3AQEA

Crystal structure of the extracellular domain of human ramp2
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
76
structure length
76
Chain Sequence
b'NYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Receptor activity-modifying protein 2
publication title Structural basis for extracellular interactions between calcitonin receptor-like receptor and receptor activity-modifying protein 2 for adrenomedullin-specific binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 22
structure length 76
sequence length 76
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2010-10-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.510 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 3aqeA00
3AQFA 3N7PD 3AQEA 3N7SC 2XVTA 2YX8A 3N7RC
chains in the Genus database with same CATH superfamily
4MFAA 2ZJ5A 1AQ6A 5AKEA 4BWMA 4NM1A 3NVWA 1PK1B 2F44A 3QE9Y 1NK9A 1PVRA 2BCQA 2WAQC 5J2KA 4ECZA 2MUTB 4CGZA 2KFNA 2PMZF 3BZCA 3KHGA 1ZRNA 9ICRA 3SV4A 4YR0A 3C23A 2WF9A 3UM9A 3TACB 3RRGA 3MBYA 2KG5A 4KLEA 2KKPA 7ICGA 1ZQSA 1DRGA 2ZUCA 3KFUF 3THVA 4C8LA 5J2CA 1IG6A 4K4HA 4Y2JA 3L3FX 3QUCA 2HOQA 3Q8MA 2D6FC 4I2FA 3MGVA 1KRPA 4J9LA 4IL6U 3ISDA 5JU5A 9ICXA 5AI6A 4NXZA 1ZQTA 5ALFA 3D2NA 3LWMA 2JH7A 3PW4A 4F4WA 2HHUA 3N28A 5J0RA 4KX3A 2DF4B 9ICUA 4DSJA 3GU3A 2E3TA 4Q45A 2MAXA 3PV8A 3H0RB 1KLNA 1F0MA 4KLFA 3OSPA 2J6UA 4JWNA 1L6NA 4O3SA 4M0AA 1A6SA 3NTUA 2R8JA 3HILA 4GC6A 3LVWA 3BDPA 2BZFA 4NM2A 1P7DA 2G06A 2A3VA 2KD1A 4OD0A 9ICEA 2DQNB 2R8HA 3ISBA 1KKXA 2BKEA 1NNLA 2KHVA 4ELTA 4P0PA 5ALKA 9ICPA 2Y0SF 2IOHA 1OUQA 2HHSA 5KFYA 3FAHA 5F3XB 5KFEA 3Q8LA 1JXEA 4DS4A 2ZIWA 4TQRA 5AHXA 3F2CA 1CRXA 4O3NA 4MFCA 4TURA 2PFPA 3PSPA 2DKZA 5FP0A 4UASA 2HVIA 3BS5B 1Z3EB 5KFBA 1MSWD 5AM1A 4QZAA 1ZQHA 3BJYA 4PGXA 7ICNA 5KFNA 4QIWF 4YQWA 2HW3A 1HJPA 3M1YA 5CHGA 4Z6EA 5ALIA 2W9AA 1HIWA 3L5KA 4DF8A 1ZD5A 2ZIVA 4O3OA 3E58A 3WKCA 5KFGA 2BGWA 5F9NA 8ICFA 4FBUA 2YB1A 3PMLA 4DFMA 2KIVA 4I2HA 3OHBA 1ZOLA 3ORYA 1M6YA 1L7PA 4UB4A 2KEYA 3UMCA 2DUYA 4YCXA 2G09A 1TAQA 1X6IA 5ALJA 3QUQA 2W54A 4Q8EA 2F3NA 1SKSA 1SKRA 1NI3A 2F1JA 3H0MB 2G0AA 1ZQ1C 1ZQLA 1NOMA 2BCUA 4EZ6A 1ECWA 2YQEA 5AM0A 1Z4NA 1T94A 1VJ5A 2W7PA 1HEKA 3QU4A 1RZTA 4F8RA 3L4PA 4U6PA 8ICCA 2ZJAA 3UQ2A 3TADA 3GIKA 4USAA 4M2YA 2AJQA 1PK3A 5EE9A 3QX7A 1Z4OA 4RQNA 1BPDA 5HP4A 3PZPA 4C7YA 4ACOA 4QZ8A 1X40A 2FDRA 2YMMA 1S5LU 2XGPA 3OJUA 4IRCA 5DBCA 1S0NA 1ZQNA 5KG6A 5EWGA 5KT4A 2HVHA 1NJXA 2F1IA 1ZQFA 4F5NA 3PSFA 4AYBF 1ZQJA 4MHVA 3M6KA 4OO1J 3JPTA 4NLBA 2KIWA 1SWWA 3JPQA 3PNCA 5J0TA 1RYUA 4TQSA 2GWSA 4NLZA 2PFQA 1L3TA 1ZXIA 2ASJA 1N5XA 2AGQA 5AKIA 2WF5A 4OJPA 4C8MA 3WK5A 4QZDA 5L9XA 7ICIA 3D2SA 5DDMA 2RHFA 3OPXA 4XRHA 1RXVA 4RPXA 1QCKA 3N4MB 4EBEA 2W8LA 3SD7A 3I1YA 1ZQYA 2HBLA 4C8KA 2O6KA 2F8KA 3ZD8A 4RQ7A 4C4SA 2HCFA 1K1QA 5J0QA 2BQRA 9ICFA 5KG0A 1QQ5A 5ALGA 4EENA 1T3QA 2W04A 4FZLA 5CRXA 2NYVA 3HKZF 2Q4TA 5AIBA 4UAYA 4UAZA 8ICUA 1QSLA 2XI9A 5CEHA 1Q46A 2BHNA 5ALPA 2ZIXB 7ICLA 1JROA 5KTQA 3HJEA 5L1LA 2KJ9A 4R63A 3K1RB 2IMWP 1IV8A 5HR7A 3DV9A 3KZIU 5ALVA 1ZD2P 5DKWA 5AICA 3BQ1A 4RQ8A 5DGBA 1JRPA 5C0YA 4Y2YA 2PI5A 5J2JA 5D4BA 2KJ8A 5J8YC 1S10A 2M0NA 2HI0A 4QZGA 2RP5A 2JGAA 5KFRA 4KLLA 1ZJMA 4J9OA 3AEVA 5AKLA 4Y2VA 3EZ5A 1SV0C 5J2DA 1BNOA 2DPIA 5IIMA 3WU2U 4FZMA 4GIBA 2ZXIA 2EQYA 5KFMA 1TV9A 4CRXA 2G5HB 1ZQKA 1N56A 2WAQF 4DSFA 4ELVA 4ECXA 1DXSA 2ZIVB 3SAFA 2BCSA 4EEKA 3GIJA 1KEJA 2G07A 2KK0A 1PK1A 3D6JA 5KT2A 1Z1BA 2MUTA 5ALRA 4JV1A 1X9WA 1RQLA 5KFAA 4KLHA 4X5VA 4LZGA 4G3IA 3ZI4A 1WWUA 1LKYA 3WKBA 4Y2SA 3HPOA 2A1AA 3EUB2 3N7PD 4J9SA 9ICIA 1JUDA 1L3UA 1NZBA 3OTQA 4PHEA 4YMNA 3A0BU 2F76X 4YFKA 2FMPA 4J9NA 2RRDA 7ICUA 2E8NA 4Y2UA 5KFSA 5HMMA 7ICPA 5EWEA 3RBDA 1Z1VA 5AK4A 2EZYA 2JZBB 4CCHA 4C7ZA 2BR0A 4E0DA 1HUZA 3H7IA 1S8OA 3H4DA 2AQ0A 2W11A 5J2EA 2DGZA 2F8LA 4IQUA 1XSLA 4DQSA 2VKQA 4ED1A 1S0VA 5AM2A 4F3OA 2FJ6A 1QTMA 3MR3A 4QWBA 1UQVA 2EAOA 2FLNA 4PL2A 2NRTA 3RRHA 2M9NA 2NRVA 3Q8QB 8ICXA 1B0XA 5J29A 4F5QA 4ED0A 3R9KA 1SZPA 1SL0A 4PH5A 4DSKA 3NUQA 1U45A 1RPLA 2FLPA 9ICVA 2NO4A 5AI8A 1FFVA 4WJ3B 5J0SA 3QZ8A 4UBBA 2LHTA 3QU5A 1N62A 5H2FU 2W3RA 4P2HA 4GXJA 4P4PA 1TE2A 4DQQA 3TARA 3PW2A 2IOFA 3MR5A 5G5HA 2YN4A 4C80A 3JPOA 2HDOA 5IILA 5DB9A 2GLEA 5DLGA 4KX5A 5F9LA 3M9OB 1RXWA 4M04A 4DSLA 1NJZA 3H8WA 3SENA 2H3VA 4AP9A 1X2IA 5B5EU 4HYKA 3QU2A 3TI0A 1XNSA 3V7JA 1ZQIA 5CJ7A 4LZDA 2C2RA 1KTQA 3H8SA 4IR1A 2ASDA 4DF4A 4ZOHC 3QU9A 2HMXA 5EE0A 1A0PA 2D3DA 5DQHA 4RQ3A 1ZQOA 1S0MA 5AKXA 5KFQA 3GILA 1QLNA 1Q3VA 1YZ7A 3KKAA 2DBYA 5J0UA 2IOFK 3IG8A 1NKEA 1NJYA 1BVSA 5ALNA 3T5JA 4BXOB 3Q8KA 2HOFA 3V7KA 3U26A 2R8IA 4OJLA 2W9CA 1KFSA 3BQTA 4KMOB 1BNPA 4ECRA 1EXNA 4R65A 4MEXA 3UXOA 5J0PA 3V72A 3T5KA 1XSPA 1C20A 3H4BA 5KFZA 4G9BA 3HT3A 4UARA 2K4EA 2K4PA 2JMGA 2G5IB 3LVVA 2RLTA 2XGQA 4I2JA 1L5UA 2YMQA 2ASLA 4BDPA 3SV3A 3T5LA 3IP4B 9ICBA 4NLCA 4RT2A 3CYMA 1D8YA 4RQ2A 4IQTA 5L1IA 3N7SC 4UB3A 3C5FA 5JTIA 2OEHA 1ZQVA 5KFXA 1D9DA 1F44A 1LKYB 1ZYQA 4CDGA 5B66U 1V97A 1B43A 1T4GA 2XY6A 3C21A 2K8CB 4YP3A 5KL1B 3N97B 3MGIA 4O5EA 1IIPA 1SV4A 1S97A 4F2RA 4EBCA 4PHPA 1BPZA 4F2SA 4M47A 5L1KA 3WK6A 2VA8A 3QU7A 4B9LA 1ZETA 5DG8A 4QWDA 3IV6A 2W9BB 4QZFA 3UXPA 5KFCA 9ICKA 1WWVA 2BDUA 4RQ6A 3JPPA 2HOIA 1N5WA 4R8UB 1CI4A 3BQ2A 3V6KA 3SAGA 2FI1A 3RTVA 5CB1A 3B9JA 2PFOA 4UB1A 3SQIA 2E8MA 2H5XA 3E2EA 4FS1A 4RNNA 4F4YA 1N63A 1KSPA 4PHAA 1X66A 5AKJA 5AM3A 5G5GA 5ALHA 4YXMA 3ZD9A 1HUOA 4DQIA 5DBBA 3RH6A 9ICNA 4RPYA 3V6HA 2KJ5A 2AXTU 2WF7A 4CE6A 4TUQA 3ONNA 1FIQA 7ICOA 2QB0B 4EEYA 1QQ7A 4JMUA 5AK6A 3NVYA 1XSNA 2ZIXA 1C7YA 5AI5A 2HBKA 1L8OA 3SR6A 5AI4A 2P6RA 4PZOA 2ESEA 2EAMA 5AIAA 4ECTA 4KLTA 1WG8A 7ICMA 5IIKA 2ODGA 4YG2A 4IS7A 2C2DA 2KICA 3HX0A 1X9SA 2GO7A 2C22A 4B9NA 1KL9A 2EDUA 8ICNA 1MQ2A 2JEIA 2EAPA 5BOLA 3O0FA 3M6ZA 2HHXA 2LMRA 4QZ9A 3ED5A 1SGGA 4DS5A 3N7RC 4RQ5A 2Q0ZX 5DG7A 3GFKB 2OHFA 3GDXA 2QKQA 2H3ZA 5KFKA 1PVPA 4EELA 2CXYA 4DCCA 3RH5A 8ICKA 2LBOA 2AHOB 3OGUA 3WKEA 5KG1A 2IBKA 2AGPA 4ECSA 2A1JB 4DEZA 2HBJA 2KTQA 2W9CB 1TAMA 4J9PA 2KNJA 2ISPA 2C2EA 3IM1A 5ALQA 4O0IA 3PO5A 4PZNA 3A0HU 2ZG6A 4DOBA 2W9MA 2LKYA 1JN3A 2DFLA 4DSIA 4KTQA 2AQ4A 2RQ5A 4OJ5A 2FMQA 2A19A 1SIJA 3AL0B 3NVZA 2DWQA 3MR2A 5TZVA 3M7DA 1Q8KA 3DDHA 4DLEA 4ED2A 2ES6A 2JZBA 2LM4A 2UVWA 3HP6A 8ICSA 5DDYA 5ALDA 1KW4A 1SXEA 5J2GA 1QH9A 1VDVA 4DSEA 9ICWA 4R66A 2CPRA 1GO3F 3TADC 1YZ6A 5KFWA 1ZQQA 3LK9A 4JK1A 1D8BA 4NV0A 1J97A 4DL3A 1B4FA 3UPQA 2N1RA 3FC4A 1RM6C 5BPCA 4M9JA 1K5OA 2W03A 5AK3A 5HHHA 1T3NA 2FLLA 3RH4A 1TVAA 1BPBA 2BPFA 2F1HA 2OCEA 5KFJA 4TUPA 2K89A 4QZIA 1UCVA 3QUBA 1PVQA 7ICVA 3PSTA 4XQ8A 4Q8FA 8ICMA 1ZD4A 2FPLA 2NRWA 4QZBA 2XIDA 2E1EA 2NRZA 5ALOA 4GFJA 4FS2A 4DQRA 3NRWA 4JB3A 3ISCA 3PW5A 4C8OA 7ICRA 5ALMA 1XC9A 5KFUA 3AU6A 8ICGA 2H3QA 4PJ0U 5KT6A 2JH1A 2V9WA 3TFSA 2BQ3A 4F92B 2L5YA 5KG2A 3PX6A 4ECYA 1SL2A 5KL8B 2ZTCA 1QQ6A 5ALYA 1KFTA 1ZQBA 1WYGA 1F5SA 4FE3A 1CEZA 7ICQA 3FM9A 1L3SA 3BZKA 5EOZA 2VA2A 4DFDA 1IM4A 2G08A 1TK8A 4DWIA 5ALEA 2HHWA 4KLOA 3E0FA 5BOMA 2PXIA 2KE7A 2VANA 4CF3A 2BQUA 3IN5A 4KLSA 2H3IA 3K75D 4NLKA 1RQNA 2QLTA 1Z19A 7ICKA 4ELUA 4BXOA 1TFRA 3BS7A 2ISOA 1NZPA 8ICPA 3D2QA 5K4LA 8ICIA 8ICLA 4DL7A 5DBAA 1L3VA 4I29A 5IINA 3B0XA 4O3QA 5KFFA 2WF8A 3UXNA 2XCAA 5AI9A 4Y2XA 2K4HA 3HWTA 4K4GA 5GTHU 2E8PA 4ICAA 2K8AA 4EBDA 1ZQAA 4PPXA 3WK4A 3RJKA 5HMLA 1S77D 2XICA 3WKAA 1KFDA 4GXIA 2QARB 2VA3A 5KFTA 3FDSA 4QJFB 2AU0A 3WK7A 5ALZA 1U49A 9ICHA 1LB2B 1TK0A 1L7NA 2XVTA 2MU2A 4B9TA 3I28A 1U4BA 1ZJNA 2K4IA 5ALSA 1D8LA 2K60A 1IXRA 4Q43A 4U7CA 2CN1A 5EE3A 2E1FA 3NS1A 4O3MA 4F93B 1MC8A 2E8OA 5EE1A 4F72A 5KFLA 4UW9A 4P4MA 3GQCA 2HHQA 4KLMA 4PGQA 4ED7A 2EANA 4F91B 2I9GA 3EW9A 1V85A 2D8CA 2P35A 2ZJ8A 4ZH4A 5KG7A 2DPJA 2W9BA 2HHTA 8ICEA 4IC9A 2MA1A 3ZDDA 4J9QA 4R8UA 3PW7A 2VJ5A 3B0YA 4QW8A 2KFZA 9ICCA 4QW9A 2JXJA 2XC9A 5L1MA 4QZHA 9ICOA 4BUGA 3K1ZA 3MDAA 2YTUA 5C5JA 3UMGA 3RJIA 1QSSA 2UVRA 4PL1A 2P6UA 5DB6A 5ALXA 4O3PA 5J2HA 1X9XA 4F4KA 2LM1A 3RAXA 1NK6A 5AM5A 3AUOA 1SZHA 2I1QA 2QB0A 5J0OA 8ICTA 5E79U 5J0WA 5T14A 5CA7A 3SEIA 4NLNA 3DEEA 8ICZA 3RB6A 2KZ3A 3EPGA 2W55A 4YVZA 2JEFA 3S6JA 2YX8A 1UPHA 5D49A 3QZ7A 3ZDAA 1K1SA 1CUKA 1JMSA 4NL9A 2HBMA 2P66A 2ZUBA 1TK5A 3RBEA 5J2IA 2ALZA 4KLGA 4F5RA 1SKWA 2VJ4A 5KAFU 5JUMA 2WTFA 4F4XA 4B9UA 3TANA 3MFIA 4DFJA 4YR2A 1NK7A 2ZIUB 4YMMA 3PX0A 5ALUA 8ICBA 3OHAA 1BGXT 3TAPA 1SXDA 1U9LA 9ICMA 3QEBZ 3RB4A 1DGSA 1VLBA 1T8EA 3C2KA 4M9GA 5J0XA 3KD3A 2XO7A 4J9RA 5KFOA 2A1JA 4ED6A 2JR5A 1UA0A 1SWVA 3RJHA 3OJSA 1JX4A 4F5OA 9ICTA 1Z00B 2FPMA 5JRTA 4A8EA 3KKAC 1N48A 3EWAA 5KFHA 5J2BA 4QWAA 5CWRA 4I2EA 3BQ0A 4F5PA 4CF5A 3SI8A 1MQ3A 4IRKA 3C29A 3T5HA 2WB1C 2MSNA 1ZQWA 4IQVA 1NK0A 4NY8A 3ZDCA 3CRXA 2F2AB 1S76D 1ZQGA 3GZFA 5AM4A 4EYIB 3TQ1A 3C1ZA 4QZCA 4M9HA 1N61A 4IR9A 3MFHA 5AK5A 2Y1IA 8ICHA 4DQPA 3AU2A 5DB7A 4BJQA 3PMNA 1KBUA 2B21A 3ZDEA 2BPGA 2JV3A 4C4RA 3AQFA 2GOLA 3OSNA 4DO9A 1NKCA 3KHLA 1DOQA 4QWEA 4RZRA 3NASA 4GLXA 4RQMA 3PVXA 2E5SA 2ZTEA 4M6WB 3KOOA 1DK3A 4UAVA 3F2BA 2DKXA 1QSYA 2OWOA 9ICJA 1FFUA 4DFKA 2BPCA 3VC8A 4YD1A 2BCRA 4GC7A 1XS9D 1ZQPA 8ICWA 1Q3UA 3PO4A 3RJFA 4ED8A 1UA1A 3QEAZ 4I2IA 5KFIA 1MA7A 2JHDA 2H3FA 3QNMA 1URJA 1H38A 3ZDBA 4RPZA 4O5CA 4RQ0A 5CR0A 1MN8A 5IIJA 3HRDD 4XUSA 1NJWA 4I2DA 4QWCA 4ECWA 2XCPA 1BPEA 2LI6A 3TKAA 3LWLA 3MABA 4MFFA 3M8SA 2Y1JA 2B0CA 2FMSA 4ECUA 4ECQA 3RAQA 4JV2A 3HW8A 1COOA 5AKKA 1DGJA 2CRXA 3H8MA 5KAIU 2PKEA 2XY7A 3LYSA 4KLUA 5GTIU 3Q8RB 3H40A 4B9SA 2J6TA 1O08A 3Q8SB 3KHHA 2FPKA 3M9NB 3AM9A 4EX7A 1L8LA 3H8JA 1KDHA 3GIMA 1WCNA 4PGYA 1DK2A 4IQWA 1N60A 5EWFA 3F5EA 5D46A 4P4OA 1ZQEA 1J2MA 3H0LB 3IG5A 3KZXA 2RDJA 4US9A 1BPYA 4TUSA 4Z6CA 1JIHA 1ZQMA 4DL2A 2NV3A 4NJ8A 3AQEA 5AKHA 2KVCA 2OXOA 4UB8U 5IIIA 2KSOB 2YB4A 1RG6A 2QARA 3G6YA 2GH1A 2W43A 3C5GA 1ZRMA 4EZ9A 4J03A 5KG3A 4RQ1A 2B6GA 2IHMA 2RDIA 3RJGA 7ICSA 4EX6A 4Y2QA 5DB8A 3C28A 1S0OA 3RB3A 3G6XA 5DQGA 4B9VA 3KBBA 2AGOA 4RUCA 9ICQA 4DOAA 5IIOA 5ALLA 4QNLA 1ZQDA 2KHQA 2W7OA 1ZQZA 4KMUA 4F50A 3F5AA 3RJEA 2VIXA 1U48A 1RDFA 1COKA 4YXJA 5DQIA 3AMZA 4K4IA 3KHRA 2UVUA 4F4ZA 4P0QA 2WF6A 4PHDA 4DFPA 3MGHA 1ZQUA 5KFPA 4MF2A 3CP8A 2PMZC 4Z6DA 7ICEA 3G6VA 8ICJA 1S9FA 3M9MB 1JXLA 5DLFA 3SAHA 3CNHA 1T7PA 4MF8A 4RQ4A 3JPNA 5KT7A 2ZUDA 4GXKA 5HHIA 2EH9A 3FYHA 2OH2A 4RU9A 2YMPA 1LV5A 5KFVA 2KV2A 3IRUA 2LPEA 3PR5B 2LYHA 4XA5A 2AH5A 2KMDA 5AKYA 2R8GA 1Y88A 2R18A 3NRZA 2KN7A 8ICQA 1UT5A 4UB5A 2BCVA 3IDWA 3KTQA 3CW2C 2Y9UA 1WUDA 4LJXA 5KT3A 3TFRA 3EYZA 3RR8A 2BDPA 3IHQB 4C8NA 4FO6A 4J9MA 4UBCA 4RNMA 5L1JA 1KQQA 8ICOA 4DLGA 5KG4A 7ICFA 4NLGA 2EZXA 4I2AA 5A0LA 4YR3A 4O5KA 4UAWA 1SB3C 2NRXA 2Z7JA 2W3SA 1RYRA 9ICAA 4CNQA 4FZNA 2JEJA 4M9LA 2KZMA 1J2NA 9ICLA 2ZIUA 3RB0A 9ICSA 1FO4A 5DG9A 1NK5A 3F2DA 3GIIA 5DGAA 3MDCA 8ICRA 2KZZA 1PZNA 9ICGA 4DL5A 1U47A 1NKBA 4CF4A 4P0PB 5J8YA 3SZ2A 1LVHA 4UAUA 5CP2A 1XU4A 2WHEA 3RFAA 5AKGA 4DL4A 1SV0A 4US8A 2MRLA 1ED1A 3TAQA 1N2XA 1Z00A 3ALRA 1A77A 2KKVA 2Y0SC 2ZIWB 3UQ0A 3T79A 2HHVA 1JALA 2WB1F 8ICVA 4RNOA 3NVVA 4I2BA 2IA6A 3C2MA 5KNIA 5ALTA 1WCLA 2QB1A 2I5HA 2JRZA 2W8KA 4Y2TA 4J9KA 4C4TA 3M8RA 4QZEA 2ZXHA 1BPXA 3UMBA 4JWMA 2F77X 8ICYA 3GV5B 4JUZA 4DOCA 2FE9A 3J81j 1ZQCA 4KLJA 4Y2PA 5J0YA 2I6XA 5AI0A 3QXGA 2KOBA 3VCBA 4QIWC 4KLDA 2NO5A 3LDAA 7ICTA 2LYBA 4EYHB 2XY5A 4YD2A 1X42A 4RT3A 2PI4A 2HSZA 7ICJA 8ICAA 3NGDA 2J6SA 5TISU 5AKZA 4B6JA 2DL0A 4BGDA 1UT8A 5ALWA 4O9MA 1OXJA 1X9MA 1OW5A 1ZQRA 4Y2RA 2WFAA 4UATA 2ZTDA 1PUZA 4Q44A 4KLIA 4P0QB 1SL1A 4M6WA 4LVSA 3F53A 4UB2A 2LYAA 3AN1A 1NK8A 5HNKA 3WKDA 3T3FA 5J2FA 1D9FA 4FBTA 3V6JA 3C1YA 4OJ6A 1A76A 4KN4A 3JPSA 1L7MA 4KLQA 1TKDA 1X6JA 2R8KA 1UHUA 3WK8A 3BQ7A 4HAIA 4RUAA 4AYBC 2EZZA 4R64A 3V7LA 5HR6A 1ZQXA 3ETLA 3Q8PB 1NK4A 4I28A 2V4QA 4YMOA 1JI7A 2V4RA 4IRDA 2UVVA 3GV7B 4NWIA 3I76A 4FFDA 3C2LA 3WK9A 3PX4A 2C28A 1AROP 3PY8A 4KITB 4BX9C 4BWJA 1XO1A 4YN4A 4I2CA 4JV0A 4UB6U 4Z6FA 3RJJA 4O3RA 1FEZA 4NL9C 4ED3A 5KT5A 4UQGA 4M9NA 3HKZC 4F71A 4I27A 3GV8B 5KG5A 4I2GA 4ECVA 2KP7A 3EPIA 2K8BB 3PW0A 3QYPA 1TAUA 3SYZA 4B9MA 3MC1A 1L7OA 2ATLA 4KN7A 3BS5A 2YMLA 3RF9A 3PR4A 7ICHA 4MEYA 1RYSA 2KSOA 4C0ZA 2Y9TA 2OYYA 1V38A 2PFNA 1ZD3A 1XWLA 3ETRA 3SMVA 1YT3A 3K4GA 2JEGA 4DL6A 1KN5A 5KFDA 3JPRA 1V9PA 4OJOA 1XO0A 3QUTA 3PSIA 3ICXA 2IHNA 1O03A 3RR7A 4OCZA 3MR6A 1B22A 2OM6A 2YY6A 5J2AA 2KVSA
chains in the Genus database with same CATH topology
2HOFA 2CN1A 2DQNB 2LKYA 3AQFA 2GOLA 2VKQA 2VJ4A 1OUQA 2H3QA 4OJLA 3SQIA 2E1FA 2OH2A 3F5EA 2JH1A 3PZPA 4O3MA 4KMOB 4OJ5A 2ZXHA 4ACOA 1PVRA 2KV2A 2WAQC 3H0LB 3IG5A 2F77X 3KZXA 5C0YA 2ZIUB 2KHVA 4NWIA 4P0PA 5KL8B 4PL2A 4CGZA 3AL0B 2R18A 2KJ8A 2PMZF 2Y0SF 4FE3A 2M0NA 2K4EA 2E5SA 2JGAA 2KOBA 2NV3A 2RP5A 3AQEA 3PSFA 2KJ5A 3VCBA 2KVCA 4QIWC 2JMGA 2OXOA 3ONNA 3M7DA 3F2BA 2G5IB 2YB4A 4AYBF 4JMUA 1WUDA 3LVVA 2G08A 2GH1A 4BX9C 2ZIXA 2LYBA 3M6KA 4OO1J 2KKPA 3VC8A 2ZIWA 3NUQA 4NLBA 2HBKA 4IC9A 2MA1A 1DRGA 3E0FA 3KFUF 4FZMA 2ZXIA 2KIWA 3F2CA 1Q3UA 1CRXA 3IN5A 4CRXA 4WJ3B 3IP4B 2G5HB 2H3IA 2WAQF 2VJ5A 2LHTA 3PSPA 1Z19A 3L3FX 4NLCA 4A8EA 2HOQA 3CYMA 2D6FC 2ZIVB 3SAFA 2KICA 3MGVA 3C28A 5A0LA 3D2QA 3N7SC 3HKZC 4BUGA 2CPRA 1MA7A 2G07A 3K1ZA 2JHDA 1GO3F 2Z7JA 1Z1BA 2K8BB 4QIWF 4FZNA 1D8BA 4NV0A 4PL1A 2H3FA 4OJPA 1F44A 2ZIUA 1URJA 4CDGA 3D2SA 2RHFA 3C29A 3OPXA 3F2DA 2N1RA 1HIWA 3D2NA 4QNLA 5HR7A 2WB1C 2JH7A 3O0FA 3M6ZA 4KX5A 2W03A 2K4HA 2ZIVA 4P0QB 2K8CB 2KHQA 4ICAA 2K8AA 2HBLA 5KL1B 4KX3A 2DF4B 1IIPA 3F53A 3RF9A 2H3VA 2F2AB 2W7OA 3CRXA 3F5AA 2LYAA 1SZHA 2VIXA 3N7RC 4C0ZA 4P0PB 2YB1A 3GU3A 5T14A 1XNSA 2OYYA 2K89A 2H3ZA 2W04A 2XICA 3GZFA 4FZLA 4OJ6A 3RFAA 3SMVA 3N7PD 1PVPA 3HKZF 1YT3A 2KEYA 2Q4TA 3DEEA 1NZBA 4P0QA 2G09A 2LBOA 1PVQA 2MRLA 1ED1A 3H0RB 2HMXA 3PSTA 2CRXA 2F76X 2XI9A 5CRXA 1A0PA 2RRDA 2ZIXB 3ALRA 3CP8A 4QJFB 2HBJA 2PMZC 2KKVA 2YX8A 2Y0SC 4OJOA 1XO0A 2ZIWB 1L6NA 1UPHA 1TAMA 3LYSA 2XIDA 2E1EA 2G0AA 2KNJA 1ZQ1C 3H0MB 4GFJA 3T79A 2WB1F 3PSIA 3ICXA 1A6SA 1ECWA 2BDUA 2XVTA 3SAHA 1T94A 2HOIA 2HBMA 1Q3VA 3NRWA 3LVWA 4AYBC 2W7PA 1HEKA 2DGZA 2K4IA 2OM6A 4BJQA 3IG8A 2F8LA 3SAGA 1P7DA 2G06A 4U6PA 1KBUA 2A3VA 2KJ9A 5HR6A 2KD1A 2ZG6A 4U7CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AQF A;  3N7P D;  3AQE A;  3N7S C;  2XVT A;  2YX8 A;  3N7R C; 
#chains in the Genus database with same CATH topology
 4MFA A;  2ZJ5 A;  1AQ6 A;  5AKE A;  4BWM A;  4NM1 A;  3NVW A;  1PK1 B;  2F44 A;  3QE9 Y;  1NK9 A;  1PVR A;  2BCQ A;  2WAQ C;  5J2K A;  4ECZ A;  2MUT B;  4CGZ A;  2KFN A;  2PMZ F;  3BZC A;  3KHG A;  1ZRN A;  9ICR A;  3SV4 A;  4YR0 A;  3C23 A;  2WF9 A;  3UM9 A;  3TAC B;  3RRG A;  3MBY A;  2KG5 A;  4KLE A;  2KKP A;  7ICG A;  1ZQS A;  1DRG A;  2ZUC A;  3KFU F;  3THV A;  4C8L A;  5J2C A;  1IG6 A;  4K4H A;  4Y2J A;  3L3F X;  3QUC A;  2HOQ A;  3Q8M A;  2D6F C;  4I2F A;  3MGV A;  1KRP A;  4J9L A;  4IL6 U;  3ISD A;  5JU5 A;  9ICX A;  5AI6 A;  4NXZ A;  1ZQT A;  5ALF A;  3D2N A;  3LWM A;  2JH7 A;  3PW4 A;  4F4W A;  2HHU A;  3N28 A;  5J0R A;  4KX3 A;  2DF4 B;  9ICU A;  4DSJ A;  3GU3 A;  2E3T A;  4Q45 A;  2MAX A;  3PV8 A;  3H0R B;  1KLN A;  1F0M A;  4KLF A;  3OSP A;  2J6U A;  4JWN A;  1L6N A;  4O3S A;  4M0A A;  1A6S A;  3NTU A;  2R8J A;  3HIL A;  4GC6 A;  3LVW A;  3BDP A;  2BZF A;  4NM2 A;  1P7D A;  2G06 A;  2A3V A;  2KD1 A;  4OD0 A;  9ICE A;  2DQN B;  2R8H A;  3ISB A;  1KKX A;  2BKE A;  1NNL A;  2KHV A;  4ELT A;  4P0P A;  5ALK A;  9ICP A;  2Y0S F;  2IOH A;  1OUQ A;  2HHS A;  5KFY A;  3FAH A;  5F3X B;  5KFE A;  3Q8L A;  1JXE A;  4DS4 A;  2ZIW A;  4TQR A;  5AHX A;  3F2C A;  1CRX A;  4O3N A;  4MFC A;  4TUR A;  2PFP A;  3PSP A;  2DKZ A;  5FP0 A;  4UAS A;  2HVI A;  3BS5 B;  1Z3E B;  5KFB A;  1MSW D;  5AM1 A;  4QZA A;  1ZQH A;  3BJY A;  4PGX A;  7ICN A;  5KFN A;  4QIW F;  4YQW A;  2HW3 A;  1HJP A;  3M1Y A;  5CHG A;  4Z6E A;  5ALI A;  2W9A A;  1HIW A;  3L5K A;  4DF8 A;  1ZD5 A;  2ZIV A;  4O3O A;  3E58 A;  3WKC A;  5KFG A;  2BGW A;  5F9N A;  8ICF A;  4FBU A;  2YB1 A;  3PML A;  4DFM A;  2KIV A;  4I2H A;  3OHB A;  1ZOL A;  3ORY A;  1M6Y A;  1L7P A;  4UB4 A;  2KEY A;  3UMC A;  2DUY A;  4YCX A;  2G09 A;  1TAQ A;  1X6I A;  5ALJ A;  3QUQ A;  2W54 A;  4Q8E A;  2F3N A;  1SKS A;  1SKR A;  1NI3 A;  2F1J A;  3H0M B;  2G0A A;  1ZQ1 C;  1ZQL A;  1NOM A;  2BCU A;  4EZ6 A;  1ECW A;  2YQE A;  5AM0 A;  1Z4N A;  1T94 A;  1VJ5 A;  2W7P A;  1HEK A;  3QU4 A;  1RZT A;  4F8R A;  3L4P A;  4U6P A;  8ICC A;  2ZJA A;  3UQ2 A;  3TAD A;  3GIK A;  4USA A;  4M2Y A;  2AJQ A;  1PK3 A;  5EE9 A;  3QX7 A;  1Z4O A;  4RQN A;  1BPD A;  5HP4 A;  3PZP A;  4C7Y A;  4ACO A;  4QZ8 A;  1X40 A;  2FDR A;  2YMM A;  1S5L U;  2XGP A;  3OJU A;  4IRC A;  5DBC A;  1S0N A;  1ZQN A;  5KG6 A;  5EWG A;  5KT4 A;  2HVH A;  1NJX A;  2F1I A;  1ZQF A;  4F5N A;  3PSF A;  4AYB F;  1ZQJ A;  4MHV A;  3M6K A;  4OO1 J;  3JPT A;  4NLB A;  2KIW A;  1SWW A;  3JPQ A;  3PNC A;  5J0T A;  1RYU A;  4TQS A;  2GWS A;  4NLZ A;  2PFQ A;  1L3T A;  1ZXI A;  2ASJ A;  1N5X A;  2AGQ A;  5AKI A;  2WF5 A;  4OJP A;  4C8M A;  3WK5 A;  4QZD A;  5L9X A;  7ICI A;  3D2S A;  5DDM A;  2RHF A;  3OPX A;  4XRH A;  1RXV A;  4RPX A;  1QCK A;  3N4M B;  4EBE A;  2W8L A;  3SD7 A;  3I1Y A;  1ZQY A;  2HBL A;  4C8K A;  2O6K A;  2F8K A;  3ZD8 A;  4RQ7 A;  4C4S A;  2HCF A;  1K1Q A;  5J0Q A;  2BQR A;  9ICF A;  5KG0 A;  1QQ5 A;  5ALG A;  4EEN A;  1T3Q A;  2W04 A;  4FZL A;  5CRX A;  2NYV A;  3HKZ F;  2Q4T A;  5AIB A;  4UAY A;  4UAZ A;  8ICU A;  1QSL A;  2XI9 A;  5CEH A;  1Q46 A;  2BHN A;  5ALP A;  2ZIX B;  7ICL A;  1JRO A;  5KTQ A;  3HJE A;  5L1L A;  2KJ9 A;  4R63 A;  3K1R B;  2IMW P;  1IV8 A;  5HR7 A;  3DV9 A;  3KZI U;  5ALV A;  1ZD2 P;  5DKW A;  5AIC A;  3BQ1 A;  4RQ8 A;  5DGB A;  1JRP A;  5C0Y A;  4Y2Y A;  2PI5 A;  5J2J A;  5D4B A;  2KJ8 A;  5J8Y C;  1S10 A;  2M0N A;  2HI0 A;  4QZG A;  2RP5 A;  2JGA A;  5KFR A;  4KLL A;  1ZJM A;  4J9O A;  3AEV A;  5AKL A;  4Y2V A;  3EZ5 A;  1SV0 C;  5J2D A;  1BNO A;  2DPI A;  5IIM A;  3WU2 U;  4FZM A;  4GIB A;  2ZXI A;  2EQY A;  5KFM A;  1TV9 A;  4CRX A;  2G5H B;  1ZQK A;  1N56 A;  2WAQ F;  4DSF A;  4ELV A;  4ECX A;  1DXS A;  2ZIV B;  3SAF A;  2BCS A;  4EEK A;  3GIJ A;  1KEJ A;  2G07 A;  2KK0 A;  1PK1 A;  3D6J A;  5KT2 A;  1Z1B A;  2MUT A;  5ALR A;  4JV1 A;  1X9W A;  1RQL A;  5KFA A;  4KLH A;  4X5V A;  4LZG A;  4G3I A;  3ZI4 A;  1WWU A;  1LKY A;  3WKB A;  4Y2S A;  3HPO A;  2A1A A;  3EUB 2;  3N7P D;  4J9S A;  9ICI A;  1JUD A;  1L3U A;  1NZB A;  3OTQ A;  4PHE A;  4YMN A;  3A0B U;  2F76 X;  4YFK A;  2FMP A;  4J9N A;  2RRD A;  7ICU A;  2E8N A;  4Y2U A;  5KFS A;  5HMM A;  7ICP A;  5EWE A;  3RBD A;  1Z1V A;  5AK4 A;  2EZY A;  2JZB B;  4CCH A;  4C7Z A;  2BR0 A;  4E0D A;  1HUZ A;  3H7I A;  1S8O A;  3H4D A;  2AQ0 A;  2W11 A;  5J2E A;  2DGZ A;  2F8L A;  4IQU A;  1XSL A;  4DQS A;  2VKQ A;  4ED1 A;  1S0V A;  5AM2 A;  4F3O A;  2FJ6 A;  1QTM A;  3MR3 A;  4QWB A;  1UQV A;  2EAO A;  2FLN A;  4PL2 A;  2NRT A;  3RRH A;  2M9N A;  2NRV A;  3Q8Q B;  8ICX A;  1B0X A;  5J29 A;  4F5Q A;  4ED0 A;  3R9K A;  1SZP A;  1SL0 A;  4PH5 A;  4DSK A;  3NUQ A;  1U45 A;  1RPL A;  2FLP A;  9ICV A;  2NO4 A;  5AI8 A;  1FFV A;  4WJ3 B;  5J0S A;  3QZ8 A;  4UBB A;  2LHT A;  3QU5 A;  1N62 A;  5H2F U;  2W3R A;  4P2H A;  4GXJ A;  4P4P A;  1TE2 A;  4DQQ A;  3TAR A;  3PW2 A;  2IOF A;  3MR5 A;  5G5H A;  2YN4 A;  4C80 A;  3JPO A;  2HDO A;  5IIL A;  5DB9 A;  2GLE A;  5DLG A;  4KX5 A;  5F9L A;  3M9O B;  1RXW A;  4M04 A;  4DSL A;  1NJZ A;  3H8W A;  3SEN A;  2H3V A;  4AP9 A;  1X2I A;  5B5E U;  4HYK A;  3QU2 A;  3TI0 A;  1XNS A;  3V7J A;  1ZQI A;  5CJ7 A;  4LZD A;  2C2R A;  1KTQ A;  3H8S A;  4IR1 A;  2ASD A;  4DF4 A;  4ZOH C;  3QU9 A;  2HMX A;  5EE0 A;  1A0P A;  2D3D A;  5DQH A;  4RQ3 A;  1ZQO A;  1S0M A;  5AKX A;  5KFQ A;  3GIL A;  1QLN A;  1Q3V A;  1YZ7 A;  3KKA A;  2DBY A;  5J0U A;  2IOF K;  3IG8 A;  1NKE A;  1NJY A;  1BVS A;  5ALN A;  3T5J A;  4BXO B;  3Q8K A;  2HOF A;  3V7K A;  3U26 A;  2R8I A;  4OJL A;  2W9C A;  1KFS A;  3BQT A;  4KMO B;  1BNP A;  4ECR A;  1EXN A;  4R65 A;  4MEX A;  3UXO A;  5J0P A;  3V72 A;  3T5K A;  1XSP A;  1C20 A;  3H4B A;  5KFZ A;  4G9B A;  3HT3 A;  4UAR A;  2K4E A;  2K4P A;  2JMG A;  2G5I B;  3LVV A;  2RLT A;  2XGQ A;  4I2J A;  1L5U A;  2YMQ A;  2ASL A;  4BDP A;  3SV3 A;  3T5L A;  3IP4 B;  9ICB A;  4NLC A;  4RT2 A;  3CYM A;  1D8Y A;  4RQ2 A;  4IQT A;  5L1I A;  3N7S C;  4UB3 A;  3C5F A;  5JTI A;  2OEH A;  1ZQV A;  5KFX A;  1D9D A;  1F44 A;  1LKY B;  1ZYQ A;  4CDG A;  5B66 U;  1V97 A;  1B43 A;  1T4G A;  2XY6 A;  3C21 A;  2K8C B;  4YP3 A;  5KL1 B;  3N97 B;  3MGI A;  4O5E A;  1IIP A;  1SV4 A;  1S97 A;  4F2R A;  4EBC A;  4PHP A;  1BPZ A;  4F2S A;  4M47 A;  5L1K A;  3WK6 A;  2VA8 A;  3QU7 A;  4B9L A;  1ZET A;  5DG8 A;  4QWD A;  3IV6 A;  2W9B B;  4QZF A;  3UXP A;  5KFC A;  9ICK A;  1WWV A;  2BDU A;  4RQ6 A;  3JPP A;  2HOI A;  1N5W A;  4R8U B;  1CI4 A;  3BQ2 A;  3V6K A;  3SAG A;  2FI1 A;  3RTV A;  5CB1 A;  3B9J A;  2PFO A;  4UB1 A;  3SQI A;  2E8M A;  2H5X A;  3E2E A;  4FS1 A;  4RNN A;  4F4Y A;  1N63 A;  1KSP A;  4PHA A;  1X66 A;  5AKJ A;  5AM3 A;  5G5G A;  5ALH A;  4YXM A;  3ZD9 A;  1HUO A;  4DQI A;  5DBB A;  3RH6 A;  9ICN A;  4RPY A;  3V6H A;  2KJ5 A;  2AXT U;  2WF7 A;  4CE6 A;  4TUQ A;  3ONN A;  1FIQ A;  7ICO A;  2QB0 B;  4EEY A;  1QQ7 A;  4JMU A;  5AK6 A;  3NVY A;  1XSN A;  2ZIX A;  1C7Y A;  5AI5 A;  2HBK A;  1L8O A;  3SR6 A;  5AI4 A;  2P6R A;  4PZO A;  2ESE A;  2EAM A;  5AIA A;  4ECT A;  4KLT A;  1WG8 A;  7ICM A;  5IIK A;  2ODG A;  4YG2 A;  4IS7 A;  2C2D A;  2KIC A;  3HX0 A;  1X9S A;  2GO7 A;  2C22 A;  4B9N A;  1KL9 A;  2EDU A;  8ICN A;  1MQ2 A;  2JEI A;  2EAP A;  5BOL A;  3O0F A;  3M6Z A;  2HHX A;  2LMR A;  4QZ9 A;  3ED5 A;  1SGG A;  4DS5 A;  3N7R C;  4RQ5 A;  2Q0Z X;  5DG7 A;  3GFK B;  2OHF A;  3GDX A;  2QKQ A;  2H3Z A;  5KFK A;  1PVP A;  4EEL A;  2CXY A;  4DCC A;  3RH5 A;  8ICK A;  2LBO A;  2AHO B;  3OGU A;  3WKE A;  5KG1 A;  2IBK A;  2AGP A;  4ECS A;  2A1J B;  4DEZ A;  2HBJ A;  2KTQ A;  2W9C B;  1TAM A;  4J9P A;  2KNJ A;  2ISP A;  2C2E A;  3IM1 A;  5ALQ A;  4O0I A;  3PO5 A;  4PZN A;  3A0H U;  2ZG6 A;  4DOB A;  2W9M A;  2LKY A;  1JN3 A;  2DFL A;  4DSI A;  4KTQ A;  2AQ4 A;  2RQ5 A;  4OJ5 A;  2FMQ A;  2A19 A;  1SIJ A;  3AL0 B;  3NVZ A;  2DWQ A;  3MR2 A;  5TZV A;  3M7D A;  1Q8K A;  3DDH A;  4DLE A;  4ED2 A;  2ES6 A;  2JZB A;  2LM4 A;  2UVW A;  3HP6 A;  8ICS A;  5DDY A;  5ALD A;  1KW4 A;  1SXE A;  5J2G A;  1QH9 A;  1VDV A;  4DSE A;  9ICW A;  4R66 A;  2CPR A;  1GO3 F;  3TAD C;  1YZ6 A;  5KFW A;  1ZQQ A;  3LK9 A;  4JK1 A;  1D8B A;  4NV0 A;  1J97 A;  4DL3 A;  1B4F A;  3UPQ A;  2N1R A;  3FC4 A;  1RM6 C;  5BPC A;  4M9J A;  1K5O A;  2W03 A;  5AK3 A;  5HHH A;  1T3N A;  2FLL A;  3RH4 A;  1TVA A;  1BPB A;  2BPF A;  2F1H A;  2OCE A;  5KFJ A;  4TUP A;  2K89 A;  4QZI A;  1UCV A;  3QUB A;  1PVQ A;  7ICV A;  3PST A;  4XQ8 A;  4Q8F A;  8ICM A;  1ZD4 A;  2FPL A;  2NRW A;  4QZB A;  2XID A;  2E1E A;  2NRZ A;  5ALO A;  4GFJ A;  4FS2 A;  4DQR A;  3NRW A;  4JB3 A;  3ISC A;  3PW5 A;  4C8O A;  7ICR A;  5ALM A;  1XC9 A;  5KFU A;  3AU6 A;  8ICG A;  2H3Q A;  4PJ0 U;  5KT6 A;  2JH1 A;  2V9W A;  3TFS A;  2BQ3 A;  4F92 B;  2L5Y A;  5KG2 A;  3PX6 A;  4ECY A;  1SL2 A;  5KL8 B;  2ZTC A;  1QQ6 A;  5ALY A;  1KFT A;  1ZQB A;  1WYG A;  1F5S A;  4FE3 A;  1CEZ A;  7ICQ A;  3FM9 A;  1L3S A;  3BZK A;  5EOZ A;  2VA2 A;  4DFD A;  1IM4 A;  2G08 A;  1TK8 A;  4DWI A;  5ALE A;  2HHW A;  4KLO A;  3E0F A;  5BOM A;  2PXI A;  2KE7 A;  2VAN A;  4CF3 A;  2BQU A;  3IN5 A;  4KLS A;  2H3I A;  3K75 D;  4NLK A;  1RQN A;  2QLT A;  1Z19 A;  7ICK A;  4ELU A;  4BXO A;  1TFR A;  3BS7 A;  2ISO A;  1NZP A;  8ICP A;  3D2Q A;  5K4L A;  8ICI A;  8ICL A;  4DL7 A;  5DBA A;  1L3V A;  4I29 A;  5IIN A;  3B0X A;  4O3Q A;  5KFF A;  2WF8 A;  3UXN A;  2XCA A;  5AI9 A;  4Y2X A;  2K4H A;  3HWT A;  4K4G A;  5GTH U;  2E8P A;  4ICA A;  2K8A A;  4EBD A;  1ZQA A;  4PPX A;  3WK4 A;  3RJK A;  5HML A;  1S77 D;  2XIC A;  3WKA A;  1KFD A;  4GXI A;  2QAR B;  2VA3 A;  5KFT A;  3FDS A;  4QJF B;  2AU0 A;  3WK7 A;  5ALZ A;  1U49 A;  9ICH A;  1LB2 B;  1TK0 A;  1L7N A;  2XVT A;  2MU2 A;  4B9T A;  3I28 A;  1U4B A;  1ZJN A;  2K4I A;  5ALS A;  1D8L A;  2K60 A;  1IXR A;  4Q43 A;  4U7C A;  2CN1 A;  5EE3 A;  2E1F A;  3NS1 A;  4O3M A;  4F93 B;  1MC8 A;  2E8O A;  5EE1 A;  4F72 A;  5KFL A;  4UW9 A;  4P4M A;  3GQC A;  2HHQ A;  4KLM A;  4PGQ A;  4ED7 A;  2EAN A;  4F91 B;  2I9G A;  3EW9 A;  1V85 A;  2D8C A;  2P35 A;  2ZJ8 A;  4ZH4 A;  5KG7 A;  2DPJ A;  2W9B A;  2HHT A;  8ICE A;  4IC9 A;  2MA1 A;  3ZDD A;  4J9Q A;  4R8U A;  3PW7 A;  2VJ5 A;  3B0Y A;  4QW8 A;  2KFZ A;  9ICC A;  4QW9 A;  2JXJ A;  2XC9 A;  5L1M A;  4QZH A;  9ICO A;  4BUG A;  3K1Z A;  3MDA A;  2YTU A;  5C5J A;  3UMG A;  3RJI A;  1QSS A;  2UVR A;  4PL1 A;  2P6U A;  5DB6 A;  5ALX A;  4O3P A;  5J2H A;  1X9X A;  4F4K A;  2LM1 A;  3RAX A;  1NK6 A;  5AM5 A;  3AUO A;  1SZH A;  2I1Q A;  2QB0 A;  5J0O A;  8ICT A;  5E79 U;  5J0W A;  5T14 A;  5CA7 A;  3SEI A;  4NLN A;  3DEE A;  8ICZ A;  3RB6 A;  2KZ3 A;  3EPG A;  2W55 A;  4YVZ A;  2JEF A;  3S6J A;  2YX8 A;  1UPH A;  5D49 A;  3QZ7 A;  3ZDA A;  1K1S A;  1CUK A;  1JMS A;  4NL9 A;  2HBM A;  2P66 A;  2ZUB A;  1TK5 A;  3RBE A;  5J2I A;  2ALZ A;  4KLG A;  4F5R A;  1SKW A;  2VJ4 A;  5KAF U;  5JUM A;  2WTF A;  4F4X A;  4B9U A;  3TAN A;  3MFI A;  4DFJ A;  4YR2 A;  1NK7 A;  2ZIU B;  4YMM A;  3PX0 A;  5ALU A;  8ICB A;  3OHA A;  1BGX T;  3TAP A;  1SXD A;  1U9L A;  9ICM A;  3QEB Z;  3RB4 A;  1DGS A;  1VLB A;  1T8E A;  3C2K A;  4M9G A;  5J0X A;  3KD3 A;  2XO7 A;  4J9R A;  5KFO A;  2A1J A;  4ED6 A;  2JR5 A;  1UA0 A;  1SWV A;  3RJH A;  3OJS A;  1JX4 A;  4F5O A;  9ICT A;  1Z00 B;  2FPM A;  5JRT A;  4A8E A;  3KKA C;  1N48 A;  3EWA A;  5KFH A;  5J2B A;  4QWA A;  5CWR A;  4I2E A;  3BQ0 A;  4F5P A;  4CF5 A;  3SI8 A;  1MQ3 A;  4IRK A;  3C29 A;  3T5H A;  2WB1 C;  2MSN A;  1ZQW A;  4IQV A;  1NK0 A;  4NY8 A;  3ZDC A;  3CRX A;  2F2A B;  1S76 D;  1ZQG A;  3GZF A;  5AM4 A;  4EYI B;  3TQ1 A;  3C1Z A;  4QZC A;  4M9H A;  1N61 A;  4IR9 A;  3MFH A;  5AK5 A;  2Y1I A;  8ICH A;  4DQP A;  3AU2 A;  5DB7 A;  4BJQ A;  3PMN A;  1KBU A;  2B21 A;  3ZDE A;  2BPG A;  2JV3 A;  4C4R A;  3AQF A;  2GOL A;  3OSN A;  4DO9 A;  1NKC A;  3KHL A;  1DOQ A;  4QWE A;  4RZR A;  3NAS A;  4GLX A;  4RQM A;  3PVX A;  2E5S A;  2ZTE A;  4M6W B;  3KOO A;  1DK3 A;  4UAV A;  3F2B A;  2DKX A;  1QSY A;  2OWO A;  9ICJ A;  1FFU A;  4DFK A;  2BPC A;  3VC8 A;  4YD1 A;  2BCR A;  4GC7 A;  1XS9 D;  1ZQP A;  8ICW A;  1Q3U A;  3PO4 A;  3RJF A;  4ED8 A;  1UA1 A;  3QEA Z;  4I2I A;  5KFI A;  1MA7 A;  2JHD A;  2H3F A;  3QNM A;  1URJ A;  1H38 A;  3ZDB A;  4RPZ A;  4O5C A;  4RQ0 A;  5CR0 A;  1MN8 A;  5IIJ A;  3HRD D;  4XUS A;  1NJW A;  4I2D A;  4QWC A;  4ECW A;  2XCP A;  1BPE A;  2LI6 A;  3TKA A;  3LWL A;  3MAB A;  4MFF A;  3M8S A;  2Y1J A;  2B0C A;  2FMS A;  4ECU A;  4ECQ A;  3RAQ A;  4JV2 A;  3HW8 A;  1COO A;  5AKK A;  1DGJ A;  2CRX A;  3H8M A;  5KAI U;  2PKE A;  2XY7 A;  3LYS A;  4KLU A;  5GTI U;  3Q8R B;  3H40 A;  4B9S A;  2J6T A;  1O08 A;  3Q8S B;  3KHH A;  2FPK A;  3M9N B;  3AM9 A;  4EX7 A;  1L8L A;  3H8J A;  1KDH A;  3GIM A;  1WCN A;  4PGY A;  1DK2 A;  4IQW A;  1N60 A;  5EWF A;  3F5E A;  5D46 A;  4P4O A;  1ZQE A;  1J2M A;  3H0L B;  3IG5 A;  3KZX A;  2RDJ A;  4US9 A;  1BPY A;  4TUS A;  4Z6C A;  1JIH A;  1ZQM A;  4DL2 A;  2NV3 A;  4NJ8 A;  3AQE A;  5AKH A;  2KVC A;  2OXO A;  4UB8 U;  5III A;  2KSO B;  2YB4 A;  1RG6 A;  2QAR A;  3G6Y A;  2GH1 A;  2W43 A;  3C5G A;  1ZRM A;  4EZ9 A;  4J03 A;  5KG3 A;  4RQ1 A;  2B6G A;  2IHM A;  2RDI A;  3RJG A;  7ICS A;  4EX6 A;  4Y2Q A;  5DB8 A;  3C28 A;  1S0O A;  3RB3 A;  3G6X A;  5DQG A;  4B9V A;  3KBB A;  2AGO A;  4RUC A;  9ICQ A;  4DOA A;  5IIO A;  5ALL A;  4QNL A;  1ZQD A;  2KHQ A;  2W7O A;  1ZQZ A;  4KMU A;  4F50 A;  3F5A A;  3RJE A;  2VIX A;  1U48 A;  1RDF A;  1COK A;  4YXJ A;  5DQI A;  3AMZ A;  4K4I A;  3KHR A;  2UVU A;  4F4Z A;  4P0Q A;  2WF6 A;  4PHD A;  4DFP A;  3MGH A;  1ZQU A;  5KFP A;  4MF2 A;  3CP8 A;  2PMZ C;  4Z6D A;  7ICE A;  3G6V A;  8ICJ A;  1S9F A;  3M9M B;  1JXL A;  5DLF A;  3SAH A;  3CNH A;  1T7P A;  4MF8 A;  4RQ4 A;  3JPN A;  5KT7 A;  2ZUD A;  4GXK A;  5HHI A;  2EH9 A;  3FYH A;  2OH2 A;  4RU9 A;  2YMP A;  1LV5 A;  5KFV A;  2KV2 A;  3IRU A;  2LPE A;  3PR5 B;  2LYH A;  4XA5 A;  2AH5 A;  2KMD A;  5AKY A;  2R8G A;  1Y88 A;  2R18 A;  3NRZ A;  2KN7 A;  8ICQ A;  1UT5 A;  4UB5 A;  2BCV A;  3IDW A;  3KTQ A;  3CW2 C;  2Y9U A;  1WUD A;  4LJX A;  5KT3 A;  3TFR A;  3EYZ A;  3RR8 A;  2BDP A;  3IHQ B;  4C8N A;  4FO6 A;  4J9M A;  4UBC A;  4RNM A;  5L1J A;  1KQQ A;  8ICO A;  4DLG A;  5KG4 A;  7ICF A;  4NLG A;  2EZX A;  4I2A A;  5A0L A;  4YR3 A;  4O5K A;  4UAW A;  1SB3 C;  2NRX A;  2Z7J A;  2W3S A;  1RYR A;  9ICA A;  4CNQ A;  4FZN A;  2JEJ A;  4M9L A;  2KZM A;  1J2N A;  9ICL A;  2ZIU A;  3RB0 A;  9ICS A;  1FO4 A;  5DG9 A;  1NK5 A;  3F2D A;  3GII A;  5DGA A;  3MDC A;  8ICR A;  2KZZ A;  1PZN A;  9ICG A;  4DL5 A;  1U47 A;  1NKB A;  4CF4 A;  4P0P B;  5J8Y A;  3SZ2 A;  1LVH A;  4UAU A;  5CP2 A;  1XU4 A;  2WHE A;  3RFA A;  5AKG A;  4DL4 A;  1SV0 A;  4US8 A;  2MRL A;  1ED1 A;  3TAQ A;  1N2X A;  1Z00 A;  3ALR A;  1A77 A;  2KKV A;  2Y0S C;  2ZIW B;  3UQ0 A;  3T79 A;  2HHV A;  1JAL A;  2WB1 F;  8ICV A;  4RNO A;  3NVV A;  4I2B A;  2IA6 A;  3C2M A;  5KNI A;  5ALT A;  1WCL A;  2QB1 A;  2I5H A;  2JRZ A;  2W8K A;  4Y2T A;  4J9K A;  4C4T A;  3M8R A;  4QZE A;  2ZXH A;  1BPX A;  3UMB A;  4JWM A;  2F77 X;  8ICY A;  3GV5 B;  4JUZ A;  4DOC A;  2FE9 A;  3J81 j;  1ZQC A;  4KLJ A;  4Y2P A;  5J0Y A;  2I6X A;  5AI0 A;  3QXG A;  2KOB A;  3VCB A;  4QIW C;  4KLD A;  2NO5 A;  3LDA A;  7ICT A;  2LYB A;  4EYH B;  2XY5 A;  4YD2 A;  1X42 A;  4RT3 A;  2PI4 A;  2HSZ A;  7ICJ A;  8ICA A;  3NGD A;  2J6S A;  5TIS U;  5AKZ A;  4B6J A;  2DL0 A;  4BGD A;  1UT8 A;  5ALW A;  4O9M A;  1OXJ A;  1X9M A;  1OW5 A;  1ZQR A;  4Y2R A;  2WFA A;  4UAT A;  2ZTD A;  1PUZ A;  4Q44 A;  4KLI A;  4P0Q B;  1SL1 A;  4M6W A;  4LVS A;  3F53 A;  4UB2 A;  2LYA A;  3AN1 A;  1NK8 A;  5HNK A;  3WKD A;  3T3F A;  5J2F A;  1D9F A;  4FBT A;  3V6J A;  3C1Y A;  4OJ6 A;  1A76 A;  4KN4 A;  3JPS A;  1L7M A;  4KLQ A;  1TKD A;  1X6J A;  2R8K A;  1UHU A;  3WK8 A;  3BQ7 A;  4HAI A;  4RUA A;  4AYB C;  2EZZ A;  4R64 A;  3V7L A;  5HR6 A;  1ZQX A;  3ETL A;  3Q8P B;  1NK4 A;  4I28 A;  2V4Q A;  4YMO A;  1JI7 A;  2V4R A;  4IRD A;  2UVV A;  3GV7 B;  4NWI A;  3I76 A;  4FFD A;  3C2L A;  3WK9 A;  3PX4 A;  2C28 A;  1ARO P;  3PY8 A;  4KIT B;  4BX9 C;  4BWJ A;  1XO1 A;  4YN4 A;  4I2C A;  4JV0 A;  4UB6 U;  4Z6F A;  3RJJ A;  4O3R A;  1FEZ A;  4NL9 C;  4ED3 A;  5KT5 A;  4UQG A;  4M9N A;  3HKZ C;  4F71 A;  4I27 A;  3GV8 B;  5KG5 A;  4I2G A;  4ECV A;  2KP7 A;  3EPI A;  2K8B B;  3PW0 A;  3QYP A;  1TAU A;  3SYZ A;  4B9M A;  3MC1 A;  1L7O A;  2ATL A;  4KN7 A;  3BS5 A;  2YML A;  3RF9 A;  3PR4 A;  7ICH A;  4MEY A;  1RYS A;  2KSO A;  4C0Z A;  2Y9T A;  2OYY A;  1V38 A;  2PFN A;  1ZD3 A;  1XWL A;  3ETR A;  3SMV A;  1YT3 A;  3K4G A;  2JEG A;  4DL6 A;  1KN5 A;  5KFD A;  3JPR A;  1V9P A;  4OJO A;  1XO0 A;  3QUT A;  3PSI A;  3ICX A;  2IHN A;  1O03 A;  3RR7 A;  4OCZ A;  3MR6 A;  1B22 A;  2OM6 A;  2YY6 A;  5J2A A;  2KVS A; 
#chains in the Genus database with same CATH homology
 2HOF A;  2CN1 A;  2DQN B;  2LKY A;  3AQF A;  2GOL A;  2VKQ A;  2VJ4 A;  1OUQ A;  2H3Q A;  4OJL A;  3SQI A;  2E1F A;  2OH2 A;  3F5E A;  2JH1 A;  3PZP A;  4O3M A;  4KMO B;  4OJ5 A;  2ZXH A;  4ACO A;  1PVR A;  2KV2 A;  2WAQ C;  3H0L B;  3IG5 A;  2F77 X;  3KZX A;  5C0Y A;  2ZIU B;  2KHV A;  4NWI A;  4P0P A;  5KL8 B;  4PL2 A;  4CGZ A;  3AL0 B;  2R18 A;  2KJ8 A;  2PMZ F;  2Y0S F;  4FE3 A;  2M0N A;  2K4E A;  2E5S A;  2JGA A;  2KOB A;  2NV3 A;  2RP5 A;  3AQE A;  3PSF A;  2KJ5 A;  3VCB A;  2KVC A;  4QIW C;  2JMG A;  2OXO A;  3ONN A;  3M7D A;  3F2B A;  2G5I B;  2YB4 A;  4AYB F;  4JMU A;  1WUD A;  3LVV A;  2G08 A;  2GH1 A;  4BX9 C;  2ZIX A;  2LYB A;  3M6K A;  4OO1 J;  2KKP A;  3VC8 A;  2ZIW A;  3NUQ A;  4NLB A;  2HBK A;  4IC9 A;  2MA1 A;  1DRG A;  3E0F A;  3KFU F;  4FZM A;  2ZXI A;  2KIW A;  3F2C A;  1Q3U A;  1CRX A;  3IN5 A;  4CRX A;  4WJ3 B;  3IP4 B;  2G5H B;  2H3I A;  2WAQ F;  2VJ5 A;  2LHT A;  3PSP A;  1Z19 A;  3L3F X;  4NLC A;  4A8E A;  2HOQ A;  3CYM A;  2D6F C;  2ZIV B;  3SAF A;  2KIC A;  3MGV A;  3C28 A;  5A0L A;  3D2Q A;  3N7S C;  3HKZ C;  4BUG A;  2CPR A;  1MA7 A;  2G07 A;  3K1Z A;  2JHD A;  1GO3 F;  2Z7J A;  1Z1B A;  2K8B B;  4QIW F;  4FZN A;  1D8B A;  4NV0 A;  4PL1 A;  2H3F A;  4OJP A;  1F44 A;  2ZIU A;  1URJ A;  4CDG A;  3D2S A;  2RHF A;  3C29 A;  3OPX A;  3F2D A;  2N1R A;  1HIW A;  3D2N A;  4QNL A;  5HR7 A;  2WB1 C;  2JH7 A;  3O0F A;  3M6Z A;  4KX5 A;  2W03 A;  2K4H A;  2ZIV A;  4P0Q B;  2K8C B;  2KHQ A;  4ICA A;  2K8A A;  2HBL A;  5KL1 B;  4KX3 A;  2DF4 B;  1IIP A;  3F53 A;  3RF9 A;  2H3V A;  2F2A B;  2W7O A;  3CRX A;  3F5A A;  2LYA A;  1SZH A;  2VIX A;  3N7R C;  4C0Z A;  4P0P B;  2YB1 A;  3GU3 A;  5T14 A;  1XNS A;  2OYY A;  2K89 A;  2H3Z A;  2W04 A;  2XIC A;  3GZF A;  4FZL A;  4OJ6 A;  3RFA A;  3SMV A;  3N7P D;  1PVP A;  3HKZ F;  1YT3 A;  2KEY A;  2Q4T A;  3DEE A;  1NZB A;  4P0Q A;  2G09 A;  2LBO A;  1PVQ A;  2MRL A;  1ED1 A;  3H0R B;  2HMX A;  3PST A;  2CRX A;  2F76 X;  2XI9 A;  5CRX A;  1A0P A;  2RRD A;  2ZIX B;  3ALR A;  3CP8 A;  4QJF B;  2HBJ A;  2PMZ C;  2KKV A;  2YX8 A;  2Y0S C;  4OJO A;  1XO0 A;  2ZIW B;  1L6N A;  1UPH A;  1TAM A;  3LYS A;  2XID A;  2E1E A;  2G0A A;  2KNJ A;  1ZQ1 C;  3H0M B;  4GFJ A;  3T79 A;  2WB1 F;  3PSI A;  3ICX A;  1A6S A;  1ECW A;  2BDU A;  2XVT A;  3SAH A;  1T94 A;  2HOI A;  2HBM A;  1Q3V A;  3NRW A;  3LVW A;  4AYB C;  2W7P A;  1HEK A;  2DGZ A;  2K4I A;  2OM6 A;  4BJQ A;  3IG8 A;  2F8L A;  3SAG A;  1P7D A;  2G06 A;  4U6P A;  1KBU A;  2A3V A;  2KJ9 A;  5HR6 A;  2KD1 A;  2ZG6 A;  4U7C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...