3AQXA

Crystal structure of bombyx mori beta-grp/gnbp3 n-terminal domain with laminarihexaoses
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
101
structure length
101
Chain Sequence
SYEAPPATLEAIHPKGLRVSVPDEGFSLFAFHGKLNEEMEGLEAGHWSRDITKPKNGRWIFRDRNAALKIGDKIYFWTFVIKDGLGYRQDNGEWTVEGFVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into recognition of triple-helical beta-glucans by an insect fungal receptor
pubmed doi rcsb
source organism Bombyx mori
molecule tags Sugar binding protein
molecule keywords Beta-1,3-glucan-binding protein
total genus 18
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2140 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3aqxA00
2RQEA 3IE4A 3AQYA 2KHAA 3AQZA 3AQXA
chains in the Genus database with same CATH superfamily
5FYJD 3WEAA 3UERA 5IROC 4AKQA 5DZOA 3B43A 2ZCKH 4E5XA 2FJHA 3DTDA 4JFFB 1KV7A 5DA0B 3KBFA 4L4VD 5KVDE 3E2HB 3MA7A 1S5HA 1I7RA 3WNMA 4FZEH 2B39A 4IBLT 3G9AB 3ARFC 2UYLA 3CLFH 4LARL 4GKNA 3MLPA 1FE8L 1PCXA 4J3BA 5BRZE 1BXXA 4HS8H 4YHPB 1ZVSA 5E2VH 4OKVA 4ACPA 1YJDC 2IBBA 4OH2A 1NA8A 1OAKL 3CV5A 5ETUA 4KTYA 4JW3A 4RAUA 4F1ZA 2DI7A 4X6CF 1JFQH 4NXKA 2MEJB 4UIMA 1F6AA 3QS3A 1ADQH 4WV1A 5EU4A 3RX9A 3S35H 3L3GB 1BM3H 1KBVA 3RWCA 3WG7B 3EGSB 3NCMA 1N9PA 3MKKA 1BV8A 4JFQA 3C8KA 2FR4B 4RSYA 1XIWC 1QRNA 4R4NC 3R06A 1YMHB 4K9JA 4KUCF 2UZXB 5I71B 1FN4B 4JM2D 5ALCL 3WTVA 4M56A 3VWJA 3KXFD 2MKLC 4EUPG 4WEUD 1JZ7A 1AY1H 3LQAH 4KRPC 4PGDB 4AGOA 5IMMB 1A8JH 4PV8B 4Z3TA 4KZEH 2ADYA 4NP9A 1BGXL 4DNLA 1ERNA 1UXWB 1KACB 1KBGL 4LCYA 2R69A 3P77A 3V2AR 3ZKSD 2X2UA 4FFWD 3L08A 3N0AA 4QXWA 1B2WH 1R5IB 1PCSA 2KZWA 4WUUB 3RVUD 3QAZC 4DP6X 1BX2A 1CVSC 5FM8A 4OFDA 4TS6A 4R96A 4XPFL 4UTCA 4WU5B 3HS9A 1S46A 1UZ8A 1FSKC 4Y16B 1QR1B 4AJYV 5JOFB 4X6EB 1FWXA 4AOFA 4M03A 2EIEA 3WXWH 1DN2A 3TO4D 1OOAA 1FL5A 1DR9A 5GGTL 3V6OC 4F1SA 5I15H 4XMKL 5HHVL 3JBG7 5IQNA 1LO0H 4XP9L 5I6KA 5DFAA 4TNGA 5BV7H 3GHBL 3SDCD 4NCDA 1A9VA 2LQRA 3TL5A 4KU1A 3WS3A 4GB9A 4C56B 2EQDA 1VEOA 1GCFA 2A73B 3ECUA 4GINA 5JHLH 4AKOA 5AQ0A 4S1RH 3QZMA 1YEDB 4PTUA 4BZ2H 4U1LB 2E46A 3GSNH 4UIMB 4UT6L 4KKZA 2CIKB 1YEEL 4AJVA 2YD2A 3GTTA 3NJGA 1ZK5A 4IRZH 5JPNB 3B5TA 4XOCA 1LK3H 4L5FE 3E8UH 3H6JA 3U0TA 4M29A 3CZNA 1ET8A 1BBDL 1CFSA 3FTZA 1JZEA 2WVUA 4PB0H 3ZDXE 3S5LG 3TT3H 1KTDA 4GP5B 3AS2A 3JTTA 1C08A 4AL8C 3BZFA 5FF6B 5T5FL 4MQSB 4AVKA 1KNOB 4BZYA 1XF2A 5FXCH 3ZRCC 4DVBA 1J5OL 3B1TA 1RIVL 5ICXA 2AJZA 3ORJA 3HLAA 1NDGB 4LCCB 5DO2C 5ISZB 1BFVL 5KOVC 1NCCL 2ATKB 3EUDA 2HLFC 3MFGB 3A4EA 4PI2A 5DHXB 5GS0H 1RSYA 3N43B 4ONGL 1O5PA 4BZ1A 2AV7B 4JY4B 4MMXC 2NRDA 3IDGB 1XCQB 4AUJA 4PWHA 3TFKC 5CSGA 1IGCL 1EPFA 1SN5A 1M1XB 2XWJA 3TPUA 1AYOA 2FZ3B 1DJXA 2H26B 4UM9A 4TNEA 5HGAA 5GS0D 3VFMA 2ZKWA 3KLDA 3Q06A 2Y6TE 2DQIH 2XWXA 5CZRA 4KY2A 3BVUA 2YD7A 1A7QL 4JO5A 2VZOA 2WVVA 4C56A 1RZJH 3H0TA 1NSNH 5I0DA 4KVCH 2Y5QA 2AK4A 2CCWA 4UOW0 5KYUB 3NESA 4P06A 1BCIA 5D7HA 4C4BA 1AQDA 2F7QA 2NXYB 3V10A 5L8KB 2OXHB 3QVAA 4PJXA 1NEZB 1KFGA 5J56B 5DQJA 5GGVY 3EJPA 2IO5A 1IEBA 3DNKA 1WV7T 2Y25A 2WWKT 3PJNA 1D9KD 3RUGE 2ZUTA 7CGTA 3HHMA 3BKJL 3VFNA 2CKBH 3GMRA 3O41A 1F56A 4PJ8C 4X5PA 2NSQA 1URIA 1W72H 1KIPA 4EIGB 3ARDA 2X4SA 3TO2A 5KAQG 3M7FB 4NQCE 4LVNC 3J7HA 1A3RH 1PG7L 4F57H 3CIQA 2R23A 2WBJD 2VWEE 1U91B 3W11D 1AGFA 3BPLC 2HFGH 5CJQH 4F2MB 1EUTA 2ZCHL 2ZPKL 3U48A 1KGIA 1WCBA 1JF5A 4GQPH 5IJKC 3ELAT 1ZT7B 1L9TA 4FOMA 1NFDE 2CJUL 1M7IB 1Y18A 3CFIC 3HN3A 3GZOA 3C6EA 1FZMA 1E4KA 1T3FA 2CA4A 5BO1H 5EZOL 4HBCL 4FNSA 5C0FA 3OKMA 3ZDYF 2WXOA 1C16B 1G0YR 4GQQA 4FTDA 2CE6A 4JKPL 3APCA 3QHFH 1OAUL 1ICTA 4BJLA 2VDQB 5I82A 2OL3H 1L9RA 2R1WA 2UX6A 4QY8B 4IBWA 1J8HA 3BUIA 2R2EB 4AENA 4YHYB 2XC8A 1EEZB 2BSTB 1NGQL 4UTBL 3PREA 2EE6A 1AXTH 1LDPH 2VC2L 1Q0YL 1F11B 3RGBA 2PP8A 3RB5A 3CX5K 4NQSB 2F8IA 3QAQA 4BKTC 1GGIH 2PPEA 2EP6A 4TQEH 5J6HA 4L9LC 3T08A 3Q1SH 1UOKA 2PO6A 3I6LE 3WKYA 2UWEA 2OR9H 4MD4B 4OLXH 1JWUB 3LRKA 3W2DH 4Z3HA 2XXCB 5TD4A 4P2OB 1ZLSH 3LNEA 2EZ0C 4KOCA 2RIKA 1I75A 4U2ZA 1YEFH 4CDGC 1YNLL 3NCYS 1VIWA 4JG1L 5KYNA 1ED3A 4NC2B 2EDRA 1R4XA 4U4IA 1X5AA 2KYIA 2CJUH 3W37A 1AHWC 3IFOA 1WBYA 1IEBB 1RV6X 1WIPA 3L3DB 4UWQB 5C0AE 4QRRD 4MA8H 4ZUVB 1RZ8B 2F61A 4MAYA 4NNXA 2E4TA 1BZ8A 1OT1A 3BFWA 5FGRA 1BZ7B 1GHFL 3FQWB 3HHSB 2NZ9C 3SHSA 3C09C 3IWUA 1ZMYA 4LFHD 4XAKE 1ZPUA 2VDRB 5FA4A 3O9WB 1KJ2L 4F5CE 1L5GA 2B15A 5GIRB 3X14B 3NFSH 2ED8A 4GKSB 5ISZD 4W70A 1A6TA 3WIHH 1AI1H 4OGAC 3EOAB 1I1YA 1HOCB 4PVLA 1G6RA 4F2EA 1SEQL 3OLGA 4D0DA 1VKXB 1X6LA 4JM4L 2J1XA 1WP6A 4AM0B 5I5MA 5SWZB 3VXUE 1L3NA 2QSVA 3BWUC 3FTGB 3CLEL 4HGWB 1D6EA 4AL8H 4GKZA 1VADB 5EU7C 1CLOL 2WWMD 4LOUC 2AVGA 1I9EA 4OCYL 4QUOA 4WEBL 3NH7L 3SOBH 2EDJA 5BQ7A 2HX9A 3MMEB 1FH2A 4D7PA 4MQXD 2DBLL 1YEEH 2V2XA 4GXVL 3MREA 3SSGA 1P6AB 2X3CA 3E6FA 3KLHD 5MEOB 2WO3B 4WNSA 2YGPA 3EYSL 1NZRA 1XF2B 3E8UL 3BKYH 1J0HA 2LLGA 1KB5L 2PTTA 5LWYL 2FEEL 2O6DA 3L1OH 4M1DH 2N7AA 4OCWL 4K3EL 5KVGH 5J7CC 1LQSR 4HX1B 2RD0A 4JJ5B 5TH2A 4LAQL 5FWRA 3IPBA 2P44B 3QAZB 2E7MA 1RULL 2X9YA 3D4YA 2FVNA 3HKZA 1DVFA 4H8WH 4S1SH 1YY8A 4XP1L 5T3XL 1MI5D 4AQEB 3LZLA 4Z7QE 1MHHB 1U8OB 2E75C 4LHQB 2FT8A 4P04A 4OF3A 4JO3H 4PCSA 1U58A 4UF7C 4B95C 2XQYK 3I74A 4ODUA 2F5BL 2OMWB 4MJIA 2GUYA 2FIKA 3PL6D 2GY7B 2BNUA 3AM8A 3HZYB 1IAKA 3W3BA 3HMXH 2QVMA 3IYLW 3MLUL 4HIJB 3SCMD 3BAJA 4KI5F 3OHXB 4N2GA 4M4RA 5GGSY 1BFOB 3SCMC 5I1KH 4LHUD 3VFWA 3QUHA 5CLWA 4CU8A 1MH5A 4P2QD 1B9KA 1OV8A 3QWOB 3ULVC 2WYHA 5I76A 3NIDE 5D55A 2L7EA 3WU1A 4LBEA 3MV7B 4ANUA 3NFPA 3ULUD 5DCCA 3FUDA 1HWGB 4UV7L 1AYRA 3L6FA 1U36A 3K4ZA 5AWNL 2R9HD 2VIRA 4KTDH 4N1EA 2O72A 5EIIG 1HNYA 1X5YA 4JVPA 3VXUD 3BXNB 2YRBA 2IV9A 3WUWA 3BISA 5D4JA 2CGRL 1P7KA 2KLRA 3MOQA 4XMPH 5KBNC 3TEWA 1AKJB 5F3FA 4WI0A 4OZIF 3Q6GL 1M7DA 3JQOB 3P9LB 4NUMA 2QGBA 4X6FA 5SV3A 2XRAL 2ZNXA 4H1LH 3NSXA 2F54B 1VFBB 1XSJA 4AXWB 1QHQA 4HK3N 3LNDA 4HUUA 5HHMD 5HTSA 2A9BA 5E0FA 2CJTA 2MCAA 4J3OC 4J3SA 1FHNA 2EXSA 1JOIA 2FQDA 2XJLA 2R1XB 1M71A 2NZIA 1HXKA 5L8JB 5E4EC 1HH9A 3B3BA 1OGTA 1Z9NA 5DDHA 4JDEA 3WCYA 4BE6A 4U3SA 1CXFA 5I1CL 3O6KH 4TLTA 3OXRB 4XR8C 1IQDA 3BH8B 2DYPB 1N2RB 2VE6A 2VZ1A 3VM5A 2NR6A 2CCVA 1D5ZA 2DJ4A 1TYJA 2AMGA 3D7PA 1MRCL 3L3JB 4NAQA 2H45A 5CN3A 1IC4L 1TU2B 2CXKA 1QSEA 1REIA 5FYLD 2OX5A 3MRGA 2XG4A 1ZLVK 4BSJA 1AKPA 4JREC 5EC1A 3TA3C 3B83A 4XMTA 2AQTA 3LKSB 4CC4A 2LFEA 5C0BD 4JM4H 3O6FB 2NXZC 2W9DL 2YUWA 3FQRA 1OAZL 3BRGC 3P9MB 3TVMB 4QHKI 1T7VA 3M45A 3IJ7A 3V0HA 3NABL 4GUQA 1MCNA 3QEHB 2JLPA 4O2CB 1QI3A 5D6CA 4DZBB 4TQEL 1KCSL 2ZX6A 1RZ7H 4YPGA 3WBDA 5K1VA 1PEWA 1R3IL 4AY0A 4LRIA 1YY9C 3EYFA 3NCJL 4MX7A 3D18A 5L9DL 3IDMA 2P52A 1JGVH 4S10A 5CJOH 3BPLB 4S1RL 4MDIB 1D5IH 5I19L 8CGTA 5BJTA 2Q3ZA 2X05A 1S3KL 4OGAD 5EBMB 2J8UE 4N1HB 3AUWB 1PZDA 4ZJ9A 4ANXA 5T5NF 2FL5B 1ZWIA 1LMKA 2XACC 4ZDHB 3WE1A 1T03H 4LQFH 2AQ1A 5KEZA 5L0QB 1OO2A 2WXFA 4OGYL 1PLBA 5CZXC 4YHZL 1UJ3B 3QRGL 4LOUD 5KANI 1AOZA 2J1KA 1I9RH 4FXKA 3QORD 1A7OL 5IG7A 2OSLA 4W9GC 1RPKA 2ADJB 5EOQL 3V55A 5BZDB 3IVKB 2VQ1A 4NKMB 2F53B 3STZB 4XNUL 3L7EB 3IRZA 2E8YA 3BESR 3PHSA 5AVWB 4MHHI 2BW5A 4XP6L 1HK6A 1ILSA 4LLAA 4FQQA 2X40A 2BDNL 1ETZB 1V27A 1OCWH 1SHMA 3BO8B 3QEUA 3U9UB 3GM8A 3ULVD 3FU5A 2NTSP 4KDVA 5DMGD 2XVKA 2P7TB 3WGUB 5TPWL 3FQRB 1Q9WB 4RCAA 2JMRA 3AREB 1MFCH 1OF2B 4Y9EA 4NRXA 3RWGB 1IE4A 1FCGA 4LXFA 3RGVC 2V8LA 1R3IH 1TMQA 2DQUL 3AB0B 3MLWL 3SJVA 1NQBA 2G9HB 2XG4B 4KZ0A 5E56A 4G82A 1Q1JL 1X6NA 2K7PA 5F3HB 1NC4A 3LPWA 5J3HD 4DQOH 1JGLH 4LSTH 5ENWA 3IDJB 1TU2A 4RIRA 4IRSD 5EOTA 1SBSL 3QSKB 2NQCA 4Z7AA 1F3RB 4YHIA 5T5NG 3V5HA 4XI5C 1X5IA 1N8ZB 3C60A 3P0VL 4LCUA 4XNYL 1OW0A 1K72A 4G7RB 2BP8B 1E28A 1F4HA 2P47B 1WWWX 4G43B 2JWYA 3BT2H 3CSYA 2ZYHA 4P5KB 4W4NA 3VXSE 4JPKL 3O4OC 4P48A 5F1KC 5C0RL 1NMCB 5G4OA 3CBRA 5ANHA 4OF6A 1T80A 3NIDF 1WFUA 2RCSH 4JZOB 5FCSH 5IBTH 4O5LL 4JG0H 2ZUYA 4N5UA 2LTQC 1C7TA 2UZIL 4HK0B 4A66A 4OZIE 3QARA 5MERB 4F57L 1ONQA 2DQHH 4MAUL 2VSDA 1T4KA 3RY5A 3DUSA 3FN9A 2V17L 3MV9A 2HVBA 2ZPKH 3AMKA 4DIXA 1LILA 1AKJA 4LPUA 5AW2B 3DTXA 4GNKB 4GRLA 1B0GA 3GI9H 4XBPB 4Z7WA 3HRZC 2L7QA 1IQWH 2NOYA 3DGGA 4OJEH 1MJJA 2I27N 2GI0A 1A14H 5E1IA 4EXPX 3H9HA 1WZMA 3LKOA 3NFPB 3RFZB 1TJHL 5D7JD 4B9FA 2HTKC 4KVPA 4LHUA 4LEBA 4R6UA 3PP3K 1HZLA 1NCBL 4JHUA 1SHWA 4PGEB 5EN2A 4AEIL 4PJ7A 4DAGH 3OHXA 3NTCH 5IKCB 1ODAA 1UWGH 2C9AA 3NYKA 3RZWA 4XO8A 2XN9D 1OSYA 1KXQE 3VACA 1MCPL 1T0MB 4BXVA 3UTZB 4IRJA 2WOYA 3MV8A 4WKZA 2IAMD 2Z7ZA 3FAXA 5KJRH 2OMTB 4U49A 1MI5A 4OI9A 5I28A 2XUWA 4TULH 5F9JB 3RLSA 1H19A 3V0IA 4C59B 2VISB 3BE1L 5ITFA 1DHKA 5ICYB 1AGEB 3DV4B 3D2UB 4FCAA 1ZLDA 4FGMA 3QJUB 5I8CB 3IMRA 3N85H 2YO3A 4JVUA 5K5YA 1IT9H 1LO3L 1F02I 4ADIA 4LLUB 1HCVA 4IK7A 3GBLA 3UAAA 1V7NL 4ENED 5DVKA 1BZQK 1HHKB 4CA4A 1JXGA 2XZZA 5BQ7B 3LMJH 1FZOA 3RY4A 3OR6A 2IPTL 2Q8BL 3RRQA 1T21B 3MUZ1 2B4CH 2F53E 6PAZA 3B9KB 4XMLL 3RVUC 5F7FA 1WS7A 5SWZA 3F5WA 3WO4B 3MI6A 3VCLB 3UCQA 3V5DB 1YJDH 3L4YA 3CSPA 3GS4A 3QIUA 4A2MA 4AT6B 5I6XC 1BEXA 3QUYB 5F3BA 4A6YA 4P2YA 1JRHL 1SN0A 3QDJB 3VXRE 4P2AA 5LGJB 3CU7A 1IC0A 3NFNB 2A1WL 3O2DH 1SEQH 4XMXA 2CHWA 5D8JL 1LNUB 3LTVA 4BV1A 1BG1A 3D3VD 3KPNB 4WHCA 3HS0B 4NNYA 2OL3L 1T1XB 2BY0A 4WJ5B 1HJBC 4EDWL 1F3DH 3P2DA 4PJGF 1EIBA 1LEGB 4JKLA 1PG7X 2OL3B 3BP4A 2V3DA 2COVD 5LGYA 4ODXA 3M7OA 5I74C 1OGPA 1MCIA 3HNTH 5J6GA 4BH7A 1EK3A 1I3GL 1OP9A 1TETH 2BWQA 3L4ZA 3NEEA 5FUOH 4X83A 4M9OA 4ELMF 3QXDA 3GXTA 1CS6A 4PJCF 1FL3A 5HHXL 2NY2B 1FLRL 3QC5X 4DGUA 1J9RA 4FQ1H 4XCFL 1P9MA 3DVFA 4I18A 2J2ZB 1YDPB 3B9DA 2HWZL 1HXYB 2NY7L 1UOLA 3ME0B 1NGWB 4JFOA 2HRLA 3PHOA 4UT9A 4AMXA 3DV6B 3JWNC 4FQXA 3NCWA 3UP1A 5DEFB 1RHHA 3LZRA 1IGFH 1A0QL 1JWUA 1QEWA 4FNUA 1MCWM 2F58L 4XRCA 4XCYA 3UPAA 5BW7A 3WDJA 3ZE2B 4L2LA 5IBLD 2P8PA 3EFFB 2PABA 3C8HA 3QFDB 4ZSOA 1FORL 1T1ZA 5D7IE 4G43A 4KK8C 5IREA 3GIZL 2M2DA 3ML8A 3TVMD 3QNXB 1ULVA 4F7TB 4OZIA 1H3TA 1KPRA 5ESAB 4J4PD 2AJVH 2HVJB 5KS9F 2EIMB 3O9WD 5I1KL 1Q0XH 3ZHLA 3QHZL 1A1OA 1WITA 5B3NA 1S9WB 2JJTC 1QFOA 3U6XA 4PLNC 1E8XA 2FO1A 43CAB 3TTYA 4P0DA 1GS8A 4OT1L 3KYOB 5T1MA 5BXFB 1BREA 4D94A 3EYQC 2WBKA 3ARVA 1J1XL 4PS4H 4FZEL 3INUL 4PCTA 1DP0A 5E2WH 4B41A 3CPLB 1LGVA 3I3DA 4U1HA 3DRTA 6FABL 1LD9A 5AAWC 4K9EC 1OM3H 5D2LF 3WEMA 2A99A 1O7VA 5EEWA 5HVHB 1AS7A 1E4WH 4U7KA 5C0NC 3KPPB 2DLTA 3M88A 3MRFA 2I5YH 4LDEB 1UC6A 4NT6B 4DTGH 2OJZL 4X5WA 4NZRH 3BVNA 4IOIA 3WN5C 1UQSB 4FI6A 4OM1L 4FQXB 1WF5A 3M07A 4JZNB 3GDBA 3PWPD 5LGHH 4GLRI 5KBMA 1DUYB 1BIIA 1IFGA 2L7JA 1T83C 4HIIB 2GHZA 2A83B 4LRIC 3ZHFA 2E74C 3X17A 1OK8A 4Q9QH 3MNDA 1M53A 3WAKA 5IHWA 5J0BA 4I5BB 4MGXA 2HRPH 2Z9TA 3K2UL 5AVRB 3KMDA 5LWYH 2VMEA 5CGBA 3E8VA 5TQ2L 2VR6A 1WZKA 1OHZA 3FONA 4OJFL 4LO9A 3V5KB 3VXUA 5JPMB 5MP6H 2X1OA 2XBDA 4OTXL 1CE6A 4KY1H 2C9RA 4FQ2H 3MROB 2X3AA 5T8IA 4EMZA 2FL5A 1QI4A 4NLHA 2ICWB 2WZPD 3UTTE 4QHNB 4HLZG 4PS8A 4XMLH 5C6TH 1Z9MA 1ZS8A 5CEZE 1JPTH 1JN6A 3QWQB 2NY0D 4BM7A 2NDFA 3TO4B 3SGKC 4K3JL 4P9HH 1JF1B 3D18B 4IKLA 1UD2A 3ZO9A 2OLDA 4IRSB 4KZDL 2NW2A 3QJHA 5DMYA 5I17B 1T2QH 1HHGB 2FGWL 4CADA 3O8XD 2IAMB 2E76C 4FNRA 3PGCB 4XBMA 2BZ7A 5AYTA 5AZUA 5IWLA 4TXVB 2OP4L 1R1CA 4H26A 1VZHA 1VFAA 2FJSA 1MHEB 4YSUA 1UM6L 4X6DF 2QGCA 1EXUA 2BW4A 3LY6A 1KELL 3V0VB 1THAA 3NJXA 4HEME 4Y2DD 5DC0A 1KPUA 4NZRL 4KTEL 4HXBH 2AXGB 2VOTA 4DO6A 4M9PA 5CGTA 4KKLD 1OPOA 4IDJH 5CMAA 3G5YB 4FHKA 4FG0A 4P5TB 4ODVH 4QGYA 1SEBA 4IRJC 5L88H 4M7JL 3E2HC 1UKSA 3FQUB 3TV3L 3DROB 1GW0A 1U93B 4ZMTA 3KLHC 2OMVA 3Q2LA 2DY2A 2E6PA 4MMYB 4KH9A 4U1GB 1MLBB 1RK1B 2UXVA 5BZZA 5I75C 2CHZA 5C8JA 3N42F 4GIOA 1UWXH 4R0LB 35C8H 4LCIL 4KY1L 4IS6B 4NB7A 4OJDH 5EN3A 3U7WL 1UA3A 3O4LE 4PJXF 5ICYA 3I6KA 1IM9A 4KKPA 3NIFB 2F7IA 2CR0A 1WISA 1U95A 1A7BA 3QXUA 3GSUB 4I7ZC 1JPST 1X5LA 2VR9A 3RU8H 2K70A 2VQ4A 2YPKA 3MR9A 3QO0B 4QJ5B 2W91A 4WO4A 4WVRA 3WHXA 3HTLX 1U21A 3QXAB 1BPLB 4H25A 3L9RA 1U8MB 2FAUA 2DTMH 4ODTH 3EH1A 3VRLF 3WS3B 2MNUA 4XB7A 4Y4HD 2D8KA 4LCWA 4OZFH 3UMTA 3ZIMA 2F54A 3F6IA 5C09A 3T0XA 3D34A 1PW3A 4QHLB 5DD1H 4ZXBA 1Y6KR 2W88A 1MRCH 3MRMB 3M6DA 3QCTL 4TPRH 3T3PE 3SPJA 5H35B 2JJSC 4KQ3L 5EO1A 4HMEA 4KTEH 5FHAH 1ASPA 4ZUWA 1MEXL 1KIRB 3Q2VA 1R17A 2VTFA 4IDJL 3LZQA 2WXMA 3QEQA 4J8RB 4U33A 1KLGA 4Z7WB 3DUUB 3VTAA 1OP5K 3LKQA 4DQOL 5GSVB 5CLYA 1IBFA 4NUPA 4YNYA 4PJFF 5IESH 3PWUB 2N7SA 2ADFL 4JHAL 1E6JL 4QHLA 2Z8SA 1NFDA 3MLRH 4N2NA 4WDIA 1GYVA 1XGQA 1GGYA 4HK0A 5HGDB 2YPLD 4P46D 5CAYB 4FG4A 3MN8A 4BFEA 3IAGC 2YMTA 4H25B 4JGNA 1QO3A 5FM5O 2E7DA 5CJOL 1BMZA 2CBPA 2ARJA 4IIZA 2XG5B 2X2IA 1TZAA 3NK3A 4ZZFA 3FBQA 3CVDA 3MOBL 5C7ZA 3O4LD 4DK3A 2F58H 3OJMB 4U3CA 1DVFB 3I6KB 2VH5H 1I31A 1UENA 1IBGH 4EOWH 2FQFA 1IV8A 5J12B 4MMZC 5TH2B 2AXHA 1UA6L 4AEEA 3TIDB 5AVZB 4FKHA 4ZUWB 1FG2A 5J13C 2NY2C 2VXSH 2QLYA 4P3CL 3EOBA 1H15B 1ORSA 3DSFL 2NY0C 1B4TA 2Z4TA 4BRVA 1JL8A 2YEZA 2ODIA 3MGTA 4UNTA 2XPGA 3HBPA 2ADIA 5GGUA 3HE7B 3QIBC 5JDSA 2Y1VA 1INDH 2QSCH 3WJLC 5IY5B 2YD6A 1L7TH 1AD9B 4ZS7H 1GYCA 1FZKA 1JFHA 4Z5RA 1Y0LA 3REVA 1H3GA 3RNQA 5JYLA 1PX4A 1BLNA 5A7BA 1EUUA 2VLJE 3WHXB 4X4ZA 3N40P 5AL8A 3U9UA 5BUGA 3UTTA 1KJ3L 3CXFA 4HPOH 1ZGLP 5EF0A 3INUH 4JPVL 2ZUQB 2VR5A 5I0VA 2FBOJ 4IU3B 3SPGA 4FQQB 1QVOA 2XNAA 4NKDA 4M6OL 3M1CA 4I9WD 2IH3B 1UM5H 3OG6B 2ENPA 1CDGA 3FRPB 5D9SA 2F53A 1AFVH 3W0WB 3B2XA 2P43B 4R7DB 2OSLB 3HE7D 5BNXD 2FEEI 4FXKB 4BFIA 3WD5H 3IGUA 1MDTA 3ECQA 4XX1E 5GHWH 4IRZL 3EO1A 4HKJB 2OFQA 3CXHK 1E8ZA 5FYKL 5IJCC 1NL0H 2CK2A 3TESA 5FGBA 3GRWH 4KFMA 5TF1H 1S5IL 4G5AA 3ZTJG 2WXJA 3EYUL 5EUOB 3TT3L 2AXGA 2CNZA 3V7AG 1ODUA 2DH2A 3EHBC 2JKXA 3I75B 5D2NC 2BC4B 4MKMA 4WNJA 2B2XL 2CLVB 1U41A 4KNSA 4PRIE 4YVUA 1N3NB 2GTZB 1UWEL 3LN5B 3O4LB 2DMHA 1QSVA 2DWDB 2LU7A 1X4ZA 3N43F 4A04A 2DW5A 4D8PB 1RIUH 2IAMA 5C0GA 1FH5H 4N26A 2NY4D 1RZJC 1X7QB 2JCWA 2IANB 2W60A 2LE9A 1GIGL 1JD9A 3TO4A 3OF6A 4WUKL 4ZW7A 4I4WB 3TYGH 2LT9A 4OFYD 3X11A 1A7PL 3QC6X 4P4KD 4PRDA 4UYQA 5K9JH 3MROA 5ERWB 3AU1A 1N5YH 3K72B 3KLKA 4EKJA 1QSFA 2PYEA 4G8GB 1BYPA 5HYSA 2NYYC 2EIZA 4XZUA 1A66A 4M61A 4CKQA 4JAMB 5EF2A 3BT0A 3PQYB 1S7VA 4MS6A 3WYRA 2V9TA 5F7YC 3HR5A 2IAND 1NCBH 4A2DA 4KDTC 4YIQA 2XA8H 4AIOA 2IDFA 3H3BC 5INCB 3QS2A 1H8OA 4FX5A 3O6LL 3PWNA 3V9FA 5ACLA 2CO3A 4QJ3B 5EH1A 4JY5H 1VENA 4LVOC 3TZVA 2GJRA 3LIZL 2V2TB 2EAEA 3D2UD 1WZLA 1XEDA 3EFFA 1S3RA 1A22B 4Y4FC 3DRTB 1VPOL 3ARZA 4RX4D 2YJQA 1R5VA 5AB9A 2MQGA 2WWMC 3FQ4A 1IL1A 6CGTA 3N04A 1X5JA 1TF4A 3SKNB 4JO3L 1P5UA 3EYQD 3WTXA 3MACL 2CLZB 3TBSA 4JFVA 1EFXD 1MUJB 2R51A 3V52L 3C87A 4FTVB 3LS5L 3DOSB 1S9WA 1A7PH 1CDHA 1KF9B 3FQXA 5GS3A 2H2PD 4IGBB 2ILLA 3VU1A 1J0ZA 5EA0L 4XNAA 4Q6IC 3SDXB 2JB5H 3EOTL 1HSAA 1UXSA 5C9JA 2JFCA 3FS9A 3IGAB 3SY6A 2M8XA 2MCG1 4YDIL 2VRQA 2XQBL 4EXKA 4PLKC 2G5UA 2VAAA 2XIDA 1WZAA 3AQZA 5C08A 2FJFB 4X6CE 1LP9B 1JGIA 2X9ZA 4OB5H 1UXMA 3MV9E 4KK5C 4P99A 4XCEA 3WIIL 3ZJAA 1YG9A 5HHPA 1YNTB 1EZSA 4B9IA 4S2SA 4XWGL 5DU7A 1M3IA 2E86A 1OB1A 3PUUA 3WHE1 3ZTEA 2IMMA 5DJAA 3TX4A 5CSZB 1HCFX 5F0LB 5IVZB 5FECA 1KWGA 4W4OA 4R0LC 3MRQB 1A21A 2QHRH 3BPCA 3OZLA 3V6FA 4DN4H 5C70A 5LXGL 2I60H 1TTCA 4GAGH 1IGYB 3QUYA 5F3BB 2YKKA 2HH0H 1N5AA 2YK1L 4PJDB 4XNXL 4UAHA 1F18A 2E9BA 3RAJL 5FDWA 3VCLA 1FQ9C 3UYPB 3CXHJ 3QJFA 4AK2A 1EAQA 3HBQA 1OIOA 4PJGB 2Q7AA 4WJG3 4X9FA 3PAUA 2C9SA 3ISWA 1HNGA 4RNRA 3UDWC 2VZUA 3MHZA 4C4UA 1G1CA 4GW4B 3OJVC 1S7UB 3OJDB 2Z8WC 3WSQH 5JHDE 5E1HB 2X1PA 4H20L 4YE4H 3AITA 2AAVA 1BA9A 2R7EB 3N0PB 4KK9D 4N8CL 3UIYA 1BBJA 5E8NB 3CAFA 4P2OD 5DJ2B 2MCPL 1HAWA 1EHLH 1TJIH 1PD6A 1S9XA 2XIIA 4PYGA 4JPIB 1I8LC 2C3VA 3AWGA 4KKCC 3INOA 3OKNB 3KW8A 1M9SA 3PIQA 4X7CC 5SX4H 3OZ9L 5FOBA 2V9UA 3VWKD 1U8JA 2WUBL 3VU2A 2FT6A 5JW4Q 5AYQA 5JO5A 2GBUA 4LLWA 2BSSB 2TSBA 1IZJA 4L29A 1F6FB 1MJ8L 3IM1A 3F5WB 3G5WA 4ATTA 3OWRA 2BSRA 4M6MH 4GP4B 3VI4A 3QB7C 3VFSB 1G6RB 2IALB 2VR3A 1JNNL 3QRLA 3UC0L 1DL7H 4CGUB 1ML0A 1L6XA 3ZYJA 2PWFA 1T89C 1ZSHA 4LSRH 3P69A 2X4NA 1E9PB 1MWOA 4XB3A 2XQYA 3GKWH 3KM1A 1E5YA 5DUPH 4S2SB 3IDIB 3Q7JA 4YSSA 2G5BB 4HKBA 3OAUL 4ZUSB 4R26H 2MTPA 3HG4A 3CFBA 4AZ8A 1S7TA 2ZOLB 1MFDH 5IROA 5AEAA 2G4GA 3VXRB 1P84J 4F7PA 5A6LA 1JZFA 4MAYB 1TQCC 1UKQA 4QOKE 4GSDL 1TSRA 4IMLB 1KJ2A 4MMZB 2P5WB 3BSZH 4GP8B 4HUCA 1BVLA 4MCYB 4AEHH 3BZ4B 4PRIA 1VFUA 2SODB 2H47C 5TDPB 2WANA 4RMSA 3DTXB 4IYKA 1I8IB 3RILA 1G6RL 2OULB 5G5DA 2DWSA 5J57B 3OLDA 4NM4L 2PYFA 4MQ7B 2ORBH 2F1EA 5GJSL 4B5EA 2CWRA 4XCCL 1YEWA 1A7OH 2OJEB 2WXGA 3IMWA 4J3XA 5CBAA 5E4EB 3I84A 3SQBB 1CU4L 4PJ7B 4PJAA 1QABA 5SWSE 2ZWSA 3C8KB 3IKCB 2FR4A 4OZHE 4XBEH 4MAYD 2YR3A 3OJ2C 3AY4A 4A7GF 3L3GA 1UD6A 1KULA 5J6HB 3LXBA 3F2LA 4M5ZH 5KTEL 3KLLA 4NGHH 4WSGA 1FFOA 4LMQE 3ZLQC 3UGEA 3RNKA 1JRHI 5EU5B 2IDUA 3CH8A 1BEYL 2FHCA 3KPRE 3GMOA 2JJSA 5E03A 3VA2C 4F58H 5F6IC 1BVOA 3QXVA 4NPKA 5DUML 2GEEA 2XWTB 5DZNA 5IB4A 1PX8A 5FYLH 4R2GD 2MOVA 4RFNC 3DKHA 2SEBA 3QNFA 3D6GA 3VXOB 3VWKC 4ZFOL 3V4PH 1JHLL 4NWTH 1F8TL 3FH5A 1KXHA 1TOXA 5FK9A 3KEDA 3CVHH 2J6EA 1T2XA 3AXHA 1NC2B 3B5GA 4KK6D 1MFUA 1NCDL 2XU9A 3SEPA 1AXSB 1Q94A 4CU6A 1WUNT 2FWLB 4LARH 2P45B 1S9VB 4L5FH 1WO2A 4TUOB 2YS4A 5JIPA 4MJ5A 5AB2A 2XZQL 4UANA 4LPYA 3CWGA 4MNQB 3RL1A 5DMIL 1QG3A 1HFUA 2ED9A 2HLEB 5F7MC 4WI5A 3BAEL 2G9KA 1AR1D 3GO1L 3EJZC 3VFPA 4FABH 2BSCA 4OUUA 5GISL 2VDLL 3L7EA 3BP5A 3ZKMD 1GZHA 4UI2A 3VM7A 2ZOWA 3BCDA 3BEVA 2VXQA 3UTSB 1KBBA 4Y4FA 5FO8A 4YDVA 3CZUB 4UQ2B 4YH6A 4UNUA 3FQNB 3JV4B 4UILH 3P3TA 3U7YH 4K7FB 4GBXA 4XHJC 1CVRA 2EYRB 4NUJB 1OP3H 3S88L 4Q58C 4KGLA 4A7TA 1EGJA 2JKWA 4ZODA 1O7DE 4WZ9A 1KCRL 4CVXB 2HZHA 1QFWH 2BCKB 5D7JB 4NO3A 3VFTB 4MXVF 5KSBB 1U3NA 3DSFH 3EJUA 4RZKA 3KPSE 1PZUB 3QEQE 4CUCA 4KRMB 1C5DA 3MJ9H 4LLQA 3ZW3A 3IF1A 4KPHH 4NYLB 5C09D 1G9MH 4ZPTA 2O5ZL 4NKDB 4PJEF 1QRKA 4M6NH 4IMKC 4N2FA 3FCBA 3DX2A 1T2JA 4P05A 3T2NH 2XWJB 4DP0X 4UYPA 3GB7B 4Y4KA 4FTVD 3WLWD 3O4LA 4NRZB 3L5JA 3TVMA 1AO7D 1BLNB 2E56A 4A37A 2FQEA 1FV1B 2BHYA 2CXGA 5DLML 1MG3C 4UV7H 4Z18A 3I9GL 2OTUA 1T6VN 2XPYA 3BMVA 3PHAA 2EILB 4ODHL 3WFBH 3HAEH 3VYOA 3ULVE 1ZCRA 2Q1EA 2YPLA 4ZFFB 5EU6A 3ZYZA 4JL2A 4N0YH 4ETQB 2WC7A 5B7MA 1XTMA 2G5RA 3BE1H 3WJJA 5IB2B 4YLQT 3CFNA 1VZGA 2F18A 2JELH 4RLDA 3QFJE 2AJUL 5BJTB 4FFYH 4F3FB 4IGBC 3PABB 2O6CA 3UDWA 4O02L 3V4VH 2ZZUT 3GZPA 2VZTA 5IB5B 1T03L 2EUVA 2I9TA 3P4OB 4KAQH 2C5DC 1GOGA 1DUZA 1FAIL 1S7RA 4GJTB 1UZ6E 1ZY9A 4LLMB 4OD1L 7PAZA 3BVTA 3NJLA 4PY8J 5J1TC 3KPQA 3C2AH 5KBPA 3QDME 3LKNB 1NCCH 4GEJA 3ZT5A 1LP9F 4KNQA 5AKTA 4ZW6A 1KYOJ 1CURA 1RZIA 4G83A 4URTB 4FMVA 2XFXB 3IE9A 3TBWB 3QUGA 3TCXA 4AQZA 5F1OB 1P4LB 1VFBA 3A67L 4N24A 4AXWA 3TN0A 2YLKA 2YAPA 2Z8RA 4FA8A 4K71B 1IBYA 3EO0A 1BQRA 5B1AB 1PD1A 5D7LE 4KO9A 4AC4A 3QIUD 3WUWB 4LSVH 1ZE3C 3KJ6H 1CT8A 2MQCA 1BVLB 4MCYA 5D1ZI 1W0WB 3RFRA 1J8HE 3VYPA 4ACTA 1EERB 5D2LE 4N8UA 5F89B 1EQWA 2R1YA 2WPGA 3BH8A 1D7FA 1MQKH 4PMEA 5B3JE 4WU7A 3L9YA 4AZ8B 2P4AB 4OCSH 2GIXA 3PNWB 1Q1PA 5DJCA 1P4IH 4BKLA 3EGDB 1SM3L 5D96B 1KGXA 4HUWA 1L3WA 2VXUL 4HPOL 1N6QL 3MNZA 5T3ZL 2UWEE 4K15A 3D07A 4R4BB 4KK5D 5J5EA 4HSQA 1LK2A 1H6UA 2WBJA 1TZHB 5I1HL 4YDJA 4F15B 4C56D 4BE5A 3WEBA 5I24A 4PW4A 4Y4HA 2GW5A 4WI0B 2OMUB 2VMFA 3TBVB 2NSMA 3O3EB 1NLBL 1JG9A 1F4XL 1JNHA 2YGOA 3QJZA 4Y4KD 5ETUB 3AMLA 1DUZB 3V0WL 3BXNA 4ZYKB 5SWSA 5D1ZB 3NGBB 1RI8A 3HRZA 3UYOD 3MNMA 4N9GA 4M93C 4P3DA 3BWZA 1CT8B 4PRHB 1K5WA 1QUNB 4I3SH 3MYJA 5JLZB 3QDAA 2WXRA 2FJHB 3F65A 2N3JA 4DP7X 5JUEH 1LE5A 2ZG3A 2NZ9D 2NY1C 3ABZA 3FU9A 3MMEA 3EW3B 4HJ0C 4NAMA 4JDTL 3B2UD 1D6VH 1S78C 3F12A 2HJKB 5BCAA 3EYVA 2KLTA 1HL9A 3IJYB 4XBGA 2VNCA 4GFTB 3P30H 1RZKH 5E6IC 3QJFB 3RVVD 3PG2A 2FBRA 1BXUA 4TF4A 5EUOF 4XP9H 4I87A 5F2FA 3D85B 4AQEA 3OMIB 3QULA 4H4NA 3ARPA 2WKOF 5HDOA 3MNVA 3QDJE 2DQJL 2OYLA 1GZHC 4HX1A 1QRND 5DFVD 1TO4A 4HETA 3ZDXB 5JHLL 5I9QB 3W81A 4M5TA 4PJIA 4N87A 5KVGE 3AT9A 4WW2C 5MENB 2VGLM 1TQCB 2JLLA 2OMXB 4U7MA 1NAKH 1WFIA 1G43A 4OD3L 4PV9A 1A6VH 3K3QA 4NDMA 2CLRA 2V2XB 2J21A 3SQOH 3LVEA 5IR1A 2O61B 2IGFL 4U0RB 1TZGH 1OARH 3FJTA 3ARRA 3N85L 3V7AE 5E0QA 4OF0A 4PGBB 3TBBA 1N10A 4G7QB 4UILL 4HISA 3UABA 1NMAH 2CQVA 2FYVA 2YZ1A 2HP4A 2VDOL 1FGNH 2X53A 2GSIA 3BEWB 3TTSA 3CXDH 4GRWE 5A40E 4L0ZA 2QV4A 1JP5A 4FADA 4IMKA 1HL4A 4JUTA 3ZKND 3DX6B 4HZ1A 5EO9A 5ESQA 3SJVE 2WK2A 4X5WB 1HIML 3M46A 5D7SH 1TTFA 3APMA 2XTSA 2UY7A 3OPZH 3QCVH 1I3UA 4I0PA 4Y1AD 1AQ8A 4OGQC 4V11A 3BKJH 1T2QL 1YJDL 4RMBA 1KZYA 4YDMA 4WUUE 3NZSA 5D7JA 4AMKL 2EIJB 3MRCB 3MU3A 4Y2DB 4HQQL 5E23A 1G4MA 5LAXA 2EE0A 2MMXA 1WFNA 4HEPA 3T2NL 1DSFL 4X7TB 3ZR6A 2BY1A 3MXVL 4F20A 1C12A 2AXJA 3DGCR 3L3DA 3ESUF 2IG2L 2D0HA 3VXUB 5JPMA 2C1PA 1WIOA 4HFWB 4QF1B 2YC1B 4Z95L 3B6SA 4PMFA 2OYMA 1H9DA 1DBAL 2PW1A 4JAMA 5IQ7L 1PAMA 5IB4B 1FFNA 1WFJA 1AH1A 4EN2A 4YAQA 3ABMB 4O4YL 5F7KC 1XGUB 2Q3AA 2ZKXA 1F90L 3GMOB 2O1AA 1TETL 1LO5A 3H2PA 1O6VA 2AK4E 4K5PA 2Y36H 4G59C 5MEND 3GRWA 2ADGB 1MCHA 3O6FC 1E2ZA 2ZG1A 2EADA 3I02A 2P8MA 3VD2A 4LSSH 4F9LA 4XP1H 2NY5L 2OTWB 4Z7WF 5B3JF 4ZTOL 3D30A 1LHZA 3KD4A 1N59B 1HC1A 1PKQB 1UASA 4GO6B 5DEFA 4LGPB 1NC2A 1N19A 4HLEA 2J57A 4HS6A 4H40A 3QNZB 1KUMA 4NQUA 1GPOH 1CO1A 4XBEL 4YHYC 4AYMC 3DPBB 1F4YL 1N0LA 4Y0GA 3SDYL 1KENH 4Z7WE 1QSFD 2NR6C 2FX7L 1MCWW 5EUOA 2CHNA 4PJ8A 4AQAB 1XB3A 3QZBA 3DIVA 4GAJH 1NEZA 4X6DA 3IGLA 1KPRB 2HLFD 4RA0C 1ZGLB 4I3RL 4PWFA 1JTTA 1R34A 3FSWA 5EIIB 3FNKA 1MVYA 1HEZB 1UJ3C 2Z4QB 2ZTBA 2FBJL 3WFEH 1W15A 1KY6A 4QLRA 5BMFL 3TZVD 3WGVB 4CVWA 3PV6B 3VG9C 2DH3A 5D71L 4P2OC 4WK2B 3D3VE 2XFGB 3LSOA 3D51A 1U91A 4DWHA 4F2MA 1NKRA 5IHZA 5KBKA 1Q0YH 5HDQL 3MGAA 1NBZB 1SDDA 3T6WA 1P0SE 5CBEB 3AGVA 4P46B 3HPLA 3L81A 4WTZG 1PVHA 3KS0J 1ZVYA 3GMNB 1V7MH 4YO0B 4HJJL 5I15L 4Z7NB 1AHWB 2H32A 5I16B 3ZE0E 1G9NL 2CR3A 4LSSL 5JO5B 1ZIAA 1U6AH 3DLQR 4PVMA 4WUUD 1BQHB 1CWVA 4BUGA 5F6HI 4Z3FA 1TZGL 4MLIA 3GO1H 1HHIA 4XB8A 3C60D 4M48H 4FAAB 5ITBH 4FQPA 5J06A 3IJHA 2VR4A 4U1GC 3MBWA 4PY7A 4QKXB 3T1FA 3TJHC 3VO0A 5JW4M 4ERSH 2X6UA 4OAWB 4XVUC 4D8OA 4ZMQA 1JYXA 3K71A 1QUNA 2GBTA 1D5RA 4IBSA 4N9GB 2Y23A 2UXFA 2ORBL 3UAJA 5AKRA 4XAWH 3DETC 1Z0NA 1CLOH 2QQNH 1E4XH 1QLRA 1TT6A 2ITEA 3D2UA 3MNVB 3IDXH 4PLKD 3UROR 4UQIM 4AT6A 2D03H 2FLBT 5HDBE 5F9JA 5JDJA 1QX1A 5FYJE 3BDYH 4FQIH 4X5XB 4ZS6C 1UH4A 3P2BA 1YQVL 2OV0A 4Y9CA 5DT1H 1ZD6A 1BXAA 1EFXA 3NFSL 3FQ1A 3ILQD 1XAKA 3T65B 4C55A 1OSEA 4M4PA 4JO4L 5AAMC 2J5LC 1MLCB 4C4KO 3LEXB 1EVUA 1ZE3H 5K93A 3DO7A 3VD1A 1UTDA 2MWCA 3C5ZA 3VVVA 1N8OE 3NP4A 2E4FA 5LCVA 3A4FA 1R47A 4J2QA 5DFVC 4NOBA 1EANA 3U46B 4JFPA 3T1FB 4XMZA 2EUZA 2FJFA 2XTJB 5DO8A 3CVCA 4M7LH 2R8SH 2ZWNA 2IAAC 1UB5B 4TKWA 1BQHA 2P3YA 4KNTA 3A6CH 3MO1A 5DEGB 5SWQA 5J11C 2OCCB 3ATFA 3WUZA 4LQFL 1TDQA 2VKWA 3NIFE 3ZHNA 4LESA 3TBSB 3IMBA 3VW3L 3TN0B 3HI6H 2IANE 3VVWA 1SLUA 1ONQB 4WI4A 1TKWB 3VWJB 3IFNL 4P46A 4AYEC 4E9YA 4YLCA 3BAEH 4MA1B 4N9OB 3VE0A 3P3UA 1QD0A 1A1NA 1WCQA 1Z7JA 2IWFA 5IKCA 5J4MA 3L9RB 1QRNB 2Z35A 1EX0A 3PXJA 1LYQA 4A67A 2Q9OA 4LVHB 1DLFH 1MIEL 3EGDA 4E5XG 1F6LL 4WO0A 1DVFC 1WFOA 4WCYL 3QO0A 1OTSC 4JQXC 2K9FB 3Q6GH 1NGPL 3D39D 4DQAA 2GK2A 5HDLA 5KS9B 2PPFA 3C2SA 2X4TA 5BZWB 1XL6A 5DSCB 3RDTC 3OKEA 3OPZL 1KN4L 3WIAA 1KTRL 4KDWA 5D4IA 4WUUA 3L4CA 4QOKB 3VFUA 2X70A 2ZX9A 4KI5C 4ALAC 4YGVB 5E24E 1TCMA 4L4TB 3ZE2F 2EC8A 5CD5D 2Y1ZA 3PWJA 1DVYA 3RI5K 4X8JB 3IDUA 1DJIA 2EO7A 3MJ9L 5BO1L 3V6OE 4XP4L 32C2B 3HAEB 3RL2A 3L3OB 2J8UA 1PDKA 2K0RA 3AU1B 4M6AA 1Z5LB 2GQHA 3G3LA 4XVTH 1AI1L 2UZXA 3C12A 4XMUA 1D2OA 1AD0B 4H7VA 3AREA 4ZO9A 2FWSA 4F8QA 2OTWA 3X11B 2B7DT 1SLWA 2OMZB 5DJDA 2GC7C 1TITA 4OBRA 5E9DD 1F58L 2EXWD 4P23B 3T6QC 2VR8A 2DQTH 5LNDA 4M7KH 4X4KA 5C0GB 4KITB 5BS0B 4KI5D 2D3JA 3GT6A 1MXDA 4NENA 2ALWA 1U8IA 1UD3A 4KJYB 4YXLH 2ROYA 3AS1A 3NH7H 4I2XA 4JLRB 5LVEA 2AK1L 4HIPA 1DQJA 1HESA 4Y2OA 4NZTH 5DYFA 3Q01A 3HR5B 4OLXL 1X5XA 1AZNA 4NO3B 3VFTA 3FRUB 4FJ6A 1X44A 25C8H 2WYIA 2EIZB 1XO8A 1I1FA 3D4GA 2Q7NA 4MRCA 4AQ1B 1YNLH 2Y2TA 3CD4A 1MVFA 2QVIA 2WHVA 1IAIH 1SJEA 3JV0A 1CE6B 2VMJA 4JN2B 8PAZA 5KVEE 1J1PL 2GJ6E 1MCRA 3W56A 1IKNA 3SODB 1WWBX 3RHWF 1FFRA 4LIQH 3D39E 5CZVH 2LGNA 5ESVA 1RL1A 1Q9OB 1EXGA 3LN4B 1CDIA 1Q9WA 5K9OB 2Y69B 5E5RB 3VNZA 3D0VB 3UZEA 3VXTB 1J9SA 2ZD0A 1PBYA 4OB5L 2ENJA 2X28A 3FYIB 4OZGE 4F7EA 3W5NA 3X3GH 5ILTL 2JKSA 1AP2A 2VN7A 2WXQA 2EDQA 2QQKL 1UATA 4A2LA 4AG4H 4DP8X 4ATWA 3A67H 5G55A 4CJ1A 1QTSA 3G04B 1ILUA 3RPKA 1FYTB 3D3VB 2WB7A 3VGHA 5F7UA 4HIXL 2OMZA 5KZCB 3ZUNC 2IH8A 1QNZH 2VDNB 5EZLB 3S6CA 2Y24A 1CZ8H 4PGBA 3MBED 1WK0A 1NTDA 2K8MA 2MFNA 3O3AA 5K1NA 1U30A 1FFTB 5GGUB 2XPGB 3P3SA 4XPFH 5E8EA 1DLHB 4QTHB 1WHPA 4K94C 3S5ZA 5F7EH 3T6ZA 1RAMA 4FEMA 2DB8A 4DGWC 1A6AB 1XR9A 4MNGB 4A7SA 1Z9SB 3MFFB 2AITA 4P2QE 1D9KB 5B39B 2GUOB 2K6WA 2XWTA 3IDMB 5LBSA 2A77H 4HJGB 3NTCL 5BRPA 5T5FA 4ZOCA 4KQ0A 1G1OA 2WO4A 4YPGB 3V0GA 5BS0A 1N6VA 3ARED 4G80B 3IEAA 2QKIA 1GRWA 3NCFB 4PSPA 4JQVA 1IB5A 5GGTA 4YZFE 1H5BB 4TUOA 3WFDL 3LMJL 4RWHA 4YSEA 5IMOB 2OXGB 2YD8A 5DHDA 4N0UB 3O6FA 2GTQA 3NCXA 4PBVC 3T09A 1JK8B 3RKDD 4OF7A 4PJBF 5A2FA 2B8OT 1WVZA 2NNXA 3LNHA 4BZ1L 1DFBH 1U8NB 2ZSWA 1KPVA 4ZNEA 3UJTL 2C3XA 4FG6C 5EULV 1TJGH 3Q3GA 5E2VL 3M1BA 1HWWA 2ZNWA 4GSRA 5FK9B 1MCBA 1U3HD 2YFNA 2KS0A 4J2XA 3ALXA 2MJWA 3BKCH 3ULSA 3CQPA 4Q6IB 4X2UA 2BRRH 4OLVH 2HUEA 3GSWB 3PRZA 5EF3A 3QQXA 2ATAA 4HJTA 5F1NA 2YAFA 1JPFA 2UX7A 4YHNB 5DRNB 4OZ4A 1TEGA 1EZVY 1HNFA 4IJ3B 4ZNCD 1NCUA 2VMCA 5HYSG 1G7MA 2MIZA 4PTTB 1S7TB 2H0JA 3D85D 3HZKA 4ICWA 4ADJA 3A47A 4FP8H 2VDPL 4HKBB 4ZUSA 5DUJA 3Q8FA 5GZOA 1AGBA 4OU3A 5FUOL 5I23A 5JNYB 1MNUH 2H6UA 5FV2A 3BKML 5CNHA 2HAZA 4P59H 4Y16D 4W9FC 4XMPL 1C5BH 2YA0A 2L8AA 1E50A 1PSKH 2W1NA 1MZYA 4D9RE 2FB4H 4KKLC 4W9LC 3J27A 5C7XH 4HAFA 1A14L 3DO4A 1NFDB 1IBBA 5L9DH 4ODUB 2BMKB 5KVEL 5DYOA 4DGVL 2JIXA 5FGCE 3WFDH 5EU3A 5LNGA 1TYEB 4YNYB 1MHHA 3F7QA 3SO3C 3LB6C 2X4PA 4OFQA 4PRIB 2H2SC 5GPRA 1BAFH 1TENA 5L7XL 3UPCA 2P5WA 3OR6B 4Z0BH 2BHZA 3QZWG 4PAZA 2CO4A 1D7BA 3P02A 3C09B 4U3HA 3KWUA 3VFGL 1S8DB 1NIDA 3P4NA 2NXZD 1QLFA 1J8HD 2FO4A 4PUBH 1E7UA 2LAAA 4X98A 5F96H 4KRPB 5IM7A 1M05B 2DDQL 3RX7A 3C5JA 2DPKA 2N59A 4MHHG 2GAZB 3QWOA 3GI9L 3OB0H 2EE3A 3LIZA 2FX7H 1LE9A 2QDVA 4JKPH 2BM3A 4R9HA 3PCYA 4P5TA 5FYLL 4S1DD 4ZW8A 5CP3A 3H9YA 1BPVA 5JA9A 2CO6B 2PKDA 1B6DA 2VLRA 1RZIB 1T7YA 2R2HA 2ENSA 1NOFA 3HB3C 4G9DA 4XHQA 3W39B 2JKNA 3DMMD 4X7DC 4GW1A 1OGAE 1QZNA 3IRPX 3LQZA 1J1XH 1QFWM 1N0XH 4H26B 5F7WC 3RDTB 1QPPA 3V9CA 4Q9BA 3AW5A 2W92A 5E6UB 1HHGA 3CH1B 2DLHA 4G6JL 3MRQA 4BGDA 5GS1C 4QTFA 3E9TA 4Z7UE 1PLCA 1L5GB 1Q1JH 3OHXC 3RJDA 4R0LA 3WNOA 3O9WA 4QKTA 1KEMH 1ID5I 1Q0XL 4G71B 4LVHC 4YDNA 5AUMA 1RK1A 1HINL 3ARQA 4NKIL 5DJ2A 1ZLWK 2XTJC 2LR4A 1QFPA 4RX4A 3FB5B 1OGAD 4YFLI 3ZT6A 4B9KC 3OKLB 2HX7A 3HNVH 3P0YH 4R7VA 1G7QB 5MEOA 4PY7B 3DROA 4PJAF 2JE8A 3WLBB 4Y5YC 1ZA3B 2YHGA 4HWEL 1L0QA 3QA3A 5I19H 5CMAB 2A9DA 1FPTH 3DX7A 3FB7B 2QL1A 3RUGB 1C7SA 3SPCA 4GKZB 3BQVA 4GRLB 3FZUC 3NJNA 1CQKA 1NBCA 4PUBL 5IOPB 3QUYC 2JH2A 3FTGA 4GQ9L 1G7PA 4HGWA 4Q4EA 5FDWB 5JIDA 4MA1C 2PCXA 3ZTNL 1ZANH 3QR1A 3QNZA 1IGTB 2AQPA 3BP6B 3QORC 1D3CA 4MD0A 4PJDA 1E4XL 5JIKA 3PFUA 5FFLA 2WXIA 3RZCC 3B2VL 5CN2A 1HKLH 5EOQH 2WLHA 2IQAB 5CR8A 3MRFB 4UU9B 1R3LA 3PGFL 2L0DA 2EVFA 1O5DT 5FC9A 1YEHL 4DGYH 3CDFA 5KSBA 1THCA 3K91A 4KROB 5I8KH 2BVYA 4WEMB 3IMUA 1KB5B 1UZGA 2QQKH 3TF4A 3GUFA 5IJKA 3L48A 4JFDA 4Y5XB 4EIBA 1XH3A 5EBLA 1KELH 5I1JL 5EWIH 5LBVA 4PJ8B 2EYRA 2QPEB 4IIQC 1BJMA 1NEZG 3FCTA 4LASH 4OV6F 2R1WB 3NJFA 2XSKA 3ISYA 1CD1A 4M02A 1WDAA 4CN6A 2B5IC 2PYEB 1C16A 3ATDA 4G8GA 3WKML 5HYSB 2X38A 3QIWA 4DAGL 4AQ1C 5HDQH 1FDLL 5ERWA 2NXYC 2WBWB 4G1EB 1NIAA 1OE2A 1PF3A 2Y3NA 3ASNB 3FFCD 4OM0L 4AEHL 5GGQL 4IOIB 5IT2H 5F1SA 2K9UA 3EJQA 4DGVH 4E41E 1RURH 5J9PB 1FYTD 3WNNA 3LYRA 3PDOB 2PN5A 2MPVA 2Z91A 3AJ7A 3ZK0A 2UV3A 2NY6D 2AVFA 4AL8L 2VDRL 4Q8BA 4NS0A 4Q4IA 3X3FH 1XV8A 2XBTA 4ZO6A 3IFNH 3C9NB 4I1RA 4X9GA 3IB4A 1IGJA 1T5XA 4FLQA 1RZPA 4GMTL 1NCAH 4YX2H 3C2AL 3MRJB 2COQA 2VLLB 3TIEA 3VAEA 2H2PC 1GGIL 1V55B 4ZO7A 1G7PB 3CDYA 2ODHA 1VACA 1CLZH 3D69A 4L3FA 2OMBA 3VXOA 3MRBA 1AGDB 3CDGA 5JR1H 5AW0B 3N06B 5IGXL 4JREB 2AC0A 1RJCA 3II1A 2O6FA 3E80A 2DICA 3H7BA 2EKSA 2VRKA 3I9PA 3HG2A 3NP3A 3FTUA 4JFDB 4Q9CA 3S5LA 4NDMB 3PS6A 4JFHD 5DA4A 1FFOB 4PBXA 5H37G 2B20A 2DL2A 3MVSA 4OFKA 4BCZA 4N86A 5MENA 2VXTL 1BZ9A 3C5SB 4DEUA 4CBZA 1MZZA 2E3VA 1LNUA 3BN9D 1FIGH 2HG0A 5D93B 5BW7C 5IEHA 3QYMA 3P73B 1T7WA 3V4VA 1C8QA 4XRCB 1O75A 5ID1A 1TQWA 3COOA 4UZUA 3GUTB 2W9EL 4R2GB 1GJWA 4G42B 1MHPH 4PS4L 2J1WA 1NGXA 3DHMA 4OTXH 2CKNA 2FTAA 1EZVX 3IAPA 4DZ8A 1XSOA 2LAGB 4BFGA 4O2CA 4BFRA 4ZPVB 2YUVA 4QAWA 3S48A 1XFPA 1L9PA 4RETB 3OWEA 2VC2B 4HOWA 3NAAH 2R9HC 3G7TA 2B1OA 3P9MA 4YWGH 4ZMNA 2ZOOA 3QCTH 4JZJC 1NC2D 4TPRL 3K6FA 2CLVA 3LKSA 2Z0UA 4QNPE 5H37H 3I75A 2W9LA 1XEUA 3HN8A 3PUCA 4YK4B 5B3SB 2HVKB 3DX8A 4WFHD 5E1AA 1DQQA 3HE6A 3LZOA 4AWJC 1GY2A 4GT0A 2HRPL 3D08A 1K8IB 3SGEH 5H4YA 4OQ1A 2W0FB 3UTSE 3CFTA 2KQMA 4G8IB 1MXGA 5EDSA 3H0TB 3UBHA 1I7UB 3MV7D 2FO8A 1MCDA 2OA9A 5I8CA 1IM3B 1JPSH 5I30L 3RIKA 5IJDC 3WEOA 3C75A 4FZ8H 3KLQA 3KGRA 5FA3B 1KIUA 5IK3A 2PWEA 5C0EB 2OMUA 5CLZA 2FQGA 3WFCH 1DQMH 2CRZA 2YLHA 1EO7A 4BD4A 1KMGA 4NHCL 1XGZA 2QFPA 1IU1A 4P5TC 1KB5H 5E4AA 4CN1A 2HJKA 4QOKD 3KH3A 1U4EA 2VLRB 2Z1PA 3GTVA 1QNIA 1LO2H 2GY5A 5DLLA 4S1SL 5T3XH 5I75B 4HJEA 3A6BL 1ANUA 3MGTB 1KTJA 3HUJA 4W9ZA 2HT4D 5IQ9B 2EO1A 2GBAA 2V5YA 2I24N 2Q5BA 4UT7L 3VSQA 2BJML 3QPQD 5E9DE 3LKQB 1M6OB 3G5ZB 5BV7B 1C08B 2B4CC 2D7PA 3GD1C 4OQTH 3HRZB 1X7SA 1BAGA 4BCYA 1H8LA 3VB8A 4KXZH 1MCCA 2DEYX 2BXZA 3OC5A 3W5MA 2J71A 1CL7L 3MJ8B 5GHWL 1DJZA 3P0YL 3GSWA 4JFEB 5CINL 5F9WC 4NQQA 5JPNA 1TXKA 4HKXB 1IRAY 1COBA 2C9PA 3UBFA 3WJMB 2A9NH 2WN2A 3MA9H 2LTQB 4BQCA 1HS6A 1II4E 3GK8H 4XWOD 1IUZA 1OGAA 4PR5A 1KPVB 3AXIA 4DKDC 5AFAA 4D0CB 4FNTA 3J8F7 2X89A 3CIAA 4GMSL 4G7YH 2R0KL 2G3MA 1YHPA 3PU7A 2CPCA 3VGAC 4POZD 4A2HA 2FLMA 4FQJH 1JCVA 4E68A 3HZKB 3NQIA 2PW2A 1OZUA 2ZT9C 2ZG2A 4YHPA 1YEHH 1M9WA 3UJTH 5IB5A 5FCUH 1ID2A 1F1DA 5HDWA 2VM4A 4GRLC 5JZ7D 3V7MA 4K23L 4ZMWA 1GS7A 5KUMA 3WKQA 3QZPA 2GK0A 1XSKA 4FFVD 4ZXBB 3MV9B 5ELIA 1AZZC 4BFBD 1OF0A 1Q0EA 4EPSA 5CWSA 1HQRA 5GRJH 3H2QA 1FGVL 3HB3B 2VDML 4NUGL 4XN1A 3FCGA 1EMTL 4YSCA 2MRYA 1BOGB 3LV3B 3ZKXC 1GXEA 5I6MA 3I3BA 5CINH 3QXAA 2XA8L 2EXYD 2VSCA 4KJPD 1PU0A 2VDLB 4RRPG 3QEGL 5EPMA 1E3XA 1BVZA 3QYCA 4W1TA 3HCVB 5DRZA 3CFMA 3GSXA 3PWPB 3FK3A 5GS1B 3SKMA 3LXAA 4U1KA 4JY5L 4RAVB 4MSWB 4MVBC 1ACYL 2IMNA 2Q20A 3JWDL 1EO5A 5F7BA 4X0KA 3SPIA 4XPHL 2ADJA 2V6HA 5B39A 1PAZA 5D2LA 1Q9OA 5F71A 2BCKA 1VGKA 5G4NA 4M7LT 1QSFB 4BWTA 4Y4HC 3QDMD 5E8EB 4N2EA 5BOPA 4NC1C 2DM3A 3E1F1 5FGCB 4XPAL 1YN7B 3MZTA 4XNYH 1QBLL 4CC4C 4Y5YA 5IW6A 1UWXK 3QI9A 1IFRA 2BPBA 3H9SD 4ZX5A 4LKCA 4N0FA 3BT2L 4QYAA 2JB5L 2JQMA 3EOTH 5KUKA 1PL3A 1PEZA 1O6TA 4UDTB 4BK5A 3RZCB 1G4RA 3GB7A 2Z0BA 4HW6A 3STLB 4DVRH 2J3SA 3G04A 1A4CA 1P7QD 4OUUB 4ZPVA 3TBYA 3F85A 3BZ5A 4KQ4L 1K4DA 1S5IH 3QIWD 4NYLA 1XF1A 3STZA 5DS8A 3V52H 4LLQB 3P30L 4HWBA 1I82A 2BRRL 4OLVL 4HYTB 3UBGA 1T89A 4ISVB 5EOCL 3WIHL 1B3IA 1T22A 3FF8A 4AUUA 1SOSA 3NQKA 4QRUA 2G4EA 1IJ9A 2ICWA 1HZKA 4OQTL 4NQSA 2J8UB 5HY9B 1JS4A 2YAOA 4JGUA 3PLYA 2VLJA 3GSVA 5EFIA 4KV5F 2R69L 1JGUH 5DURD 1TEFA 2AZUA 4CVZB 3HPJB 4OZGF 1IM3D 3VFUB 4RFNB 3VWKB 2A6DB 2KBGA 4LL9A 2D0FA 3I6GB 4M7JH 4NZFA 4XMKH 3RY6C 3C6LB 1DQJB 1F42A 2J20A 1MSPA 2XI9A 2YA1A 3JT2A 1QFWI 3NT0A 5BV7L 4HVBA 4FQCL 3A4AA 1M42A 1PJWA 3APFA 5KS9A 3HI1A 1MF2H 3UJIL 1P69B 1G94A 3IK2A 4HT1H 2NDGA 2DQFA 3BIKB 1DCLA 5JA8B 2CDFB 5AVQB 2KH2B 1T0OA 1HYSC 5HVHC 1IBZA 1XL4A 1A6WL 4L18A 1AD9A 4G6FD 3RVTC 1MRFL 4GRWB 5FYLE 2A5UA 1Z5LA 1P53A 2YWYA 5DHVB 1JZ8A 4X7SH 4TVUA 2ADIB 2X4SB 4PB0L 1GIGH 3DVNA 2WSKA 3QDGB 2ED6A 5GJTL 1QSEB 5LJYH 2D31A 3DJRA 5H2BA 3L3JA 2EDXA 4LCWE 3O2DL 3DYOA 1NGYB 3HBZA 3GGWA 2HVJA 4LVEA 3VXNB 2Z3FA 2NY4B 2Z65C 4ODXB 4Y5XA 2GIMA 3RTLA 3D50A 4PG2A 4CW1B 5GZND 4KXCA 4YQXL 1JGUL 4DP2X 5FKAA 1PJ9A 5IHBA 5JW5B 2DQCH 2RFXB 4EBQH 2AK4B 3FH8A 1E9OA 1N0XL 3H9ZA 3MLVH 3TO4C 1ZLEA 1GC1L 1N7ML 1LO4H 1KJMB 3WY2A 3QUXC 4FXLA 3MTRA 3UXFA 4PJHE 4XC1L 1OGAB 1SOKA 1UM5L 2J8UF 4GYBA 3GSRA 4K3HA 1P7QA 4JZJB 3WXVH 3S5YA 3GHEL 5ADPH 4AMWA 1UVQA 1T1WA 1Z5YD 3TH2T 3MLRL 2LOEA 2GJ6D 4FFWC 5JPMC 1ZV2A 2AJXH 3IS0X 3RTQD 3GBNL 4LZKA 3SIKA 4F27A 3PL6A 5GGTH 4J4PC 5DEGA 4APQD 1T21A 1TTGA 1OT2A 4TUKH 4TVPH 1A7RL 2VL5B 3LQAC 5E8OB 4PH8A 5HVWA 1BQ5A 4G8AC 2ZOUA 3CHXA 4H8UA 4BA0A 2DEWX 3ESNA 3UAEA 3QXTA 5E5LA 3V0EA 1I9IL 3GZQA 3O81A 2CZNA 5KTEH 3VXRA 5EO1B 2VJ8A 3CFBB 3S98A 4NQVB 3X12A 3IDIA 3ZDZF 4HIEB 2W59A 2NY3D 2ZXEB 4ODSH 1Q72H 2WLIA 2NQ3A 1XF3B 3O0RH 3U2SB 1CFSB 1HDMA 3NZHH 4M4RB 3UTPD 1MY5A 4AVHA 3JUYA 3CH1A 2BS9A 3VGBA 3HFFA 3RTQB 4A6YB 3K6OA 3RQ3A 1JI1A 2Z1KA 4XP4H 1JBJA 1AZCA 1CD9B 1MI5E 2H32B 3V5DA 4FE9A 2VMDA 3KR3L 5BVPL 3MNWB 4MJ4A 3QRFM 2EDDA 3IAQA 4D9RD 3KLAB 1F4AA 1NEUA 3GMNA 3KXFA 4JM2F 2H7WA 2X88A 5AL0A 2WWNA 1ZTXH 5HHNB 1U3HA 4O58H 2NW3A 3VRIB 2YRLA 4F91B 3WKNA 5F21B 2EZ0D 1EO8H 2YFOA 3NN8A 5HYJE 1Q8MA 2K3HA 1RP9A 3DIFA 5EWIL 1PY4A 5DUMH 1XF3A 5HGGS 2WZ5A 4TSCL 1J8RA 2BIMA 2RB8A 5BV7C 1JZ3A 3L3KA 4M3KB 5E95B 1K8IA 3K71B 3FFDA 4HD5A 3SDDA 5JOEA 1HEZA 2Z4QA 3HMXA 4DUVA 3CZSA 2EC9T 2WNXA 4HMDA 1BJ1J 1L9MA 1A7NH 5C08B 1KEGL 1NGQH 1X5FA 4LLVB 1WAAE 3G5YA 3SYQA 5C97A 1UXSB 1WBYB 3HE6B 1XX9C 5LXVA 1Z6JT 3T0ED 2PLTA 1RSFA 1I1CA 2G60H 4GW5A 4CNIB 1KPUB 2HG5A 3IMVA 4IGBA 1OAQL 3V4LA 3VXSB 2IIJA 4AQ8A 4HMCA 1AHWA 4XPAH 1QFUH 4YUEH 3IDNB 3BAKA 4XXDA 4WFFD 3QRGH 5E08L 4RISL 1N5AB 2J55A 1JPGB 3PYCA 2V5RA 3O11A 2J88L 4GKSA 4RMVA 2X44D 1PZ2A 3U6RB 2CO2A 3R19A 1WS8A 1OB1B 5FA4B 4MYPA 3RWCB 1CFQA 5KVFH 4NFCA 3X3GL 3BDYL 4M8RA 4J39A 4WV1B 4EI0A 1U8PB 4RAUB 3EJYD 1OCWL 4MA7L 5HGHA 1T04B 4WTXA 5CJBA 1KFAL 2ICEB 3RI5F 4WWPA 4QXGL 1ECZA 4NRYB 3NJIA 2WAQA 3KWVA 3G6JB 1KB9K 3NGBC 4JGJA 1IGFL 1LWHA 2YPVA 1OZTG 4IKJA 4BELD 4F92B 1MFAL 4MJ6B 3E3QC 1OP4A 3Q05A 1AGDA 3CDGB 4TQ8A 4LSQL 1R3JB 2A38A 1LTXA 4PIBA 4PJFB 3I2CH 3U9WA 5CEXA 3BSZA 3HOGA 3BQUD 3D87B 1JXJA 5C0FB 5DK0B 1XIWA 1C12B 3IGKA 4OCXH 3U0PB 4AV5A 2XPZA 5FUZH 1WCBB 5L4MA 2WWKO 1I1AD 2OXGA 5I8OL 2I69A 1CGTA 4WWKA 1U6AL 3QISA 2XVLA 5IW3A 1KCVH 4XCCH 4N2BA 4LAJH 4XOBA 4WEBH 5ITBL 1CR9H 3KCPB 4QHPA 2VR7A 1XSIA 2J4WH 5IFAL 4LDOB 1KCBA 4ONFL 3KYOA 2X7LA 3L5XL 2ERJC 4UQEA 3NSYA 4UV4L 3NUKA 1QRNE 1D9KA 3KDMA 1MIMH 1YEGH 4LU5L 3B37A 4RZCB 5EOTB 3FQ2A 3PQYA 3ZDYE 5D2NE 1AACA 4HUVB 4EZLA 2EUWA 3EJTA 4L4VA 4JRXD 3BKCL 3S4SB 4N2LA 4ETYA 5IR1B 3FO0H 1J5IA 3RYMA 1J11A 3B7YA 2WP3O 4J1UB 2F7PA 1KB5A 1E67A 3S35L 4B9ZA 1MHCB 4PWEA 4FF9A 2OW7A 2MOQA 3FW6A 3LPOA 1M1SA 1GGCH 1G7HA 3AS3A 1HKFA 2BO0A 1FVDA 2MCMA 4B27A 5L6YH 1ETZA 1T83A 2APSA 5HHME 4C83B 3G9VA 3BP6A 2VW4A 3JZ7A 1NKOA 5CO1A 2MQ3A 3O3DA 3Q43A 4E42A 4I1PA 2WV3A 4FL4C 3BHBA 3A6BH 1LO0L 2J2ZA 3ZDXF 1ETJA 2KZBA 1F3JA 4P59L 5HP5A 4JCMA 4LNVA 7TAAA 3BX7C 3RVWC 2AV7A 4JY4A 1CLVA 2YAMA 1FL3B 4J4PA 3REVB 4GUCA 3ZVVA 3RIAF 2ATKA 2DQMA 1ECYA 4ZTPL 5JW3H 5DK2A 2W0LA 4WF7A 2OXHA 2XICA 4UMGA 2CLRB 3CZJA 2A74A 1T1XA 1KNOA 1MN4A 3FRUA 2VM3A 4BFIB 1A2YB 2E7BA 2EEDA 3ARGC 1P4IL 3HG3A 3NMEA 4NZJA 3VI3E 2CO1A 3QDGD 2D9QB 3WSQL 3UTQA 3ZL2A 3QG6B 4MA3B 2BIQA 3GK8L 2X89D 2ICWI 4RESB 3W0WA 2Q76A 2BCMA 3SDAA 3JV6B 3U83A 2DQGL 3QZLA 3ZIYA 1GKOA 4P3CH 2NMSA 5AYUL 3FMGH 1J5OH 3CFCL 5DD6A 1E5ZA 4R5TA 5D6CB 5DZJA 4POYA 4TTGA 3HJ0A 1JHKL 3QEHA 4YL9A 5I1DA 4OGXL 1BD2A 4QI3A 2PPAA 3REWA 5E9AA 1QTPA 4GG6B 4FMFA 4N28A 3IU3B 3QUMB 5M94B 1A9EA 4Y1AE 4Y2LA 3TBCA 2JF1A 1G9HA 5EEZA 4GQRA 3HRPA 1RH8A 2XN9A 5HJBA 2H1PH 2Z7WA 3EAKA 4K7PY 4WDIB 2AJYH 2PTUA 4H1LB 4HS8L 1JK9B 4OLUL 2YRPA 4IRJD 3D1MC 2VYRE 2C26A 4RGOL 4YSOA 4KJQD 5JQHC 2G0KA 1LM8V 5E1GA 1O7DC 4FNPA 4IKNA 4LOVA 1UA7A 2K1MA 3V4PL 3S37H 3FT2B 1J8SA 2FO4B 3DTUB 1KJVB 4PCYA 4WU5A 3MODH 1RZJL 3FFOA 3CVHL 1CICA 1UWYA 5LHDA 1M56B 4P49A 2WZ6A 4NO0D 2F19L 4H0HB 4ZS7L 2BWDA 4LMQI 4F8NA 1SMAA 3MV7A 2E27L 4Q56A 3S2CA 3O3EA 1MCKA 3OAZH 5TF0A 2H6PA 3S9DB 2AJUH 3L3IA 5DRXB 4OCRH 2D2OA 5EEUA 2BP0B 1L9NA 2A73A 3GBML 4F9PA 1G0XA 5AKSA 5CD3A 5LCVH 2WYZA 4TNVF 3CJJA 1QR4A 5IEKA 3LNGA 1FZJB 3GSQA 4CRPA 2A9AA 4F9LC 3KVDD 4B0MM 4YFLF 5E5MB 4NO2B 2PCYA 4NXSA 1M7DB 4Z3IA 1DJWA 5EIQA 1PY9A 4YFDB 4KROD 2CUIA 5FYKH 4G8GE 4EVNA 3KPRB 1JV5A 1SMDA 3D33A 3MO1B 4J3OF 3WMQA 5I1EL 1EAJA 1NL0L 1DQVA 2NCEA 3SYOA 1GAFL 3IWVA 1VESA 2AERT 1G7JB 1DJYA 3FUFA 2BVEA 1Q9LB 4BQBA 2VLKD 2UUDK 4JO8A 1QBAA 4IEFB 1MCOH 3CXDL 4JFZH 1BSIA 4OIIL 3MLSL 3GJFK 2I32A 4U6YA 5F88A 3RUGF 3EBIA 4D9LL 1BYNA 3LRGA 4YSPA 5IV2B 4OBSA 5MERA 1U8NA 3EJCA 1R33A 3NEOA 3OF6D 1D5XA 3MRRB 1PS3A 5TQ0L 4DT2A 2AXFB 3KBHE 5FHBH 3UTOA 1ZK9A 1ZS2A 3V0VA 1OSPH 4OR1A 5JMRA 3KPQB 1JZ2A 3NOIA 4WWOA 4KHXH 3BGAA 2QMKA 3MXWH 5C0EA 3ELQA 3ES6A 5CD5C 1HOCA 1I1YB 1JPEA 3RVXD 1EEYB 2M26A 3N50A 3HI5H 2NNCA 1EA9C 2DWTA 3C60B 2IOOA 5GIRA 3X14A 2O30A 3VSTA 2IV8A 4K7PL 3V6ZA 2UYLB 4HS3B 1AR2A 5HD8D 4BH8B 1VRSA 2PUQT 3W2DL 2R0LH 4G2AA 3T4AA 4CN4A 2JELL 2P5ED 2GBVA 3GI8L 3SYCA 4JFFA 2DLIA 1OEZW 3RJOA 3MRIA 3MBWB 4X8XA 5C0AD 1EHNA 4ZFGH 1F2QA 5JXEC 4X8GA 1DO6A 1DN0B 2WVSA 5KSBF 4Y2NA 1I4FB 3DUHA 4N8VB 3UG4A 4Z3GA 4X4ME 5DJ6B 3JWOH 1K6QH 2JTYA 2XDHA 1D6EB 1A02N 2DZEA 3VDCA 1BM3L 3MLXL 4QRBA 4AJWA 4L8CA 2HLAB 5D5MB 1JGDB 5JUEL 3NRPA 5K39A 4A6YH 3O3DB 4O5LH 2NX5E 3OX8B 1ZXKA 4MBOA 3Q8CA 1BXVA 1UQSA 4MZRA 4C83A 2JQZA 1W6LA 1AJ7L 1M57B 3FT4A 5EZIH 3VFRA 4WHTB 1MPAL 4KKQA 5TQ0H 3D4CA 3W9EA 5EZJA 3BAIA 3KPPA 3P73A 3D0VA 2WMPB 3RWDA 3U2JA 5A3ID 5GZOD 2EXYC 2XHNA 1QQDB 1BZ9B 3C5SA 4LCCC 4QRPB 1LD9B 4DUXA 1JZIA 1XD1A 1IKFH 5DQ9A 4L3ED 3SE8L 1UADC 1U2HA 2XZAH 3N41B 3QFJA 5D1QE 3IN0A 4G6ML 4I9XA 3R7QA 3KYNB 1J5CA 3KW7A 4JKMA 1F11A 1X5MA 4J5VA 5B1BB 4KMTL 3H7BB 5T3ZD 1IC5H 1MREH 1QSZA 3V6ZB 4IBVA 3D0LA 4NN6C 4AE0A 1EJ8A 2GSMB 2ESVB 2JXMB 4D0BB 3Q6FA 2VW7A 2RGSA 3VMPA 4H8QA 5HYJD 3APNA 2VXUH 1EEYA 5FLUA 4UUJA 2YBGA 5TGBB 4BKSC 1BIIB 2NUTB 4JCLA 3EIFA 1AE6L 4HS6B 1TZIA 2A9MH 4XC1H 3UYRH 2HKHL 3F64A 1DDTA 4FULA 4ONHA 4BINA 2BSEA 4HIQA 4NERA 4GQ9H 4HJUA 2DQGH 5D2NB 1O0VA 3KYAA 1TVBA 3IDXL 2WSPA 3JWDC 5DRWB 2BERA 1GTFA 1IGML 4M43H 4DKTA 5DD5L 5TE4H 4Z77A 2YWZA 5ID0B 4JM0A 3RL2B 2CCLA 3PHOB 4XNBA 4WGWB 2BSTA 4XNDA 4TRPH 1CXKA 4PJ7F 3PWJB 4LCVA 4TNWF 4BDVB 1CD1B 5AW9B 4X99A 5C9KA 1QYGL 4D0BA 3WMPA 3ILPA 5L2KB 4FCHA 2C4FU 1MY7A 2VLJD 1G0DA 3FCTB 1AR1C 1FI8C 3OM3B 4A39A 1BECA 1X5GA 3KLSA 4Y5VB 1RPQA 3FU0A 1IQDB 4ONGH 3AB0C 2UVFA 3GXMA 3N1GC 1RK0B 4F8PA 6TAAA 4JDEB 3QFDA 4ZSOB 3KPNA 1VCBC 3N44B 4DKEH 3EF7A 4CC1A 3K8KA 4CMHC 2HJLB 2ITDB 2D9CA 5E99L 4JRWA 2BP0A 5CD3B 4NX0A 3FT4B 2F5AH 4F33B 4YJZL 2P1YA 3U1SL 1QW8A 2WLZA 4MJID 3ZZ1A 4DK5A 3SZ6A 5HI5D 3OKKA 4KVNL 3FB8B 4I18B 3CC5A 3NZUA 1ORQB 5KW9L 4JX0A 3U79A 2V5SA 1UOWA 5FM5M 5D71H 5AOIA 4UQ3B 3VXQB 5J6GB 2AJSH 3GC3A 3U9PH 3IJEA 4ZFGL 4LIQE 2C3VB 4Q6KA 1IAIM 2XZCL 3QWRD 1U2YA 2NY6B 5IVXE 2XN1A 4FQLH 3WNLA 2CRMA 2X09A 1KTBA 4KK9C 4PWGA 4L8SA 1AC6A 3U0WL 1HE7A 1XGPA 3O6FD 4HOMA 3B2PA 3WNPA 1A5FH 2X4NB 1MLCA 4XWOC 2OPCA 3NN8B 4KGJA 3ZDZB 4N5ED 2KZ1B 3U82B 1YPZB 1IC4H 4G70B 1KOAA 2HT2C 2VISA 3BGMA 5GRWA 5ITFB 4EO5A 1TCRB 1D5MB 4PJAE 2FX8H 3B5HA 2DKSA 1AIZA 2OKMA 4HIHA 2WO2B 4U1LA 4E9XA 4LHJB 2WTRB 2BINA 1U8OA 5FO9B 3BKYL 1ZVNA 2WTOA 5LDUA 1GOHA 3O6KL 4EN3B 3IXAA 4G6MH 1FNHA 3MTXA 2IWEA 1A2YA 5CU9A 2ZP0T 1S6NA 1RULH 2IG2H 2ZUWA 3DBXB 3LVTA 1S9XB 4ABVA 1OPGL 4Z95H 3RGVD 1OKEA 1GZPA 3KPMA 3QHZH 4ONOA 1FNEA 1AXIB 1PNDA 3TT1L 3MYJB 5FW8A 5JLZA 2ZXDA 4Y16A 3VUAA 3FN0L 4B9GA 1YEKH 1T66D 2J56A 3RWJB 3JTTB 5FYJL 3ULVL 3TYFA 1A47A 4XPHH 1OAYH 5C9JB 4EI5A 2BFVL 3S8FB 1I1RA 1YNTF 4UCFA 2IPKA 2NLJB 5KYXB 3UPRB 5I8EB 4ICXA 1TVDA 3S4SG 4AYGA 4ERSL 4ZD3L 2JKRM 3VXMA 1HI6A 1WE5A 4QRRA 5JXAH 2VB5A 4PTUB 3OAUH 4XO9A 3EFDH 3O6ML 4Y7OC 3FB8A 1XB6A 1J88A 5C0AA 2LV4A 4GEIA 3IJSB 1P7QB 1X9LA 4JZJA 3TGXA 5EBWA 2YOCA 4Y8AA 2EH7L 4K9EL 2FRGP 1ACZA 4XPTL 3JWNG 4IHBA 5DI8B 3QUMH 2J4WL 5IFAH 3NCCB 4PI0A 3KNBB 4HF5H 1VF5C 4Q6YA 1AGBB 2Y7LA 3CBKB 5KVDL 3H2WA 1J0YA 2VITA 3AY4C 3LKRB 1NCWH 4JKNA 4XN9A 1AJ7H 4JKKA 4S0HA 1NUFA 3VQ2C 2XOTA 3H9HB 1LP9A 3HI6L 1ZVSB 2QGDA 4OIBA 2VAAB 3SZKC 5ALBH 3ESVF 2YJLA 2ISDA 3EG9A 1HSAB 2ZUVA 1RMFH 1J5HA 1B0WA 3JYCA 1PZAA 4AK1A 2O6EA 5AAMA 5K59E 5AG8A 3FQXB 3UJJH 4NN5C 3KCPA 5HJGA 3ESOA 3QFJD 1MUJA 1ROCA 3ETSA 3C6LD 4KZDH 2IWGA 2B9AA 1OXYA 3QI9D 2B3IA 3D9AH 1QW9A 4BXSV 3AS0A 3U0PA 3JYBA 1TVHA 2WZPA 1PKOA 5LBSL 3O8XB 4G5ZH 3NK4A 4NQDD 3EBGA 2IANA 4I3GA 1OAKH 3VI4E 3HI1B 3ESPA 2YXFA 4LP4A 5LCVL 2Z92A 3HLKA 5D4HA 1ADQL 5C92A 1VHPA 4FQHB 4R8WH 2CGZA 5I1GH 5M95B 5JQIB 1UACH 2VO5A 4IDLA 4L0PB 2XV3A 3OMZA 4LNRA 3ZE2E 1NCDH 1QEXA 2JJTA 1KLUB 3T0VA 3Q48A 3CK0L 2A6DA 3BUDA 6FABH 3UP6A 3CFKA 2DQDH 1S7VB 4KRPD 2BC4A 1HH6A 1A6AA 1SJMA 1XR9B 3B6SB 4MNGA 4RGNB 4R84A 4RSVA 4CDHA 5K9QI 1UCBL 4K3EH 5K9KB 2IDTA 4KZEL 1CGVA 1U9KA 4L1SA 4WENB 1V5JA 1DQTA 4ZOAA 4MZ2A 4P23C 5A2AA 1M7IA 1Y18B 1H6EA 2JSFA 2OS7A 3QJXA 4N8PA 4PRBB 4HAGA 1RK7A 4XOEA 5EZLA 1B2WL 2A6IB 4QO1B 5ACZA 3U36B 2F7RA 2NNAA 2AK4D 5C0JA 4QHKJ 4ESKA 1NWOA 3SE9H 5DT1L 4U1SB 2R23B 1LEIA 3SY0B 2ZQKA 1DFBL 2X4RB 3EFOB 4RFEA 5GZNC 2HUHA 4DFIA 4F37F 2D7NA 3O45A 4OZGA 1J10A 3HC3L 3IF1B 3MV9D 2HG5B 1NPUA 4DW2H 3RX8A 4PJ9D 5C6TL 3ZE0B 4OVVA 3OD3A 3HB3D 1XB8A 2BJMH 4PJEA 5TTRA 1FZKB 2H6OA 4Z5RB 5FO7A 5AOKA 3KCWA 2HPTA 3T8XA 2QTEA 2FCBA 5KYYA 1T7XA