3AQEA

Crystal structure of the extracellular domain of human ramp2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
76
structure length
76
Chain Sequence
b'NYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Receptor activity-modifying protein 2
molecule tags Transport protein
source organism Homo sapiens
publication title Structural basis for extracellular interactions between calcitonin receptor-like receptor and receptor activity-modifying protein 2 for adrenomedullin-specific binding
pubmed doi rcsb
total genus 22
structure length 76
sequence length 76
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.510 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3aqeA00
3AQEA 3N7PD 3AQFA 3N7RC 2YX8A 2XVTA 3N7SC
chains in the Genus database with same CATH superfamily
3OHBA 2MUTA 3UMCA 3RH5A 3WKBA 1WWUA 3ETRA 9ICKA 2HI0A 4Y2JA 1ZQCA 1UCVA 4M9NA 2YMQA 1NKCA 4DF4A 1DK3A 3TQ1A 3PW7A 4DSKA 2HHTA 3EWAA 7ICHA 2H3FA 2UVUA 4AP9A 3AM9A 8ICPA 3WK8A 3HKZF 1ZYQA 2F8KA 2JRZA 3N7PD 5KTQA 1TVAA 4XA5A 4KLHA 4I2EA 3HP6A 3C1YA 4CGZA 4F72A 1V9PA 4PH5A 1S0VA 5ALQA 5KFKA 5AKGA 1J2NA 4GIBA 3JPNA 2JR5A 4F5RA 1MA7A 4DL4A 4B9SA 5ALGA 9ICJA 1NI3A 3PVXA 3PR4A 1YZ7A 1WG8A 4B9MA 2ZIUB 3I1YA 5AI6A 2IOFA 1ZJMA 5K4LA 5DKWA 4BUGA 3TFRA 1NK8A 2QB1A 2W9AA 4O3QA 3RH6A 3CNHA 3FM9A 1UA1A 7ICLA 2CN1A 3LDAA 4R64A 5IINA 3RJKA 1HIWA 2AHOB 5B5EU 3RRHA 8ICYA 2BCRA 4X5VA 2JH7A 3JPPA 2PKEA 5KFLA 1FO4A 8ICQA 2KV2A 5HHIA 3BJYA 1T7PA 2KOBA 4U6PA 2PMZF 2C2DA 1BNPA 1K5OA 3D2NA 1ZD2P 4IS7A 2W03A 1NK0A 2EZYA 3PW0A 3IRUA 3O0FA 1DGSA 1BNOA 5J2HA 1JXLA 2PMZC 4J9NA 1K1QA 5AK4A 5KFGA 1B0XA 1TAMA 2XCPA 4JWMA 3SZ2A 9ICHA 8ICGA 1ZQQA 8ICJA 5L1IA 1S77D 3UM9A 4ECTA 1XS9D 2Q4TA 4BX9C 1PK3A 3PX4A 2BGWA 4A8EA 2K8CB 5JU5A 1J2MA 1X66A 3GU3A 3C2LA 1O03A 2W9BA 3V6JA 1JIHA 3QU7A 2ZJAA 4EYHB 4DQSA 3RR7A 4KLQA 3GIKA 2C22A 5KL8B 4RQNA 4DOAA 5T14A 1TE2A 4F2RA 3BQ0A 2ASLA 2VA2A 4JUZA 4DSIA 1QCKA 4BJQA 4B9TA 2G5IB 1SWVA 4YG2A 3BQTA 2DPJA 4QZ8A 4DL5A 1C20A 4XRHA 2KG5A 1UT5A 4DSEA 4C4RA 3HKZC 1A76A 4YXJA 3PX0A 4BXOB 3T5LA 1LVHA 1L5UA 7ICSA 8ICLA 3AQFA 4KLUA 2DUYA 3EPIA 4G9BA 1XO0A 2DGZA 5CWRA 1NNLA 4P4OA 4PPXA 1V38A 1AQ6A 3QE9Y 1KFTA 1U49A 4QWAA 1SXEA 1KRPA 2FDRA 2R8HA 2F76X 2YX8A 5HR6A 3HW8A 3PR5B 3N97B 3ZDBA 4FFDA 3KHRA 5CP2A 3BS5A 1ZQEA 5JUMA 1TV9A 5J0TA 3IG5A 5AKZA 2AJQA 4Y2VA 2XY6A 2D3DA 4UBCA 1ZQRA 4C8MA 4KLJA 4M9LA 4ECUA 2K4IA 5DBAA 1L8OA 3NVWA 4KLEA 5TISU 5CB1A 3HT3A 5KFYA 4C4TA 1Z4OA 5ALWA 4OJ6A 4PGYA 2DQNB 2XY7A 2EANA 5CR0A 3TAQA 1ZQAA 3PSTA 4BDPA 1WCNA 1F44A 1RYUA 3TAPA 5L1JA 2FLLA 1NZBA 2LYHA 5DB9A 5AICA 3B0YA 4R63A 4DCCA 2VJ5A 3RJFA 4F71A 5ALXA 2EAOA 4EX6A 7ICFA 1Y88A 1BPEA 3VC8A 2KVCA 3KZIU 4KN7A 4Z6FA 1QQ5A 2E8OA 1X9MA 5AIBA 1ZRNA 2MRLA 4ELVA 5TZVA 4ED3A 1B43A 4G3IA 4F4XA 4MFFA 2EQYA 4KLSA 4DQQA 5DQIA 2YB4A 1SV4A 2R8JA 1VDVA 7ICMA 5J2BA 3LWMA 2IBKA 4F5NA 1N48A 4RT2A 5AKHA 2QLTA 1X42A 3RBEA 3PSPA 4KX3A 1U47A 3JPRA 5B66U 2Y0SF 5C5JA 4QWEA 4KTQA 2KHVA 2EZXA 4XUSA 4KN4A 1KEJA 3WK9A 5KFWA 4DOBA 4FBUA 1D8BA 1L3SA 3QEAZ 1N5WA 2XO7A 4ECZA 4QJFB 2ESEA 2E1FA 4PL2A 1L7MA 1L3TA 3PSIA 5KFFA 3FYHA 1SKSA 1N62A 1JX4A 4NLGA 5J0OA 2MU2A 4JV0A 5IIOA 5ALRA 5AK5A 4BWMA 4NXZA 5F9NA 1PK1B 5KG0A 4CCHA 4I28A 3H8WA 1DXSA 3PMLA 2JEGA 2XY5A 4PZNA 3AL0B 2F44A 2J6TA 2E8PA 3QUBA 3Q8PB 5EWFA 3ISDA 3RJJA 4EZ9A 2KN7A 4OJ5A 2ZJ5A 3OPXA 3HWTA 5HHHA 3KFUF 2KNJA 3KTQA 1PVQA 3SV3A 3SR6A 3FC4A 1L8LA 3QNMA 1RYRA 5DLFA 1L7NA 2BPFA 1HUZA 3A0HU 3QU2A 2GOLA 4KITB 4NJ8A 3OSNA 3EYZA 1XNSA 3V7LA 3K4GA 4QWCA 5ALLA 5J0PA 1F5SA 1ZQYA 2KKPA 3N7SC 5IIKA 4M2YA 4DL7A 5KFQA 2W9CA 4JV1A 5AKXA 3LK9A 2W9CB 5A0LA 5KFHA 1SL1A 3TI0A 2W04A 3TACB 4OD0A 4M9GA 4YQWA 3TARA 4B6JA 1ZQSA 4ED6A 2KZMA 2WF5A 3SV4A 1LKYB 4HAIA 4ED8A 1Q46A 2WAQC 3VCBA 4MF2A 3GFKB 2EAPA 4M6WA 4I27A 4NL9C 2WF7A 3THVA 5DB6A 3AMZA 2NRZA 3LWLA 3ISCA 2I5HA 2H5XA 3G6VA 3J81j 2V9WA 5J0WA 4J9OA 4QW9A 4UB3A 4IL6U 5KNIA 2A1JB 3MABA 1X6IA 3F2DA 5CRXA 1L7PA 2BQUA 2ATLA 2VANA 2BCUA 2YQEA 2HBMA 2MUTB 3C21A 2VIXA 3ICXA 1O08A 9ICFA 3QUQA 4RQ3A 4O3NA 3GIJA 2XCAA 4UB1A 5AM1A 4KLOA 8ICAA 3H4BA 3Q8MA 1DRGA 1AROP 4UATA 5HMLA 1DOQA 1BGXT 5KT2A 2I6XA 3GIIA 4ECQA 4F4YA 3KKAC 1BPDA 5DDYA 5KFBA 5EE0A 3ONNA 3QUCA 2AH5A 5KG3A 4YFKA 1PK1A 1D9DA 2HOIA 4UAYA 7ICTA 2BZFA 1WCLA 3ALRA 5AI8A 2XGQA 1NJYA 2NO5A 2G07A 2WAQF 5ALUA 4F93B 1N61A 4OO1J 4RQ5A 9ICRA 1UT8A 4ECVA 5KT5A 2PFQA 5L1MA 3H8MA 4OJPA 3WU2U 3RB4A 4LZGA 4FZLA 3RJGA 4EEYA 4IQUA 4CF3A 2KFZA 1SV0C 4UB2A 1UHUA 2WB1F 4O3PA 2F1HA 2DKZA 1QTMA 4TURA 3ZI4A 2ZIVA 2FJ6A 2ZTDA 4ECSA 2ZIVB 2ODGA 3B0XA 5KFPA 5KFOA 4CF4A 3PSFA 3HRDD 3Q8QB 2FPKA 1SV0A 7ICPA 5KFNA 4P4MA 3WKEA 1ZQGA 5BOLA 1IG6A 3UMGA 5JRTA 4US8A 1Z1BA 3OTQA 2CPRA 4OCZA 1BPYA 3KBBA 1ZQPA 4ACOA 2NRXA 1BPXA 4QZFA 2DFLA 3PY8A 2FE9A 2G0AA 3NRWA 3BZKA 3E58A 3PMNA 2IOHA 2ZIUA 3WK7A 5ALSA 4DO9A 4LVSA 2EDUA 1VLBA 2QB0B 2KVSA 3SD7A 1U45A 3V7JA 9ICXA 3PW4A 2ISOA 2EAMA 4TUSA 4M47A 1S8OA 2HDOA 4DSLA 4AYBC 3QXGA 4GXJA 1XSLA 4YXMA 4QZHA 4FS1A 1ZQOA 2UVWA 2K8BB 1PZNA 5BPCA 4RQ1A 2H3QA 2RRDA 5J2JA 4Y2YA 4O5KA 4DFPA 2K89A 3M7DA 4MEXA 4CDGA 5J0QA 3KKAA 5J29A 4UB6U 4IRKA 3KHGA 2F3NA 3PX6A 2ZG6A 3C2MA 1LV5A 3AQEA 3NVYA 1KFDA 4I2IA 4B9NA 2W8LA 1Q3VA 3E0FA 3TADA 1A6SA 4XQ8A 3H7IA 5DBCA 1D8LA 2ASJA 2DF4B 3D6JA 2YMPA 2YB1A 4B9UA 4J9LA 1V97A 4O5CA 3M9OB 5KFTA 1JXEA 2PXIA 2E1EA 2AQ4A 8ICWA 1S9FA 2PFPA 3RFAA 3JPOA 4MFAA 2G08A 1F0MA 2K8AA 2ZTCA 1TAQA 3NUQA 5KG5A 3QZ7A 5DB8A 5AKKA 2ISPA 2WFAA 3NASA 3BQ2A 2HSZA 4QW8A 2XIDA 2W9BB 4UAVA 4RPZA 3ZDEA 4RU9A 1SZHA 5J2AA 4NL9A 1ZQMA 4DFMA 4YVZA 1XO1A 1IXRA 4KLGA 4DQRA 1BVSA 2OXOA 5G5HA 2P6RA 1EXNA 5J0RA 8ICKA 3AUOA 4Q8FA 2ASDA 1TAUA 2FPLA 5ALDA 5KFSA 5E79U 4YR3A 2HHVA 5ALZA 4MHVA 2RDJA 4RQ6A 1B22A 2BCVA 1CEZA 3PV8A 2Y0SC 2G09A 2K4PA 3WKDA 1SKRA 4RPXA 2V4RA 1NK6A 1URJA 4K4GA 2W7OA 4Z6DA 3WKCA 4ECXA 2JXJA 1L6NA 5AKIA 3LVVA 2NO4A 5F3XB 1KFSA 1Z19A 2C2EA 3RJEA 2KMDA 5J8YC 5KFVA 3RTVA 8ICUA 1BPZA 5KFCA 3QZ8A 3V7KA 3UQ2A 1RDFA 4Z6EA 2E3TA 1COOA 2DKXA 4YD2A 4M6WB 1WUDA 1ZQNA 3OJUA 2OM6A 2AU0A 4M0AA 5FP0A 3UXPA 2GO7A 9ICSA 5CJ7A 4RZRA 4KLIA 3SEIA 3OJSA 4PL1A 5DBBA 2OH2A 3D2QA 3M6ZA 4KLMA 4KLLA 4NLBA 1ZQBA 3JPTA 3GIMA 3TKAA 9ICAA 5KG6A 3MR6A 2IHNA 1L3VA 4F91B 2BQRA 1GO3F 1OUQA 1S0OA 3IG8A 2PFNA 3T3FA 4J9MA 5EOZA 1MN8A 9ICMA 2ZIXB 5HR7A 2C28A 4NM2A 2RQ5A 2B6GA 2OYYA 3K1ZA 4O3RA 2K60A 2G5HB 3A0BU 4RQMA 4UB8U 1COKA 3C5GA 3MFIA 4JB3A 5DGBA 4DL3A 4O5EA 4GC6A 3WK6A 3RB0A 4UB5A 3T5JA 4RQ0A 2HHUA 2XC9A 2J6UA 3L5KA 1FFUA 5AKEA 5ALMA 4RQ7A 2HW3A 3M8RA 5J2FA 3C29A 2ZUBA 3KHHA 4JK1A 4P0QA 2HBJA 2KK0A 2R8IA 1FFVA 1Q3UA 2P66A 5KFUA 1ZQDA 3S6JA 4IQVA 1U9LA 3MGHA 2NYVA 9ICBA 5EE3A 2RHFA 4F5PA 3NGDA 3DV9A 5KFDA 4RNOA 2DWQA 3NRZA 4R8UA 2D6FC 5DG8A 5EE1A 2W55A 4KLFA 3ZDCA 2EH9A 4QZ9A 4Y2QA 1Q8KA 3F2CA 1ED1A 2ZXHA 2BR0A 1D8YA 4F2SA 9ICOA 4QWDA 4P2HA 1S10A 4QNLA 2HVHA 3HX0A 4PHDA 3L4PA 2IA6A 4FO6A 7ICQA 1VJ5A 3IP4B 3MR2A 5C0YA 2FMPA 1ZQFA 3MDAA 1T94A 1Z3EB 4EBCA 5D46A 5ALVA 1IM4A 1OXJA 1SKWA 2HHQA 3TADC 3IDWA 3M9NB 3C28A 1WYGA 2JH1A 1JN3A 2HMXA 2KEYA 1TK0A 3D2SA 4O3SA 1C7YA 4Q45A 1X2IA 4Y2PA 2BQ3A 3IV6A 2M0NA 2LHTA 2KP7A 3RAQA 8ICZA 4ECYA 3CYMA 3H0RB 4DL6A 1X40A 8ICHA 7ICNA 4NLKA 5AIAA 3GZFA 2HOQA 3R9KA 4UW9A 5DDMA 4HYKA 2FLPA 3T79A 4Q43A 2DPIA 4J9QA 2OCEA 3UQ0A 2BCSA 3QU9A 4QZGA 4NLCA 5KFMA 9ICUA 9ICWA 2KZ3A 2W11A 1TKDA 3UPQA 8ICNA 1ZQHA 4CRXA 5DQHA 3V6KA 2ZIWA 2ZIXA 3WK5A 4NY8A 3MGVA 2VA8A 1UQVA 2H3IA 4UQGA 4R66A 3PW2A 1NK9A 2JV3A 2WHEA 1Z00A 8ICMA 1A77A 2F77X 4KMUA 1Z00B 2KHQA 1L3UA 2LYAA 2PI5A 3H40A 3V6HA 1KTQA 3L3FX 3K75D 2ZUDA 4MFCA 3CW2C 3DEEA 5KFRA 4ECWA 3BZCA 4DLEA 2JHDA 5KT7A 1ZQKA 3RH4A 1HUOA 4ED1A 4Y2XA 5DB7A 9ICCA 4Y2SA 4YN4A 4EBDA 3PW5A 1M6YA 1KW4A 2HHSA 4IC9A 4GXKA 2A19A 5AI4A 2Y1IA 4DL2A 3EUB2 5GTHU 2RP5A 4I2AA 2BHNA 9ICTA 2UVVA 4K4HA 1ZQXA 4CF5A 9ICLA 4R8UB 8ICEA 9ICNA 3H0MB 4RNNA 3ZD9A 5D4BA 1N2XA 4I2BA 1HEKA 3WK4A 2LMRA 7ICUA 1JRPA 5KFIA 4Y2RA 4US9A 1NK7A 5IIMA 1SXDA 1RYSA 4C7ZA 2LI6A 7ICJA 4EELA 3RB3A 4EZ6A 5KG2A 4OJOA 2W8KA 1ZRMA 4J03A 3SAGA 3M6KA 3GDXA 4DOCA 4J9SA 2C2RA 1ZQVA 2W9MA 4U7CA 5J2CA 4Q44A 3TFSA 4M04A 1JUDA 2LM4A 2JZBA 2KSOA 4I2DA 1T4GA 2O6KA 1N5XA 3RJHA 3HJEA 3G6YA 5DGAA 2BPGA 2WF8A 4EX7A 4PJ0U 3UXNA 4F4ZA 4Y2TA 4M9JA 3H8JA 1KQQA 1QQ6A 4AYBF 5AHXA 2FI1A 3NS1A 4RUAA 3AN1A 1QSYA 4NM1A 1N60A 4EENA 3SI8A 4TQRA 4YP3A 2XI9A 5HMMA 3LYSA 8ICVA 1ECWA 2KZZA 2K4EA 2KIVA 8ICSA 1IV8A 2A1JA 3FAHA 5AI0A 2OWOA 3Q8LA 4JWNA 4P4PA 1J97A 3V72A 4YR0A 9ICVA 4LZDA 5J0SA 9ICPA 5J0XA 4UAUA 4GFJA 4ECRA 5KG4A 1N63A 3U26A 4IQWA 4QZCA 1Z1VA 1U48A 1OW5A 1RZTA 2ZTEA 5KL1B 2IHMA 4C8LA 2JEFA 4PZOA 2GWSA 2VJ4A 4O3OA 4DEZA 2ALZA 2R8KA 3JPQA 3IN5A 2QB0A 4J9RA 4DSFA 2MSNA 2W7PA 1ZQTA 2K4HA 4ELTA 1SL2A 1BPBA 3RBDA 4Z6CA 4FZMA 1JROA 2PI4A 4ZH4A 4DS5A 1LB2B 5KAFU 8ICRA 5EWEA 3B9JA 4RQ2A 4JMUA 1MQ3A 5IILA 5AM0A 4RPYA 1Z4NA 2GLEA 3KHLA 4YR2A 4C4SA 1NJZA 4Q8EA 4TUQA 1NK4A 4QZBA 5G5GA 3SAFA 3H8SA 5AKLA 1KN5A 1UA0A 5L9XA 4PGQA 1T3QA 2AGOA 4DLGA 3E2EA 3GV5B 1TK5A 5J2IA 3QYPA 5GTIU 4BXOA 4LJXA 1KL9A 5ALJA 2I9GA 1JMSA 2RLTA 1ZD4A 2P6UA 3ZD8A 8ICCA 2V4QA 2OHFA 3QU5A 3T5KA 1CUKA 5CEHA 2HHXA 3TANA 2YMLA 3MBYA 4I2FA 4R65A 3BQ1A 2JMGA 3F2BA 2MAXA 3BDPA 4YMNA 1MC8A 5AI5A 3F53A 3G6XA 4FE3A 2YMMA 3SMVA 4DFDA 4C7YA 1SL0A 1QLNA 2FPMA 1ZQ1C 2KD1A 3PO4A 4QZDA 1QQ7A 2QARA 3UXOA 4RNMA 8ICIA 3PZPA 3ETLA 2G06A 5DQGA 5ALYA 3BS7A 2Q0ZX 4K4IA 9ICQA 5AM5A 5J2KA 2WTFA 3EZ5A 4F4WA 1SGGA 4IQTA 1QH9A 2KE7A 4GLXA 2KJ9A 4ICAA 4NV0A 7ICGA 4NLZA 3K1RB 3KZXA 9ICIA 4F5OA 5ALTA 3ED5A 5KFAA 5KFXA 2NRWA 5L1LA 5L1KA 2E5SA 5AI9A 3MC1A 2JEIA 1SZPA 4ZOHC 1MQ2A 4C8KA 3KD3A 2HVIA 2Y9UA 4O9MA 1L7OA 4J9KA 3N28A 4EYIB 4USAA 2ZUCA 4QWBA 4TUPA 2QKQA 1NK5A 4YD1A 2H3ZA 5J2GA 5AK3A 4DF8A 2F1IA 5KT6A 1YZ6A 2NRVA 2YN4A 2BCQA 2ES6A 2GH1A 2BDPA 3RAXA 3C23A 4YMOA 3N4MB 3F5EA 2JEJA 1NJXA 4KLDA 1SB3C 5CA7A 1X9WA 2WB1C 3C5FA 2L5YA 1U4BA 5EE9A 4JV2A 2PFOA 1JALA 3RR8A 2KIWA 4IR9A 7ICEA 1B4FA 4PHEA 2Y1JA 1KDHA 2E8NA 3H4DA 3ZDAA 1X9SA 4IR1A 4GC7A 5ALNA 2AGPA 5AM3A 2B0CA 1NKBA 8ICTA 1XWLA 5DG9A 4IRCA 1X9XA 4DWIA 1QSSA 5AKJA 4OJLA 4DS4A 5J0YA 3SYZA 7ICVA 5J2EA 4C80A 7ICIA 1ZOLA 2VA3A 1KLNA 1FEZA 5HP4A 3OHAA 3C2KA 3WKAA 5JTIA 3SENA 5AKYA 3RRGA 2KICA 3H0LB 5F9LA 2HHWA 2KJ5A 4FBTA 5H2FU 3CP8A 4J9PA 1SWWA 4KLTA 4RQ4A 3LVWA 1KKXA 1KSPA 1TK8A 1RG6A 5KFJA 5DLGA 1JI7A 4Y2UA 5D49A 4P0PB 1ZQLA 3GQCA 4PGXA 4I2HA 2R8GA 4P0PA 1KBUA 3IHQB 3ZDDA 2HBKA 4C0ZA 3T5HA 2A3VA 4P0QB 2BPCA 7ICOA 1LKYA 3AEVA 4KX5A 1ZQIA 2QARB 2IMWP 4EEKA 3M8SA 2LM1A 4QZIA 4FS2A 5ALKA 1CRXA 4UASA 4UAWA 5HNKA 3MR5A 2Z7JA 4QIWC 3MR3A 1QSLA 5ALIA 2CRXA 2R18A 1PVPA 4YCXA 2LYBA 2HCFA 2MA1A 2D8CA 2FMSA 5ALOA 1PVRA 4MEYA 4RT3A 2F8LA 4DQIA 1DK2A 3DDHA 2WF9A 2E8MA 2ZIWB 3HPOA 1NKEA 5IIIA 2BDUA 1ZD3A 3PO5A 4ELUA 4PHPA 4UARA 8ICOA 1FIQA 3ORYA 1V85A 1ZQUA 3QUTA 4ED0A 3F5AA 1S0NA 5EWGA 1S97A 1PUZA 1P7DA 2H3VA 3QU4A 3QX7A 2KJ8A 3PNCA 1DGJA 1A0PA 1T8EA 1ZXIA 2W43A 1IIPA 5J2DA 2J6SA 1H38A 4B9VA 3M1YA 3I76A 2W3SA 3Q8KA 1HJPA 1RQLA 2YY6A 3AU6A 4I2GA 2LPEA 2VKQA 2XVTA 3QEBZ 4I29A 2B21A 2P35A 4I2CA 5KG1A 1TFRA 3IM1A 4E0DA 2NV3A 4QIWF 4CE6A 3EPGA 1YT3A 4BWJA 3JPSA 2YTUA 1NJWA 2LBOA 3BQ7A 2AXTU 4F8RA 9ICGA 4UB4A 2I1QA 7ICKA 2ZJ8A 5ALEA 1NZPA 3ISBA 1ZD5A 5ALPA 3GV7B 3M9MB 2LKYA 1RPLA 4I2JA 3MFHA 3KOOA 4KMOB 4UBBA 3RB6A 2M9NA 4UAZA 3RJIA 3HILA 5AM2A 2W54A 2BKEA 4FZNA 4F4KA 2F2AB 3MDCA 5KT4A 2KTQA 4QZEA 4RQ8A 3OGUA 4DFKA 2F1JA 3EW9A 8ICBA 1RM6C 2CXYA 2DBYA 1RXVA 3FDSA 2WF6A 1XSPA 2HBLA 4QZAA 7ICRA 1ZJNA 2EZZA 4TQSA 5KT3A 2OEHA 5CHGA 4C8NA 3MGIA 3BS5B 4F3OA 4WJ3B 1SIJA 4NWIA 2UVRA 8ICFA 3GV8B 2IOFK 2Y9TA 4EBEA 3CRXA 1NOMA 2DL0A 4C8OA 5KG7A 4F92B 3OSPA 4F5QA 2A1AA 1RQNA 4B9LA 2NRTA 5BOMA 5KFZA 2KFNA 4F50A 3Q8SB 1UPHA 5KAIU 3GILA 3Q8RB 3AU2A 2W3RA 1S0MA 4IRDA 1RXWA 4NLNA 2FLNA 1ZQZA 1XSNA 1K1SA 5AM4A 2ZXIA 5IIJA 3UMBA 3I28A 2KKVA 3RF9A 2AQ0A 3NTUA 4O0IA 4ED7A 4O3MA 2HOFA 2JGAA 4DSJA 1CI4A 4BGDA 4YMMA 4PHAA 3SQIA 1ZQWA 5KFEA 1S76D 1MSWD 4M9HA 3NVZA 1XC9A 4CNQA 1XU4A 2JZBB 2KSOB 1D9FA 5AK6A 3N7RC 4RUCA 2AGQA 5ALFA 8ICXA 4GXIA 1ZETA 4DQPA 9ICEA 1S5LU 2FMQA 1X6JA 2RDIA 2XGPA 4MF8A 5J8YA 4ED2A 3NVVA 5ALHA 1ZQJA 5J0UA 1WWVA 5DG7A 3C1ZA 2N1RA 1N56A 3SAHA 1T3NA 4DFJA 2XICA
chains in the Genus database with same CATH topology
4WJ3B 2HOQA 2WAQF 4NWIA 3PZPA 2G06A 4OO1J 3O0FA 2KHVA 2VJ4A 5A0LA 2PMZC 3CRXA 1URJA 2HOFA 2W7OA 3F5AA 1HEKA 2W04A 1D8BA 2K8BB 3IN5A 1TAMA 3T79A 1P7DA 2H3VA 4QJFB 2W7PA 2H3QA 2KICA 2RRDA 3H0LB 3IG5A 2E1FA 2KJ8A 2KJ9A 4ICAA 2K89A 4OJPA 1L6NA 2K4HA 3M7DA 4NV0A 4PL2A 2KJ5A 3LVVA 4CDGA 3PSIA 4FZLA 4NLCA 3CP8A 3C29A 1A0PA 1Z19A 1UPHA 3LVWA 4P0QA 2HBJA 3KZXA 2WAQC 4OJOA 2H3FA 3GZFA 4FZMA 3VCBA 1IIPA 2ZG6A 1Q3UA 3AQEA 4CRXA 2WB1F 3HKZF 3SAGA 1Q3VA 3M6KA 2ZIWA 3E0FA 2Q4TA 2ZIXA 4BX9C 2K4IA 1A6SA 4JMUA 3MGVA 4A8EA 2E5SA 2ZIVA 4P0PB 2RHFA 2H3IA 1WUDA 4U7CA 2K8CB 2VKQA 2XVTA 2ZIVB 3GU3A 3N7PD 2DF4B 4OJ6A 4P0PA 2YB1A 1KBUA 2DQNB 2D6FC 2ZXIA 2OM6A 2HBKA 4CGZA 3PSTA 4C0ZA 3SAFA 2A3VA 1F44A 2NV3A 4QIWF 4P0QB 2E1EA 3F2CA 1ED1A 2KKVA 2ZXHA 2F77X 3RF9A 4KX5A 3PSFA 1NZBA 1YT3A 1MA7A 4PL1A 3AL0B 2KHQA 5KL8B 2OH2A 3D2QA 3RFAA 5HR6A 4O3MA 3M6ZA 5T14A 3F2DA 2LYAA 2G08A 2JGAA 4QNLA 2H3ZA 2K8AA 4NLBA 2LBOA 4AYBF 5CRXA 3NUQA 2Y0SF 3L3FX 2VJ5A 3SQIA 2HBMA 4BJQA 1CRXA 2ZIUB 2XI9A 2G5IB 3DEEA 2VIXA 3ICXA 2GH1A 3IP4B 3LYSA 4OJ5A 1ECWA 1GO3F 3OPXA 1OUQA 5C0YA 2K4EA 2JHDA 3KFUF 2XIDA 3IG8A 1T94A 2LKYA 2KNJA 2Z7JA 3F5EA 3N7RC 3VC8A 2KVCA 4BUGA 4KMOB 4QIWC 1SZHA 1Z1BA 1PVQA 2CPRA 2CRXA 2R18A 2WB1C 3HKZC 4ACOA 3C28A 1DRGA 1PVPA 2MRLA 2JH1A 2CN1A 4FZNA 2LYBA 2ZIXB 4IC9A 2F2AB 2HMXA 1HIWA 2KEYA 5HR7A 2MA1A 2KIWA 3AQFA 2G0AA 2JMGA 3NRWA 3F2BA 1PVRA 3D2SA 2JH7A 3ONNA 2OXOA 1XO0A 2F8LA 2RP5A 2DGZA 2OYYA 2ZIUA 2YB4A 3F53A 3K1ZA 2GOLA 2KV2A 4FE3A 3SMVA 2G5HB 1XNSA 2ZIWB 4GFJA 2HOIA 2M0NA 2HBLA 2LHTA 2BDUA 2KOBA 1ZQ1C 4U6PA 2KD1A 3PSPA 2KKPA 2PMZF 3CYMA 3H0RB 2N1RA 3N7SC 4KX3A 3H0MB 3ALRA 5KL1B 3SAHA 3D2NA 4OJLA 2F76X 4AYBC 2W03A 2YX8A 2G07A 2XICA 2Y0SC 2G09A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AQE A;  3N7P D;  3AQF A;  3N7R C;  2YX8 A;  2XVT A;  3N7S C; 
#chains in the Genus database with same CATH topology
 3OHB A;  2MUT A;  3UMC A;  3RH5 A;  3WKB A;  1WWU A;  3ETR A;  9ICK A;  2HI0 A;  4Y2J A;  1ZQC A;  1UCV A;  4M9N A;  2YMQ A;  1NKC A;  4DF4 A;  1DK3 A;  3TQ1 A;  3PW7 A;  4DSK A;  2HHT A;  3EWA A;  7ICH A;  2H3F A;  2UVU A;  4AP9 A;  3AM9 A;  8ICP A;  3WK8 A;  3HKZ F;  1ZYQ A;  2F8K A;  2JRZ A;  3N7P D;  5KTQ A;  1TVA A;  4XA5 A;  4KLH A;  4I2E A;  3HP6 A;  3C1Y A;  4CGZ A;  4F72 A;  1V9P A;  4PH5 A;  1S0V A;  5ALQ A;  5KFK A;  5AKG A;  1J2N A;  4GIB A;  3JPN A;  2JR5 A;  4F5R A;  1MA7 A;  4DL4 A;  4B9S A;  5ALG A;  9ICJ A;  1NI3 A;  3PVX A;  3PR4 A;  1YZ7 A;  1WG8 A;  4B9M A;  2ZIU B;  3I1Y A;  5AI6 A;  2IOF A;  1ZJM A;  5K4L A;  5DKW A;  4BUG A;  3TFR A;  1NK8 A;  2QB1 A;  2W9A A;  4O3Q A;  3RH6 A;  3CNH A;  3FM9 A;  1UA1 A;  7ICL A;  2CN1 A;  3LDA A;  4R64 A;  5IIN A;  3RJK A;  1HIW A;  2AHO B;  5B5E U;  3RRH A;  8ICY A;  2BCR A;  4X5V A;  2JH7 A;  3JPP A;  2PKE A;  5KFL A;  1FO4 A;  8ICQ A;  2KV2 A;  5HHI A;  3BJY A;  1T7P A;  2KOB A;  4U6P A;  2PMZ F;  2C2D A;  1BNP A;  1K5O A;  3D2N A;  1ZD2 P;  4IS7 A;  2W03 A;  1NK0 A;  2EZY A;  3PW0 A;  3IRU A;  3O0F A;  1DGS A;  1BNO A;  5J2H A;  1JXL A;  2PMZ C;  4J9N A;  1K1Q A;  5AK4 A;  5KFG A;  1B0X A;  1TAM A;  2XCP A;  4JWM A;  3SZ2 A;  9ICH A;  8ICG A;  1ZQQ A;  8ICJ A;  5L1I A;  1S77 D;  3UM9 A;  4ECT A;  1XS9 D;  2Q4T A;  4BX9 C;  1PK3 A;  3PX4 A;  2BGW A;  4A8E A;  2K8C B;  5JU5 A;  1J2M A;  1X66 A;  3GU3 A;  3C2L A;  1O03 A;  2W9B A;  3V6J A;  1JIH A;  3QU7 A;  2ZJA A;  4EYH B;  4DQS A;  3RR7 A;  4KLQ A;  3GIK A;  2C22 A;  5KL8 B;  4RQN A;  4DOA A;  5T14 A;  1TE2 A;  4F2R A;  3BQ0 A;  2ASL A;  2VA2 A;  4JUZ A;  4DSI A;  1QCK A;  4BJQ A;  4B9T A;  2G5I B;  1SWV A;  4YG2 A;  3BQT A;  2DPJ A;  4QZ8 A;  4DL5 A;  1C20 A;  4XRH A;  2KG5 A;  1UT5 A;  4DSE A;  4C4R A;  3HKZ C;  1A76 A;  4YXJ A;  3PX0 A;  4BXO B;  3T5L A;  1LVH A;  1L5U A;  7ICS A;  8ICL A;  3AQF A;  4KLU A;  2DUY A;  3EPI A;  4G9B A;  1XO0 A;  2DGZ A;  5CWR A;  1NNL A;  4P4O A;  4PPX A;  1V38 A;  1AQ6 A;  3QE9 Y;  1KFT A;  1U49 A;  4QWA A;  1SXE A;  1KRP A;  2FDR A;  2R8H A;  2F76 X;  2YX8 A;  5HR6 A;  3HW8 A;  3PR5 B;  3N97 B;  3ZDB A;  4FFD A;  3KHR A;  5CP2 A;  3BS5 A;  1ZQE A;  5JUM A;  1TV9 A;  5J0T A;  3IG5 A;  5AKZ A;  2AJQ A;  4Y2V A;  2XY6 A;  2D3D A;  4UBC A;  1ZQR A;  4C8M A;  4KLJ A;  4M9L A;  4ECU A;  2K4I A;  5DBA A;  1L8O A;  3NVW A;  4KLE A;  5TIS U;  5CB1 A;  3HT3 A;  5KFY A;  4C4T A;  1Z4O A;  5ALW A;  4OJ6 A;  4PGY A;  2DQN B;  2XY7 A;  2EAN A;  5CR0 A;  3TAQ A;  1ZQA A;  3PST A;  4BDP A;  1WCN A;  1F44 A;  1RYU A;  3TAP A;  5L1J A;  2FLL A;  1NZB A;  2LYH A;  5DB9 A;  5AIC A;  3B0Y A;  4R63 A;  4DCC A;  2VJ5 A;  3RJF A;  4F71 A;  5ALX A;  2EAO A;  4EX6 A;  7ICF A;  1Y88 A;  1BPE A;  3VC8 A;  2KVC A;  3KZI U;  4KN7 A;  4Z6F A;  1QQ5 A;  2E8O A;  1X9M A;  5AIB A;  1ZRN A;  2MRL A;  4ELV A;  5TZV A;  4ED3 A;  1B43 A;  4G3I A;  4F4X A;  4MFF A;  2EQY A;  4KLS A;  4DQQ A;  5DQI A;  2YB4 A;  1SV4 A;  2R8J A;  1VDV A;  7ICM A;  5J2B A;  3LWM A;  2IBK A;  4F5N A;  1N48 A;  4RT2 A;  5AKH A;  2QLT A;  1X42 A;  3RBE A;  3PSP A;  4KX3 A;  1U47 A;  3JPR A;  5B66 U;  2Y0S F;  5C5J A;  4QWE A;  4KTQ A;  2KHV A;  2EZX A;  4XUS A;  4KN4 A;  1KEJ A;  3WK9 A;  5KFW A;  4DOB A;  4FBU A;  1D8B A;  1L3S A;  3QEA Z;  1N5W A;  2XO7 A;  4ECZ A;  4QJF B;  2ESE A;  2E1F A;  4PL2 A;  1L7M A;  1L3T A;  3PSI A;  5KFF A;  3FYH A;  1SKS A;  1N62 A;  1JX4 A;  4NLG A;  5J0O A;  2MU2 A;  4JV0 A;  5IIO A;  5ALR A;  5AK5 A;  4BWM A;  4NXZ A;  5F9N A;  1PK1 B;  5KG0 A;  4CCH A;  4I28 A;  3H8W A;  1DXS A;  3PML A;  2JEG A;  2XY5 A;  4PZN A;  3AL0 B;  2F44 A;  2J6T A;  2E8P A;  3QUB A;  3Q8P B;  5EWF A;  3ISD A;  3RJJ A;  4EZ9 A;  2KN7 A;  4OJ5 A;  2ZJ5 A;  3OPX A;  3HWT A;  5HHH A;  3KFU F;  2KNJ A;  3KTQ A;  1PVQ A;  3SV3 A;  3SR6 A;  3FC4 A;  1L8L A;  3QNM A;  1RYR A;  5DLF A;  1L7N A;  2BPF A;  1HUZ A;  3A0H U;  3QU2 A;  2GOL A;  4KIT B;  4NJ8 A;  3OSN A;  3EYZ A;  1XNS A;  3V7L A;  3K4G A;  4QWC A;  5ALL A;  5J0P A;  1F5S A;  1ZQY A;  2KKP A;  3N7S C;  5IIK A;  4M2Y A;  4DL7 A;  5KFQ A;  2W9C A;  4JV1 A;  5AKX A;  3LK9 A;  2W9C B;  5A0L A;  5KFH A;  1SL1 A;  3TI0 A;  2W04 A;  3TAC B;  4OD0 A;  4M9G A;  4YQW A;  3TAR A;  4B6J A;  1ZQS A;  4ED6 A;  2KZM A;  2WF5 A;  3SV4 A;  1LKY B;  4HAI A;  4ED8 A;  1Q46 A;  2WAQ C;  3VCB A;  4MF2 A;  3GFK B;  2EAP A;  4M6W A;  4I27 A;  4NL9 C;  2WF7 A;  3THV A;  5DB6 A;  3AMZ A;  2NRZ A;  3LWL A;  3ISC A;  2I5H A;  2H5X A;  3G6V A;  3J81 j;  2V9W A;  5J0W A;  4J9O A;  4QW9 A;  4UB3 A;  4IL6 U;  5KNI A;  2A1J B;  3MAB A;  1X6I A;  3F2D A;  5CRX A;  1L7P A;  2BQU A;  2ATL A;  2VAN A;  2BCU A;  2YQE A;  2HBM A;  2MUT B;  3C21 A;  2VIX A;  3ICX A;  1O08 A;  9ICF A;  3QUQ A;  4RQ3 A;  4O3N A;  3GIJ A;  2XCA A;  4UB1 A;  5AM1 A;  4KLO A;  8ICA A;  3H4B A;  3Q8M A;  1DRG A;  1ARO P;  4UAT A;  5HML A;  1DOQ A;  1BGX T;  5KT2 A;  2I6X A;  3GII A;  4ECQ A;  4F4Y A;  3KKA C;  1BPD A;  5DDY A;  5KFB A;  5EE0 A;  3ONN A;  3QUC A;  2AH5 A;  5KG3 A;  4YFK A;  1PK1 A;  1D9D A;  2HOI A;  4UAY A;  7ICT A;  2BZF A;  1WCL A;  3ALR A;  5AI8 A;  2XGQ A;  1NJY A;  2NO5 A;  2G07 A;  2WAQ F;  5ALU A;  4F93 B;  1N61 A;  4OO1 J;  4RQ5 A;  9ICR A;  1UT8 A;  4ECV A;  5KT5 A;  2PFQ A;  5L1M A;  3H8M A;  4OJP A;  3WU2 U;  3RB4 A;  4LZG A;  4FZL A;  3RJG A;  4EEY A;  4IQU A;  4CF3 A;  2KFZ A;  1SV0 C;  4UB2 A;  1UHU A;  2WB1 F;  4O3P A;  2F1H A;  2DKZ A;  1QTM A;  4TUR A;  3ZI4 A;  2ZIV A;  2FJ6 A;  2ZTD A;  4ECS A;  2ZIV B;  2ODG A;  3B0X A;  5KFP A;  5KFO A;  4CF4 A;  3PSF A;  3HRD D;  3Q8Q B;  2FPK A;  1SV0 A;  7ICP A;  5KFN A;  4P4M A;  3WKE A;  1ZQG A;  5BOL A;  1IG6 A;  3UMG A;  5JRT A;  4US8 A;  1Z1B A;  3OTQ A;  2CPR A;  4OCZ A;  1BPY A;  3KBB A;  1ZQP A;  4ACO A;  2NRX A;  1BPX A;  4QZF A;  2DFL A;  3PY8 A;  2FE9 A;  2G0A A;  3NRW A;  3BZK A;  3E58 A;  3PMN A;  2IOH A;  2ZIU A;  3WK7 A;  5ALS A;  4DO9 A;  4LVS A;  2EDU A;  1VLB A;  2QB0 B;  2KVS A;  3SD7 A;  1U45 A;  3V7J A;  9ICX A;  3PW4 A;  2ISO A;  2EAM A;  4TUS A;  4M47 A;  1S8O A;  2HDO A;  4DSL A;  4AYB C;  3QXG A;  4GXJ A;  1XSL A;  4YXM A;  4QZH A;  4FS1 A;  1ZQO A;  2UVW A;  2K8B B;  1PZN A;  5BPC A;  4RQ1 A;  2H3Q A;  2RRD A;  5J2J A;  4Y2Y A;  4O5K A;  4DFP A;  2K89 A;  3M7D A;  4MEX A;  4CDG A;  5J0Q A;  3KKA A;  5J29 A;  4UB6 U;  4IRK A;  3KHG A;  2F3N A;  3PX6 A;  2ZG6 A;  3C2M A;  1LV5 A;  3AQE A;  3NVY A;  1KFD A;  4I2I A;  4B9N A;  2W8L A;  1Q3V A;  3E0F A;  3TAD A;  1A6S A;  4XQ8 A;  3H7I A;  5DBC A;  1D8L A;  2ASJ A;  2DF4 B;  3D6J A;  2YMP A;  2YB1 A;  4B9U A;  4J9L A;  1V97 A;  4O5C A;  3M9O B;  5KFT A;  1JXE A;  2PXI A;  2E1E A;  2AQ4 A;  8ICW A;  1S9F A;  2PFP A;  3RFA A;  3JPO A;  4MFA A;  2G08 A;  1F0M A;  2K8A A;  2ZTC A;  1TAQ A;  3NUQ A;  5KG5 A;  3QZ7 A;  5DB8 A;  5AKK A;  2ISP A;  2WFA A;  3NAS A;  3BQ2 A;  2HSZ A;  4QW8 A;  2XID A;  2W9B B;  4UAV A;  4RPZ A;  3ZDE A;  4RU9 A;  1SZH A;  5J2A A;  4NL9 A;  1ZQM A;  4DFM A;  4YVZ A;  1XO1 A;  1IXR A;  4KLG A;  4DQR A;  1BVS A;  2OXO A;  5G5H A;  2P6R A;  1EXN A;  5J0R A;  8ICK A;  3AUO A;  4Q8F A;  2ASD A;  1TAU A;  2FPL A;  5ALD A;  5KFS A;  5E79 U;  4YR3 A;  2HHV A;  5ALZ A;  4MHV A;  2RDJ A;  4RQ6 A;  1B22 A;  2BCV A;  1CEZ A;  3PV8 A;  2Y0S C;  2G09 A;  2K4P A;  3WKD A;  1SKR A;  4RPX A;  2V4R A;  1NK6 A;  1URJ A;  4K4G A;  2W7O A;  4Z6D A;  3WKC A;  4ECX A;  2JXJ A;  1L6N A;  5AKI A;  3LVV A;  2NO4 A;  5F3X B;  1KFS A;  1Z19 A;  2C2E A;  3RJE A;  2KMD A;  5J8Y C;  5KFV A;  3RTV A;  8ICU A;  1BPZ A;  5KFC A;  3QZ8 A;  3V7K A;  3UQ2 A;  1RDF A;  4Z6E A;  2E3T A;  1COO A;  2DKX A;  4YD2 A;  4M6W B;  1WUD A;  1ZQN A;  3OJU A;  2OM6 A;  2AU0 A;  4M0A A;  5FP0 A;  3UXP A;  2GO7 A;  9ICS A;  5CJ7 A;  4RZR A;  4KLI A;  3SEI A;  3OJS A;  4PL1 A;  5DBB A;  2OH2 A;  3D2Q A;  3M6Z A;  4KLM A;  4KLL A;  4NLB A;  1ZQB A;  3JPT A;  3GIM A;  3TKA A;  9ICA A;  5KG6 A;  3MR6 A;  2IHN A;  1L3V A;  4F91 B;  2BQR A;  1GO3 F;  1OUQ A;  1S0O A;  3IG8 A;  2PFN A;  3T3F A;  4J9M A;  5EOZ A;  1MN8 A;  9ICM A;  2ZIX B;  5HR7 A;  2C28 A;  4NM2 A;  2RQ5 A;  2B6G A;  2OYY A;  3K1Z A;  4O3R A;  2K60 A;  2G5H B;  3A0B U;  4RQM A;  4UB8 U;  1COK A;  3C5G A;  3MFI A;  4JB3 A;  5DGB A;  4DL3 A;  4O5E A;  4GC6 A;  3WK6 A;  3RB0 A;  4UB5 A;  3T5J A;  4RQ0 A;  2HHU A;  2XC9 A;  2J6U A;  3L5K A;  1FFU A;  5AKE A;  5ALM A;  4RQ7 A;  2HW3 A;  3M8R A;  5J2F A;  3C29 A;  2ZUB A;  3KHH A;  4JK1 A;  4P0Q A;  2HBJ A;  2KK0 A;  2R8I A;  1FFV A;  1Q3U A;  2P66 A;  5KFU A;  1ZQD A;  3S6J A;  4IQV A;  1U9L A;  3MGH A;  2NYV A;  9ICB A;  5EE3 A;  2RHF A;  4F5P A;  3NGD A;  3DV9 A;  5KFD A;  4RNO A;  2DWQ A;  3NRZ A;  4R8U A;  2D6F C;  5DG8 A;  5EE1 A;  2W55 A;  4KLF A;  3ZDC A;  2EH9 A;  4QZ9 A;  4Y2Q A;  1Q8K A;  3F2C A;  1ED1 A;  2ZXH A;  2BR0 A;  1D8Y A;  4F2S A;  9ICO A;  4QWD A;  4P2H A;  1S10 A;  4QNL A;  2HVH A;  3HX0 A;  4PHD A;  3L4P A;  2IA6 A;  4FO6 A;  7ICQ A;  1VJ5 A;  3IP4 B;  3MR2 A;  5C0Y A;  2FMP A;  1ZQF A;  3MDA A;  1T94 A;  1Z3E B;  4EBC A;  5D46 A;  5ALV A;  1IM4 A;  1OXJ A;  1SKW A;  2HHQ A;  3TAD C;  3IDW A;  3M9N B;  3C28 A;  1WYG A;  2JH1 A;  1JN3 A;  2HMX A;  2KEY A;  1TK0 A;  3D2S A;  4O3S A;  1C7Y A;  4Q45 A;  1X2I A;  4Y2P A;  2BQ3 A;  3IV6 A;  2M0N A;  2LHT A;  2KP7 A;  3RAQ A;  8ICZ A;  4ECY A;  3CYM A;  3H0R B;  4DL6 A;  1X40 A;  8ICH A;  7ICN A;  4NLK A;  5AIA A;  3GZF A;  2HOQ A;  3R9K A;  4UW9 A;  5DDM A;  4HYK A;  2FLP A;  3T79 A;  4Q43 A;  2DPI A;  4J9Q A;  2OCE A;  3UQ0 A;  2BCS A;  3QU9 A;  4QZG A;  4NLC A;  5KFM A;  9ICU A;  9ICW A;  2KZ3 A;  2W11 A;  1TKD A;  3UPQ A;  8ICN A;  1ZQH A;  4CRX A;  5DQH A;  3V6K A;  2ZIW A;  2ZIX A;  3WK5 A;  4NY8 A;  3MGV A;  2VA8 A;  1UQV A;  2H3I A;  4UQG A;  4R66 A;  3PW2 A;  1NK9 A;  2JV3 A;  2WHE A;  1Z00 A;  8ICM A;  1A77 A;  2F77 X;  4KMU A;  1Z00 B;  2KHQ A;  1L3U A;  2LYA A;  2PI5 A;  3H40 A;  3V6H A;  1KTQ A;  3L3F X;  3K75 D;  2ZUD A;  4MFC A;  3CW2 C;  3DEE A;  5KFR A;  4ECW A;  3BZC A;  4DLE A;  2JHD A;  5KT7 A;  1ZQK A;  3RH4 A;  1HUO A;  4ED1 A;  4Y2X A;  5DB7 A;  9ICC A;  4Y2S A;  4YN4 A;  4EBD A;  3PW5 A;  1M6Y A;  1KW4 A;  2HHS A;  4IC9 A;  4GXK A;  2A19 A;  5AI4 A;  2Y1I A;  4DL2 A;  3EUB 2;  5GTH U;  2RP5 A;  4I2A A;  2BHN A;  9ICT A;  2UVV A;  4K4H A;  1ZQX A;  4CF5 A;  9ICL A;  4R8U B;  8ICE A;  9ICN A;  3H0M B;  4RNN A;  3ZD9 A;  5D4B A;  1N2X A;  4I2B A;  1HEK A;  3WK4 A;  2LMR A;  7ICU A;  1JRP A;  5KFI A;  4Y2R A;  4US9 A;  1NK7 A;  5IIM A;  1SXD A;  1RYS A;  4C7Z A;  2LI6 A;  7ICJ A;  4EEL A;  3RB3 A;  4EZ6 A;  5KG2 A;  4OJO A;  2W8K A;  1ZRM A;  4J03 A;  3SAG A;  3M6K A;  3GDX A;  4DOC A;  4J9S A;  2C2R A;  1ZQV A;  2W9M A;  4U7C A;  5J2C A;  4Q44 A;  3TFS A;  4M04 A;  1JUD A;  2LM4 A;  2JZB A;  2KSO A;  4I2D A;  1T4G A;  2O6K A;  1N5X A;  3RJH A;  3HJE A;  3G6Y A;  5DGA A;  2BPG A;  2WF8 A;  4EX7 A;  4PJ0 U;  3UXN A;  4F4Z A;  4Y2T A;  4M9J A;  3H8J A;  1KQQ A;  1QQ6 A;  4AYB F;  5AHX A;  2FI1 A;  3NS1 A;  4RUA A;  3AN1 A;  1QSY A;  4NM1 A;  1N60 A;  4EEN A;  3SI8 A;  4TQR A;  4YP3 A;  2XI9 A;  5HMM A;  3LYS A;  8ICV A;  1ECW A;  2KZZ A;  2K4E A;  2KIV A;  8ICS A;  1IV8 A;  2A1J A;  3FAH A;  5AI0 A;  2OWO A;  3Q8L A;  4JWN A;  4P4P A;  1J97 A;  3V72 A;  4YR0 A;  9ICV A;  4LZD A;  5J0S A;  9ICP A;  5J0X A;  4UAU A;  4GFJ A;  4ECR A;  5KG4 A;  1N63 A;  3U26 A;  4IQW A;  4QZC A;  1Z1V A;  1U48 A;  1OW5 A;  1RZT A;  2ZTE A;  5KL1 B;  2IHM A;  4C8L A;  2JEF A;  4PZO A;  2GWS A;  2VJ4 A;  4O3O A;  4DEZ A;  2ALZ A;  2R8K A;  3JPQ A;  3IN5 A;  2QB0 A;  4J9R A;  4DSF A;  2MSN A;  2W7P A;  1ZQT A;  2K4H A;  4ELT A;  1SL2 A;  1BPB A;  3RBD A;  4Z6C A;  4FZM A;  1JRO A;  2PI4 A;  4ZH4 A;  4DS5 A;  1LB2 B;  5KAF U;  8ICR A;  5EWE A;  3B9J A;  4RQ2 A;  4JMU A;  1MQ3 A;  5IIL A;  5AM0 A;  4RPY A;  1Z4N A;  2GLE A;  3KHL A;  4YR2 A;  4C4S A;  1NJZ A;  4Q8E A;  4TUQ A;  1NK4 A;  4QZB A;  5G5G A;  3SAF A;  3H8S A;  5AKL A;  1KN5 A;  1UA0 A;  5L9X A;  4PGQ A;  1T3Q A;  2AGO A;  4DLG A;  3E2E A;  3GV5 B;  1TK5 A;  5J2I A;  3QYP A;  5GTI U;  4BXO A;  4LJX A;  1KL9 A;  5ALJ A;  2I9G A;  1JMS A;  2RLT A;  1ZD4 A;  2P6U A;  3ZD8 A;  8ICC A;  2V4Q A;  2OHF A;  3QU5 A;  3T5K A;  1CUK A;  5CEH A;  2HHX A;  3TAN A;  2YML A;  3MBY A;  4I2F A;  4R65 A;  3BQ1 A;  2JMG A;  3F2B A;  2MAX A;  3BDP A;  4YMN A;  1MC8 A;  5AI5 A;  3F53 A;  3G6X A;  4FE3 A;  2YMM A;  3SMV A;  4DFD A;  4C7Y A;  1SL0 A;  1QLN A;  2FPM A;  1ZQ1 C;  2KD1 A;  3PO4 A;  4QZD A;  1QQ7 A;  2QAR A;  3UXO A;  4RNM A;  8ICI A;  3PZP A;  3ETL A;  2G06 A;  5DQG A;  5ALY A;  3BS7 A;  2Q0Z X;  4K4I A;  9ICQ A;  5AM5 A;  5J2K A;  2WTF A;  3EZ5 A;  4F4W A;  1SGG A;  4IQT A;  1QH9 A;  2KE7 A;  4GLX A;  2KJ9 A;  4ICA A;  4NV0 A;  7ICG A;  4NLZ A;  3K1R B;  3KZX A;  9ICI A;  4F5O A;  5ALT A;  3ED5 A;  5KFA A;  5KFX A;  2NRW A;  5L1L A;  5L1K A;  2E5S A;  5AI9 A;  3MC1 A;  2JEI A;  1SZP A;  4ZOH C;  1MQ2 A;  4C8K A;  3KD3 A;  2HVI A;  2Y9U A;  4O9M A;  1L7O A;  4J9K A;  3N28 A;  4EYI B;  4USA A;  2ZUC A;  4QWB A;  4TUP A;  2QKQ A;  1NK5 A;  4YD1 A;  2H3Z A;  5J2G A;  5AK3 A;  4DF8 A;  2F1I A;  5KT6 A;  1YZ6 A;  2NRV A;  2YN4 A;  2BCQ A;  2ES6 A;  2GH1 A;  2BDP A;  3RAX A;  3C23 A;  4YMO A;  3N4M B;  3F5E A;  2JEJ A;  1NJX A;  4KLD A;  1SB3 C;  5CA7 A;  1X9W A;  2WB1 C;  3C5F A;  2L5Y A;  1U4B A;  5EE9 A;  4JV2 A;  2PFO A;  1JAL A;  3RR8 A;  2KIW A;  4IR9 A;  7ICE A;  1B4F A;  4PHE A;  2Y1J A;  1KDH A;  2E8N A;  3H4D A;  3ZDA A;  1X9S A;  4IR1 A;  4GC7 A;  5ALN A;  2AGP A;  5AM3 A;  2B0C A;  1NKB A;  8ICT A;  1XWL A;  5DG9 A;  4IRC A;  1X9X A;  4DWI A;  1QSS A;  5AKJ A;  4OJL A;  4DS4 A;  5J0Y A;  3SYZ A;  7ICV A;  5J2E A;  4C80 A;  7ICI A;  1ZOL A;  2VA3 A;  1KLN A;  1FEZ A;  5HP4 A;  3OHA A;  3C2K A;  3WKA A;  5JTI A;  3SEN A;  5AKY A;  3RRG A;  2KIC A;  3H0L B;  5F9L A;  2HHW A;  2KJ5 A;  4FBT A;  5H2F U;  3CP8 A;  4J9P A;  1SWW A;  4KLT A;  4RQ4 A;  3LVW A;  1KKX A;  1KSP A;  1TK8 A;  1RG6 A;  5KFJ A;  5DLG A;  1JI7 A;  4Y2U A;  5D49 A;  4P0P B;  1ZQL A;  3GQC A;  4PGX A;  4I2H A;  2R8G A;  4P0P A;  1KBU A;  3IHQ B;  3ZDD A;  2HBK A;  4C0Z A;  3T5H A;  2A3V A;  4P0Q B;  2BPC A;  7ICO A;  1LKY A;  3AEV A;  4KX5 A;  1ZQI A;  2QAR B;  2IMW P;  4EEK A;  3M8S A;  2LM1 A;  4QZI A;  4FS2 A;  5ALK A;  1CRX A;  4UAS A;  4UAW A;  5HNK A;  3MR5 A;  2Z7J A;  4QIW C;  3MR3 A;  1QSL A;  5ALI A;  2CRX A;  2R18 A;  1PVP A;  4YCX A;  2LYB A;  2HCF A;  2MA1 A;  2D8C A;  2FMS A;  5ALO A;  1PVR A;  4MEY A;  4RT3 A;  2F8L A;  4DQI A;  1DK2 A;  3DDH A;  2WF9 A;  2E8M A;  2ZIW B;  3HPO A;  1NKE A;  5III A;  2BDU A;  1ZD3 A;  3PO5 A;  4ELU A;  4PHP A;  4UAR A;  8ICO A;  1FIQ A;  3ORY A;  1V85 A;  1ZQU A;  3QUT A;  4ED0 A;  3F5A A;  1S0N A;  5EWG A;  1S97 A;  1PUZ A;  1P7D A;  2H3V A;  3QU4 A;  3QX7 A;  2KJ8 A;  3PNC A;  1DGJ A;  1A0P A;  1T8E A;  1ZXI A;  2W43 A;  1IIP A;  5J2D A;  2J6S A;  1H38 A;  4B9V A;  3M1Y A;  3I76 A;  2W3S A;  3Q8K A;  1HJP A;  1RQL A;  2YY6 A;  3AU6 A;  4I2G A;  2LPE A;  2VKQ A;  2XVT A;  3QEB Z;  4I29 A;  2B21 A;  2P35 A;  4I2C A;  5KG1 A;  1TFR A;  3IM1 A;  4E0D A;  2NV3 A;  4QIW F;  4CE6 A;  3EPG A;  1YT3 A;  4BWJ A;  3JPS A;  2YTU A;  1NJW A;  2LBO A;  3BQ7 A;  2AXT U;  4F8R A;  9ICG A;  4UB4 A;  2I1Q A;  7ICK A;  2ZJ8 A;  5ALE A;  1NZP A;  3ISB A;  1ZD5 A;  5ALP A;  3GV7 B;  3M9M B;  2LKY A;  1RPL A;  4I2J A;  3MFH A;  3KOO A;  4KMO B;  4UBB A;  3RB6 A;  2M9N A;  4UAZ A;  3RJI A;  3HIL A;  5AM2 A;  2W54 A;  2BKE A;  4FZN A;  4F4K A;  2F2A B;  3MDC A;  5KT4 A;  2KTQ A;  4QZE A;  4RQ8 A;  3OGU A;  4DFK A;  2F1J A;  3EW9 A;  8ICB A;  1RM6 C;  2CXY A;  2DBY A;  1RXV A;  3FDS A;  2WF6 A;  1XSP A;  2HBL A;  4QZA A;  7ICR A;  1ZJN A;  2EZZ A;  4TQS A;  5KT3 A;  2OEH A;  5CHG A;  4C8N A;  3MGI A;  3BS5 B;  4F3O A;  4WJ3 B;  1SIJ A;  4NWI A;  2UVR A;  8ICF A;  3GV8 B;  2IOF K;  2Y9T A;  4EBE A;  3CRX A;  1NOM A;  2DL0 A;  4C8O A;  5KG7 A;  4F92 B;  3OSP A;  4F5Q A;  2A1A A;  1RQN A;  4B9L A;  2NRT A;  5BOM A;  5KFZ A;  2KFN A;  4F50 A;  3Q8S B;  1UPH A;  5KAI U;  3GIL A;  3Q8R B;  3AU2 A;  2W3R A;  1S0M A;  4IRD A;  1RXW A;  4NLN A;  2FLN A;  1ZQZ A;  1XSN A;  1K1S A;  5AM4 A;  2ZXI A;  5IIJ A;  3UMB A;  3I28 A;  2KKV A;  3RF9 A;  2AQ0 A;  3NTU A;  4O0I A;  4ED7 A;  4O3M A;  2HOF A;  2JGA A;  4DSJ A;  1CI4 A;  4BGD A;  4YMM A;  4PHA A;  3SQI A;  1ZQW A;  5KFE A;  1S76 D;  1MSW D;  4M9H A;  3NVZ A;  1XC9 A;  4CNQ A;  1XU4 A;  2JZB B;  2KSO B;  1D9F A;  5AK6 A;  3N7R C;  4RUC A;  2AGQ A;  5ALF A;  8ICX A;  4GXI A;  1ZET A;  4DQP A;  9ICE A;  1S5L U;  2FMQ A;  1X6J A;  2RDI A;  2XGP A;  4MF8 A;  5J8Y A;  4ED2 A;  3NVV A;  5ALH A;  1ZQJ A;  5J0U A;  1WWV A;  5DG7 A;  3C1Z A;  2N1R A;  1N56 A;  3SAH A;  1T3N A;  4DFJ A;  2XIC A; 
#chains in the Genus database with same CATH homology
 4WJ3 B;  2HOQ A;  2WAQ F;  4NWI A;  3PZP A;  2G06 A;  4OO1 J;  3O0F A;  2KHV A;  2VJ4 A;  5A0L A;  2PMZ C;  3CRX A;  1URJ A;  2HOF A;  2W7O A;  3F5A A;  1HEK A;  2W04 A;  1D8B A;  2K8B B;  3IN5 A;  1TAM A;  3T79 A;  1P7D A;  2H3V A;  4QJF B;  2W7P A;  2H3Q A;  2KIC A;  2RRD A;  3H0L B;  3IG5 A;  2E1F A;  2KJ8 A;  2KJ9 A;  4ICA A;  2K89 A;  4OJP A;  1L6N A;  2K4H A;  3M7D A;  4NV0 A;  4PL2 A;  2KJ5 A;  3LVV A;  4CDG A;  3PSI A;  4FZL A;  4NLC A;  3CP8 A;  3C29 A;  1A0P A;  1Z19 A;  1UPH A;  3LVW A;  4P0Q A;  2HBJ A;  3KZX A;  2WAQ C;  4OJO A;  2H3F A;  3GZF A;  4FZM A;  3VCB A;  1IIP A;  2ZG6 A;  1Q3U A;  3AQE A;  4CRX A;  2WB1 F;  3HKZ F;  3SAG A;  1Q3V A;  3M6K A;  2ZIW A;  3E0F A;  2Q4T A;  2ZIX A;  4BX9 C;  2K4I A;  1A6S A;  4JMU A;  3MGV A;  4A8E A;  2E5S A;  2ZIV A;  4P0P B;  2RHF A;  2H3I A;  1WUD A;  4U7C A;  2K8C B;  2VKQ A;  2XVT A;  2ZIV B;  3GU3 A;  3N7P D;  2DF4 B;  4OJ6 A;  4P0P A;  2YB1 A;  1KBU A;  2DQN B;  2D6F C;  2ZXI A;  2OM6 A;  2HBK A;  4CGZ A;  3PST A;  4C0Z A;  3SAF A;  2A3V A;  1F44 A;  2NV3 A;  4QIW F;  4P0Q B;  2E1E A;  3F2C A;  1ED1 A;  2KKV A;  2ZXH A;  2F77 X;  3RF9 A;  4KX5 A;  3PSF A;  1NZB A;  1YT3 A;  1MA7 A;  4PL1 A;  3AL0 B;  2KHQ A;  5KL8 B;  2OH2 A;  3D2Q A;  3RFA A;  5HR6 A;  4O3M A;  3M6Z A;  5T14 A;  3F2D A;  2LYA A;  2G08 A;  2JGA A;  4QNL A;  2H3Z A;  2K8A A;  4NLB A;  2LBO A;  4AYB F;  5CRX A;  3NUQ A;  2Y0S F;  3L3F X;  2VJ5 A;  3SQI A;  2HBM A;  4BJQ A;  1CRX A;  2ZIU B;  2XI9 A;  2G5I B;  3DEE A;  2VIX A;  3ICX A;  2GH1 A;  3IP4 B;  3LYS A;  4OJ5 A;  1ECW A;  1GO3 F;  3OPX A;  1OUQ A;  5C0Y A;  2K4E A;  2JHD A;  3KFU F;  2XID A;  3IG8 A;  1T94 A;  2LKY A;  2KNJ A;  2Z7J A;  3F5E A;  3N7R C;  3VC8 A;  2KVC A;  4BUG A;  4KMO B;  4QIW C;  1SZH A;  1Z1B A;  1PVQ A;  2CPR A;  2CRX A;  2R18 A;  2WB1 C;  3HKZ C;  4ACO A;  3C28 A;  1DRG A;  1PVP A;  2MRL A;  2JH1 A;  2CN1 A;  4FZN A;  2LYB A;  2ZIX B;  4IC9 A;  2F2A B;  2HMX A;  1HIW A;  2KEY A;  5HR7 A;  2MA1 A;  2KIW A;  3AQF A;  2G0A A;  2JMG A;  3NRW A;  3F2B A;  1PVR A;  3D2S A;  2JH7 A;  3ONN A;  2OXO A;  1XO0 A;  2F8L A;  2RP5 A;  2DGZ A;  2OYY A;  2ZIU A;  2YB4 A;  3F53 A;  3K1Z A;  2GOL A;  2KV2 A;  4FE3 A;  3SMV A;  2G5H B;  1XNS A;  2ZIW B;  4GFJ A;  2HOI A;  2M0N A;  2HBL A;  2LHT A;  2BDU A;  2KOB A;  1ZQ1 C;  4U6P A;  2KD1 A;  3PSP A;  2KKP A;  2PMZ F;  3CYM A;  3H0R B;  2N1R A;  3N7S C;  4KX3 A;  3H0M B;  3ALR A;  5KL1 B;  3SAH A;  3D2N A;  4OJL A;  2F76 X;  4AYB C;  2W03 A;  2YX8 A;  2G07 A;  2XIC A;  2Y0S C;  2G09 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...