3AQDA

Unliganded trap
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
69
structure length
66
Chain Sequence
SDFVVIKALEDGVNVIGLTRTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription attenuation protein mtrB
publication title Allostery in TRAP
rcsb
source organism Bacillus stearothermophilus
molecule tags Rna binding protein
total genus 10
structure length 66
sequence length 69
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V
ec nomenclature
pdb deposition date 2010-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02081 TrpBP Tryptophan RNA-binding attenuator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.50 Mainly Beta Sandwich Immunoglobulin-like TRAP-like 3aqdA00
5EEYA 1GTNA 2ZCZA 4B27A 1GTFA 5EF1A 5EF2A 2ZP8A 5EEVA 3ZZLA 2EXSA 1WAPA 5EEZA 5EF0A 2ZP9A 3AQDA 1QAWA 1C9SA 2EXTA 2ZD0A 3ZTEA 3ZZSA 5EF3A 5EEWA 5EEUA 3ZZQA 1UTDA 5EEXA
chains in the Genus database with same CATH superfamily
4EZLA 3KCWA 1KENH 1FNEB 2FCBA 1AZVA 5CU5A 5T5NG 5KZCB 3QAZB 3O3AB 4POYA 4PV9A 1Z32X 2FEEL 2HAZA 2H2PC 1MCQA 2MQ0A 4JFOA 5JIMA 3EYVB 2BS9A 2VN6A 3JWNC 3ZKND 2Y9RT 2GT9A 3IJ9A 5GGTL 1DFXA 2XTJE 4Z6AT 2YPLB 1G1OA 1CL7H 3T3MF 2FUQA 4P06A 5E9DD 2FDBP 1QSVA 2BRRH 3VQ1C 4YFLI 2BDNH 4FG6C 1PBYA 2UZYB 4LCCC 2F74A 3N9GH 2KZWA 4X2UA 3ULVD 2EDDA 3HA0A 3S37L 5T3XH 5HGAA 2Q86B 1IGIL 4KBPA 4QY8A 3NEOA 4B7IA 3KM2A 1ZTXL 3ISYA 2YRZA 1JYVA 3QE5A 3A22A 1URZA 3I75A 4X8GA 5K9OB 2OXHB 1GYCA 3BVTA 3RWFB 3QQDA 1AGFA 1R24B 3RDTB 5B8CC 3C6EA 3W0WE 2G4EA 3BSZA 2IPUG 5I2IB 1MCIA 3ARVA 4YGVB 4N1CA 3JTSA 2B2XH 4ZW6A 1MFCL 1FIEA 3NJVA 3U4EB 2BOBB 4DN3L 1BXUA 1L0QA 1JF1A 4WV1C 3MYJB 3CG8A 2H6OA 4YDIH 3Q05A 2GK0B 4LOUC 2OTUB 4M5ZH 1VCAA 3MCKA 2KT6A 2R8SL 1D5RA 4P3CL 2GVYA 2QJDA 4JR9L 4M5YH 4UZUA 5TE6H 4GRWH 3EO9H 3FU7A 4G11A 4LRNH 1INQB 5B1JA 5HYJB 1MCOL 3VVWA 1F11B 1I3RB 4OTXL 1PKOA 1JPGA 4D9RD 3KWWA 1KY7A 3IDIA 1C1EL 5JXEA 4FYQA 1IC1A 4TLTA 4DOHB 4P9HC 1M6OB 1CFMA 1KBKA 3CX5J 5JLZA 5FYKE 3MLWH 1NDGA 4UQ9A 3DHPA 1EEQA 1I9JH 2G0LA 2LT9A 5CFHA 1P2CB 1DDHB 2NZ9C 3RWEA 5IB2B 5IP4A 2C9VA 4AYEC 5H4YA 1HL8A 1F13A 2OQJB 5JO5B 4FQLL 4JFTA 4K3GA 5ALCH 5E2UL 1USZA 4A2FA 4YSCA 3VW3L 4L1HA 3FH7A 3ZDWA 3VTTA 1YO4A 4H8QA 1N6QH 7CGTA 3NIGB 4ZS6D 3PQYE 1BDYA 3EJCA 1EAPB 2GSIA 1KCVL 2MRYA 2WGNB 4JLRB 4DP9X 1N2RB 1CDBA 4HKJB 2BS71 1OE1A 2ARJQ 2V0AA 3LXBA 4LSVL 3B9DA 3ZT7A 1MCRA 4QT5B 4ZW8A 5JPMA 5T5FH 4DTGL 3SDXF 1EO8H 4KXZI 4LCWD 4ZQTA 3K72B 2Z31B 4HC1L 4WHYG 3VXUA 1K72A 3BVNB 3QO0B 5FHBH 2VXSL 4MX7B 5EEVA 2GKIA 1TPXB 1KY6A 2WVSA 4BGLA 3PDDA 1H9DA 1AR2A 4NKIH 1FFOA 1M4KA 2NTFB 3BE1H 3MLTA 5BRZD 4XB7A 1KC5H 3DJTA 3HAEA 1FNLA 3EH2A 2IGLA 2FBOJ 1BLNB 1NOLA 1PD1A 1UGKA 3C08H 2N59A 2I25N 2EKSB 1RPQA 1MWAA 2WLIA 3U83A 2R39A 3RKDD 4BE6A 5JXAH 1MI5B 1DQDH 2QV2A 4BFOA 4NAMA 3RNQA 5LBGA 4L4VA 1KYAA 1P5UC 2LHAA 2NR6D 5C07D 1N5YH 2EDFA 2ORBH 2BNRD 4ZO6A 3QXDA 2NY0B 5SWZA 2O6EA 4ETYA 1BHGA 4MZRA 2CJ3A 3NPZB 5BJTB 4G6FD 5F6HJ 2Y5QA 4PJHB 4R4BA 5I76A 2V17L 4HUWB 3K46A 4KO5A 1MJ8H 5EZIL 5EIVA 4ZMOA 1A6TB 4MJ5A 2K45A 1LD9B 4UTAL 4HV8B 5AB0A 1XF3B 3EKCA 1P7BA 4MJ6A 3RBSA 5EEWA 5CIPA 2NYYD 1FL6A 3G6JF 4HD5A 4IM8A 3T3ME 1XXDC 4CSTA 4W4NA 1JVLA 1KLGA 4G9FD 2GQHA 2D7OA 2XZAH 4N2KA 3HC2A 4O9HL 2ALAA 4NC0B 2FZ3B 1T0OA 5IG7B 5E2VL 2GJZA 3IAQA 1EANA 3D08A 4UQCA 2WWMC 1CS6A 3CFBB 5D4HA 1GJUA 2IBBA 4YIQB 4NO2B 4Q2ZB 2F1AA 3TH4T 3LPOA 4FL4C 5D1ZI 3HN8A 4G7VL 4IBSA 2KYIA 2CHXA 2DQ6A 4PJIB 4XNZB 3B5HA 3MCLH 3NTCH 3V0VA 3FT2B 3EGDB 1YEWA 1GZQA 2A77L 3DSFH 4PJHF 5F7EH 5F7DB 1N6UA 3T4AB 1IV8A 5DCCA 4R0LB 4LXFA 3QIUA 3DXAB 2A6KB 4XPAH 3PL6D 1DBJL 3FN9A 4PVNA 3AREA 3NZ8B 3OJMB 1ZT4B 3TWCH 4WWOA 4NJAL 3C5SB 4HVBA 4XX1G 4Q8BA 1JWSA 2JLLA 3QJVB 2C3VB 4BWWA 5I19H 4IQHA 3KLHC 2PUQT 1OT4A 2EE0A 2B20A 2F7OA 4RRPG 1MRCL 4ORZC 2CNZA 1OARH 3LQAL 4GLRH 3BFOA 2KHAA 2CO6B 4OJDH 4PGJA 2CAKA 3CDYA 3UEQA 1I4FA 2OJEB 4HFWB 4I18A 4YPGB 1FP5A 4WWKC 1TVHA 3VXTB 1HTYA 3T1FB 1NH6A 3CFDB 4PJIF 3RGVA 4M5TA 3NJJA 5CCJA 3GC3A 4OLUH 2Y07H 3V0IA 1T04A 4WW2B 1HEZB 4OF3A 4U1LA 5IW6B 4KAQH 3DYMA 3WKMH 3F6JA 2DYPA 2OMYA 3FRPG 4MFHA 1HJCA 1J9TA 2CCVA 2ENPA 2VDQL 4PRNA 4Z7WF 1RAMA 3VCLA 3O11B 3IPFA 4LARH 5J11B 4JB9L 1U8MB 1HFUA 1CICB 1EFXD 2HFTA 2QGDA 5B39G 3IDGB 2EIMB 1DR9A 4WNSA 3BPCB 3KPMB 3HZKB 3OSVA 3SDXE 2APFA 1IEBB 1LDPH 4H20L 4PBDA 1WTGT 5GGTA 1WA1X 5FYLE 5I30H 2YKLL 5HYJE 3CX2A 1BSIA 2DL2A 1YVLA 3WD5H 2X05A 4EQ3A 2Z4QA 1TZOA 1XH1A 1NBYA 2IOOA 4OB5H 5GIRA 5D7LB 4DGUA 2C9XA 4QHMB 3QEUB 4ALAC 3P73B 2ENSA 2HTKD 4DOHE 3F6IA 4LNRB 5DS2A 1RUML 2ZE0A 2BVYA 2FGWH 3PDOB 4IU2A 1H6FA 2H5UA 4RBPK 3WKNA 3QHZH 3RTQD 4KGLA 3C6LC 2WQ8A 3OQRA 1UM4H 3WE6A 1ZD6A 3DTUB 2HVKA 1S7UB 1OOAA 4OVVA 4QWWD 3UTSE 1J9RA 2H9GB 3HE6B 4WI2A 4PRPD 5ETUB 2Q76B 3HI6L 2Z93B 3LKRA 3WN5C 1LJMA 3O41A 2OMZB 4ODHL 5DS8A 4OLVL 1A7PL 1ZLSL 1K8DB 1E6JL 2WD0A 5CMAA 3Q1EA 4L3CA 3VE0B 4EDWH 5CBAA 2BFVL 3F7YA 3G6JE 4JFQB 4KI5F 3IAGC 1T20B 3P9WB 3LZOA 3NIFB 4NZJA 3QJTB 3A6CH 4JFFD 1C16A 1Y07A 2JE8A 2DM2A 4JFDA 3SYQA 1LEKA 2Y23A 2GBTA 1OANA 3DK0A 4AV4A 1UH4A 3MJ8B 4FNSA 5EIQA 4OLXL 3TBTA 1QOKA 2FJGA 3FQXB 2G2NA 4LO9A 4KQ0A 3RY5A 5T3ZL 5EUOB 2NW3A 1BBJB 2AK1H 4Q9RL 2NZ1A 1NMCB 2BINA 3DV6A 5BRQA 2R7EB 4B9KC 4GI9A 1SQ2N 2DZEA 4EN2A 2R2HB 4RDBA 4XCYB 2Q3XA 3MOAL 3VFMB 1KG0A 3CK0L 4NKMA 1X5XA 1BZ7B 4K23L 1SLVA 2B9BA 3BT0A 4PJHE 4GG6F 3QG7L 1QZNA 4ETQA 2D2OA 3NCYS 4BA8A 2NX5A 5KVDH 2JB5H 4AIZB 3ROLB 1B9KA 4ZTOH 3ZZSA 1MCFA 3V6FA 1GAFH 4DEPB 5ISZD 3GZQA 4P04A 3V7MA 4TNVK 1VACB 4XXWA 2ZCZA 3RX7A 4L5FE 3M7OA 3TZVD 1KCUL 2MQ3A 5IQLA 4L29B 4XOBA 1E42A 3AAZA 2P45B 2UWEB 3GSOA 1AKJA 4HC1A 4K9EC 5HHVL 5E94A 3ZOAA 4RFNB 3DHMA 3N1FC 1E7UA 1RZJC 3U30B 1XGQB 3RWDA 1B0IA 3ULUC 4NO5A 3UBXB 2C26A 2A4EA 1EBPA 3REVB 5ANMA 2ARJB 2E0PA 4PJIE 3AS2A 3QDMD 3RUGA 2JKXA 1JUFA 4ZOBA 4F33A 3RI5K 4OCXH 3RIFK 2JLPA 4OZIB 2YBRB 1NOAA 4OFYD 2J72A 4EBQL 4MVBC 5IMLA 3D52A 3KPSB 4KUCF 5DRZB 3DXAE 6TAAA 5F1KC 3WFEH 3FMGH 2EDKA 3HCVA 4Z76B 4KMQA 4GW1B 1MCSA 4F1ZA 3L95A 3ZZLA 1XIWC 4Z7WE 1JK9B 1UB6A 4LT7A 4CVZA 5ESQA 3S88H 1ZJBA 1UXMA 2EDWA 3D69A 2XRAL 4HIJB 1S7QB 4FQXB 3IJ8A 4XAKE 3JWOH 3RX8A 3TV3L 1KEGL 3LS4L 3CMGA 1GW0A 3IKCB 1JG9A 2AANA 1U0QA 3DURA 4UTAA 3DUSA 2ZD0A 3CU7A 2UWEF 3CXHJ 1L9NA 1I3GL 2CBTA 4U1MA 4XVOA 2R29L 3VGAB 4Y2DC 2CIIB 4NQSA 2JKWA 4NQEB 1QBLH 3S5LA 3WIFB 5DJCB 3N42B 4YN3A 1TTFA 1V7NH 3N1QC 2DQJL 3JVGC 1EGJA 3FO1A 1U8CA 1KJVB 4OT1L 1SY6H 3C8DA 4HDIA 1O75A 4Z95L 4L37A 5LVEA 4H5SB 1JCVA 3NK3A 4Z7VA 1DHKA 4CJ1A 3SDAB 5H94A 1ANUA 4OZIF 5IZ7A 3L5JA 4MD4A 1XSOA 4PJ9A 1JERA 5GS0L 4PBXA 2VSKB 3KH4A 3P2DA 4JY6A 1JZ4A 4FG0A 5A2BA 3BJ91 2AEIT 3U9WA 4EN3A 2DWTA 3FC8A 5L0QB 1G0XA 2ITDA 3NH7L 3VD0A 4IHOB 3V4UH 4IMKC 3ILDA 5BS0D 1H5BA 4NWUH 5DFAA 5B1CA 1IC4H 1BYNA 3AY2A 4XPGH 1S9YB 3D7PA 5FHAL 4XNUH 3NZUA 1RZ8B 4IYKA 4QYAA 5B1BB 3BW9B 5HPMB 4YE0A 5FUCE 2WTRA 2WXNA 1KEMH 3LHPH 4YE4L 2GYSA 4FFZL 3VFOA 4R83A 1TEYA 3IDXH 5D7EA 4KTEH 3D39B 4KI5E 5DR5H 3L9RB 3N42F 3MLYL 4JM0A 5IVOA 1QA9A 2VDNH 4GRWB 1QO3A 5F9OL 5C0FB 5D7LE 3D0LA 4G1MA 5AYQA 1A6WH 3GHEH 4QOKA 4RGNB 3O9WC 3DBSA 1E3FA 3ECBA 1P84K 1K2DA 2OTWB 3LMJH 4MXWL 3WEMA 3CSFA 1QUPA 2NZIA 5F7YC 1CWVA 4Z3EA 1MIMH 4GAJH 1WBXB 5EU7C 1ZS2A 3MJWA 4AQEA 1LE9A 1DVQA 1P7QA 1VZIA 1KB9J 1AXSB 1HESA 1G87A 1NKGA 4FJ6A 5DLLA 5LGHH 5A3IC 7FABH 2EYTB 2F7PA 2ESVD 2XV3A 5GGRY 5ADOL 4JPKL 4GG6E 1UXSB 1FVEB 2FD6H 2G9HB 1JD9A 1SLWA 2C1PA 3DARA 2VDLH 4LLYA 3LN5A 5CLTA 2AAAA 3LKQA 1IGFL 4KY1L 3HR5A 4BFBD 2EYSA 3HHSA 2MPAL 4BSWA 5IF0B 4FTVA 2YSTA 3COOA 1NC2D 4K3JH 3MRIB 4QXGH 1LWRA 1DBKH 1U3NA 25C8L 3P4OB 4X6BB 3SDCB 3V95A 5SWSA 4GW4A 2YOAA 2FIKB 1FZOA 1JZIA 4GAAA 1LK3H 1E67A 3GUTA 4HOZA 3BISA 3ESPA 1A1OB 3U1SL 4KK9C 2VMDA 3G04A 1D5XA 3VXSD 4N4YB 1FLTX 3O6FB 4BFNA 5GQBA 1SYSA 4ZMYA 1PLCA 4N8CL 3I74A 2J2ZA 1MPAH 2BFGA 4I0PB 4E0RA 1FE8H 4O58L 4ZMTA 3L3JB 3QNYA 3CHQA 4FQ1H 3UFIA 1G7HB 3RJOA 5DJ0B 5L2KB 2IFFH 4JG0L 2YAEA 3BJLA 3R06A 4UQ3A 5K39A 5DF0A 1FN4B 1MFUA 1S78C 1DQML 2WVUA 3H7BB 2DH2A 2EXYD 2DICA 5CLXA 5DEZA 4HJ0C 1NMBH 5EPMB 4ZI8A 1S8DA 2AITA 4LSSL 1NEZG 4LVNC 1SM3L 3FF8A 4GJTB 3WFCH 3PAVA 1BIIB 2ZXGA 1SVCP 2NY4C 2LU7A 3ATDA 3QNXB 4GMTL 5EU3B 4FQJL 3HMWL 1MLBB 1DYZA 1UA6L 3CFCH 3SYOA 5I23A 3TTYA 2Y7OA 5DMKA 2UWEE 1RUQL 3SPCA 1E3ZA 4MSWB 3FUHA 1DJYA 3LKNB 1ACZA 5GGSA 1BQHG 3SOTA 3ATAA 4OBSA 3ZMRA 1KPVA 3FAXA 1I9RH 4AC4A 2G5RA 3GJFA 3UAJC 2EDQA 3LZLA 2X4RB 1CLYH 4APQD 5SX4H 5BO0D 1F1DA 3C60C 2BY1A 4L2LA 4RAHA 5JIHA 5CCGE 4N6RA 3PWVB 4Y4FA 4OZIE 1JNJA 3AT9A 3MUGA 4DF9A 1TEGA 2R0KL 5IROC 2QKIB 1RUAL 2WMPA 2WUCH 3B9KC 3CSYB 2X12A 3EHBD 4L3EA 5GJTH 1HK6A 4PGBA 4A6YB 4PH8A 3B1UA 3HIZA 1JGEA 2I9LA 4JHVA 5LG6A 3FTGA 1DL7H 4XP9L 3MA7B 2ZUVA 5E5RB 1P4LA 3MUUA 1MNUH 3SBPA 5LHDA 4PTTA 2WN2A 1BAFL 5MP6L 3FFCD 1F6AB 2VERN 4QXUL 3X12A 4ZX4A 1EFQA 3QPKA 4PJEA 5C0CB 3KPRB 4NQEE 4MDJB 5F6HI 2ZAHA 1AZBA 4MNHA 2F6AA 5T3XE 4M7LH 4UT9H 5AW2B 5IW1A 5H4ZA 4HKZA 4XXCC 4PJFF 3OHXC 3A21A 1IT9L 2A0LD 3DDFA 4D3CH 5DSCB 2W81C 5IVNA 1UWXH 1NWPA 2C4FU 2GEQA 3MJ9A 4OI7A 2J5LC 2JCCF 5C0BB 3TA3C 1I1YB 1KIQB 4O5LH 1WS8A 5F9AC 5EO0B 2AP2A 4PVBA 3PWPD 5DQJA 1QYGL 2KLSA 4X5XB 3OJDA 4OQTL 4HWZA 5JA9A 2VLME 2XTJC 2F1EA 3H2PA 4LK4A 3DI2B 3QUXD 1XGPB 4FA7B 4GKNB 5C70A 4NQCD 4CU6A 5L6YL 1R19A 2UUDH 4DVBA 4RETB 4M6MH 2PTUA 3UGXA 3V0EA 1UVQA 2HN7B 5K1JA 2BY2A 2QKSA 5BO1L 3BIKA 4A68A 5GGRA 3CVIH 1U42A 1KTRL 2DBJA 4P5TB 5E6ZA 4P3WA 1JZJA 3NEXA 3RHWF 1BD2D 2C4FT 2H1PL 3D39E 3QWRD 2F53E 5BPPA 4UV4L 3MRPA 1MVUB 3TONA 1TMQA 3NSCA 3S4SA 2H0JA 3LB6C 2XWJB 2VN7A 1B0GA 3GMQB 4RGOH 2YK1L 1QATA 1SJEA 1T2XA 3NA4A 3GO1L 1A1MA 4WTZG 1D7DA 2R29A 4RGNE 3DX3A 3MDJA 2WOBA 2A5UA 5DJYB 3N04A 1I9IH 4JEGB 2APSA 3RGHA 4PGDA 4K4KA 1TZAA 3SKJH 2FQGA 3O2WH 3PU7A 1GXEA 2V2TB 2FHFA 3BP4B 1DEEB 3C5JA 2VT0A 1CLZH 2JH2A 3AY4C 4PGZA 4WGVB 4PRBA 3RVXD 4URKA 5HY9B 1TQCB 2X4NB 3ORJA 1KYOJ 1T6BX 2PCFA 4FI7A 1GYAA 1VPOH 1FFQA 1KGWA 1DVXA 1T22A 3L3OC 3EDKA 2J4WL 5AD0A 5KTEL 5KBDA 4ZYKB 2P8PB 1KYFA 4PJDB 4Y8DC 4M1GL 5IREA 4XTRC 4HKXA 2WKOA 3MFFB 3E9TA 3BZFA 3RIAK 3EW3B 4Z18A 4A1RA 3GFUA 4PUBH 3UACA 1ZIBA 3QZWG 2DMGA 2R2EB 4OQ1A 3CDCA 3QQ4B 1U2HA 3HS9A 5EU6D 5IBUG 3ULAB 2HT2C 3U0WL 3ZR5A 2CCWA 5FO2A 1ZHKA 4NIYE 4YFDB 1MCPH 4S1QL 3PGCB 2WHVA 1LK2B 2BRQA 3EYQD 4OLZL 5BV7H 5HI5C 4NP4H 2P24A 3U2SA 3U7AA 2EUWA 4AE1A 2YMXL 4H7VA 1PNCA 2WXGA 1OCWL 4QUOA 3HS0B 5JR1L 3ASOB 1S7SB 5MEQB 3JWDL 3EYOB 3MLZL 2EEFA 3KDMB 1QEWB 2FJHA 4K5OA 3MRBA 4P5MA 4OGYH 5CLWA 4WSJA 4J3XA 1F1GA 5IY5B 9PCYA 2D3JA 3PP4H 5D8JH 4WCYL 4N5UA 1QTPA 5A6LA 4JJOA 4FAAB 4HCRL 3RA7L 1QRNB 3ARGB 5L2KE 3FDWA 4JVUA 5LNGA 1JYXA 4ZMVA 1T4WA 3DHUA 5EBLB 1K8IB 5ID0B 3F00A 3ARSA 5I18H 1E27A 3BMVA 4R7NA 3ROOB 3N55A 4KKBC 4LQ1A 5F1IB 1JRHH 3VWJB 4F27A 4P3DB 1L0XA 2LTQC 2AS5M 2EABA 2AXGA 5F97E 2OMTA 2OSYA 4U6YB 2XOTA 3GSNL 1K6QH 2FBJL 4HWBH 2R4SL 1B3IA 3SN6N 5EC1A 1RPUA 5BOJA 5FA4B 2IH3A 1DANT 4WEEA 3NSYA 4GAYA 2PMZA 4N2HA 2DTSA 5I5RA 5TF0A 3PGDB 3BX7C 3L4YA 4WIQA 1QHPA 3LPWA 3P3SA 5HDBB 5IFAL 5EBWA 5GSRB 1JXDA 1NGWA 1ZVSA 2XN2A 4P2QB 4QCIB 4YXKH 5HYQA 3O8XB 4PJFE 4JFZL 3HFML 2LU4A 2ZX6A 1I7ZA 1PYWA 4G43A 4QRSA 1Q0XL 4JRYB 1OEZW 4Y19A 2E6QA 5F9WC 2J43A 2JCCE 4JM2B 4KX9A 4PG9A 3EG9B 3WLBB 1V7MH 2VXTL 1M9WA 2ZYSA 4LSRH 5EBMA 4N9GB 3T65B 2ITEA 4HZAA 3GMOB 1IAIH 3GDBA 4X0KB 3EUUA 1M71A 1Z9PA 3CLWA 3QRLA 5AB1A 3WNMA 6CGTA 1HCZA 3INUL 2HG5B 2AMGA 4ZSOA 1ND0A 3VRLF 4CADA 4L4TB 4DT2A 5JQHC 1W8OA 1KCSH 3AB0B 4H4NA 4AQAB 1PZBA 3OLEA 5EN2A 3E9UA 4WUUD 4MCNA 2VCOA 4JAMA 1E5BA 2PXYC 4Z0XA 5T3ZD 3F04A 1N64H 4DCQA 4M93B 4UOZA 4LPYA 5EU4B 5B3SB 3IRCA 2DQDL 4PV9B 1A1NA 4H0LC 5C0CE 5J5EA 3KPRE 4JFOB 4Y2NA 1E5CA 2XN0A 4P23D 1W0YT 1Q9KA 2VR9A 3V0FA 2HMIC 2GT9B 4FP8H 4RNRA 5J7CC 4E68A 5D1XB 1CFTB 1BQ5A 4WU7B 3IU4L 3MBEA 3QWNA 3HZYB 1CUOA 2BVOA 2CPCA 3B5TA 4DK3A 5IB3A 3K71B 2EUZA 4Q14A 3QAZC 1HWHB 4JM2F 4UMSA 1AO7D 3QEQD 4XP4H 2DMBA 1MF2H 3R8QA 4FNLL 4HOMA 1OVZA 3KW8A 2F5BH 4HOXA 5HVHB 5I1KL 4K8RD 4P2RB 2DM4A 4KMTH 4BH7B 1M7XA 2I32A 3FQWB 3D9AH 2M2DA 5HGAB 4BCYA 4D8OA 4DP5X 1L7TH 3HE7A 4GUQA 3SY0A 2F7QA 3ZL2A 1U92A 3E2HB 5EB9A 2K4WA 1H19A 3HHRB 1I8AA 2F68X 4XN5A 1KPUA 4U1SA 1AGFB 2ZWLT 3V2AR 4U7MA 2RJMA 1JWUA 1B4RA 3VWKA 1I8UA 1JZ3A 1QKZL 4NUGL 5C6TL 1JF1B 1LMKA 3CXDH 4K71B 1ZWIB 4OJFH 3VFGH 2EDYA 4BA0A 1C08B 4PRHD 2D7MA 2VDNB 1UOKA 2UXTA 2QDWA 1TETL 3C75A 3I6KB 3RDTC 1FLRH 1URIA 1J5DA 2ZWSA 4HU8A 3CFEB 4UU9B 2WXFA 2J6EL 5EA0H 4BEIA 3FU7B 4N0YL 1LM8V 4YLCA 2CBQA 3AUWB 3ZDYF 1PKQE 2MOGA 1A6UH 3IDIB 2XIDA 4UM9D 3DYPA 4PN6A 4R96A 2CD0A 5JLZB 1NBZA 1NDGB 3IB4A 3MKKA 2QHLA 4X7CC 3WN6A 3QP3A 3AFLA 3ZLQC 1AC6A 4Y9CA 3N5AA 3HG3A 4OQTA 4L0ZA 1XHHA 2VDLB 3F83A 5DD3L 2V7HA 2UVEA 1IKFL 5J56B 3ES6B 3QFJA 3TO2A 1HC1A 3GK8H 5ES4B 3TO4D 5IJKC 1A5FL 3CSGA 3DNKA 3T77A 1J0ZA 5LBSA 1BVNP 2GSIB 2G3MA 4GXUN 4MAUH 3U7YH 3JV4B 5DO2D 3VXME 3D85D 5JPMB 1G9NH 3HHMA 1VFOA 3AWGA 3VXUB 2ZPKH 5DVNA 2O93L 4M48L 2PO6B 1KTKE 1D7CA 1A2YB 4AMKH 2BSEA 5I1EL 2FJFA 5I1IH 1ICTA 4N25A 2WK2A 4TL5A 3V4VA 1BXXA 4ZUTB 2PW1B 3SDDD 2X6BA 5KYYA 5DWUH 5JZ7D 1QRNE 4AT6A 3T8XB 1MWAB 4E5XG 2AQ3A 2AFNA 1ZLVK 4WJ5B 3A4EA 5D71L 2Z31C 4AYID 2EJ1A 5TDOA 2OYLA 5KVDE 4KTYA 3PUUA 1TPXC 1IGMH 3VRLE 5SWZB 1MY7A 2LLNA 4KRMB 4QAMB 2CDFA 1G5GA 4X6CB 4X6FB 1GHFH 4GW5A 3ZTEA 4Q4IA 1U30A 3WHXA 2IXQB 4F24A 1ZIAA 4KJYB 1DSFL 4R4BB 4MNQA 1ZMYA 4B9JA 2GITA 2YO3A 5D6DC 3GRWH 4MJ5B 1JXKA 2VE6A 4JFYA 4P59L 4RISL 1CO1A 2ADJB 4JG1H 4MJ6B 3SJVD 1IAKB 2UY6A 1VGKA 2EDXA 2YPVH 2X2HA 1S7VB 5HDQL 4R9HA 4MB5A 2BOCB 2NY0C 3DTXA 5C1MB 1G6RH 5DU7A 4W9IC 3SDYL 4MJIB 3WUWB 3IN0A 1TJGH 4UTBL 5J1AA 3LEYL 4QHPA 4LU5L 4JRYE 2XVLA 3GMPA 1MW2A 3GINA 3L3GA 3IDMA 1U8IA 2IDSA 1WFUA 4UT6L 2GJZB 1PF3A 3BN9C 3SE9L 3WKYA 2VM9A 1OAUH 2CIKA 1SOQA 3GJFH 3ZYZA 1NC4D 1LHZA 4WDIA 5GS1A 1V05A 3LRLA 3TT3H 2Y5TB 4L4TE 1PY9A 4OFVA 2B15A 2HFGL 3WO3B 3GYRA 1RZ7L 3L54A 4IOSD 2X6CA 1GZQB 1NGQH 5ACMA 4IRSC 2GIMA 5CP7A 3GIZL 3MRMB 3MRKA 3OJ2C 2X70B 2ZKYA 3TN0D 4X8JB 4ILDA 1EZVY 4IU3A 3S3JA 1FO0A 4AQ8C 5CD5C 3AREB 2AC0A 2BNUA 2HFFA 1KCLA 1QSZA 2G60L 1RIVL 1FL3A 3GSNA 4P9ML 4UIMA 4U3XA 4XNZC 2P8LA 4FS0A 3V5KA 5I6KA 1O6TA 4FHKA 4Y2OA 2O1AA 4MS8C 4V33A 1OTTD 1PZSA 2J73A 3T4AC 1DDTA 4LSPL 4R3SA 4XZUA 5JQ6L 5TDPA 4M7JL 4KKCD 1E50A 2BWIA 2OA9A 4MMXA 4MD5B 4R0LC 5KYUA 2EVGA 1UWGL 1KELL 1BZ9A 2NY5H 5KSAD 2CHZA 5JHDD 1I4FB 4HJJL 5KVGH 3GHBL 5DD5L 1KGCD 2PF6A 3WI9A 3ZDYE 3V8OA 3D34A 2FYYA 1MH5B 3LY6A 3N1PC 5ADPL 1Y0LB 2A9NL 4E9XA 2MCPH 4PMFA 3CJJA 1UWFA 5K9KA 3IJSA 4U1LB 5EO9A 2ED9A 1BJMA 3FYIB 1RIHH 2C8NA 3VXRA 2OMYB 5D5MA 1NCCL 1L9SA 3FUJA 1UM6L 3UC2A 3CVHL 4CSPA 4KZDH 3DA0A 5EORL 4PRNB 2FX8H 4PAZA 1AR1C 3VCLB 3WY2A 1HL4A 2OR9L 4IIQB 4RWHA 1PD6A 4K07A 1VEPA 1F56A 5E4AA 3QARA 2E7HA 2EXWC 4HPYL 4ONOA 1DJZA 4P49A 4WW2C 1ETZB 3H9HA 5PAZA 4DQOH 3B56A 3ECVA 1MFBH 1Q1JH 4W9HC 3V52H 4PM1A 4TSBL 3NJNA 2WZ5A 4AENB 3MJ7A 2EE6A 5TK4A 1MFEH 3H4FA 3PE9A 3GS4A 5D1ZD 2F19L 1EV2E 2VERA 2Z4QB 3LEVH 2HFEB 5J11C 4HHWA 12E8L 4Z23A 3SKMA 3VX0A 3ZT6A 1CICC 4YDKL 1A7OH 1EHLH 3P11L 3VFUB 1JPEA 1EX0A 4TNWF 4IU2B 5FUCC 3IJEB 3SGKA 2VDOL 4JO5A 2I27N 3LOWA 5DK0A 1X5GA 3HS8A 1IL1B 4KI5C 5TDNA 5GHWH 3CDZA 4R5XA 2O26U 2WVVB 2IH9A 1A22B 4N3UA 2YWZA 4OSUH 3KYOB 2H0PA 4OZHA 1KN4H 4KDWA 5LAPA 3DVFA 2X89A 1FZKA 2VL5B 4XAWL 2E46A 2BZCA 1BZEA 1J8HD 3CDGA 5BV7B 1PDKA 4MCZA 5CJQH 4JDVA 3VXUE 5CBAB 1MHPH 3F7YB 4NS0A 3PDGA 1SEBA 2YSSB 3EFOA 1UYWL 3LCYA 5IB1A 1QR1A 2AJVL 1C16B 4OZFG 2I07A 2NY1D 3KLSA 1LEKB 4JKPH 1I7RB 1AGCA 1GS7A 2J6EA 1LEIB 1ORQB 3C12A 4MJJA 3ESMA 2FJGB 5F0LB 3H8NA 5GZOD 5CILH 3I2CH 3GSQA 3U25A 1TTCA 1VCBC 1I8LC 3GXMA 2AXHA 1J0YA 2C3WA 4L4VE 3U0PB 3TIDA 3IJ7A 4R4FL 4GRLA 1BBDH 5B1KA 2HJKA 5SWZE 4IOFC 5I66A 5CGMA 3RVUD 3QXAB 2GSMB 1PSKL 5IHZB 5JMRA 2Y7QA 3I84A 4J3BA 4WKZB 5B7FA 5C2BH 2D7TH 4M61B 5CKGA 2VW7A 4ETQB 4L3AA 4IRJA 2NX5B 3L13A 2WANA 3FO0L 5IVZA 4KH9A 4LLVB 2WWKT 5JPNA 4CSZA 1NMCC 2CXGA 1I8IB 4HK3J 1HJBC 3WFDH 1QFWM 2ROXA 2W59A 5GS2H 5T1LD 2DD8H 4QXWA 4CL7A 1VKXA 4U1KA 4MJIE 4X5WB 1OQOA 1HQRA 4DUWA 4ODTH 3B2MA 2C4XA 3AAZB 3VFNB 3GRGA 2K9UA 5E08H 1T03H 3ALPA 1MRFL 3MZGB 5I6XB 5DK2B 1AD0A 3F58L 4LP5A 3P54A 3TA4D 3L4TA 2VL4A 1XZ0A 2VQUA 15C8L 5LWYH 1KOAA 4DEPC 3GGWA 5HD8C 2JIXD 1AZZC 2Z64C 5EDXA 3RUGB 1E4XI 4F33B 3MX0A 4HPOH 4BXVA 5B4MD 4UBDC 4IGBD 1UKTA 3C9NB 4GUOA 4Y5VB 4JN2B 5DJZA 3MRQA 4NQQA 1QX1A 4H8PA 1ET8A 3PHOA 3HCVB 3DLQR 4HFUL 5KJ4A 2DTML 4IJ3B 2NY2B 2IEPA 4HT1H 3VYNA 2IH8A 1FAIH 3ESUF 3UGEA 3NEEA 3N50A 3KZ8A 2E75C 4JPWL 5D72H 3T2PA 4DGVH 1NCBL 3OR6B 4A7TA 4B27A 2D7QA 4LLUA 3NCBB 1DUZB 3DURB 3DUSB 1FNAA 1L7IH 4P9HL 3BKCL 4U1MB 2IOIA 2VLKA 4PJAA 4F7PA 4LSTL 2FT6A 2FSEA 3MXWH 3S5LB 4LVHB 4UTBA 1TR7A 3PIQA 5L4MA 3STLA 1BMGA 2C3XA 1U8CB 3ZTDC 5JDJA 3GD1C 1BWMA 1JDCA 4HDIB 4FQXC 4GFXA 4L37B 4OGXH 5ITBL 3QDAA 4KJWC 3RUGF 4O02H 4UMGA 5EWIH 4JO2L 5EO1A 3WY3A 5ICXB 3PCYA 4MD4B 4N0UA 5CU9A 5E6YA 4JFEB 3QAQA 4A37A 3B2DC 5E00A 1KLUA 3Q6FA 4E9TA 4JX0A 1FNGB 2XG5A 4J3VA 3Q1SL 5E8PA 1HVXA 2ITDB 2Y6SD 3T09A 3N3EA 3VH8B 2RA1A 2R69A 4OCWL 2IPTH 1A21A 3KEHA 1H5BB 3CCHB 4H26B 1UUSA 4K7FA 4DK6A 5JOFB 3ABMB 1X9LA 1EMTL 1F6LL 1RD6A 3SDAC 3MLSL 5DQDL 2HJFA 2WY3B 3JBG7 4MASA 4RDQF 1DFBL 1ZHLB 4PRAB 3SGJC 5IOKA 5EEYA 1M53A 1L4IA 2W9DL 1BG9A 4O2CA 3ZZ1A 1L3NA 3MV9A 1QO3B 3JUYA 3E1ZA 4M43H 3F5WB 3KMDA 2X4UA 3D0LB 2HWZL 4G1MB 1KUMA 1XF4A 3L9YA 3BQUD 4PLOB 4QOKB 5DZJA 1G5AA 2WSKA 2A6DB 3ECBB 5ACZA 4G8IA 1GS8A 2D0FA 3M88A 2PTTB 2R59A 1NWOA 2J44A 1L9MA 1ZTXE 1OAKH 5CJXC 4M3JA 4WO4D 3N91A 4WFGE 5F96H 2EDTA 3ZHKA 3BAYA 3HC4H 3LRMA 3DGDA 1HHJA 2LLGA 2DQEH 1SF3A 3TNMB 4DKEL 4XP6H 3NJGA 4WK4B 2J1ZA 2F54A 4PJ6A 3TCXA 4FG4A 1EUUA 3N2JA 4RGNC 4HIIA 3HBGA 3WXWH 4FKHA 3CVHA 3LN5B 3QORD 4GKZA 1TFHA 2A73B 1R5WA 4I3RH 4OLEA 4AM0B 4CRPA 1KXTB 2WBKA 1MDTA 1BFOB 4YDVA 5JW3L 4XPHL 4E9SA 1UB5B 3DIVA 5SWSB 2DM7A 4GW4B 5B7EA 3HMXA 3QDJB 3O3EA 4LCIL 4PR5A 4KZCA 1SXNA 3M1CA 2KBGA 4XI5D 5FC9A 4MMYA 4V1DD 1OP3K 3D09A 1LO0L 4JHZA 4XB3A 3UBHA 2NRDA 3FO9A 1FGVH 1D5XB 3G04B 4U6VH 4FXKA 4KQ3L 5IT2H 4RAVA 2DLTA 1XF2A 5GPRA 1EXUA 3EGXA 4FDWA 2AEQL 5DTFA 4GIAA 2PWDA 2TRYA 2CGRL 3IN2A 3N40P 5I1CH 2F7RA 2J1YA 3SDCC 5C08D 1FFNB 4RZCB 4ELMA 1KCKA 5C0EB 4E0RB 4LRIA 1FH5H 5DLMH 2X53A 3TJEL 2NCMA 1YJDH 2NW2A 3LTVA 3R06B 5K39B 1D9KB 3FCSA 1PG7H 5I0ZA 2NX5E 1Q9LB 3SPHA 3FJTA 3HFFA 3QDMA 4J3OG 4QXTA 4BK5C 2NNAB 4HH9A 2E7BA 1JNHA 1S8DB 3N6YA 5E8OA 3VACA 1BA9A 2ZX7A 4NN7C 4I0PC 2MMXA 3DRQA 2DDQH 3AMKA 1JPSL 2AK4D 3DMMA 3PPEA 5I71B 1G6RB 4FQIH 4DAGL 1WK0A 1QP1A 4M8UA 5E1QA 5CM1A 4KJPC 5JW4M 5FM8A 5DMKB 4H2CA 3IU3A 1XMWA 4F8PA 1CGSL 4FFYL 3H3KA 3MV01 1HN1A 5GGSB 1I1AD 5DJDB 4IBZA 2CCLA 5F1NB 3QHFH 3T0BA 1G7MB 3VB9A 1KPVB 2ZYRA 1NGYA 5J6SA 3N44B 3GJFB 1O7VA 4KNQA 3OJVC 3RUGE 4HLEA 1SPDA 4XO4A 5HHPA 2P49B 3CLEL 5F7LB 1XB3A 3RNKB 1NLDH 3IGLA 2V3EA 4U3SA 4GO6B 5FYJD 4A55A 4HLZG 4H1LA 1J0KA 4DGIL 4FABL 4MAYD 3A6BL 4EIBA 1QEXA 1VGEL 2VAAA 5EU5A 4GXVH 1IFHL 3DVNB 3PAYA 2I9LB 4L9LB 2YAHA 5KVEL 1YPZB 5E6IB 3T2OA 3ULVH 3TS8A 1P4LB 1A4KB 3GMRB 1KBGH 5DUJA 2P42B 3BWSA 2Y72A 4Q97A 4LCCA 4NBZB 4LLAA 3ECWA 4HIQA 4G8FA 3X12B 4IK6A 3D50A 5LXGH 1RJYA 1ZT7B 1GKEA 5TQ2L 1MLCA 4TM9A 3RZCB 2DWDB 2OMWB 4AGMA 4I5BA 4F7MA 5AVRB 2YEQA 4ZXBD 1J1OH 5JUEL 2BSTA 3KGSA 3TNNA 5H2BB 4X0NA 2BP8B 4HKZB 3K74B 4L8CA 2ITCA 3BVXA 5I82A 5B8CA 1PZCA 2L0DA 3VXOA 2NXYC 4X50A 4PBWD 5I1JH 1Q8MA 4HXAL 1EK3A 1PJ9A 4OLWH 3VFTB 1W6LA 4JFEE 1X5ZA 3RPKA 1W0VA 4DW2L 3HG5A 5L4JA 1LDSA 4LCUB 5F6IB 4B9ZA 3EJPA 5LGJB 5B3JF 1N8ZB 3L1FA 3B2VL 4N6QA 2CHDA 2IAMD 4C4KO 3JV6B 4AIOA 3NACH 5HVFB 5I6OA 1JNLH 4PLKC 4PRDA 3ZDXB 3APNA 3MGOA 3QUKB 4GKOA 4KI1A 5D7HA 1ZLEA 4KXAA 2DB8A 2YD1A 5ID1B 4CMMA 4PJ8C 4AUJA 4LOEA 3FQRA 3ALWA 4XBGA 2PPEA 4FLSA 3BO8B 4HAGA 3C87A 3PAUA 1P6WA 3HTLX 2WZPA 1B0GB 4NO0B 5J9PB 4YFEA 3I02A 4KK8C 4M02A 5ICYA 4J3OD 4QOKE 4X6EB 5CR1A 4I9WE 2CK0L 1KB3A 3FBKA 2EC9U 3EO0B 1DVTA 3IFOB 1QAWA 3K2KA 4PGDB 5DVPA 1XL4A 2Y2TA 4ODVH 4O2EB 3E6FA 4P5TC 3TF7C 3C5JB 4Q58C 5C0JB 4PRBB 2K3HA 4Y5YB 3FQ2A 4AJVA 3K0WA 4OF5A 5HGDA 5KUMA 1E4KC 5IMOB 4Y5XB 3QPXL 4DP4X 1T5XA 5IEHA 4I77H 4NNYB 1T22B 3BKMH 2Q7AA 4XE5B 5AD0B 1HEHC 1Z9OA 4MA3A 3ZDXF 1KTCA 2W95A 3MV7D 3P2BA 2GJ6D 1A66A 4KX7A 5AW0B 4ELKB 2YQGA 3QXWA 1PG7X 4K3EH 3DBXA 4K9EL 1ZS8B 4IMLB 7PAZA 5F3HA 3HC0A 4FRWA 4FTVE 3UAEA 1MUJA 2NXZB 3ULUL 4LOFA 4A63A 2EC9T 3T2LA 1ILUA 1TQCC 3VG0L 5E5MB 3GJEB 3CVCA 5SWSE 3WL9A 3D87B 4CC1A 1RZKH 3O2VH 1CK0H 4YSOA 5HDWA 5JQIB 3SQOL 5C0RH 5FO9A 2E8YA 4TQHA 4XMKL 2N7AA 4U31A 1CLOL 3PUCA 3T0ED 1BQLH 5E99L 4G7YL 2WWNA 1FORL 3RLSA 1RZGA 1YEKL 1HYRC 2A6IA 4WNQA 1FIGL 4DN4L 4U6HA 4UV7L 3L5WA 1RMFH 2BCMA 3N06B 1AQDA 1Z3GH 1XVSA 3GSUB 4X80L 4AQOA 1CQKA 1YRKA 2YEVB 2IJ0C 5I1DB 2Z92A 3DO3A 4H8WC 1EH9A 1AHWA 2Y2YA 4JN1H 4NKDA 3VMOA 3VU2A 5AWNL 4HIPA 1FSKB 4JO3L 4NYLB 4KPHL 2VMCA 3PWUA 2WKOF 2QQKL 2IAAC 1MFDL 4R7NB 1I8MB 2X0UA 3MOBL 4GP4B 4NQTA 1YYLH 2NY6D 3L5XL 2R27A 1J87A 4TS6A 4X4XA 5IJCC 1BAGA 4NZUH 3HEIB 1M42A 2AXGB 5I8CA 4XMLL 2ENQA 1TQUA 1WA2X 5F7BA 5EC1B 5JOPE 4J27A 2IH3B 3ARGC 4HIXH 4JRXA 1QSEA 4HULB 2Y24A 4YZWA 4H25B 3TASA 5E8DH 4LP8A 4KHTL 1HXYA 1S2EA 3LN9A 3MV8B 1BJ8A 3FKUS 5EBWB 4AZ8A 1Y1UA 3PPSA 3VWJC 5T1KA 1S9XB 1WDAA 4U1GB 1H8NA 1KGXA 2D9QB 4A38A 1R0AH 4FERA 4QRSB 4Y19B 2PYEA 4WFED 3LKPA 3VUAA 4H0HB 1V3KA 1MFMA 1PZ3A 2VXUH 3DYOA 2ITFA 4W81A 3VD2A 3AC0A 4H88H 4PJCA 1MW3A 2YD9A 4NRXA 1CFSA 4YHZH 1JZ5A 5MERA 5B3JE 4CADB 3C2SA 2F8XC 1ND0B 1F2QA 4AL8C 4AKQA 1ZANH 3BH4A 3MSPA 4Q7DA 3W81A 2JKJA 3SZ6A 3O8XC 5EN2B 4GIOA 1P7KB 3O0RH 4Z0XB 1IM9A 1E4XL 1M1XB 1XFPA 4JM2C 5CNHA 4QRAA 4JVPA 4DCQB 2Z0BA 1R3HB 3V9FA 4HGMA 2CLZA 3KE0A 3QUXA 2B08A 4U0RB 4WFFE 4WHYH 4WWKA 3SIKA 1FYTD 1WS7A 3WJLC 1CU4H 4ODUA 2ROYA 2WSDA 3SCMD 4JZOB 3AB0C 3DX2A 4B9CA 2J8OA 5IQMA 5KYWA 2ZUTA 4CDHA 1R1CA 4FFYA 3GHPA 4X4MA 3I6GA 4TPRH 3QI9D 3FB6A 3HI5H 5IB3B 4M93C 1S3KH 3ZMEA 1NPJA 3AU0A 3UP6A 1JD7A 4LASH 1XSJA 3B2UD 3CLFH 2JTYA 3OX8B 1KT2A 5DUML 3FRUB 4FI6A 3ARFA 4AI7A 5KYNA 3WEXA 3SY0B 5D1XC 1KLFB 3V7AG 3CQQA 2OR7A 1WIOA 3NCJH 3OZ9H 4ERSL 5DYOA 1OAZH 1QFUH 2Q2EB 5HHMB 3ZDXE 3PLYA 4LHJB 1KPUB 3MHZA 3GI9H 2HKFH 3NFSH 2MFNA 3MACH 1ZLWK 3VWKB 5BW7A 1NMAL 1YZZA 3WFHA 3GSRA 3OWRA 2R15A 2EEBA 2Y25A 2VDML 3I6LD 4LOUD 1ASOA 3E2HC 1F4XL 4ONGH 4BDVA 4FQ2L 5IGXL 3P4NA 4NOFA 4Y88A 1D6EA 2D31B 1NPNA 5EFIA 4ZUVA 3S2CA 2EZ0C 1NBCA 3WNOA 1N12A 2PTVA 1JE6A 3LSOB 4GMSL 4YL9A 2Q87A 3I50L 3AQZA 4NC2B 1CE1L 4K71C 1DVFB 4WLCA 4TUKL 3L4XA 4YQXH 3UZVA 4PJBA 4R96B 4GYBA 1UKQA 4YO0A 5IVXA 2X40A 4GQ9H 2ERJB 2WM0A 4HK0A 3RAJL 4ES9A 5I8KH 2X6UA 1GMEA 4LLWA 3UJIL 1TKWA 2V7HB 3UO8B 1QFWI 5EZLA 2ZP9A 1IM3B 3D2UB 3G9VA 3QFJB 2E27L 3KPNA 3TO2B 1J5HA 4C57C 2FR4A 1H3WM 4BUQA 1Z5HA 2IADA 5EF3A 5JXEC 3IGUA 3RFZB 3AQYA 2IV9A 4HWUA 3IFPB 2Y1ZA 4JO1H 4WHTA 5FA3B 2WBJA 4PD4J 3D5OF 1IJNA 3TV8A 4ZAKA 3UJTH 1TJHL 3QFDA 1FVDA 3UTQA 1OSPH 4P2OD 3BP6A 2EEDA 1KULA 4JKLA 1FRGL 3US1A 5GRUL 3ML8A 3WTTA 4MJ4A 2Q7YB 1MKFA 3HMXH 1NSNL 4DFHA 3D06A 3IDNA 5FO7B 2CO7A 3V4VB 2DJ4A 4F8OA 1ZLUH 2WLJA 2A1WH 3UYOD 1EAQA 3ARUA 4NOBA 5JPMC 4NGHH 1D2OA 1RP9A 5AYUH 3QCUL 2ZXQA 3WY4A 2FO4B 2SODB 3F6LA 4N68A 4FQQA 3TT1H 4POZD 1UCBH 2PO6C 4LGSB 4AMXA 5KYXB 3OMZA 1ADQL 5GRVK 4QRRD 3E6HB 3NJMA 2CKBH 1TZIB 2CDFB 4K94H 3VI3B 4GW5B 4EVNA 3WHXB 5FF6B 1DJWA 1JHLL 2D0GA 2FB4H 3LRGA 4UM8A 3DUUB 1OY3B 2BSSB 4FI8A 5MEPB 1YNKH 3U4BH 4N1HB 2GITB 3Q2VA 3AWEA 2WUBH 4IDJH 3RPBA 5DRWB 2VE6B 4Z0BH 4B9GA 5J89A 2UY6B 3IS0X 4WUUA 2FNWA 3WIIH 2Y3NA 3MV8E 1A3LH 2NTSP 3NRFA 1ECYA 1HCYA 2DQIH 3DTXB 1G43A 3PHQB 2AV7A 4R8WH 2F8OA 2X9WA 1KN2L 3CSBA 4ZFOL 5FKAA 1S4IA 4Y19E 4Z8FL 3GMPB 1HZHH 3NIDB 3L3GB 1GGUA 3KPPB 1YN7A 4X7DC 1VLXA 4KZEL 5E9DB 4AX3A 5C3TA 4Q0XL 4WDIB 1MHHB 3V5DA 1T1YA 1G7QA 2OR8A 3EBHA 5F72S 1ID2A 3V8CA 3UTTD 4XMTA 1FV1A 1NEUA 4S1DD 3BHBB 3E8UL 4XPFH 2XU9A 3KL0A 3QA3A 3L3KB 4WU5B 5M94B 3BD5A 4WI7A 5IHUH 4AK2A 1XR9A 5E4IA 4AUYA 1A7NL 3IDYB 2V3FA 3MRKB 2PWEA 3D0VA 3QEGL 4HUXA 4Y4HA 5DGRA 1ONQA 4Y1AA 5PCYA 4OM1H 1FO0B 1Z5YD 2B4CL 4MA8L 3BGFB 1BMWA 4PW9A 3TURA 2EXSA 3WLWD 3MR9B 4R7VA 1WAPA 3DX7A 3I9GL 4UIMB 1FL3B 3IXTB 3ZXAC 2N3JA 2P8LB 3KLHD 3V5KB 2ADIA 5DFWH 1LO2L 3BAIA 4XMUA 5INDB 4GBXA 3FUDA 4NUJA 3QCTH 4ZPVB 5IW3A 5TDPB 3KGUA 4EEEA 3NIDF 3GEFA 2EVJA 4MZ2A 5BNXD 1F5WA 1A47A 1NKOA 1TZ8A 3FTYA 1BZ9B 4R84A 5AALA 3AREC 3R0MA 2K9FB 5EOCJ 1OF0A 4HK3N 4YX2H 2RD0A 5HHXL 2AXFA 2QMJA 2XSKA 4IMKA 4DQAA 4C56D 2ZCKH 3DGGB 3LXUX 5T1JA 1MWOA 2QQLL 4WW1B 2UXVA 5HHME 3IJSB 4KKLD 5EO9B 1N4XL 5CBEA 4GSDL 5FYKL 3Q2WA 1UD6A 5TFSL 3ENEA 4ONFL 1U2CA 1ZXQA 5D5MB 4Q9BA 4I89A 1TVBA 2BHFA 2XWTB 6PAZA 5MEND 2BMKB 1H15B 1IE4A 1RK1A 4JO4L 1ACYL 1B3JA 1MFNA 5AVWB 3RGVC 5DVKA 2RCSL 1FNSL 4BELD 1R3KA 3VD1A 3GI8H 3TYFA 5ESVB 2X1WL 1JJUA 1GZPB 2KDGA 4S1RH 3REWA 3CWGA 4ISVB 2CDGA 3EGSB 3MJ7B 4CU8A 1CF8H 2WINA 4ZNEA 3KR3H 2D73A 2DIEA 4G6AC 4LDEB 1U3ZA 5FK9B 2WAHA 2EDEA 2JKNA 4IIQC 2NSQA 1AQ8A 1SNRA 3SKMB 4XVSL 4LCWB 2VYRE 4QNPF 1J11A 5H37G 4L18A 3ABKB 4QRUB 4WO0A 4YLBA 1EUTA 3BDYH 5DK0B 2YQ3A 3L4CA 3MC0A 2VIRB 5BRZB 1P9MA 3C6LD 2OX5A 5D5MF 5C8JA 1JPFB 3HNSH 4JDTL 1A4JA 4GSUA 1GCYA 1M7IA 2XYBA 3D4GA 3QFJE 4BZ1L 3FFOA 3P0YH 2NSXA 1O5DT 3L1OL 5BXFA 1A9VA 5I0WA 1FPTL 1DQLL 4G8GD 4NRYA 2BVUA 3IM1A 5C07B 3EJYC 2BNRB 4IKIA 4MMZA 4NAQA 4AVHA 1D3CA 3CDGB 1PDKB 2VTFA 2EIKB 4NT6B 4E36A 4NRZB 4P3CH 4YWGH 4G6FB 4OCSL 4U7SA 4LEXL 1HDMA 3CHRA 3S8FB 3EFOB 1MCOH 5IB1B 1D5IH 1QR1B 1EXHA 1YC7A 3LEXB 2C9QA 2O5XL 2QQQA 3IGFA 4IIZA 5F9DC 3FQNA 1LP9A 1C1EH 2BHZA 3O45A 3MLXH 4G8EB 3MBWA 3SEPA 1UJ3B 4F7TA 2W60A 5BV7C 1Q1PA 4MWFA 3BEWA 2H8PB 1RY7B 4G9FB 4RZKA 4EXPX 2XZQL 3KWXA 1G0YR 4RFOL 2F8VA 2HJKB 2GABA 3S96A 1WBZA 4Y2LA 1U8QA 2YMTA 4NQVA 2Q3ZA 3FSOA 1IFGA 2D0HA 2Y7QB 4OZHF 4MNQE 3VJ6B 1KCVH 4P5RA 4YXLL 4RGMC 1OE3A 1O6SA 2DBLL 5JYLA 5DJ2A 3DIDA 3VTMA 2D7NA 2UY7A 3NCYP 1SEQL 2HH0H 4NSKA 3UCRA 4CNIA 4TUUA 4L1LA 1I3VA 2MNJB 3QC6X 4UZGA 4JM4H 4U1KB 4PJXB 3CN1A 1G9MH 3PL6B 1HQRB 1Q0YL 1WFOA 2JF1A 3HKZA 2F5AH 3I9AA 5I5IA 4N8VG 5IROA 3NIDE 1G7IB 3B9KA 2FO8A 2YC1A 4EI6A 4DIXA 3TIEA 1I1FB 1ORSA 1UM5H 1U4EA 3ARQA 3ULUD 1P69B 1HNGA 1XGUB 5E9DE 1J12A 3TBCA 3ZL1A 3AXLB 1XZ0B 3H1ZA 3GGWB 3B6SB 5C92A 4PY7A 1E6OL 4XXWC 3P30L 1FVCA 1YMMD 3MLVL 1YEJL 3TC9A 1ZVNA 5LNDA 3P0GB 3L1GA 3ARZA 3MRQB 5I6LA 1ADQA 2Q0ZX 1JGIA 3C8HA 3PHOB 5I6XC 4KVPA 2GTZA 4APXA 4L8BB 3ETTA 1XIWD 2AJZA 1QMUA 1B2YA 5IIEA 5SWQB 4C83A 4U6XB 5D93B 4XXCA 4CN1A 4M8RA 3VD5A 3UTOA 1V3JA 2FX7H 2NOYA 4LAQL 2KMWA 2F58L 2CUHA 4Y5VC 4Y2DD 4ZX3A 4PJAB 1IBGL 2HA1A 3BD3A 4F7PB 2X6VA 2A3TA 2FSEB 2QHRL 1EFXB 3QQ3A 2NY2C 2Q20A 3HZ3A 3QXVA 4B9FA 5FYLL 2I7SA 4ZFOA 3M1BB 3STLB 5D7JA 3W2DL 4XOEA 1I85A 2JNZA 1I7UA 5AOIA 3ZX1A 4GINA 3RY4A 3VRIA 3MRDA 5GRXG 2EC8A 4QNPE 2MOVA 3EH4B 5AOMA 1HE7A 4DVRH 3SHSA 4FLHA 1KJ3H 4HALA 2A77H 5B3NA 4N0UB 2QZ5A 1H3PL 1NUDA 1QQDA 1UOWA 4WSGA 4D9RE 5E00B 1YY8B 1KLUB 3QJOA 3Q6FB 5D5ME 2L8AA 3ZKMC 2ZXEB 4OCLC 1AJ7H 5E8PB 3BWAA 3CBRA 3RKPA 3FO2A 4TUOA 2ARWA 4MKTA 2PYFA 3EJQA 1IBDA 1BFTA 4K7FB 3WJJA 4HPHA 1A02N 3ZKXB 2FAUA 3RTQB 5EF1A 5E6SB 5TPWH 2PCYA 2H2SD 2DQMA 4TTDC 1HQ4A 1WWAX 4F1SA 4HUKB 4KNTA 4HZLB 3LQAH 4J8QA 1QFOA 4PJAF 4PRPB 2RACA 3VFRA 4EN3C 4O2CB 4BYHA 5KBPA 5JIQA 3QO1A 4FNUA 5C97A 1S7XA 2X4UB 1H5BC 3VFPA 4W9LC 4C54A 4UILL 3O9WD 2WLKA 4LCWE 4S10A 1M56B 5D4IA 5DJAB 4RA0C 3K4AA 3UO1L 2ZF9A 4UQIM 3QCVH 4ICWA 3SKUD 2PR9A 1CBVL 4JFFB 2YGOA 2IDTA 4KJQD 4OUUB 3RVTC 3O6MH 2AHIA 3LS5H 5DD1L 3Q7JA 1KGIA 3G6DL 1YECL 3HNVH 1MAJA 2Y1YA 2YPKA 1OP9A 4Z78B 2DLFH 1CZ8L 4OZHE 4HIIB 3V55A 5J13B 4TVSa 1CFNA 2VDPH 4GKZB 1Q0EA 3K1DA 3NJFA 5A2IH 5JW4N 5TJWK 1MHCA 4HHGA 4V11A 3U6RB 1O7SA 4I8DA 1VENA 4FEMA 2EYRB 1O0VA 4PVLA 1MCEA 4JJ5B 1QFWL 4H8VA 4NHCL 3L7EB 1AACA 3TYGH 3CFKB 2P5WD 1CVSC 3BZEA 3CSPA 3O3EB 4WQOA 5AOZA 3HPLA 4PR5B 3AM8A 1LO4H 4MMYB 4L5FL 3G5WA 4KK9D 4B3EA 2XPYA 4GQZA 5T1LA 4XVJH 4OIAA 1XF2B 1EXUB 1N0XH 3FRPB 1F90H 3KPOB 1X7SA 2AAVA 1DO6A 4HG4J 1OGAD 4NC1E 4Y4KD 1D6VL 1JV5A 1V3LA 2YHGA 5MHSD 1DE4B 1PZ5B 2Z8SA 5I1HL 1NICA 1JHKL 1IO4C 1WCBB 3F7PC 2QQNL 5B39B 4KO7A 3FCSB 1S78D 3KEDA 4UNVA 5CEZD 4BZ1A 3IJHA 5GJSL 1JPTL 4GLRI 3QDMB 4HJ0D 5E51A 4L1BA 2AABL 2UZXB 5IM7B 3OKEA 1ZLSH 2W9LA 1F86A 4TULH 2CM6A 4XHJC 3GTVA 4FLOA 2NY4D 1MAML 2VLRA 2XVBA 4HJTA 1V10A 1XT5A 3DRQB 5E03A 1BVOA 5CSGA 3DMMB 1UUNA 3BLKA 4P4KD 3STZA 3B3BA 1Z0MA 2V2XA 5C0NC 4BCZA 3IU3B 5E8NB 5BOZG 1D9KC 3EBGA 4XWGL 1BVNT 4QF1B 4PYGA 1BFSA 1A7QH 2ICES 3HR6A 5T3ZH 1UFUA 2PPCA 5CCKL 1AFVH 1MJUL 2P5PA 1NGYB 3UAJD 1IAIM 4LDLB 4ELMF 5I71C 3CQFA 2J20A 3C60D 1T4KA 5HHPB 3KXFD 2APVA 3MOAH 1XCTB 1Z9NA 4K23H 4U3SB 2AJUL 1A4CA 5EOTB 4H1LB 4E41A 5I8OH 1CPUA 1AYOA 1VESA 5GZND 3MVSA 2VAAB 2AQTA 5EU5B 2WXKA 4P4RA 3FBQA 1TQSA 3LIZL 3SPVA 2KC0A 3U9PL 3JVFC 4M6AA 4A7VA 2P46B 3V4PH 1PFOA 1A9EB 2AQPA 1WAAA 4K8RH 1BEYL 1FNEA 2XN9A 4OCMC 4POUB 4DFIA 1KIUB 2VWEC 2YD0A 5CHNA 3O3AA 1KCUH 1MW1A 2FEJA 2X2YA 1ZEAL 2DM3A 4GSQA 1W0WA 1EJOH 1FI8C 3B9AA 3UPAA 3VFWB 2WXJA 4CJ0A 2VLKE 4PJAE 4K5PA 1QBBA 1BZ8A 2YD3A 4AGLA 4L9LC 5ERWB 2YPLA 4QI3A 4AEIL 2R56L 4S1SL 3BAEH 5AUMB 4DP1X 1ZOXA 4LCVA 4HS6A 5KBNC 1WHPA 3GZOA 4AKOA 4K2UL 4OGAC 2KUTA 1M7UA 4QEGA 4F2EA 2UZYA 4LHUG 1TDQA 3TA3D 4R6UA 1RVFL 4ZOAA 1BM7A 2Y4SA 4W6XB 5BRPA 4QO1B 4N0UE 1MCBA 5CEYB 4EBQH 2OK0L 1W0VB 2Q86A 4F91B 2VN5A 1DLFH 4X5LA 2BH0A 2XTJD 4G1EA 3NJXA 4DP0X 2OXHA 3KLDA 1WEJL 5ECJE 3PXJA 3EYUH 4JPQA 5GRYA 3RWFA 4B97A 2QBWA 4XNXL 2RQ8A 3NZHL 1R24A 4JUTA 2VB5A 3ZL4L 3JZ7A 4XNDA 3VB8A 2L3BA 2QEJA 5I2IA 5CLYA 5BOPA 4YGVA 4IBLT 3U4EA 4MLSA 5L88L 2BOBA 4G80B 4LL1A 3ZJAA 4ELDA 5TE4H 4F8QA 1U8KB 2WQAA 1HKLL 4KXBA 2ESVB 3FQRB 4GT0A 5F6IC 3KLLA 2WJ5A 1TSRA 2PPAA 2GK0A 1J1PL 1WF5A 3LB6D 2DQJH 2BWQA 1MJJB 1SJHA 4J3TA 2OTUA 4OT1H 1ETA1 1LWHA 1N3NA 5ICYB 3F8UB 5HTSA 4YHIA 1U41A 3W0WD 4F57L 3ZBMA 5FGBC 4CC4C 3O3BA 4KDVA 1INQA 2WV3A 4JFFE 4XCCL 1F11A 2WO4A 1NDTA 3C8KB 3NPSB 3PFQA 4KQ4H 4EUPG 2YAFA 1JIBA 4Z3TA 5IEHB 1M6OA 1G7PB 4LSQL 4J6RL 2F54E 3VXSB 3LYRA 4MA3B 1OZTG 4RMVA 1JZ2A 1P2CA 1DDHA 1N59A 4RSVA 4XTRD 1NANH 3F12A 1R5IA 2VUYA 3OPZH 4NNXA 5GXBB 3T1WA 2OQJA 1NL0L 3NCEB 4F20A 4NCDA 1A25A 1J1XL 5F3HB 1YEFL 2V9UA 3A47A 1P84J 4GP8B 4LMQE 4Y5XC 2HT2D 4JLRA 1EAPA 3FU8A 2E9IA 4HKJA 3JYCA 5F9OH 4BXSV 5FO9B 1UQSA 5FYKD 2BNQA 2AERT 1F1AA 1KBWA 3OGOE 3Q8CA 1F4AA 3K72A 4HJ1A 2W9EL 4OD1L 5CCHE 2CKNA 3BVNA 3QO0A 5A1AA 1F4WL 1RZGB 4MX7A 1GL4B 5JORA 3OKYA 3J7HA 1B9ZA 1FHNA 3FB8A 4WNQB 2V5YA 4HF5H 1WWBX 2NXZC 3L5WB 4JG9A 3SE8H 3EXLA 2W1NA 4ELME 2GIXA 3PQYD 4X9BA 4X7FC 1BLNA 2BY0A 3LNGA 4XVUC 2EKSA 2Z92B 4LPVA 1AHWB 4NKDB 3FU5A 4XNQB 3IFLL 1A0QL 1MI5A 1T6WA 3NG5A 4ZZKA 3P77B 1NAMH 2VXQH 3QDME 4APQB 4J4PC 4MCYB 1ZCRA 3HOGA 4LHUD 4YHKH 4IBTA 5BJTA 4X4XB 5C0GB 4PCKA 4PJHA 3MBXH 4JKMA 4ONHB 4HUWA 1GR7A 3QRGL 3CHXA 4JHAL 1FSKC 4UANA 1B4LA 2OMUB 3WENA 1RCYA 1A6TA 1BLIA 2WKLA 3U1SH 4HV8A 1XF3A 2BRRL 1X5FA 5EIIG 1PL3A 2BDNL 4QGTA 5EV7A 2L04A 3N9GL 3LV3B 1HYSC 2P3YA 3FFCB 1JGLL 4ZFGH 5JMOC 2BWDA 2DWEB 5T3XL 3LDBB 1ROCA 1SHWA 3G5XB 2FZ3A 4W70A 3KLAA 5IG7A 5D7IB 1P5VA 1YEEH 2DS4A 4UQDA 1GZHC 4OAWB 4BQ6A 5GGQH 3QUMA 5LXVA 4YIQA 1LXMA 4NO2A 1GPOH 1DQMH 2A4CA 3U4KA 3S7GA 5MERB 2YD8A 4TL4A 3FT2A 1SM3H 3EGDA 1JDDA 2B2XL 4R2GB 1CDGA 2F2HA 2PXYD 2NUPB 3PV7A 4I3SH 2VM3A 4YDIL 3ELQA 4ANKA 1AY1H 4ABVA 2WXOA 3GKZA 1ZT4A 3NZ8A 3QUXB 4U05A 5KVFH 3HW7A 4M5ZL 3C5SA 4NQCB 3D4YA 4YZFF 2HT4C 4UDUB 2C3VA 2HMID 4ODUB 4MA1B 3TBVB 5IQ9B 1RV6X 4M5YL 5TE6L 4CKVX 1PQZB 3EO9L 4LRNL 4Q74A 5TGBB 3VD9A 5ECGA 3FB6B 3QZMA 4NEHB 3PGFH 1BD2B 2BP5M 2OL3A 2H7WA 4RMUA 4XMWA 5BZWA 1Z5LB 2RHEA 4RLDA 4U0RC 2G75B 2VAJA 3MLWL 4YPGA 5DC2A 1KT2B 1I9JL 3ARFB 3D05A 1TO4A 5GGVY 3T1FA 3TBWA 4UTCA 1QSFD 2GCYA 1G9EA 3GMNB 4CC0A 2AJYL 2WXRA 4WW2A 4ABWA 5ALCL 1HEZA 5IW6A 1ESOA 1AXTH 2X41A 3R1GL 1BAFH 1AZUA 3LIZA 4BD4A 3EOAB 2VABA 5DHDA 2PETA 3Q43A 3O11A 2ESVE 1BQHB 1T5KA 1GGCL 5T5FL 4WSKA 2K4AA 3HE7C 4CVXA 4EDXB 2Y36L 4PHXA 1CICA 5DHEA 1NAKH 3ZE0B 4N8PA 5AVYB 4QHNA 1KB5H 4ZFQA 5FHBL 1F45A 1SDDB 2HUHA 2ZOUA 3BAJA 1BFVH 3BPCA 4F2MA 4NKIL 2O6CA 2FWOA 1IT9H 3RDTD 5HYSA 1KC5L 1DJHA 1F3JB 5FOBA 4R4ND 4FZ8H 5EU6B 1DQTA 5T33L 3VWKC 3C08L 1ZAGA 3BVUA 2LQRA 4E9QA 5JXAL 3NCMA 1DQDL 4GI6A 2YGVA 1U33A 3QEUA 5CZVL 3P73A 2FWUA 2UZPA 4LNRA 3UZVB 1N5YL 5EZPA 3EXJA 1M2VB 2ORBL 2V8LA 4PJBB 3Q2CA 3VXSE 3PDOA 4YO0B 5IVXB 4HK0B 4ACPA 4PFEA 4HMDA 3KYNB 4LLWB 5FYLD 2BW5A 4Y7MA 4ADIA 5J57B 2VDPB 3MPCA 8PAZA 1GKOA 5BO1H 5EZLB 5HYJD 4TUJB 1S7UA 3ZPDA 2CO2A 3BVDB 2IDCA 1MJ8L 3KPNB 1DVFC 3HE6A 1WZ1L 1A65A 4NHUB 1YHPA 1D5MB 2R4RL 4WHTB 4YDJB 2WBJB 4D7BA 5B38G 2ERJC 4OM0H 4ZAKB 4HAKA 3S3BB 5C7XL 2I5YH 1AZNA 3QFDB 2MCG1 2XZAL 3BP6B 3VE0A 1IBZA 2P44B 2J7LA 1HHHB 1Y18A 4JFQA 3SSGA 1M05B 4TF4A 3NJIA 3UTSD 5KWYC 2BJMH 1YEIH 2DEXX 1MSPA 3ZU8A 4TYUA 3MJ8A 3RFZC 1Z1WA 3P0VH 2OJZL 3SQBA 2CO7B 4L1DA 1GH7A 4JKKA 4BK4A 1A6ZA 4PJBF 1OOWA 3HPJB 4HXBH 1HCVA 1WGOA 3KYAA 5IVXF 3MCLL 3NTCL 5EUOA 5IHWA 1QBML 5F7EL 3AS1A 2R7EA 4R90L 4XBPB 4DP7X 2CR6A 4LVOC 4YHNB 1I53A 1JHTB 2R2HA 3GXPA 4XPAL 5I74B 4WF7A 3VFMA 3CIAA 2Q9OA 1BF8A 1BZ7A 1LO3L 1E30A 3UYRH 3TWCL 4AUUA 2JMRA 5JIKA 1R3LB 3U0WH 4UM8B 3MXVH 5I19L 1BVKA 3T5WA 1BF2A 4ACTA 4S1QH 4B53A 3HB3D 4OLZH 4ZFZB 3ZTCC 4AIZA 3DSNB 2FO1A 4YZFE 2NSMA 4WUUB 1OARL 4WEBH 5CFAA 3JWDH 3FT3A 1UOVA 3MLZH 4NWTH 5D2NA 3UXFA 3FFCE 1VACA 1DJGA 1W91A 4OCRL 2HJLB 4L29A 1EEYB 2CJUH 2RH0A 3M86A 4OVUA 3QDGD 2UWEA 2PYEE 4HCRH 4P23B 3DIFA 1XGQA 2MNWA 1U8JA 5DEJA 2QADC 4DPAX 3S36H 4FCHA 1AS8A 2Y07L 4OLUL 2DQGL 1N5AA 3GLDA 4PYHA 3REVA 1BJ1H 4KAQL 3WKML 4IKLA 3V5DB 1G7QB 3NSXA 1L5GA 3QZWB 1AO7B 3QEQB 1A64A 3BD4A 3T0DA 4F15B 5HHOA 1NUGA 3WEBA 4CMHB 2N0MA 4WTQA 4IRSD 3KPSA 4LARL 1BVZA 4LVEA 2OPCA 3D0VB 3ZKNC 4Y4HB 2KI6A 4GW1A 3LNDA 5BUPA 6FABH 1JK9A 2D7PA 2QGCA 4HIJA 5GS1C 1S7QA 1LDPL 2VZTA 1WSST 4DKAA 3IKCA 4OZFH 4M62H 3CFNA 3ULVC 4MS8D 5I30L 4X4ME 4KK5C 3ZHFA 3WD5L 4GBXB 3S5YA 2ZSVB 4HSAC 4JFZH 4PS7A 4OB5L 3DXAD 1DJIA 3CMOL 4WUKH 3IDYC 1GJWA 1NIAA 4N86A 1U21A 2CIIA 1SRDA 2VSDA 5CINL 4NQEA 4PRHB 1M3IA 3WIFA 5DJCA 4GH7B 1J48A 3S3PA 3BGFC 3MGAA 1TYRA 4H0IA 2FGWL 1QNIA 2DQHH 1E9PA 3QHZL 4H5SA 4XAKD 5AYTA 1ES0B 3INUH 3VXNB 2WWKO 3WG7B 3ZKQD 2VO8A 2QSTA 3GPSA 4MMXC 5CBEB 2Q8BL 4MGXA 3X17A 1ET5A 2PKDA 3L2NA 2XBDA 4EJ1C 2DQDH 4RX4A 1GIGL 1TVBB 4UM9B 1G7JB 1AR1D 4ZMWA 4OJYA 4XCEB 4G9DB 4GEJA 3CZLA 4EDWL 1R3KB 5HPMA 4OIFA 3TYFB 3IU4H 3PY9A 3H9ZA 3IMWA 5AL0A 3A6CL 4TQEH 5E56A 3REWB 4Z7AA 3TO4B 5EU6E 1U6AH 3D39A 2EDLA 3L9RA 2WAQA 5I1KH 4J28A 5C0FA 3UC0H 1GA2A 4NQDD 5CUSH 2ADGB 3BYYA 4JANB 2MKWA 3D85B 1IEHA 4NNPH 2AK1L 3UBXG 1JRHI 5EC2B 2WBXA 5D96B 1RHFA 3GBNH 4PJBE 1H0DB 5AKRA 2ZIDA 2OTWA 2Z3FA 5IVXE 1ZK5A 3VA6A 3BSHA 2EKJA 2WXQA 4LAJH 1R3JB 2A9BA 5DA0B 2EH8H 3ECQA 4MHHI 3FH8A 3B9EA 2MIZA 2OX5B 3FHAA 1AXSA 2X7LB 1XAKA 1B6UA 3SDDB 1GTNA 1YQ2A 1XF5B 5KVDL 5C6TH 3O6LH 4TLSA 5ENWA 2H26A 5D7LD 1AHKA 1SBSL 2JB5L 2NPLX 4ATWA 3ERXA 2ZJSH 3PF2A 1OTSC 1UXSA 1FVEA 2G9HA 4NZ8A 4I48A 1HE8A 1GAFL 2CLVB 2WLHA 3IXAA 3K6NA 1JZGA 3QG6B 3DTDA 3VGBA 1TETH 3CXFA 4MMZB 2J1WA 2OZ4L 3A3YB 1JWMA 2BOLA 2H3NB 2PCPB 3P3RA 4FHJA 4HEPG 5T5FA 5IF0A 3MMEA 4KUZH 4P99A 1SMDA 5LB1A 1OAYH 4DGYH 4MYPA 5HDOA 3MRIA 5A2AA 3POCA 3P4OA 4UNIA 1N67A 5EOCL 3GUFA 5HI4D 1IAII 3SDCA 4ADGA 5J4MA 1HDMB 2VOTA 1CTNA 3QR2A 4N0YH 1NTDA 1PCSA 3RKDC 1UT1A 2KZ1B 4AL8L 1A1OA 3VFSB 5AG8A 1IKNC 2WCPA 1NBQA 3O45B 3SJVB 3MBWB 3NCFB 1IGCH 4F7TB 2W60B 1UFGA 4BK5A 3UL4A 4EKJA 3GTNA 3O6FA 5MI0B 3S36X 3JT0A 1UT2A 3BEWB 1F00I 4M9PA 4PB9H 3BT2L 1NAMB 4I0PA 3AXIA 1IKFH 1LNUB 4IOFD 2BW4A 3WFEL 3CIQA 5KS9B 3FMGL 3L3JA 5FFOA 5I28A 1S9WA 2L7QA 2QLYA 1XWVA 1SHMA 1A5FH 3BOVA 4NQVB 4QHKJ 3WAKA 3S88L 3NCCB 1FN4A 3DJZA 1UJ3C 1NC4B 1UZGA 2NYYC 2VH5H 4NM8H 3JV5A 5EPMA 1U95B 4ZPTB 3OB0H 2EACA 4XO9A 5DJ2B 3F64A 3IE4A 1WH0A 2UY7B 3ARTA 4WUUE 5FYJH 4CNIB 4GRLC 1BIIA 2BM3A 4M48H 2IQ9H 2EVIA 5EU3A 4EE2A 4M4PA 1YAIA 5FW8A 2MOQA 3D07A 5DHVH 3OF6A 5T1MB 1SJVA 3LKOA 4N0CC 4KUCD 1LEGA 3HJEA 1SY6L 4MSWA 4PPTA 3BVVA 1W2KT 3LKNA 4EI6B 4O4YH 3TIEB 4PS4L 3BI9X 2EQDA 5HVWA 5JPNC 5GS3A 1GC1C 2VSCA 3ARBD 4EQ2A 2VQ1B 3K2UH 5AZ2H 4F8LA 9CGTA 4OFIA 5HD8D 4I85A 5B7MA 1XXFC 3RVVC 5KS9F 3PP3H 5A2JH 1AO7E 3H9SA 3PL6C 3PWVA 4N28A 3ISWA 2ALWA 1FVCB 5KSAB 3BKYL 1S46A 5DURD 5G4NA 2Q10A 1DUYB 1ACCA 1T7XA 5JHDB 3EJZC 2QKIA 4Y8AA 3V4UL 3CSYA 3H4HA 2PR4L 4JY4A 4Y1AE 1IC4L 1CF1A 4XPGL 2GTZB 3BPNB 2JXMB 3QS2A 4XNUL 4CILA 3UZEA 3BUDA 1NJ9A 1ZDSA 3MA7A 4L0YA 1U93B 1KTDA 1KEML 2YD2A 1QACA 3MRCB 5EDSA 3IPEA 1F3DH 5D2LB 5HDQH 1R3IH 2XZCL 3IDXL 3G9AB 4WI8A 4HKBA 4KVCL 5DR5L 4PW3A 1JTTA 2VDNL 1F6AA 2XVGA 1YN6A 2E4FA 4TQ8A 4X6DB 2DQTH 5MENA 1WV7T 1A6WL 4G6KL 3GHEL 3AG2B 1KCRH 4MQXD 4HMEA 4E5XB 1QD0A 1LGVA 4UT6H 5GGUA 4NPYB 3CN2A 2KLRA 2AXWA 3VD4A 3X1NA 4HX1B 4EAEA 2EP6A 5D93C 5AAMC 3EDEA 4FQXD 1XV8A 1I7UB 2D03L 4AYGA 2PPFA 5DSCA 3VRIB 1T0NA 2YIHA 5C0BA 1GOFA 2OL3H 3FCTB 4HISA 4DEUA 1I1YA 5F9JB 3BZ4A 4HH8A 2A6JB 4RAUA 4TN9A 5LGHL 3B34A 4W1TA 5ELIA 2BERA 3QB7C 1G0DA 3K4DA 3UIYA 4J3OH 4K73A 1HT6A 2V5RA 4M7ZB 3B7YA 3VSVA 1A6PA 2VDLL 5C09D 3KPQA 1XGPA 3FO2B 4GKNA 4LEEA 2G60H 4KGJA 5DK3A 1LVEA 2HN7A 2B77A 1KJ2H 3GM8A 1E8ZA 1J05B 1HQ4B 1L9PA 4UAHA 5KN5B 3RU8H 1IVTA 2ICEB 1QRKA 3Q48A 4EIUA 4ZNEE 3QZOA 3VFRB 1IZJA 2HTKC 1E4KA 2VLMD 2FYVA 4AIEA 3QO1B 2APBA 2XWJA 1YNLH 3GMQA 3GHBH 5DD5H 2LLLA 5CKAA 2EIEA 2QSCH 4XBEH 1MREL 1J8HB 1PW3A 5JHLA 1VZGA 3ZKXC 1I9EA 5DJYA 3RTQC 4R7DA 4Z77A 1MPAL 1FE8L 4HLZH 2JQAA 2X9YA 4FQ1L 5C0AD 2V2TA 1CFVL 1DEEA 2NY1B 2IFFL 2F53D 5HY9A 2X4NA 2XV0A 5TF1H 3MUY1 1YDPA 3HLAB 5F7MC 5AW3B 1NKRA 4RGND 1AP2A 2P80A 4ZYKA 2P8PA 2ETWA 4PJDA 1D5BA 3S98A 2DJSA 4PJ5A 2BO0A 2G2PA 1U8PB 2BY3A 2XWCA 3DX8B 4ABUA 5HGHB 4TSBH 2EDOA 3K8MA 4ZUSB 2CUIA 2R2EA 3QQ4A 1TITA 4BIKA 1TQVA 2Y5EA 4I0KA 4AE0A 1GGTA 3B7SA 2ZG3A 5JTWA 1T5WA 1Y1DA 3MGTB 3FSWA 3HPLB 4JGMA 5FR3A 3PGCA 1L0YA 1LK2A 3DETC 3KPTA 4XC3L 1B0RB 1OALA 1H8SA 4PY8J 2EDRA 3WDHA 5J13C 3HS0A 4JFPA 5MEQA 1S7SA 5T1LB 3SE3C 3EYOA 3A67H 2WO3B 2QPSA 3KDMA 4MDRA 1MZZA 2X28A 2VDOH 4P46D 2IF7A 3OAWA 3UP1A 4MCMA 2EEAA 3AU1A 2GPZA 1H3VA 1T2JA 1WISA 2B16A 2F7IA 5KS9E 5SX5K 4JKWA 3DDGA 4M6OH 3QR0A 2WB1A 1HAWA 4BH8A 3ARGA 1EBAA 3O0LA 2DY2A 1DL7L 3R4RA 1FGNH 1R75A 2AI0H 2P28B 3LQZA 1XB6A 4L48A 3TWYA 5EBLA 2OXGA 4YHLH 3X11B 3W57A 2YARA 4XAWH 4C55A 5ID0A 1R5VB 3BIAX 2JIXB 1EJFA 4R5VA 3SO3B 2XI9A 2H6UA 3PV6B 3AS0A 4KVNH 5F1IA 2EICA 3VWJA 4YSEA 5DJZB 1XR8B 4XOAA 4U6YA 3STZB 5IB5B 4K94C 5FA4A 4K3HA 5L7XH 3PS6A 5E2WL 4UINH 5L2KD 4M7LL 3GIVB 4UT9L 5E1GA 3AWFA 3EJJX 4LFHG 1NINA 1IBHA 3PGDA 4MYWB 2YLHA 5GSRA 2GHZA 1WE5A 4P2QA 4QCIA 4ES8A 1KFAH 4O5LL 5LAXB 1QHOA 1DLHA 1ZGLA 2V7NA 2O6FA 1PG7W 3DMMC 2XJKA 3QSKB 5AKSA 1T4KB 4M5SA 4TVPE 5IHBA 4JM2A 2EE3A 4QJ4B 5FB8A 1DZBA 1PSKH 4L3FA 4N9GA 1ZVYA 3T65A 5L4FA 3W39B 5KJRH 1FUNA 1ZE3H 3GMOA 5CJBA 1KGCE 1UD8A 3OXRB 3JTTB 4OIIH 1Z9MA 4X0KA 4AVKA 4Z7NB 4M6ML 3WJLA 1GGBL 4P4RB 1JZEA 1OCOB 5KANG 2HG5A 4ZD3H 2WOYA 5KVFE 3SPVB 3W38A 4AQAA 3HNTH 1WG3A 3QXTA 5IBLD 3CVIL 3Q8EA 4AGNA 2XN9B 4UNTA 1QFPA 2PNDA 4ZTPH 2HTLC 2XQYG 5CHNB 3ETSA 5EU4A 5AENA 2X4OB 4RGOL 1W0WB 3UTZB 3WJMA 3GQFA 1MRFH 3VG9B 3KBEA 1I9IL 3PABB 5D1XA 1MJ7H 1CFTA 4WU7A 3SKJL 4AYFA 3O2WL 4HS6B 15C8H 1SY6A 2IV8A 3HZYA 3VAEA 3K71A 3BUYB 3ULSB 1RK7A 1WC7A 2NXYD 5E8EB 3FB7B 5E7FA 3ATBA 1QUNB 5C0CD 1F8TH 4P2RA 3KPRD 4BH7A 3FQWA 2RTTA 1K85A 4Z7NF 3OKOA 2YFNA 3BQUB 1W9XA 1E28B 1UENA 1JK8B 4G1EB 4KK6C 5JW5B 3NSFA 5HPOA 1KYOK 1R33A 1OPOA 3PWLA 1WAAF 1IQDB 4PLKD 4PUBL 3WSQL 2ZYIA 3BESR 3EYSH 4ZOEA 2VXVH 1QABA 4WO4B 4F93B 2XWXA 2V9RA 3MJ6A 3U4AA 3QRFM 4F8TA 4P9HH 4YDZA 3ARDD 5M7QA 1JZ8A 1MCPL 4PJ8D 4U0QB 4IOIB 4XO3A 5BV7L 1ZWIA 2BZDA 4NP4L 4Z5RA 5L8LB 1C08A 2A9CA 4TSAL 2WLLB 4I1RA 3NN8A 3ZR6A 1S7RB 1SJHB 4BKLA 1N19A 3KVPA 3SBRA 1J8HE 2E86A 4OGYL 1DQVA 1E65A 1N3NB 3TBYA 2AXJA 2E4TA 3I6KA 2ZX5A 3MLRH 3PP4L 3CFMA 4YHIB 5ITBH 3QXUA 2DQFB 5D8JL 3AGVA 4JO2H 3CFEA 2BHYA 3MROB 4UU9A 3O3BB 3BUIA 4PI0A 5I73B 2FRGP 4P5TD 4RIRB 4FA8A 2H3XC 1IIIA 2OMNA 1OAJA 4V1DB 1BMZA 4LFHD 4F80A 3Q1SH 3FN0H 3E80A 4N3TA 2GB2A 4Y1SA 1RLBA 3Q5OA 3QQ9C 5I18L 1ZV9A 4OCWH 4Z3IA 1PLBA 1JRHL 1O9ZA 5JW4Q 2DMKA 1N59B 5CWSB 3LZFH 2VR8A 3F12B 5FIEA 4RRPM 1R5IB 1R47A 4ZO9A 4EOWH 4NNXB 1PLGH 1OGAA 5C08B 1K6QL 4TOYH 1A9BB 1NGPL 3ES6A 2VKXA 4ORGB 2VW6A 4GP5B 1IB5A 1DFBH 5D70H 4F37K 3NPSC 5AVZB 2JKTM 3EJSA 4HA1A 5TD4A 4RQQA 2OM5A 1K4DA 3ZE2B 4NZTH 2NNCA 3JV4A 4GRMA 1UQSB 2APWA 3OG6B 2BNQB 4FYTA 3DO7A 4H44C 3SPIA 1HIMH 2XWEA 4FTDA 4NLHA 4PTUA 4PJ7B 5JORB 3PHSA 2PO6A 2AK4B 4P4KA 1A2YA 3FB8B 4YEFA 3V0WL 3S8WA 4LSRL 2AQQA 1M3JA 3C6SA 2MH4A 5BVPH 2DV6A 1TTBA 1TOXA 1IAIL 4ZUTA 2PW1A 2C9SA 4N1EA 3VXMD 3T8XA 1AZCA 1DZ0A 1I1AB 1RK0A 4QLRA 3CC5B 1KCSL 4WJ5A 2KZBA 1S5HB 2WNGA 3H85A 5IBTH 3UAFA 3X1GA 4ZODA 1N64L 3K6IA 2IDUA 4X6CA 3ZYJA 4X6FA 4YS4A 3VGFA 3NIGF 1WFIA 2IXQA 2VLRE 4KJYA 4MAYB 1HHKA 2JVUA 1ODAA 2X2JA 1AHWC 1QRND 2G3XA 4FP8L 3UIZA 5DHVB 4CSSA 3UJJH 2Y3AA 1IGYB 5SV4A 2E47A 2ADJA 1IAKA 1W8EA 1S7VA 3VM7A 2CDEB 4G42B 2BOCA 4NXKA 4XP4L 4GXUM 3WFZA 1MF2L 2AEQH 4MJIA 3WUWA 2GC7C 3O81A 2CGRH 2F5BL 3EOTL