3AQCA

M. luteus b-p 26 heterodimeric hexaprenyl diphosphate synthase in complex with magnesium and fpp analogue
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
135
structure length
135
Chain Sequence
MMRYLHKIELELNRLTSRYPFFKKIAFDAEIIKLVDDLNVDENVKCAIVAIDTSMRMQDFINEDNKDSFVLSTDVLSALFYKYLSQPFYQHDFLVLTDCVSRINELKSIRATITDEIALHNINKQIHYMFIQPYM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Component A of hexaprenyl diphosphate synthase
publication title Crystal structure of heterodimeric hexaprenyl diphosphate synthase from Micrococcus luteus B-P 26 reveals that the small subunit is directly involved in the product chain length regulation.
pubmed doi rcsb
source organism Micrococcus luteus
molecule tags Transferase
total genus 55
structure length 135
sequence length 135
chains with identical sequence C
ec nomenclature ec 2.5.1.83: Hexaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific).
pdb deposition date 2010-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1450 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3aqcA00
3AQCA 3AQBA
chains in the Genus database with same CATH superfamily
2XLDA 4NCQA 4U5EE 3BRJA 1FTSA 2XLMA 3UNGC 4AL1A 2R25A 1QZXA 4KBLA 2R7UA 2KGOA 4BEMJ 1ZHTA 3G4ZA 1Q0KA 3X1OA 1RJ9B 3ZTMA 3EGXA 4KNWA 2J7PD 3FOOA 5FZTA 4IAOA 2HMZA 2QNLA 4JEBA 4PJMA 4F4BA 5KYYA 3IQ5A 4JCHA 4U5DE 2ICWG 5EGYA 3HNIA 5GPGB 3SZRA 5KYUA 3RQGA 2G3VA 3DMDA 3M4BA 5BQIA 2DYSC 2XM4A 5KYXA 2ZXOA 3LEOA 3O6XA 1E84A 3U9JA 4BG0A 1I5NA 4XPWA 3GODA 4MTGA 3NYMA 1LE4A 1SR2A 1CGNA 2R02A 1MQVA 2XL4A 3ECSA 1RKCA 1G5ZA 3GORA 4JC7A 2W4MA 3KH2A 2FGYA 1ZHXA 1TWHA 3DI5A 2R7XA 1YYJA 3NMJA 2H7VC 3AQBA 5KYYB 1A7EA 1RCPA 3U3FA 5JSLA 2R7TA 5A6BA 2UUIA 3RQFA 3PHF2 2EIJC 1YAUO 1ORSC 1ZU5A 5BQHA 1K40A 1TR2A 2IXPA 2IM8A 3E70C 1OQCA 1CPRA 4MW3A 4Z9IA 4H4KC 4OIOF 4U5CE 4KI2A 4LERA 4XQ1A 2W4BA 4CS8A 4GYTA 3U2MA 4EBBA 3JTLO 2QUPA 3A11A 3AGUA 4AL0A 4YN0B 3S0XA 1OCZC 2BC5A 2KSFA 1JRAA 3H2UA 2Q4FA 3U5SA 2J0XA 1Z7Qc 2H7OA 1NFOA 3GM2A 4DJ9A 1SYQA 1MMAA 2J46A 4YK5A 3S9OA 2JD3A 2R7QA 3SXZA 4ULVA 3ZIBA 2R7RA 1YVIA 2AP3A 1NLXA 3GM3A 4FX5A 3W2WA 4IGGA 3EZIA 2VASA 2WL8A 2WVOA 4IWBA 3VF0A 1FFHA 4EWCA 4JVSA 2CCYA 1WASA 2UUHA 3GANA 3WODF 1NG1A 1XZPA 2PNOA 4RDAA 4G7HF 2QY9A 5JLIA 4MVQA 2JPUA 4MQ9F 2P61A 1SZIA 2XLEA 3C18A 1VB5A 2Y3BA 3LS1A 4P9FA 1ORYA 1HMDA 2X0CA 2HS5A 3SXKA 4AE4B 2XL8A 2YHSA 5AC5A 4QDLA 3S28A 2RSEB 3GM1A 1PCXA 5JS5A 2WVQA 3G50A 2VB6A 5E2QA 3GEEA 3DE8A 4HFKB 1YLMA 2HMQA 1H7IA 2KYHA 1LPEA 3C7JA 2V3CC 2YZSA 4YJWA 5B1BC 1PV3A 5DS4A 4E0IA 2QE9A 4ONSA 2IBFA 2ZD9A 2R7VA 5F28E 1JAFA 3MYFA 1NU7D 1Z23A 2L7AA 2Y39A 1Z5ZA 3EGDA 4MVSA 2TMVP 3MLGA 2Q9CA 5KYWB 2B0HA 2XLOA 2OU6A 2OQMA 1VTMP 2L81A 4WJ0A 1ZHZA 4MTOA 3ATPA 3EHNA 1ZW2A 3UMKA 2R7SA 1HY5A 3U9MA 3W8HA 3JSEO 2AU5A 3LUTB 4JIOA 1QVXA 4JTAB 2EINC 2LD6A 3EQLF 1Y6DA 1W2WA 3MX3A 3WG7C 5CIVA 4N4WA 3JCUQ 2LSEA 5DVWA 2MWQA 3QW1A 2AWCA 1HW2A 2PFDA 3I4UA 4XEFA 2YRFA 3NYJA 1YJGA 4C7OA 4OD4A 1LE2A 1SF8A 1U6HA 1YA7O 3AQCA 3DXJF 2Y3GA 4MS2A 2EPOA 3KKBA 4NC3A 3TD7A 4JJFA 3C63A 2CW0F 3K33A 2OJED 3ABMC 1BDJB 2A6EF 1VMAA 2YEVA 3AJMA 3LS0A 2NUTB 1M2OA 1MNDA 4BPMA 3US6A 3NDBB 3T4RA 2D5RB 2BE5F 2IXMA 1LIHA 1RJ9A 2YL3A 3V5YA 1U0BB 4O79A 1F1MA 1NSGB 5CI9A 3L0IA 4C3DA 3F46A 3O39A 4C7OB 2PX0A 3JYHA 3ZQYA 4ANJA 4KNVA 3MBGA 5A6JA 1G4US 3GEIA 3U8VA 1ZW3A 2IXNA 3ZG1A 4CS8C 5EHHA 4E0HA 3MYIA 3M79A 4E17A 5AC4A 4QI0A 3DAFA 4XEKA 3BEHA 3N24A 4NTBA 4PFOA 2KW3C 4MTFA 4N6HA 2VCBA 4P9TA 4U9DA 1N1CA 2WVNA 3TJ5A 3SYNA 3H2VA 3ZQVA 3B0VC 1QPUA 2M64A 4B6IA 2I8BA 5L0GA 1TFOB 2BL2A 3K1IC 4Z9JA 2FAPB 4OIRF 4IJJA 1I4YA 3LEVA 3UMIA 4G7OF 3AG4C 4O7GA 3ZWIA 2R7WA 3VYWA 4IB4A 1YDIA 1OCCC 3JRMO 1Z3IX 2EIMC 1G4WR 5JUAA 3OA1A 3QMKA 2NG1A 2ZXPA 2NSGA 1MMDA 2VCAA 3AG1C 4HFFB 2ZPAA 1A41A 1Q0MA 3DWWA 1OR2A 3IQTA 3IQ6A 4NTAA 4O6MA 2OG2A 2EPLX 3GWNA 2XLHA 3L8JA 2CNWD 1HMOA 4YT4A 1BR4A 4MVOA 4GEHA 3PMRA 3DJUB 2LFFA 3HTKC 3S29A 3U8PA 4BJ6C 2O9XA 1LS1A 1IW7F 2GFHA 4HEAJ 5L0JA 1T9KA 3EH1A 1HE9A 1E83A 1Q0DA 4I1MA 4JRZA 1EQ1A 1H6GA 4ZLCA 4WGYA 4OD5A 5L0CA 2OEXA 2YLGA 1WN0A 2C03A 2J0WA 1FAPB 2IXOA 2CDQA 4NQFA 2I15A 4U9EA 2J45A 4WGZA 1NU9C 1NBBA 4LDRA 1D1CA 1WOLA 2L6GA 4MVUA 5DQZA 1EI7A 2Q3TA 1VK5A 1VYIA 3C8GA 5T3TA 2IOQA 3ZC4A 4XLPF 2HKVA 4PJNA 4DXWA 1MNEA 1V54C 4AE4A 1ZU4A 4E7ZA 3FOPA 3W4YA 1C03A 1GQAA 1LVKA 2G3KA 1I4ZA 1JOGA 2HJMA 3K1IA 2PF4E 3NMKA 4HE8D 5COMA 2XSEA 4XLNF 5D91A 3TK0A 3TULA 3OEOA 1VLSA 1OCRC 1QSPA 2H8AA 4RBNA 3FMSA 5HV9A 2AVKA 3NG1A 4EUKB 2LK4A 3W2VA 3AGTA 4J32B 1LM3B 1V4AA 1D0YA 3G4XA 3KMIA 3FAPB 3SP1A 4CX9A 5DS6A 2HV7A 1RMVA 3ZTZA 2ZXRA 4EKWA 4NY3A 1OXKA 1XWJA 3X2QC 3C8GB 4W8PA 3CZ6A 3Q7LA 2R7OA 4A4AA 5KYWA 1OKKA 2JX0A 4MVRA 4LLEA 2XM0A 1HW1A 2RD9A 1LKXA 4ER9A 256BA 3IEEA 1AEPA 1L7CA 4U5HA 4L6RA 4BJ6A 4JEAA 4G7ZF 2XS1A 3S90A 3ITFA 1CGOA 2Q00A 4JCZA 3RW0A 3MFNA 5A6KA 3K6BA 4CDVA 1BBHA 2QTVA 1OCOC 4OIQF 5COGA 3RQEA 5B1AC 3DE9A 4DVZA 5B3IA 4D4XA 1A0BA 3FXHA 3IHUA 3LLKA 1J8MF 1A7VA 4E18A 1QQ3A 2A1DD 3CAXA 1BZ4A 2NUPB 3HLZA 3LESA 1Q0FA 5F5HA 2Z15A 1TWAA 1JR8A 3DD7A 4DBRA 3EJNA 2XL6A 2YL0A 4H54A 2Q9AA 2MHRA 4I1OB 3QVYA 5E3CA 4YT5A 1O5HA 1SMYF 2EIKC 2HJ3A 2Y69C 2NUTA 1S05A 3OWTA 3TOMA 5F5FA 2WZFA 1FR0A 1K04A 3DKAA 4YT2A 1WGWA 5IY5C 5EK0A 4K1OA 4OIPF 2HSBA 2B0JA 3L8IA 4O6YA 2EPNA 2H7BA 2YLDA 3EFOB 1PD0A 3L34A 4FAPB 5L0HA 1OW7A 3JSZA 1GS9A 3NKDA 2V26A 4Z9HA 4MNDA 2X51A 3HJCA 5L3QA 3T6JA 1KTMA 2AWYA 3FAJA 2P7VA 3W8IA 2WZLA 3SEOA 1FMVA 4JKVA 4DRIB 2KJGA 2EILC 2PBEA 4JJGA 3HNKA 3VAYA 4CIHA 4D4NA 2L6HA 3C8ZA 4PK4A 5K0IA 1AUEA 4C3EA 5A6BD 1H9TA 3RF3A 5JRAA 1E85A 3K7DA 3M15A 3B71A 3JZ0A 1T6IA 2FFHA 2E87A 3EPVA 3N2ZB 2ETSA 1BR1A 3ABKC 3LLIA 1M2VB 3EZHA 3GWLA 1ZYRF 4R32A 3TQOA 3S84A 1H9GA 2L9JA 3L1MA 2XLVA 4O6NA 2M4EA 4PJLA 2DGJA 2EPKX 2P0NA 3V5ZA 4ULWA 4I44A 1M56C 5L0IA 3V5XA 2XXAA 5JP7A 1MMNA 3U3BA 3PDMP 3DZAA 1T01A 3R2PA 4DRJB 4JURI 4PFPA 3JYYA 1LI7A 1UFBA 2DYRC 4AK9A 1YA9A 2CYDA 2LP4A 1OW6A 2YVKA 1J8YF 3ZVRA 3LJBA 1D1BA 3NYLA 3VRCA 4BJ5C 3KPHA 1E2XA 1O3UA 1MMGA 3RVYA 1RKEB 1JMWA 4CDYA 3B29A 1FFTC 1OKKD 1O87A 2IYLD 2XXAB 2LIGA 4XPYA 4A2NB 1M6TA 3ABLC 1FMWA 4LLCA 1KU2A 1ST6A 3WHNA 1FNTc 2R9RB 4XPXA 4YL1A 2LFDA 4XWJA 1JPNA 1NFNA 3KYJA 1T5OA 4QI2A 3VM6A 1DOWA 4CJGA 1R4TA 1D0XA 3JT1A 2VH3A 4U5GA 5CI8A 1V55C 3PCVA 3C62A 5DS5A 1D1AA 3UGPA 1RXQA 3HNJA 4BJ1A 2L6FA 2Y3HA 2YQYA 1BR2A 1GM5A 3JRTA 2XLWA 4K7BA 3O55A 2OKUA 4FESA 1Q0GA 1A7DA 1YARO 1YZAA 3NRHA 5DQTA 1T6UA 4W8KA 4DVYP 4JZAA 1OW8A 4YL0A 5A69A 3WAQA 3EGXB 5T1DB 3GEHA 2YKZA 3LAYA 2HFIA 4EBKA 4EIYA 2OEVA 3HNLA 3A9CA 4NTFA 4C3BA 3V7OA 4UDVA 4CSAA 3UGOA 2Y3DA 4CDAA 4AX2A 2KC3A 4BJ5A 2PP4A 2NSFA 4BEJA 4CBEA 3KYIA 4CJOA 1OXBA 5KYUB 5KYXB 3QVZA 1OR3A 4G0HA 3TOLA 4E7SA 2YWAA 2GAQA 4LDKA 2Q7RA 4CS9C 3O10A 2OJQA 1UG7A 2OCCC 4Q7CA 4U5BE 2A68F 4MVZA 3K1HA 3M4CA 2GWWA 3DJNB 3QW0A 2EPMX 3DM9B 1C17M 1VYKA 3R7CA 3T6BA 2LCHA 3TJ6A 1TQGA 1K05A 2NUPA 2WB7A 2LQGA 2J9UA 2GDCA 2YLIA 5D92A 2KQ9A 2WZGA 5COFA 4JTDB 1G8XA 2J7PA 2D4UA 3U0CA 5KYNA 1YZCA 3S27A 2R03A 1XZQA 5JT4A 1T6QA 1AVOB 2HUJA 2HZ8A 2A6HF 3IPMO 3LNMB 2P1AA 5T3WA 3AG3C 3EFOA 3RH3A 3POVA 1TKNA 5E3AA 3H65A 3T9OA 3NMIA 4MW8A 3RVZA 1V74B 2XS8A 1TWGA 3SNHA 4Q4ZF 4JTCB 3ASNC 1NZEA 3NKEA 3FHDA 4XTKA 4Q5SF 3Q6NA 2OOCA 3RYLA 1QKRA 1DOVA 1U89A 3M1CB 4JE9A 4YL3A 1QLEC 1L3PA 2CNWA 2MYSA 3F47A 1KNYA 1ORJA 1IZMA 1S7ZA 4IRUA 2J8WA 4DRHB 4KC9A 1CGME 1WTYA 1LS4A 1Z6AA 2CGEA 1CPQA 1Y4CA 2PX3A 2NPUA 2Q9BA 2VC9A 3B9QA 3I5QA 4GQHA 3AOUA 2XRHA 4I3MA 4CS9A 4U5FE 5L0FA 2W45A 2G62A 2J9VA 3I5PA 1M2VA 3ZSUA 2J9WA 4BJTA 1GGQA 1LI5A 2DB4A 4G78A 4LDQA 3CSKA 1E86A 1PD1A 1WATA 3RIPA 3ZDLA 5BUOA 3RFYA 4IAQA 2P6VA 4PJJA 3SXMA 2KK1A 3K66A 3FDQA 3DM5A 4WABA 4M63A 3QZCA 1VLTA 2F22A 2ZXWC 3EHMA 4FWVA 4RD9A 3UMHA 2C04A 3EH2A 4EHPA 5L0DA 3U2LA 5HSWA 5AGFA 3CQZA 2A0BA 1JPJA 1ZVZA 2YL7A 3EG9A 4P6IC 3LNRA 5L3VA 5E33A 1ZHYA 1EKYA 2QLAA 3RKOF 1ZZPA 5FCLA 2ASRA 3ASOC 1Z63A 1YYXA 3J06A 3FVYA 3EGDB 4K0DA 2A0UA 3QTHA 1TWCA 1HE1A 4J7YA 3IQCA 2DI3A 1ZHWA 4LACB 3B0PA 4ZLDA 4J30B 3DAGA 2HV6A 1WWPA 3CEXA 4YT8A 3Q7GA 3UR3C 1RKEA 5JVEA 4JW1A 3C8GD 3E9VA 5TJ5E 4J7TA 4DBQA 2A69F 4XEVA 5B3SC 4N06A 4OINF 3Q6MA 1B68A 1C02A 3EG9B 4DOZA 4EBJA 1EA8A 4CIPA 5BQGA 4PR9A 4CS7A 1D0ZA 1R5ID 2W9YA 2GA0A 2KNHA 1M57C 4IARA 2HSQA 4PACA 4CSAC 5DLJA 3T6GB 1TFKB 3B0UX 3AG2C 4N6CA 2J9BA 2R05A 3SXYA 1APCA 4X0RA 5A6AA 4MVMA 4YWQA 1VOMA 2YL1A 3KL4A 3HKKA 2VCCA 3N0TA
chains in the Genus database with same CATH topology
4U5EE 3UNGC 1FTSA 1QZXA 4KBLA 2R7UA 2KGOA 1ZHTA 3X1OA 1RJ9B 3EGXA 4KNWA 2J7PD 4IAOA 4PJMA 4F4BA 5KYYA 4JCHA 4U5DE 5EGYA 3SZRA 5KYUA 2G3VA 3DMDA 5KYXA 2DYSC 2ZXOA 3O6XA 4BG0A 3GODA 3NYMA 3ECSA 2XL4A 2W4MA 3KH2A 2FGYA 1ZHXA 1TWHA 2R7XA 2H7VC 3AQBA 5KYYB 2R7TA 3PHF2 2EIJC 1ZU5A 1TR2A 2IXPA 3E70C 4OIOF 4H4KC 4U5CE 4KI2A 4LERA 4CS8A 2W4BA 4GYTA 4EBBA 3S0XA 4YN0B 1OCZC 2J0XA 2H7OA 2J46A 1MMAA 3ZIBA 2JD3A 2R7QA 2R7RA 3W2WA 4FX5A 3EZIA 2VASA 2WL8A 2WVOA 4IWBA 1FFHA 4EWCA 4JVSA 3GANA 3WODF 1NG1A 4RDAA 4G7HF 2QY9A 4MQ9F 1SZIA 2Y3BA 3LS1A 4AE4B 2YHSA 4QDLA 3S28A 1PCXA 2WVQA 2VB6A 5E2QA 4HFKB 2V3CC 2YZSA 4YJWA 5B1BC 5DS4A 2R7VA 1NU7D 1Z23A 2Y39A 3EGDA 1Z5ZA 3MLGA 2Q9CA 5KYWB 2L81A 4WJ0A 1ZHZA 3EHNA 3UMKA 2R7SA 3W8HA 2EINC 3EQLF 1W2WA 3MX3A 3WG7C 3JCUQ 2LSEA 5DVWA 2MWQA 2PFDA 3I4UA 3NYJA 4C7OA 4OD4A 1SF8A 3AQCA 4B6IA 3DXJF 2Y3GA 3TD7A 3KKBA 4JJFA 2CW0F 3K33A 3ABMC 2A6EF 1VMAA 2YEVA 3LS0A 2NUTB 1M2OA 1MNDA 3NDBB 3T4RA 2D5RB 2BE5F 2IXMA 1RJ9A 4O79A 5CI9A 3L0IA 4C3DA 3F46A 3O39A 4C7OB 2PX0A 3JYHA 4ANJA 4KNVA 2IXNA 3ZG1A 4CS8C 5EHHA 4QI0A 3DAFA 3N24A 4PFOA 2KW3C 1N1CA 2WVNA 3SYNA 3B0VC 2I8BA 3K1IC 4OIRF 3UMIA 4IJJA 3LEVA 4G7OF 3AG4C 4O7GA 2R7WA 3VYWA 1OCCC 1Z3IX 2EIMC 3OA1A 3QMKA 2NG1A 2ZXPA 1MMDA 3AG1C 4HFFB 2ZPAA 4O6MA 2OG2A 2CNWD 1BR4A 4GEHA 3PMRA 3DJUB 3HTKC 3S29A 4BJ6C 2O9XA 1LS1A 1IW7F 2GFHA 4HEAJ 3EH1A 4I1MA 4ZLCA 4OD5A 2C03A 2J0WA 2IXOA 2CDQA 2J45A 1NU9C 1D1CA 5DQZA 2Q3TA 1VK5A 1VYIA 5T3TA 3ZC4A 2IOQA 4XLPF 4PJNA 1V54C 1MNEA 4AE4A 1ZU4A 4E7ZA 1LVKA 2G3KA 2PF4E 4HE8D 4XLNF 2XSEA 5D91A 3OEOA 1OCRC 4RBNA 3NG1A 3W2VA 4J32B 4YT4A 5DS6A 3KMIA 1D0YA 3SP1A 2HV7A 2ZXRA 4NY3A 3X2QC 3CZ6A 3Q7LA 2R7OA 5KYWA 1OKKA 4LLEA 1LKXA 3IEEA 4U5HA 4BJ6A 4G7ZF 3ITFA 3K6BA 2QTVA 1OCOC 4OIQF 5B1AC 4DVZA 3LLKA 1J8MF 2A1DD 3LESA 3HLZA 2NUPB 5F5HA 2Z15A 1TWAA 3DD7A 4DBRA 3EJNA 2Q9AA 4I1OB 5E3CA 4YT5A 1O5HA 1SMYF 2EIKC 2Y69C 2NUTA 3OWTA 5F5FA 2WZFA 4YT2A 1WGWA 5IY5C 4OIPF 2B0JA 4O6YA 2H7BA 3EFOB 1PD0A 3L34A 3JSZA 3NKDA 2V26A 4MNDA 2X51A 3HJCA 5L3QA 3T6JA 3FAJA 2P7VA 3W8IA 2WZLA 3SEOA 1FMVA 2KJGA 2EILC 4JJGA 3VAYA 4CIHA 4PK4A 4C3EA 3K7DA 2FFHA 2E87A 3EPVA 3N2ZB 1BR1A 3ABKC 3LLIA 1M2VB 3EZHA 1ZYRF 2L9JA 4O6NA 2M4EA 4PJLA 2DGJA 4ULWA 4I44A 1M56C 2XXAA 1MMNA 3DZAA 4JURI 4PFPA 2DYRC 4AK9A 1J8YF 3ZVRA 3LJBA 1D1BA 3NYLA 4BJ5C 1MMGA 1FFTC 1OKKD 1O87A 2IYLD 2XXAB 4A2NB 3ABLC 1FMWA 4LLCA 1KU2A 1ST6A 4XWJA 1JPNA 4QI2A 1D0XA 3JT1A 2VH3A 4U5GA 5CI8A 1V55C 5DS5A 1D1AA 3UGPA 4BJ1A 2Y3HA 1BR2A 3JRTA 4K7BA 4FESA 3NRHA 5DQTA 4DVYP 4W8KA 4JZAA 3EGXB 5T1DB 3LAYA 4C3BA 3V7OA 4CSAA 3UGOA 2Y3DA 4AX2A 4BJ5A 2PP4A 4BEJA 5KYUB 4CBEA 5KYXB 4G0HA 4E7SA 4CS9C 4Q7CA 2OCCC 4U5BE 2A68F 3K1HA 3DJNB 3DM9B 1VYKA 3T6BA 2NUPA 2WB7A 2J9UA 5D92A 2KQ9A 2WZGA 1G8XA 2J7PA 5KYNA 3S27A 2A6HF 5T3WA 3AG3C 3EFOA 3RH3A 3POVA 1TKNA 5E3AA 3H65A 4Q4ZF 1TWGA 3SNHA 3ASNC 1NZEA 3NKEA 3FHDA 4XTKA 4Q5SF 3Q6NA 3RYLA 3M1CB 1QLEC 2CNWA 2MYSA 3F47A 1IZMA 1S7ZA 4IRUA 4KC9A 1Z6AA 2CGEA 2PX3A 2Q9BA 3B9QA 3I5QA 4I3MA 2XRHA 4CS9A 4U5FE 2W45A 2G62A 2J9VA 3I5PA 1M2VA 3ZSUA 2J9WA 4BJTA 3CSKA 1PD1A 3RIPA 5BUOA 3RFYA 2P6VA 4PJJA 3K66A 3FDQA 3DM5A 4M63A 3QZCA 2ZXWC 4FWVA 3EHMA 4RD9A 3UMHA 5HSWA 2C04A 3EH2A 3CQZA 1JPJA 3EG9A 4P6IC 5L3VA 3LNRA 5E33A 1ZHYA 3RKOF 5FCLA 3ASOC 1Z63A 3FVYA 3EGDB 4K0DA 1TWCA 4ZLDA 1ZHWA 4LACB 3B0PA 4J30B 3DAGA 2HV6A 4YT8A 3Q7GA 3UR3C 4JW1A 3E9VA 4DBQA 5B3SC 2A69F 4N06A 4OINF 3Q6MA 3EG9B 4DOZA 4CS7A 1D0ZA 2W9YA 2KNHA 1M57C 4CSAC 5DLJA 3B0UX 3AG2C 4X0RA 4YWQA 1VOMA 3KL4A 3N0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AQC A;  3AQB A; 
#chains in the Genus database with same CATH topology
 2XLD A;  4NCQ A;  4U5E E;  3BRJ A;  1FTS A;  2XLM A;  3UNG C;  4AL1 A;  2R25 A;  1QZX A;  4KBL A;  2R7U A;  2KGO A;  4BEM J;  1ZHT A;  3G4Z A;  1Q0K A;  3X1O A;  1RJ9 B;  3ZTM A;  3EGX A;  4KNW A;  2J7P D;  3FOO A;  5FZT A;  4IAO A;  2HMZ A;  2QNL A;  4JEB A;  4PJM A;  4F4B A;  5KYY A;  3IQ5 A;  4JCH A;  4U5D E;  2ICW G;  5EGY A;  3HNI A;  5GPG B;  3SZR A;  5KYU A;  3RQG A;  2G3V A;  3DMD A;  3M4B A;  5BQI A;  2DYS C;  2XM4 A;  5KYX A;  2ZXO A;  3LEO A;  3O6X A;  1E84 A;  3U9J A;  4BG0 A;  1I5N A;  4XPW A;  3GOD A;  4MTG A;  3NYM A;  1LE4 A;  1SR2 A;  1CGN A;  2R02 A;  1MQV A;  2XL4 A;  3ECS A;  1RKC A;  1G5Z A;  3GOR A;  4JC7 A;  2W4M A;  3KH2 A;  2FGY A;  1ZHX A;  1TWH A;  3DI5 A;  2R7X A;  1YYJ A;  3NMJ A;  2H7V C;  3AQB A;  5KYY B;  1A7E A;  1RCP A;  3U3F A;  5JSL A;  2R7T A;  5A6B A;  2UUI A;  3RQF A;  3PHF 2;  2EIJ C;  1YAU O;  1ORS C;  1ZU5 A;  5BQH A;  1K40 A;  1TR2 A;  2IXP A;  2IM8 A;  3E70 C;  1OQC A;  1CPR A;  4MW3 A;  4Z9I A;  4H4K C;  4OIO F;  4U5C E;  4KI2 A;  4LER A;  4XQ1 A;  2W4B A;  4CS8 A;  4GYT A;  3U2M A;  4EBB A;  3JTL O;  2QUP A;  3A11 A;  3AGU A;  4AL0 A;  4YN0 B;  3S0X A;  1OCZ C;  2BC5 A;  2KSF A;  1JRA A;  3H2U A;  2Q4F A;  3U5S A;  2J0X A;  1Z7Q c;  2H7O A;  1NFO A;  3GM2 A;  4DJ9 A;  1SYQ A;  1MMA A;  2J46 A;  4YK5 A;  3S9O A;  2JD3 A;  2R7Q A;  3SXZ A;  4ULV A;  3ZIB A;  2R7R A;  1YVI A;  2AP3 A;  1NLX A;  3GM3 A;  4FX5 A;  3W2W A;  4IGG A;  3EZI A;  2VAS A;  2WL8 A;  2WVO A;  4IWB A;  3VF0 A;  1FFH A;  4EWC A;  4JVS A;  2CCY A;  1WAS A;  2UUH A;  3GAN A;  3WOD F;  1NG1 A;  1XZP A;  2PNO A;  4RDA A;  4G7H F;  2QY9 A;  5JLI A;  4MVQ A;  2JPU A;  4MQ9 F;  2P61 A;  1SZI A;  2XLE A;  3C18 A;  1VB5 A;  2Y3B A;  3LS1 A;  4P9F A;  1ORY A;  1HMD A;  2X0C A;  2HS5 A;  3SXK A;  4AE4 B;  2XL8 A;  2YHS A;  5AC5 A;  4QDL A;  3S28 A;  2RSE B;  3GM1 A;  1PCX A;  5JS5 A;  2WVQ A;  3G50 A;  2VB6 A;  5E2Q A;  3GEE A;  3DE8 A;  4HFK B;  1YLM A;  2HMQ A;  1H7I A;  2KYH A;  1LPE A;  3C7J A;  2V3C C;  2YZS A;  4YJW A;  5B1B C;  1PV3 A;  5DS4 A;  4E0I A;  2QE9 A;  4ONS A;  2IBF A;  2ZD9 A;  2R7V A;  5F28 E;  1JAF A;  3MYF A;  1NU7 D;  1Z23 A;  2L7A A;  2Y39 A;  1Z5Z A;  3EGD A;  4MVS A;  2TMV P;  3MLG A;  2Q9C A;  5KYW B;  2B0H A;  2XLO A;  2OU6 A;  2OQM A;  1VTM P;  2L81 A;  4WJ0 A;  1ZHZ A;  4MTO A;  3ATP A;  3EHN A;  1ZW2 A;  3UMK A;  2R7S A;  1HY5 A;  3U9M A;  3W8H A;  3JSE O;  2AU5 A;  3LUT B;  4JIO A;  1QVX A;  4JTA B;  2EIN C;  2LD6 A;  3EQL F;  1Y6D A;  1W2W A;  3MX3 A;  3WG7 C;  5CIV A;  4N4W A;  3JCU Q;  2LSE A;  5DVW A;  2MWQ A;  3QW1 A;  2AWC A;  1HW2 A;  2PFD A;  3I4U A;  4XEF A;  2YRF A;  3NYJ A;  1YJG A;  4C7O A;  4OD4 A;  1LE2 A;  1SF8 A;  1U6H A;  1YA7 O;  3AQC A;  3DXJ F;  2Y3G A;  4MS2 A;  2EPO A;  3KKB A;  4NC3 A;  3TD7 A;  4JJF A;  3C63 A;  2CW0 F;  3K33 A;  2OJE D;  3ABM C;  1BDJ B;  2A6E F;  1VMA A;  2YEV A;  3AJM A;  3LS0 A;  2NUT B;  1M2O A;  1MND A;  4BPM A;  3US6 A;  3NDB B;  3T4R A;  2D5R B;  2BE5 F;  2IXM A;  1LIH A;  1RJ9 A;  2YL3 A;  3V5Y A;  1U0B B;  4O79 A;  1F1M A;  1NSG B;  5CI9 A;  3L0I A;  4C3D A;  3F46 A;  3O39 A;  4C7O B;  2PX0 A;  3JYH A;  3ZQY A;  4ANJ A;  4KNV A;  3MBG A;  5A6J A;  1G4U S;  3GEI A;  3U8V A;  1ZW3 A;  2IXN A;  3ZG1 A;  4CS8 C;  5EHH A;  4E0H A;  3MYI A;  3M79 A;  4E17 A;  5AC4 A;  4QI0 A;  3DAF A;  4XEK A;  3BEH A;  3N24 A;  4NTB A;  4PFO A;  2KW3 C;  4MTF A;  4N6H A;  2VCB A;  4P9T A;  4U9D A;  1N1C A;  2WVN A;  3TJ5 A;  3SYN A;  3H2V A;  3ZQV A;  3B0V C;  1QPU A;  2M64 A;  4B6I A;  2I8B A;  5L0G A;  1TFO B;  2BL2 A;  3K1I C;  4Z9J A;  2FAP B;  4OIR F;  4IJJ A;  1I4Y A;  3LEV A;  3UMI A;  4G7O F;  3AG4 C;  4O7G A;  3ZWI A;  2R7W A;  3VYW A;  4IB4 A;  1YDI A;  1OCC C;  3JRM O;  1Z3I X;  2EIM C;  1G4W R;  5JUA A;  3OA1 A;  3QMK A;  2NG1 A;  2ZXP A;  2NSG A;  1MMD A;  2VCA A;  3AG1 C;  4HFF B;  2ZPA A;  1A41 A;  1Q0M A;  3DWW A;  1OR2 A;  3IQT A;  3IQ6 A;  4NTA A;  4O6M A;  2OG2 A;  2EPL X;  3GWN A;  2XLH A;  3L8J A;  2CNW D;  1HMO A;  4YT4 A;  1BR4 A;  4MVO A;  4GEH A;  3PMR A;  3DJU B;  2LFF A;  3HTK C;  3S29 A;  3U8P A;  4BJ6 C;  2O9X A;  1LS1 A;  1IW7 F;  2GFH A;  4HEA J;  5L0J A;  1T9K A;  3EH1 A;  1HE9 A;  1E83 A;  1Q0D A;  4I1M A;  4JRZ A;  1EQ1 A;  1H6G A;  4ZLC A;  4WGY A;  4OD5 A;  5L0C A;  2OEX A;  2YLG A;  1WN0 A;  2C03 A;  2J0W A;  1FAP B;  2IXO A;  2CDQ A;  4NQF A;  2I15 A;  4U9E A;  2J45 A;  4WGZ A;  1NU9 C;  1NBB A;  4LDR A;  1D1C A;  1WOL A;  2L6G A;  4MVU A;  5DQZ A;  1EI7 A;  2Q3T A;  1VK5 A;  1VYI A;  3C8G A;  5T3T A;  2IOQ A;  3ZC4 A;  4XLP F;  2HKV A;  4PJN A;  4DXW A;  1MNE A;  1V54 C;  4AE4 A;  1ZU4 A;  4E7Z A;  3FOP A;  3W4Y A;  1C03 A;  1GQA A;  1LVK A;  2G3K A;  1I4Z A;  1JOG A;  2HJM A;  3K1I A;  2PF4 E;  3NMK A;  4HE8 D;  5COM A;  2XSE A;  4XLN F;  5D91 A;  3TK0 A;  3TUL A;  3OEO A;  1VLS A;  1OCR C;  1QSP A;  2H8A A;  4RBN A;  3FMS A;  5HV9 A;  2AVK A;  3NG1 A;  4EUK B;  2LK4 A;  3W2V A;  3AGT A;  4J32 B;  1LM3 B;  1V4A A;  1D0Y A;  3G4X A;  3KMI A;  3FAP B;  3SP1 A;  4CX9 A;  5DS6 A;  2HV7 A;  1RMV A;  3ZTZ A;  2ZXR A;  4EKW A;  4NY3 A;  1OXK A;  1XWJ A;  3X2Q C;  3C8G B;  4W8P A;  3CZ6 A;  3Q7L A;  2R7O A;  4A4A A;  5KYW A;  1OKK A;  2JX0 A;  4MVR A;  4LLE A;  2XM0 A;  1HW1 A;  2RD9 A;  1LKX A;  4ER9 A;  256B A;  3IEE A;  1AEP A;  1L7C A;  4U5H A;  4L6R A;  4BJ6 A;  4JEA A;  4G7Z F;  2XS1 A;  3S90 A;  3ITF A;  1CGO A;  2Q00 A;  4JCZ A;  3RW0 A;  3MFN A;  5A6K A;  3K6B A;  4CDV A;  1BBH A;  2QTV A;  1OCO C;  4OIQ F;  5COG A;  3RQE A;  5B1A C;  3DE9 A;  4DVZ A;  5B3I A;  4D4X A;  1A0B A;  3FXH A;  3IHU A;  3LLK A;  1J8M F;  1A7V A;  4E18 A;  1QQ3 A;  2A1D D;  3CAX A;  1BZ4 A;  2NUP B;  3HLZ A;  3LES A;  1Q0F A;  5F5H A;  2Z15 A;  1TWA A;  1JR8 A;  3DD7 A;  4DBR A;  3EJN A;  2XL6 A;  2YL0 A;  4H54 A;  2Q9A A;  2MHR A;  4I1O B;  3QVY A;  5E3C A;  4YT5 A;  1O5H A;  1SMY F;  2EIK C;  2HJ3 A;  2Y69 C;  2NUT A;  1S05 A;  3OWT A;  3TOM A;  5F5F A;  2WZF A;  1FR0 A;  1K04 A;  3DKA A;  4YT2 A;  1WGW A;  5IY5 C;  5EK0 A;  4K1O A;  4OIP F;  2HSB A;  2B0J A;  3L8I A;  4O6Y A;  2EPN A;  2H7B A;  2YLD A;  3EFO B;  1PD0 A;  3L34 A;  4FAP B;  5L0H A;  1OW7 A;  3JSZ A;  1GS9 A;  3NKD A;  2V26 A;  4Z9H A;  4MND A;  2X51 A;  3HJC A;  5L3Q A;  3T6J A;  1KTM A;  2AWY A;  3FAJ A;  2P7V A;  3W8I A;  2WZL A;  3SEO A;  1FMV A;  4JKV A;  4DRI B;  2KJG A;  2EIL C;  2PBE A;  4JJG A;  3HNK A;  3VAY A;  4CIH A;  4D4N A;  2L6H A;  3C8Z A;  4PK4 A;  5K0I A;  1AUE A;  4C3E A;  5A6B D;  1H9T A;  3RF3 A;  5JRA A;  1E85 A;  3K7D A;  3M15 A;  3B71 A;  3JZ0 A;  1T6I A;  2FFH A;  2E87 A;  3EPV A;  3N2Z B;  2ETS A;  1BR1 A;  3ABK C;  3LLI A;  1M2V B;  3EZH A;  3GWL A;  1ZYR F;  4R32 A;  3TQO A;  3S84 A;  1H9G A;  2L9J A;  3L1M A;  2XLV A;  4O6N A;  2M4E A;  4PJL A;  2DGJ A;  2EPK X;  2P0N A;  3V5Z A;  4ULW A;  4I44 A;  1M56 C;  5L0I A;  3V5X A;  2XXA A;  5JP7 A;  1MMN A;  3U3B A;  3PDM P;  3DZA A;  1T01 A;  3R2P A;  4DRJ B;  4JUR I;  4PFP A;  3JYY A;  1LI7 A;  1UFB A;  2DYR C;  4AK9 A;  1YA9 A;  2CYD A;  2LP4 A;  1OW6 A;  2YVK A;  1J8Y F;  3ZVR A;  3LJB A;  1D1B A;  3NYL A;  3VRC A;  4BJ5 C;  3KPH A;  1E2X A;  1O3U A;  1MMG A;  3RVY A;  1RKE B;  1JMW A;  4CDY A;  3B29 A;  1FFT C;  1OKK D;  1O87 A;  2IYL D;  2XXA B;  2LIG A;  4XPY A;  4A2N B;  1M6T A;  3ABL C;  1FMW A;  4LLC A;  1KU2 A;  1ST6 A;  3WHN A;  1FNT c;  2R9R B;  4XPX A;  4YL1 A;  2LFD A;  4XWJ A;  1JPN A;  1NFN A;  3KYJ A;  1T5O A;  4QI2 A;  3VM6 A;  1DOW A;  4CJG A;  1R4T A;  1D0X A;  3JT1 A;  2VH3 A;  4U5G A;  5CI8 A;  1V55 C;  3PCV A;  3C62 A;  5DS5 A;  1D1A A;  3UGP A;  1RXQ A;  3HNJ A;  4BJ1 A;  2L6F A;  2Y3H A;  2YQY A;  1BR2 A;  1GM5 A;  3JRT A;  2XLW A;  4K7B A;  3O55 A;  2OKU A;  4FES A;  1Q0G A;  1A7D A;  1YAR O;  1YZA A;  3NRH A;  5DQT A;  1T6U A;  4W8K A;  4DVY P;  4JZA A;  1OW8 A;  4YL0 A;  5A69 A;  3WAQ A;  3EGX B;  5T1D B;  3GEH A;  2YKZ A;  3LAY A;  2HFI A;  4EBK A;  4EIY A;  2OEV A;  3HNL A;  3A9C A;  4NTF A;  4C3B A;  3V7O A;  4UDV A;  4CSA A;  3UGO A;  2Y3D A;  4CDA A;  4AX2 A;  2KC3 A;  4BJ5 A;  2PP4 A;  2NSF A;  4BEJ A;  4CBE A;  3KYI A;  4CJO A;  1OXB A;  5KYU B;  5KYX B;  3QVZ A;  1OR3 A;  4G0H A;  3TOL A;  4E7S A;  2YWA A;  2GAQ A;  4LDK A;  2Q7R A;  4CS9 C;  3O10 A;  2OJQ A;  1UG7 A;  2OCC C;  4Q7C A;  4U5B E;  2A68 F;  4MVZ A;  3K1H A;  3M4C A;  2GWW A;  3DJN B;  3QW0 A;  2EPM X;  3DM9 B;  1C17 M;  1VYK A;  3R7C A;  3T6B A;  2LCH A;  3TJ6 A;  1TQG A;  1K05 A;  2NUP A;  2WB7 A;  2LQG A;  2J9U A;  2GDC A;  2YLI A;  5D92 A;  2KQ9 A;  2WZG A;  5COF A;  4JTD B;  1G8X A;  2J7P A;  2D4U A;  3U0C A;  5KYN A;  1YZC A;  3S27 A;  2R03 A;  1XZQ A;  5JT4 A;  1T6Q A;  1AVO B;  2HUJ A;  2HZ8 A;  2A6H F;  3IPM O;  3LNM B;  2P1A A;  5T3W A;  3AG3 C;  3EFO A;  3RH3 A;  3POV A;  1TKN A;  5E3A A;  3H65 A;  3T9O A;  3NMI A;  4MW8 A;  3RVZ A;  1V74 B;  2XS8 A;  1TWG A;  3SNH A;  4Q4Z F;  4JTC B;  3ASN C;  1NZE A;  3NKE A;  3FHD A;  4XTK A;  4Q5S F;  3Q6N A;  2OOC A;  3RYL A;  1QKR A;  1DOV A;  1U89 A;  3M1C B;  4JE9 A;  4YL3 A;  1QLE C;  1L3P A;  2CNW A;  2MYS A;  3F47 A;  1KNY A;  1ORJ A;  1IZM A;  1S7Z A;  4IRU A;  2J8W A;  4DRH B;  4KC9 A;  1CGM E;  1WTY A;  1LS4 A;  1Z6A A;  2CGE A;  1CPQ A;  1Y4C A;  2PX3 A;  2NPU A;  2Q9B A;  2VC9 A;  3B9Q A;  3I5Q A;  4GQH A;  3AOU A;  2XRH A;  4I3M A;  4CS9 A;  4U5F E;  5L0F A;  2W45 A;  2G62 A;  2J9V A;  3I5P A;  1M2V A;  3ZSU A;  2J9W A;  4BJT A;  1GGQ A;  1LI5 A;  2DB4 A;  4G78 A;  4LDQ A;  3CSK A;  1E86 A;  1PD1 A;  1WAT A;  3RIP A;  3ZDL A;  5BUO A;  3RFY A;  4IAQ A;  2P6V A;  4PJJ A;  3SXM A;  2KK1 A;  3K66 A;  3FDQ A;  3DM5 A;  4WAB A;  4M63 A;  3QZC A;  1VLT A;  2F22 A;  2ZXW C;  3EHM A;  4FWV A;  4RD9 A;  3UMH A;  2C04 A;  3EH2 A;  4EHP A;  5L0D A;  3U2L A;  5HSW A;  5AGF A;  3CQZ A;  2A0B A;  1JPJ A;  1ZVZ A;  2YL7 A;  3EG9 A;  4P6I C;  3LNR A;  5L3V A;  5E33 A;  1ZHY A;  1EKY A;  2QLA A;  3RKO F;  1ZZP A;  5FCL A;  2ASR A;  3ASO C;  1Z63 A;  1YYX A;  3J06 A;  3FVY A;  3EGD B;  4K0D A;  2A0U A;  3QTH A;  1TWC A;  1HE1 A;  4J7Y A;  3IQC A;  2DI3 A;  1ZHW A;  4LAC B;  3B0P A;  4ZLD A;  4J30 B;  3DAG A;  2HV6 A;  1WWP A;  3CEX A;  4YT8 A;  3Q7G A;  3UR3 C;  1RKE A;  5JVE A;  4JW1 A;  3C8G D;  3E9V A;  5TJ5 E;  4J7T A;  4DBQ A;  2A69 F;  4XEV A;  5B3S C;  4N06 A;  4OIN F;  3Q6M A;  1B68 A;  1C02 A;  3EG9 B;  4DOZ A;  4EBJ A;  1EA8 A;  4CIP A;  5BQG A;  4PR9 A;  4CS7 A;  1D0Z A;  1R5I D;  2W9Y A;  2GA0 A;  2KNH A;  1M57 C;  4IAR A;  2HSQ A;  4PAC A;  4CSA C;  5DLJ A;  3T6G B;  1TFK B;  3B0U X;  3AG2 C;  4N6C A;  2J9B A;  2R05 A;  3SXY A;  1APC A;  4X0R A;  5A6A A;  4MVM A;  4YWQ A;  1VOM A;  2YL1 A;  3KL4 A;  3HKK A;  2VCC A;  3N0T A; 
#chains in the Genus database with same CATH homology
 4U5E E;  3UNG C;  1FTS A;  1QZX A;  4KBL A;  2R7U A;  2KGO A;  1ZHT A;  3X1O A;  1RJ9 B;  3EGX A;  4KNW A;  2J7P D;  4IAO A;  4PJM A;  4F4B A;  5KYY A;  4JCH A;  4U5D E;  5EGY A;  3SZR A;  5KYU A;  2G3V A;  3DMD A;  5KYX A;  2DYS C;  2ZXO A;  3O6X A;  4BG0 A;  3GOD A;  3NYM A;  3ECS A;  2XL4 A;  2W4M A;  3KH2 A;  2FGY A;  1ZHX A;  1TWH A;  2R7X A;  2H7V C;  3AQB A;  5KYY B;  2R7T A;  3PHF 2;  2EIJ C;  1ZU5 A;  1TR2 A;  2IXP A;  3E70 C;  4OIO F;  4H4K C;  4U5C E;  4KI2 A;  4LER A;  4CS8 A;  2W4B A;  4GYT A;  4EBB A;  3S0X A;  4YN0 B;  1OCZ C;  2J0X A;  2H7O A;  2J46 A;  1MMA A;  3ZIB A;  2JD3 A;  2R7Q A;  2R7R A;  3W2W A;  4FX5 A;  3EZI A;  2VAS A;  2WL8 A;  2WVO A;  4IWB A;  1FFH A;  4EWC A;  4JVS A;  3GAN A;  3WOD F;  1NG1 A;  4RDA A;  4G7H F;  2QY9 A;  4MQ9 F;  1SZI A;  2Y3B A;  3LS1 A;  4AE4 B;  2YHS A;  4QDL A;  3S28 A;  1PCX A;  2WVQ A;  2VB6 A;  5E2Q A;  4HFK B;  2V3C C;  2YZS A;  4YJW A;  5B1B C;  5DS4 A;  2R7V A;  1NU7 D;  1Z23 A;  2Y39 A;  3EGD A;  1Z5Z A;  3MLG A;  2Q9C A;  5KYW B;  2L81 A;  4WJ0 A;  1ZHZ A;  3EHN A;  3UMK A;  2R7S A;  3W8H A;  2EIN C;  3EQL F;  1W2W A;  3MX3 A;  3WG7 C;  3JCU Q;  2LSE A;  5DVW A;  2MWQ A;  2PFD A;  3I4U A;  3NYJ A;  4C7O A;  4OD4 A;  1SF8 A;  3AQC A;  4B6I A;  3DXJ F;  2Y3G A;  3TD7 A;  3KKB A;  4JJF A;  2CW0 F;  3K33 A;  3ABM C;  2A6E F;  1VMA A;  2YEV A;  3LS0 A;  2NUT B;  1M2O A;  1MND A;  3NDB B;  3T4R A;  2D5R B;  2BE5 F;  2IXM A;  1RJ9 A;  4O79 A;  5CI9 A;  3L0I A;  4C3D A;  3F46 A;  3O39 A;  4C7O B;  2PX0 A;  3JYH A;  4ANJ A;  4KNV A;  2IXN A;  3ZG1 A;  4CS8 C;  5EHH A;  4QI0 A;  3DAF A;  3N24 A;  4PFO A;  2KW3 C;  1N1C A;  2WVN A;  3SYN A;  3B0V C;  2I8B A;  3K1I C;  4OIR F;  3UMI A;  4IJJ A;  3LEV A;  4G7O F;  3AG4 C;  4O7G A;  2R7W A;  3VYW A;  1OCC C;  1Z3I X;  2EIM C;  3OA1 A;  3QMK A;  2NG1 A;  2ZXP A;  1MMD A;  3AG1 C;  4HFF B;  2ZPA A;  4O6M A;  2OG2 A;  2CNW D;  1BR4 A;  4GEH A;  3PMR A;  3DJU B;  3HTK C;  3S29 A;  4BJ6 C;  2O9X A;  1LS1 A;  1IW7 F;  2GFH A;  4HEA J;  3EH1 A;  4I1M A;  4ZLC A;  4OD5 A;  2C03 A;  2J0W A;  2IXO A;  2CDQ A;  2J45 A;  1NU9 C;  1D1C A;  5DQZ A;  2Q3T A;  1VK5 A;  1VYI A;  5T3T A;  3ZC4 A;  2IOQ A;  4XLP F;  4PJN A;  1V54 C;  1MNE A;  4AE4 A;  1ZU4 A;  4E7Z A;  1LVK A;  2G3K A;  2PF4 E;  4HE8 D;  4XLN F;  2XSE A;  5D91 A;  3OEO A;  1OCR C;  4RBN A;  3NG1 A;  3W2V A;  4J32 B;  4YT4 A;  5DS6 A;  3KMI A;  1D0Y A;  3SP1 A;  2HV7 A;  2ZXR A;  4NY3 A;  3X2Q C;  3CZ6 A;  3Q7L A;  2R7O A;  5KYW A;  1OKK A;  4LLE A;  1LKX A;  3IEE A;  4U5H A;  4BJ6 A;  4G7Z F;  3ITF A;  3K6B A;  2QTV A;  1OCO C;  4OIQ F;  5B1A C;  4DVZ A;  3LLK A;  1J8M F;  2A1D D;  3LES A;  3HLZ A;  2NUP B;  5F5H A;  2Z15 A;  1TWA A;  3DD7 A;  4DBR A;  3EJN A;  2Q9A A;  4I1O B;  5E3C A;  4YT5 A;  1O5H A;  1SMY F;  2EIK C;  2Y69 C;  2NUT A;  3OWT A;  5F5F A;  2WZF A;  4YT2 A;  1WGW A;  5IY5 C;  4OIP F;  2B0J A;  4O6Y A;  2H7B A;  3EFO B;  1PD0 A;  3L34 A;  3JSZ A;  3NKD A;  2V26 A;  4MND A;  2X51 A;  3HJC A;  5L3Q A;  3T6J A;  3FAJ A;  2P7V A;  3W8I A;  2WZL A;  3SEO A;  1FMV A;  2KJG A;  2EIL C;  4JJG A;  3VAY A;  4CIH A;  4PK4 A;  4C3E A;  3K7D A;  2FFH A;  2E87 A;  3EPV A;  3N2Z B;  1BR1 A;  3ABK C;  3LLI A;  1M2V B;  3EZH A;  1ZYR F;  2L9J A;  4O6N A;  2M4E A;  4PJL A;  2DGJ A;  4ULW A;  4I44 A;  1M56 C;  2XXA A;  1MMN A;  3DZA A;  4JUR I;  4PFP A;  2DYR C;  4AK9 A;  1J8Y F;  3ZVR A;  3LJB A;  1D1B A;  3NYL A;  4BJ5 C;  1MMG A;  1FFT C;  1OKK D;  1O87 A;  2IYL D;  2XXA B;  4A2N B;  3ABL C;  1FMW A;  4LLC A;  1KU2 A;  1ST6 A;  4XWJ A;  1JPN A;  4QI2 A;  1D0X A;  3JT1 A;  2VH3 A;  4U5G A;  5CI8 A;  1V55 C;  5DS5 A;  1D1A A;  3UGP A;  4BJ1 A;  2Y3H A;  1BR2 A;  3JRT A;  4K7B A;  4FES A;  3NRH A;  5DQT A;  4DVY P;  4W8K A;  4JZA A;  3EGX B;  5T1D B;  3LAY A;  4C3B A;  3V7O A;  4CSA A;  3UGO A;  2Y3D A;  4AX2 A;  4BJ5 A;  2PP4 A;  4BEJ A;  5KYU B;  4CBE A;  5KYX B;  4G0H A;  4E7S A;  4CS9 C;  4Q7C A;  2OCC C;  4U5B E;  2A68 F;  3K1H A;  3DJN B;  3DM9 B;  1VYK A;  3T6B A;  2NUP A;  2WB7 A;  2J9U A;  5D92 A;  2KQ9 A;  2WZG A;  1G8X A;  2J7P A;  5KYN A;  3S27 A;  2A6H F;  5T3W A;  3AG3 C;  3EFO A;  3RH3 A;  3POV A;  1TKN A;  5E3A A;  3H65 A;  4Q4Z F;  1TWG A;  3SNH A;  3ASN C;  1NZE A;  3NKE A;  3FHD A;  4XTK A;  4Q5S F;  3Q6N A;  3RYL A;  3M1C B;  1QLE C;  2CNW A;  2MYS A;  3F47 A;  1IZM A;  1S7Z A;  4IRU A;  4KC9 A;  1Z6A A;  2CGE A;  2PX3 A;  2Q9B A;  3B9Q A;  3I5Q A;  4I3M A;  2XRH A;  4CS9 A;  4U5F E;  2W45 A;  2G62 A;  2J9V A;  3I5P A;  1M2V A;  3ZSU A;  2J9W A;  4BJT A;  3CSK A;  1PD1 A;  3RIP A;  5BUO A;  3RFY A;  2P6V A;  4PJJ A;  3K66 A;  3FDQ A;  3DM5 A;  4M63 A;  3QZC A;  2ZXW C;  4FWV A;  3EHM A;  4RD9 A;  3UMH A;  5HSW A;  2C04 A;  3EH2 A;  3CQZ A;  1JPJ A;  3EG9 A;  4P6I C;  5L3V A;  3LNR A;  5E33 A;  1ZHY A;  3RKO F;  5FCL A;  3ASO C;  1Z63 A;  3FVY A;  3EGD B;  4K0D A;  1TWC A;  4ZLD A;  1ZHW A;  4LAC B;  3B0P A;  4J30 B;  3DAG A;  2HV6 A;  4YT8 A;  3Q7G A;  3UR3 C;  4JW1 A;  3E9V A;  4DBQ A;  5B3S C;  2A69 F;  4N06 A;  4OIN F;  3Q6M A;  3EG9 B;  4DOZ A;  4CS7 A;  1D0Z A;  2W9Y A;  2KNH A;  1M57 C;  4CSA C;  5DLJ A;  3B0U X;  3AG2 C;  4X0R A;  4YWQ A;  1VOM A;  3KL4 A;  3N0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...