3AQEA

Crystal structure of the extracellular domain of human ramp2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
76
structure length
76
Chain Sequence
NYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for extracellular interactions between calcitonin receptor-like receptor and receptor activity-modifying protein 2 for adrenomedullin-specific binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Receptor activity-modifying protein 2
total genus 22
structure length 76
sequence length 76
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.510 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3aqeA00
2XVTA 3N7PD 3AQFA 3AQEA 3N7RC 2YX8A 3N7SC
chains in the Genus database with same CATH superfamily
3WKEA 2CRXA 3PMLA 1SKWA 9ICBA 4QZIA 3SYZA 4QIWC 2K8BB 3M8RA 4I2CA 4P0QB 2MUTB 7ICLA 5J2IA 7ICFA 4PL1A 3J81j 4OJOA 4QZFA 4WJ3B 3B0YA 2NRWA 3RTVA 2XI9A 3QXGA 4KLGA 3RH4A 9ICSA 5DBCA 4O9MA 5KFIA 5CP2A 2WB1F 4UB1A 1RPLA 4LJXA 1ZQRA 4PJ0U 3NVVA 2E8OA 5AK4A 1D9DA 4NY8A 2LM4A 2W9BA 5KFZA 1OUQA 2XY6A 2F8LA 3MBYA 2RDIA 1SXDA 5DG9A 5ALKA 1HEKA 2NYVA 2F8KA 4YR3A 4P0PA 3GIJA 2HHUA 5J0TA 4C80A 5CR0A 1F0MA 3FYHA 5KG7A 2LM1A 1ZD2P 8ICEA 3SAFA 4DL5A 1L3VA 4F4KA 2LI6A 3Q8PB 3LWMA 4O0IA 4C8MA 2BQRA 8ICNA 2JV3A 1TV9A 1MA7A 4Y2XA 3Q8KA 5KFPA 8ICVA 3MR6A 2AJQA 5AKZA 4B9VA 4NXZA 2V4QA 1YZ6A 1TAMA 2A3VA 5AHXA 2YB1A 3G6YA 1HUOA 4ECWA 4M9LA 3MGIA 3LWLA 2PFNA 2LKYA 5L1KA 1UQVA 1ZQNA 3QUQA 4UATA 3PX4A 2OEHA 1TK5A 1Y88A 3T3FA 5KFGA 2IA6A 3GIKA 1T94A 5L9XA 5DLFA 1ZQSA 3AU6A 2KJ5A 4YN4A 3IG8A 4U7CA 4TUPA 1IXRA 1LKYA 3WU2U 3T79A 4M9HA 4BGDA 2HHQA 3IG5A 3C28A 4R8UA 4RQ7A 3QUTA 2KV2A 4FFDA 1DK2A 2MUTA 5KT2A 3G6VA 4FZMA 5EE1A 2K8CB 5A0LA 4QWDA 5KFVA 4U6PA 1ECWA 2GH1A 1SV4A 1WCNA 4XUSA 3IDWA 2IOFK 2N1RA 3B9JA 2C2EA 3PSFA 4MF8A 2RHFA 3PR5B 1JX4A 3QE9Y 1X9WA 2WHEA 1L5UA 3PR4A 1LV5A 4C8KA 5B5EU 4UBBA 1NZPA 4QZHA 3RR8A 1NNLA 5D49A 5AM2A 2MU2A 2AU0A 2W43A 4JMUA 3VCBA 9ICHA 3GV8B 1VLBA 5AM1A 3N28A 3RBDA 4UW9A 3UXOA 3E0FA 3KKAA 2DUYA 5DKWA 2ZTDA 1KFDA 3F2BA 2IOHA 2JH1A 4MHVA 9ICUA 3LVVA 1F44A 3T5KA 2XGPA 1X2IA 3RJJA 9ICAA 3AQFA 8ICCA 4ED7A 2H3IA 4NLGA 5KNIA 2Y1JA 1ZOLA 1JN3A 3KHHA 4PZNA 3PSPA 4BWJA 1ZQIA 2EDUA 1L8OA 4P0QA 4IQWA 1RQLA 3PW7A 2BCUA 4FS2A 2MRLA 4DQRA 5KFWA 2KIVA 2IHNA 3U26A 1N56A 1N62A 3JPOA 5J29A 4B9SA 1KRPA 2OM6A 2ZUCA 1N48A 3PMNA 2FDRA 5ALEA 2KP7A 5EE0A 4Q8FA 9ICWA 2YB4A 1ZQUA 1BNPA 4P4MA 4GXIA 2ASLA 2J6UA 4O3QA 3OTQA 4YVZA 4TQRA 2HOQA 4DSLA 4KLHA 2KIWA 1NJXA 2ASJA 5DQIA 1PVPA 5KFSA 2XC9A 4C0ZA 2HBJA 4F5QA 4EENA 1U4BA 2PI5A 1T8EA 2QB1A 1S5LU 3L5KA 1XO1A 2PFPA 4DOBA 1ZETA 3AM9A 9ICGA 2G07A 3E2EA 5KFAA 3KKAC 3NASA 4GXJA 3WKDA 4QZCA 2DKXA 2F3NA 3RJFA 4CE6A 4P4OA 1KLNA 4PHPA 2L5YA 5J0XA 5J2GA 1ZQ1C 3SV4A 4RQ5A 4EBCA 3UPQA 1GO3F 4EX7A 3C1YA 5EWFA 3E58A 4M0AA 2ESEA 2R8JA 1B0XA 3GZFA 3KHLA 1ZQDA 3OHBA 4RPZA 4RQ3A 2DWQA 5J2DA 5KT3A 1XNSA 2HVHA 3F2CA 4CF5A 8ICHA 2LPEA 4ED1A 3WKBA 3CW2C 5ALQA 4Y2YA 8ICJA 1XS9D 4EELA 2EAOA 1UT5A 4QWAA 3TI0A 3RJHA 1KBUA 4J9NA 4PH5A 1ZQOA 2YX8A 5ALHA 2F77X 1BNOA 1QTMA 3GU3A 5ALVA 2YMLA 1J2MA 7ICHA 1HIWA 9ICXA 4EBDA 8ICYA 3TFSA 3HILA 4HAIA 3ED5A 4ECQA 5ALMA 4TQSA 1S0MA 7ICNA 3NVWA 2K89A 3RRGA 8ICGA 4E0DA 3JPQA 3ZDEA 2B21A 1SL2A 2E8MA 1Z4NA 2W3RA 1DOQA 5D4BA 1BPYA 2OH2A 5B66U 4O5KA 3T5JA 3LYSA 3HT3A 3HWTA 3WK8A 4UAUA 4BUGA 2D6FC 1KEJA 2RRDA 1ZQPA 2YMMA 7ICEA 4KLMA 4FBUA 5AICA 1K1QA 3RB3A 3KFUF 4CDGA 3N4MB 3BJYA 4NL9A 4XA5A 1LVHA 2KG5A 2HBMA 1RM6C 1L6NA 3NVYA 3H0LB 1KFSA 7ICTA 3ISDA 4DSFA 1QLNA 4ECVA 4F5RA 4Y2PA 5IIMA 5KFMA 9ICMA 5G5HA 2ZIWB 5HHHA 3BZKA 3V6JA 4I2IA 4DFDA 2H5XA 4YQWA 1ZQJA 3D2QA 7ICVA 2W7OA 3GIIA 1TK8A 2F76X 4NV0A 1TE2A 1RDFA 5AM4A 7ICMA 3KZXA 4RQNA 5E79U 4RQ0A 5AK3A 1KQQA 3N97B 4PHAA 1U9LA 5AKLA 2RP5A 4RQ1A 3EZ5A 4I27A 2E1EA 1BPZA 4A8EA 3ISBA 1JRPA 4HYKA 4NLNA 4QW8A 4ECUA 1WUDA 2KZ3A 4ELVA 1CI4A 2ZJ5A 4Q8EA 4MFFA 2B6GA 2FPKA 4GC7A 2A1AA 4YR2A 4O3OA 2KK0A 2XCPA 4O3PA 2K4PA 4AYBC 7ICOA 3SZ2A 5EE9A 3NGDA 3Q8RB 3KOOA 3TQ1A 1MQ3A 1ED1A 4NLZA 5DQGA 4NM2A 1A77A 4P2HA 1X42A 5HR6A 4Z6FA 5KFYA 1SZHA 4US9A 8ICFA 1NK7A 4PGYA 2I1QA 2GO7A 2AGQA 1UPHA 4F2SA 1V9PA 4AP9A 4Q43A 3DDHA 4KN4A 3QEBZ 2FI1A 8ICSA 2ZTCA 2LHTA 3C1ZA 2E1FA 2H3ZA 4UARA 4F4XA 1IG6A 8ICOA 2KVSA 1ZQEA 4QNLA 3UQ0A 2XGQA 4F5PA 1N5WA 2FLNA 4OCZA 5AKIA 4P4PA 1UHUA 2FLPA 4KLJA 4B9NA 3ORYA 4IRCA 5HNKA 2W9BB 4C7YA 1L3TA 5D46A 2PFQA 2ZIVA 4NM1A 1SV0C 3GDXA 2PKEA 5L1IA 3F53A 1N63A 1NJZA 4DL7A 3RB6A 3AN1A 5CRXA 2BDUA 1V97A 4MEXA 2R8GA 5HMMA 5HR7A 5IIOA 1ZQGA 9ICFA 3RBEA 4UAWA 3H7IA 4DQIA 4O5CA 5AM0A 1T7PA 4OJ6A 4ELUA 4I2HA 8ICPA 1QH9A 3TAPA 3PW0A 1NK4A 3IM1A 3GFKB 5F3XB 1Q3UA 4KLLA 5DB8A 3C5GA 2K4IA 2J6TA 5IIKA 1SL0A 4JV2A 2B0CA 3NRWA 5J2BA 3BDPA 2QLTA 4O3RA 4DSJA 5DQHA 2EZYA 4IL6U 3CRXA 4KLIA 3NVZA 2XVTA 1PK3A 1KKXA 1B22A 3DV9A 3GQCA 1NK9A 3HKZF 5T14A 2WF8A 2V9WA 5J2HA 1LKYB 4QWCA 2JZBB 2RQ5A 9ICCA 1MC8A 1PK1B 3SENA 3WK6A 4QW9A 5ALJA 2R8IA 2ISPA 1NK6A 3ONNA 3OSPA 5J2KA 3OSNA 1PUZA 3JPSA 1YT3A 4ED6A 5ALLA 1A76A 1JMSA 2AQ4A 5KG0A 5GTHU 4J9KA 5CB1A 1Z4OA 1L7PA 3AUOA 4I2BA 2K8AA 4MFCA 1FO4A 1ZQYA 4Y2JA 5KFNA 2XO7A 4MFAA 3GILA 2DBYA 5DGBA 4ACOA 1CUKA 1LB2B 1N60A 3ZDCA 2JRZA 3B0XA 7ICGA 4UQGA 4DF4A 2YQEA 1Z1VA 4G9BA 1NKCA 1D8BA 4BDPA 4NL9C 3C23A 1ZJNA 5DBAA 2ZIVB 2VANA 2LMRA 4I28A 5F9NA 1M6YA 3ISCA 2KVCA 5J8YA 4IQVA 2CPRA 5KG2A 5AM3A 4I2AA 2F1JA 2LYBA 3H40A 5KFKA 3RF9A 2KNJA 3EPIA 1COOA 3QU5A 4J9RA 1KDHA 1PK1A 1SXEA 4EBEA 4EYIB 5AI8A 3NTUA 1OXJA 1PVRA 5HHIA 3D2SA 1Q8KA 1SV0A 3THVA 4DS5A 4JWNA 2JEGA 2BCQA 2G5IB 2JXJA 2MSNA 1QSLA 8ICUA 4J9MA 5KFCA 4BX9C 4TUSA 4FZNA 2QKQA 4DF8A 3RJIA 3K1RB 2ES6A 8ICKA 3FDSA 5KFDA 7ICPA 2Y9UA 2UVRA 9ICJA 1C20A 5J2FA 1K5OA 3PY8A 5AM5A 4NLCA 2VKQA 4O5EA 4DSIA 2I5HA 2UVVA 5EWEA 3RJGA 3H4DA 4YFKA 2WAQF 3H8SA 1ZD3A 5KL8B 5AKYA 8ICMA 3MR2A 1JALA 5JRTA 4ED8A 1O03A 5G5GA 3H4BA 3H8WA 4UAYA 2GLEA 3C2MA 5C0YA 2W9AA 4KLEA 3ZD8A 4QIWF 2DF4B 3KD3A 1ZQXA 3H8JA 3JPTA 2EAMA 3M9OB 3PW5A 3F5AA 2J6SA 4PHDA 5CA7A 2P6RA 4DL2A 1NK8A 1S9FA 2HSZA 1SIJA 4DOAA 1X9SA 2G08A 4JV0A 4BJQA 2NO4A 4F2RA 3LVWA 1SWVA 3F2DA 2BPFA 4CRXA 1UA0A 3BS5B 4Y2UA 1ZQHA 3L3FX 2OCEA 4F5OA 3EUB2 4PHEA 1XU4A 2GWSA 3FAHA 7ICSA 4F5NA 5AK5A 3QU7A 2PMZC 3MFIA 5IIJA 5J0YA 3MDAA 8ICXA 1X6JA 2NRTA 5KFRA 4FE3A 3QUCA 4M9JA 3I1YA 1TAQA 5C5JA 4C4SA 4C7ZA 4ZOHC 2R8KA 3M9NB 3WK9A 4F72A 4O3MA 4FZLA 4KLUA 3V6HA 4IS7A 2FPLA 2W7PA 3T5HA 2NO5A 1KW4A 2G06A 3BZCA 3D2NA 4QJFB 4DLGA 2JHDA 1BPBA 3I28A 1S76D 2BCVA 3ICXA 3A0HU 5CJ7A 4KLDA 3PO4A 5DG7A 5K4LA 3N7SC 2ZIXB 5KT7A 5BOLA 2RDJA 2WF5A 5ALUA 4XQ8A 1AQ6A 2YN4A 2DFLA 4K4GA 5KT4A 5H2FU 3WK5A 1ZQWA 4BXOA 4O3NA 2DKZA 4RUCA 2E5SA 2UVWA 3PSTA 4NWIA 5KFHA 4DFMA 1S77D 4UB8U 1DK3A 1NI3A 2C2RA 3M8SA 4J9LA 3PX0A 4B9TA 8ICAA 3C21A 3LK9A 2K60A 3M9MB 2H3FA 4GLXA 3UQ2A 7ICJA 2ZUDA 5KFFA 5KFLA 1ZQBA 4CGZA 1Z19A 2FMQA 3HX0A 1T4GA 2JH7A 5KG4A 2BQUA 2IOFA 4NJ8A 3ZD9A 1HUZA 2W9CB 8ICZA 4M9NA 3BQ2A 1BGXT 4KLQA 4CNQA 5AKGA 4KMOB 5AIAA 4DFJA 3RJEA 1DRGA 3M6ZA 2XIDA 2OYYA 3ZDDA 3SAHA 3PV8A 1QQ5A 4IQTA 5KT5A 2KSOA 1NKBA 3C2LA 4NLBA 2AGPA 4UB2A 2Y0SF 2KMDA 4EZ9A 4M04A 2ALZA 4RQ4A 2KHVA 1Z3EB 3MFHA 1D8LA 4CCHA 4RQ8A 3MDCA 4PGXA 1JIHA 3K75D 2R8HA 1UT8A 2LYHA 4PPXA 2Z7JA 5J0OA 3FC4A 4GC6A 2KTQA 2HOIA 2W03A 1QSYA 1FFUA 3AQEA 4JB3A 1VDVA 3TADA 2O6KA 1NJWA 4UB5A 2KICA 5KT6A 9ICKA 2ZIWA 2HMXA 3EW9A 4B6JA 3MC1A 3RB0A 5TISU 4BWMA 4RT3A 2F44A 2H3QA 5AI9A 1MN8A 5FP0A 3V7LA 4ED2A 2YMQA 5J0SA 5L1LA 2JR5A 2JZBA 2IHMA 1SWWA 4C8LA 4RUAA 1WCLA 1QQ7A 4KLFA 1B4FA 3H0MB 1X6IA 3SEIA 5CHGA 3CNHA 1P7DA 3RAXA 4Q44A 1Z00B 1AROP 4QZAA 4GFJA 1ZJMA 4PL2A 2KD1A 4Z6DA 4UAZA 3TANA 5AKHA 2AGOA 5ALGA 3M7DA 1BVSA 1XO0A 5BPCA 2KZZA 4DCCA 4JUZA 1URJA 2FMPA 3UXNA 2YY6A 2BPGA 2EH9A 4R63A 2VJ5A 3SMVA 5KG5A 2KZMA 2KJ8A 2FPMA 1ZQQA 4MF2A 2PFOA 5J2AA 3MGHA 5EOZA 1L3UA 1RG6A 4NLKA 3PSIA 2ZIUB 1B43A 5AK6A 1S0OA 2IBKA 3TKAA 3LDAA 4YXJA 4UB6U 2P35A 5KFXA 2RLTA 4C8OA 1DGSA 2W8KA 3QZ7A 3MGVA 4QWEA 4QZ9A 1DGJA 2E3TA 1SL1A 4EEKA 4F71A 4I2JA 4ECRA 5ALWA 1KSPA 4DQQA 3PW2A 4F92B 1ZQFA 4F3OA 3UM9A 1ZQMA 3SI8A 1TKDA 1FEZA 5ALSA 3SD7A 1BPEA 1EXNA 4J9SA 3NS1A 3V72A 3M1YA 2WFAA 1D8YA 8ICBA 2BCRA 5ALTA 2QARA 3DEEA 4QZDA 1ZQZA 4I2GA 4F91B 4LZGA 4DO9A 4B9UA 4DLEA 3UMBA 5J0QA 1U45A 4KLTA 2WB1C 2Q0ZX 2Y0SC 2EZXA 4C8NA 1TK0A 2K4HA 5J0WA 4QWBA 4M9GA 5KG1A 2LBOA 2QB0A 5ALXA 2G0AA 1A6SA 3UXPA 4F8RA 2W55A 5J2JA 1Z1BA 3PW4A 2DPJA 4M6WB 2IMWP 4KTQA 5JUMA 2A1JA 2NRVA 3NUQA 4PZOA 3AEVA 2LYAA 1RYSA 5KFOA 5ALFA 2HDOA 7ICQA 1S0VA 1N2XA 3KHRA 1TAUA 3SAGA 2NRZA 4EZ6A 2AHOB 5CWRA 4EX6A 4PGQA 4I2FA 4OJPA 3AL0B 8ICRA 1WG8A 1WWUA 4F4WA 4F93B 4ICAA 1J97A 2P66A 2ZJAA 4UAVA 1J2NA 3N7RC 7ICRA 4B9MA 4I29A 2JEJA 3IHQB 4UB3A 4YXMA 1X40A 1TVAA 4UASA 2HCFA 4F4ZA 2PI4A 4MEYA 4Y2QA 3JPPA 3WKAA 3VC8A 5HMLA 2I6XA 2KEYA 1Z00A 2W9MA 4CF3A 4J9PA 1COKA 5J0UA 2ZIUA 4RNNA 2KFZA 1QCKA 2YMPA 1KN5A 2VA3A 2ZXHA 5DDYA 3UMGA 1ZQVA 5J0PA 5KFJA 1JXLA 1IV8A 3Q8QB 2ZUBA 4QZGA 3OPXA 4FS1A 3PNCA 7ICKA 1ZQCA 1SKSA 1ZXIA 2EANA 9ICEA 3SQIA 2KN7A 4LVSA 1S0NA 3QU2A 2C28A 4R64A 2AH5A 3QU4A 4USAA 1L7OA 3QU9A 5AKKA 3PX6A 4OJLA 2VIXA 3PO5A 3WKCA 1NK5A 5J0RA 2ASDA 2JGAA 2OWOA 4ED3A 4YG2A 5KL1B 2BPCA 2PMZF 3H8MA 4K4HA 4KX3A 4KX5A 5J2EA 2ISOA 4JV1A 3QX7A 2KJ9A 2FLLA 4GXKA 2NV3A 1NJYA 4OJ5A 2KE7A 5DGAA 3TARA 3BQTA 3BS5A 3NRZA 4M47A 3AU2A 5BOMA 5KG3A 1O08A 4ECTA 4DFPA 2Y1IA 2F1IA 2ZTEA 4IQUA 4YD1A 3EWAA 1K1SA 1PVQA 3Q8LA 2EAPA 2MAXA 2DPIA 1DXSA 4DFKA 4XRHA 2K4EA 4Y2TA 1KTQA 5IINA 1CRXA 3KBBA 2D3DA 3C2KA 5KFEA 4KMUA 2GOLA 1XSLA 4J9QA 2BGWA 1V38A 4O3SA 2JMGA 4C4TA 1XWLA 5DDMA 1U48A 5AI5A 4RQMA 2HHSA 2VA8A 3Q8SB 9ICLA 4DS4A 4US8A 2ZXIA 3OJUA 1RXVA 2FJ6A 1SZPA 8ICQA 1Q46A 3S6JA 4YD2A 4M2YA 2AXTU 3RFAA 2WTFA 2WAQC 5ALDA 5TZVA 4EYHB 4EEYA 7ICUA 3N7PD 2WF9A 5J8YC 2QB0B 2BR0A 5AIBA 4K4IA 4QZEA 2HBKA 3HRDD 8ICTA 1JROA 2VA2A 5KTQA 1ZQAA 4J03A 3RRHA 1XSPA 3QZ8A 1YZ7A 1ZD4A 1MQ2A 1IM4A 4DSKA 5EWGA 1NK0A 1WWVA 9ICQA 4YP3A 4UB4A 3ETRA 3EYZA 5IIIA 3K4GA 1QQ6A 4DOCA 3SV3A 4IR9A 5L1JA 9ICTA 2E8PA 2PXIA 4YMMA 1NZBA 3GV5B 1T3NA 4DEZA 1L7NA 4LZDA 3KHGA 1NKEA 1JI7A 2C2DA 2M9NA 5ALIA 5J2CA 1N61A 4RZRA 3G6XA 1VJ5A 3ZI4A 4OO1J 4CF4A 1SGGA 4RU9A 4JWMA 4C4RA 2EZZA 2KKPA 3HW8A 2BHNA 4I2EA 2KOBA 1L3SA 2UVUA 3BQ1A 3ETLA 4RPYA 2KKVA 4RQ2A 4DQPA 4Y2SA 2BDPA 4R8UB 1ZRMA 2FE9A 5AI4A 1H38A 1KFTA 4Z6EA 2DL0A 4RNMA 4IC9A 2KSOB 2MA1A 4X5VA 2HBLA 1TFRA 2JEFA 3HJEA 5JTIA 4DQSA 5IILA 4R66A 2CN1A 2DQNB 5KFBA 2ZIXA 1XC9A 4KLSA 1JXEA 2A19A 1QSSA 2D8CA 1IIPA 3L4PA 1X9XA 3C29A 4G3IA 1RZTA 4Y2VA 3QUBA 9ICNA 1JUDA 3T5LA 2XY5A 3IRUA 4BXOB 2ODGA 4Q45A 2HVIA 4YMNA 1S97A 1ZD5A 4ZH4A 4RT2A 1X9MA 9ICPA 2W11A 4OD0A 5DBBA 5ALNA 4RNOA 3ZDAA 2V4RA 3A0BU 2VJ4A 3FM9A 1ZQTA 3GIMA 3CYMA 3SR6A 5AI6A 3TAQA 4KN7A 3Q8MA 2ZG6A 2W3SA 5AKXA 1KL9A 4DSEA 2CXYA 9ICRA 2W9CA 2AQ0A 4FO6A 4Z6CA 3PZPA 2XICA 2W8LA 1A0PA 2E8NA 5DG8A 1RXWA 3RR7A 3RH6A 3RJKA 3IV6A 4P0PB 3CP8A 2BKEA 1ZQLA 5KFUA 3IP4B 1NOMA 2HHVA 5KAFU 2HHXA 4DL6A 3QNMA 1FIQA 3AMZA 3V7JA 5KAIU 7ICIA 1MSWD 3RH5A 2HOFA 2BCSA 4ECYA 4F50A 1PZNA 2M0NA 2NRXA 3BQ7A 1X66A 2R18A 3PVXA 3ZDBA 2WF7A 3OJSA 3TACB 1F5SA 3H0RB 4QZBA 5F9LA 2OXOA 2HI0A 5KFTA 1ZQKA 3HP6A 2H3VA 4R65A 1D9FA 4RQ6A 1N5XA 9ICIA 3JPRA 5ALOA 8ICLA 1XSNA 2KHQA 3IN5A 4GIBA 4Y2RA 4KITB 2F1HA 2XCAA 5DB6A 2HHWA 2F2AB 5ALRA 2HW3A 3EPGA 4TURA 2KFNA 1S10A 1SKRA 4YMOA 2W54A 2I9GA 2ATLA 3KZIU 3MR3A 1UA1A 3KTQA 2OHFA 3RB4A 3WK7A 2W04A 5DB9A 1CEZA 9ICVA 4DL3A 1RYRA 2HHTA 2EQYA 3TADC 5DLGA 3TFRA 3HPOA 2DGZA 3WK4A 3ALRA 1S8OA 3K1ZA 4ECSA 1ZYQA 2G5HB 2QARB 5ALZA 3HKZC 2XY7A 4ED0A 3QYPA 1T3QA 2C22A 4RPXA 5AKEA 1L7MA 2ZJ8A 4IRDA 2BZFA 2Y9TA 3D6JA 1U49A 9ICOA 5CEHA 4KLOA 4JK1A 5L1MA 4J9OA 5HP4A 3QEAZ 4YCXA 5KG6A 2A1JB 1V85A 5ALPA 3I76A 4DL4A 4TUQA 4UBCA 4F4YA 1RQNA 1L8LA 3V6KA 1RYUA 2Q4TA 5KFQA 1UCVA 3F5EA 2G09A 1WYGA 1Q3VA 2YTUA 5EE3A 1FFVA 4M6WA 3MABA 8ICIA 3M6KA 8ICWA 1OW5A 4FBTA 5DB7A 3BS7A 4ECZA 3C5FA 3RAQA 1BPXA 4I2DA 4AYBF 2BQ3A 4IRKA 4DWIA 3OGUA 4ELTA 3O0FA 4ECXA 4QZ8A 2P6UA 5GTIU 2FMSA 1U47A 3OHAA 5ALYA 3R9KA 3UMCA 1SB3C 5JU5A 4YR0A 3V7KA 2JEIA 4IR1A 3GV7B 3JPNA 3BQ0A 4B9LA 5AKJA 1BPDA 3MR5A 5AI0A 1HJPA 1ZRNA 1C7YA 2WF6A
chains in the Genus database with same CATH topology
2NV3A 4NV0A 2W7PA 2CRXA 4OJ5A 3AQFA 1KBUA 5CRXA 2H3IA 2BDUA 2G06A 4QIWC 2K8BB 4ACOA 2DGZA 5HR7A 3KZXA 4P0QB 3ALRA 1T94A 3D2NA 3PZPA 4QJFB 1NZBA 3K1ZA 2YX8A 2F77X 3PSPA 4PL1A 4OJOA 5C0YA 2XICA 2KHVA 2JHDA 4WJ3B 4OJPA 2RP5A 4P0QA 3AL0B 2KJ5A 3GU3A 2G5HB 1D8BA 1A0PA 1HIWA 3HKZC 3MGVA 2XI9A 2E1EA 2MRLA 4ICAA 3IG8A 4OJ6A 4A8EA 4QIWF 3ICXA 4U7CA 2ZIVB 1PVQA 4OO1J 2Z7JA 3N7RC 3N7SC 2ZIXB 2DF4B 3CP8A 4P0PB 2WB1F 2KKPA 2KVCA 1WUDA 2W03A 3IP4B 3PSIA 2ZIUB 3T79A 2HOIA 3AQEA 2KOBA 2K4EA 2OM6A 2CPRA 2K89A 3IG5A 1Q3UA 3C28A 3F5AA 1CRXA 2KKVA 2HOFA 2KV2A 2KICA 2M0NA 2LYBA 2ZIWA 2HMXA 2YB4A 1OUQA 2E5SA 3RF9A 2KNJA 2R18A 2GOLA 2F8LA 2K4IA 4FZMA 3VC8A 2K8CB 2KEYA 3PSTA 2H3QA 4NWIA 5A0LA 2G08A 4AYBC 3NRWA 4BJQA 4U6PA 1ECWA 2GH1A 2HOQA 2JMGA 2MA1A 2KIWA 3DEEA 4IC9A 2Q4TA 2OH2A 2HBLA 2ZIUA 1HEKA 3F5EA 3H0RB 2G09A 4P0PA 2OXOA 1Q3VA 2CN1A 2ZXHA 3LYSA 2DQNB 2N1RA 3D2SA 1PVRA 3LVWA 2ZIXA 1ED1A 3F2DA 2H3VA 2ZXIA 1PVPA 4C0ZA 4CRXA 2HBJA 5HR6A 4BUGA 2D6FC 3M6KA 3H0MB 3PSFA 2RRDA 1SZHA 1IIPA 2RHFA 3L3FX 3C29A 2G5IB 2H3FA 3OPXA 2KHQA 2WB1C 3SAFA 1UPHA 3IN5A 3CRXA 2G07A 2XVTA 2Y0SC 4BX9C 1P7DA 3KFUF 3RFAA 4AYBF 4CDGA 2K4HA 4FZNA 2WAQC 3SQIA 4CGZA 1Z19A 3O0FA 1MA7A 3HKZF 2PMZC 2LHTA 4GFJA 2JH7A 2LBOA 4PL2A 5T14A 2F2AB 2KD1A 2E1FA 2H3ZA 2G0AA 1ZQ1C 2HBMA 1A6SA 1GO3F 3N7PD 1L6NA 1TAMA 3M7DA 4JMUA 4QNLA 3H0LB 3VCBA 1XO0A 3SAGA 2A3VA 3GZFA 1Z1BA 2YB1A 1URJA 2HBKA 4NLCA 4KMOB 4OJLA 2VKQA 2VIXA 2VJ5A 3NUQA 3M6ZA 3ONNA 1DRGA 2XIDA 4FE3A 3SMVA 3F2CA 2W04A 1XNSA 2VJ4A 2OYYA 2ZIWB 1YT3A 3E0FA 2KJ8A 2LYAA 2JGAA 5KL1B 2ZIVA 3F2BA 2PMZF 3D2QA 3SAHA 4KX3A 3CYMA 4KX5A 2W7OA 2WAQF 2ZG6A 2JH1A 4NLBA 4O3MA 2LKYA 4FZLA 2F76X 2K8AA 3LVVA 1F44A 3F53A 2Y0SF 2KJ9A 5KL8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XVT A;  3N7P D;  3AQF A;  3AQE A;  3N7R C;  2YX8 A;  3N7S C; 
#chains in the Genus database with same CATH topology
 3WKE A;  2CRX A;  3PML A;  1SKW A;  9ICB A;  4QZI A;  3SYZ A;  4QIW C;  2K8B B;  3M8R A;  4I2C A;  4P0Q B;  2MUT B;  7ICL A;  5J2I A;  7ICF A;  4PL1 A;  3J81 j;  4OJO A;  4QZF A;  4WJ3 B;  3B0Y A;  2NRW A;  3RTV A;  2XI9 A;  3QXG A;  4KLG A;  3RH4 A;  9ICS A;  5DBC A;  4O9M A;  5KFI A;  5CP2 A;  2WB1 F;  4UB1 A;  1RPL A;  4LJX A;  1ZQR A;  4PJ0 U;  3NVV A;  2E8O A;  5AK4 A;  1D9D A;  4NY8 A;  2LM4 A;  2W9B A;  5KFZ A;  1OUQ A;  2XY6 A;  2F8L A;  3MBY A;  2RDI A;  1SXD A;  5DG9 A;  5ALK A;  1HEK A;  2NYV A;  2F8K A;  4YR3 A;  4P0P A;  3GIJ A;  2HHU A;  5J0T A;  4C80 A;  5CR0 A;  1F0M A;  3FYH A;  5KG7 A;  2LM1 A;  1ZD2 P;  8ICE A;  3SAF A;  4DL5 A;  1L3V A;  4F4K A;  2LI6 A;  3Q8P B;  3LWM A;  4O0I A;  4C8M A;  2BQR A;  8ICN A;  2JV3 A;  1TV9 A;  1MA7 A;  4Y2X A;  3Q8K A;  5KFP A;  8ICV A;  3MR6 A;  2AJQ A;  5AKZ A;  4B9V A;  4NXZ A;  2V4Q A;  1YZ6 A;  1TAM A;  2A3V A;  5AHX A;  2YB1 A;  3G6Y A;  1HUO A;  4ECW A;  4M9L A;  3MGI A;  3LWL A;  2PFN A;  2LKY A;  5L1K A;  1UQV A;  1ZQN A;  3QUQ A;  4UAT A;  3PX4 A;  2OEH A;  1TK5 A;  1Y88 A;  3T3F A;  5KFG A;  2IA6 A;  3GIK A;  1T94 A;  5L9X A;  5DLF A;  1ZQS A;  3AU6 A;  2KJ5 A;  4YN4 A;  3IG8 A;  4U7C A;  4TUP A;  1IXR A;  1LKY A;  3WU2 U;  3T79 A;  4M9H A;  4BGD A;  2HHQ A;  3IG5 A;  3C28 A;  4R8U A;  4RQ7 A;  3QUT A;  2KV2 A;  4FFD A;  1DK2 A;  2MUT A;  5KT2 A;  3G6V A;  4FZM A;  5EE1 A;  2K8C B;  5A0L A;  4QWD A;  5KFV A;  4U6P A;  1ECW A;  2GH1 A;  1SV4 A;  1WCN A;  4XUS A;  3IDW A;  2IOF K;  2N1R A;  3B9J A;  2C2E A;  3PSF A;  4MF8 A;  2RHF A;  3PR5 B;  1JX4 A;  3QE9 Y;  1X9W A;  2WHE A;  1L5U A;  3PR4 A;  1LV5 A;  4C8K A;  5B5E U;  4UBB A;  1NZP A;  4QZH A;  3RR8 A;  1NNL A;  5D49 A;  5AM2 A;  2MU2 A;  2AU0 A;  2W43 A;  4JMU A;  3VCB A;  9ICH A;  3GV8 B;  1VLB A;  5AM1 A;  3N28 A;  3RBD A;  4UW9 A;  3UXO A;  3E0F A;  3KKA A;  2DUY A;  5DKW A;  2ZTD A;  1KFD A;  3F2B A;  2IOH A;  2JH1 A;  4MHV A;  9ICU A;  3LVV A;  1F44 A;  3T5K A;  2XGP A;  1X2I A;  3RJJ A;  9ICA A;  3AQF A;  8ICC A;  4ED7 A;  2H3I A;  4NLG A;  5KNI A;  2Y1J A;  1ZOL A;  1JN3 A;  3KHH A;  4PZN A;  3PSP A;  4BWJ A;  1ZQI A;  2EDU A;  1L8O A;  4P0Q A;  4IQW A;  1RQL A;  3PW7 A;  2BCU A;  4FS2 A;  2MRL A;  4DQR A;  5KFW A;  2KIV A;  2IHN A;  3U26 A;  1N56 A;  1N62 A;  3JPO A;  5J29 A;  4B9S A;  1KRP A;  2OM6 A;  2ZUC A;  1N48 A;  3PMN A;  2FDR A;  5ALE A;  2KP7 A;  5EE0 A;  4Q8F A;  9ICW A;  2YB4 A;  1ZQU A;  1BNP A;  4P4M A;  4GXI A;  2ASL A;  2J6U A;  4O3Q A;  3OTQ A;  4YVZ A;  4TQR A;  2HOQ A;  4DSL A;  4KLH A;  2KIW A;  1NJX A;  2ASJ A;  5DQI A;  1PVP A;  5KFS A;  2XC9 A;  4C0Z A;  2HBJ A;  4F5Q A;  4EEN A;  1U4B A;  2PI5 A;  1T8E A;  2QB1 A;  1S5L U;  3L5K A;  1XO1 A;  2PFP A;  4DOB A;  1ZET A;  3AM9 A;  9ICG A;  2G07 A;  3E2E A;  5KFA A;  3KKA C;  3NAS A;  4GXJ A;  3WKD A;  4QZC A;  2DKX A;  2F3N A;  3RJF A;  4CE6 A;  4P4O A;  1KLN A;  4PHP A;  2L5Y A;  5J0X A;  5J2G A;  1ZQ1 C;  3SV4 A;  4RQ5 A;  4EBC A;  3UPQ A;  1GO3 F;  4EX7 A;  3C1Y A;  5EWF A;  3E58 A;  4M0A A;  2ESE A;  2R8J A;  1B0X A;  3GZF A;  3KHL A;  1ZQD A;  3OHB A;  4RPZ A;  4RQ3 A;  2DWQ A;  5J2D A;  5KT3 A;  1XNS A;  2HVH A;  3F2C A;  4CF5 A;  8ICH A;  2LPE A;  4ED1 A;  3WKB A;  3CW2 C;  5ALQ A;  4Y2Y A;  8ICJ A;  1XS9 D;  4EEL A;  2EAO A;  1UT5 A;  4QWA A;  3TI0 A;  3RJH A;  1KBU A;  4J9N A;  4PH5 A;  1ZQO A;  2YX8 A;  5ALH A;  2F77 X;  1BNO A;  1QTM A;  3GU3 A;  5ALV A;  2YML A;  1J2M A;  7ICH A;  1HIW A;  9ICX A;  4EBD A;  8ICY A;  3TFS A;  3HIL A;  4HAI A;  3ED5 A;  4ECQ A;  5ALM A;  4TQS A;  1S0M A;  7ICN A;  3NVW A;  2K89 A;  3RRG A;  8ICG A;  4E0D A;  3JPQ A;  3ZDE A;  2B21 A;  1SL2 A;  2E8M A;  1Z4N A;  2W3R A;  1DOQ A;  5D4B A;  1BPY A;  2OH2 A;  5B66 U;  4O5K A;  3T5J A;  3LYS A;  3HT3 A;  3HWT A;  3WK8 A;  4UAU A;  4BUG A;  2D6F C;  1KEJ A;  2RRD A;  1ZQP A;  2YMM A;  7ICE A;  4KLM A;  4FBU A;  5AIC A;  1K1Q A;  3RB3 A;  3KFU F;  4CDG A;  3N4M B;  3BJY A;  4NL9 A;  4XA5 A;  1LVH A;  2KG5 A;  2HBM A;  1RM6 C;  1L6N A;  3NVY A;  3H0L B;  1KFS A;  7ICT A;  3ISD A;  4DSF A;  1QLN A;  4ECV A;  4F5R A;  4Y2P A;  5IIM A;  5KFM A;  9ICM A;  5G5H A;  2ZIW B;  5HHH A;  3BZK A;  3V6J A;  4I2I A;  4DFD A;  2H5X A;  4YQW A;  1ZQJ A;  3D2Q A;  7ICV A;  2W7O A;  3GII A;  1TK8 A;  2F76 X;  4NV0 A;  1TE2 A;  1RDF A;  5AM4 A;  7ICM A;  3KZX A;  4RQN A;  5E79 U;  4RQ0 A;  5AK3 A;  1KQQ A;  3N97 B;  4PHA A;  1U9L A;  5AKL A;  2RP5 A;  4RQ1 A;  3EZ5 A;  4I27 A;  2E1E A;  1BPZ A;  4A8E A;  3ISB A;  1JRP A;  4HYK A;  4NLN A;  4QW8 A;  4ECU A;  1WUD A;  2KZ3 A;  4ELV A;  1CI4 A;  2ZJ5 A;  4Q8E A;  4MFF A;  2B6G A;  2FPK A;  4GC7 A;  2A1A A;  4YR2 A;  4O3O A;  2KK0 A;  2XCP A;  4O3P A;  2K4P A;  4AYB C;  7ICO A;  3SZ2 A;  5EE9 A;  3NGD A;  3Q8R B;  3KOO A;  3TQ1 A;  1MQ3 A;  1ED1 A;  4NLZ A;  5DQG A;  4NM2 A;  1A77 A;  4P2H A;  1X42 A;  5HR6 A;  4Z6F A;  5KFY A;  1SZH A;  4US9 A;  8ICF A;  1NK7 A;  4PGY A;  2I1Q A;  2GO7 A;  2AGQ A;  1UPH A;  4F2S A;  1V9P A;  4AP9 A;  4Q43 A;  3DDH A;  4KN4 A;  3QEB Z;  2FI1 A;  8ICS A;  2ZTC A;  2LHT A;  3C1Z A;  2E1F A;  2H3Z A;  4UAR A;  4F4X A;  1IG6 A;  8ICO A;  2KVS A;  1ZQE A;  4QNL A;  3UQ0 A;  2XGQ A;  4F5P A;  1N5W A;  2FLN A;  4OCZ A;  5AKI A;  4P4P A;  1UHU A;  2FLP A;  4KLJ A;  4B9N A;  3ORY A;  4IRC A;  5HNK A;  2W9B B;  4C7Y A;  1L3T A;  5D46 A;  2PFQ A;  2ZIV A;  4NM1 A;  1SV0 C;  3GDX A;  2PKE A;  5L1I A;  3F53 A;  1N63 A;  1NJZ A;  4DL7 A;  3RB6 A;  3AN1 A;  5CRX A;  2BDU A;  1V97 A;  4MEX A;  2R8G A;  5HMM A;  5HR7 A;  5IIO A;  1ZQG A;  9ICF A;  3RBE A;  4UAW A;  3H7I A;  4DQI A;  4O5C A;  5AM0 A;  1T7P A;  4OJ6 A;  4ELU A;  4I2H A;  8ICP A;  1QH9 A;  3TAP A;  3PW0 A;  1NK4 A;  3IM1 A;  3GFK B;  5F3X B;  1Q3U A;  4KLL A;  5DB8 A;  3C5G A;  2K4I A;  2J6T A;  5IIK A;  1SL0 A;  4JV2 A;  2B0C A;  3NRW A;  5J2B A;  3BDP A;  2QLT A;  4O3R A;  4DSJ A;  5DQH A;  2EZY A;  4IL6 U;  3CRX A;  4KLI A;  3NVZ A;  2XVT A;  1PK3 A;  1KKX A;  1B22 A;  3DV9 A;  3GQC A;  1NK9 A;  3HKZ F;  5T14 A;  2WF8 A;  2V9W A;  5J2H A;  1LKY B;  4QWC A;  2JZB B;  2RQ5 A;  9ICC A;  1MC8 A;  1PK1 B;  3SEN A;  3WK6 A;  4QW9 A;  5ALJ A;  2R8I A;  2ISP A;  1NK6 A;  3ONN A;  3OSP A;  5J2K A;  3OSN A;  1PUZ A;  3JPS A;  1YT3 A;  4ED6 A;  5ALL A;  1A76 A;  1JMS A;  2AQ4 A;  5KG0 A;  5GTH U;  4J9K A;  5CB1 A;  1Z4O A;  1L7P A;  3AUO A;  4I2B A;  2K8A A;  4MFC A;  1FO4 A;  1ZQY A;  4Y2J A;  5KFN A;  2XO7 A;  4MFA A;  3GIL A;  2DBY A;  5DGB A;  4ACO A;  1CUK A;  1LB2 B;  1N60 A;  3ZDC A;  2JRZ A;  3B0X A;  7ICG A;  4UQG A;  4DF4 A;  2YQE A;  1Z1V A;  4G9B A;  1NKC A;  1D8B A;  4BDP A;  4NL9 C;  3C23 A;  1ZJN A;  5DBA A;  2ZIV B;  2VAN A;  2LMR A;  4I28 A;  5F9N A;  1M6Y A;  3ISC A;  2KVC A;  5J8Y A;  4IQV A;  2CPR A;  5KG2 A;  5AM3 A;  4I2A A;  2F1J A;  2LYB A;  3H40 A;  5KFK A;  3RF9 A;  2KNJ A;  3EPI A;  1COO A;  3QU5 A;  4J9R A;  1KDH A;  1PK1 A;  1SXE A;  4EBE A;  4EYI B;  5AI8 A;  3NTU A;  1OXJ A;  1PVR A;  5HHI A;  3D2S A;  1Q8K A;  1SV0 A;  3THV A;  4DS5 A;  4JWN A;  2JEG A;  2BCQ A;  2G5I B;  2JXJ A;  2MSN A;  1QSL A;  8ICU A;  4J9M A;  5KFC A;  4BX9 C;  4TUS A;  4FZN A;  2QKQ A;  4DF8 A;  3RJI A;  3K1R B;  2ES6 A;  8ICK A;  3FDS A;  5KFD A;  7ICP A;  2Y9U A;  2UVR A;  9ICJ A;  1C20 A;  5J2F A;  1K5O A;  3PY8 A;  5AM5 A;  4NLC A;  2VKQ A;  4O5E A;  4DSI A;  2I5H A;  2UVV A;  5EWE A;  3RJG A;  3H4D A;  4YFK A;  2WAQ F;  3H8S A;  1ZD3 A;  5KL8 B;  5AKY A;  8ICM A;  3MR2 A;  1JAL A;  5JRT A;  4ED8 A;  1O03 A;  5G5G A;  3H4B A;  3H8W A;  4UAY A;  2GLE A;  3C2M A;  5C0Y A;  2W9A A;  4KLE A;  3ZD8 A;  4QIW F;  2DF4 B;  3KD3 A;  1ZQX A;  3H8J A;  3JPT A;  2EAM A;  3M9O B;  3PW5 A;  3F5A A;  2J6S A;  4PHD A;  5CA7 A;  2P6R A;  4DL2 A;  1NK8 A;  1S9F A;  2HSZ A;  1SIJ A;  4DOA A;  1X9S A;  2G08 A;  4JV0 A;  4BJQ A;  2NO4 A;  4F2R A;  3LVW A;  1SWV A;  3F2D A;  2BPF A;  4CRX A;  1UA0 A;  3BS5 B;  4Y2U A;  1ZQH A;  3L3F X;  2OCE A;  4F5O A;  3EUB 2;  4PHE A;  1XU4 A;  2GWS A;  3FAH A;  7ICS A;  4F5N A;  5AK5 A;  3QU7 A;  2PMZ C;  3MFI A;  5IIJ A;  5J0Y A;  3MDA A;  8ICX A;  1X6J A;  2NRT A;  5KFR A;  4FE3 A;  3QUC A;  4M9J A;  3I1Y A;  1TAQ A;  5C5J A;  4C4S A;  4C7Z A;  4ZOH C;  2R8K A;  3M9N B;  3WK9 A;  4F72 A;  4O3M A;  4FZL A;  4KLU A;  3V6H A;  4IS7 A;  2FPL A;  2W7P A;  3T5H A;  2NO5 A;  1KW4 A;  2G06 A;  3BZC A;  3D2N A;  4QJF B;  4DLG A;  2JHD A;  1BPB A;  3I28 A;  1S76 D;  2BCV A;  3ICX A;  3A0H U;  5CJ7 A;  4KLD A;  3PO4 A;  5DG7 A;  5K4L A;  3N7S C;  2ZIX B;  5KT7 A;  5BOL A;  2RDJ A;  2WF5 A;  5ALU A;  4XQ8 A;  1AQ6 A;  2YN4 A;  2DFL A;  4K4G A;  5KT4 A;  5H2F U;  3WK5 A;  1ZQW A;  4BXO A;  4O3N A;  2DKZ A;  4RUC A;  2E5S A;  2UVW A;  3PST A;  4NWI A;  5KFH A;  4DFM A;  1S77 D;  4UB8 U;  1DK3 A;  1NI3 A;  2C2R A;  3M8S A;  4J9L A;  3PX0 A;  4B9T A;  8ICA A;  3C21 A;  3LK9 A;  2K60 A;  3M9M B;  2H3F A;  4GLX A;  3UQ2 A;  7ICJ A;  2ZUD A;  5KFF A;  5KFL A;  1ZQB A;  4CGZ A;  1Z19 A;  2FMQ A;  3HX0 A;  1T4G A;  2JH7 A;  5KG4 A;  2BQU A;  2IOF A;  4NJ8 A;  3ZD9 A;  1HUZ A;  2W9C B;  8ICZ A;  4M9N A;  3BQ2 A;  1BGX T;  4KLQ A;  4CNQ A;  5AKG A;  4KMO B;  5AIA A;  4DFJ A;  3RJE A;  1DRG A;  3M6Z A;  2XID A;  2OYY A;  3ZDD A;  3SAH A;  3PV8 A;  1QQ5 A;  4IQT A;  5KT5 A;  2KSO A;  1NKB A;  3C2L A;  4NLB A;  2AGP A;  4UB2 A;  2Y0S F;  2KMD A;  4EZ9 A;  4M04 A;  2ALZ A;  4RQ4 A;  2KHV A;  1Z3E B;  3MFH A;  1D8L A;  4CCH A;  4RQ8 A;  3MDC A;  4PGX A;  1JIH A;  3K75 D;  2R8H A;  1UT8 A;  2LYH A;  4PPX A;  2Z7J A;  5J0O A;  3FC4 A;  4GC6 A;  2KTQ A;  2HOI A;  2W03 A;  1QSY A;  1FFU A;  3AQE A;  4JB3 A;  1VDV A;  3TAD A;  2O6K A;  1NJW A;  4UB5 A;  2KIC A;  5KT6 A;  9ICK A;  2ZIW A;  2HMX A;  3EW9 A;  4B6J A;  3MC1 A;  3RB0 A;  5TIS U;  4BWM A;  4RT3 A;  2F44 A;  2H3Q A;  5AI9 A;  1MN8 A;  5FP0 A;  3V7L A;  4ED2 A;  2YMQ A;  5J0S A;  5L1L A;  2JR5 A;  2JZB A;  2IHM A;  1SWW A;  4C8L A;  4RUA A;  1WCL A;  1QQ7 A;  4KLF A;  1B4F A;  3H0M B;  1X6I A;  3SEI A;  5CHG A;  3CNH A;  1P7D A;  3RAX A;  4Q44 A;  1Z00 B;  1ARO P;  4QZA A;  4GFJ A;  1ZJM A;  4PL2 A;  2KD1 A;  4Z6D A;  4UAZ A;  3TAN A;  5AKH A;  2AGO A;  5ALG A;  3M7D A;  1BVS A;  1XO0 A;  5BPC A;  2KZZ A;  4DCC A;  4JUZ A;  1URJ A;  2FMP A;  3UXN A;  2YY6 A;  2BPG A;  2EH9 A;  4R63 A;  2VJ5 A;  3SMV A;  5KG5 A;  2KZM A;  2KJ8 A;  2FPM A;  1ZQQ A;  4MF2 A;  2PFO A;  5J2A A;  3MGH A;  5EOZ A;  1L3U A;  1RG6 A;  4NLK A;  3PSI A;  2ZIU B;  1B43 A;  5AK6 A;  1S0O A;  2IBK A;  3TKA A;  3LDA A;  4YXJ A;  4UB6 U;  2P35 A;  5KFX A;  2RLT A;  4C8O A;  1DGS A;  2W8K A;  3QZ7 A;  3MGV A;  4QWE A;  4QZ9 A;  1DGJ A;  2E3T A;  1SL1 A;  4EEK A;  4F71 A;  4I2J A;  4ECR A;  5ALW A;  1KSP A;  4DQQ A;  3PW2 A;  4F92 B;  1ZQF A;  4F3O A;  3UM9 A;  1ZQM A;  3SI8 A;  1TKD A;  1FEZ A;  5ALS A;  3SD7 A;  1BPE A;  1EXN A;  4J9S A;  3NS1 A;  3V72 A;  3M1Y A;  2WFA A;  1D8Y A;  8ICB A;  2BCR A;  5ALT A;  2QAR A;  3DEE A;  4QZD A;  1ZQZ A;  4I2G A;  4F91 B;  4LZG A;  4DO9 A;  4B9U A;  4DLE A;  3UMB A;  5J0Q A;  1U45 A;  4KLT A;  2WB1 C;  2Q0Z X;  2Y0S C;  2EZX A;  4C8N A;  1TK0 A;  2K4H A;  5J0W A;  4QWB A;  4M9G A;  5KG1 A;  2LBO A;  2QB0 A;  5ALX A;  2G0A A;  1A6S A;  3UXP A;  4F8R A;  2W55 A;  5J2J A;  1Z1B A;  3PW4 A;  2DPJ A;  4M6W B;  2IMW P;  4KTQ A;  5JUM A;  2A1J A;  2NRV A;  3NUQ A;  4PZO A;  3AEV A;  2LYA A;  1RYS A;  5KFO A;  5ALF A;  2HDO A;  7ICQ A;  1S0V A;  1N2X A;  3KHR A;  1TAU A;  3SAG A;  2NRZ A;  4EZ6 A;  2AHO B;  5CWR A;  4EX6 A;  4PGQ A;  4I2F A;  4OJP A;  3AL0 B;  8ICR A;  1WG8 A;  1WWU A;  4F4W A;  4F93 B;  4ICA A;  1J97 A;  2P66 A;  2ZJA A;  4UAV A;  1J2N A;  3N7R C;  7ICR A;  4B9M A;  4I29 A;  2JEJ A;  3IHQ B;  4UB3 A;  4YXM A;  1X40 A;  1TVA A;  4UAS A;  2HCF A;  4F4Z A;  2PI4 A;  4MEY A;  4Y2Q A;  3JPP A;  3WKA A;  3VC8 A;  5HML A;  2I6X A;  2KEY A;  1Z00 A;  2W9M A;  4CF3 A;  4J9P A;  1COK A;  5J0U A;  2ZIU A;  4RNN A;  2KFZ A;  1QCK A;  2YMP A;  1KN5 A;  2VA3 A;  2ZXH A;  5DDY A;  3UMG A;  1ZQV A;  5J0P A;  5KFJ A;  1JXL A;  1IV8 A;  3Q8Q B;  2ZUB A;  4QZG A;  3OPX A;  4FS1 A;  3PNC A;  7ICK A;  1ZQC A;  1SKS A;  1ZXI A;  2EAN A;  9ICE A;  3SQI A;  2KN7 A;  4LVS A;  1S0N A;  3QU2 A;  2C28 A;  4R64 A;  2AH5 A;  3QU4 A;  4USA A;  1L7O A;  3QU9 A;  5AKK A;  3PX6 A;  4OJL A;  2VIX A;  3PO5 A;  3WKC A;  1NK5 A;  5J0R A;  2ASD A;  2JGA A;  2OWO A;  4ED3 A;  4YG2 A;  5KL1 B;  2BPC A;  2PMZ F;  3H8M A;  4K4H A;  4KX3 A;  4KX5 A;  5J2E A;  2ISO A;  4JV1 A;  3QX7 A;  2KJ9 A;  2FLL A;  4GXK A;  2NV3 A;  1NJY A;  4OJ5 A;  2KE7 A;  5DGA A;  3TAR A;  3BQT A;  3BS5 A;  3NRZ A;  4M47 A;  3AU2 A;  5BOM A;  5KG3 A;  1O08 A;  4ECT A;  4DFP A;  2Y1I A;  2F1I A;  2ZTE A;  4IQU A;  4YD1 A;  3EWA A;  1K1S A;  1PVQ A;  3Q8L A;  2EAP A;  2MAX A;  2DPI A;  1DXS A;  4DFK A;  4XRH A;  2K4E A;  4Y2T A;  1KTQ A;  5IIN A;  1CRX A;  3KBB A;  2D3D A;  3C2K A;  5KFE A;  4KMU A;  2GOL A;  1XSL A;  4J9Q A;  2BGW A;  1V38 A;  4O3S A;  2JMG A;  4C4T A;  1XWL A;  5DDM A;  1U48 A;  5AI5 A;  4RQM A;  2HHS A;  2VA8 A;  3Q8S B;  9ICL A;  4DS4 A;  4US8 A;  2ZXI A;  3OJU A;  1RXV A;  2FJ6 A;  1SZP A;  8ICQ A;  1Q46 A;  3S6J A;  4YD2 A;  4M2Y A;  2AXT U;  3RFA A;  2WTF A;  2WAQ C;  5ALD A;  5TZV A;  4EYH B;  4EEY A;  7ICU A;  3N7P D;  2WF9 A;  5J8Y C;  2QB0 B;  2BR0 A;  5AIB A;  4K4I A;  4QZE A;  2HBK A;  3HRD D;  8ICT A;  1JRO A;  2VA2 A;  5KTQ A;  1ZQA A;  4J03 A;  3RRH A;  1XSP A;  3QZ8 A;  1YZ7 A;  1ZD4 A;  1MQ2 A;  1IM4 A;  4DSK A;  5EWG A;  1NK0 A;  1WWV A;  9ICQ A;  4YP3 A;  4UB4 A;  3ETR A;  3EYZ A;  5III A;  3K4G A;  1QQ6 A;  4DOC A;  3SV3 A;  4IR9 A;  5L1J A;  9ICT A;  2E8P A;  2PXI A;  4YMM A;  1NZB A;  3GV5 B;  1T3N A;  4DEZ A;  1L7N A;  4LZD A;  3KHG A;  1NKE A;  1JI7 A;  2C2D A;  2M9N A;  5ALI A;  5J2C A;  1N61 A;  4RZR A;  3G6X A;  1VJ5 A;  3ZI4 A;  4OO1 J;  4CF4 A;  1SGG A;  4RU9 A;  4JWM A;  4C4R A;  2EZZ A;  2KKP A;  3HW8 A;  2BHN A;  4I2E A;  2KOB A;  1L3S A;  2UVU A;  3BQ1 A;  3ETL A;  4RPY A;  2KKV A;  4RQ2 A;  4DQP A;  4Y2S A;  2BDP A;  4R8U B;  1ZRM A;  2FE9 A;  5AI4 A;  1H38 A;  1KFT A;  4Z6E A;  2DL0 A;  4RNM A;  4IC9 A;  2KSO B;  2MA1 A;  4X5V A;  2HBL A;  1TFR A;  2JEF A;  3HJE A;  5JTI A;  4DQS A;  5IIL A;  4R66 A;  2CN1 A;  2DQN B;  5KFB A;  2ZIX A;  1XC9 A;  4KLS A;  1JXE A;  2A19 A;  1QSS A;  2D8C A;  1IIP A;  3L4P A;  1X9X A;  3C29 A;  4G3I A;  1RZT A;  4Y2V A;  3QUB A;  9ICN A;  1JUD A;  3T5L A;  2XY5 A;  3IRU A;  4BXO B;  2ODG A;  4Q45 A;  2HVI A;  4YMN A;  1S97 A;  1ZD5 A;  4ZH4 A;  4RT2 A;  1X9M A;  9ICP A;  2W11 A;  4OD0 A;  5DBB A;  5ALN A;  4RNO A;  3ZDA A;  2V4R A;  3A0B U;  2VJ4 A;  3FM9 A;  1ZQT A;  3GIM A;  3CYM A;  3SR6 A;  5AI6 A;  3TAQ A;  4KN7 A;  3Q8M A;  2ZG6 A;  2W3S A;  5AKX A;  1KL9 A;  4DSE A;  2CXY A;  9ICR A;  2W9C A;  2AQ0 A;  4FO6 A;  4Z6C A;  3PZP A;  2XIC A;  2W8L A;  1A0P A;  2E8N A;  5DG8 A;  1RXW A;  3RR7 A;  3RH6 A;  3RJK A;  3IV6 A;  4P0P B;  3CP8 A;  2BKE A;  1ZQL A;  5KFU A;  3IP4 B;  1NOM A;  2HHV A;  5KAF U;  2HHX A;  4DL6 A;  3QNM A;  1FIQ A;  3AMZ A;  3V7J A;  5KAI U;  7ICI A;  1MSW D;  3RH5 A;  2HOF A;  2BCS A;  4ECY A;  4F50 A;  1PZN A;  2M0N A;  2NRX A;  3BQ7 A;  1X66 A;  2R18 A;  3PVX A;  3ZDB A;  2WF7 A;  3OJS A;  3TAC B;  1F5S A;  3H0R B;  4QZB A;  5F9L A;  2OXO A;  2HI0 A;  5KFT A;  1ZQK A;  3HP6 A;  2H3V A;  4R65 A;  1D9F A;  4RQ6 A;  1N5X A;  9ICI A;  3JPR A;  5ALO A;  8ICL A;  1XSN A;  2KHQ A;  3IN5 A;  4GIB A;  4Y2R A;  4KIT B;  2F1H A;  2XCA A;  5DB6 A;  2HHW A;  2F2A B;  5ALR A;  2HW3 A;  3EPG A;  4TUR A;  2KFN A;  1S10 A;  1SKR A;  4YMO A;  2W54 A;  2I9G A;  2ATL A;  3KZI U;  3MR3 A;  1UA1 A;  3KTQ A;  2OHF A;  3RB4 A;  3WK7 A;  2W04 A;  5DB9 A;  1CEZ A;  9ICV A;  4DL3 A;  1RYR A;  2HHT A;  2EQY A;  3TAD C;  5DLG A;  3TFR A;  3HPO A;  2DGZ A;  3WK4 A;  3ALR A;  1S8O A;  3K1Z A;  4ECS A;  1ZYQ A;  2G5H B;  2QAR B;  5ALZ A;  3HKZ C;  2XY7 A;  4ED0 A;  3QYP A;  1T3Q A;  2C22 A;  4RPX A;  5AKE A;  1L7M A;  2ZJ8 A;  4IRD A;  2BZF A;  2Y9T A;  3D6J A;  1U49 A;  9ICO A;  5CEH A;  4KLO A;  4JK1 A;  5L1M A;  4J9O A;  5HP4 A;  3QEA Z;  4YCX A;  5KG6 A;  2A1J B;  1V85 A;  5ALP A;  3I76 A;  4DL4 A;  4TUQ A;  4UBC A;  4F4Y A;  1RQN A;  1L8L A;  3V6K A;  1RYU A;  2Q4T A;  5KFQ A;  1UCV A;  3F5E A;  2G09 A;  1WYG A;  1Q3V A;  2YTU A;  5EE3 A;  1FFV A;  4M6W A;  3MAB A;  8ICI A;  3M6K A;  8ICW A;  1OW5 A;  4FBT A;  5DB7 A;  3BS7 A;  4ECZ A;  3C5F A;  3RAQ A;  1BPX A;  4I2D A;  4AYB F;  2BQ3 A;  4IRK A;  4DWI A;  3OGU A;  4ELT A;  3O0F A;  4ECX A;  4QZ8 A;  2P6U A;  5GTI U;  2FMS A;  1U47 A;  3OHA A;  5ALY A;  3R9K A;  3UMC A;  1SB3 C;  5JU5 A;  4YR0 A;  3V7K A;  2JEI A;  4IR1 A;  3GV7 B;  3JPN A;  3BQ0 A;  4B9L A;  5AKJ A;  1BPD A;  3MR5 A;  5AI0 A;  1HJP A;  1ZRN A;  1C7Y A;  2WF6 A; 
#chains in the Genus database with same CATH homology
 2NV3 A;  4NV0 A;  2W7P A;  2CRX A;  4OJ5 A;  3AQF A;  1KBU A;  5CRX A;  2H3I A;  2BDU A;  2G06 A;  4QIW C;  2K8B B;  4ACO A;  2DGZ A;  5HR7 A;  3KZX A;  4P0Q B;  3ALR A;  1T94 A;  3D2N A;  3PZP A;  4QJF B;  1NZB A;  3K1Z A;  2YX8 A;  2F77 X;  3PSP A;  4PL1 A;  4OJO A;  5C0Y A;  2XIC A;  2KHV A;  2JHD A;  4WJ3 B;  4OJP A;  2RP5 A;  4P0Q A;  3AL0 B;  2KJ5 A;  3GU3 A;  2G5H B;  1D8B A;  1A0P A;  1HIW A;  3HKZ C;  3MGV A;  2XI9 A;  2E1E A;  2MRL A;  4ICA A;  3IG8 A;  4OJ6 A;  4A8E A;  4QIW F;  3ICX A;  4U7C A;  2ZIV B;  1PVQ A;  4OO1 J;  2Z7J A;  3N7R C;  3N7S C;  2ZIX B;  2DF4 B;  3CP8 A;  4P0P B;  2WB1 F;  2KKP A;  2KVC A;  1WUD A;  2W03 A;  3IP4 B;  3PSI A;  2ZIU B;  3T79 A;  2HOI A;  3AQE A;  2KOB A;  2K4E A;  2OM6 A;  2CPR A;  2K89 A;  3IG5 A;  1Q3U A;  3C28 A;  3F5A A;  1CRX A;  2KKV A;  2HOF A;  2KV2 A;  2KIC A;  2M0N A;  2LYB A;  2ZIW A;  2HMX A;  2YB4 A;  1OUQ A;  2E5S A;  3RF9 A;  2KNJ A;  2R18 A;  2GOL A;  2F8L A;  2K4I A;  4FZM A;  3VC8 A;  2K8C B;  2KEY A;  3PST A;  2H3Q A;  4NWI A;  5A0L A;  2G08 A;  4AYB C;  3NRW A;  4BJQ A;  4U6P A;  1ECW A;  2GH1 A;  2HOQ A;  2JMG A;  2MA1 A;  2KIW A;  3DEE A;  4IC9 A;  2Q4T A;  2OH2 A;  2HBL A;  2ZIU A;  1HEK A;  3F5E A;  3H0R B;  2G09 A;  4P0P A;  2OXO A;  1Q3V A;  2CN1 A;  2ZXH A;  3LYS A;  2DQN B;  2N1R A;  3D2S A;  1PVR A;  3LVW A;  2ZIX A;  1ED1 A;  3F2D A;  2H3V A;  2ZXI A;  1PVP A;  4C0Z A;  4CRX A;  2HBJ A;  5HR6 A;  4BUG A;  2D6F C;  3M6K A;  3H0M B;  3PSF A;  2RRD A;  1SZH A;  1IIP A;  2RHF A;  3L3F X;  3C29 A;  2G5I B;  2H3F A;  3OPX A;  2KHQ A;  2WB1 C;  3SAF A;  1UPH A;  3IN5 A;  3CRX A;  2G07 A;  2XVT A;  2Y0S C;  4BX9 C;  1P7D A;  3KFU F;  3RFA A;  4AYB F;  4CDG A;  2K4H A;  4FZN A;  2WAQ C;  3SQI A;  4CGZ A;  1Z19 A;  3O0F A;  1MA7 A;  3HKZ F;  2PMZ C;  2LHT A;  4GFJ A;  2JH7 A;  2LBO A;  4PL2 A;  5T14 A;  2F2A B;  2KD1 A;  2E1F A;  2H3Z A;  2G0A A;  1ZQ1 C;  2HBM A;  1A6S A;  1GO3 F;  3N7P D;  1L6N A;  1TAM A;  3M7D A;  4JMU A;  4QNL A;  3H0L B;  3VCB A;  1XO0 A;  3SAG A;  2A3V A;  3GZF A;  1Z1B A;  2YB1 A;  1URJ A;  2HBK A;  4NLC A;  4KMO B;  4OJL A;  2VKQ A;  2VIX A;  2VJ5 A;  3NUQ A;  3M6Z A;  3ONN A;  1DRG A;  2XID A;  4FE3 A;  3SMV A;  3F2C A;  2W04 A;  1XNS A;  2VJ4 A;  2OYY A;  2ZIW B;  1YT3 A;  3E0F A;  2KJ8 A;  2LYA A;  2JGA A;  5KL1 B;  2ZIV A;  3F2B A;  2PMZ F;  3D2Q A;  3SAH A;  4KX3 A;  3CYM A;  4KX5 A;  2W7O A;  2WAQ F;  2ZG6 A;  2JH1 A;  4NLB A;  4O3M A;  2LKY A;  4FZL A;  2F76 X;  2K8A A;  3LVV A;  1F44 A;  3F53 A;  2Y0S F;  2KJ9 A;  5KL8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...