3AQDA

Unliganded trap
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
69
structure length
66
Chain Sequence
SDFVVIKALEDGVNVIGLTRTRFHHSEKLDKGEVLIAQFTEHTSAIKVRGKAYIQTRHGVIESEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allostery in TRAP
rcsb
source organism Bacillus stearothermophilus
molecule tags Rna binding protein
molecule keywords Transcription attenuation protein mtrB
total genus 10
structure length 66
sequence length 69
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V
ec nomenclature
pdb deposition date 2010-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02081 TrpBP Tryptophan RNA-binding attenuator protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.50 Mainly Beta Sandwich Immunoglobulin-like TRAP-like 3aqdA00
5EF3A 5EEUA 1GTNA 2ZD0A 4B27A 5EF0A 1UTDA 1QAWA 3ZZSA 3ZTEA 1GTFA 5EEZA 3ZZQA 3ZZLA 5EEWA 5EEVA 5EF2A 2EXSA 2ZP9A 1WAPA 5EEXA 5EEYA 2EXTA 3AQDA 2ZCZA 2ZP8A 5EF1A 1C9SA
chains in the Genus database with same CATH superfamily
2O5ZL 5FGBA 5GZOD 5FYJU 3SPJA 2E46A 3APNA 5KYYB 2GBVA 3N9GL 5D4JA 4MBRA 4YHOL 4U6HB 5ABZA 2W0FA 2EIDA 5DVMA 1KCWA 1IRAY 3ARFB 1WZKA 2CHXA 5DT1L 3CFKB 5ICYB 3OG4B 4KHXH 1Z0NA 3OAYK 3O9WC 5FYKL 1MFAH 3NN8B 3WD5L 1NCOA 1JZGA 2Y7MA 3ZE2E 4H26A 3HS9A 3KPSB 1KGCD 2W9LA 1YEEL 3CX5J 4A38A 4GP8B 5AYUH 4NOFA 4B9GA 3QWQB 1NM4A 2A77L 3T3MF 1MWAL 3QUXD 9PCYA 3QIBB 2PN5A 3KS0J 1E7VA 1GKOA 3BP7B 4JMXA 5GQBA 2LLNA 5IB5A 1I8UA 2VDRH 5A3ID 3HNVL 4NQUA 4H88L 5JUEL 3NIFF 2HJLA 4U1SA 2NY3D 5HDBB 3MLSL 2VXQA 3RZCB 1N4XH 3HMXH 4POZD 1GGCL 2V7NA 3V6OA 1NC4B 4ENED 2XG5A 1H6EA 3UP6A 3QNFA 3ECBA 3F12B 1P6FA 4U1MA 3OLEA 3NP4A 4C4KT 5ACZA 2FDBP 1GZQA 4U6YA 2GABA 4P5TA 1A6PA 3MNZB 2LVEA 3FRUB 3D4GA 2E5EA 1CLOH 4HISA 3DOIA 3QUKA 3SJVD 3S5LB 1GGBH 1S78C 1G6RL 3CHRA 4OVVA 5B7FA 4KVNL 3CE1A 1WISA 4GXFA 4JRXD 3L5WB 4PRHE 4UTBL 4I88A 5D1XC 2YRZA 3LMJL 3IDMA 1UXLA 5B8CC 5I6XB 4OZFG 1M3IA 3EYUH 3P0YH 2MCAA 2EYSA 1N10A 2EIEA 2X0WA 2ZYRA 3QIUA 3T4AB 1X5MA 1OAKH 2W1NA 4X80L 4MAYD 1CDIA 1U8IB 5DWUH 4G7VL 1R3KA 5C08B 2OAAA 2YEZA 1ACYH 3D06A 4PJCE 2Q3ZA 1EJ6A 4Z0XB 3MV9E 3NDZE 4JFDB 2XI9A 2R69L 4S1DD 1DLFL 3D0LB 1QTSA 4IRJC 5HY9B 5MENA 25C8L 4BXVA 1PW3A 5EOQL 1O7DE 1Q1JL 4ZK8A 2K78A 3INOA 3Q8EA 5C07B 5KN5B 2WO2B 2R0WL 5I30L 2ETWA 2MQ3A 5DJDA 1MCCA 1SEBA 4M62H 4G8IB 1RZ8A 2VWEE 3D51A 1N8ZB 1OZTG 1QO3B 2R4RL 4PCYA 4MX7B 3DDFA 3TCLA 2GUOA 4RFOH 4ZFOL 4HUCA 3ZR6A 3STZA 3IS0X 3BAXA 5DWPA 2E9WA 1TJIH 3K6DA 4B3EA 1PD6A 5AZUA 3EO9H 1LO3L 3KL5A 2CAKA 3WXVH 5FOJA 4OZIB 3V4UL 4PJ8A 4QHMA 4URKA 4L5FE 2I9TA 4FL4C 1JNHA 1T2XA 2CBTA 1D6VL 1WITA 3HI6H 3EYVB 3IJSB 4MB5A 5DZJA 2VDPB 1B88A 5E95B 3WE6A 5ITBH 2VLJB 4P2OD 3AITA 3FAXA 5CN2A 3VGDA 4GNKB 5EBWB 2ZWSA 2R69A 4LBEA 3F2LA 1UB5A 4IU2A 1FL3B 3LD8C 1UGNA 3ETTA 5HI4D 3TH3T 5GJTH 5DRXA 4GO9A 4NPJA 2ADFL 1AE6L 1T2QL 4FQHA 1KB5A 2FZ3B 4U1GC 5AZ2L 2DBLL 4QEGA 5HVFB 2QJDA 2ATKB 3MLYH 1UD4A 4BHUA 1C08A 4WTZA 3R1GH 2HFEA 1SN2A 4YSPA 1LL1A 3BVDB 3JTTB 5IB4B 1FZKB 2HJFB 4P59L 3QW9A 5FUOL 4ES8A 3P4LA 2XA3A 1V7ML 4V2BA 2XJKA 2PABA 1QG3A 3LPGA 3L3KB 4HYTB 1KENH 4AX3A 2AHIA 1Q9LB 4TYUA 3ML8A 3INUL 4LXFA 1HYRC 3LAFA 4HS8L 4NC2B 1E27A 3QAQA 4LASL 4UIMA 4AQ1C 3NEEA 3O81A 2A6JB 2I5YL 4N0UA 1OP3H 4HK3J 4YAQA 3PWVA 1AR1B 1PLGH 5HYJE 1HL4A 4N6RA 4NNXB 4U49A 5I74C 5E8EA 1VESA 3BUPA 3M8OH 4BE5A 4Y2DB 3IXAB 5FWRA 5GGRA 4G43A 3CFEA 4XE5B 4AM0B 4N2EA 4HXBL 1VPOH 2BNRB 1CI5A 1KYOK 4YHLL 2WLMA 4H8PA 3QUYA 1YC8A 1R5IB 3VD4A 4MFHA 3N2JA 1Z5LA 1R0AL 4U31A 2V2WA 3JXAA 4BH8A 4ENZA 1BYPA 3OSKA 4LEXH 2MFNA 3ARXA 4FG0A 5INDA 3FTGA 1E6JH 4ZS7L 4ZZFA 4V2CB 1DBKL 1VF5C 2EXSA 4XP5H 2ZKWA 3QA3B 4LB8A 4BWUA 3VVWA 3ZDXB 3QZBA 2BW5A 2X88A 3MACL 4F7PB 1B2YA 1CXIA 1OT2A 2CHWA 3P9LA 2J1ZA 1ILUA 2BWQA 5FDWB 4AW4A 4P3DB 4OF5A 3WFDH 1S9VA 2FSDA 1V55B 3B9DA 3EDKA 1OAJA 3OPZL 3S4SA 1I3UA 3K91A 4PJFE 4JO2L 1NPJA 2FWUA 4RAVA 5IBTH 3CFQA 5IROA 3CUPB 1FFPB 1TNMA 4HC1A 2IALA 4MA8H 1GZQB 4ZMVA 1Z3GL 3JWNC 1CG9A 5C09D 1SGKA 3N1MC 3LPPA 4IU3B 1JGEA 1URLA 2SEBA 5GSRA 4JVUA 5HGAB 5I8KH 3QIBC 1I1YB 3EDJA 3V79C 1SN0A 2VR8A 2FJFB 3N04A 2DWEA 4J2QA 5KSUA 2W60B 3FMGL 4AUJA 5IKCB 4L4TD 2FGZA 4L4TB 1RPQA 3HMWH 4X5WA 4YHMH 1CXFA 2WXOA 4XCCH 5GGSY 4LQ1A 3MHZA 4WI0A 1SXSA 4FLQA 3IRPX 5D1XD 1V3MA 3ZUCA 5I75B 2TRYA 1Z6JT 3UADA 1I1AC 1K8DB 3L3GB 4FC3E 2IGLA 1OAUH 3DX8A 3LQMA 4M5TA 5IK3B 3TO2B 3QUZC 3RWJA 2NY6C 2V17H 1IBDA 2BXYA 3CQFA 5JR1L 1T3FA 5I17B 1YUKB 5AVUB 1AS7A 3BH4A 1CBJA 1NGXB 4FYSA 4YSRA 3OM3B 4EI5D 4QXGH 1SJEA 1VEPA 2L7QA 3UTQB 3KGTA 4NQCE 2ZKYA 1KGCE 1WPCA 2XPYA 3QUGA 3PHQA 4HEPA 1LLAA 3GZOA 1ZHBA 5EUKA 3QSKB 5IVZB 4NCC1 4Z7NB 2BS9A 4LK4A 3MNVA 2E7CA 3JV6B 3GMMB 3DVNB 5D4QA 2BHZA 5AB0A 1HCVA 4HUUA 1IM9B 3BPLB 3GBNH 1QFWM 4JKNA 1EMTH 4HJTA 2YS4A 3RVWC 4G8FB 5DUBB 1FG2B 4AMKL 1MI5B 4X4XA 4TVSa 4Z7OE 2VN6A 1FNAA 4PJ7F 2MNUA 4DW2L 3G5ZA 1NCIA 2G5UA 4LRIA 2ICWJ 2LLGA 4U1LB 1RUAH 3C60B 3ESVF 1E4XH 3LN5B 3GXUB 2QTEA 3N42F 3T3PF 3PIQB 4XGZB 3U0PA 1AOHA 4DN4H 1ACCA 2J20A 4YR6A 2ARJQ 4PHXA 3AJ7A 5I1IH 2E75C 3WHE0 5KZCB 1FAIH 3SJVB 1FBIH 3NABL 2AQTA 3JVGA 4R84A 2OXGA 5AOJA 2BSDA 4YX2L 1N64H 4JG0L 1Z3RA 4Y8AA 5E94B 4I2XE 4NZUH 4OFDA 5DD3L 3LHPL 3BE1L 4NO0A 4P07A 4ZMWA 2D2CC 3FTSA 4IK7A 4PJ9C 3I9PA 3NZ8B 4LSTL 2ZOWA 4HVBA 5J1TC 2FSEB 1CFTB 3JVGC 1FE8L 1IAMA 3HLAB 2VLME 4DKFH 3GMRA 1GYCA 5ESQA 1YSOA 2KL6A 4UIMB 1E0OB 4JJHA 1ITCA 1G9MH 2K6WA 4WUKL 1KGYE 5EO0B 1C8QA 2AXGA 3IKCA 3VSTA 4ANKA 1JWMA 2VZVA 1Y18A 4FHKA 4NZTL 3TBCA 1ODAA 3HI5H 2D3NA 3H4FA 1J9TA 2X7LB 4KXDA 4XO5A 1WFTA 5KBNC 1PD0A 5F6HI 2PCFA 3FB8B 2V5MA 1DQQA 3BEVB 2F19H 2MQGA 4WHYG 1D5IH 3CVHL 3DOSA 4UF7C 3E1ZA 2H47C 1KIRA 3VXOA 1CL7I 3BDXA 7CGTA 5I1AB 3BAJA 4QF1A 2QPFA 1Q72L 3FCTB 5CEZD 1NLDL 1S9KC 3WLBA 3FSOA 3L13A 3L9RB 5HHQB 2VGLM 4K3EH 5K59F 3W9EA 1ZXQA 2WXNA 3VM7A 3Q13A 2H1LM 2GBTA 2YFOA 2CWRA 2YJQA 3LNGA 3B7UX 3QJTB 2VDKL 3KPMA 3QO0A 4MMYA 2Z0BA 4KGLA 1H3PH 4WFFE 5E00A 2ILLA 3D2UA 1GHFL 4ALAH 2WLHA 1M7XA 5FC9A 2APXA 1YUHB 2AABH 1NGWB 2WSPA 2MCPL 2JKLA 4ODXB 2VM4A 2H2SC 1HDMB 2FVNA 4N68A 5IHWA 4K7PH 2NR6C 1B0RB 2XWRA 2EO1A 1MCNA 1QHPA 2COVD 2EILB 2F53B 3P54A 4BSWA 1OE2A 5HDQH 3PV6A 5I8OH 2DTSA 2IQAB 4N2AA 4M6MH 1KEGL 1VSCA 1Z5HA 1HL5A 3NJLA 3RE0A 1T7WA 4R4FH 4PLJD 3X3FH 2O4EA 1E65A 4NP4H 4B60A 4BQ6A 3FT2B 4L4TA 2DL9A 5DVPA 5FB8B 3F58L 2WTRB 3PPEA 3KWWA 1THCA 4L8SB 4R7DA 5HI3D 1HWHB 1C7SA 1XGTA 4X9IA 3ARQA 3ZE0E 1ZSDA 4NYLA 1P5UB 3QORD 5HDWA 3O2VL 1NBZA 4PY7B 2NY3B 1IGTA 1YEIL 1IJNA 4F3FB 2IXQB 1PZBA 3BN9C 4R4BB 4MAUL 2K7PA 4XCNB 1I8MB 3WS3B 3HG1B 1SY6H 3IMVA 5C7XL 1BD2E 1OE3A 3A6BL 5M94B 4HFWB 4Z95H 5FYKH 4S1RH 1F4YH 1IC4H 4MA7H 3T0WA 3OC5A 4D2NA 4XMLL 1QD0A 2FX9L 3UIYA 4JFFA 1PJ9A 3KLLA 1RIUL 1MH5A 1OGAA 4P3DA 2BXZA 1S9VB 4H1LB 4Y9BA 5C1MB 3FTWA 1JOIA 4DPCX 4LEEA 4ZO8A 4JRXB 2PP9A 1F8TH 3BUQA 1AQMA 4HZLB 1HZHH 4OZ4B 3GXNA 5AAPA 2MTAA 4M7JL 3QIWC 3DTXB 2ADIA 5FWQA 1YN7B 3DBXA 3EHBC 1MAKA 3N40F 1DN2A 3QUZA 3HA0A 4Y1AE 1YNKH 2YD2A 4PVBA 2CO1A 1QLEL 5DVKA 3MLSH 1VA9A 3U2IA 2ZUVA 1T0MB 3QJUB 1PDKB 3LQZA 3QXVA 2LE9A 4JPKH 2OXHB 2VYRE 3O0RL 3IFPA 4X7SH 2O5NA 2EXYC 3D30A 2XPZA 4XNXH 5IQ7H 2G3XA 1T04B 4RMTA 1JZEA 2YEQA 3ZZLA 2W65B 3VX0A 2QFRA 3RWCA 3U46B 3RWIB 4F8OA 1XMEB 1PJWA 2XQYK 4MXWH 1Q0YH 3SOBL 1CDCA 1S7QA 5TDOA 1WICA 4F9LA 5I9QC 1WT5C 5KYNA 4D7PA 1M9WA 1QVOB 3NFSH 4A04A 1IGIL 5A6LA 4XO4A 3ARTA 2NY2C 1XIWB 4OFKA 3UAJC 1EHKB 2EDJA 5KANG 1CR9L 2OMVA 2RQEA 4EIGB 3EGXB 3POCA 5DR5L 3MNWA 2ZOOA 1JXGA 4AQ8A 1N3NA 2EXWD 4KO7A 5GS1B 3Q8BA 2Z4TA 3THMH 3NACH 1EZSA 1TSRA 4W9HC 4XMUA 1MFCL 1G4RA 2XG5B 2MQCA 2V5SA 3SQBA 3Q6GL 5BOPA 2X10A 2NR6A 4HLZG 1RXLA 3LN4B 3C9NA 1LE5B 2XSKA 4IBVA 4ZYKA 4HBCL 1P7QB 1RK1A 1PY0A 3P0GB 2AK4E 4MJIB 3VXSE 2R69H 5IOKA 3FRUA 3ULUL 3QHFH 1DLFH 2BWIA 4G80B 1GRWA 2Y1VA 3QPQD 43CAA 3WUZA 1TETL 4FLRA 3QZOA 5C0JB 4TSCH 4B41A 2DLGA 5AUMA 5EF0A 5AVSB 1T6BX 1BLIA 5F88A 4F37F 3JTSA 1CGWA 2HG5A 4PGBB 2CK0L 4BZ2A 2YWZA 5IHZA 4X0NA 1H19A 3D12B 2VXUL 3QWRD 3FB5B 3RVTC 1RZKC 2QVTA 4FNTA 3PDGA 5CSZB 2NY5H 5DGQA 2WBJD 3NJNA 3S8FB 4GBXC 3P02A 3ZX1A 2RD0A 4BFBD 1L0XA 1R3HB 2YAEA 2YAPA 3GKWL 2NY4B 1NCNA 3GBLA 1KOAA 3S97C 5AG8A 1B4TA 1IQWL 3GMQA 4HH9A 4X9YA 1RK7A 4DPAX 4YSQA 4FNLH 4ZTEA 3SGKA 4YPGA 2Z35B 1JHLL 1WS7A 1FQ9C 4KKCC 3HI6L 2OP4L 3DMMC 1THAA 3TIDB 2G9HB 5IM7A 3H2QA 2AK1L 4OQTL 4CDHA 3B9AA 5SWZA 5EFIA 3TT1L 4ACTA 3KPMB 4ELKB 4OZHF 3D4CA 4HU8A 2AF2A 3SPIA 4A7GA 1RUPL 1BF2A 1WP6A 3MJ6A 4ZFGL 4NO0B 4CKQA 3A6CH 3M45A 2HZHA 3BZFB 3SE4A 8FABB 4P04A 3CZEA 2DBLH 1G5GA 1WFIA 5BXFA 2J6EH 2QV4A 1AD0A 1ET8A 5JZ7D 4APQB 4K5NA 1W16A 3IU4H 4LIQH 5HXMA 4TTGA 1F4AA 2EEXA 3O8XA 1S5HA 4XNAA 4N5EC 4X6DB 1W9XA 2CJUH 5B1AB 3MRFA 2OCCB 2V6HA 2R1XA 5FYKU 1K9TA 1V3JA 4QHMB 5CUSL 5C0BD 4U1GB 1E3ZA 1UZ6E 4Z7WE 3V6OE 4XMTA 4OF0A 3ARDA 1QI3A 3N9GH 2YQ3A 5JPNA 4S1QL 3TASA 2WN3A 2Y9RT 1EIBA 2W59A 5FYKE 1MFEH 3EOTH 4KROD 4FQQB 4NENB 1NA8A 3RU8L 3TPUB 1DQQB 4KHTH 3EJYD 5GGQL 3WTTA 1HJBC 3R8BB 2D7TL 3WNNA 4HJ0C 3Q43A 1QFWL 2FATH 2ZG3A 3WEMA 5DRXB 4CADB 3WFHA 4FI8A 2AP2A 4QF1B 1ET7A 4K4KA 5FLVA 4X8JA 4RGND 2DYPA 4DZBA 1KXVC 1EEUA 3QQNA 1T22A 1T66D 3ZDYB 5C86A 5E4EC 2YK1L 4H0LC 2W9EL 5AW3B 3L4XA 5PCYA 4KQ4H 3OMAB 2BIOA 1Q94B 1I9JL 3QK0A 4R3SA 1PCXA 2VDLH 2C4FU 4MJJA 3RUGE 4I0PC 1J88A 4A1RA 2HTKD 1TFPA 2Y0SA 4C59B 3NGBC 4RDBA 5GJSH 2CLRA 2VDOL 1UFGA 5IBLD 5EOCL 2ZXCA 2YPLD 4R96A 4DQOH 3O2DL 5CR1A 1CTOA 1UKTA 4HZLA 2OMZA 4OZ4A 4M43L 3ZQXA 4F37K 1URZA 2Z0UA 5KBMA 4R7NB 5CU5A 2ZQKA 3MOAL 1X7SA 1KJ2B 3QZWB 4ODXA 4AV4A 3N0PB 2AMGA 2UWEE 3U79A 5IT2H 1UOKA 3Q2NA 1MW0A 3N5AA 3ZLQC 1DVFC 1RUKL 1ZVHA 2VLKA 2OK0L 4JO2H 2KZWA 2WAQA 4MA3A 2Z8SA 1A7PL 4X99B 4YBQD 3QRLA 3QEUA 1F4WL 1GVIA 1WZAA 2NXZD 2PO6A 4R7XA 1HH6A 1T20A 4JLRB 1U3HC 3T8MA 1EA9C 2OMYA 4B53A 5DJ2A 3TYGL 3LMJH 5C0BA 3RWIA 3ZTEA 2VUYA 4UB0H 4UU9A 2OL3H 1AYRA 2P24A 1FLRH 3A22A 3I9IA 4KDTA 1XGTB 5EULV 3MRHB 3O8XD 2X4PB 1CXEA 5ICXB 1IEAB 2JTYA 3ETBJ 1R34A 1K72A 5IFAL 3DV6B 3RJOA 1SOQA 4X9FA 3QC6X 1BW8A 2ZOTA 1G7LA 2CDEA 3NJXA 2Z1PA 3R4DA 2BINA 3HPLB 4S1DC 2GTWB 4WF7A 1UASA 4CSTA 3PFQA 5D96C 4RFEB 4D8PB 1EERB 5FO8B 2X4UA 3KZ8A 5I6LA 2WQUA 1GGYA 4KXBA 3CBKB 4BZ1L 2DYPD 3TEWA 1J9RA 3U9PH 2Q1EA 1S7XB 1CICB 2HFFA 2O61B 2FRGP 5EOQH 3SQBB 2DQJL 3QUXC 3AXLB 4RQQB 5D7JB 2QADB 4H1LA 1DUZA 3SPVA 3CDGB 2IC2A 1SDDA 3IB4A 3MLUH 4PB0H 3HZVA 1OZUA 3ENEA 4KK6C 4ZYKB 3TOPA 5JOPD 4Y4KA 3KPRD 2E0PA 4KI5C 4ECNA 1KELL 2WK2A 3BOVA 2A9BA 1NM9A 3DX1A 3ZE1B 1NAMH 3F7QA 4Y1TA 1KMGA 2H3NB 4FYTA 4LHUG 2BSTB 4V1DE 2K8QA 2X87A 5F7KC 3SE8L 4KXZI 5FLUA 4IDJL 1ZXKA 5B3SB 3FULA 4HAKA 5DK2B 5K9OA 5AW8B 1W0YT 4X6FA 5T5FL 3VUAA 2DQEL 2A74C 5DHEA 1S4IA 3FB5A 2R29A 4M61A 4XZ4A 4NERA 1PZ2A 5D6CA 1MCHA 2P8PA 1CFNA 3DJRA 2ITDA 3PWLB 1ZLWK 2FGWH 2XRAL 3GSUB 5D1XA 3K8LA 1S9YA 2AJZA 4L8BA 1IGFH 2ZNWA 3AMKA 3VI4A 4U3SB 3KM1A 4V11A 5A2LH 3TEXA 1U2CA 3OKEB 5I6KA 1WVZA 5DC0A 3RWJB 1PAMA 1QEWA 4L8DA 3KG5A 4W9FC 5DYOB 3MRJB 3KPPB 4FFWD 4WSGA 3HAEB 4PP2B 3I6SA 2YFNA 5AZ2H 2IANE 1HIMH 1N18A 4LIQE 3MODL 4X8GA 1TLKA 3HBQA 4F8NA 3FQRA 4LCIL 2X12A 4UM9D 3RL2B 2NXYB 5EZLA 2L7JA 1DVFA 1CTNA 1G84A 3BZFA 1X4ZA 2J57A 5K1JA 4NQCB 3PJNA 3CHOA 4XVJL 1L7TH 2BVEA 5E24E 1P7QA 1RK1B 2G5RA 2LOEA 3V0FA 1HTYA 4MQ7A 3CX2A 3P73A 1AXSB 1HHJB 4O2EB 3GXFA 5GIRA 3ZK0A 5D7HA 2OSLA 2YXVA 3G6JF 3LH9A 2WMPB 2AKRB 3LKSA 2I5YH 2E7LA 4E0RA 1BMGA 4ANUA 2ZWYA 3BH8B 4QAWA 2R0KL 1JZHA 2NY5C 1JFHA 1JPTL 4L4VE 1E67A 1S8DB 5HYIA 4OFYA 2DW5A 3RNKB 1KGWA 1AY1L 3FN0H 4Q6YA 4Q9QL 3LRLA 4HKBB 4PJIB 5F6HJ 3WIHL 4HXAH 4DKFL 4FJZA 5FCSH 3C60A 5FV2A 3EIFA 1OP3K 1FFOA 5FA4B 2MH4A 4IGBB 4JFXA 3WSQL 1ZGLB 2YD0A 3AGVA 2R2EB 4MVBD 3U0PB 3G6JA 3ZTCC 1G9ML 5DZ9A 1B90A 2NZIA 4DGIL 2RTTA 1L7IH 3VFNA 3D39E 4WO4A 3Q44A 2H8PB 3Q3GA 4Q6IB 4ZUUB 4Y9CA 4AZUA 3EGDA 4U6HA 3C6SA 1DUYA 1RIHH 2AMUA 1Y0LB 2CRMA 4W68A 4BCZA 1IM3D 3ASNB 2VXVH 5E6SB 3SGDI 1T4KB 5CN3A 2CKNA 3BGMA 3VJ6B 1X7QB 4HHAA 5KANI 2G9HA 5IM7B 1D5BA 4NKDB 4JFFD 4BZYA 2R39A 3VRLF 4QHPA 3RZWA 2IBGA 3ECUA 3A21A 4G8EB 1N5AA 2A1WH 3MZTA 5IMKB 3BP7A 4ZUWA 4IQHA 4GG8A 4YSSA 2Z93B 4I48B 1BBDH 1JGUL 3LDBC 1RJCA 1HXYA 4H1LH 3W57A 2QHRH 2AV1A 4LCUB 2Q20A 5KS9A 4PJIE 1Y18B 4ZSOE 1H3PL 1KGUA 3WEOA 3SYPA 1P9MC 1OQXA 4BRJA 4DQAA 1A7BA 1S9XA 1HL8A 4YHYC 1IE5A 2IAMC 4ZTPL 1QP1A 1ID2A 1NCAL 4LNRB 4NJAH 4L8CA 4PV9B 2G5BB 4OLWH 4CW1A 4KZDH 4JPVL 5D8JL 4DZ8B 3UTTB 3GDCA 2EYTB 3BFOA 4ZFQA 5KSAA 1J10A 1SBSL 3G9VA 4Y2LA 1A0QH 3H85A 3BJLA 2AI0H 2A77H 3MJ7A 4UT7L 3MV7A 3VM5A 3D85B 2P8LB 2PR4H 3L4YA 1A1MA 1T0NA 1RVFH 2Y06L 1MFDH 2O5XL 2UY6A 4R4FL 4HDIA 3NDYE 5D7KE 3V5DB 3SYQA 3NH7L 1LO0H 4XP6L 2J25A 2VDRL 3MRRA 2HJKB 3HNVH 3F58H 5FOBA 3BX7C 1MW2A 2WIIA 2ICEB 3OBAA 1L9RA 3H7BB 2D03L 4V1DA 4D9RE 3D2UB 3D2UD 2CGYA 3WFZA 2CSPA 2E9GA 4AYGA 5A6MA 1ULVA 1G9HA 5D9SB 2YPLA 3PAVA 2JNZA 3QR0A 1UHVA 1QUPA 2X0VA 5LBSH 5MHSD 4F93B 1OF0A 3LKRA 4S1RL 4RZCA 1KBGH 4GKNA 1IZJA 1H15B 3WKPA 4X2UA 3MRKA 1Q0XL 3PV6B 4XN8A 5I16A 3VO0A 4A7UA 5JTWA 3HIZA 3KMDA 3LKPB 4PV8A 4S0TD 4XBGA 4XXCA 5LCVL 1DQML 4GMSH 1XEDA 4TVPL 4JO5A 5K33A 2NUTA 3P4OA 5E2WL 2H7WA 5IW6A 2XIDA 1KTLB 3QWOB 2QSTA 1M1SA 5FDYA 5DMKB 2XWEA 4QRPB 4TUKL 1KLFB 1LDPH 3NP3A 1Z9LA 4G5ZL 2B1HH 2J1XA 5CP7B 2VLRA 2P8PB 2Y72A 4ZUVB 2BMKA 1I9RH 2YZ1A 1TTBA 4ONFL 2V3DA 2A73B 1XCTB 4QRRE 1FYHB 1NIEA 1QBMH 2Q2EB 3QIBD 1JHTB 4AVJA 2I32A 3X2QB 3EO0B 1YPZE 3TBTA 1MCPH 1IEAA 1NPUA 4X7SL 3TTYA 3WIIL 2HLAB 1Z0MA 1FPTH 5AALA 3PYCA 4IBTA 3JWNH 2HLFC 2Y7SA 1FAIL 4X4ME 4EIBA 2HN7B 4C4UA 3ILEA 3NABH 1E9PB 1Q1JH 4PD4J 1COBA 3ULVF 5LG6A 4ANVA 2F58H 2HJLB 3A47A 1UWYA 4DSYA 3FCGA 4L4JA 5SWZD 4TUJA 5IVXA 5JHDB 3RVXD 1GC1H 2WC7A 5I30H 1IGML 5L0QB 3GGWB 4FQLL 3BPNB 4RQQA 4M7LT 1V3LA 2R4RH 3UTSA 2IQ9L 1MCFA 1GIGL 1T1XB 3I6LE 1QI4A 3V9CA 4NZJA 1Z2KA 4MQ7B 4EXKA 1BF8A 2Y23A 3L95B 4BK5A 4EQ3A 1IM3B 3QUKB 4QTIL 2X4TB 3EH4B 1LO3H 3ZO9A 5IV2A 2WTOA 3AADB 3MRDA 1A6ZB 2WLIB 4KX7A 1YY8A 4QRRD 1BM3H 5FFOA 4P4KC 4G83A 3OKMB 4R0LC 3SJVE 1IEBB 5I0DA 2A4CA 4UTBA 1M4KA 5DRNA 1N7ML 3SDDB 4X6FB 3MQIA 3I3EA 4IGBA 2R29L 4DF9A 1IIIA 2WBJA 3ULUE 2EYSB 2APTA 5LN4A 2WXFA 4PW9A 3M1BB 3AUVA 1NEZB 4H8QA 3ULUD 1MCBA 2NY7H 4GPVA 2CK0H 2DMCA 5FGCB 3VI4B 2AJXH 2QSVA 3RJDA 1NLDH 2UZYA 2AJ3A 1MJJA 3QXTA 4YUEL 3UC2A 1ZY9A 3CVBA 5BJTB 5I0XA 3D18A 1XSJA 2ZXDA 1NCCL 1QSFA 2DV6A 3AU1B 2DY2A 5C0AA 4NFDA 1NLBL 3GPSA 2CKBB 5B3NA 4CL7A 3T08A 2GC4C 5LXGL 3ARZA 2E7BA 1JHLH 3OHXB 3VFWB 3W3BA 2BX5A 4PW3A 3GT6A 4M4PA 2DQ6A 1HXYB 2HPOA 3ETSA 3FSZA 1NMAH 3B34A 5EU7E 2JCCE 5BRZA 2VQTA 1MELA 1PU0A 4ZS6C 3FH5A 1VERA 4UBDD 1OB1A 1MCRA 1VPOL 4PJ9D 4YHLH 3FFOA 5D5ME 5H8DA 3MA9L 4MQXD 4I77H 1WA0X 1ILSA 2UXVA 3LRMA 4C4BA 3EGSA 4MASA 1OHQA 2C9SA 3MV11 3IETA 2PW1B 4EN3C 4XPBL 5C09A 4Q6IC 3S96B 4ZS7H 4P2RD 3VB8A 5CD3B 3N06B 3LNDA 5EBWA 4PJGA 4UZGA 1A4JB 3ZQWA 4GEJA 2HKHL 2IAMA 3E6FB 3MUY1 4HFUL 4HDIB 3DXAB 1EEQA 1ETJA 2NNCA 3HFML 1Y0LA 1SY6L 2F6AA 4ELMF 1RZJC 2C1OB 4HUNB 4DO6A 4QXWA 2D73A 3RY6A 2PNDA 2A74A 1TVDA 5F1IA 4LLVA 1C1EH 3NJVA 4NUJB 1JGDA 2B14A 2X4SB 2BY1A 2HFEB 3KR3H 3JTTA 1IFRA 2GFBA 3FT4B 2A9DA 3N85L 4WV1B 1T5WB 1T6VN 3GXPA 4OSUL 3LKQA 2IWFA 2E6PA 3VXTB 3PG2A 1E3FA 4CSSA 1I8IB 1MVUA 1WWWX 2E7HA 3KEHA 4HJSA 3O8XB 3IPFA 5AW6B 3KD4A 4QXTA 2APWA 3DI3B 4N9OB 2Y07L 4Q0XH 5DZVA 4BFNA 3C8HA 5JNYB 4U05A 1BIIA 3P30H 4JQIA 3WNMA 1MCEA 4DESA 4Z3IA 1MCSA 1KUMA 3QUMB 4WFED 4XBPB 5LNGA 1J0ZA 4A6YB 2F7QA 2NX5E 4RESB 5CZXC 1BQKA 2J1YA 3T5WA 3VFSA 2RMNA 4F58L 3LIZA 2R59A 5DA0B 4MMXB 1X5IA 2AGJH 4XNXL 5C6PB 5IQ7L 2XLLA 1ZT1A 2GIXA 1N6QH 2WYTA 4W6YB 2WUBL 3GSOA 1RSFA 3IMUA 4M93C 1RUKH 4RGOH 2VN7A 4MXWL 4PFEA 1ODUA 3SOBH 1E8YA 3JV5A 1WC7A 2AERT 3HE7C 4ZRGA 1T5XA 4OGXH 3L4WA 1WBXA 2NY1B 4Q74A 3B2VH 2Q2LA 3RTQA 5F9DC 3FONA 3N41B 3GJFK 5DRZB 3PGDB 4ILDA 3NFNB 4PRBB 4P4RB 2GT9A 2HJKA 1E3XA 2YAHA 3ATBA 1FLRL 4XH2B 5L8LB 4J7RA 1WZ1L 2YBGA 1AQ8A 4C4KO 2Y36L 3OD3A 1CGYA 4RAVB 2YMOA 1IGJA 1G9EA 4GW5B 4RGNB 5KVDH 2GCYA 3MRCA 1AACA 4B9ZA 4TOYL 1KJ2A 3QZWA 3SGKC 4MSWA 4N2MA 5JHLA 1DO5A 1KJ2H 5BZWB 4Y16A 2J7LA 3EYSH 3HRZB 2DQUL 1DBAH 4JFSA 2VM9A 2G2PA 1AKJB 4JFEB 2X9XA 3WKYA 3BC9A 3SKNB 3II1A 4OM1L 1G6RB 4E9XA 3LX9A 4C55A 4WJG3 2FSEA 1UCBH 1A66A 5DJ2B 5C0BB 4Z5RB 1XO8A 3TIEB 4YDJB 1SMAA 3RLSA 4YK4C 2WXLA 2XDHA 3D0VB 1BBJB 4I3GA 4Y1AD 2FHCA 1XBRA 4WWPA 1MZYA 3PABB 3TU6A 2F2HA 3GSVB 3GXTA 3TX4A 2XVLA 2RCSL 1FNEA 3LB6C 5E6ZA 4NRZA 3CXDH 3GSXB 4XAKD 1KPVA 3K80A 4NDMA 3W37A 2VISA 5CBEB 1HH9B 2LFEA 3HTLX 4CSPA 5LGJB 2WZ6A 1FFNB 1OF2B 2APBA 2VIRA 5KBLA 1HHHA 5D2NE 4KITB 3G5YA 2EE3A 4LSTH 3UTPE 4EOWH 4CMHB 1VIWA 5HHQA 3AM8A 4P2OA 5EU4B 3BZ4A 3ZU8A 5TDPA 3QIUD 3HR5B 2WOBA 4LARH 1EGJH 1Z9PA 3HRZC 4K94H 4ZW6A 3D0AA 5GGTL 3GRGA 1SDYA 3MODH 1EDYA 3GMMA 1X5AA 4NZTH 4R5VA 4E9QA 2J6EL 4DKEH 2KERA 4ZFOB 1Z9SA 2XFGB 1J1OL 1MWOA 1A7QH 1FRGL 4PJHF 1OL0A 2VITB 4X7EC 5I6OA 5E4EB 1XGQA 2OM5A 4IMLA 4S2SA 1QMUA 1A6UH 3FJTA 3KVQA 5HJDA 2F5AL 1A22B 4J8QA 1YPZA 4XVJH 2BVYA 3HVNA 4A63A 4HWEL 3VE0B 3MUGA 1RZJL 3TM6A 5HHOD 2H32A 3ZTDC 4A68A 1ZGLM 3FQUB 4WKZA 5EORH 4HKJB 4NQTA 1YN6B 1EAPB 2CDFB 2COQA 2FX8H 4R97B 3X11A 4G2AA 2B4CL 4QRUB 3KVDD 3RVTD 1A4JA 1FH2A 1TZIB 2IBZX 1LHZA 4JFOA 3VB9A 1MFUA 4HK0A 2V7HB 1NUDA 1RZ7L 3ELQA 2UZYB 1B9KA 4ZMYA 4Y4HB 3MVSA 3QHTC 5F0MB 1INQA 2BNUA 9CGTA 4G7YL 3V0IA 2BNRD 3NZUA 5ECGA 2Q9OA 1FGNL 1CFBA 1ORSB 4QIRA 1WAPA 4ZTOL 5C0AB 4PJBE 4XCNA 1I4FA 3UZEA 5EOCH 1NCHA 1R4XA 1Z32X 5BZDA 1CCZA 2GUYA 3X14A 2EDKA 4DFIA 1GR7A 2YZ8A 3P73B 4KKCD 4ZOCA 3VA6A 3NA9L 3RIFF 5HDQL 1U8JA 3KYOA 5I8OL 1PD1A 2E4TA 2RB8A 2DYSB 3BH8A 1BQ5A 2R0ZH 1ZLUK 4RA3A 2W92A 3MLTB 4MMZC 5KVEH 1QHOA 4OFVA 4OFYD 4Z78A 1SJMA 3GI9L 5MEPA 1NGZB 1QFUH 2ZAGA 2KYIA 4FGMA 1OB1B 3SGJC 2OYLA 2Y69B 1EFXD 2NYYC 4EKXA 2BSBA 2Z7WA 3N50A 1DVFD 1Q9WB 2WHVA 1OSZB 4LDOB 1ZLWH 2LTQB 1HESA 1AZCA 1G7JB 1ZT1B 4GP4B 1CGSL 1R19A 4ISVB 3WEBA 3B5HA 2BIIA 4GI8A 1C7TA 3Q1SH 4O4YL 3ZOAA 3S0PA 5AD0A 3L2MA 3DSNB 4U3CA 4K15A 4GBXB 2ZYHA 2R7EA 3BZ5A 4YSOA 3VFTA 3M88A 5KVDE 2YXMA 2J8UE 2P8MB 4OLWL 1F4YL 4ZQKB 3EBAA 1WBXB 3TZVD 3CMOL 3HI1B 1ZWIA 1KNOB 3A6OA 1NJ9A 1OCRB 1GS6X 1X7QA 1YECL 1DJXA 2EDOA 2X9WA 4Z7WA 5DRZA 1DN0A 5J12C 3UTZB 3VD0A 2BOCB 4BM7A 4EDWH 3M46A 4LCVA 3CDCA 4BZ1H 4BJLA 1JHKL 4G1MB 1RVFL 2Y06H 1WBYA 2G0LA 1J1XH 1QRKA 2NZ1A 2EDRA 5LWYL 4XXWC 5FKAA 1BA9A 2DQIL 3X3GH 4WFFD 4QRPD 5DJXB 5MP6H 3FFDA 3HUJE 2PP8A 3GHEH 4HJJH 1NANI 4KY1L 4TXVB 4XP9H 5G4OA 3QDGD 5JOFA 2DKMA 4XT1C 4LOVA 1FNGB 1R1CA 3NIDE 5AKVA 5DD5H 2HTKC 3FOMB 3K81A 2WV3A 2MCMA 1FCGA 1KCBA 4QXTB 1R9FA 3BUTA 4G72B 4HLZH 4IM8A 4PRID 3DX3A 2PWGA 4ABWA 4AE1A 3SE8H 1YG9A 1CFVH 1YYMH 3ESOA 3FFCE 3G04A 5INCA 5DLML 2ZUTA 1MRFL 4HIJB 4N3TA 1IAIH 5EHFA 2X4NA 2IPUG 4OJYA 4DP7X 5JW4M 3ZE1F 1CFMA 3KWWB 4GAFB 5LAXA 4PBXA 2BVOA 1N8ZA 3H8NA 4KO5A 4KTEL 2JI1A 1QKZL 1GJWA 3EJZD 3KGSA 1FIEA 3PE9A 3Q2CA 3UEQA 5BVPL 3JBG7 4MNHB 5LCVH 3G5XB 1ZLUH 1I9EA 2GJ6A 1MIEL 2DWDA 3HNTH 3CN2A 5HPOA 5FECB 5FOBB 4NRZB 1G7IB 5EO1B 2E76C 3QEGL 4UQ2A 4Y19A 1U3ZA 4AVIA 2WQXA 5L2KE 2VISB 5CBEA 2Y2TA 1KTKE 3AQZA 1GZPB 2X3CA 2H4EA 4EUPG 3RBGA 1OF2A 4PGCB 1MH5B 2E7MA 3B56A 4K3DH 3UZVB 4DVBB 5K9JL 3H9HB 3HW7A 1FORH 3ZHNA 2J88L 4YWGH 2I85A 1B0GB 3N44B 3LZLA 3FUFA 1KGIA 2AXJA 2Z35A 1RH8A 5E6UB 3BZ4B 4JM0A 2PO6D 1GJUA 5CU9A 3QUZD 3GZKA 1AO7D 1FN4B 4EZMA 3GBDA 5EEXA 2GEQA 4FXGA 3MJWA 4N9GB 4TLUA 1P4IH 1KTDA 1TLMA 3L6FA 4K5MA 4O58L 1TPXB 1AKJA 3TBBA 5E7BA 5EF1A 4R8WH 4AQZA 2K1MA 2HH0H 4AWJC 5F0PB 1XV8A 4FE9A 2CDGA 2HVKA 2Y25A 3ZMNA 1P1ZB 1XAUA 3P9MB 5KSBE 3P0VH 2FWLB 3FN0L 1PLCA 4JM2C 3LRKA 3X1BA 1KCSH 1JXFA 1W0VA 1AGFA 5B1JA 4AVKA 3SY6A 5I1DA 3L3DA 1N6VA 1SN5A 2JIXA 2YGQA 1ZTXH 5F93C 2AQSA 1BQRA 2A6KA 3RB7A 2IOIA 2R0LL 2NX5D 3EYQD 4YZWA 4X6EA 2CO6B 2ZKMX 5F97E 4HG4K 3DHJA 2H3XC 1ZSHA 2B2XL 4RDQG 3ESUF 3V0JA 1UM6L 2VLMD 1ZA6B 3R4RA 4AM0A 4PY8J 3FKUS 4WAFA 1P4BH 3TT1H 2NT0A 4IRZA 2J4WL 2Z8VC 5TE7H 1XAKA 4HZ1A 2FT6A 1AMYA 3SDYL 1ONQB 3STLA 3ES6B 4OI9A 2OCFD 4L0PB 1PMYA 1TJHL 1XDTT 1T1WB 1SHXA 5C6WH 4UT6H 1N26A 1ZLSH 3KLHC 4LVHB 2E7LC 1UM5L 5EMYA 4NO3B 3VU2A 3PNRB 1MREL 4JM4H 4KUCD 2NY0C 2BVUA 2CO4A 4N8UA 4ZOEA 1H6TA 4MZ2A 3HS8A 4NC1C 2FX7L 3S5LG 1S5IL 5CUSH 1LEKB 3ZUNC 4G9FA 1AZBA 3MO1A 3C6LD 2EC8A 1UM4H 5IHZB 5EBMA 1MFEL 4H8HA 5AEAA 1NCAH 3T8VA 4IJ3C 2ICEC 4FFVD 4KUZL 1YPZB 4KNUA 5E8NA 4PS4L 4KY2A 5KVFE 4ISVA 5DS1A 4DH2A 4F7TB 2VLKB 3VG9C 1GS8A 2TSAA 3B37A 4JFQA 2PLTA 5AFAA 1K5NB 5BQ7A 4C56B 1WH0A 2BVPB 2NMSA 5ILTH 3HCVB 4PJXB 5FUCE 3F7YB 4JM2B 2VJXA 5D2NA 2YK1H 5IUCA 3X11B 1Y1UA 4N8VA 4MVBC 1ZWIB 1WF5A 5AYTA 5E9DD 1DVUA 4AC4A 2D03H 1YN6A 5C3LD 1X5FA 4AT6A 1TQBB 1ZEAL 1LNUA 3TJEL 2YUWA 1X9QA 2H2PD 3AUWB 1TTRA 3TBYB 1ZLEA 5FYLH 1NKOA 5DMGC 4L1TA 4K5LA 3U1SH 4FFYA 4IBYA 4GAGL 1JZ4A 2VCOA 1QNZH 1NBYB 4RA0C 5BV7L 4Z76B 2I07A 2OMUB 3H0TB 2FT8A 3SZ6A 1Q0XH 4ZUTA 1SJVA 1F4WH 2DIBA 4XVSH 5F7NC 4WTQA 3MRBA 4HUKB 2YC1A 4C54A 1XR8A 2CA3A 2DWTA 1N5YH 5KS9F 2CGRL 4Y4KB 1ZK9A 3MNZA 1RIVH 1UYWH 4LSSH 2YKLL 1FZOA 3I6KB 2BSRA 2FBJH 2ICWB 5DF0A 2GBAA 4OQ1A 4NQDA 2NR6D 2UV3A 2VMEA 5L2KA 4LDLB 1JK8B 5K9QI 3ILQC 4M00A 1JYNA 4GW1B 3P30L 4YDLB 2YGPA 4BFKA 2EDMA 2IAMB 2IAMD 2FB4L 3BDYH 3E6FA 3FQTA 4GRMA 3WO4C 4B9YA 3MLZL 4E5XB 6PCYA 4HF5L 4W9LC 2XN0A 3CC5A 3WFHB 2EH7H 4KI5F 4NKIH 4ELME 4I5BA 4OD1H 5T3XE 4K3GA 4LCCB 4RSYA 3ZDXE 3QDGB 3DTUB 3SDAD 2VZ1A 1KWKA 4KHXL 4MDIA 4IGBC 3ZDZF 2Q5BA 2JKJA 3CWGA 4BH7B 1IC1A 2K4WA 5CZKA 2GFBB 3FT4A 1YEEH 3AWGA 5D1ZD 4ORGA 4UT9A 4M5YH 1GC1L 3GSWB 1MOEA 4P9ML 4XMZA 3VGFA 4GUCA 3GMPA 5K69A 1K8IB 1M6OB 1BQHG 1KACB 3QO1A 4AH2B 5F9WC 1VKXB 5IB1A 1FYTB 1JZJA 2EEBA 2WTPA 5JDJA 2G60L 4MHHI 1ZVSA 3CCHA 3HS0C 1JPST 4KMTH 4DOHB 2JKTM 4KJPD 3IE9A 1NIDA 2Y36H 1AVAA 4RWYH 5DEJA 4UZUA 1DQIA 1BJMA 4YLQT 1BVLA 3QQXA 1PZCA 4RGMC 4X42A 4PEEA 1BM3L 2E6JA 3LXBA 2KT6A 3U0WH 4PTTB 3MFFB 1FA4A 4U2ZA 3QUXA 4E9LA 1SQMA 5JXEC 4DGVH 2VL5B 3QGVA 4HWBL 4YXKH 4OFQA 1NICA 2JH2A 5LDSA 2C8NA 5JW4N 1VGKA 4NBZB 2A6KB 2QQNL 2FIKA 2ODIA 5ANHA 4M7LH 1JWMB 1NCTA 4JO3H 3CVCA 4JPWH 4AKOA 4JDVB 4Q4EA 1V5JA 4AQ1A 3F64A 3CFCL 4WI7A 1F90H 3VYPA 5J89A 3KPTA 1IBBA 5DJZB 1UWXK 4X6DE 3TZVA 1NCCH 3F05A 5CEZH 1Q8MA 1HSBA 1ONQA 2H8PA 5F0JB 2YO3A 4YBLB 4X7TB 2YEZB 5T33L 1NLBH 3ULUF 2DRUA 4ZFZA 2ZUQB 1L7TL 1E6OL 1KB5L 3II3A 1DJZA 3LZNA 5HDBF 3AROA 4JHUA 4ZMXA 1U8HA 3HG4A 2YKKA 3AFLA 5FK9B 1OD7A 3MNDA 3PP3H 5TH2B 2A83B 2QMJA 3J8F7 3JWDH 3QG7H 5EU3A 2NX5B 3QJOA 5F6IC 2EVGA 4HPYH 1KBKA 3QPQC 2AW2A 1C16B 1T6WA 4WWKA 4Z3GA 4G9DA 1LEKA 5E00B 3N55A 1A9EB 3NCFB 4ZX4A 1X5HA 5DK2A 1A14L 1FDLL 5TK2A 3KNBA 3VACA 4AK2A 5T5NG 4JKKA 1AFVH 1NGWA 4Z7NF 4N0UB 4XPFL 3X1GA 5HPMA 4CMHC 2CPUA 3MROB 1KB9K 1U95A 5LUMA 1FL6A 3CG8A 3C8KA 3V8OA 2XN9A 1I8AA 2N3JA 4QJ3B 5ENWB 4BFRA 1DHKA 3H6AA 4MJ5B 1S9WA 3AVEA 4PH8A 1A7QL 1FRGH 2IQAA 3OKEA 2BFVH 2BRQA 4NDMB 4XXCC 2VXVL 1EO8H 1XZWA 3PAZA 5ICZA 3GS7A 5E99H 3APDA 3GSRA 5F89B 3SQOH 3KPPA 1J8RA 2DEYX 2VAAB 35C8H 3DRTA 2EDHA 3QUYD 4FABH 1BREA 1PX8A 1YMME 4FS0A 4OUUB 2EJ1A 4OT1H 5E5MB 1ADWA 4DWHA 2F08A 2XKNB 3N1GC 4JDTL 2ZCHH 4Y1SA 5D7JC 4MLSA 3ABGA 1CFSB 1JF1A 4HWUA 3UC0H 1E2ZA 1IGTB 1VRSA 1KCUL 1CICC 1JGUH 4OAWA 1DVFB 3MRRB 4HJIA 2QHRL 2BP3A 2FR4A 1RZ7H 3N85H 4J3OC 1ADQL 5D4IA 1R33A 43C9A 3V9EA 1KLUB 4WEEA 3W0WA 5I1JH 4JO4H 4NZ8A 4OLVL 1FZJA 4GY4A 3TA3A 3W82A 3SDCB 2Y5TA 4BQBA 3GUFA 3JWDC 3CFMA 3ZE0F 4E0RB 1RUQH 3WL9B 4ZTOH 4IMLB 2PWHA 3HB3B 4LGRB 2GY5A 1DO6A 2BP0B 2DZEA 4L3EB 1H3WM 2WVTA 5FUOH 3MXVH 1INEL 3FUJA 5D8JH 3REWA 1HVXA 5TGBA 5ID1B 4HULB 4BFFA 4Z7UA 2WGNB 1JI1A 1YEKL 5CEXB 1A0QL 1YN7A 1Z66A 2DQTH 4PCKA 1JGEB 4UT7H 2AGJL 3M17B 1N6QL 5AB2A 3GO1H 5CAYB 3QP3A 2EC9T 4HEMA 2Y1AA 2VUKA 4JY5L 3HE7D 5T1KB 1JNNL 3OMZA 2ESVB 2W9DL 4QRAA 1A4BA 4XNBA 1PIGA 1GMIA 2PCYA 3B8SA 3BAYA 1BJ1J 3V0VA 1OCWH 4KKBD 5BUAA 1KTLA 1B4JH 4N0CC 4EUPH 1YEHH 3UBXB 4FNSA 1GMEA 3LYRA 5B39B 4G8GE 4L3FA 1INQB 3D4ZA 2Q10A 2K9FB 5HYJD 2FQFA 2R9HD 1T4KA 3MV8D 2I25N 4BH7A 3LEVH 2WYZA 4G6FB 4XB7A 2NNAB 4M48L 4B9JA 4JB9H 4JR9L 4OI8A 3IDGA 2BSCA 4KRPD 2JK5A 2QSCH 2WAHA 4RGNC 2FEDC 5LBGA 1VFOA 3ZVVA 4IBSA 4F7CA 4A7SA 3QXAB 1KJ2L 2J44A 3CVIH 4HIPA 3DO3A 2DQUH 4MDJA 1ZT7B 2VLKE 3HMXA 4ZW3A 1L3NA 1AD9A 4JJ5B 4Z76A 4KGJA 5L4JA 3WMSA 2AJUH 4O5LH 2ADJB 2WD0A 5ES4B 3AM8C 3CFNA 1EH9A 3BSGA 1LO4L 4CUCA 1UCBL 3QJHB 7FABH 2IANB 1I9RL 2ZIDA 4MA8L 1TCMA 2VR3A 4B9PA 3QISA 3QUMH 4IU3A 3X1NA 4HUUB 4XAKE 1MJ7H 2WZ5A 5CEZE 1UUNA 4HGWB 1MDAA 2IDFA 5L2KB 5B1KA 1X4YA 1NCUA 1DCEA 4GW1A 5MERA 1BEYH 4OCWL 1TTAA 4JE4B 1F18A 3CPLA 5FW6A 4ZX6A 3VFRB 1U4FA 1E5YA 1JN6B 3CXDL 3UJJH 4PUBH 4H5SA 4PW4A 3ISYA 5GRUH 3ZE2B 1AGCB 2YOCA 3BPCA 5H2BB 2CRYA 4JFEE 3LB6D 3CFDB 1FIGL 1IGMH 4RGMB 1UKQA 3BCDA 1DYZA 3O8XC 1U42A 3I2CH 3DNKA 2Z31A 3ZKNC 4Z3JA 1OTSD 2IQ9H 3WNLA 5DSCA 4CA4A 4QRBA 3WFCL 1SZNA 1M7IB 3HAEG 4AY0A 1FNGA 1GZHC 4NQDD 1WGVA 3LKRB 4GAJL 5T3ZH 3CHQA 4P9HC 1JTTA 4P46B 3RZCC 1BFSA 4LARL 3CBJB 2GAZB 4I7ZC 2DD8L 1AZRA 2F5BH 3FQWA 2OS7A 4R4ND 3OAUH 1BZ7A 3Q8AA 4TSBH 4TPRL 4N5UA 3CCHB 4QUOA 4KK9D 2H1PH 3CVDA 1QSED 3O6ML 4Q4IA 2ZUWA 5ESQB 2AEQL 2XA8L 1W8OA 2FQGA 3UAJA 1EFXB 4N2IA 2XQYA 5SWQA 3L45A 5BRZB 2CPCA 3BD4A 4WJ5B 4P3CL 2V2TB 5D7LB 2BCMA 1LWRA 1NCJA 4MS8D 1TQBC 2OYPA 4XP1H 1JZDC 3MMEA 4PM1A 2ATAA 4TUUA 1XGPA 1BVNP 4QKXB 4AMKH 1ZE3H 3BYTA 4M6OL 2OMNA 3FB6A 1XTMA 4CJ1A 3KWVA 5IHBA 4BA8A 2ITCA 3R7QA 3QFGA 4UOZA 4GUOA 4RAUA 3FFCB 4Z7AA 3QQ9D 1AI1H 2ARJB 3MRQB 4HIIA 4LMQE 4OJAA 1MCQA 4WHTB 4FQIH 1HXMA 1QWUA 2V5TA 5TFSL 5KSVA 3BHBA 1F13A 4AQOA 3MV9B 3N91A 2J8UA 4XN2A 5JQIB 1NMAL 2V2XA 3MFGB 3KLQA 5H94A 1FN4A 3ZHLA 43C9B 3V4VA 1SHWA 1EXGA 2H0EA 5GISL 4DUVA 5G4MA 2HVBA 1KTDB 2NDFA 3TA3B 1MIMH 2YAFA 4FP8H 1G7PB 4DN3H 1G1YA 2MEJB 3BE1H 2EKJA 3DSFL 2BVTA 3LKQB 4UT6L 1HHIB 1E8ZA 2VMFA 5C97A 3HG5A 1J12A 4K8RL 5CJBA 4MAYC 4HZAA 1CTMA 2JIXB 3VXMD 5CEXA 4JM4L 4G42B 5F96H 2BC4B 3QQ4B 3RY5A 2HRHA 2IIJA 3J7HA 4AYSA 2DM3A 4CMMB 4PJDB 4IEFA 3I9AA 2WBKA 3FOLB 1JI2A 3FTYA 4EF3A 3MBEC 4QI3A 3QUMA 2OBGA 3ZE0B 5T5NF 3NESA 3UO1L 4NUPA 1JPGB 4N2HA 1J8HB 4M1DL 3GLAA 3QPKA 3FSAA 2F1AA 2FJUB 4Z8FL 2DMHA 3CH8A 3EOAB 1T20B 4L3CB 2IF7A 1N68A 3PWJB 3CVHH 4FG4A 5LGYA 4UV7H 4XNDA 4P2QA 2MWCA 3I84A 3O9WD 5IOPA 3RUGA 2XTJD 3KPNB 3L16A 5GGTA 5I0WA 3BSZL 3HG1A 5J1SC 2HWZL 4ZNCD 4M6AA 5AG9A 1JK9A 4URTB 2ED6A 1YA5A 2PYED 2GHWB 4OAWB 3SCMB 3HPLA 4BELD 1JCVA 4AIXA 2Y07H 3V10A 4N0RA 4HJJL 2P46B 2ZZUT 2W0LA 4RFEA 1C5DA 5FO8A 4Z9KB 4XAWL 4G82A 1FJ1B 1VEOA 1CXLA 4HIXH 4G9FB 1KXVA 1L9MA 5A3IC 3D25A 1A7OH 3NG5A 3WL9A 1EAQA 1TPXC 3B2UD 2NY3C 5DCCA 1IEHA 4GLRI 1IX2A 3QQDB 1F3JA 4MSWB 1P5UC 5ESVA 3MU3A 4HW6A 1HU8A 3BP4A 3CLEH 4XX1G 1DQKA 4PJBA 3IDYC 3REVB 4WGVB 3LS4L 2F53A 1K4CA 4S1SH 4GRLD 4UDTA 3K6OA 4Q56A 1YY9C 3FK3A 1QKZH 1F3DH 1NAKH 4J4PD 3GIVA 2ROXA 1OK0A 2NSQA 1MIEH 3FCBA 4A2LA 3FO1A 2DQHH 5I19L 1FNHA 5L7XH 3GSNL 4QWWD 1URIA 2HX7A 4F20A 1BZ9B 3NN8A 1Q9OB 4JKMA 4AT6B 1G9MC 2EEDA 4G7VH 5IWLC 2YA2A 2DJ4A 1IVTA 4GT0A 1ZLVH 1JGIA 4L8BB 1DBJH 3T0DA 4X6CA 4NN7B 2EIBA 3QIBA 4JQXC 4Z0XA 1WZMA 3BH9B 4LLMB 4PLJC 4C83B 1G1KA 4NT6A 2RHEA 1MAMH 3A6BH 4L0YA 2CE6A 1BVZA 1TEGA 5AW9B 4KOCA 4DVRH 1MCLA 3GRBA 4XMLH 5JOPE 2AK4B 3VXSB 3QYNA 1CD9B 4D9QE 5AW1B 4HPHA 4OFIA 1U6AL 3IFOA 3TESA 2WNKA 3FCUB 3BZDA 4HP5A 4PJAB 2NXYD 1CE6A 4M62L 2NXZB 1PLBA 3L1OH 4LCWB 4G1EB 5HGBA 4BKSC 2BIHA 1JK8A 4UQIM 4AYBA 1MCOL 4HWZA 4HJ1A 3C2SA 3DXAD 1QLEH 1ZKAA 4ODSL 2Q86A 4PVNA 5L4MA 4B27A 1HHJA 4H2CA 4O2EA 3T2NH 1RLBA 4RWYL 5KJ7E 3BGFC 3RPKA 2XTJE 1ZTMA 4JHZA 3IDIB 3P2BA 5HVHB 2R56L 4N2FA 5HP5A 4DP1X 4EZLA 5C0GA 2IAAC 4HD5A 4YQXL 1KCKA 4MQTB 4JEGB 4HUVB 5EZJB 3MV7E 4CJ0A 4OF8A 1R3HA 1CF8L 1KIQB 2QZ5A 4DGVL 5ITBL 5J12B 4B3VA 1P4BL 4S0SD 1S3KH 4J8RA 1Q0YL 1ERNA 4O2FA 1HKLL 1QVOA 3GZPA 4CC1A 4N8VG 1QSEA 4QOKA 4RNRB 1XIWA 1KXQA 3MRGB 4JO3L 3KLHD 2QZQA 1BSIA 4GW5A 5CS7A 3BLKA 4AH2A 4DUXA 1JMZA 2ADFH 3AS3A 5AVYB 5J7CC 3WJLA 5GGTH 1S7WA 1JWSA 4XN9A 1OSEA 5SX4I 3CSYA 4QLRA 3WU1A 3MLWL 3MUUA 3ORJA 1IC5H 3THML 1J1OH 1LK2B 5FA3B 5E6IA 4OFPA 2VDMH 2W95A 2NY2D 4FTVD 1A02N 4HS8H 4JY4B 4N28A 1YYLH 3QCUH 1FWXA 3MYJB 4XXWA 2JKWA 5SWSB 3RVUC 4J3BA 4PIRF 3LKNA 1AZZC 2WWKT 3F8UB 3OB0H 4QOKE 1VGKB 4KUZH 3U4EA 5KVFL 2A6JA 2VDNB 4YAQB 4APQD 2VZOA 4Y2OA 3VX1A 2R1XB 1DVTA 1PX3A 3GI8H 4CC4A 2OX5B 4NNPL 1UA6H 3PJSB 1F02I 1MHEA 4G6KL 3TVMD 3VRIA 3VXUB 2AJVH 3BPLC 3MLRH 2H32H 3O6KH 4HSCX 4OCYL 4KTYA 4XPFH 1MCIA 1OAYH 1JV5A 1R3JA 4HU2A 3MCLH 4JG1L 3IJEB 1Y7VA 3WIHA 4J27A 1HH9A 3HPJB 1Z5LB 3JV4B 2X3AA 3SKMA 3QXWA 2IG2H 2VLJA 2X09A 5FXCH 1GW0A 3UGUA 3QI9D 4ZMLA 3BUDA 3RUGB 2BFVL 4P57B 2ZF9A 1A5FH 4WHTA 4ZQKA 5BRZD 1FL3A 5EU4A 2XIBA 2JJWA 5J5EA 2E56A 3WY4A 1FC2D 2WN2A 2CUMA 2YIHA 2XU9A 1AOZA 3FB7B 2NNXA 4JRYE 3L7EA 3MGTA 4F7KA 3VI3A 1I1FA 1BQHA 3QDJB 2J8HA 2BHUA 3D25B 1FFRA 5I2IA 4IIQC 2QPSA 4NQSB 4E5XG 2YPLB 2NW2A 2EP6A 3MROA 4GO6B 4AV0A 4LOEA 2X9ZA 1N5YL 2EIZB 5BXFB 3B2UC 4LSSL 1A1OA 4HV8A 3Q0HA 3ILQD 2YD5A 1P7QD 3I6GA 2UXGA 3LQAH 4UUJB 4P23B 1WUZA 2CCWA 3S4SG 3B3IA 5DHXB 1YPZF 2C1PA 2ESVD 2V9RA 4RGNE 2X28A 2VE6A 1WHOA 1CVSC 3IDNB 5GGRB 4HIJA 1S7RA 3Q5TA 3CFEB 4KRNA 3MREA 5E4OA 4JRYA 4B95C 4YHML 4M8RA 1OT1A 3AREC 4K3HA 4I0CC 1M2VB 2DQTL 5IEHB 1GYUA 1WA1X 5D1QB 2XXCB 5ICXA 3L1GA 2IH1A 1ACXA 4JQVA 3NCYP 2P5WE 2ZF8A 1XCTA 4P5RA 1F5WA 3EYOB 2CRIA 3LN9A 5T1DH 3TO4C 2Q76B 3DETC 4QR7A 2FR4B 1HCZA 2PXYA 4BGLA 1AQDB 2AC0A 3ME0B 1EX0A 2CNZA 2X4UB 5CP3H 4A2DA 3KPRE 2O6CA 2N56A 4NT6B 4BZ1A 3VWJA 3NCXA 2Z9TA 4KQ4L 2AJSL 1I9JH 3BKML 5C0CD 2Z65C 3KH3A 2OL3B 3E1F1 3K71A 1AGEA 4WNSA 4ERSH 5DJAA 4EKJA 3ELAT 1LGVA 3H9HA 2Q87A 3E3QE 4RAHA 4YIQA 3IWUA 1A47A 5GRYA 3REWB 3K6IA 5IVXB 1MNNA 4CGTA 2FWOA 5KSBF 1HK6A 3T3ME 3M17A 2VDQL 4XNUH 4DEPB 4KTEH 5C8JA 1FFPA 1FH5H 4GS7C 4Q52A 2AQNA 5C0DB 5KYXA 3O9WA 5ABAA 5IT2L 3REVA 2Y6SD 2QKIC 3K3QA 3OC8A 3DK2A 1FVCB 4I0PD 4X99A 2UWEB 3E3QC 3OQ3B 2NQ3A 3L4UA 1IM9A 3T3PE 3L2NA 2FYVA 2IH3B 1JP5A 1A7RH 1IQDA 1P7KA 2WLLA 1KGXA 3DUUA 1QR4A 1A9BB 1U3HB 3P9MA 2W60A 3D9AL 2IEPA 1I7UA 4LLDB 1TO5A 2WWMD 3FQNB 1ID5I 4K7PY 5EZPA 1PEWA 2YOAA 3KPQB 3S37H 4NC0B 1YMMD 2ZJSH 3MJ9A 3FTXA 1XSKA 1YEFL 4TMPA 4EJ1C 1FORL 4GXUN 1S46A 1NL0L 4LVOC 4FFYL 2PXYD 1QSEB 4AYDC 3O2DA 4BUQA 3BD5A 1HFUA 4YBQC 3ZL4L 2DLFH 1XF4B 3QWNA 2B3RA 3TFKC 1RZGB 4LHJB 3N44F 2O6EA 4HKZB 2MSPA 4M93B 4GQ9H 3TWCL 4FERA 1OXYA 1GTNA 1MRCL 4XHJC 1N70A 3H42H 4FKHA 1DE4A 3VQMA 5I1LA 5GRUL 3QB7C 4LVNC 4UAHA 3EXJA 4NPKA 3TO2A 2FEEL 3ZSSA 4W9GC 4JZNB 1SF3A 3LEXB 3QDAA 1E28A 3AS1A 4LHUD 3JWDL 3Q05A 3PDOA 3HHMA 5GGSA 4FD0A 3LIZL 4J1UB 3UGXA 4JKLA 2O26U 1GZHA 2R83A 1CLZL 2CKBA 3J07A 4OF7A 4G6JH 5CLYA 5JW4R 1AHMA 2TAAA 4PB0L 4JY4A 5DZNA 5GGVY 3RFRA 5IMMB 1ZHBB 1P6AB 1QBLH 5H94B 2Q3XA 1PZAA 1ANUA 4AJWA 3IKCB 4X5QA 1T1ZB 3MZGB 4ZI8A 3QFJA 3P3RA 1JN6A 3LTVA 3GDBA 5C0CA 3SO5A 4Y5YC 1PY9A 1AGCA 4KOBA 4HETA 2WXKA 4XVOA 1D5IL 1SHMA 3VXQB 3W39A 2IDSA 1WWAX 2GVYA 5JPNC 3I75A 2FJGB 3VXOB 1N0LB 3KDMA 2GSIB 1ML0A 1RZIA 3P3UA 3FCTA 2A2QT 1U8CB 1JXDA 3F6JA 4GP5B 3K0YA 4WHYH 5EU5A 4ZMNA 3QRFM 1CIDA 3UC0L 2X4QB 1CIUA 1JVOA 1WUNT 3MRJA 1FNSH 1HAWA 2OTWA 5HY9A 1D7BA 4PJAF 4KJWC 4UQAA 4TSAL 2UZPA 2EXYD 3HS0B 3T0AA 1GHFH 5MEQA 1RZPA 4UT6A 1LK3L 12E8L 4JM2F 3IJYB 3D09A 4GG8B 2MCPH 4G8IA 1MCWM 2HVJA 3FU7A 4NQCA 2ICES 3MXVL 1QO3A 3L4TA 4FG2A 3GJFB 3US9A 5JIPA 3D48R 5J11C 1NCDL 5EDSA 2D31A 3AABA 4LEOB 2VZSA 5E5UB 1V7NL 3T6VA 1GYWA 5GIRB 3VDAA 4XNZB 2Z6FA 4NKMB 5C9JA 1UACL 1NFAA 5I1GH 2NY4C 4FDWA 2MNJB 1CBVH 1SYSA 3COOA 3NCCB 1KEGH 1A4CA 2R0KH 1RP9A 3E0GA 5IJVB 4ATTA 2X4RB 3E8UL 5DLLA 4O9HH 4FZEH 1MHEB 4Y5XC 3P4NA 3CN1A 2MTPA 3NJMA 3IJSA 3D7PA 3IWVA 1UJ3B 5E08H 3W2DL 4JCMA 1S7SA 4PRHA 2I26N 1W15A 4NN5C 5DZLA 1IIKA 2WVSA 3RNQB 1O9VA 3QR2A 2C3HA 3DURB 3ARED 4J3WA 1E9OA 2P5EB 2DWSA 3ES6A 3LEVL 3QZMA 4NB7A 4W70A 1NBZB 4PY7A 3SDCD 3V5DA 5CCJA 1DQJA 4Y5XA 1NCBL 4K55A 5ACMA 2W81C 2DDQH 3PUCA 1WV7T 1OW0A 1T0OA 3QNZA 3P40A 2A9NL 4Z8FH 4GAGH 2CO2A 5FEBA 2QHLA 4I3SL 5GHWL 4N24A 1U3YA 3B9KB 4GOSA 4RETB 3MJ9L 2XPGA 4R0LB 4XH2A 4AIZA 1ETZB 5LBVA 1VCAA 5I66B 1F8TL 1JVLA 2HWZH 4TNGA 3OSVA 4E9VA 4KK5C 2ZOLA 4H8WL 3QIWB 2WLNA 3HHSA 2FO8A 3VA2C 1MG3C 1R3IH 3IFNH 5IQLA 1T80A 3ZKMD 5KG9B 3A23A 1BOYA 3PL6D 5C0DA 3VG0H 1HYSC 2P1YA 3DUHA 1XCQA 5DD0L 3I6GB 1B4LA 3LZQA 4R5TA 1MJ7L 3LQZB 1LVEA 4X9GA 1XD0A 3ZKXB 5EPMB 2BVPA 1DEEB 3FUDA 3ARDC 5TK4A 1IGYB 3PWUB 2G5BA 1MF2H 1B6DA 2VR9A 1BEYL 3DIDA 1E9QB 3MSPA 4NJAL 5BZZA 1VFUA 4OCXH 1I7UB 4HIHA 1NUGA 3HEIB 1DVQA 3VWKC 6CGTA 1G7QA 3GD1C 2EDXA 4S1SL 3TZVC 2X9YA 3IN2A 5AOIA 3P4MB 4RBPK 3MJ8A 3SDDC 6PAZA 5KSAC 1KBVA 5E8DL 4MA1B 2AI0L 4HCGA 1HWGB 4NYLB 1IGIH 4EVNB 4ZBJA 1A3QA 5BOZG 2X1QA 1CLCA 4DKDC 1PZDA 4U33A 5FUCC 1UVQB 5KOVC 1T7XA 4R4BA 5DXWA 3S5ZA 4A7TA 2OMVB 4KDVA 2VDLB 4PRPD 2MIZA 2OMXA 4M8QA 5IB3B 4A2HA 2F7PA 1UWFA 1ZRUA 3H7BA 2QL1A 3ROLB 2N7AA 3OAWA 2YMXL 1CT8B 5F9JB 1OTSC 4QYOA 2CJTA 5EG6C 2DLTA 2F9BT 5HYSG 1JPEA 4K71B 5L0QC 3MRBB 3VFVB 1DBJL 2CQVA 2Y2YA 5KZCD 4YIQB 1YNTB 2R23B 5EF2A 5LDUA 4HAGA 2C9XA 4WLCA 5DJ8A 2JTDA 4ZOAA 1YMHB 2BNQD 4ZXBA 2ZCKL 3KCPB 2EZ0D 4DK3A 4I13B 4NS0A 4POZC 1YY8B 1FNLA 1G1CA 1BAFH 4PBWD 3JTSB 3E38A 4Z7QB 4GSUA 3UERA 4X6DF 1F1AA 1VZHA 1G7HB 3UMTA 1TG8A 4S2SB 2X1PA 1DZ0A 5HGGS 5J6SA 4NQQA 4XO3A 1NCWH 4LLDA 1KCVL 1A6WL 1FSKB 1L9TA 2A5UA 2LU3A 3B2DC 2YQ2A 4ZSOA 3KGRA 3EO0A 2PTVA 3I75B 4QT5B 5D1ZI 3T2NL 1OCZB 1IQWH 1HEZB 5HYJA 3UDWC 4OJEH 4NO0D 5EH1A 4OUOA 2XWDA 4HH9B 1U8NA 2XIIA 3ASOB 1J9QA 1KDJA 1IMHC 1YAIA 4HIQA 4YPGB 1V54B 2VRAA 2JVUA 1EQWA 1GOFA 5DK3A 5ADPL 4KO9A 5D5MF 4BKTC 3WY2A 4LHUA 2E8ZA 4ATWA 1CU4L 4JGUA 1CE6B 2F54D 2B1AH 4DAGL 2XN2A 4MD0B 4WW2F 1DVYA 2M1KA 1A6TA 4OGYL 3K2IA 2GI0A 1KLGA 3MX0A 4MQSB 4TUOB 4YFDB 3H2WA 4K7FB 1X5YA 5DFWH 5DQDL 5F1KC 3AB0C 2KZBA 4XNQA 3HKZA 5CZVH 3PHOA 2TRHA 1E2WA 2E6QA 3SGEI 1L6ZA 3KYOB 3TP4A 1FSKC 2FO4B 3FDWA 3MXWL 4B7IA 2VDMB 1FHGA 1EO8L 2R2CA 3RL1A 5E56A 1U93A 1IEBA 3FUMA 2O5YH 1ZHKA 4FKEA 4F9PA 4M5ZH 1OOWA 1LM8V 4I0PA 1K2DB 3CVHA 1SFHA 3TWYA 5AW0B 3V6FB 3W0WE 5KBDA 4LSDA 4BEIA 3QNYB 1HE7A 2C3XA 1NBQA 4M1DH 4FABL 3HZ3A 2A3TA 2BVQA 5IHLB 2D4DA 1QA9A 3BUYA 3OKLA 4OLXL 1EEYB 2JJTA 3T9WA 3ZSTA 1QBBA 1A4KA 3ARVA 3U6RA 3JWOL 5BZXA 4D9LH 2P5EA 3CZSA 3OKDB 5F9AC 4YHYB 3Q2LA 5LB1A 1I3VA 4IK6A 1M2OA 4ONGL 2H3KA 3BSZH 2AJXL 4X8JB 5DHYB 5SX5K 4EDXB 4OLVH 3RIFK 2JB5L 3WJJA 4IDLA 2FD6H 4JG1H 4ADGA 4EZKA 4OZGB 3VSUA 2RA1A 1RUQL 1SXBA 3QI9A 5E94A 4BQCA 3CV5A 2X6AA 2DJUA 1NPNA 2H0JA 4HJGA 2IG2L 3WNIA 4I0KA 4XAWH 1ETZA 1INEH 4WWKD 4BSVA 3SBQA 4G1MA 2MHAB 1A5FL 2DJSA 1A7OL 3N6YA 3W5MA 5H4ZA 5KBPA 5KEZA 2WBXA 1F0LA 1I8IA 2FEEI 3IPEA 3GRWA 4IOFC 4XE0A 3RDTC 1JUFB 4YHIA 3BWAB 4XCFH 1KC5H 1PGRB 4JFDE 4GG6B 4GI6A 4YEFA 2FJSA 1CDUA 1D7CA 4CVUA 4APQA 1NC4A 5F1OB 5GRZA 5JXAH 1EANA 2VJ8A 4X6DA 2P5WB 2LFGA 3ARGB 4G6AD 3IETB 2B7DT 2ZUYA 3TNMB 1CURA 1PFOA 2CHZA 3ARDB 2TSBA 1QHQA 1I1AB 4L1BA 3DBSA 2DQHL 1SM3H 5L7XL 1SJHA 3LQAL 1MHPL 3KW7A 4PRHB 5JPMB 5I1HL 4GKZB 2IMNA 3U7YL 3S48A 1IBZA 2UZXA 2BZ7A 3OR6B 3PWPE 3GUTB 1JZ7A 2XV2A 3O11B 2DI9A 1AHKA 4A37A 3L3JA 3G5XA 4O02A 4M8UA 4CADA 5I8CB 3WV0A 2ZCLL 3NFNA 3QR1A 4YHOH 4NZFA 4PJ8C 3TBSB 5TQ0L 1XF1A 3HFMH 2AEWA 3QPXL 3DGCR 2CBPA 4A55A 4F57L 1XL6A 3RPIA 1VJSA 1XXDC 4NUJA 5D70L 4JREC 1MCDA 5IJCC 5IGXH 2J72A 1ES0A 3T2OA 2J6WA 1LO4H 5T1DL 2MCG1 4U1NA 4KQ0A 3UZVA 5IG7A 1W2KT 3CBRA 3VXTA 1X5KA 3EUUA 3F5WB 3D0LA 4WW2C 3L1OL 2YR3A 4IHOB 4X5PA 3I9GH 4H0GA 1H3UA 1FFTB 3VXRB 1W72L 4KK6D 2AXWA 4AV5A 2ENQA 4MJ4A 1BIIB 4Q0XL 3SYAA 2Y7QA 1IC7H 2Y7NA 4AK1A 1PS3A 2QADC 4ODSH 2M2DA 2ZTBA 3ULVD 2ESVA 4HJEA 2HP4A 1UJ3C 5D2LB 2DQEH 2FJHA 3LZPA 3MR9B 4P05A 4Q14A 2K4AA 2W0FB 2EDLA 4ZODA 1KEML 1W72A 1Z7JA 3NVQA 1PBYA 1W0WB 3WTSA 2GJ6D 1G7MB 2LLLA 2CDGB 5D1QA 2VNCA 1V8HA 4M1GH 2N7BA 5HDOA 3WCYA 1OTTD 3ARYA 3TCLB 2PPDA 3CX5K 2M26A 1EDHA 3L3DB 2B16A 5J0BA 4OH2A 3SE3A 2RJMA 3WFCH 5ISZE 5J11B 4QHLA 4N0UE 4LCWE 1U8NB 1DQVA 1QSFD 2XWZA 3PGDA 1TU2A 4KKNA 2YUZA 2APVA 4JFFB 4PP2A 2OL3A 3JSSA 4TSBL 4XXDB 1FV1B 3P0YL 4RAUB 1YEFH 2VXSL 3ROLA 1HINH 2YGVA 2ZSWA 3IT8D 4IRSC 3O3UN 5EWIL 2FWOB 2N59A 5HGDA 4XNYH 5CLZA 4PJGE 2H26B 3BQUC 2P80D 3D33A 4XX1E 4Y16B 4ZO6A 4QDGA 3LV3A 3HZVB 3V4VB 4ANWA 2P49B 4U7KA 4UTAA 5DJ8B 5K59E 3SIKA 4NAQA 2BOBA 1EAOA 5JQ6H 1MJ8H 1UXSA 1RLWA 1XGQB 3KXFD 4X7FC 1HCYA 3KPRB 3LIZH 4XI5C 4NNPH 3RL1B 4Q9QH 3NGBB 5J6GA 3TJPA 4I0PB 4J3TA 3GK8H 2C3WA 4YDJA 4WNQB 3S2CA 4KRPB 1OGTA 1QBLL 3AG1B 1AI1L 2J73A 3S2AA 5CHNB 2BNRE 5AL8A 3I50L 4LQFH 2F54B 4WRLA 1DDHA 3RVWD 4Q6IA 1XF5B 3CXHJ 5FO2A 2Y24A 3DC0A 3OXSA 4FL4B 4B97A 3GSXA 2EDQA 3Q9PA 1J05A 3HCVA 4PJXA 5DHYA 1CDHA 4OTXH 4BDVB 1PYWA 1RMFH 3IAQA 3NJIA 4PS7A 3PGCA 4X6BB 5JYMA 2FTAA 3D08A 1IGCL 4XPGH 4LOUD 5C0IB 5INDB 2VXTH 2P45B 4U3XA 1DBML 3U2SB 1G9NH 4ICXA 1DEDA 3SBWA 1HQRB 1WE5A 2P7TB 4LVNB 2K6ZA 3QA3A 3V5KB 4C58B 4G8EA 1J0IA 3A4FA 5GJTL 4FNRA 3C6LA 4WWKC 3EOYG 2WZPD 5DQJB 4KK8D 4XPTL 1NH6A 1T2QH 1E30A 1S3RA 3ZT5A 1SLUA 2N01B 4L3ED 2VZ3A 1GCYA 3UPAA 4DKEL 3MGAA 3UO1H 1XGZA 1RURL 1S9XB 1WFJA 3QAZB 3R1GL 1SMOA 4RRPM 3TS8A 4X0KA 2HUHA 1A6UL 4OZIA 2BSED 1N8OE 1U8KA 1NCDH 1P4LA 1UOWA 1KENL 5FW8A 1RZJH 3HE7B 3FB6B 2FJGA 4AEIH 1C9SA 2W0KA 2BVQB 4R2GD 1I7TB 5I1GL 1KJ3H 3OLIA 5I76B 3KPSE 3OKLB 5HHOA 3QUYC 2QV2A 4UIKL 4NPYB 2P8MA 1PL3A 2RIKA 2DWEB 1I82A 2IGFH 2UY6B 1LO5B 4JDEB 1TZGH 2B4CH 3BP5A 4HK0B 4MCYB 4HOXA 1I1RA 15C8H 4XN5A 3C6SB 3UP1A 2JB6A 3SY0A 3DPBB 4WO4D 1U58B 3NZHL 4HIEB 4HIXL 4Z18A 2ATKA 3IXTA 3HC4H 4MZIA 3DI2B 1ORSA 5B7EA 2AJSH 4W9JC 3RHWF 4QGTA 4RISL 3NFPA 3VTMA 2J55A 3C60D 3L08A 1IFGA 1JGLL 5JOFB 1OK8A 2GYSA 3L3KA 3X14B 2VXQL 4I3SH 1UT9A 2QVMA 4FJYA 4JFYA 4ZXBC 5HHNB 2BCKB 4I48A 5IQNA 2XN9E 1AZVA 4RMUA 3QO1B 2IFFL 1VKXA 3VQLA 1NGXA 1JD7A 5KBKA 4UTAH 1PG7H 1AGBA 1BOGA 2GW5A 1F58H 5INCB 4DO5A 2VUOA 3P4OB 5IESL 2HA1A 1CE1H 4GUPB 1OV8A 4FQQA 4NENA 3T0EC 2QADD 4HS3B 2EICA 3R19A 1A8JH 1DSWA 1LDPL 3E6HB 3N3EA 4NIYE 4HOZA 2Z91B 5DMKA 5CKAA 2CLZB 2Y5EA 2CR0A 4Y9EA 3HZYA 2EYTA 3MRPA 2VKWA 5D7SH 1ND0B 5E5RB 1ZK5A 3KE0A 4MJIE 2ZJSL 3AREA 1XIWC 1S7TB 3P11H 3PQYA 4B9FA 2QBWA 3WIIH 3WYRA 1I85A 4FN0A 3FUNA 1MI5A 4X4XB 2YRBA 2H6UA 5D1ZA 2BSSA 2HLAA 3T3MB 5CGYC 3OGOE 4ZO9A 1D6EB 1HAUA 2R4SL 1YECH 3Q2WA 3RWDA 2JKXA 2WIIB 1HWWA 1LMIA 4EDWL 1DLHA 1R5VB 2LV4A 1IAKA 1AO7B 3MRGA 4FQLH 5EA0L 1N9PA 4WW2A 2EIMB 1XZ0B 3BYYA 3IMTA 3JZ7A 1TNNA 1FFQA 4J6RH 4JCWA 1UWGH 4ZFZB 1S7WB 5I6PA 1ED3B 4H88H 5F21B 4ODUB 1BGXL 5JUEH 2ICWI 3L9EA 2DH3A 1NOLA 2Q7AA 3H9SB 2CZNA 1BFVL 3BVNB 4A6YH 2XG4B 2JXMB 3HZMB 2BY3A 2XACC 2J21A 1CFVL 3B9EA 3QIWD 4FQ1H 3WNJA 4TTDC 3EH3B 3T4YB 4PWHA 2KI6A 1Z9NA 5EU6B 2KDYA 5I1DB 1NMBL 2GJZB 2X4PA 5HPMB 1F6LL 4ACPA 5EO0A 2AVFA 4Y2OB 4CVZB 1BYOA 4P49A 2XQBH 4YFLF 1PZUB 1KTCA 4TNWK 3HG0A 1ZCRA 3QXDB 1J86A 3GKZA 2ZUUA 5DJ6B 5FAAA 4R7LA 1M53A 3UAEA 1FNSL 3QFJD 4HSQA 1KCVH 1ZV9A 3SDAA 3VI3F 3RDTB 2YAMA 3QH3B 3FT0A 1NANH 2VAAA 1E9PA 4FQ2L 4PS3A 4XXDA 3ILDA 1OSPH 1ACYL 2GJ6E 4LLWB 4K9EC 1V05A 2IWEA 1BCIA 3QNXB 5E1HB 3HUJF 3MLVH 1S7VA 5DS2A 1DBBL 3SO3B 4L1HA 2P48B 2CA4A 3TEZA 4CU8A 1KJMB 1QBAA 5A2IH 2D7QA 3GI8L 1KLUA 1PEZA 3W0WB 3MGTB 4HPOL 1NC4D 2WVVA 3MV9D 5E51A 4WUUE 2SODB 4YE4H 3CXFA 4FG6C 1FVDA 4X7DC 4R4NC 4WUUD 4R8WL 4FCAA 4QJ5B 3CHPA 1X7TA 5HYQB 4H8UA 1KBBA 4X5XA 4FZEL 4QY8A 4OBSA 1W0VB 5TGBB 4TL5A 5ID1A 1A1OB 1KCRH 3CDYA 4JGNA 3L3OB 2WJ5A 5F3HB 1KIQA 3NQIA 4F8LA 3SQRA 3V52L 4YHPB 2RFXA 3C5SB 4FQXB 4JQVC 2WBJB 5B1JC 5FS5A 2LHAA 1TQSA 1TVHB 1XGYL 2PTUA 2HKHH 4WKXA 3X12B 1IILE 2GTZB 5CWSB 3HAEA 3PJLA 1A21A 5FB8A 5IEHA 1BXUA 1SPDA 3D4YA 1J1PH 3D39A 5CINH 5B39A 2IH1B 3BN3B 3PP4H 3D18B 3BWUC 2XKSA 5CGBA 5TE7L 3KR3L 3H3BC 2G3ZA 3UYRH 1ZMYA 3D6GA 4GIOA 3FTVA 1R46A 2P5WD 1T03H 2VT0A 4PJFB 3Q6FA 1BP3B 3R18A 1T1WA 5CLTA 5DUJA 4JRFA 4WW1A 1FVEB 2QSQA 4N0FA 3F65A 5CLXA 4HFWA 2JB5H 4H8WH 5DD6A 3HC0A 3JTBA 5FHBH 1AXSA 1UD3A 4B5EA 4QGYA 4QXUH 3H0TA 5AOKA 5C0AD 2J2ZB 3HRPA 1UWEL 1WAEA 4B7LA 3QXAA 4UAOC 2BJMH 3RILA 3DX7B 5FF6A 2EINB 4LPWA 5SWZE 5F1NB 1X5XA 1BX2B 4KX9A 1FFOB 1NIAA 2YHGA 3QRBA 5FA4A 1FZOB 2J5LC 4KZCA 4A6YA 4J39A 1BZOA 1U21A 5C8JB 1U8KB 3F01A 2Z91A 3WNPA 4L9LB 5DMIL 5KSAD 3SBRA 2UUDK 1RZQA 1T0MA 4XBMA 1FVCA 3F00A 2FUQA 1V3KA 2PCPB 4PGEB 4FQXC 3U4BH 5G55A 3C87A 3MBED 2WW8A 5CD3A 5CFHA 4L37A 5D2NB 5J13C 1QPPA 5ILTL 4PTUA 5HHVL 3QJSB 4E9WA 1O9ZA 1A9BA 1U3HA 4M8VA 2AXFA 3VXNA 4AITA 3L4ZA 4Y5VA 1A3RL 4F1SA 2YSSA 1OO2A 1MXDA 4GIAA 4PJXE 1R0AH 4J28A 4LFHD 3DIVA 2RH0A 4V1DD 4AYFA 3L7EB 4B96A 2OMWB 4X9BA 3NJGA 5F1IB 1L0PA 1DLHB 3FU5A 3QRGL 2DIEA 2B59B 2E86A 2JKNA 4BD4A 3MACH 1D5XB 1P5VB 4TOYH 1R3KB 2WPGA 4P5TC 5DFTA 3DKHA 1AYOA 5KVGH 1FH5L 4PJCF 4OV5A 1AANA 5ANME 2DYRB 3KPSD 5E1AB 1IB5A 3QJXA 4ODUA 4OZIF 1ZVSB 5D70H 1NIFA 4AXWB 1CC3A 1XF3A 3VCLA 4CN4A 1IAII 4JPIA 3DX6B 4ODWA 4BUGA 3NSXA 4X50A 5DEFB 1A7RL 1P4UA 4Y4FB 3HG1D 1KXTB 1IKFL 1HILA 2OMTA 1F45A 5C07A 4XC1L 5AYQA 1KGJA 2YQGA 2J1WA 3MFFA 3MREB 1HZHL 2Y3NA 3MV8B 4HWBA 4PRIB 1HYSD 4BV1A 3LH8A 4MNGB 2QMKA 1HCFX 2VW4A 3GSNB 2X05A 2ZAIA 1XMWA 3QZLA 5ETUB 1A6WH 2EQDA 1RY7B 4BA0A 4WJKB 2XXGA 1JDDA 3GSVA 3OAZH 1D9KC 1F3RB 4MD5B 5ANMA 4AM0Q 2D0HA 4BBWA 2DI7A 2QQKH 1SRDA 3OKOA 4G59C 4J3UA 1MRCH 1OY3B 2JCWA 5AAMA 4PJCA 1S7UB 4U7MA 1JXKA 4PJ9A 2I9TB 4LSVL 2EECA 1FO0L 1T7ZA 3OVUB 1XF2B