3AQEA

Crystal structure of the extracellular domain of human ramp2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
76
structure length
76
Chain Sequence
NYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Receptor activity-modifying protein 2
publication title Structural basis for extracellular interactions between calcitonin receptor-like receptor and receptor activity-modifying protein 2 for adrenomedullin-specific binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 22
structure length 76
sequence length 76
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.510 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3aqeA00
2YX8A 2XVTA 3AQEA 3N7RC 3N7SC 3AQFA 3N7PD
chains in the Genus database with same CATH superfamily
3ETLA 2MAXA 1HUZA 2VJ4A 5EWEA 4GC7A 2MUTA 1MA7A 4J9RA 3LWMA 1XSPA 3KHRA 9ICGA 1ZQZA 2EAPA 4QZ9A 4Y2JA 1BPDA 5CJ7A 1SKSA 3WK5A 1B4FA 3L4PA 1Q3VA 5EWGA 2F1JA 2BPGA 1ZQAA 1KEJA 5AI4A 9ICWA 7ICVA 4B9TA 3RR8A 1Z00A 4QZAA 1PK1A 1SXEA 4R65A 2LBOA 3MFHA 3L5KA 1Z1BA 3UM9A 2JRZA 4DLEA 4QZ8A 1D8YA 2H3QA 4HAIA 3NVYA 3M8SA 3ISBA 2W9BA 3ZD8A 2OYYA 4Q8FA 3AQFA 4NWIA 3OJSA 5CWRA 2KD1A 5HHIA 3QE9Y 3UXOA 4Q45A 2IHNA 2HBMA 2FLLA 3LVWA 3OSPA 2D8CA 3V7KA 5JTIA 4NJ8A 2I9GA 3H7IA 4M6WB 1L3VA 4TUPA 2HOIA 1NK9A 1PUZA 3Q8QB 3RJEA 4Y2UA 5AIBA 2H3ZA 1ZQDA 4NM2A 3T5KA 4PH5A 5J0UA 4GFJA 4DQIA 2NRZA 2E5SA 4RNNA 2XGPA 1UCVA 4PGXA 9ICQA 1S0NA 3H4BA 4I2AA 3TACB 4IQVA 4FS1A 2LPEA 3N7PD 5ALVA 3RH5A 2OEHA 4NLZA 5ALOA 1J2NA 2WTFA 3MDAA 2PXIA 4PGQA 4F4XA 2FMPA 2VJ5A 3RJGA 1ZJMA 2OCEA 5ALDA 3RRGA 2V4RA 5CHGA 1SL1A 3D2QA 2R18A 1VDVA 4KLTA 3QEAZ 4F5RA 5AM2A 4GIBA 3SQIA 2E1FA 5D46A 2W11A 4PL2A 2W8LA 4R8UA 2JR5A 8ICGA 4PZOA 1JIHA 1ZQVA 2LHTA 3PVXA 2LYAA 3GDXA 4K4HA 4M04A 3SZ2A 2MRLA 4IQTA 3GU3A 4YVZA 2HBLA 1BNOA 3Q8KA 5J2EA 3TADC 2VA2A 1U49A 5KAIU 2I6XA 3WU2U 3WK4A 3WKAA 3PW5A 3E2EA 4YFKA 2XO7A 1ZQ1C 3IRUA 2IHMA 5ALTA 4QWAA 4FO6A 1FO4A 3G6VA 3UQ0A 4OJ5A 1DK2A 5EE1A 1D9DA 4CF3A 4C4TA 5J0YA 2XVTA 1BNPA 3C5FA 5ALWA 8ICCA 5JU5A 2FLNA 3UMGA 2K4EA 2QLTA 4DO9A 4BX9C 3WK7A 1SV0A 2L5YA 5AKKA 4I29A 5DB8A 4MF8A 4EEYA 4F2SA 3QU7A 5AI0A 4YP3A 3PX6A 2R8JA 4JWMA 4OJOA 1SL0A 4M9LA 1ZJNA 4RQ4A 5AI5A 1C20A 2PFNA 3H40A 2YX8A 1XO1A 5AK6A 5AM3A 4FZNA 4P0QB 2XY7A 2YMLA 5J2HA 3HX0A 4NLNA 1KW4A 4C8MA 4C4SA 3AMZA 3AEVA 4YMNA 1X40A 3I1YA 5D4BA 3KKAA 3E0FA 2KSOB 3WKEA 2KV2A 1IXRA 2BQ3A 1LB2B 4EENA 5JUMA 4RQ3A 2OWOA 4DFMA 1WYGA 2EAMA 1DGSA 8ICFA 1U4BA 2OH2A 2PMZF 2C2DA 5ALGA 1S5LU 2KP7A 2N1RA 2HHWA 5HNKA 1O03A 2RLTA 1V38A 4USAA 1RXWA 1U47A 3LDAA 4UAWA 1CUKA 3EYZA 1BPZA 2C28A 4NL9C 1NOMA 2LYHA 4G9BA 2ES6A 5DKWA 2AGOA 5IILA 5EE9A 1SZPA 9ICIA 4DSJA 1CRXA 2XCPA 5AM0A 2BQRA 3EWAA 1QLNA 3MGVA 3MGHA 5T14A 1L8OA 3PSTA 4B6JA 4O3NA 2ZXHA 4ECRA 3C1YA 1SWVA 2OHFA 4M6WA 2Y0SF 5KAFU 4YXJA 3M9NB 2AU0A 4KN4A 1NK7A 4B9SA 4QW8A 2DQNB 1RQLA 1ZD3A 3CNHA 5C5JA 1QCKA 2NO4A 4QJFB 5KG3A 4KLQA 1BPXA 5J0TA 4B9VA 2BCQA 2KOBA 4FZLA 3QU5A 1ZOLA 3I28A 4TUQA 4R64A 4YR0A 1COOA 2DBYA 2KE7A 2E3TA 2F44A 4I2HA 2KN7A 4DWIA 1N48A 1RM6C 4XQ8A 4C8KA 3BJYA 2BDUA 1CI4A 2ZJAA 3SR6A 1TAMA 5KFAA 1ZQWA 4DFJA 4UB3A 7ICHA 3R9KA 1NNLA 3PR4A 3KD3A 4M9NA 3N7SC 8ICPA 5AKLA 4JMUA 4QZDA 2YY6A 4ED2A 1BPEA 2MUTB 4O3PA 4GXIA 3NS1A 7ICTA 4P0PB 2Y0SC 7ICFA 1SB3C 1PZNA 3GIMA 3ZDAA 3TAQA 2RDIA 1NK6A 4QWBA 5L1MA 3KHGA 2MU2A 5KNIA 8ICHA 2ZJ5A 1SZHA 5AI8A 2ZUCA 5AKZA 4KLSA 8ICYA 4MFFA 2JH7A 5AK5A 2K60A 3BQ0A 5CP2A 3JPQA 4MF2A 4KTQA 3IP4B 2W9BB 1OXJA 3HKZF 4F71A 2XICA 3U26A 1AROP 1MQ2A 5J2AA 5K4LA 1X6JA 4QZBA 1KDHA 1WCLA 4NLBA 1L5UA 1S77D 1TKDA 2EQYA 2W03A 4ZH4A 4UB5A 4UAZA 2JEIA 5L1IA 2ISPA 1Z4OA 4KLDA 4MEYA 4UB8U 3H0RB 4PGYA 1ECWA 5KFJA 4EX7A 3RAXA 4O5CA 2HVIA 2VA3A 2RP5A 1NJZA 2A3VA 5F9LA 2RDJA 3QEBZ 2E8PA 2A1JB 2Z7JA 2KVSA 3PR5B 5J8YA 3SI8A 1QQ5A 1XO0A 4BUGA 2EH9A 2WF9A 1JN3A 4BWMA 3FDSA 3PX0A 3TANA 3HKZC 4JUZA 2EANA 2XCAA 1PK3A 9ICFA 3BQ7A 3I76A 1ZD2P 4IS7A 4O5EA 1TV9A 3UQ2A 4KLMA 2MA1A 4RQ0A 3MDCA 2BCVA 5J2GA 3ISCA 3IV6A 4QZCA 3GV7B 4RQ8A 3K1ZA 1YZ7A 3TARA 3WKBA 2IOFA 3N97B 4UARA 1X6IA 2LYBA 4R63A 4O9MA 2RHFA 5G5GA 4KMOB 3M6ZA 2HHXA 4R8UB 3PMLA 7ICEA 3LK9A 2H5XA 4GXJA 5HP4A 9ICXA 1ZQXA 4DCCA 4QZEA 4C80A 1TK8A 3OJUA 3AUOA 5AI6A 7ICGA 5L9XA 1JUDA 1KN5A 2Y9UA 5KT3A 5J0SA 2AJQA 3C2LA 5KT6A 4ECYA 2YMMA 1LKYB 3TKAA 4YMMA 4JV0A 2KIWA 2BCSA 1N60A 1A77A 5ALQA 2XI9A 2BHNA 1Z19A 9ICJA 3MC1A 7ICUA 2HDOA 4F93B 5ALHA 5ALEA 3TQ1A 5DDMA 3FYHA 4EBDA 3T5LA 2LI6A 1NZPA 1T3QA 5DG8A 1SL2A 3ZD9A 3V6HA 1SGGA 5ALUA 1X9WA 7ICNA 3D2NA 2H3FA 1JMSA 1QQ7A 3M9OB 4PZNA 4FE3A 1B43A 2EZXA 4ECZA 5KL8B 9ICTA 1LVHA 2ASJA 4OCZA 1NK8A 2KFNA 4P0PA 2D3DA 5L1JA 2A1AA 3PO5A 2BDPA 1TFRA 2W9AA 3WKCA 4I2BA 2FMSA 3QXGA 5KFLA 3F53A 4F5QA 1L7MA 2P66A 4UAUA 3HILA 2JMGA 3RAQA 3RJFA 8ICOA 5L1LA 4DQSA 3LYSA 8ICEA 2UVUA 3ICXA 1FFVA 1J2MA 2PFPA 5KT4A 2QARB 3AQEA 5H2FU 3EPGA 2KKVA 1C7YA 5CEHA 1Q46A 3PW2A 4PL1A 3UMCA 2BGWA 2HCFA 3RB4A 1RZTA 4F4YA 4DS5A 4ECSA 5J2DA 1U48A 3C28A 2ZTCA 3NTUA 9ICKA 4DSIA 5AKEA 3IG5A 1X2IA 1MC8A 3WKDA 4XUSA 2CRXA 1X9MA 3RJHA 3WK6A 5J0OA 1KTQA 1JX4A 5BOMA 4F5OA 1L6NA 4J9KA 8ICVA 3IG8A 5KFBA 4DLGA 1A76A 2KK0A 2WB1F 5CR0A 3N28A 3QU9A 3RH4A 1KFDA 1DRGA 4F92B 1HJPA 4ELVA 1RQNA 2A1JA 4ELUA 4TQRA 5KTQA 2P35A 3PZPA 4RPXA 4IQUA 4UAYA 1T8EA 9ICVA 1ZQSA 4CF4A 3NVWA 4BXOB 2G09A 3IHQB 4DEZA 2BKEA 1ZQYA 8ICKA 5KFRA 4EYHB 8ICZA 3V72A 3PV8A 4PJ0U 2GH1A 4ICAA 3EPIA 4KMUA 2F8KA 3N7RC 4DQRA 1LV5A 1ZQKA 4ECQA 2KZMA 5KFVA 4DSFA 2V4QA 4O3QA 3GV5B 3RJJA 4HYKA 4J03A 2BPCA 8ICTA 2WHEA 1L3TA 3JPPA 3UXPA 4IRCA 3BQTA 2W7PA 4C7YA 4F3OA 1RYSA 4NY8A 5HMMA 1S8OA 2W9MA 9ICRA 2RRDA 3M9MB 1HUOA 4I2DA 2WB1C 3HJEA 3JPOA 2AGPA 2WAQF 4ECUA 3HWTA 2YQEA 1TVAA 2G08A 2EDUA 1GO3F 2UVRA 9ICLA 1Q3UA 7ICMA 2K89A 2E8NA 2GO7A 1S97A 4F4ZA 3QU4A 1LKYA 9ICMA 1YT3A 3PSFA 2MSNA 1TK5A 3ETRA 3H8MA 4B9MA 4YXMA 2F3NA 2ISOA 3MR3A 3V6JA 1UT5A 2WF7A 1TAQA 3V6KA 4KLFA 1ZQHA 1QQ6A 4B9UA 3QZ7A 4F4KA 1N5WA 2A19A 4DL2A 5KFHA 3MFIA 4J9NA 3T5JA 1QH9A 2DGZA 3KZIU 5ALPA 4U7CA 1S0OA 5EWFA 3C5GA 2P6RA 4P4OA 1JI7A 2W04A 2VANA 2JXJA 4NLCA 4PHEA 4RQNA 1IIPA 2F76X 2Q4TA 1BGXT 2ATLA 2W3RA 1N61A 1ED1A 1PVRA 1K5OA 3F2BA 4YR3A 1SV0C 5KFDA 2YB4A 4ECWA 4Z6CA 5DQGA 1H38A 4PHDA 3K4GA 2JZBB 3C1ZA 4NL9A 2IA6A 4Q43A 3H4DA 4DL4A 2UVWA 7ICJA 4TUSA 2HMXA 3M7DA 5ALRA 4XA5A 3UMBA 5DGBA 3TI0A 2R8IA 5AICA 2QARA 4IRKA 2KHVA 2QB1A 2WFAA 2NRTA 4NV0A 3RR7A 2ODGA 2KTQA 2C2EA 3KKAC 1D9FA 3IM1A 1DK3A 1UT8A 4UASA 4RZRA 1NKBA 4K4IA 9ICUA 5J2JA 3C2MA 5DLFA 3EUB2 4FS2A 3RB0A 5AKHA 1WWUA 3D6JA 1BPBA 4NXZA 2I1QA 4QWDA 1K1QA 1KL9A 3UPQA 3OHBA 1ZQNA 4U6PA 2J6SA 2HOQA 5J29A 1ZD5A 4E0DA 1Q8KA 4RUCA 4MEXA 2HHTA 3H0LB 5AKXA 1WUDA 4QZFA 2Y9TA 4LZDA 4YMOA 2HHQA 2PMZC 2DKXA 5KG1A 5HR6A 3E58A 1ZQJA 5KFWA 5KFIA 5HMLA 4NM1A 4CGZA 4US9A 4BXOA 4YQWA 5KFSA 9ICEA 1S9FA 4OJLA 1ZQGA 3L3FX 4J9SA 2FPMA 4J9OA 4QWCA 5ALIA 2KZ3A 2AH5A 4DF8A 2DPIA 4M9GA 3QYPA 3V7JA 1N5XA 1YZ6A 7ICQA 4DSLA 1XWLA 4YD2A 3GFKB 2Y1IA 2NO5A 3F2CA 2JV3A 3RB3A 4ZOHC 2XY6A 1D8LA 2WF5A 4KLUA 5KFFA 2FLPA 5IIIA 4DOAA 4NLKA 4YD1A 4DOCA 5IIJA 4ECXA 5BOLA 4Y2QA 4KLLA 2B6GA 3V7LA 5KFTA 2GWSA 5ALJA 3N4MB 3EW9A 1JALA 8ICXA 2Y1JA 3OSNA 1V97A 2FJ6A 4J9QA 4O5KA 4YG2A 3PSIA 1ZRNA 4Y2XA 5ALKA 2K8BB 2R8GA 2F77X 2FI1A 4IQWA 1JXEA 5AK3A 2DFLA 2LM1A 3RH6A 2LM4A 1RYUA 5ALXA 2G07A 4DOBA 1PVPA 2IBKA 4EX6A 2WF8A 3RJKA 1KQQA 3NASA 4RT2A 3ZDCA 4P4MA 3ZDEA 4C0ZA 1NK4A 5KL1B 4US8A 3WK8A 1EXNA 4RU9A 4UB4A 4M47A 5KT7A 3LWLA 3C2KA 3K75D 3VCBA 1L7OA 2KG5A 2IOHA 2ZXIA 2G0AA 2JEFA 2NV3A 4F2RA 1T4GA 3Q8MA 1SKWA 3RBEA 3Q8SB 3ZI4A 3NRZA 3SAHA 4C8LA 2W43A 1ZQMA 3BS7A 2ZTEA 5IINA 2M0NA 2FMQA 1ZQPA 4X5VA 3PO4A 3ZDDA 3RB6A 4F4WA 2GOLA 4FBUA 4KLJA 1U9LA 1AQ6A 4EBCA 3KZXA 9ICPA 2JZBA 4I2IA 2BQUA 4Y2TA 1F44A 2PFOA 4QWEA 2OM6A 4UW9A 2H3IA 1NJXA 3AM9A 2KKPA 3M8RA 2AQ4A 2KVCA 3NUQA 3MR5A 4I2FA 3AL0B 1D8BA 4AP9A 3H8WA 2XGQA 2C2RA 4O3RA 4LZGA 1F0MA 2ZUBA 2HW3A 2KEYA 5KFZA 4EZ6A 3VC8A 1RYRA 3CRXA 4GLXA 2LMRA 1N63A 4DSEA 2ESEA 2G06A 3M1YA 4M9JA 5AKJA 5KG6A 2KJ8A 3DDHA 4I2GA 1CEZA 2YN4A 4PHAA 3Q8LA 4ED0A 3B9JA 8ICIA 3CW2C 1O08A 2XIDA 3QUTA 2E8MA 4RNMA 4DF4A 5DB7A 5DB6A 4TQSA 1JROA 5KG0A 1K1SA 1UQVA 1X9SA 4J9LA 3Q8RB 3DEEA 4CF5A 4DL7A 5KFQA 4ED7A 4EYIB 3FM9A 2F1IA 2ZJ8A 1SWWA 1KFSA 2J6TA 8ICNA 5C0YA 2D6FC 1DGJA 3PNCA 3OHAA 3PX4A 1SKRA 3MR2A 2EZYA 2FPLA 1ZQTA 2KZZA 5D49A 1UA1A 4DL6A 2R8HA 4F5NA 4R66A 2VIXA 5DB9A 4Y2YA 1ZQIA 2E8OA 2HSZA 3IDWA 5L1KA 4Y2RA 2FPKA 1L7PA 2WF6A 4ELTA 5AI9A 4J9MA 5HR7A 4C7ZA 2HOFA 1TE2A 5KFMA 4IL6U 4KITB 2JGAA 5FP0A 2CN1A 4JV2A 1JRPA 1OUQA 2ALZA 8ICUA 5KFOA 4F8RA 3MR6A 4DS4A 5TISU 4UBCA 2BZFA 1T3NA 3D2SA 1ZQEA 2DF4B 3QUBA 3OGUA 5AHXA 3SAFA 3SAGA 4JV1A 3ZDBA 3SV4A 2FE9A 5CA7A 3BS5A 2K4PA 3HRDD 4I27A 1HEKA 4LVSA 1P7DA 1NKCA 1QSLA 4WJ3B 2ZTDA 2YB1A 8ICWA 2E1EA 3T5HA 4I2CA 1N56A 4IR1A 1ZQOA 3H0MB 2QB0A 1ZQBA 1KRPA 3HPOA 1UPHA 2W7OA 1U45A 5IIMA 4F72A 1NJYA 4JWNA 3JPRA 5J0PA 1VLBA 1RPLA 1ZETA 3DV9A 1KBUA 5KG2A 2W3SA 2G5HB 5DDYA 2PI5A 4A8EA 1KKXA 3OPXA 2B0CA 4KLGA 1ZYQA 5AM5A 1TAUA 1SV4A 7ICSA 3ED5A 3H8JA 3TFRA 3A0HU 4RQ7A 5AK4A 2F1HA 2PKEA 1J97A 2YTUA 3C21A 9ICCA 5ALMA 5HHHA 1HIWA 1FEZA 2IMWP 3GQCA 3GILA 3PW0A 5DLGA 3BQ2A 5DBAA 3RRHA 4DQPA 1QSSA 5ALFA 2K4HA 4AYBF 3TADA 3H8SA 3CP8A 1XSNA 1F5SA 4UQGA 1NK5A 4O3SA 1M6YA 3RF9A 1ZQFA 1S0MA 3F2DA 3KHLA 4QZIA 2F8LA 1V9PA 2KFZA 3GIJA 8ICBA 1URJA 5J0WA 3OTQA 3G6XA 1UA0A 3TAPA 5DQHA 4RPYA 3HT3A 5G5HA 1L3UA 3JPNA 3CYMA 4Z6EA 5J0XA 5TZVA 5AKIA 5KFNA 1ZRMA 5KFUA 7ICKA 1B22A 5KG5A 3BDPA 3PSPA 8ICRA 4G3IA 4RQ1A 5AM1A 2KJ5A 5DQIA 3FAHA 3QZ8A 1ZQUA 4O0IA 4AYBC 2JEGA 4RQ5A 5AKYA 3GIIA 1ZQCA 2NRWA 2WAQC 2DWQA 3MBYA 3FC4A 3F5EA 8ICSA 4DFPA 4KN7A 1X42A 2ZIVA 5KFPA 2DL0A 5A0LA 5J2FA 1Z3EB 7ICLA 4ED3A 5ALSA 5AKGA 4Y2SA 5KFEA 4Z6DA 8ICJA 4IC9A 4TURA 4QIWF 4Z6FA 4JK1A 1L3SA 1WCNA 4UB6U 3ORYA 5ALZA 2IOFK 3C23A 2J6UA 3JPSA 4QNLA 2K4IA 1RXVA 1ZD4A 4QW9A 1WWVA 4C8NA 7ICIA 3MABA 5KFGA 3THVA 3QNMA 2NYVA 5AM4A 3AU6A 5B66U 5AIAA 4LJXA 1V85A 2JEJA 3JPTA 2YMQA 4YN4A 1N2XA 4KLOA 4KLEA 2ZIUB 3NVZA 4RPZA 4C8OA 1X66A 9ICHA 3RJIA 1QTMA 2UVVA 2K8CB 2AQ0A 2DPJA 4YCXA 5B5EU 3RFAA 4C4RA 4OJPA 2CXYA 2RQ5A 3ONNA 2KJ9A 4M9HA 3J81j 3NRWA 4M0AA 9ICOA 4M2YA 1KLNA 2BR0A 4QIWC 3QUQA 2BCUA 2R8KA 2EZZA 2I5HA 5EOZA 2KIVA 2ZG6A 4DL5A 3IN5A 2HBJA 5KG7A 4J9PA 8ICQA 4MHVA 2NRVA 3O0FA 5ALLA 2W8KA 3A0BU 4RQ6A 2PFQA 3T3FA 1B0XA 1BVSA 4EEKA 2EAOA 1S76D 3KOOA 4CNQA 5F3XB 4FFDA 2DKZA 5J0QA 4Q44A 2W54A 3BZCA 1SIJA 5ALYA 2GLEA 2Q0ZX 3KFUF 2ZIWB 3B0YA 5DBBA 4BGDA 9ICAA 5J2BA 2ZIXB 4IR9A 4RUAA 2ASLA 5DGAA 1JXLA 2W9CB 2ZUDA 5J2CA 4NLGA 4Q8EA 1X9XA 4UB2A 4CRXA 3NGDA 4MFCA 9ICNA 3PY8A 7ICOA 2VA8A 4ECVA 3RTVA 3T79A 4GC6A 3HW8A 1IV8A 1T7PA 1COKA 1BPYA 3GZFA 1XNSA 7ICRA 1IG6A 3LVVA 4BDPA 3PMNA 4IRDA 4RQ2A 8ICMA 2HVHA 1ZXIA 1PVQA 2F2AB 2HHSA 1A0PA 1OW5A 2XY5A 5J0RA 4P2HA 5KG4A 1Z00B 4OD0A 1PK1B 2XC9A 3C29A 4KLIA 1S10A 4MFAA 4B9LA 3BS5B 1KSPA 3KBBA 4PHPA 4DQQA 3QX7A 1FFUA 3K1RB 1L8LA 1T94A 8ICAA 3NVVA 4P4PA 3QUCA 2QB0B 3Q8PB 1KFTA 3SYZA 4Y2PA 1DXSA 4O3OA 2NRXA 5KT2A 3EZ5A 2P6UA 8ICLA 1NI3A 4CDGA 5EE3A 2QKQA 3B0XA 1Y88A 4QZHA 4DSKA 2FDRA 3KHHA 7ICPA 5ALNA 1RG6A 4I2EA 1ZQLA 3AU2A 4ED6A 5J2IA 1QSYA 1XS9D 5GTHU 2JH1A 3TFSA 4K4GA 4I28A 4OO1J 5KFCA 3SENA 4P0QA 2C22A 3PW7A 3G6YA 4B9NA 1VJ5A 3GV8B 5DG7A 4EZ9A 2ASDA 1S0VA 2HI0A 3ISDA 5DBCA 1A6SA 4ED1A 2KNJA 4I2JA 2KSOA 4FZMA 1ZQQA 2AGQA 4KX5A 5J8YC 2G5IB 4O3MA 1NJWA 5IIKA 2B21A 1TK0A 1RDFA 5KFYA 1Z1VA 1XU4A 2ZIUA 5KFKA 2CPRA 4UATA 2HHUA 4ECTA 2O6KA 4F5PA 4EBEA 2DUYA 1XSLA 3PW4A 2BPFA 3AN1A 4UBBA 3SMVA 2KMDA 4ED8A 4DL3A 5CB1A 2AHOB 1ZQRA 5E79U 5DG9A 3BQ1A 4EELA 4ACOA 4Y2VA 4CCHA 2YMPA 4UB1A 2KICA 5BPCA 2AXTU 4DFKA 4F91B 4KLHA 1FIQA 2M9NA 2VKQA 3SD7A 2LKYA 3SV3A 2HHVA 2PI4A 4F50A 1DOQA 4RT3A 4RNOA 1Z4NA 1SXDA 2K8AA 4YR2A 2KHQA 4RQMA 3S6JA 3F5AA 9ICBA 1MN8A 5EE0A 3HP6A 3UXNA 4OJ6A 1MQ3A 4XRHA 3KTQA 1UHUA 4JB3A 3BZKA 4KX3A 4BWJA 1N62A 4CE6A 5CRXA 5F9NA 5KT5A 5GTIU 1MSWD 4PPXA 5KFXA 1NK0A 2JHDA 5J2KA 1IM4A 5JRTA 3RBDA 4BJQA 1NZBA 4GXKA 1XC9A 3GIKA 2HBKA 1L7NA 3QU2A 2W55A 1NKEA 4QZGA 4UAVA 5IIOA 2BCRA 2ZIWA 9ICSA 3SEIA 4DFDA 2ZIXA 2OXOA 2ZIVB 3M6KA 4FBTA 1WG8A 2W9CA 2V9WA 3ALRA 3MGIA 2H3VA 3WK9A
chains in the Genus database with same CATH topology
3CRXA 3D2SA 4OJOA 1A6SA 2KNJA 1L6NA 4FZMA 2RP5A 3RF9A 3T79A 2DF4B 2G06A 2VJ4A 4U6PA 4KX5A 2HOQA 3IG8A 2YX8A 3F2DA 2G5IB 3GZFA 1XNSA 3SAFA 3SAGA 1MA7A 4O3MA 4FZNA 4P0QB 3LVVA 2A3VA 2WB1F 2VJ5A 4C0ZA 2F8LA 5KL1B 2BDUA 2KJ8A 2Z7JA 1DRGA 2ZIUB 1PVQA 2F2AB 3H0LB 1TAMA 1A0PA 1WUDA 1HEKA 3PZPA 2ZIUA 1URJA 1P7DA 1XO0A 4BUGA 4WJ3B 1Q3VA 2CPRA 3VCBA 2XIDA 2H3FA 3D2NA 3E0FA 3N7SC 2YB1A 2ZXIA 2KV2A 2K8CB 2E1EA 2R18A 3D2QA 2G0AA 4FE3A 2PMZC 2NV3A 3C29A 4JMUA 3HKZC 3CYMA 5HR6A 3H0MB 2G09A 3SMVA 3RFAA 2LBOA 2DGZA 4OJPA 4U7CA 5KL8B 4CGZA 2Y0SC 3SQIA 1UPHA 2E1FA 4P0PB 1Z1BA 2W7OA 3ONNA 2KJ9A 3DEEA 2W04A 4ACOA 2GH1A 4ICAA 2OH2A 4P0PA 3NRWA 4PL2A 2H3QA 2KICA 2PMZF 3N7RC 1T94A 3PSPA 4NLCA 4OJLA 4QIWC 2MA1A 3L3FX 2N1RA 3SAHA 2VKQA 2LHTA 1IIPA 1SZHA 2F76X 4QJFB 5C0YA 2D6FC 2LKYA 2LYAA 2Q4TA 2KJ5A 2OYYA 2M0NA 3AQFA 4NWIA 3K1ZA 1KBUA 2MRLA 1ED1A 1PVRA 2JH7A 3F2BA 3GU3A 2GOLA 2K8AA 2HBLA 4AYBC 2KHQA 2LYBA 2KD1A 2G5HB 3F53A 2YB4A 3F5AA 2ZG6A 3F2CA 4A8EA 2HBMA 2RHFA 3LVWA 3IN5A 2JMGA 3OPXA 4KMOB 2HBJA 4OJ6A 2W7PA 1CRXA 2VIXA 3M6ZA 4CDGA 3LYSA 2WAQC 3O0FA 1ZQ1C 3ICXA 3IP4B 2RRDA 3KZXA 3MGVA 5T14A 4KX3A 3HKZF 3PSTA 5CRXA 2XICA 3F5EA 2WB1C 2ZIVA 2HMXA 2ZXHA 3M7DA 2HOIA 3AQEA 1F44A 5A0LA 4OJ5A 2JHDA 2Y0SF 2KKVA 4BJQA 1NZBA 2KHVA 2OM6A 2WAQF 4PL1A 1HIWA 2HOFA 5HR7A 2HBKA 4NV0A 2H3ZA 4IC9A 2H3IA 2DQNB 2G08A 4QIWF 2XVTA 2ZIWB 4NLBA 3KFUF 1GO3F 2JH1A 3PSIA 2KKPA 1Q3UA 4GFJA 2ZIXB 4OO1J 2JGAA 2KVCA 2K4EA 2K89A 2K8BB 2CN1A 2E5SA 2ZIWA 3NUQA 4P0QA 2F77X 2W03A 3AL0B 3C28A 1D8BA 4BX9C 2ZIXA 2OXOA 2ZIVB 3M6KA 2KIWA 1OUQA 2K4HA 2KOBA 3IG5A 4AYBF 4FZLA 4QNLA 2K4IA 3H0RB 2CRXA 4CRXA 2G07A 1ECWA 2XI9A 3CP8A 1Z19A 1YT3A 2KEYA 3ALRA 3PSFA 1PVPA 2H3VA 3VC8A 3N7PD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YX8 A;  2XVT A;  3AQE A;  3N7R C;  3N7S C;  3AQF A;  3N7P D; 
#chains in the Genus database with same CATH topology
 3ETL A;  2MAX A;  1HUZ A;  2VJ4 A;  5EWE A;  4GC7 A;  2MUT A;  1MA7 A;  4J9R A;  3LWM A;  1XSP A;  3KHR A;  9ICG A;  1ZQZ A;  2EAP A;  4QZ9 A;  4Y2J A;  1BPD A;  5CJ7 A;  1SKS A;  3WK5 A;  1B4F A;  3L4P A;  1Q3V A;  5EWG A;  2F1J A;  2BPG A;  1ZQA A;  1KEJ A;  5AI4 A;  9ICW A;  7ICV A;  4B9T A;  3RR8 A;  1Z00 A;  4QZA A;  1PK1 A;  1SXE A;  4R65 A;  2LBO A;  3MFH A;  3L5K A;  1Z1B A;  3UM9 A;  2JRZ A;  4DLE A;  4QZ8 A;  1D8Y A;  2H3Q A;  4HAI A;  3NVY A;  3M8S A;  3ISB A;  2W9B A;  3ZD8 A;  2OYY A;  4Q8F A;  3AQF A;  4NWI A;  3OJS A;  5CWR A;  2KD1 A;  5HHI A;  3QE9 Y;  3UXO A;  4Q45 A;  2IHN A;  2HBM A;  2FLL A;  3LVW A;  3OSP A;  2D8C A;  3V7K A;  5JTI A;  4NJ8 A;  2I9G A;  3H7I A;  4M6W B;  1L3V A;  4TUP A;  2HOI A;  1NK9 A;  1PUZ A;  3Q8Q B;  3RJE A;  4Y2U A;  5AIB A;  2H3Z A;  1ZQD A;  4NM2 A;  3T5K A;  4PH5 A;  5J0U A;  4GFJ A;  4DQI A;  2NRZ A;  2E5S A;  4RNN A;  2XGP A;  1UCV A;  4PGX A;  9ICQ A;  1S0N A;  3H4B A;  4I2A A;  3TAC B;  4IQV A;  4FS1 A;  2LPE A;  3N7P D;  5ALV A;  3RH5 A;  2OEH A;  4NLZ A;  5ALO A;  1J2N A;  2WTF A;  3MDA A;  2PXI A;  4PGQ A;  4F4X A;  2FMP A;  2VJ5 A;  3RJG A;  1ZJM A;  2OCE A;  5ALD A;  3RRG A;  2V4R A;  5CHG A;  1SL1 A;  3D2Q A;  2R18 A;  1VDV A;  4KLT A;  3QEA Z;  4F5R A;  5AM2 A;  4GIB A;  3SQI A;  2E1F A;  5D46 A;  2W11 A;  4PL2 A;  2W8L A;  4R8U A;  2JR5 A;  8ICG A;  4PZO A;  1JIH A;  1ZQV A;  2LHT A;  3PVX A;  2LYA A;  3GDX A;  4K4H A;  4M04 A;  3SZ2 A;  2MRL A;  4IQT A;  3GU3 A;  4YVZ A;  2HBL A;  1BNO A;  3Q8K A;  5J2E A;  3TAD C;  2VA2 A;  1U49 A;  5KAI U;  2I6X A;  3WU2 U;  3WK4 A;  3WKA A;  3PW5 A;  3E2E A;  4YFK A;  2XO7 A;  1ZQ1 C;  3IRU A;  2IHM A;  5ALT A;  4QWA A;  4FO6 A;  1FO4 A;  3G6V A;  3UQ0 A;  4OJ5 A;  1DK2 A;  5EE1 A;  1D9D A;  4CF3 A;  4C4T A;  5J0Y A;  2XVT A;  1BNP A;  3C5F A;  5ALW A;  8ICC A;  5JU5 A;  2FLN A;  3UMG A;  2K4E A;  2QLT A;  4DO9 A;  4BX9 C;  3WK7 A;  1SV0 A;  2L5Y A;  5AKK A;  4I29 A;  5DB8 A;  4MF8 A;  4EEY A;  4F2S A;  3QU7 A;  5AI0 A;  4YP3 A;  3PX6 A;  2R8J A;  4JWM A;  4OJO A;  1SL0 A;  4M9L A;  1ZJN A;  4RQ4 A;  5AI5 A;  1C20 A;  2PFN A;  3H40 A;  2YX8 A;  1XO1 A;  5AK6 A;  5AM3 A;  4FZN A;  4P0Q B;  2XY7 A;  2YML A;  5J2H A;  3HX0 A;  4NLN A;  1KW4 A;  4C8M A;  4C4S A;  3AMZ A;  3AEV A;  4YMN A;  1X40 A;  3I1Y A;  5D4B A;  3KKA A;  3E0F A;  2KSO B;  3WKE A;  2KV2 A;  1IXR A;  2BQ3 A;  1LB2 B;  4EEN A;  5JUM A;  4RQ3 A;  2OWO A;  4DFM A;  1WYG A;  2EAM A;  1DGS A;  8ICF A;  1U4B A;  2OH2 A;  2PMZ F;  2C2D A;  5ALG A;  1S5L U;  2KP7 A;  2N1R A;  2HHW A;  5HNK A;  1O03 A;  2RLT A;  1V38 A;  4USA A;  1RXW A;  1U47 A;  3LDA A;  4UAW A;  1CUK A;  3EYZ A;  1BPZ A;  2C28 A;  4NL9 C;  1NOM A;  2LYH A;  4G9B A;  2ES6 A;  5DKW A;  2AGO A;  5IIL A;  5EE9 A;  1SZP A;  9ICI A;  4DSJ A;  1CRX A;  2XCP A;  5AM0 A;  2BQR A;  3EWA A;  1QLN A;  3MGV A;  3MGH A;  5T14 A;  1L8O A;  3PST A;  4B6J A;  4O3N A;  2ZXH A;  4ECR A;  3C1Y A;  1SWV A;  2OHF A;  4M6W A;  2Y0S F;  5KAF U;  4YXJ A;  3M9N B;  2AU0 A;  4KN4 A;  1NK7 A;  4B9S A;  4QW8 A;  2DQN B;  1RQL A;  1ZD3 A;  3CNH A;  5C5J A;  1QCK A;  2NO4 A;  4QJF B;  5KG3 A;  4KLQ A;  1BPX A;  5J0T A;  4B9V A;  2BCQ A;  2KOB A;  4FZL A;  3QU5 A;  1ZOL A;  3I28 A;  4TUQ A;  4R64 A;  4YR0 A;  1COO A;  2DBY A;  2KE7 A;  2E3T A;  2F44 A;  4I2H A;  2KN7 A;  4DWI A;  1N48 A;  1RM6 C;  4XQ8 A;  4C8K A;  3BJY A;  2BDU A;  1CI4 A;  2ZJA A;  3SR6 A;  1TAM A;  5KFA A;  1ZQW A;  4DFJ A;  4UB3 A;  7ICH A;  3R9K A;  1NNL A;  3PR4 A;  3KD3 A;  4M9N A;  3N7S C;  8ICP A;  5AKL A;  4JMU A;  4QZD A;  2YY6 A;  4ED2 A;  1BPE A;  2MUT B;  4O3P A;  4GXI A;  3NS1 A;  7ICT A;  4P0P B;  2Y0S C;  7ICF A;  1SB3 C;  1PZN A;  3GIM A;  3ZDA A;  3TAQ A;  2RDI A;  1NK6 A;  4QWB A;  5L1M A;  3KHG A;  2MU2 A;  5KNI A;  8ICH A;  2ZJ5 A;  1SZH A;  5AI8 A;  2ZUC A;  5AKZ A;  4KLS A;  8ICY A;  4MFF A;  2JH7 A;  5AK5 A;  2K60 A;  3BQ0 A;  5CP2 A;  3JPQ A;  4MF2 A;  4KTQ A;  3IP4 B;  2W9B B;  1OXJ A;  3HKZ F;  4F71 A;  2XIC A;  3U26 A;  1ARO P;  1MQ2 A;  5J2A A;  5K4L A;  1X6J A;  4QZB A;  1KDH A;  1WCL A;  4NLB A;  1L5U A;  1S77 D;  1TKD A;  2EQY A;  2W03 A;  4ZH4 A;  4UB5 A;  4UAZ A;  2JEI A;  5L1I A;  2ISP A;  1Z4O A;  4KLD A;  4MEY A;  4UB8 U;  3H0R B;  4PGY A;  1ECW A;  5KFJ A;  4EX7 A;  3RAX A;  4O5C A;  2HVI A;  2VA3 A;  2RP5 A;  1NJZ A;  2A3V A;  5F9L A;  2RDJ A;  3QEB Z;  2E8P A;  2A1J B;  2Z7J A;  2KVS A;  3PR5 B;  5J8Y A;  3SI8 A;  1QQ5 A;  1XO0 A;  4BUG A;  2EH9 A;  2WF9 A;  1JN3 A;  4BWM A;  3FDS A;  3PX0 A;  3TAN A;  3HKZ C;  4JUZ A;  2EAN A;  2XCA A;  1PK3 A;  9ICF A;  3BQ7 A;  3I76 A;  1ZD2 P;  4IS7 A;  4O5E A;  1TV9 A;  3UQ2 A;  4KLM A;  2MA1 A;  4RQ0 A;  3MDC A;  2BCV A;  5J2G A;  3ISC A;  3IV6 A;  4QZC A;  3GV7 B;  4RQ8 A;  3K1Z A;  1YZ7 A;  3TAR A;  3WKB A;  2IOF A;  3N97 B;  4UAR A;  1X6I A;  2LYB A;  4R63 A;  4O9M A;  2RHF A;  5G5G A;  4KMO B;  3M6Z A;  2HHX A;  4R8U B;  3PML A;  7ICE A;  3LK9 A;  2H5X A;  4GXJ A;  5HP4 A;  9ICX A;  1ZQX A;  4DCC A;  4QZE A;  4C80 A;  1TK8 A;  3OJU A;  3AUO A;  5AI6 A;  7ICG A;  5L9X A;  1JUD A;  1KN5 A;  2Y9U A;  5KT3 A;  5J0S A;  2AJQ A;  3C2L A;  5KT6 A;  4ECY A;  2YMM A;  1LKY B;  3TKA A;  4YMM A;  4JV0 A;  2KIW A;  2BCS A;  1N60 A;  1A77 A;  5ALQ A;  2XI9 A;  2BHN A;  1Z19 A;  9ICJ A;  3MC1 A;  7ICU A;  2HDO A;  4F93 B;  5ALH A;  5ALE A;  3TQ1 A;  5DDM A;  3FYH A;  4EBD A;  3T5L A;  2LI6 A;  1NZP A;  1T3Q A;  5DG8 A;  1SL2 A;  3ZD9 A;  3V6H A;  1SGG A;  5ALU A;  1X9W A;  7ICN A;  3D2N A;  2H3F A;  1JMS A;  1QQ7 A;  3M9O B;  4PZN A;  4FE3 A;  1B43 A;  2EZX A;  4ECZ A;  5KL8 B;  9ICT A;  1LVH A;  2ASJ A;  4OCZ A;  1NK8 A;  2KFN A;  4P0P A;  2D3D A;  5L1J A;  2A1A A;  3PO5 A;  2BDP A;  1TFR A;  2W9A A;  3WKC A;  4I2B A;  2FMS A;  3QXG A;  5KFL A;  3F53 A;  4F5Q A;  1L7M A;  2P66 A;  4UAU A;  3HIL A;  2JMG A;  3RAQ A;  3RJF A;  8ICO A;  5L1L A;  4DQS A;  3LYS A;  8ICE A;  2UVU A;  3ICX A;  1FFV A;  1J2M A;  2PFP A;  5KT4 A;  2QAR B;  3AQE A;  5H2F U;  3EPG A;  2KKV A;  1C7Y A;  5CEH A;  1Q46 A;  3PW2 A;  4PL1 A;  3UMC A;  2BGW A;  2HCF A;  3RB4 A;  1RZT A;  4F4Y A;  4DS5 A;  4ECS A;  5J2D A;  1U48 A;  3C28 A;  2ZTC A;  3NTU A;  9ICK A;  4DSI A;  5AKE A;  3IG5 A;  1X2I A;  1MC8 A;  3WKD A;  4XUS A;  2CRX A;  1X9M A;  3RJH A;  3WK6 A;  5J0O A;  1KTQ A;  1JX4 A;  5BOM A;  4F5O A;  1L6N A;  4J9K A;  8ICV A;  3IG8 A;  5KFB A;  4DLG A;  1A76 A;  2KK0 A;  2WB1 F;  5CR0 A;  3N28 A;  3QU9 A;  3RH4 A;  1KFD A;  1DRG A;  4F92 B;  1HJP A;  4ELV A;  1RQN A;  2A1J A;  4ELU A;  4TQR A;  5KTQ A;  2P35 A;  3PZP A;  4RPX A;  4IQU A;  4UAY A;  1T8E A;  9ICV A;  1ZQS A;  4CF4 A;  3NVW A;  4BXO B;  2G09 A;  3IHQ B;  4DEZ A;  2BKE A;  1ZQY A;  8ICK A;  5KFR A;  4EYH B;  8ICZ A;  3V72 A;  3PV8 A;  4PJ0 U;  2GH1 A;  4ICA A;  3EPI A;  4KMU A;  2F8K A;  3N7R C;  4DQR A;  1LV5 A;  1ZQK A;  4ECQ A;  2KZM A;  5KFV A;  4DSF A;  2V4Q A;  4O3Q A;  3GV5 B;  3RJJ A;  4HYK A;  4J03 A;  2BPC A;  8ICT A;  2WHE A;  1L3T A;  3JPP A;  3UXP A;  4IRC A;  3BQT A;  2W7P A;  4C7Y A;  4F3O A;  1RYS A;  4NY8 A;  5HMM A;  1S8O A;  2W9M A;  9ICR A;  2RRD A;  3M9M B;  1HUO A;  4I2D A;  2WB1 C;  3HJE A;  3JPO A;  2AGP A;  2WAQ F;  4ECU A;  3HWT A;  2YQE A;  1TVA A;  2G08 A;  2EDU A;  1GO3 F;  2UVR A;  9ICL A;  1Q3U A;  7ICM A;  2K89 A;  2E8N A;  2GO7 A;  1S97 A;  4F4Z A;  3QU4 A;  1LKY A;  9ICM A;  1YT3 A;  3PSF A;  2MSN A;  1TK5 A;  3ETR A;  3H8M A;  4B9M A;  4YXM A;  2F3N A;  2ISO A;  3MR3 A;  3V6J A;  1UT5 A;  2WF7 A;  1TAQ A;  3V6K A;  4KLF A;  1ZQH A;  1QQ6 A;  4B9U A;  3QZ7 A;  4F4K A;  1N5W A;  2A19 A;  4DL2 A;  5KFH A;  3MFI A;  4J9N A;  3T5J A;  1QH9 A;  2DGZ A;  3KZI U;  5ALP A;  4U7C A;  1S0O A;  5EWF A;  3C5G A;  2P6R A;  4P4O A;  1JI7 A;  2W04 A;  2VAN A;  2JXJ A;  4NLC A;  4PHE A;  4RQN A;  1IIP A;  2F76 X;  2Q4T A;  1BGX T;  2ATL A;  2W3R A;  1N61 A;  1ED1 A;  1PVR A;  1K5O A;  3F2B A;  4YR3 A;  1SV0 C;  5KFD A;  2YB4 A;  4ECW A;  4Z6C A;  5DQG A;  1H38 A;  4PHD A;  3K4G A;  2JZB B;  3C1Z A;  4NL9 A;  2IA6 A;  4Q43 A;  3H4D A;  4DL4 A;  2UVW A;  7ICJ A;  4TUS A;  2HMX A;  3M7D A;  5ALR A;  4XA5 A;  3UMB A;  5DGB A;  3TI0 A;  2R8I A;  5AIC A;  2QAR A;  4IRK A;  2KHV A;  2QB1 A;  2WFA A;  2NRT A;  4NV0 A;  3RR7 A;  2ODG A;  2KTQ A;  2C2E A;  3KKA C;  1D9F A;  3IM1 A;  1DK3 A;  1UT8 A;  4UAS A;  4RZR A;  1NKB A;  4K4I A;  9ICU A;  5J2J A;  3C2M A;  5DLF A;  3EUB 2;  4FS2 A;  3RB0 A;  5AKH A;  1WWU A;  3D6J A;  1BPB A;  4NXZ A;  2I1Q A;  4QWD A;  1K1Q A;  1KL9 A;  3UPQ A;  3OHB A;  1ZQN A;  4U6P A;  2J6S A;  2HOQ A;  5J29 A;  1ZD5 A;  4E0D A;  1Q8K A;  4RUC A;  4MEX A;  2HHT A;  3H0L B;  5AKX A;  1WUD A;  4QZF A;  2Y9T A;  4LZD A;  4YMO A;  2HHQ A;  2PMZ C;  2DKX A;  5KG1 A;  5HR6 A;  3E58 A;  1ZQJ A;  5KFW A;  5KFI A;  5HML A;  4NM1 A;  4CGZ A;  4US9 A;  4BXO A;  4YQW A;  5KFS A;  9ICE A;  1S9F A;  4OJL A;  1ZQG A;  3L3F X;  4J9S A;  2FPM A;  4J9O A;  4QWC A;  5ALI A;  2KZ3 A;  2AH5 A;  4DF8 A;  2DPI A;  4M9G A;  3QYP A;  3V7J A;  1N5X A;  1YZ6 A;  7ICQ A;  4DSL A;  1XWL A;  4YD2 A;  3GFK B;  2Y1I A;  2NO5 A;  3F2C A;  2JV3 A;  3RB3 A;  4ZOH C;  2XY6 A;  1D8L A;  2WF5 A;  4KLU A;  5KFF A;  2FLP A;  5III A;  4DOA A;  4NLK A;  4YD1 A;  4DOC A;  5IIJ A;  4ECX A;  5BOL A;  4Y2Q A;  4KLL A;  2B6G A;  3V7L A;  5KFT A;  2GWS A;  5ALJ A;  3N4M B;  3EW9 A;  1JAL A;  8ICX A;  2Y1J A;  3OSN A;  1V97 A;  2FJ6 A;  4J9Q A;  4O5K A;  4YG2 A;  3PSI A;  1ZRN A;  4Y2X A;  5ALK A;  2K8B B;  2R8G A;  2F77 X;  2FI1 A;  4IQW A;  1JXE A;  5AK3 A;  2DFL A;  2LM1 A;  3RH6 A;  2LM4 A;  1RYU A;  5ALX A;  2G07 A;  4DOB A;  1PVP A;  2IBK A;  4EX6 A;  2WF8 A;  3RJK A;  1KQQ A;  3NAS A;  4RT2 A;  3ZDC A;  4P4M A;  3ZDE A;  4C0Z A;  1NK4 A;  5KL1 B;  4US8 A;  3WK8 A;  1EXN A;  4RU9 A;  4UB4 A;  4M47 A;  5KT7 A;  3LWL A;  3C2K A;  3K75 D;  3VCB A;  1L7O A;  2KG5 A;  2IOH A;  2ZXI A;  2G0A A;  2JEF A;  2NV3 A;  4F2R A;  1T4G A;  3Q8M A;  1SKW A;  3RBE A;  3Q8S B;  3ZI4 A;  3NRZ A;  3SAH A;  4C8L A;  2W43 A;  1ZQM A;  3BS7 A;  2ZTE A;  5IIN A;  2M0N A;  2FMQ A;  1ZQP A;  4X5V A;  3PO4 A;  3ZDD A;  3RB6 A;  4F4W A;  2GOL A;  4FBU A;  4KLJ A;  1U9L A;  1AQ6 A;  4EBC A;  3KZX A;  9ICP A;  2JZB A;  4I2I A;  2BQU A;  4Y2T A;  1F44 A;  2PFO A;  4QWE A;  2OM6 A;  4UW9 A;  2H3I A;  1NJX A;  3AM9 A;  2KKP A;  3M8R A;  2AQ4 A;  2KVC A;  3NUQ A;  3MR5 A;  4I2F A;  3AL0 B;  1D8B A;  4AP9 A;  3H8W A;  2XGQ A;  2C2R A;  4O3R A;  4LZG A;  1F0M A;  2ZUB A;  2HW3 A;  2KEY A;  5KFZ A;  4EZ6 A;  3VC8 A;  1RYR A;  3CRX A;  4GLX A;  2LMR A;  1N63 A;  4DSE A;  2ESE A;  2G06 A;  3M1Y A;  4M9J A;  5AKJ A;  5KG6 A;  2KJ8 A;  3DDH A;  4I2G A;  1CEZ A;  2YN4 A;  4PHA A;  3Q8L A;  4ED0 A;  3B9J A;  8ICI A;  3CW2 C;  1O08 A;  2XID A;  3QUT A;  2E8M A;  4RNM A;  4DF4 A;  5DB7 A;  5DB6 A;  4TQS A;  1JRO A;  5KG0 A;  1K1S A;  1UQV A;  1X9S A;  4J9L A;  3Q8R B;  3DEE A;  4CF5 A;  4DL7 A;  5KFQ A;  4ED7 A;  4EYI B;  3FM9 A;  2F1I A;  2ZJ8 A;  1SWW A;  1KFS A;  2J6T A;  8ICN A;  5C0Y A;  2D6F C;  1DGJ A;  3PNC A;  3OHA A;  3PX4 A;  1SKR A;  3MR2 A;  2EZY A;  2FPL A;  1ZQT A;  2KZZ A;  5D49 A;  1UA1 A;  4DL6 A;  2R8H A;  4F5N A;  4R66 A;  2VIX A;  5DB9 A;  4Y2Y A;  1ZQI A;  2E8O A;  2HSZ A;  3IDW A;  5L1K A;  4Y2R A;  2FPK A;  1L7P A;  2WF6 A;  4ELT A;  5AI9 A;  4J9M A;  5HR7 A;  4C7Z A;  2HOF A;  1TE2 A;  5KFM A;  4IL6 U;  4KIT B;  2JGA A;  5FP0 A;  2CN1 A;  4JV2 A;  1JRP A;  1OUQ A;  2ALZ A;  8ICU A;  5KFO A;  4F8R A;  3MR6 A;  4DS4 A;  5TIS U;  4UBC A;  2BZF A;  1T3N A;  3D2S A;  1ZQE A;  2DF4 B;  3QUB A;  3OGU A;  5AHX A;  3SAF A;  3SAG A;  4JV1 A;  3ZDB A;  3SV4 A;  2FE9 A;  5CA7 A;  3BS5 A;  2K4P A;  3HRD D;  4I27 A;  1HEK A;  4LVS A;  1P7D A;  1NKC A;  1QSL A;  4WJ3 B;  2ZTD A;  2YB1 A;  8ICW A;  2E1E A;  3T5H A;  4I2C A;  1N56 A;  4IR1 A;  1ZQO A;  3H0M B;  2QB0 A;  1ZQB A;  1KRP A;  3HPO A;  1UPH A;  2W7O A;  1U45 A;  5IIM A;  4F72 A;  1NJY A;  4JWN A;  3JPR A;  5J0P A;  1VLB A;  1RPL A;  1ZET A;  3DV9 A;  1KBU A;  5KG2 A;  2W3S A;  2G5H B;  5DDY A;  2PI5 A;  4A8E A;  1KKX A;  3OPX A;  2B0C A;  4KLG A;  1ZYQ A;  5AM5 A;  1TAU A;  1SV4 A;  7ICS A;  3ED5 A;  3H8J A;  3TFR A;  3A0H U;  4RQ7 A;  5AK4 A;  2F1H A;  2PKE A;  1J97 A;  2YTU A;  3C21 A;  9ICC A;  5ALM A;  5HHH A;  1HIW A;  1FEZ A;  2IMW P;  3GQC A;  3GIL A;  3PW0 A;  5DLG A;  3BQ2 A;  5DBA A;  3RRH A;  4DQP A;  1QSS A;  5ALF A;  2K4H A;  4AYB F;  3TAD A;  3H8S A;  3CP8 A;  1XSN A;  1F5S A;  4UQG A;  1NK5 A;  4O3S A;  1M6Y A;  3RF9 A;  1ZQF A;  1S0M A;  3F2D A;  3KHL A;  4QZI A;  2F8L A;  1V9P A;  2KFZ A;  3GIJ A;  8ICB A;  1URJ A;  5J0W A;  3OTQ A;  3G6X A;  1UA0 A;  3TAP A;  5DQH A;  4RPY A;  3HT3 A;  5G5H A;  1L3U A;  3JPN A;  3CYM A;  4Z6E A;  5J0X A;  5TZV A;  5AKI A;  5KFN A;  1ZRM A;  5KFU A;  7ICK A;  1B22 A;  5KG5 A;  3BDP A;  3PSP A;  8ICR A;  4G3I A;  4RQ1 A;  5AM1 A;  2KJ5 A;  5DQI A;  3FAH A;  3QZ8 A;  1ZQU A;  4O0I A;  4AYB C;  2JEG A;  4RQ5 A;  5AKY A;  3GII A;  1ZQC A;  2NRW A;  2WAQ C;  2DWQ A;  3MBY A;  3FC4 A;  3F5E A;  8ICS A;  4DFP A;  4KN7 A;  1X42 A;  2ZIV A;  5KFP A;  2DL0 A;  5A0L A;  5J2F A;  1Z3E B;  7ICL A;  4ED3 A;  5ALS A;  5AKG A;  4Y2S A;  5KFE A;  4Z6D A;  8ICJ A;  4IC9 A;  4TUR A;  4QIW F;  4Z6F A;  4JK1 A;  1L3S A;  1WCN A;  4UB6 U;  3ORY A;  5ALZ A;  2IOF K;  3C23 A;  2J6U A;  3JPS A;  4QNL A;  2K4I A;  1RXV A;  1ZD4 A;  4QW9 A;  1WWV A;  4C8N A;  7ICI A;  3MAB A;  5KFG A;  3THV A;  3QNM A;  2NYV A;  5AM4 A;  3AU6 A;  5B66 U;  5AIA A;  4LJX A;  1V85 A;  2JEJ A;  3JPT A;  2YMQ A;  4YN4 A;  1N2X A;  4KLO A;  4KLE A;  2ZIU B;  3NVZ A;  4RPZ A;  4C8O A;  1X66 A;  9ICH A;  3RJI A;  1QTM A;  2UVV A;  2K8C B;  2AQ0 A;  2DPJ A;  4YCX A;  5B5E U;  3RFA A;  4C4R A;  4OJP A;  2CXY A;  2RQ5 A;  3ONN A;  2KJ9 A;  4M9H A;  3J81 j;  3NRW A;  4M0A A;  9ICO A;  4M2Y A;  1KLN A;  2BR0 A;  4QIW C;  3QUQ A;  2BCU A;  2R8K A;  2EZZ A;  2I5H A;  5EOZ A;  2KIV A;  2ZG6 A;  4DL5 A;  3IN5 A;  2HBJ A;  5KG7 A;  4J9P A;  8ICQ A;  4MHV A;  2NRV A;  3O0F A;  5ALL A;  2W8K A;  3A0B U;  4RQ6 A;  2PFQ A;  3T3F A;  1B0X A;  1BVS A;  4EEK A;  2EAO A;  1S76 D;  3KOO A;  4CNQ A;  5F3X B;  4FFD A;  2DKZ A;  5J0Q A;  4Q44 A;  2W54 A;  3BZC A;  1SIJ A;  5ALY A;  2GLE A;  2Q0Z X;  3KFU F;  2ZIW B;  3B0Y A;  5DBB A;  4BGD A;  9ICA A;  5J2B A;  2ZIX B;  4IR9 A;  4RUA A;  2ASL A;  5DGA A;  1JXL A;  2W9C B;  2ZUD A;  5J2C A;  4NLG A;  4Q8E A;  1X9X A;  4UB2 A;  4CRX A;  3NGD A;  4MFC A;  9ICN A;  3PY8 A;  7ICO A;  2VA8 A;  4ECV A;  3RTV A;  3T79 A;  4GC6 A;  3HW8 A;  1IV8 A;  1T7P A;  1COK A;  1BPY A;  3GZF A;  1XNS A;  7ICR A;  1IG6 A;  3LVV A;  4BDP A;  3PMN A;  4IRD A;  4RQ2 A;  8ICM A;  2HVH A;  1ZXI A;  1PVQ A;  2F2A B;  2HHS A;  1A0P A;  1OW5 A;  2XY5 A;  5J0R A;  4P2H A;  5KG4 A;  1Z00 B;  4OD0 A;  1PK1 B;  2XC9 A;  3C29 A;  4KLI A;  1S10 A;  4MFA A;  4B9L A;  3BS5 B;  1KSP A;  3KBB A;  4PHP A;  4DQQ A;  3QX7 A;  1FFU A;  3K1R B;  1L8L A;  1T94 A;  8ICA A;  3NVV A;  4P4P A;  3QUC A;  2QB0 B;  3Q8P B;  1KFT A;  3SYZ A;  4Y2P A;  1DXS A;  4O3O A;  2NRX A;  5KT2 A;  3EZ5 A;  2P6U A;  8ICL A;  1NI3 A;  4CDG A;  5EE3 A;  2QKQ A;  3B0X A;  1Y88 A;  4QZH A;  4DSK A;  2FDR A;  3KHH A;  7ICP A;  5ALN A;  1RG6 A;  4I2E A;  1ZQL A;  3AU2 A;  4ED6 A;  5J2I A;  1QSY A;  1XS9 D;  5GTH U;  2JH1 A;  3TFS A;  4K4G A;  4I28 A;  4OO1 J;  5KFC A;  3SEN A;  4P0Q A;  2C22 A;  3PW7 A;  3G6Y A;  4B9N A;  1VJ5 A;  3GV8 B;  5DG7 A;  4EZ9 A;  2ASD A;  1S0V A;  2HI0 A;  3ISD A;  5DBC A;  1A6S A;  4ED1 A;  2KNJ A;  4I2J A;  2KSO A;  4FZM A;  1ZQQ A;  2AGQ A;  4KX5 A;  5J8Y C;  2G5I B;  4O3M A;  1NJW A;  5IIK A;  2B21 A;  1TK0 A;  1RDF A;  5KFY A;  1Z1V A;  1XU4 A;  2ZIU A;  5KFK A;  2CPR A;  4UAT A;  2HHU A;  4ECT A;  2O6K A;  4F5P A;  4EBE A;  2DUY A;  1XSL A;  3PW4 A;  2BPF A;  3AN1 A;  4UBB A;  3SMV A;  2KMD A;  4ED8 A;  4DL3 A;  5CB1 A;  2AHO B;  1ZQR A;  5E79 U;  5DG9 A;  3BQ1 A;  4EEL A;  4ACO A;  4Y2V A;  4CCH A;  2YMP A;  4UB1 A;  2KIC A;  5BPC A;  2AXT U;  4DFK A;  4F91 B;  4KLH A;  1FIQ A;  2M9N A;  2VKQ A;  3SD7 A;  2LKY A;  3SV3 A;  2HHV A;  2PI4 A;  4F50 A;  1DOQ A;  4RT3 A;  4RNO A;  1Z4N A;  1SXD A;  2K8A A;  4YR2 A;  2KHQ A;  4RQM A;  3S6J A;  3F5A A;  9ICB A;  1MN8 A;  5EE0 A;  3HP6 A;  3UXN A;  4OJ6 A;  1MQ3 A;  4XRH A;  3KTQ A;  1UHU A;  4JB3 A;  3BZK A;  4KX3 A;  4BWJ A;  1N62 A;  4CE6 A;  5CRX A;  5F9N A;  5KT5 A;  5GTI U;  1MSW D;  4PPX A;  5KFX A;  1NK0 A;  2JHD A;  5J2K A;  1IM4 A;  5JRT A;  3RBD A;  4BJQ A;  1NZB A;  4GXK A;  1XC9 A;  3GIK A;  2HBK A;  1L7N A;  3QU2 A;  2W55 A;  1NKE A;  4QZG A;  4UAV A;  5IIO A;  2BCR A;  2ZIW A;  9ICS A;  3SEI A;  4DFD A;  2ZIX A;  2OXO A;  2ZIV B;  3M6K A;  4FBT A;  1WG8 A;  2W9C A;  2V9W A;  3ALR A;  3MGI A;  2H3V A;  3WK9 A; 
#chains in the Genus database with same CATH homology
 3CRX A;  3D2S A;  4OJO A;  1A6S A;  2KNJ A;  1L6N A;  4FZM A;  2RP5 A;  3RF9 A;  3T79 A;  2DF4 B;  2G06 A;  2VJ4 A;  4U6P A;  4KX5 A;  2HOQ A;  3IG8 A;  2YX8 A;  3F2D A;  2G5I B;  3GZF A;  1XNS A;  3SAF A;  3SAG A;  1MA7 A;  4O3M A;  4FZN A;  4P0Q B;  3LVV A;  2A3V A;  2WB1 F;  2VJ5 A;  4C0Z A;  2F8L A;  5KL1 B;  2BDU A;  2KJ8 A;  2Z7J A;  1DRG A;  2ZIU B;  1PVQ A;  2F2A B;  3H0L B;  1TAM A;  1A0P A;  1WUD A;  1HEK A;  3PZP A;  2ZIU A;  1URJ A;  1P7D A;  1XO0 A;  4BUG A;  4WJ3 B;  1Q3V A;  2CPR A;  3VCB A;  2XID A;  2H3F A;  3D2N A;  3E0F A;  3N7S C;  2YB1 A;  2ZXI A;  2KV2 A;  2K8C B;  2E1E A;  2R18 A;  3D2Q A;  2G0A A;  4FE3 A;  2PMZ C;  2NV3 A;  3C29 A;  4JMU A;  3HKZ C;  3CYM A;  5HR6 A;  3H0M B;  2G09 A;  3SMV A;  3RFA A;  2LBO A;  2DGZ A;  4OJP A;  4U7C A;  5KL8 B;  4CGZ A;  2Y0S C;  3SQI A;  1UPH A;  2E1F A;  4P0P B;  1Z1B A;  2W7O A;  3ONN A;  2KJ9 A;  3DEE A;  2W04 A;  4ACO A;  2GH1 A;  4ICA A;  2OH2 A;  4P0P A;  3NRW A;  4PL2 A;  2H3Q A;  2KIC A;  2PMZ F;  3N7R C;  1T94 A;  3PSP A;  4NLC A;  4OJL A;  4QIW C;  2MA1 A;  3L3F X;  2N1R A;  3SAH A;  2VKQ A;  2LHT A;  1IIP A;  1SZH A;  2F76 X;  4QJF B;  5C0Y A;  2D6F C;  2LKY A;  2LYA A;  2Q4T A;  2KJ5 A;  2OYY A;  2M0N A;  3AQF A;  4NWI A;  3K1Z A;  1KBU A;  2MRL A;  1ED1 A;  1PVR A;  2JH7 A;  3F2B A;  3GU3 A;  2GOL A;  2K8A A;  2HBL A;  4AYB C;  2KHQ A;  2LYB A;  2KD1 A;  2G5H B;  3F53 A;  2YB4 A;  3F5A A;  2ZG6 A;  3F2C A;  4A8E A;  2HBM A;  2RHF A;  3LVW A;  3IN5 A;  2JMG A;  3OPX A;  4KMO B;  2HBJ A;  4OJ6 A;  2W7P A;  1CRX A;  2VIX A;  3M6Z A;  4CDG A;  3LYS A;  2WAQ C;  3O0F A;  1ZQ1 C;  3ICX A;  3IP4 B;  2RRD A;  3KZX A;  3MGV A;  5T14 A;  4KX3 A;  3HKZ F;  3PST A;  5CRX A;  2XIC A;  3F5E A;  2WB1 C;  2ZIV A;  2HMX A;  2ZXH A;  3M7D A;  2HOI A;  3AQE A;  1F44 A;  5A0L A;  4OJ5 A;  2JHD A;  2Y0S F;  2KKV A;  4BJQ A;  1NZB A;  2KHV A;  2OM6 A;  2WAQ F;  4PL1 A;  1HIW A;  2HOF A;  5HR7 A;  2HBK A;  4NV0 A;  2H3Z A;  4IC9 A;  2H3I A;  2DQN B;  2G08 A;  4QIW F;  2XVT A;  2ZIW B;  4NLB A;  3KFU F;  1GO3 F;  2JH1 A;  3PSI A;  2KKP A;  1Q3U A;  4GFJ A;  2ZIX B;  4OO1 J;  2JGA A;  2KVC A;  2K4E A;  2K89 A;  2K8B B;  2CN1 A;  2E5S A;  2ZIW A;  3NUQ A;  4P0Q A;  2F77 X;  2W03 A;  3AL0 B;  3C28 A;  1D8B A;  4BX9 C;  2ZIX A;  2OXO A;  2ZIV B;  3M6K A;  2KIW A;  1OUQ A;  2K4H A;  2KOB A;  3IG5 A;  4AYB F;  4FZL A;  4QNL A;  2K4I A;  3H0R B;  2CRX A;  4CRX A;  2G07 A;  1ECW A;  2XI9 A;  3CP8 A;  1Z19 A;  1YT3 A;  2KEY A;  3ALR A;  3PSF A;  1PVP A;  2H3V A;  3VC8 A;  3N7P D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...