3AQCA

M. luteus b-p 26 heterodimeric hexaprenyl diphosphate synthase in complex with magnesium and fpp analogue
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
135
structure length
135
Chain Sequence
MMRYLHKIELELNRLTSRYPFFKKIAFDAEIIKLVDDLNVDENVKCAIVAIDTSMRMQDFINEDNKDSFVLSTDVLSALFYKYLSQPFYQHDFLVLTDCVSRINELKSIRATITDEIALHNINKQIHYMFIQPYM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Component A of hexaprenyl diphosphate synthase
publication title Crystal structure of heterodimeric hexaprenyl diphosphate synthase from Micrococcus luteus B-P 26 reveals that the small subunit is directly involved in the product chain length regulation.
pubmed doi rcsb
source organism Micrococcus luteus
molecule tags Transferase
total genus 55
structure length 135
sequence length 135
chains with identical sequence C
ec nomenclature ec 2.5.1.83: Hexaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific).
pdb deposition date 2010-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3aqcA00
3AQBA 3AQCA
chains in the Genus database with same CATH superfamily
3C62A 4D4XA 2J46A 2LIGA 2IOQA 3NDBB 4BJ5C 5F5FA 3ATPA 4KNVA 4U5DE 4DOZA 2E87A 2JPUA 3A9CA 1W2WA 3MX3A 4E7SA 5B3SC 2TMVP 2VC9A 3B29A 3S28A 2XL8A 1J8MF 1EKYA 2EIMC 1OKKD 3X1OA 3M4BA 3TQOA 3GM2A 1OR2A 1C03A 4JRZA 1BR2A 3LUTB 3NMKA 2YKZA 1G4WR 2HZ8A 2YL0A 4EBBA 4AE4B 1JAFA 1TWGA 2R7XA 1T01A 2DGJA 4AL0A 2YL3A 2H7VC 3E9VA 3FHDA 3IQTA 1OW8A 1QQ3A 1R4TA 3AG4C 5T3WA 1FAPB 1HMDA 3GM1A 3F46A 3W8IA 3QVYA 3JZ0A 3KL4A 3S27A 4BEJA 3J06A 2BE5F 2XLEA 4DRIB 2VH3A 2G62A 3QTHA 5JRAA 1OXKA 2R7WA 3GWNA 1NBBA 4IAOA 3Q6NA 5L0DA 3ASNC 1IW7F 3HNJA 4MNDA 1K04A 2OU6A 2XS1A 4JIOA 3CSKA 4P6IC 4FAPB 2R7SA 3I5PA 4CS8A 1D1AA 3GEIA 1ZVZA 5B1BC 1E83A 2IXOA 2KQ9A 1RJ9A 2DI3A 2YEVA 2L6HA 3UMHA 2VCCA 2UUHA 2R7RA 5KYYA 4GEHA 3B0PA 1H7IA 1M57C 1T6IA 1NFOA 1WTYA 3T4RA 5AC5A 4MQ9F 4C7OB 5L0GA 4PACA 1T9KA 3EGDA 5JVEA 2QUPA 1DOWA 3JCUQ 5IY5C 3NG1A 1M2OA 4DJ9A 4NCQA 2OQMA 1JMWA 1VLSA 2WVOA 2LP4A 1Q0KA 3FAPB 3EGXB 2HJMA 4H54A 4WABA 1M56C 2HSQA 3HLZA 4LLEA 4OIPF 2WVNA 1YJGA 3NRHA 4DRJB 1Z3IX 3EFOA 3ZTZA 5L0FA 4F4BA 5E3AA 3Q7LA 2PX3A 2KGOA 4IWBA 5KYXA 1VYIA 1E85A 3U0CA 2DB4A 2OJQA 3AG2C 2LSEA 5B3IA 4CSAC 3RVZA 3SEOA 3AG1C 2J45A 5E3CA 4YK5A 1KNYA 3JRTA 1ST6A 4Z9JA 3ZDLA 4N4WA 2YWAA 2L7AA 5BUOA 2XLOA 1MMAA 3KYIA 3UMIA 5EGYA 1JPJA 1GGQA 3K7DA 3OWTA 3RQEA 4DVYP 4OIQF 3AGUA 1EQ1A 5CI8A 2HMZA 2XRHA 3AQCA 4MW3A 3V5YA 2UUIA 1H9TA 1BR1A 2RSEB 5A6AA 1NZEA 1ZHZA 4FESA 256BA 2GWWA 2PF4E 4GYTA 4RD9A 2ZD9A 3T9OA 3WODF 3G4XA 4NTAA 1VB5A 2J9BA 2M4EA 2OJED 2P1AA 3M4CA 3Q6MA 4HE8D 5AC4A 1E86A 3CAXA 3EHMA 5DQZA 2R7QA 1TKNA 1T6UA 3FXHA 4O7GA 2YLIA 4ER9A 2R25A 3G4ZA 2NUPA 3DZAA 1NU9C 5DS6A 3EH2A 1ZHXA 2CNWD 4KI2A 1U6HA 4CIPA 2ASRA 2Z15A 2G3KA 1YDIA 2W45A 3C8GA 2G3VA 4IARA 2B0HA 1RCPA 3ZWIA 4A2NB 2A0UA 2Y3HA 1F1MA 1S7ZA 5D91A 4ZLCA 3EQLF 1WASA 3DM9B 4N6HA 1D1BA 3GWLA 4PK4A 3T6GB 1UG7A 2YQYA 2AVKA 3MBGA 2HKVA 5GPGB 1ZHTA 2ETSA 4PJMA 3NMIA 2J0XA 3VF0A 2AWYA 4LDKA 2QNLA 5TJ5E 2GDCA 4EBJA 5K0IA 3B0UX 3BEHA 4GQHA 5F5HA 2C04A 1BR4A 1TR2A 1QLEC 3AJMA 2EINC 3EHNA 3HNIA 1LM3B 2CGEA 4G78A 4K1OA 3M15A 2XM4A 4J30B 1ZW3A 3NYMA 2Q3TA 2FAPB 4QI2A 2OEVA 2VCAA 4WGYA 4W8KA 1RXQA 3RW0A 2V3CC 1A0BA 3NKEA 4IAQA 3DD7A 2PX0A 1SF8A 2CDQA 3AQBA 5EHHA 1OW6A 4KNWA 1VK5A 3PCVA 2PBEA 4O79A 3ZIBA 1OCZC 2AU5A 5BQIA 2LD6A 4U5FE 3ZG1A 4U5EE 2P6VA 4E0IA 4N06A 3FOOA 1Z6AA 1YZAA 3B9QA 3QW0A 1JOGA 2NUTA 3SP1A 3LESA 4RDAA 5L0JA 1LIHA 2EPMX 3IQ6A 2XLMA 2H7BA 3EG9B 4DBRA 4XEFA 4CS9A 2NG1A 3IPMO 2P0NA 2NPUA 3LLKA 4P9FA 3GORA 1M2VB 3O39A 2Q9CA 4JW1A 4AL1A 3ZTMA 4DRHB 4R32A 1O87A 1K40A 2HMQA 1VYKA 3OEOA 3PMRA 4K7BA 1UFBA 4MVOA 4NC3A 5AGFA 1HY5A 3SXZA 3TOMA 2J9WA 4XPYA 3UGPA 2WZLA 2A0BA 1YA7O 3SXMA 1APCA 2A6EF 2IYLD 2J9VA 2YL7A 2PNOA 3NMJA 3A11A 1SZIA 3HNLA 1J8YF 4MTGA 3U5SA 1Q0GA 2EPNA 4IGGA 3FMSA 3O10A 5JUAA 3L1MA 3L34A 1HE1A 4JURI 2ZXOA 4JKVA 4QI0A 4AK9A 3JYYA 3U9MA 2H7OA 3K33A 4YT5A 1HE9A 1QZXA 1VLTA 4MVZA 3HJCA 1H6GA 3K6BA 4I1MA 2GFHA 3QVZA 5KYWB 2X51A 3CQZA 1VOMA 3RF3A 4MTOA 4XLNF 4KC9A 3DAFA 1QVXA 3KYJA 4C7OA 1FFTC 2WB7A 4JTAB 1NG1A 2V26A 2EILC 3LEVA 2HUJA 4XPWA 3S84A 1FNTc 3KKBA 4D4NA 4BJ6C 4PR9A 1XWJA 1D0XA 1D1CA 3DKAA 4JTCB 1A41A 4ANJA 4CDAA 5F28E 4LDRA 4NTFA 3EGXA 5COMA 1MMDA 1TFOB 2KK1A 2WL8A 4Z9HA 3DM5A 1MMNA 3W8HA 4EWCA 1OXBA 1DOVA 3B71A 3I5QA 2LFDA 1Z5ZA 3DE8A 3K1IC 1M6TA 2XLDA 2XLHA 4NY3A 5HV9A 2OKUA 1BZ4A 3U8PA 4W8PA 1V54C 3WHNA 1ORJA 3C8ZA 3U8VA 2ZXRA 1YAUO 4JJFA 5BQGA 2H8AA 3QW1A 4X0RA 3LNRA 3ZQVA 1IZMA 4AX2A 3RKOF 3I4UA 4XWJA 5E33A 2XS8A 4NTBA 4UDVA 1TFKB 1YLMA 2QE9A 3K66A 2WVQA 3GODA 1CPQA 3TULA 4EBKA 1G4US 2KW3C 1OCRC 1L3PA 2HV6A 1OKKA 4JJGA 3LLIA 3R2PA 4BEMJ 3N0TA 3N2ZB 3SXKA 5KYUA 4Z9IA 4OIRF 1Q0DA 2I8BA 1RJ9B 2Q7RA 5A6BD 4C3BA 3U3BA 3GANA 1TWCA 4J7YA 4CJOA 3L8IA 5KYYB 2GA0A 1ZHYA 2I15A 2J7PD 4BJ5A 3IEEA 2XLWA 3IHUA 5COFA 1S05A 2WZGA 1D0YA 2Q00A 3L0IA 3EGDB 2KSFA 3G50A 1RKEA 2L6GA 1HW2A 1OQCA 4IB4A 2R7TA 3WG7C 3U9JA 4A4AA 4J32B 4EUKB 1NLXA 3LJBA 3T6JA 1OR3A 2L81A 4PJJA 1R5ID 2F22A 1E2XA 1MMGA 3ITFA 1T5OA 1YA9A 1ZU4A 4HFKB 1VTMP 4MTFA 1QSPA 3CEXA 3JSEO 4ULWA 3UNGC 3WAQA 4WJ0A 4MS2A 4E0HA 3QZCA 5KYXB 2YLGA 1WWPA 1FFHA 3C63A 2XL6A 4LERA 4PFOA 2A68F 3TOLA 2A69F 3PDMP 3DAGA 2XXAA 2R02A 1TQGA 3TJ5A 4BJTA 4U9EA 1SMYF 5L0IA 1WATA 4G7ZF 1U0BB 3H2UA 3OA1A 3W2VA 2PP4A 4JVSA 3JTLO 3MYFA 1CGNA 2IM8A 2P7VA 2L9JA 4CS8C 3DXJF 2A1DD 1HW1A 4MVSA 3EG9A 4U5CE 3TD7A 3JT1A 1FMVA 3H2VA 4XQ1A 5HSWA 5CIVA 4M63A 4ULVA 3S0XA 2QTVA 3HKKA 1QPUA 3KPHA 4PFPA 2B0JA 2R03A 5COGA 5D92A 3U2LA 1LVKA 1LS4A 4CIHA 2D4UA 2XLVA 3NYJA 4YJWA 3ECSA 1CPRA 2LK4A 3E70C 5DVWA 1SR2A 3RIPA 1A7DA 1LS1A 2Y3DA 4JEAA 3RYLA 2W4MA 3UR3C 4YL1A 3ZQYA 2Y39A 4BG0A 4EIYA 1WN0A 4AE4A 3POVA 2MWQA 4U5BE 3CZ6A 3SXYA 5FCLA 4H4KC 1NU7D 2HV7A 4HFFB 3RQGA 4CS7A 2AWCA 1FTSA 2JD3A 3U2MA 1A7VA 1A7EA 4U9DA 4BJ1A 4E7ZA 1L7CA 1KTMA 1NFNA 1YYXA 2IXNA 2O9XA 1MNEA 3KMIA 1ZZPA 3LS1A 2W4BA 5FZTA 1LI5A 3DMDA 2ZPAA 4G7OF 2Q9AA 4CSAA 4CBEA 2EPOA 3UMKA 2DYSC 2MHRA 2YZSA 4U5GA 4PJNA 2YVKA 4XTKA 3W2WA 4MVRA 1V74B 3JYHA 2J8WA 3HTKC 3V5XA 2R9RB 2IXPA 3Q7GA 2CNWA 3T6BA 3HNKA 4QDLA 3L8JA 3VYWA 4BPMA 1MNDA 4Q7CA 3DWWA 3EJNA 3SZRA 1T6QA 2CCYA 2HJ3A 1LKXA 4JTDB 2NUTB 2HS5A 3W4YA 1JRAA 1ZHWA 2OEXA 4WGZA 4C3EA 1OCCC 5E2QA 2YRFA 1G8XA 4J7TA 1ORSC 1YZCA 1XZPA 3AG3C 3AGTA 3EZHA 1PCXA 5DQTA 5L3VA 3GEEA 1V55C 3MYIA 1B68A 1LPEA 3LNMB 1YVIA 2R7VA 2QY9A 3DE9A 2Y3GA 3FOPA 4U5HA 3DJNB 1NSGB 2KJGA 3EH1A 4I1OB 4O6YA 5A69A 4CDYA 3UGOA 1O5HA 2YHSA 2IBFA 2D5RB 3DI5A 1VMAA 4HEAJ 2AP3A 1GS9A 2LFFA 3K1HA 3PHF2 3C8GD 4IRUA 5A6JA 5A6KA 3F47A 4I3MA 4YL3A 3NYLA 4YT4A 3TJ6A 1I4ZA 5KYNA 2HSBA 1KU2A 4OD5A 1Y6DA 2Y69C 5B1AC 5DS4A 1GQAA 1O3UA 3BRJA 4B6IA 3IQCA 3RH3A 3RFYA 2XSEA 4XEKA 4G0HA 1AVOB 5JLIA 4MVQA 1AUEA 3U3FA 3ZC4A 4DVZA 3JSZA 2GAQA 2LQGA 5JP7A 1SYQA 3O6XA 4EHPA 1JR8A 4G7HF 2EIKC 5JSLA 1G5ZA 2RD9A 2BL2A 3LS0A 2BC5A 3M1CB 3B0VC 1PV3A 3ABMC 2R7OA 2YLDA 5T3TA 4YT8A 2CYDA 3QMKA 3V5ZA 1D0ZA 2EPLX 4K0DA 4MVMA 2Q9BA 3GEHA 2OCCC 4XLPF 3FDQA 5CI9A 4CS9C 3C18A 4EKWA 4IJJA 1BDJB 3ASOC 4Q5SF 4ONSA 1EA8A 4OINF 2NSFA 4O6MA 2X0CA 2KYHA 4E17A 2VB6A 1FR0A 4JZAA 3ZVRA 4CX9A 1RMVA 2VASA 1Z63A 2ICWG 4LLCA 3MFNA 1I5NA 1MQVA 2M64A 3RVYA 4OD4A 4DXWA 3AOUA 2EPKX 4O6NA 4FX5A 1AEPA 2Q4FA 2IXMA 3SYNA 1ORYA 4L6RA 4LDQA 5L3QA 1Z23A 1YARO 1LE2A 3DJUB 3JRMO 2DYRC 3V7OA 1U89A 2JX0A 2MYSA 1ZW2A 2FGYA 3ABKC 3EFOB 1PD1A 1XZQA 2KC3A 1Y4CA 2A6HF 3LAYA 4ZLDA 4JEBA 5L0HA 3MLGA 1TWAA 1GM5A 1QKRA 4YN0B 1V4AA 3R7CA 5JT4A 4OIOF 1I4YA 1ZU5A 2QLAA 2XM0A 1OW7A 1HMOA 4JE9A 4JCHA 2ZXPA 1TWHA 5KYUB 4XEVA 1CGOA 1JPNA 3M79A 4YT2A 2R7UA 2Y3BA 4KBLA 4CDVA 4FWVA 5JS5A 2WZFA 3EZIA 3US6A 1LI7A 2FFHA 1BBHA 2OG2A 4YWQA 4DBQA 5L0CA 4BJ6A 1CGME 1C17M 1EI7A 1LE4A 1YYJA 2J0WA 2KNHA 3C7JA 3VM6A 1E84A 2R05A 3ZSUA 2OOCA 1M2VA 2ZXWC 1RKEB 4NQFA 4MVUA 2XL4A 4XPXA 3RQFA 3LEOA 1PD0A 1C02A 1H9GA 1RKCA 4JCZA 2P61A 5T1DB 3X2QC 5BQHA 1FMWA 2YL1A 2L6FA 2NUPB 3K1IA 3S9OA 3VRCA 1OCOC 4CJGA 3H65A 2J9UA 2NSGA 3C8GB 2LCHA 3GM3A 3EPVA 3IQ5A 4I44A 2C03A 3S29A 1Z7Qc 3SNHA 2CW0F 1K05A 1WOLA 3FAJA 3KH2A 3N24A 4E18A 4JC7A 5EK0A 1ZYRF 5A6BA 4P9TA 4Q4ZF 2XXAB 4YL0A 4C3DA 3TK0A 4N6CA 4MW8A 2J7PA 1Q0FA 5DS5A 3VAYA 5KYWA 3NKDA 1N1CA 3FVYA 2HFIA 2PFDA 4LACB 1Q0MA 4PJLA 2EIJC 3S90A 2W9YA 3O55A 5DLJA 1WGWA 2VCBA 4RBNA 3ABLC
chains in the Genus database with same CATH topology
2J46A 2IOQA 3NDBB 4BJ5C 5F5FA 4KNVA 4U5DE 4DOZA 4E7SA 2E87A 1W2WA 3MX3A 5B3SC 3S28A 1J8MF 2EIMC 1OKKD 3X1OA 1BR2A 4EBBA 4AE4B 1TWGA 2R7XA 2DGJA 2H7VC 3E9VA 3FHDA 3AG4C 5T3WA 3F46A 3W8IA 3KL4A 3S27A 4BEJA 2BE5F 2VH3A 2G62A 2R7WA 4IAOA 3Q6NA 3ASNC 1IW7F 4MNDA 3CSKA 4P6IC 2R7SA 3I5PA 4CS8A 1D1AA 5B1BC 4OIOF 2IXOA 2KQ9A 1RJ9A 2YEVA 3UMHA 2R7RA 5KYYA 4GEHA 3B0PA 1M57C 3T4RA 4MQ9F 4C7OB 3EGDA 5IY5C 3JCUQ 3NG1A 1M2OA 2WVOA 3EGXB 1M56C 3HLZA 4LLEA 4OIPF 2WVNA 3NRHA 1Z3IX 3EFOA 4F4BA 5E3AA 3Q7LA 2PX3A 2KGOA 4IWBA 5KYXA 1VYIA 3AG2C 2LSEA 4CSAC 3SEOA 3AG1C 2J45A 5E3CA 3JRTA 1ST6A 5BUOA 5EGYA 1MMAA 3UMIA 1JPJA 3K7DA 3OWTA 4DVYP 4OIQF 5CI8A 2XRHA 3AQCA 1BR1A 1NZEA 1ZHZA 4FESA 2PF4E 4RD9A 4GYTA 3WODF 2M4EA 3Q6MA 4HE8D 3EHMA 5DQZA 2R7QA 1TKNA 4O7GA 2NUPA 3DZAA 1NU9C 5DS6A 3EH2A 1ZHXA 2CNWD 4KI2A 2Z15A 2G3KA 2W45A 2G3VA 4A2NB 2Y3HA 1S7ZA 5D91A 4ZLCA 3EQLF 3DM9B 1D1BA 4PK4A 1ZHTA 4PJMA 3ZSUA 2J0XA 3B0UX 5F5HA 2C04A 1BR4A 1TR2A 1QLEC 3EHNA 2EINC 2CGEA 4J30B 3NYMA 2Q3TA 4QI2A 2V3CC 4W8KA 3NKEA 3DD7A 2PX0A 1SF8A 2CDQA 3AQBA 5EHHA 4KNWA 1VK5A 4O79A 3ZIBA 1OCZC 4U5FE 3ZG1A 4U5EE 2P6VA 4N06A 1Z6AA 3B9QA 2NUTA 3SP1A 3LESA 4RDAA 3EG9B 2H7BA 4DBRA 4CS9A 2NG1A 3LLKA 3O39A 1M2VB 2Q9CA 4JW1A 1O87A 1VYKA 3OEOA 3PMRA 4K7BA 3UGPA 2J9WA 2WZLA 2A6EF 2IYLD 2J9VA 1SZIA 1J8YF 3L34A 4JURI 2ZXOA 4QI0A 4AK9A 2H7OA 3K33A 4YT5A 1QZXA 3HJCA 4I1MA 3K6BA 5KYWB 2GFHA 2X51A 3CQZA 1VOMA 4XLNF 4KC9A 3DAFA 4C7OA 1FFTC 2WB7A 1NG1A 2V26A 2EILC 3LEVA 3KKBA 4BJ6C 4ANJA 1D0XA 1D1CA 3EGXA 1MMDA 2WL8A 3DM5A 1MMNA 3W8HA 4EWCA 3K1IC 3I5QA 1Z5ZA 4NY3A 1V54C 2ZXRA 4JJFA 4X0RA 3LNRA 4AX2A 1IZMA 3RKOF 3I4UA 4XWJA 5E33A 3K66A 2WVQA 3GODA 2KW3C 1OCRC 2HV6A 1OKKA 4JJGA 3LLIA 3N0TA 3N2ZB 5KYUA 4OIRF 2I8BA 1RJ9B 4C3BA 3GANA 1TWCA 5KYYB 1ZHYA 2J7PD 4BJ5A 3IEEA 2WZGA 1D0YA 3L0IA 3EGDB 2R7TA 3WG7C 4J32B 3LJBA 3T6JA 2L81A 4PJJA 3ITFA 1MMGA 1ZU4A 4HFKB 4ULWA 3UNGC 4WJ0A 5KYXB 3QZCA 4PFOA 1FFHA 4LERA 2A68F 2A69F 2XXAA 3DAGA 4BJTA 1SMYF 4G7ZF 3OA1A 3W2VA 2PP4A 4JVSA 2P7VA 2L9JA 4CS8C 3DXJF 2A1DD 3EG9A 4U5CE 3TD7A 3JT1A 1FMVA 5HSWA 4M63A 2QTVA 5DLJA 4PFPA 5D92A 2B0JA 1LVKA 4CIHA 3NYJA 4YJWA 3ECSA 3E70C 5DVWA 3RIPA 1LS1A 2Y3DA 3RYLA 3UR3C 2W4MA 4BG0A 2Y39A 4AE4A 3POVA 2MWQA 4U5BE 3CZ6A 5FCLA 4H4KC 1NU7D 2HV7A 4HFFB 4CS7A 3S0XA 1FTSA 2JD3A 4BJ1A 4E7ZA 2O9XA 2IXNA 3LS1A 3KMIA 1MNEA 2W4BA 3DMDA 4G7OF 2ZPAA 2Q9AA 4CSAA 4CBEA 3UMKA 2DYSC 2YZSA 4U5GA 4PJNA 3W2WA 4XTKA 3JYHA 3HTKC 3Q7GA 2IXPA 3T6BA 2CNWA 4QDLA 3VYWA 1MNDA 4Q7CA 3EJNA 3SZRA 1LKXA 2NUTB 1ZHWA 4C3EA 1OCCC 5E2QA 1G8XA 3AG3C 3EZHA 1PCXA 5DQTA 5L3VA 2R7VA 1V55C 2QY9A 2Y3GA 4U5HA 3DJNB 2KJGA 3EH1A 4I1OB 4O6YA 3UGOA 1O5HA 2YHSA 2D5RB 1VMAA 4HEAJ 3PHF2 3K1HA 4IRUA 3F47A 4I3MA 4YT4A 3NYLA 5KYNA 4OD5A 1KU2A 2Y69C 5B1AC 5DS4A 4B6IA 3RH3A 3RFYA 2XSEA 4G0HA 4DVZA 3ZC4A 3JSZA 3O6XA 4G7HF 2EIKC 3LS0A 3M1CB 3B0VC 3ABMC 2R7OA 5T3TA 4YT8A 3QMKA 1D0ZA 4K0DA 3FDQA 2Q9BA 2OCCC 4XLPF 5CI9A 4CS9C 4IJJA 3ASOC 4Q5SF 4OINF 4O6MA 2VB6A 4JZAA 3ZVRA 2VASA 1Z63A 4LLCA 4OD4A 4O6NA 4FX5A 2IXMA 3SYNA 5L3QA 1Z23A 3DJUB 2DYRC 3V7OA 2MYSA 2FGYA 3ABKC 3EFOB 1PD1A 2A6HF 3LAYA 4ZLDA 3MLGA 1TWAA 4YN0B 1ZU5A 4JCHA 2ZXPA 1TWHA 5KYUB 2R7UA 1JPNA 4YT2A 2Y3BA 4KBLA 4FWVA 2WZFA 3EZIA 2FFHA 2OG2A 4YWQA 4DBQA 4BJ6A 2J0WA 2KNHA 1M2VA 2ZXWC 2XL4A 1PD0A 5T1DB 3X2QC 1FMWA 2NUPB 1OCOC 3H65A 2J9UA 3EPVA 4I44A 2C03A 3S29A 3SNHA 2CW0F 3KH2A 3FAJA 3N24A 1ZYRF 4Q4ZF 2XXAB 4C3DA 2J7PA 5DS5A 3VAYA 5KYWA 3NKDA 1N1CA 3FVYA 2PFDA 4LACB 4PJLA 2EIJC 2W9YA 1WGWA 4RBNA 3ABLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AQB A;  3AQC A; 
#chains in the Genus database with same CATH topology
 3C62 A;  4D4X A;  2J46 A;  2LIG A;  2IOQ A;  3NDB B;  4BJ5 C;  5F5F A;  3ATP A;  4KNV A;  4U5D E;  4DOZ A;  2E87 A;  2JPU A;  3A9C A;  1W2W A;  3MX3 A;  4E7S A;  5B3S C;  2TMV P;  2VC9 A;  3B29 A;  3S28 A;  2XL8 A;  1J8M F;  1EKY A;  2EIM C;  1OKK D;  3X1O A;  3M4B A;  3TQO A;  3GM2 A;  1OR2 A;  1C03 A;  4JRZ A;  1BR2 A;  3LUT B;  3NMK A;  2YKZ A;  1G4W R;  2HZ8 A;  2YL0 A;  4EBB A;  4AE4 B;  1JAF A;  1TWG A;  2R7X A;  1T01 A;  2DGJ A;  4AL0 A;  2YL3 A;  2H7V C;  3E9V A;  3FHD A;  3IQT A;  1OW8 A;  1QQ3 A;  1R4T A;  3AG4 C;  5T3W A;  1FAP B;  1HMD A;  3GM1 A;  3F46 A;  3W8I A;  3QVY A;  3JZ0 A;  3KL4 A;  3S27 A;  4BEJ A;  3J06 A;  2BE5 F;  2XLE A;  4DRI B;  2VH3 A;  2G62 A;  3QTH A;  5JRA A;  1OXK A;  2R7W A;  3GWN A;  1NBB A;  4IAO A;  3Q6N A;  5L0D A;  3ASN C;  1IW7 F;  3HNJ A;  4MND A;  1K04 A;  2OU6 A;  2XS1 A;  4JIO A;  3CSK A;  4P6I C;  4FAP B;  2R7S A;  3I5P A;  4CS8 A;  1D1A A;  3GEI A;  1ZVZ A;  5B1B C;  1E83 A;  2IXO A;  2KQ9 A;  1RJ9 A;  2DI3 A;  2YEV A;  2L6H A;  3UMH A;  2VCC A;  2UUH A;  2R7R A;  5KYY A;  4GEH A;  3B0P A;  1H7I A;  1M57 C;  1T6I A;  1NFO A;  1WTY A;  3T4R A;  5AC5 A;  4MQ9 F;  4C7O B;  5L0G A;  4PAC A;  1T9K A;  3EGD A;  5JVE A;  2QUP A;  1DOW A;  3JCU Q;  5IY5 C;  3NG1 A;  1M2O A;  4DJ9 A;  4NCQ A;  2OQM A;  1JMW A;  1VLS A;  2WVO A;  2LP4 A;  1Q0K A;  3FAP B;  3EGX B;  2HJM A;  4H54 A;  4WAB A;  1M56 C;  2HSQ A;  3HLZ A;  4LLE A;  4OIP F;  2WVN A;  1YJG A;  3NRH A;  4DRJ B;  1Z3I X;  3EFO A;  3ZTZ A;  5L0F A;  4F4B A;  5E3A A;  3Q7L A;  2PX3 A;  2KGO A;  4IWB A;  5KYX A;  1VYI A;  1E85 A;  3U0C A;  2DB4 A;  2OJQ A;  3AG2 C;  2LSE A;  5B3I A;  4CSA C;  3RVZ A;  3SEO A;  3AG1 C;  2J45 A;  5E3C A;  4YK5 A;  1KNY A;  3JRT A;  1ST6 A;  4Z9J A;  3ZDL A;  4N4W A;  2YWA A;  2L7A A;  5BUO A;  2XLO A;  1MMA A;  3KYI A;  3UMI A;  5EGY A;  1JPJ A;  1GGQ A;  3K7D A;  3OWT A;  3RQE A;  4DVY P;  4OIQ F;  3AGU A;  1EQ1 A;  5CI8 A;  2HMZ A;  2XRH A;  3AQC A;  4MW3 A;  3V5Y A;  2UUI A;  1H9T A;  1BR1 A;  2RSE B;  5A6A A;  1NZE A;  1ZHZ A;  4FES A;  256B A;  2GWW A;  2PF4 E;  4GYT A;  4RD9 A;  2ZD9 A;  3T9O A;  3WOD F;  3G4X A;  4NTA A;  1VB5 A;  2J9B A;  2M4E A;  2OJE D;  2P1A A;  3M4C A;  3Q6M A;  4HE8 D;  5AC4 A;  1E86 A;  3CAX A;  3EHM A;  5DQZ A;  2R7Q A;  1TKN A;  1T6U A;  3FXH A;  4O7G A;  2YLI A;  4ER9 A;  2R25 A;  3G4Z A;  2NUP A;  3DZA A;  1NU9 C;  5DS6 A;  3EH2 A;  1ZHX A;  2CNW D;  4KI2 A;  1U6H A;  4CIP A;  2ASR A;  2Z15 A;  2G3K A;  1YDI A;  2W45 A;  3C8G A;  2G3V A;  4IAR A;  2B0H A;  1RCP A;  3ZWI A;  4A2N B;  2A0U A;  2Y3H A;  1F1M A;  1S7Z A;  5D91 A;  4ZLC A;  3EQL F;  1WAS A;  3DM9 B;  4N6H A;  1D1B A;  3GWL A;  4PK4 A;  3T6G B;  1UG7 A;  2YQY A;  2AVK A;  3MBG A;  2HKV A;  5GPG B;  1ZHT A;  2ETS A;  4PJM A;  3NMI A;  2J0X A;  3VF0 A;  2AWY A;  4LDK A;  2QNL A;  5TJ5 E;  2GDC A;  4EBJ A;  5K0I A;  3B0U X;  3BEH A;  4GQH A;  5F5H A;  2C04 A;  1BR4 A;  1TR2 A;  1QLE C;  3AJM A;  2EIN C;  3EHN A;  3HNI A;  1LM3 B;  2CGE A;  4G78 A;  4K1O A;  3M15 A;  2XM4 A;  4J30 B;  1ZW3 A;  3NYM A;  2Q3T A;  2FAP B;  4QI2 A;  2OEV A;  2VCA A;  4WGY A;  4W8K A;  1RXQ A;  3RW0 A;  2V3C C;  1A0B A;  3NKE A;  4IAQ A;  3DD7 A;  2PX0 A;  1SF8 A;  2CDQ A;  3AQB A;  5EHH A;  1OW6 A;  4KNW A;  1VK5 A;  3PCV A;  2PBE A;  4O79 A;  3ZIB A;  1OCZ C;  2AU5 A;  5BQI A;  2LD6 A;  4U5F E;  3ZG1 A;  4U5E E;  2P6V A;  4E0I A;  4N06 A;  3FOO A;  1Z6A A;  1YZA A;  3B9Q A;  3QW0 A;  1JOG A;  2NUT A;  3SP1 A;  3LES A;  4RDA A;  5L0J A;  1LIH A;  2EPM X;  3IQ6 A;  2XLM A;  2H7B A;  3EG9 B;  4DBR A;  4XEF A;  4CS9 A;  2NG1 A;  3IPM O;  2P0N A;  2NPU A;  3LLK A;  4P9F A;  3GOR A;  1M2V B;  3O39 A;  2Q9C A;  4JW1 A;  4AL1 A;  3ZTM A;  4DRH B;  4R32 A;  1O87 A;  1K40 A;  2HMQ A;  1VYK A;  3OEO A;  3PMR A;  4K7B A;  1UFB A;  4MVO A;  4NC3 A;  5AGF A;  1HY5 A;  3SXZ A;  3TOM A;  2J9W A;  4XPY A;  3UGP A;  2WZL A;  2A0B A;  1YA7 O;  3SXM A;  1APC A;  2A6E F;  2IYL D;  2J9V A;  2YL7 A;  2PNO A;  3NMJ A;  3A11 A;  1SZI A;  3HNL A;  1J8Y F;  4MTG A;  3U5S A;  1Q0G A;  2EPN A;  4IGG A;  3FMS A;  3O10 A;  5JUA A;  3L1M A;  3L34 A;  1HE1 A;  4JUR I;  2ZXO A;  4JKV A;  4QI0 A;  4AK9 A;  3JYY A;  3U9M A;  2H7O A;  3K33 A;  4YT5 A;  1HE9 A;  1QZX A;  1VLT A;  4MVZ A;  3HJC A;  1H6G A;  3K6B A;  4I1M A;  2GFH A;  3QVZ A;  5KYW B;  2X51 A;  3CQZ A;  1VOM A;  3RF3 A;  4MTO A;  4XLN F;  4KC9 A;  3DAF A;  1QVX A;  3KYJ A;  4C7O A;  1FFT C;  2WB7 A;  4JTA B;  1NG1 A;  2V26 A;  2EIL C;  3LEV A;  2HUJ A;  4XPW A;  3S84 A;  1FNT c;  3KKB A;  4D4N A;  4BJ6 C;  4PR9 A;  1XWJ A;  1D0X A;  1D1C A;  3DKA A;  4JTC B;  1A41 A;  4ANJ A;  4CDA A;  5F28 E;  4LDR A;  4NTF A;  3EGX A;  5COM A;  1MMD A;  1TFO B;  2KK1 A;  2WL8 A;  4Z9H A;  3DM5 A;  1MMN A;  3W8H A;  4EWC A;  1OXB A;  1DOV A;  3B71 A;  3I5Q A;  2LFD A;  1Z5Z A;  3DE8 A;  3K1I C;  1M6T A;  2XLD A;  2XLH A;  4NY3 A;  5HV9 A;  2OKU A;  1BZ4 A;  3U8P A;  4W8P A;  1V54 C;  3WHN A;  1ORJ A;  3C8Z A;  3U8V A;  2ZXR A;  1YAU O;  4JJF A;  5BQG A;  2H8A A;  3QW1 A;  4X0R A;  3LNR A;  3ZQV A;  1IZM A;  4AX2 A;  3RKO F;  3I4U A;  4XWJ A;  5E33 A;  2XS8 A;  4NTB A;  4UDV A;  1TFK B;  1YLM A;  2QE9 A;  3K66 A;  2WVQ A;  3GOD A;  1CPQ A;  3TUL A;  4EBK A;  1G4U S;  2KW3 C;  1OCR C;  1L3P A;  2HV6 A;  1OKK A;  4JJG A;  3LLI A;  3R2P A;  4BEM J;  3N0T A;  3N2Z B;  3SXK A;  5KYU A;  4Z9I A;  4OIR F;  1Q0D A;  2I8B A;  1RJ9 B;  2Q7R A;  5A6B D;  4C3B A;  3U3B A;  3GAN A;  1TWC A;  4J7Y A;  4CJO A;  3L8I A;  5KYY B;  2GA0 A;  1ZHY A;  2I15 A;  2J7P D;  4BJ5 A;  3IEE A;  2XLW A;  3IHU A;  5COF A;  1S05 A;  2WZG A;  1D0Y A;  2Q00 A;  3L0I A;  3EGD B;  2KSF A;  3G50 A;  1RKE A;  2L6G A;  1HW2 A;  1OQC A;  4IB4 A;  2R7T A;  3WG7 C;  3U9J A;  4A4A A;  4J32 B;  4EUK B;  1NLX A;  3LJB A;  3T6J A;  1OR3 A;  2L81 A;  4PJJ A;  1R5I D;  2F22 A;  1E2X A;  1MMG A;  3ITF A;  1T5O A;  1YA9 A;  1ZU4 A;  4HFK B;  1VTM P;  4MTF A;  1QSP A;  3CEX A;  3JSE O;  4ULW A;  3UNG C;  3WAQ A;  4WJ0 A;  4MS2 A;  4E0H A;  3QZC A;  5KYX B;  2YLG A;  1WWP A;  1FFH A;  3C63 A;  2XL6 A;  4LER A;  4PFO A;  2A68 F;  3TOL A;  2A69 F;  3PDM P;  3DAG A;  2XXA A;  2R02 A;  1TQG A;  3TJ5 A;  4BJT A;  4U9E A;  1SMY F;  5L0I A;  1WAT A;  4G7Z F;  1U0B B;  3H2U A;  3OA1 A;  3W2V A;  2PP4 A;  4JVS A;  3JTL O;  3MYF A;  1CGN A;  2IM8 A;  2P7V A;  2L9J A;  4CS8 C;  3DXJ F;  2A1D D;  1HW1 A;  4MVS A;  3EG9 A;  4U5C E;  3TD7 A;  3JT1 A;  1FMV A;  3H2V A;  4XQ1 A;  5HSW A;  5CIV A;  4M63 A;  4ULV A;  3S0X A;  2QTV A;  3HKK A;  1QPU A;  3KPH A;  4PFP A;  2B0J A;  2R03 A;  5COG A;  5D92 A;  3U2L A;  1LVK A;  1LS4 A;  4CIH A;  2D4U A;  2XLV A;  3NYJ A;  4YJW A;  3ECS A;  1CPR A;  2LK4 A;  3E70 C;  5DVW A;  1SR2 A;  3RIP A;  1A7D A;  1LS1 A;  2Y3D A;  4JEA A;  3RYL A;  2W4M A;  3UR3 C;  4YL1 A;  3ZQY A;  2Y39 A;  4BG0 A;  4EIY A;  1WN0 A;  4AE4 A;  3POV A;  2MWQ A;  4U5B E;  3CZ6 A;  3SXY A;  5FCL A;  4H4K C;  1NU7 D;  2HV7 A;  4HFF B;  3RQG A;  4CS7 A;  2AWC A;  1FTS A;  2JD3 A;  3U2M A;  1A7V A;  1A7E A;  4U9D A;  4BJ1 A;  4E7Z A;  1L7C A;  1KTM A;  1NFN A;  1YYX A;  2IXN A;  2O9X A;  1MNE A;  3KMI A;  1ZZP A;  3LS1 A;  2W4B A;  5FZT A;  1LI5 A;  3DMD A;  2ZPA A;  4G7O F;  2Q9A A;  4CSA A;  4CBE A;  2EPO A;  3UMK A;  2DYS C;  2MHR A;  2YZS A;  4U5G A;  4PJN A;  2YVK A;  4XTK A;  3W2W A;  4MVR A;  1V74 B;  3JYH A;  2J8W A;  3HTK C;  3V5X A;  2R9R B;  2IXP A;  3Q7G A;  2CNW A;  3T6B A;  3HNK A;  4QDL A;  3L8J A;  3VYW A;  4BPM A;  1MND A;  4Q7C A;  3DWW A;  3EJN A;  3SZR A;  1T6Q A;  2CCY A;  2HJ3 A;  1LKX A;  4JTD B;  2NUT B;  2HS5 A;  3W4Y A;  1JRA A;  1ZHW A;  2OEX A;  4WGZ A;  4C3E A;  1OCC C;  5E2Q A;  2YRF A;  1G8X A;  4J7T A;  1ORS C;  1YZC A;  1XZP A;  3AG3 C;  3AGT A;  3EZH A;  1PCX A;  5DQT A;  5L3V A;  3GEE A;  1V55 C;  3MYI A;  1B68 A;  1LPE A;  3LNM B;  1YVI A;  2R7V A;  2QY9 A;  3DE9 A;  2Y3G A;  3FOP A;  4U5H A;  3DJN B;  1NSG B;  2KJG A;  3EH1 A;  4I1O B;  4O6Y A;  5A69 A;  4CDY A;  3UGO A;  1O5H A;  2YHS A;  2IBF A;  2D5R B;  3DI5 A;  1VMA A;  4HEA J;  2AP3 A;  1GS9 A;  2LFF A;  3K1H A;  3PHF 2;  3C8G D;  4IRU A;  5A6J A;  5A6K A;  3F47 A;  4I3M A;  4YL3 A;  3NYL A;  4YT4 A;  3TJ6 A;  1I4Z A;  5KYN A;  2HSB A;  1KU2 A;  4OD5 A;  1Y6D A;  2Y69 C;  5B1A C;  5DS4 A;  1GQA A;  1O3U A;  3BRJ A;  4B6I A;  3IQC A;  3RH3 A;  3RFY A;  2XSE A;  4XEK A;  4G0H A;  1AVO B;  5JLI A;  4MVQ A;  1AUE A;  3U3F A;  3ZC4 A;  4DVZ A;  3JSZ A;  2GAQ A;  2LQG A;  5JP7 A;  1SYQ A;  3O6X A;  4EHP A;  1JR8 A;  4G7H F;  2EIK C;  5JSL A;  1G5Z A;  2RD9 A;  2BL2 A;  3LS0 A;  2BC5 A;  3M1C B;  3B0V C;  1PV3 A;  3ABM C;  2R7O A;  2YLD A;  5T3T A;  4YT8 A;  2CYD A;  3QMK A;  3V5Z A;  1D0Z A;  2EPL X;  4K0D A;  4MVM A;  2Q9B A;  3GEH A;  2OCC C;  4XLP F;  3FDQ A;  5CI9 A;  4CS9 C;  3C18 A;  4EKW A;  4IJJ A;  1BDJ B;  3ASO C;  4Q5S F;  4ONS A;  1EA8 A;  4OIN F;  2NSF A;  4O6M A;  2X0C A;  2KYH A;  4E17 A;  2VB6 A;  1FR0 A;  4JZA A;  3ZVR A;  4CX9 A;  1RMV A;  2VAS A;  1Z63 A;  2ICW G;  4LLC A;  3MFN A;  1I5N A;  1MQV A;  2M64 A;  3RVY A;  4OD4 A;  4DXW A;  3AOU A;  2EPK X;  4O6N A;  4FX5 A;  1AEP A;  2Q4F A;  2IXM A;  3SYN A;  1ORY A;  4L6R A;  4LDQ A;  5L3Q A;  1Z23 A;  1YAR O;  1LE2 A;  3DJU B;  3JRM O;  2DYR C;  3V7O A;  1U89 A;  2JX0 A;  2MYS A;  1ZW2 A;  2FGY A;  3ABK C;  3EFO B;  1PD1 A;  1XZQ A;  2KC3 A;  1Y4C A;  2A6H F;  3LAY A;  4ZLD A;  4JEB A;  5L0H A;  3MLG A;  1TWA A;  1GM5 A;  1QKR A;  4YN0 B;  1V4A A;  3R7C A;  5JT4 A;  4OIO F;  1I4Y A;  1ZU5 A;  2QLA A;  2XM0 A;  1OW7 A;  1HMO A;  4JE9 A;  4JCH A;  2ZXP A;  1TWH A;  5KYU B;  4XEV A;  1CGO A;  1JPN A;  3M79 A;  4YT2 A;  2R7U A;  2Y3B A;  4KBL A;  4CDV A;  4FWV A;  5JS5 A;  2WZF A;  3EZI A;  3US6 A;  1LI7 A;  2FFH A;  1BBH A;  2OG2 A;  4YWQ A;  4DBQ A;  5L0C A;  4BJ6 A;  1CGM E;  1C17 M;  1EI7 A;  1LE4 A;  1YYJ A;  2J0W A;  2KNH A;  3C7J A;  3VM6 A;  1E84 A;  2R05 A;  3ZSU A;  2OOC A;  1M2V A;  2ZXW C;  1RKE B;  4NQF A;  4MVU A;  2XL4 A;  4XPX A;  3RQF A;  3LEO A;  1PD0 A;  1C02 A;  1H9G A;  1RKC A;  4JCZ A;  2P61 A;  5T1D B;  3X2Q C;  5BQH A;  1FMW A;  2YL1 A;  2L6F A;  2NUP B;  3K1I A;  3S9O A;  3VRC A;  1OCO C;  4CJG A;  3H65 A;  2J9U A;  2NSG A;  3C8G B;  2LCH A;  3GM3 A;  3EPV A;  3IQ5 A;  4I44 A;  2C03 A;  3S29 A;  1Z7Q c;  3SNH A;  2CW0 F;  1K05 A;  1WOL A;  3FAJ A;  3KH2 A;  3N24 A;  4E18 A;  4JC7 A;  5EK0 A;  1ZYR F;  5A6B A;  4P9T A;  4Q4Z F;  2XXA B;  4YL0 A;  4C3D A;  3TK0 A;  4N6C A;  4MW8 A;  2J7P A;  1Q0F A;  5DS5 A;  3VAY A;  5KYW A;  3NKD A;  1N1C A;  3FVY A;  2HFI A;  2PFD A;  4LAC B;  1Q0M A;  4PJL A;  2EIJ C;  3S90 A;  2W9Y A;  3O55 A;  5DLJ A;  1WGW A;  2VCB A;  4RBN A;  3ABL C; 
#chains in the Genus database with same CATH homology
 2J46 A;  2IOQ A;  3NDB B;  4BJ5 C;  5F5F A;  4KNV A;  4U5D E;  4DOZ A;  4E7S A;  2E87 A;  1W2W A;  3MX3 A;  5B3S C;  3S28 A;  1J8M F;  2EIM C;  1OKK D;  3X1O A;  1BR2 A;  4EBB A;  4AE4 B;  1TWG A;  2R7X A;  2DGJ A;  2H7V C;  3E9V A;  3FHD A;  3AG4 C;  5T3W A;  3F46 A;  3W8I A;  3KL4 A;  3S27 A;  4BEJ A;  2BE5 F;  2VH3 A;  2G62 A;  2R7W A;  4IAO A;  3Q6N A;  3ASN C;  1IW7 F;  4MND A;  3CSK A;  4P6I C;  2R7S A;  3I5P A;  4CS8 A;  1D1A A;  5B1B C;  4OIO F;  2IXO A;  2KQ9 A;  1RJ9 A;  2YEV A;  3UMH A;  2R7R A;  5KYY A;  4GEH A;  3B0P A;  1M57 C;  3T4R A;  4MQ9 F;  4C7O B;  3EGD A;  5IY5 C;  3JCU Q;  3NG1 A;  1M2O A;  2WVO A;  3EGX B;  1M56 C;  3HLZ A;  4LLE A;  4OIP F;  2WVN A;  3NRH A;  1Z3I X;  3EFO A;  4F4B A;  5E3A A;  3Q7L A;  2PX3 A;  2KGO A;  4IWB A;  5KYX A;  1VYI A;  3AG2 C;  2LSE A;  4CSA C;  3SEO A;  3AG1 C;  2J45 A;  5E3C A;  3JRT A;  1ST6 A;  5BUO A;  5EGY A;  1MMA A;  3UMI A;  1JPJ A;  3K7D A;  3OWT A;  4DVY P;  4OIQ F;  5CI8 A;  2XRH A;  3AQC A;  1BR1 A;  1NZE A;  1ZHZ A;  4FES A;  2PF4 E;  4RD9 A;  4GYT A;  3WOD F;  2M4E A;  3Q6M A;  4HE8 D;  3EHM A;  5DQZ A;  2R7Q A;  1TKN A;  4O7G A;  2NUP A;  3DZA A;  1NU9 C;  5DS6 A;  3EH2 A;  1ZHX A;  2CNW D;  4KI2 A;  2Z15 A;  2G3K A;  2W45 A;  2G3V A;  4A2N B;  2Y3H A;  1S7Z A;  5D91 A;  4ZLC A;  3EQL F;  3DM9 B;  1D1B A;  4PK4 A;  1ZHT A;  4PJM A;  3ZSU A;  2J0X A;  3B0U X;  5F5H A;  2C04 A;  1BR4 A;  1TR2 A;  1QLE C;  3EHN A;  2EIN C;  2CGE A;  4J30 B;  3NYM A;  2Q3T A;  4QI2 A;  2V3C C;  4W8K A;  3NKE A;  3DD7 A;  2PX0 A;  1SF8 A;  2CDQ A;  3AQB A;  5EHH A;  4KNW A;  1VK5 A;  4O79 A;  3ZIB A;  1OCZ C;  4U5F E;  3ZG1 A;  4U5E E;  2P6V A;  4N06 A;  1Z6A A;  3B9Q A;  2NUT A;  3SP1 A;  3LES A;  4RDA A;  3EG9 B;  2H7B A;  4DBR A;  4CS9 A;  2NG1 A;  3LLK A;  3O39 A;  1M2V B;  2Q9C A;  4JW1 A;  1O87 A;  1VYK A;  3OEO A;  3PMR A;  4K7B A;  3UGP A;  2J9W A;  2WZL A;  2A6E F;  2IYL D;  2J9V A;  1SZI A;  1J8Y F;  3L34 A;  4JUR I;  2ZXO A;  4QI0 A;  4AK9 A;  2H7O A;  3K33 A;  4YT5 A;  1QZX A;  3HJC A;  4I1M A;  3K6B A;  5KYW B;  2GFH A;  2X51 A;  3CQZ A;  1VOM A;  4XLN F;  4KC9 A;  3DAF A;  4C7O A;  1FFT C;  2WB7 A;  1NG1 A;  2V26 A;  2EIL C;  3LEV A;  3KKB A;  4BJ6 C;  4ANJ A;  1D0X A;  1D1C A;  3EGX A;  1MMD A;  2WL8 A;  3DM5 A;  1MMN A;  3W8H A;  4EWC A;  3K1I C;  3I5Q A;  1Z5Z A;  4NY3 A;  1V54 C;  2ZXR A;  4JJF A;  4X0R A;  3LNR A;  4AX2 A;  1IZM A;  3RKO F;  3I4U A;  4XWJ A;  5E33 A;  3K66 A;  2WVQ A;  3GOD A;  2KW3 C;  1OCR C;  2HV6 A;  1OKK A;  4JJG A;  3LLI A;  3N0T A;  3N2Z B;  5KYU A;  4OIR F;  2I8B A;  1RJ9 B;  4C3B A;  3GAN A;  1TWC A;  5KYY B;  1ZHY A;  2J7P D;  4BJ5 A;  3IEE A;  2WZG A;  1D0Y A;  3L0I A;  3EGD B;  2R7T A;  3WG7 C;  4J32 B;  3LJB A;  3T6J A;  2L81 A;  4PJJ A;  3ITF A;  1MMG A;  1ZU4 A;  4HFK B;  4ULW A;  3UNG C;  4WJ0 A;  5KYX B;  3QZC A;  4PFO A;  1FFH A;  4LER A;  2A68 F;  2A69 F;  2XXA A;  3DAG A;  4BJT A;  1SMY F;  4G7Z F;  3OA1 A;  3W2V A;  2PP4 A;  4JVS A;  2P7V A;  2L9J A;  4CS8 C;  3DXJ F;  2A1D D;  3EG9 A;  4U5C E;  3TD7 A;  3JT1 A;  1FMV A;  5HSW A;  4M63 A;  2QTV A;  5DLJ A;  4PFP A;  5D92 A;  2B0J A;  1LVK A;  4CIH A;  3NYJ A;  4YJW A;  3ECS A;  3E70 C;  5DVW A;  3RIP A;  1LS1 A;  2Y3D A;  3RYL A;  3UR3 C;  2W4M A;  4BG0 A;  2Y39 A;  4AE4 A;  3POV A;  2MWQ A;  4U5B E;  3CZ6 A;  5FCL A;  4H4K C;  1NU7 D;  2HV7 A;  4HFF B;  4CS7 A;  3S0X A;  1FTS A;  2JD3 A;  4BJ1 A;  4E7Z A;  2O9X A;  2IXN A;  3LS1 A;  3KMI A;  1MNE A;  2W4B A;  3DMD A;  4G7O F;  2ZPA A;  2Q9A A;  4CSA A;  4CBE A;  3UMK A;  2DYS C;  2YZS A;  4U5G A;  4PJN A;  3W2W A;  4XTK A;  3JYH A;  3HTK C;  3Q7G A;  2IXP A;  3T6B A;  2CNW A;  4QDL A;  3VYW A;  1MND A;  4Q7C A;  3EJN A;  3SZR A;  1LKX A;  2NUT B;  1ZHW A;  4C3E A;  1OCC C;  5E2Q A;  1G8X A;  3AG3 C;  3EZH A;  1PCX A;  5DQT A;  5L3V A;  2R7V A;  1V55 C;  2QY9 A;  2Y3G A;  4U5H A;  3DJN B;  2KJG A;  3EH1 A;  4I1O B;  4O6Y A;  3UGO A;  1O5H A;  2YHS A;  2D5R B;  1VMA A;  4HEA J;  3PHF 2;  3K1H A;  4IRU A;  3F47 A;  4I3M A;  4YT4 A;  3NYL A;  5KYN A;  4OD5 A;  1KU2 A;  2Y69 C;  5B1A C;  5DS4 A;  4B6I A;  3RH3 A;  3RFY A;  2XSE A;  4G0H A;  4DVZ A;  3ZC4 A;  3JSZ A;  3O6X A;  4G7H F;  2EIK C;  3LS0 A;  3M1C B;  3B0V C;  3ABM C;  2R7O A;  5T3T A;  4YT8 A;  3QMK A;  1D0Z A;  4K0D A;  3FDQ A;  2Q9B A;  2OCC C;  4XLP F;  5CI9 A;  4CS9 C;  4IJJ A;  3ASO C;  4Q5S F;  4OIN F;  4O6M A;  2VB6 A;  4JZA A;  3ZVR A;  2VAS A;  1Z63 A;  4LLC A;  4OD4 A;  4O6N A;  4FX5 A;  2IXM A;  3SYN A;  5L3Q A;  1Z23 A;  3DJU B;  2DYR C;  3V7O A;  2MYS A;  2FGY A;  3ABK C;  3EFO B;  1PD1 A;  2A6H F;  3LAY A;  4ZLD A;  3MLG A;  1TWA A;  4YN0 B;  1ZU5 A;  4JCH A;  2ZXP A;  1TWH A;  5KYU B;  2R7U A;  1JPN A;  4YT2 A;  2Y3B A;  4KBL A;  4FWV A;  2WZF A;  3EZI A;  2FFH A;  2OG2 A;  4YWQ A;  4DBQ A;  4BJ6 A;  2J0W A;  2KNH A;  1M2V A;  2ZXW C;  2XL4 A;  1PD0 A;  5T1D B;  3X2Q C;  1FMW A;  2NUP B;  1OCO C;  3H65 A;  2J9U A;  3EPV A;  4I44 A;  2C03 A;  3S29 A;  3SNH A;  2CW0 F;  3KH2 A;  3FAJ A;  3N24 A;  1ZYR F;  4Q4Z F;  2XXA B;  4C3D A;  2J7P A;  5DS5 A;  3VAY A;  5KYW A;  3NKD A;  1N1C A;  3FVY A;  2PFD A;  4LAC B;  4PJL A;  2EIJ C;  2W9Y A;  1WGW A;  4RBN A;  3ABL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...