM F;  5ERO A;  4KPJ A;  3WCC A;  5IL3 A;  4LTZ A;  4MC0 A;  3M00 A;  3ASX A;  3OAB A;  4WK5 A;  3LMD A;  4E1E A;  2F89 F;  3AE0 A;  3P8L A;  3VJC A;  1WMW A;  2AZL A;  5IKA A;  3WEJ A;  5A0I A;  4N1Z F;  4NKE A;  3KRO B;  1HM7 A;  2H8O A;  3EFQ A;  2ZEU A;  4DXJ A;  2QIS A;  3NF2 A;  3SDR A;  3WCJ A;  5JV1 F;  3M01 A;  3P8R A;  5AFX A;  3ICK A;  4LTV A;  2E93 A;  4P0V A;  3ICN A;  3NRI A;  5B0I A;  2Z4W A;  3WJK A;  3DYF A;  5ILH A;  5ERN A;  4KKM A;  1ZW5 A;  4JVJ F;  1V4I A;  4JXN A;  3TFP A;  3M9U A;  5IVG A;  1V4J A;  3LLW A;  3Q2Z A;  5IM1 A;  3PDE A;  4LFG A;  1WY0 A;  3N3L F;  1YYU A;  2E95 A;  4F62 A;  5AYP A;  4LPG F;  5ILD A;  4MC3 A;  4KFA A;  1V4H A;  1YHK A;  3EZ3 A;  4UMJ A;  3N45 F;  4EA1 A;  5JA0 F;  5B03 A;  3P41 A;  5A0J A;  5DJV F;  3RYE A;  2OGD A;  4KPD A;  2Z7I A;  1UBV A;  3TFV A;  3WSB A;  3WCA A;  4H5D F;  4LA5 A;  4LFE A;  3IPI A;  3NPK A;  3PYA A;  4PVX F;  3AQC B;  3AQB B;  3PKO A;  4RXD A;  5DZ2 A;  5IK9 A;  3LDW A;  3KRC B;  3TC1 A;  5A0K A;  3TS7 A;  3ID0 A;  1VG3 A;  1VG7 A;  4N9U A;  3OYR A;  5DJP F;  3PYB A;  5ILZ A;  2OA6 A;  3N46 F;  1UBX A;  3EGT A;  1VG2 A;  3WCL A;  5IKH A;  4NFK F;  3WCF A;  3V1X A;  3N6K F;  5AHU B;  3WCB A;  1JFA A;  4E9U A;  1HXC A;  5B0J A;  3KB9 A;  3KRA B;  4JZX A;  3QQV A;  3LGZ B;  3APZ A;  2ZEV A;  2F9K F;  4LZ3 A;  2F8Z F;  4L2X F;  2ZCR A;  2AET A;  1HM4 A;  2E94 A;  1DGP A;  2ONH A;  2E8U A;  3AQ0 A;  5HN8 A;  4KVI A;  1WKZ A;  2P1C A;  2PS6 A;  1N1Z A;  1N21 A;  1WL3 A;  5CG5 A;  2ONG A;  3RMG A;  5DW7 A;  2VF6 A;  1V4E A;  3TFN A;  2ZCQ A;  3ZMB A;  2J5C A;  1YYR A;  3WJN A;  1PS1 A;  3SDV A;  5JV0 F;  2J1P A;  4LUU A;  3ZOU A;  5DHK A;  2AZJ A;  4P0W A;  1YJ4 A;  2F8C F;  3SDQ A;  3N49 F;  2PS4 A;  2PS7 A;  2F7M F;  4FJQ A;  5ER8 A;  5B00 A;  2Z50 A;  5IL8 A;  1N1B A;  4OMH A;  3G4D A;  2EWG A;  4LXW A;  1FPS A;  2E91 A;  3WCM A;  4DHD A;  3KRP A;  3WEK A;  5IMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...