3AQXA

Crystal structure of bombyx mori beta-grp/gnbp3 n-terminal domain with laminarihexaoses
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
101
structure length
101
Chain Sequence
b'SYEAPPATLEAIHPKGLRVSVPDEGFSLFAFHGKLNEEMEGLEAGHWSRDITKPKNGRWIFRDRNAALKIGDKIYFWTFVIKDGLGYRQDNGEWTVEGFVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-1,3-glucan-binding protein
molecule tags Sugar binding protein
source organism Bombyx mori
publication title Structural insights into recognition of triple-helical beta-glucans by an insect fungal receptor
pubmed doi rcsb
total genus 18
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2140 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3aqxA00
3AQZA 2KHAA 3AQYA 3AQXA 3IE4A 2RQEA
chains in the Genus database with same CATH superfamily
3O6ML 2NQCA 2O6FA 2P24B 3FFCD 1NLBL 3U7YL 2JKWA 1F45A 2PPEA 4XPAL 1U3YA 1YYLL 4KQ4L 4YHOH 2RAMA 2IDTA 4LLVB 4UT6A 4JM4H 4X8JA 2A1WL 3ULUE 1RUAH 3PDOA 4PW3A 3QQ4B 3TA3B 2DQHH 2UXFA 2FVNA 4NRYB 5DCCA 4U6YB 2XFXA 1N5YH 1LO4H 4QJ4B 2WN3A 4KJPC 4RWHA 1UXWA 2G2RB 2CKBL 3VXRE 4JG9A 3KBEA 3CBRA 3U48A 4R4BA 1KFAH 2H32A 3CD4A 4JY6A 3CDZA 4KGJA 5A16B 3FTUA 3CFJB 5I6MA 5F7WC 2V2TB 5ANMB 2WD0A 4LSTH 3WUWG 4AM0B 4FULA 3RGBA 4LCCB 4M9OA 3KVPA 4U3SB 4P5RA 3GLEA 1TYJA 3SPCA 2OMYA 2NY4D 2OQJB 2IDUA 5ALCL 4ZAKA 3M7FB 1Y6NR 3QFJA 1KSRA 3FBKA 3HI1A 5FYLL 1MJ8H 3ZPDA 3T4AB 5J12C 5IVXA 4CVWA 4OIFA 3QUYB 1DQML 2KQMA 4Q6YA 4NNPH 1FNSL 3OBAA 3QDGE 3KPMB 3WTTA 2QVKA 3KNBB 3NA4A 4L1TA 3W81A 3NJGA 1HDMB 2VC2H 2RD0A 2KDGA 2R29H 3OMIB 4OLVL 4OUUA 4G8EA 1ZXKA 4DFIA 1VACB 1YY8A 4X5QA 2KT6A 1XGQA 3TWCH 4L4TE 4DP6X 2P80D 1H5BC 2IALA 3QI9A 4IW4C 4R4FL 3KPNA 3QXAB 3EGXB 1Q9OA 4HS8H 4NJAH 1FLRH 4TSAL 2W65A 1J5OL 3CZFA 1PG7X 1R4XA 3L5WB 4I5BA 3DURA 1TSHA 1KBPA 1YG9A 3ILQD 3PWLB 1YHPA 1L5GB 4EAEA 1DDHA 5DVOA 2QQNL 2OXGA 4QRQA 1G1OA 3AREA 4GP8B 4MMXC 3U4EB 1XF5B 5I1IH 1MW2A 4F15B 4GAGL 4XMVA 3WN5B 2BOLA 3IN2A 4YH6A 3H9SE 5I16A 1WS8A 3GXDA 1TT6A 1BGXL 1U8CB 5T1KA 1KYUA 4L3ED 4N87A 3V6ZA 2WUBL 3HHRB 5LGJB 3VD0A 1A1MA 3SBPA 3K6IA 4AI7A 3MRQA 4JPIB 1INEH 4FF9A 4Q2ZA 1QQDA 1ZV2A 2MSPA 3OLGA 3N40F 5JMRA 5I1AA 3HS0C 2C9SA 4HJTA 1QSED 3TVMC 4DGVH 3QUML 4Z95H 3CFCH 2HKAA 4LASL 3VFGH 5EOTA 3UEQA 4W93A 1MWAB 3BCDA 3RZWA 3O8XD 2Z91A 5DJCA 2AGJH 3M17A 2EYRA 3DUSA 4IIQA 4NQDA 5ENWB 4ONGL 2GJ6A 1PLCA 4LQFH 3ISYA 4XNUH 3ZHLA 2EDYA 5TDOA 1DQQA 4PBDA 2HRHA 4J1UB 4UTAA 4HCFA 4K7PH 3PQYB 1K8DA 5T1MA 3NIGE 3WIIH 4P49A 4DK6A 3ARDD 5C08E 4XPHH 5HHVH 2R4RH 3D18A 3W39A 5GS0H 5KYXB 4OF3A 2DLEA 4S1SH 3MUGB 2V9QA 4X4ME 3RBGA 3ZK0A 2BSCA 2AJSL 3ZKSD 1AGDA 1KIPA 5DRZB 3N0AA 2AGJL 3WTVA 1EJFA 1FLTX 4LBAA 4X7CC 3VFGL 4A7GA 5H2BB 4LSQL 1FVCA 3RVVD 1VADB 5C0DB 4PJEE 1S7RA 4JFED 1KN4L 1SY6H 5B39G 2HKHH 3GTVA 1A6VL 5LWYH 3UYRL 5D2NA 1ACXA 2GTWA 2NNFA 1Z7JA 2APWA 4ONHA 5FLUA 1ECYA 5A2JH 4FQXB 1DVXA 4O2CB 5L0QB 1BXUA 1QVOB 2JE8A 5BZDB 2OX5A 4HJ0C 2R1WA 1BOGA 1PL3A 3UTPD 4PJAB 1MIML 1N6VA 4MA3B 2BY1A 4YHPB 5LBGA 2FHFA 4LCUB 4PREB 3NAAL 2UZIH 3H7LA 3N9GH 2G2PA 1FNSH 5F97E 1F0LA 3D09A 4AITA 5JA9A 3PE9A 4AGNA 1PG7W 5TPWH 2H4EA 2NT1A 3U0WH 1NFKA 1KXTA 3MRNA 4MXQC 3K4ZA 3MLZH 3UJTH 1MF2L 2ZXDA 3JXAA 3WE6B 1GH7A 1OY3B 4Q6IA 4P2OD 5CCHE 2WNGA 2ZXWB 3MV9E 3D4GA 1MNUH 1F86A 2FYYA 2NUTA 1CD8A 2XN2A 3ASOB 3TONA 1ZVSA 1AFVH 4EN2A 3JV5A 4TM9A 3DJRA 1DVZA 1G7PB 1YNLL 4V1DD 4XC3H 4FQ2L 3TVMD 3S97C 4JFYB 5FYLD 3B2DC 4PI0A 4AZ8B 4LLQA 5ILTL 5LUMA 3L4UA 1HINL 4JR9L 1J9CT 4E42B 3MO1B 3TS8A 3ARDC 4LRIC 3OC8A 1GMEA 1H5BA 2EYTB 4L37A 5AB0A 2I32A 3MKGA 3CFKA 3D87B 1A64A 3GJFB 3INUL 5DJXB 4MJIE 3G5VA 2JCCF 5I6KA 4Z7VE 1ZIAA 4K9EL 4YHNA 3LKPB 4GW1B 4KY2A 2BDNL 1TTCA 3MXVL 4W68A 1FBIL 4MSWA 3M17B 4NWTH 1V10A 1KY6A 2P5EA 4QRRE 4H26B 3T2NL 1QWHA 4KX7A 5CP7A 1KCUH 3RVVC 1J0IA 3TEUA 3L6FB 5B7EA 4IDLA 1MFAL 4PVMA 3MV7B 2E46A 3T6WA 4ODHL 2A83B 3AUWB 3WY2A 4NO0A 3DOSA 1FAIL 2IH3A 5DT1H 3QUKA 3V0FA 1U3JA 3BUYA 4EUPH 2JSFA 3DROB 5I1JH 2O6EA 4M7ZC 5DMJB 1AYOA 3H9ZA 3RYMA 2APSA 3M46A 4FHJA 4QHNB 4Y9CA 3STZA 2OI9B 2MOQA 2PTTB 5DEFB 3K46A 4Y8AA 4BRVA 4DJMA 1M3IA 2QLVB 3DTXA 4C58B 4PI2A 5AZUA 1TSRA 4UBDD 5IESL 3LZLA 1AGEA 5DD1H 3AU1A 5ICYA 3AS0A 5LGHL 2YMOA 5DDHB 4CMMB 3KH4A 4IK7A 3I9PA 3L3OB 2X2UA 3QRBA 5IT2H 4Q89A 3TBCA 1T20A 4BSWB 2V9UA 1BJ1H 3D0LB 4XCEA 5A2BA 1U8MB 1KPRA 4BUHA 4FEIA 4Z8FL 4P9MH 4ELMA 1FFTB 2AVFA 1OK8A 2MWCA 5DYFA 1BQ5A 4G6FD 3FL7A 3V95A 1CXHA 3QIWB 4K0OA 2ISDA 4B5EA 4HJJH 3KBHE 4LU5H 4XNMA 5A7BA 1NANH 1SXBA 2ADIA 4BE6A 5EO0B 2AV1A 4NUGL 4HJUA 3FDWA 5AW3B 4F7TB 3BP7B 2A73B 2OPCA 3H3KA 4TNFA 3FW6A 4PWEA 1FZMA 2XVKA 4WKZB 5C9JA 2E9JA 4Y9EA 3QPXL 3ZQ9A 4DQOL 1DN0A 4OKVB 3QEQB 5EO9A 1M7UA 3KXFB 4JANB 2DQDH 3ZDYE 2OA9A 1OTTC 3D39D 1URLA 1E4XI 5FUCE 4H8QA 5E6IB 1QAWA 3UTTB 3MRNB 4JFFA 2IH1A 4K3EH 3WN5C 3AADB 5IEKB 2DQ6A 1S9XA 1BF5A 1KTLA 4UMSA 1ED3B 3ABGA 2Y24A 2ETWA 1VFUA 2LU3A 3BYTA 4I3RL 2ZF8A 1TTFA 5AKVA 1FFPB 4NQCE 1U8PB 2XIBA 4NZUL 2HT3D 5JQ6H 3M7OA 3KWUA 4ZMVA 2RTTA 3U7WH 5KSBA 1TLMA 1MJ7H 2JNZA 3BP5B 3DXAD 3KPLA 5D1XA 4HXBH 3T2PA 4GAJH 5I1GH 4ZMYA 2LT9A 3II3A 5BOZG 2Q1EA 1QASA 2V17L 3BGAA 3THMH 5JR1H 1W15A 4DUVA 4YHZL 3RNQB 1QSEA 3BKYL 1BFVL 1PKQE 3G9AB 1AOZA 2EH7H 2H6UA 1SYVA 1KT2B 2NY2C 4R84A 4DHLA 4DO6A 4G6KL 4NQDD 1XF2A 2AS5M 4OCRH 4UM9D 4Z9KB 1RZGA 5EPMB 1IBGH 3P4NB 4AZUA 1RZIB 1ZWIB 4IRSB 2P52A 1VGEL 2HTLC 4PJFA 5EC1A 4LCWD 1AQMA 2CR0A 2HJFA 1HNYA 1FG2A 2FX9H 2QKIA 3SDCC 4OH2A 5CJQH 1EEYA 3EUUA 3MBXH 1DVFA 2E6JA 4K5PA 4U4BA 3P02A 1KACB 4UILL 1E27A 1NDMA 4DIXA 1MAJA 4FC3E 1ZT4B 4DP0X 3U2SB 4YPGB 1LP9B 2GITA 1SFDA 3F6JA 3Q1SH 5LO7A 1SOKA 3G6JF 3TP4A 4RSYA 4HPOL 3MJWA 4RBPK 3NN8A 1WBYB 1EAJA 1AKJA 3BZDA 3FQ2A 1MPAL 4QHUA 4MKMA 1CGVA 1FNAA 3BO8A 4KNUA 3L4CA 4JFFE 5DDHA 3PS6A 4KROC 5ADOL 2R69A 5I82A 5FK9B 2F61A 1CDBA 2DQCL 2JKNA 2KC0A 3D6GA 4ZZKA 5GS1B 5J9PA 1CLVA 1X4XA 3DO7B 2DQMA 2HJLB 3G6DL 4Z7VB 2A9NL 5DD5H 3DX1A 4GKZA 5LG1A 4FFZH 2CLZA 4POZC 4W6XB 4Y2DD 3ZMNA 1I8KA 4C4UA 5FUZL 4EIUA 3TBWA 4ZW3A 1S78D 2NXZC 1MW3A 1AE6L 3VH8G 3TWYA 3WBDA 5FM4A 5DJAA 3LKQA 4XCNA 2RFXB 5BXFB 3HVNA 3QDGB 3HN8A 2F7RA 2IOOA 4UV4L 5IBUG 4Y5XC 3Q5YA 2DH3A 1J0HA 2BH0A 1GOGA 2OBGA 3RX8A 1G84A 5JOFB 2GEEA 5FA3A 1TOXA 1TZHB 2V5SA 5I9QC 1BVLA 4N3TA 4LSQH 1WTLA 2J6EA 3MV9D 1OP5K 2HUHA 2E5EA 4JE0A 4LQFL 3U1PA 4CVUA 4DKFL 1HXMA 1GJUA 4AEHL 5ADPH 3VFPB 5EU7E 3SQBA 3V5DB 5LN8A 4YIQA 4KJYA 1XH0A 1TVDA 4KWUA 4HIXL 4K8RH 4KV5E 4WTWA 3T3ME 3UACA 2EYSB 1NUFA 3S5YA 1SEQL 3BEVA 2MRYA 1MCRA 4OM0L 5DZOA 5M95B 4QTHB 4M5ZL 1JOIA 2YMTA 3TVMA 2B7DT 3QDME 4XXDA 4A68A 5EU6A 2EVFA 2FWLB 1KLUA 1UJ3C 3MR9B 2VO8A 3EO0A 3W2DH 1YYML 5CEZE 1SLWA 5F0MB 4GUQA 2NTFA 1G7JA 4LEXL 4JFEE 3UIZA 3UJJH 1MLBA 2NYZA 3HRZA 3L3IB 2R51A 3LPPA 4HJ1A 4OFIA 4E36A 3O6LL 2VLJB 1PNCA 5IOPB 1ZHBA 4LGPB 1LQBC 2CG9X 4ADIA 3QIUA 4OFKA 4X0NA 4IKNA 3U0TA 4RFNC 1ZEAL 1P2CB 1U9KA 2BP0B 3APMA 1YDPA 3T65B 1XIWC 3MRCA 3ZDYB 3OKLA 3FH8A 4UM9B 3CU7A 5EZIL 1MZYA 1EH9A 4Z7NB 4TMPA 1D6EA 4GAGH 3GMQA 2VLRB 5DXWA 5F2FA 1TTAA 4WI8A 1YNLH 3NSCA 4PJ7A 4JHAH 4MDRA 4WKXA 1S3KL 3QIUD 4NNPL 2J43A 4Z3GA 4M7ZB 4GMTH 4Y2OA 4K94H 2I07B 5FIEA 3HPJA 4MYWB 1Y6MR 1QUNB 1IGFH 3BN9D 4GXVL 5I26A 5C70A 5C07E 5ILTH 4NNYA 3TZVD 2DQFA 4WWID 2KZWA 2X4QA 2VDPB 3RX5A 4AYID 5CBEB 1AKJB 3LKNA 5L8LB 1J9RA 2GG1A 3GXPA 5DJDB 4OFVA 2BVTA 1A4JB 4UINH 3VG0L 1AZVA 2P7TA 4DUXA 5BMFH 3BSGA 3KL5A 3LRSB 3PWVB 4FZ8H 1XGTA 5J89A 5BUPA 1S7VA 5DHYB 1RJZA 2OMUB 2D7TH 3U4BL 3I6GA 2Z92B 4EUPG 1C5CL 2E47A 2G4EA 4LRNH 4HG4K 1OP5H 1K5WA 3OKEA 2QTVA 2WSPA 2ICCA 4WWPA 4HUVB 2VQ4A 2CLZB 4FYSA 1XSJA 2I9TB 4DEPC 1UH3A 1OGPA 3JWOC 2IG2L 5AENA 1R3JB 1YEKH 4X4YB 1V5JA 1R3IH 4HT1L 5DUBB 2DYPB 5BXFA 3KD4A 4JZNA 1I7UB 4C56A 4LP8A 3V4VB 2DQEH 3MNZA 4X98A 5CXPA 4PJBE 4FYTA 3GSQA 4YE4H 4CADB 2IAMB 1IEAA 2QZ5A 1Y1UA 2XWTB 4P5TA 1FFQA 4NKQB 4XHJD 3IDXL 1EUTA 4R7DA 5EFIA 4M4RA 2NUPB 4MMXB 3O3AA 2YRZA 1TF4A 1DFXA 2P48B 5B4MC 2E86A 2EZ0D 4D9RD 3BQUD 2WQRA 2K3TA 4N8VB 1OHZA 1SVBA 1WGVA 4KDTC 4HJIA 3VFMA 5EOCH 3K74B 4NAMA 4D9LH 3K8KA 2WK2A 1QFUH 1HX0A 3GRWL 3TBVB 4PJFE 4J23A 3I50H 1F56A 4EZJA 1T2XA 1AXSA 3ORJA 5IMOB 4OF7A 4OJYA 2BNRD 2ZUXA 4P4KD 4KH2A 2X4TA 3BPOC 1V7MH 5HHNB 3GWJA 3VWJB 3BP6A 4MCYA 4DF9A 3MLRL 1RZJL 2GY5A 3ENEA 3MLTB 3QZWG 4M7LL 4MJ2A 4UT9L 3LX9A 4X6EA 4YBQD 4ZOCA 5DLML 3ZDZE 3CC5A 2ESVE 3VI3A 3X14B 3R8BB 3CXDH 1U3HC 2N0MA 2VLJE 3SHSA 4XB8A 5JIDA 4YSCA 3ILPB 4U31A 4ZFZA 5F71A 3B3IA 3FTSA 5IREA 5T1LD 3ARBD 1R3KA 4W4OC 2JCCA 1I1YB 5F3FA 3T65A 1CFNA 3CZGA 2YAOA 5E2VL 3QUMA 1BMWA 2PTUA 4M1CC 4ZW5A 2BS8A 2B2XH 3S37H 3ARTA 3IMTA 4TF4A 1FH2A 1N0XH 5D5MB 3Q44A 4HKXB 1OEZW 3ZZSA 4F2EA 2DTMH 1QSVA 5CCJA 1Z32X 1FN4B 3GI8L 4PJXE 3F6IA 3OLIA 2X41A 4KK8C 3MLRH 4M7LH 3SDAA 5HYSG 2F68X 2AVGA 2HTLD 4G3YL 2AEOA 3KLAB 3PAYA 5I1JL 4XMPL 5CP3H 4JO2H 3RPIB 3FQUA 2OL3A 5HP5A 4L29A 4MAUL 4N5UA 3FRPA 3FTWA 4FA6A 1QEWA 1TZOA 2G9HB 2PPFA 1N6QL 1KYAA 3L5XL 2C1OB 3LVTA 4MXWH 3K71A 3WKMH 1YEDA 4I9WE 1AKJD 3K91A 2EKSB 1FFNA 3EG9B 5E6UB 3RI5K 4IRZA 3PJNA 5IW1A 1JZEA 5FFLA 5GGUB 2GPZA 1MJJB 4OZFH 2DQUH 2ZOLB 3AMKA 4ILDA 4FFZL 2K6WA 3N85L 4ZX6A 3QO1A 1N0LB 5LCVH 1TG8A 4N68A 1ZSDB 2QKSA 1OAXH 2MOGA 4E41E 1OCZB 3VXTB 2VYRE 5B22A 3WNOA 5ID1A 2CO6A 3EW3B 4NHUB 2A6IB 4J8RB 4AK1A 3LQZA 5IHBA 3FO1A 4XBEH 2N56A 3MJ8A 4XGZA 2FUTA 1J5IA 3AACA 4Y5XB 3VXNA 1OANA 1SGKA 4Z3JA 2JI3A 4F7CA 5K9JH 5HYQA 2V3FA 2CDEB 4FNLL 4E9TA 3RKDD 4F9LC 3B1TA 5DHVA 3L4YA 1UOWA 1MJ8L 4CADA 3QS3A 3LEXA 3WS6A 4J6IA 3K6OA 4L4JA 1F90L 5I8KH 2DS4A 1MI5B 2LTQC 3CFBA 4GRWB 5LHDA 1Q0YH 2KDYA 3U7AA 2XIDA 3PGCA 4LHUB 3RRQA 2R1YA 1RHHA 4K23H 3FJTA 3AS2A 3SIKA 1VF5C 3MLWL 1JPFB 4R5TA 1MHHB 5GGSB 1A7QH 1ZVHA 2BNUA 5F7MC 2K7PA 4J4PD 3MBXL 4OF6A 3VU1A 3L3KB 2X6VA 3VAEA 5B38A 3B8YA 5ES4B 1TQBB 3ARBC 3R0NA 4P2OB 3VI4A 5J6HB 5EEZA 1HZHH 3MYZA 3RI5F 5MI0C 1VHPA 3EH3B 3QORD 4N1EA 3NAAH 4B41A 1AXSB 5IMOA 4JFSA 3ESPA 2IPUK 2YKLH 4XOBA 5DRWB 3MRQB 3IGAB 3RAJH 1P4BH 4KZ0A 1S9KC 4PJ8B 4Q7DA 1QTYT 4HAKA 1T0OA 5DRNA 1I3GL 1ORSA 1BZ9B 3MRIB 4N8PA 1V3LA 2XPYA 1RLWA 3KW8A 1UFUA 1OTSC 2WHVA 3HAEH 4KI5D 4ZFZB 1J9TA 1K9TA 5D1ZI 3DKHA 4XPAH 4IGBD 4HIJB 4AT6B 4U3HA 5TDOB 1R3KB 3GSNH 4WSKA 1QABA 1GYCA 1T22A 1KZQA 1E4XL 1CLOH 3QIBC 1SJEA 1CICA 5DJ6B 2CSPA 1SEBA 4HKXA 2DM4A 1I9JH 1JMXA 4GUPA 4Q4IA 3GM8A 1I1FA 3W1ZA 4G9DA 1K8IA 3BAYA 3P2BA 3JTSB 4W4NA 5JYLA 4NPYA 3VWKD 5CZKA 5JIMA 3HC0A 1QRND 3HG1A 1K2DA 1NGYB 4YDVA 5E6YA 1PIGA 4FZEH 2AP2A 2MHAA 3AG4B 4JFZL 1F6LL 5MHSE 3C6SA 2EDBA 2QV4A 3A6OA 3F65A 1PMYA 3WEXA 3O9WA 5DK0B 2D0GA 5ANME 3H9SB 1BQSA 1D5ZA 3BT0A 4PJ5B 3BEWB 3QCTL 3QG7L 5E0FA 4HWEL 1BPVA 4L9LA 4XR8C 2WLLB 1FORL 3MOAH 3FT3B 2D73A 3D0AA 5GJTL 1IM3D 4BK4A 3EG9A 3FC8A 1T83C 2COVD 4NNXB 5DJ0B 1TUPA 3MV8D 4KKAD 4EVNA 1SXSA 4FZEL 4AX3A 1B88A 4R26H 5HI3C 3D39E 2X10A 4ADJA 1T5XB 2B8OT 3C6LB 1IZKA 1PSKL 1NBVL 3DJTA 3OPZH 2DPKA 1KCRL 3M07A 5EU6E 1Q90A 1WYJA 2CO6B 2QLYA 4NBXB 4PJAE 3IJSB 3T04D 2NY7H 4KV5F 3T3MF 4CBZA 4B60A 4MD0B 1DEDA 1MCLA 1OSYA 1P5VB 3ARGD 3KE0A 5CMAB 3VXUD 3N2JA 1CBVL 5I1KH 2WXJA 2XG4A 3IDIB 1R3HA 1CYXA 1N59B 4UM8B 1CMOA 5DZNA 2WWMD 4MS8C 1IKFH 3DK2A 3I74A 1LNUB 5T5FH 3QJZA 2DWDB 4LESA 2OCJA 1QSZA 3MRFB 1C16B 3X3FL 5SX5H 5BO1H 5KSVB 1QRKA 2XETA 5MEQB 1NCWH 4HW6A 3MX0B 3ULVF 5C6TH 5EF1A 3HE7D 5D9SA 3TT3H 4RGOH 4E2OA 3NP3A 5IVXF 2LHAA 1RIVL 1X5IA 3ARWA 3B7UX 4RAHA 4EO5A 2GUYA 2JQAA 3VSTA 5HTSA 2KH2B 3L4VA 1BZ7B 1HU8A 1XTLA 5EN3A 3ZW3A 4BH7A 4BKLA 1OIOA 2EIJB 1T66C 3HKZA 2ZKHL 4YNYB 4IBUA 4YAQA 4NDMA 3KDMA 5TF1L 4YSRA 5H94B 3MXWH 4X80L 3O6FD 3A4EA 3BXNB 5C0CA 2OZ4A 3PJLA 5SWQA 5IJBC 2OYKA 2J1ZA 3NSDA 1HQ4B 4P0DA 5D2LF 4N4YB 5LXGH 3DI3B 1H0DA 4MJIB 2OSLB 4QRUB 5IWLC 4HWBA 4I5BB 5IEHB 1MNUL 1R5VB 5F7AA 1VKXB 4JFUA 4P4KA 1E5ZA 4E5XB 3DUUB 1UB5A 5FO2A 4XVJH 3LKPA 4GW1A 2F7IA 4JRLA 3WXWL 1D7FA 3JYCA 4BH8B 2LR4A 2ZICA 1RERA 1HHGA 4A6YL 2P5EB 4URKA 4HKZA 5HHOA 4M6NL 2X09A 3SGKC 1L0XA 4L23A 1S5HA 3G6JE 4QT5A 3N43F 1VCBC 3K5RA 4GIPD 2ZUYA 1PVHA 2X4SA 3TN0B 4XMLH 2V3EA 2OR9H 1DZBA 1T22B 4NZUH 3S4SG 1DO6A 2P80A 3QI9D 3COOA 5D7KE 3MV01 2AW2A 3NFPB 1XGYH 4P2QE 4P2YA 1JZFA 5CJXC 2E75C 1NOAA 3MN8A 4YVNA 5A2AA 1WTGT 3FFDA 3ARZA 5CJOH 3SBQA 5BVPH 1J8HE 3X11A 2PCYA 4Y9GA 4A37A 2JJSC 1VCAA 1QATA 3MA7B 2Y1ZA 2WGNB 4JM2F 3F7QA 4QRSB 4EBQL 1J0ZA 2C26A 4ZTOL 3FZUD 1UOVA 3HR5B 2YD9A 4J1UA 1S9WA 2OK0H 4MDJB 2LVEA 1EXGA 4HDIB 2WYZA 3BDYL 4X8CA 2JKJA 2VMJA 4L1BA 4QEGA 4AMXA 3QNXB 2FR4A 4DP5X 4L8SB 1FHGA 4EQ2A 5IB3B 5KYXA 3V0AC 3T6XA 4GBXC 3WD5H 4Y8DC 1OE3A 2GAZB 4M8QA 1KIUB 3FS9A 2CIKB 2V2XB 1ZD6A 4G9FB 3EGSA 2FLMA 1S5IH 3AS3A 5FA4A 1B9ZA 4XC1H 5GIRA 4KO6A 1DLFL 4P3WA 3TCLA 5HPOA 5D70H 1NFDB 2CWRA 3E8UL 4OM1L 5C0IA 3UJJL 3RY6C 1XD1A 3FZUC 3ZZLA 2GKIA 2H2PC 4OT1L 3TFBA 4F7TA 1A6UH 4U1IB 3C5XA 4RSVA 4L4TA 1EXUA 2KYIA 3CMOH 4D9QD 5DA0B 4YE0A 1DN0B 4A2LA 4LSUL 5F44A 4Y2NA 1FSKB 5EV7A 5F1NB 5TF0A 4H0IA 4J3XA 4O2CA 1X9QA 2JFCA 3QDGD 4JK0D 1F58H 1GZHA 1S46A 1B3IA 2QPSA 2Z9TA 1S9XB 3RB5A 2GSIA 4N8VG 5F7FA 3EYQD 1JD7A 4G6ML 4GYBA 4KKCD 3RZCA 1L9SA 2ICEA 4KK9C 4ZMZA 1PCSA 1OAUL 4NQUA 1CL7I 4XCCL 5HYSB 1IQWL 4KUCD 4O02L 3C5JB 3IM1A 5BRPA 3FT2A 1AGCB 1FVEA 1DBJH 2BSTA 5I5RA 5MI0B 5JIPA 1ZVYA 4QO1A 2MJWA 4HMDA 5JQIB 3F3HA 2BFVL 3VXMB 4XTRD 4M7KH 5B21A 4RFOL 3BSZH 2K8QA 1IGIH 2A6KA 3MTXA 2NX5D 2ALWA 4WRLA 1XBDA 3TBYA 3RZCD 2YXVA 4IRJA 4F2MA 4XP4L 4EJ1C 3BN9C 3N06B 4G8GA 1HL4A 2L3BA 3H2WA 1MEXH 1G7PA 4W70A 3ATAA 4J6RL 4KUZL 4L3EE 4O2EB 5I19L 4YZWA 3SOBH 5KUMA 2PWEA 4WSJA 4K7FA 2YUZA 1YN6A 2B20A 2WKGA 1QSFE 2ZCZA 1I7TA 4ZXBC 4JQVA 3FT4A 4FYQA 3SSGA 2YRLA 2FX8L 2HLFD 2YARA 3GM0A 1P6AB 1JK8A 3D1MC 4MASA 2WXOA 4MQ7A 2NW2B 1ZLVK 4FGMA 2BNQB 1TYEB 5JUEL 3V5HA 3ROLB 3REWA 2QADD 3V4PB 4PS3A 4MCZA 1CZ8L 3FYEB 4WDIB 4YPGA 1N2RA 1JHTB 1AGBB 3L3GB 2VL4A 5F8RC 1RUQH 2F8IA 3IPEA 3I84A 4IJ3B 3D2UB 5CSBA 4NAJA 2K9FB 3HAEG 2F7QA 4HUNB 5JOEA 2X12A 3LZPA 4OJCA 4MDJA 4PG2C 3DVGB 4UQDA 5AWNH 2PP9A 1RZ8A 3OGOE 4O2FB 4WWKB 5KJRH 3MTRA 2ZCLH 5I15H 2UWEF 3TZVB 1EHLH 4G1MA 2O5YH 1B4RA 3POHA 2VRQA 3U46A 2XRAH 4XMWA 3II1A 2H26A 3FUDA 3K2IA 4OB5H 3IJEA 5AB9A 2EIBA 5IQ9A 4ELKB 1AYRA 2Q2LA 4MZRA 2DD8L 3VXPA 5HSFA 2AEQL 1P4IH 3GSVB 5IM7B 1A1NA 5IF0B 4B9CA 3IKCB 4OUOA 3L2MA 3T0EC 3L2LA 3CIAA 4OLZL 3NDYE 5LN4A 3H0TB 1YMHB 1MCEA 2X7LB 2J88L 2X40A 3IAPA 4FQIH 4PJ9A 3TF7C 4FQLH 3HHSA 5TE4L 1C5DB 2AXGB 3CVIH 3B43A 4OW6A 3RWDB 4W6YB 1TZHA 2ADJB 4OB5L 5EIIA 2YSTA 4TPRL 3DHMA 1CFTB 2ZXEB 5F1NA 3VD4A 5K39A 4D3CL 3CQPA 2OCCB 4CA4A 2AV1B 3I6KA 1FL6B 5CHNB 5JMOC 2CO3A 3O6MH 4HSCX 5IMLA 4LEBA 3QEHA 2Z1PA 3TEWA 4JFPA 3OJDB 4W9EC 4JM2A 2DZEA 1ITCA 2BCKB 3C12A 1XCWA 1OAKH 1PX8A 2IAND 3FTGB 1IMHC 2FJGA 5DZ9A 3DX7A 2BSTB 3VD3A 4LLUA 4H8HA 3ZMEA 5F89B 4N2EA 3MI6A 2XFGB 4U2ZA 5HYFA 1ZV9A 2FIRT 3SDYL 2ZKYA 2ITFA 1SEQH 3KYAA 5D7IA 3HLAA 4WSGA 1BWMA 3Q2VA 4WHTB 4UU9B 4HJJL 2AXFA 4NN6B 5D1QC 3WUZA 4ZMAT 1E28A 3VXSD 4ZD3L 1K5NA 1XH3A 2IDQA 1JGLH 1KELL 5KS9E 3ME0B 1P2CA 1WUZA 5IGXH 3ARFD 3HJEA 4PCYA 2H3XC 1XCTB 2R8SL 1PZ5A 2AHIA 2VCOA 3UP1A 4U1HB 4BDVB 1FNGA 1YEGH 1GGBL 3BWUF 5D2LA 3RNQA 2VLRE 1JRHH 4JKKA 3TYFB 3BAXA 4NKDB 4PGJA 2VIRB 4HUKB 4KPHH 5J06A 4UB0L 2X9WA 4N6RB 2V5TA 3L9BA 3PXHA 3Q3GA 2KERA 1LK3L 2E7HA 4FABL 2E7CA 1WFIA 2YD7A 1I9RL 1DJWA 2CA4A 2DQFB 2FX7L 3ABZA 3CGTA 3CUPB 4OCSH 4RVBA 4XBGA 1GKEA 1RSFA 2XPGA 3OD3A 3LKSA 5CJ5A 3BZFB 4HUWB 2QKIB 2QSTA 4U0RB 1RJLB 1S7WA 2E7MA 4JFXB 2IWGA 4O2FA 1HZLA 2WXRA 3N1PC 4TLUA 5TH2A 5DC2A 3X17A 2CQVA 4M8RA 1ZLWH 1RVFH 5E8PB 1U8LA 3KYKH 1M3JA 4HJEA 2YHGA 1P7QA 5DO8A 1UCBL 1XBRA 4KTDH 4ZPVA 3Q5OA 5FB8A 1I9EA 2PETA 3UL4A 4ALAH 2R1XB 1A3ZA 3FB7A 4GI9A 1A6UL 5C0BE 2VDNB 3ECVA 4PD4K 5JW3L 1ZHLA 2F5AH 1MQ8A 4N0CD 3RU8L 2BSSB 5F7DB 1AGFA 2XN9D 1KJ3H 4Q9QL 4GW4A 1GJWA 3UTTD 3QA3B 2EC8A 1O6SA 1WCQA 4MNQB 3MLVL 4P5KA 3EOBB 3MNZB 1F1GA 2XIIA 2F53D 5J6GA 4G8EB 3HBGA 2BK8A 2D7MA 1C5CH 1QR1A 2FBJL 2VXSH 4NLAA 3WLBA 1CZ8H 4K9EC 2CLVA 2YPLB 1IUZA 1Q72H 1MWAH 1I8IA 1TCRB 4A04A 3DETD 3VGDA 4JJOA 3RGVD 1MFBH 3GB7B 2R2BA 4DP2X 5SWZE 4DERA 2OMNA 4U6YA 1ZOXA 3U4EA 4AKQA 4JM2B 1TO5A 1HIMH 4PEEA 4LSRL 5C0RL 2HFFB 4R5XA 6FABL 4MMZA 4GXVH 5AAPA 3DX7B 4HWNA 5KVEH 3NJMA 5ANMA 1WBZA 3SDAC 1I3GH 3BIKB 3U1QA 4EQ3A 5I5IA 1FVDA 4DKAA 4UQ3A 1FQ9C 4ACPA 1ZLSL 2W95A 3BRGC 3S37X 3OAYH 4GFXA 4PJHA 1G1YA 3RIAF 3ELAT 1U8HB 1BIHA 4GLRI 4MNGA 5EORL 2IDFA 2Q8AL 5I75C 5JW4N 1NIFA 3HG1E 4WZ9A 2ZUUA 5KYUA 3LDBB 4GAAA 2AQ3A 2XZAL 3LB6C 4L0YA 5DQ9A 1Y6KR 3IMVA 2DMHA 1A6PA 1U58A 2CJUL 3N41B 3W5MA 3PV6A 3AVEA 3RDTB 2QGBA 4BXVA 1U95A 3O2VL 1KN2H 3MRPB 4X42A 3CSGA 1OAUH 3W57A 3QXDB 4AQOA 5IOPA 1VACA 1YY8B 5KSUB 4NUMA 4RZKA 1EERB 1U8JA 1HHIA 1AOHA 4R90H 1WV7T 5AOLA 4ZUTB 5LXGL 1XSKA 4MQSB 3D3VE 3LN4A 4OIAA 2D9CA 3CZKA 4KRPC 5CR1A 1UJTA 3U79A 4PJCB 1AMYA 2W65B 3SQOH 4PJGF 3NBNA 4KI5F 4NN7B 2OSYA 2RACA 4YXKL 1GGTA 5DO2D 1L6ZA 1S7TA 3FQRB 3MJGX 1S8DA 3A23A 4N2BA 1U8QA 5KVGE 2V7NB 4NC0B 1JF5A 1FH5L 2ARWA 4LARL 5EEWA 1B2WL 2HWZH 2CA3A 1JZ4A 1U8IA 4U2YA 1QRNB 3K71B 4L8CA 3DSNB 4PJAF 4TVPL 3GZQA 2UZPA 1Z2KA 1IEBB 1YEDB 4OSUH 3KMDA 4HZLB 4B3EA 1G7IB 3IXAA 5FYJH 3BUTA 5E6SB 3H2QA 1SUJA 2QPFA 3OMAB 1T3FB 3RNKB 1H8NA 3P2TA 2HT4C 4PJ5D 4NNYB 1NJ9A 4ZO9A 3WTUA 3O9WD 3LZNA 1BBJB 3EJQA 1GW0A 4MA7L 5TK4A 2WVVA 4DP7X 5IR1A 3X1GA 1NC4B 4J4PC 1F3DJ 5KSAB 3KVDD 2V5MA 1OGAE 2OMWA 1GGCL 1AGFB 1UXMA 3DETC 4GY4A 5IFJA 1BEXA 2Y2WA 3QS2A 5DK2B 2X2JA 4FQHA 4F33A 3MRRA 4TS6A 4CUCA 3VWJC 3NCJL 4MS6A 4XP1L 3TIDB 3EOYG 1NM9A 4N9OB 3AAZA 2NY6C 2F54A 4N90D 5BQ7B 1M1SA 3HI1B 1YY9D 2H8PB 4FG4A 2R0LH 4FAAB 3ML9A 5GJTH 1MFMA 2YWYA 4WI2A 2W9EL 3BI9X 2HT4D 3QUYA 4P23C 4RETB 1U8NB 3P4MA 2DWSA 4M8VA 3N55A 3UCRA 4MNHB 2X4NA 3O3BB 3ARUA 3P9LB 2R29L 5TF1H 4ZYKB 2HFFA 2FECI 3HE7B 3OKMB 4KRLB 5IMKB 1JCVA 2ESVB 2WZAA 3D69B 1A3LH 1KV7A 1TETH 2JK5B 4BBWA 4KXCA 3IDJB 4A2MA 3BN3B 5I18L 4HSAC 3EYQC 2B9AA 4IKLA 1G0DA 2WINA 4M1DL 3KPQB 3BUIA 2H2SC 3U6XA 3WO4C 1JWMA 2ZYSA 3LXAA 2OCFD 1WVZA 3S5LG 3V0VB 2FGWH 3BWAA 4YSAA 2JI1A 3V4UH 2EACA 2ZOKB 4BM7A 1ZHNA 1NM4A 4LDCA 1WF5A 1SQ2N 2FZ3A 1WZKA 1QD0A 3E6HA 3GRWA 4J2XA 3CN0A 1IC0A 1OT4A 3K72A 1COBA 3M8OH 2WZPD 4XOAA 5CF3A 4NKMA 2D03H 1SJEB 2P5WA 1JPSL 3LCYA 4AVJA 1VRSA 4JDZB 4EKJA 4XO4A 3OX8A 1D9KB 2R2HA 5MENB 4PG2A 3WJMA 1WBXA 3II2A 4MB4A 3EZ8A 2P42B 2XWEA 4HF5L 4PJCA 5I1EH 1JF1B 1PAMA 4L8BB 5DGQA 1EVUA 1CU4H 2MQ3A 4JS7A 1BAWA 3N44F 2QQKL 1U8QB 3DTXB 1WZ1L 2EDNA 1ASQA 2ZUQC 3Q2CA 1CIDA 2CJSA 4H8WL 1UT1A 3DO4A 5ABDE 4XB3A 2Z93A 1UM5H 4OCWL 3TJPA 5CN3A 4IOIA 1EZVY 5A2IH 4ZXBA 4I89A 4GINA 1BYPA 2BOBA 3QJUB 3LKOB 3N1MC 4PLNC 2W9DL 3L3DB 3H54A 3UGEA 4I48B 2ZONA 3BPOB 1JHLH 4XVUC 4A6YA 1P7KA 3KPSA 4QGYA 1CPUA 2WY3B 4M48L 3ZVVA 1H15B 4Y1TA 5JDSA 4DKDC 3MCLH 4LP4A 5DEGB 1JPGB 4DO5A 1A25A 1EBPA 5KVFH 4G1EB 2DDQH 2ZWSA 2OAAA 1T1ZA 2PCPB 4FMVA 4JB9L 5C0DA 1OOAA 1Q0XL 2IOMA 4DETA 4IBWA 3MV7E 5AW4B 1BFSA 2BZ7A 2FO8A 3V7MA 2VH5L 5I1HL 1ZA6B 2F53E 4HFUH 3L9YA 5FKAA 5C9JB 4B9ZA 5IW1B 5E9DD 4XPGL 4Y4HC 1NC4D 1S2EA 4EI5D 4AJYV 1EZLA 2BVQA 5TK2A 4GSQA 5IJVA 3CLEH 4OZFG 1CG9A 1C12A 2EO9A 2H9GB 1FZJB 3P0YL 4PH8A 1TNMA 3C60B 1E9QA 3AU0A 3NCMA 2DL2A 5E1GA 5J57B 4R7XA 3SY0B 5L4JA 5HGGS 1E7UA 3RQ3A 1A14L 2DTSA 3EBGA 5GGVY 5I8EB 3IDYB 4ZMQA 1P4BL 2PTTA 3JYBA 3Q6GH 3TLRA 4KK5C 4PV9B 1G6RL 5JHMA 2N7SA 4RAUA 4KZCA 5TDPA 2EE6A 2HN7A 2ZNWA 4ZFGH 5BV7L 4MDIA 1KMGA 1RURL 5DWPA 4HWBL 1JZHA 3QHFL 3SOBL 2BZCA 3L3OA 4NQVA 4OLYL 4TV3A 1DBBH 4YAQB 4F92B 2PR4L 2BX5A 4F8OA 5IJKA 3L9RA 4QYAA 2GBUA 2Y0SA 4XCEB 3KLKA 2HX8A 2VLLA 3QEGL 3UG3A 2VITB 1VJSA 4FX5A 4BFKA 4LLMA 4MZIA 3OAZK 1MCSA 4HYTB 2E7LC 1JGVH 1H8OA 1U91A 4XOEA 2WIIB 2ZAGA 4F2FA 1A3LL 4E5XA 3QJFA 5E4IA 2C3VB 3Q8BA 3QH3A 5JTWA 4Z7IA 4JO4L 3A0OA 2XTSA 5BV7H 3P4NA 4OGXL 1I4FA 4CN1A 4E9VA 4HIIA 2V37A 2OJEA 2NPLX 1S5HB 5J3HC 3SE6A 2FZ3B 4FNLH 3SN6N 2WZ0A 1H3PL 2CUAA 3O4LA 4LCCC 4K9EH 4O4YL 3VSQA 8FABA 4DTGH 2ADFH 5E1AB 5AVQB 2EUWA 1N7ML 1U6AH 3CFKB 1K3IA 4H20L 3RTQC 1O7DE 4PU2A 4UQEA 2VT0A 4Q14A 1ZDSA 3OX8B 3GF8A 4K23L 1YJDC 3SDYH 3T77B 5I1DB 1IM9A 3HRPA 4U6XA 2R2HB 4ZOEA 4TL5A 3T1FB 3SGJC 3WY1A 4WK2B 2Q2EB 5JPNB 4JQXA 1LD9A 3BOVA 1XO8A 4JKMA 1ED3A 1SMDA 4POZD 4LIQE 4Y2DC 2DIAA 3ZSTA 2KMWA 4OQ1A 3M1OA 3TASA 4HG4J 5F6IC 1NAMA 2ZSVB 3SPJA 4QHUB 1H3VA 2Y1AA 3WTSA 3RPKA 1ES0B 2J6EL 2VUKA 2YRBA 3IFPA 3MLXL 4WHCA 3IBOA 4K3HA 4HVBA 1BZOA 1OAZH 5D7LB 5DJZA 3VB8A 4GAFB 3BP5A 4F57H 3MRDB 4IBYA 4Y4HD 5I76B 5AB2A 1MIEH 3BRDA 3DO3A 4ZNEE 3OG6B 4I48A 4IHOB 1EIBA 3KEHA 2H47C 2ED9A 1HILA 3SDXF 4GQ9H 5GGQH 1IL1A 2OXHA 2YD1A 2W9DH 4WWKD 1IBBA 2A3TA 2A4ZA 2M2DA 3NACH 5DEZA 2AXWA 2BP8B 3NCCB 1R1CA 4G8GE 4ZMXA 3QUXC 3DX8A 1YEKL 1NDGA 1SJVA 2BVEA 4OFPA 2HKHL 1L7TL 4Y1AB 4UF7C 3D25A 3ZT7A 2IVFC 1KGCE 1SF5A 5I71B 1Y18B 1QOKA 4P46D 4PY7B 4Z78A 2AJXH 4LPXA 1T03H 4MAUH 3UTOA 1SYSB 4XP5H 1JAEA 4MNGE 1RXLA 1H6EA 5E9DB 1ZT4A 1NCCH 4ERSH 1IAOA 5KSAC 1EHLL 1N5AA 4QRAA 2ZAIA 3BP4B 3SY0A 4IBSA 3WFDH 4KK6C 4F9LA 2DIJA 1ILUA 2D7PA 3EFDL 4ZK8A 1SY6L 2RH0A 1NGXB 4IBQA 4JJ5A 3D50A 3PWNB 3UJIL 1F41A 1ACYH 3FT2B 4X6CB 5IG7A 1IGFL 3WG7B 1PD1A 2VLKD 4JFFB 1SBBA 1EAOA 4LRIA 5C8JB 4X4XB 3IMUA 3WAKA 5DI8B 2X3BA 3PIQA 4WUUD 5IBUB 3E38A 2WXKA 3NGBB 4XHQA 3PFQA 3BJLA 1C16A 3SO3B 3UTZB 4FQXD 3Q6FA 3MX0A 1BFVH 3N42F 4LSPH 4FMKA 4PN6A 1JHKH 1KPUA 1ZLSH 3CFIC 4C57C 1FFPA 1BF8A 2J1WA 4WTZA 4GP5B 3DX4A 5IHUL 2BW4A 4F80A 1EDQA 1NMCC 4P5TD 5IFAH 2YPKA 1MHPL 2WP3O 1YEFH 3JVGA 3VACA 4JZJA 1SJMA 2LGNA 1OGAA 1I4FB 2M1KA 1AJ7H 1I75A 4Z5RB 3OWRA 4GOSA 3BXNA 3VGAB 3B5GA 4LASH 2XLLA 2LU5A 3MUZ1 3RG1C 1NMCB 3WJLC 5CGMA 5CGYD 5B1JC 4GRWE 5A1AA 2QHRL 4HEMA 2NDFA 5TGBB 1T83A 4J3UA 3VQMA 2AJZA 1R3IL 4HT1H 4XH2A 4BZYA 3LNFA 4TLKA 4XX1G 2XPZA 3U36A 4FA7B 2ENQA 3H7BA 7FABL 2JQZA 1FYTA 1N2RB 3BLBA 2YUXA 4JL2A 1Z9LA 4QRPB 4CN6A 4OZIB 3QI9C 2YJLA 3CFDA 3FQNA 1BVNT 4TVSa 3T9WA 4LVHB 3JUZA 3LV3B 5AW2B 3MCG1 1Z66A 4OM0H 1G1KA 4UAHA 3EJYD 1IIKA 5DZJA 3VGFA 5MP6H 2BRRL 1AG0A 4EIZC 1P5UB 2E56A 5GGTH 4AEIL 2XNAA 1MLCA 2Y7QA 4FG6C 5CM1A 3UG4A 3HZMB 2CMRL 5EZPA 5DFVC 4KQ3H 12E8H 5T1LA 3L1FA 1YQVL 2CO1A 4Y19A 5D7HA 2LFGA 2YO3A 1MCOL 3O4OC 5BS0E 5E99H 2Q7NA 5IK3A 3NN8B 3HC3H 3FHEA 4Y4HB 4JMNA 5T3ZL 3TWCL 5D6DC 4H8UA 1ACZA 4QXGH 2P9RA 1R3LA 2IQAB 3BH8B 5AW9B 4GMTL 4OQTL 3QJTB 4RISL 4G7VH 3SPIA 5FYJD 1AHWA 1AQKH 2OJ1A 5F1IA 1YEWA 3VFTA 3OKLB 1NGWA 3ZKMC 1DLFH 4JREC 1AD0B 2H3NB 1J5CA 1KLGB 1XF4A 2AI0H 3CLFL 2WQUA 2PR9A 3NIDB 4DVBB 5TQ0L 3S88L 2H6PB 3RP1A 1JUFA 1DANU 1E3XA 3J7HA 4F5CA 4TLSA 4OQTA 1JI1A 3TCLB 4P4RA 5FO9A 2Y9RT 5IP4A 1KXVC 4R8WH 3L08A 4OCWH 3BSHA 1EEZB 3QAZB 4U3CA 3QDMB 1BFOB 4ZFFA 4XBMA 1JZJA 2HSIA 4BZ1H 5AD0B 5JXEA 1QBLL 3BDYH 3R06B 1QLRA 5ALBL 3QQ4A 4TL4A 1OGTB 3JZYA 3MLSL 2XYCA 4Z7OE 4OFYD 5BVJB 4JJ5B 3UH8A 3G5XB 4LZKA 3FTGA 3IJ9A 4HPOH 3W2DL 3DX9A 2EEFA 2SEBB 4IDJH 7PCYA 3ARFC 2ZKXA 1OLZA 1BOYA 1E90A 1UH4A 2APTA 2GSGB 2K0RA 2X4OB 3L4XA 3S0PA 1RK0B 5INCA 1F3RB 4R2GB 2YMXL 2WXLA 2ZCHH 1T0MA 3V6FB 2VRKA 3FN0L 3WIHL 1S7VB 5DHYA 5AEAA 3C9NA 3D3VA 5EBMA 2CHNA 3L9EA 4X7EC 1BWWA 4DPAX 1B0RA 1M42A 3AG3B 4ABVA 3TV8A 3ILPA 2O4EA 4MCMA 6PAZA 5EU6B 2PO6B 2C4FT 5AVVB 2YEVB 4G5ZH 4UI2A 5JXAL 1JGDA 4DZBB 2H45A 5C0EB 1T04B 5G4OA 3MRHB 1AH1A 2CR3A 4OF5A 2FCBA 1IM9D 2DAVA 2OTPA 2UY6B 4MZ2A 4A2FA 4AJWA 1GYWA 1KJ2B 2NNRA 1A4KA 2VZOA 1I8UA 4IU3B 5E95B 4RRPG 3V0WH 3V4PL 4YSQA 2NUPA 2IPKA 4MMXA 3O4LD 2CCWA 1W0VA 1FL5B 4PB9L 2QMJA 4QRPE 1EJOH 3GK8L 4BCXA 4GG8B 1I1AC 3RWHB 2FT7A 3PV7A 4L29B 1QFWL 3K6SA 2AXJA 1P6WA 1VADA 2OMVB 5FS5A 4QCIA 4Z3IA 1D6EB 1ODAA 5EUKA 3LQMA 4N0CC 2B77A 1A0QH 2C3XA 1BM3L 3HPLA 3QG6B 4QOKD 2ZG1A 2YQ2A 2DYRB 1F11A 3EOAA 4JX0A 1KENL 3O3DA 4M29A 3A6CH 3AXIA 1U8CA 2B0SH 5T1KB 1KWKA 1LWHA 3KR3H 1FC1A 1P84J 3DVNB 3VU2A 1U2HA 1X5YA 5GGQL 2Y06L 4EI0A 1F97A 2DM7A 3GRBA 3FH7A 3GBML 3NH7L 5F8QC 4WCYH 5E4OA 5A6MA 4X9BA 5ETUA 3HE6B 5E4AA 4LL1A 1RUML 3DSFL 2DIEA 2KPNA 4NCDA 5I6NA 2ENYA 1MUJA 2IFFL 2F58H 3FUNA 3JVFC 1A4JA 2QVFB 2I24N 2Y23A 3HI5H 5T3XE 1XGYL 4Y5XA 3CFJA 4PP2B 1OQXA 3CU1A 2OP4H 2JMRA 4FFVC 4NGHL 4QJ5B 2QVTA 1D5BA 3D12B 3H2PA 3GBMH 4PY8J 3STLA 3ECQA 1TJGH 5IJCC 5CKAA 3BD5A 3BPLC 3TC9A 4ORGB 8CGTA 4OFDA 1KBGL 3FT0A 9CGTA 1TQCC 5E24E 3KR3L 3HS8A 3MREB 1NGZA 4WI0B 2BZDA 4ZUSA 1UJ3A 1UVQB 3FULA 3RUGA 3SZ6A 5FYKE 5GGSY 3KWTA 3T4AA 4EN3C 5L6YH 1CB4A 1C8PA 2CLVB 3F5WA 2CHWA 3SY6A 4PGZA 1TVBB 4S1SL 5CSZB 1I8IB 3L7FB 4RGMC 4LIQH 4BA0A 4UTBL 1BVKB 3LKRB 4FN0A 3HB3D 1FNFA 3APCA 3BVNA 4KAQH 4NQCB 1R5IA 4G80B 1TZGL 1SOSA 2FAUA 5GGRY 1IFGA 2JKRM 4MA8H 1XVSA 5DUML 5IVZB 3UAFA 2ICEC 3FTVA 1KELH 4MAYB 4N0UA 2YR3A 2FECL 4HQQL 4OIIH 4U1NB 3VVVA 3EDDA 1BA9A 1BLIA 3DX3A 1CL7H 3P30H 2WCSA 5BNXD 1FAIH 2MCMA 5E8EA 1L5GA 3DJSA 1U36A 1UC6A 3T2OA 3TGXA 1INEL 5FGSA 5F3BA 5CEZD 4J3VA 1BOGB 4RWYL 2Y72A 4YGAB 4CW1A 2Y5TA 3QQDA 4K3EL 3L3JB 4J3OD 3QUYD 2ILLA 5BZWB 2X4RB 3RBSA 3S2AA 1IX2A 15C8H 5F7YC 3RY6A 4BGDA 4LAQH 2J1XA 3BZ4B 1XXFC 2LW3A 3B8SA 1GGIL 2DH2A 2X4TB 1IQWH 3MV7A 3NYKA 1F4HA 5E51A 4F7CB 4MCYB 1GGCH 1DCEA 1QPPA 4XO5A 3TEYA 3SYOA 2OQJA 4WHTA 1RZFH 1U8JB 3RX9A 4NO3B 1SOXA 5MEPB 1LP9E 2CM5A 4H8WC 2AK1L 4WAFA 1ASOA 3RFZB 1UACH 1OGSA 2B4CH 1B4JL 2PW1A 4MMYA 5B1CA 4HIHB 2VDKH 5GGSA 4ZUUB 1BZEA 4RGND 1Z0MA 3T08A 3LIZA 3K6SB 3D85D 1IILE 3IT8D 3ULUL 4KXAA 4ZRGA 2VERN 4JMXA 4TUOB 4ZMLA 2CE6A 1MRCH 2EINB 3H9SA 2VXVH 4FTVD 1Q72L 3EH4B 4APXB 5MERA 1JV5B 4WO4A 2XDHA 1T20B 2Y1YA 5GRWA 2BRQA 1YUKB 3O3UN 1I85A 5T3ZH 3BFQG 1Q9LA 3VYPA 1NIAA 5HGAA 4DAGL 1L9NA 4YUEL 3PWLA 1IARB 1JG9A 2CKNA 1UYWL 2HVJA 2J1YA 2XKSA 2DOCA 1CT8B 1LVEA 3HMXL 1AQDA 1PLGH 3QC6X 5GHWH 5GRZA 5K9JL 3WI9A 1EXHA 1XMEB 4M3HA 3OSKA 1RIHL 1MUJB 4YEEA 1N4XL 3P77A 1MCQA 5KSAA 2VDPL 4JFDB 2VXQH 1SXNA 4ODSH 1DCLA 5AZ2H 4GT7A 3SKNB 1T1XA 1KYOK 1DEEB 2NY3B 1KG0A 4KMTL 4OCLC 1OV8A 5K59E 2Z34A 1AI1L 5TFSH 2DW5A 2EXSA 2ITEA 5IBTH 2R7EA 1CC3A 3BKJH 4OJFH 2B59A 2IAAC 3HZYA 3QDJA 4NWTL 4FQCH 5C0CE 1A7RL 3C09C 4UIMB 3MXVH 4L8CB 4WWKC 1BLNB 3O8XC 4XPFH 5I8OH 4UCFA 5HDLA 3Q13A 1CUOA 4P99A 3ZMRA 2DKUA 4PRAA 1JPEA 3CX2A 1OSZB 4LEOB 1RZJC 1FYHB 3GSOA 1PS3A 3I02A 3MOBL 2YKLL 3O3BA 4HPYH 3SGDI 1YA5A 3C60D 4G8FA 3IXTA 1BZ7A 3H56A 2VDQB 7FABH 5JLZA 3KPLB 5D1XB 4DNLA 1D3CA 1NIDA 3RVUD 3PHQA 3V9CA 5G5DA 2WYTA 5L8JB 5SWQB 4XC3L 4X5RA 1QLFA 1RHHB 4E41D 3HMWH 4A2GA 4QTIL 1XD0A 1MNNA 3BIBX 3D4ZA 5FKPB 4HBQA 4C8XA 4O02A 4U0RC 4OGQC 3ZYJA 3GPEA 4DN3H 1OE1A 4R0LC 5AOJA 3ZTNL 1S9YB 4XWGH 2J57A 5DWUH 4CW1B 4HWZA 5ACMA 5TQ0H 3QQDB 3PAUA 1XAUA 5IFAL 3L3JA 1HHGB 1KTJA 4PRNB 3RWEB 4XNQB 4YDLC 4HBCL 3NK4A 3K1DA 3MO1A 4EOWH 4UDUB 3BIAX 3DPBB 3ECBA 3US0A 1NEZA 2P5WB 3RA7H 5EWIH 4PJ8A 1ZS8B 4UT9H 4M6MH 3WKQA 1BZ9A 3P4OA 5F0PB 3B2PA 4BFFA 2VOTA 4Y89A 4NRZA 1W0WA 3EJTA 1T7WA 1BGXH 1I1AB 5KYUB 1CLZL 4FL4C 4YHPA 5C9KA 1REIA 2XG5B 2AJXL 4HIJA 4AT6A 3TPKA 1T03L 3N85H 2V8LA 7TAAA 1DVQA 3BZ5A 5E1QA 3RE0A 4BFNA 4L0ZA 2XZCH 1QBBA 5I6XB 2KS0A 4AIZA 2A9CA 3HUJA 4N86A 3IU4L 4I2XB 2DLGA 4UV4H 3KG5A 1BJMA 4HMEA 3QNXA 2FR4B 1AE6H 4ONFH 3AABA 3L4WA 4Z7UF 2IH3B 2Y7NA 4ZX5A 4M03A 2Y7MA 3FO0L 3UTQA 1YPZB 3MBEA 5C0AB 4B9JA 2R0ZL 2P45B 3OGCB 4GQ9L 1RFDL 2DQTH 4FHBD 2Y36H 2WWNA 2FD6H 5EO1A 1YRKA 2EZ0C 3MROB 1S7SA 1L6PA 2VDLH 4UWQB 5HI4C 1R5VA 3QQ9D 1VKXA 5I5JA 2NZ9C 4RIRA 4ZW6A 2ITDB 2ZG2A 3KBPA 5H35A 5I73B 4Z7WE 2N1TE 3F7KA 4WI9A 1BJ8A 1HHKB 4JLRB 2P44B 3H9HB 3FT3A 4YGVA 1Q4NX 1N0XL 2V8MA 3D0LA 2DBLL 4TN9A 2EYTA 4M6OL 3KCPB 2VTFA 1B0GA 1C1EH 3RDJA 1T3FA 3PGDA 3Q8CA 1F4XH 2CGRH 2NY3D 2VL5A 2GFBA 2EUZA 2MNWA 4JHWL 4ELME 1U3HB 1M57B 3DYPA 4UILH 5F0JB 4DW2H 1N12A 2BY0A 1GOHA 1I9JL 3GS7A 4U7KA 2FQFA 4HGMA 5D1ZB 4MD0A 2PYEB 3FMGH 3ROOB 3VFSB 2WTRA 4CDHA 2IF7A 3MJ6A 5GRJL 3HFML 4XXDB 4WGVB 3B6SA 1KB5A 1RHFA 3MR9A 4PRDA 1LWRA 2XOTA 1DHKA 1X4ZA 4TQ8A 4FE9A 1NCOA 4LLDB 3EFFB 4WTQA 5AAWC 3L9RB 4KHXL 3UAJD 4D9LL 1J0KA 1ULVA 4LFHD 4MVBC 4OD3H 4W9LC 4ZQKA 3JSSA 2CK2A 3ZDWA 3BKYH 1FGVH 4LSVL 4HLJA 1I8MA 2G5RA 4RAVA 5EU7C 3THML 3BKCL 5C86A 5I23A 3DECA 1WAAE 3GBNL 4PRID 1I3VA 1J5OH 4GAJL 2XBTA 4HULB 3QJFB 2IADA 4FJ6A 1T7XA 1KC5L 2E7DA 4OD2A 4Y9FA 3P54A 3O41A 2ENSA 4CU7A 4QXUH 3KXFE 3ARGA 3IWVA 5JIQA 4ZFQA 2VR9A 2GIMA 5I19H 5IQ7H 2ZXQA 4RQQA 1TO4A 1JZIA 2YD0A 3O6KL 3F7YA 4JY4A 3ZLQC 4B9PA 2NDGA 4PJXB 2XQYG 1BDYA 3G6JA 3ECBB 5E1AA 4F8NA 3ELQA 4W9KC 2OJZL 3MLWH 5K1VA 2N7BA 5C2UB 4P57A 1GAFL 4NKIL 4XNMB 5ERWA 4K7PY 3FCSA 2DD8H 2P5WD 3HS0B 4JKWA 3WELA 1NDTA 5ACLA 1CCZA 1LILA 4PV8A 1YO4A 3A4DA 3RZCB 3ZGIA 3SYCA 1OL0A 1W9XA 2XV2A 4D0BB 4L48A 1AKPA 2VXQL 4ODSL 3T0ED 2R56L 3AW5A 4JFWA 5HGBB 4RMUA 2FEDD 2IWFA 3QFJD 2PW2A 3F00A 4YK4B 5F6HJ 3W11D 2LFEA 2D2OA 5ICZB 1KB3A 1ROWA 3NCFB 1B2YA 1NBVH 3Q43A 1KCVH 1A9BA 4TQHA 5IB4B 3CSBA 3TPUB 1XF1A 3TZVA 5ADPL 5FUOH 4NM4L 1T5KA 1A7OL 4JUTA 5BW7C 1MJUL 1MKFA 2YN3A 1R0AL 2Q20A 5FYLE 4R9HA 5DHXB 1AR1C 3ASNB 5AL0A 4P46C 1QBAA 1KXQA 3T4YB 5L2JA 2BSRB 3MJ7A 3FUHA 1IAKB 5KN5A 4TTDC 2QADB 5CLZA 2JJWA 4NQXB 3UADA 3VXPB 4PJIB 5JIHA 1HNGA 4K3DL 3US9A 2JCCE 5HJGA 1SHWA 3LS5L 3Q7JA 1R3JA 3BMWA 2CLRB 1YN6B 2EDMA 3TL5A 3K3QA 4X99B 1E6OH 1JS4A 4H88L 1HXYB 4N0UE 3ULSA 2AQQA 2XN0A 3KYNB 4MJ5A 4W1TA 4UM9A 3WNPA 5LQBH 2C7UA 2DDQL 3SKOA 3SBWC 5A3IC 3V4VA 2QPUA 2E27H 1JZ8A 1RUPH 3LIUA 2F19H 1N3NB 1GC1L 2B4CL 2G3MA 1FO0B 2GTZA 3FU5A 2DLFH 1SYSA 4LPWA 4ODWA 3S35X 4JO4H 3ARED 1OPOA 2UUDK 4GKZB 4QRRD 3A47A 4PIBA 1H3TA 2CKBB 1BJ1J 2YBRA 1WJ3A 2PABA 1FIGL 1AACA 5D1QD 1IIIA 4L5FL 2FQDA 1JRHL 3LB6D 1T4KB 3LNEA 3V6OA 3U0PB 2QGCA 3ULUD 3FUIA 3LDBC 3RY5A 2RALA 1QHOA 2NMSA 5C3LD 1U3HD 1XB8A 4W9GC 1V7NH 5BPPA 1PDKB 4DK3A 5B1JA 4KKCC 2GYSA 1NDMB 2VKWA 4DUWA 2L04A 1KDIA 3F7LA 4G7SB 1MCKA 5ESQB 1C12B 4M7LT 4YHML 1WCBA 3GSRA 3O81A 4QF1A 3LRSA 2F1EA 3AREC 5E2UH 2LAAA 1MCHA 1OB0A 3LNGA 3B9DA 1DBMH 3CZUB 3CH1A 3OKEB 4JGJA 3CFEA 5DC9B 3SGEI 1XT5A 4QTHA 4GBXD 3PWPB 3TA3C 3EYVA 4C56E 1NAKH 2HG5B 4PJBA 4RMBA 1TKWB 3ALPA 3T0BA 4NQSB 5I24A 3S35L 1JYXA 1J1PL 2PXYC 1TQSA 5E8NA 3KNBA 1CYWA 3FBQA 3P9MB 3F04A 4N26A 5CGTA 1MOEA 1CGXA 1D5RA 1PTZA 2CJTA 3EGDA 4R6UA 4A39A 4UQ2B 5HY9A 3FSZA 1C5DA 1L9MA 2AXGA 3TURA 4A67A 1JMZA 4TUKH 2KI6A 2XWBB 4FI6A 3KHQA 4PWIA 1UKSA 4L4TD 3PUUA 4PJEF 2WXGA 5DD3L 4CNIB 2AXHA 4NT6B 1IBDA 1B3JA 2YA2A 2H41A 5LBSH 1C8QA 3O6KH 5L88H 3L5WA 4H5SB 3MRCB 4XCNB 2I7OA 3FSWA 3LNHA 3OM3B 4XCFH 5KW9L 1PQZA 5A43C 1GYUA 2B3RA 2CRYA 3OJDA 4NYLB 4LGRB 1E42A 5HVFB 4FJYA 5AOKA 1TEFA 2CRIA 5C09A 3MA9H 1XIWA 2EIKB 5EF2A 3E6FA 1A9BB 3GSXB 3SE8H 4LLUB 2DKMA 2G3ZA 3FOMA 5FGBA 1QLEB 4KC3B 3UTPE 1FO0H 1KCBA 1MJJA 2DLTA 1AGBA 1T80A 4DGWC 4LFHG 5I1AB 1P7QB 4G8GD 3UZQB 3TA3A 4KNTA 2XBZA 4LOEA 4I4WB 4TVPE 2JJVA 4E9RA 5BMFL 2O5YL 2IBZY 4PJIA 4NQEB 1TQCB 2BIMA 3SJVE 4HLEA 2EUXA 1H3UA 1QUPA 3GBEA 4U7MA 5GRUL 4CJ1A 1E3FA 4I0PC 3VWKA 4FQ1L 3QR0A 3IDMB 4NBZB 3NQIA 1D2PA 1E6JL 1NGWB 3A4AA 4R26L 3GD1C 3CE1A 4U3SA 2QQQA 3GSWA 2OMTA 1AD0A 2H3NA 3UOAB 5FLVA 4JG0L 5D2LB 3SD2A 5E23A 4V1DA 5EULV 3W9DA 3EHBD 4P9ML 1UURA 2VJXA 2IBGA 4F3FB 5IMMB 4Q9CA 4N25A 3GT6A 2DTML 3G7TA 4M1DH 4L3CA 5JUEH 3S48A 4KKLC 1BXXA 2IPTH 1UA3A 2C9UA 5B7FA 1QLRB 2WZ5A 5CD5D 2FBRA 3VFRA 3WSQL 1YMMB 4TOYL 2BLFA 1NCJA 1MFDH 2XTJE 5GGRA 3AB0B 2PWDA 4FJZA 1LO2L 5E8OB 1Z3RA 1LTXA 1PZAA 4XP6L 3SYQA 2SODB 4L05A 5BZZA 3UZVB 1ZEAH 3ZT6A 3U2JA 1WBZB 1RIVH 3CZFB 3QQ3A 2NR6C 1GHFL 3LD8C 1ROCA 2Z6FA 5F6IB 3IDYC 4LHQB 2QR0A 1RZJH 5EH1A 1PKQB 2NXYB 3HNSH 4PJHB 2BHYA 1E5BA 3HG3A 3ERXA 3VDAA 2ZSWB 4M3JA 4YHMH 1TPXC 2CRZA 1XSOA 1ZSDA 4NO0D 4ZO6A 3CFEB 1TU2B 5GZNA 5T5FL 5HJDA 1JDDA 3EYVB 1KTBA 2YEQA 3WGVB 1MCJA 1SN2A 5I16B 3T6VA 4XNZB 2FJGB 3PQYE 3VXOB 2K8MA 5HYQB 1JDAA 3UTSE 3CK0L 3HNSL 4IU2A 4DZBA 1GW6A 3L81A 3LSOB 2P5WE 3VMNA 1LGVA 4LOUC 3BWSA 1WD9A 2AERT 1EMTH 3F6LA 4LP5A 5ICUA 2P8LA 4GRLB 3HUJF 4PMEA 5AZEL 1D5XA 3EXLA 1KXQE 3NUKA 4NCC1 5KVDE 1S9VA 2Q3ZA 4G82A 2H3KA 3K6FA 2DEXX 1F1DA 2X1QA 3ULUF 3PCYA 3RVXC 1CFNB 1R24A 1GYAA 3QRLA 4FQ2H 4RX4D 4BXSV 1TMCB 1D5MB 4O51B 5LQBL 3I85A 2ADGA 4HFUL 3FHAA 1VZHA 2EILB 2IAMA 2VH5H 4AZ8A 4FDWA 3QAQA 4PS4L 1K3ZA 2ATPA 4Z7OB 3O3DB 2B9BA 4U1MB 5JORA 4RISH 3NIFB 3KPNB 1ZK5A 1XAKA 2ICWB 3FCTA 2FEJA 4XH2B 5TE7H 3GSUB 3MBEC 5B3SB 3QPQD 5D70L 4ALAL 1WFMA 3QEUA 2WKOA 3FONB 2CBTA 3IGAA 3WS3B 4YDIH 3C5ZA 2D4FA 2DJUA 4MQXC 2OL3B 3OAZH 4N2CA 2HX9A 1SLXA 2B1AL 3G5VB 3BT2H 3QC5X 12E8L 4I18A 3B2XA 1JNNL 4LSTL 3WKYA 2D8KA 2RIKA 3LRLA 2XPGB 4K3JL 2Q3XA 2EVHA 4ZDHA 2WVVB 5IR1B 3GDCA 1NMBH 4L4VE 5JW3H 2GC7C 4X6DE 4YBQC 4GSXA 3KPOB 2J2ZB 3OF6A 1DSWA 3NEXA 4KXDA 3SCMC 1FCCA 5K1JA 5TTRA 1AC6A 4TTDD 1RIUL 1ZE3C 1U8LB 3NH7H 3TBSB 4Z18A 2Y22A 1CXLA 1M6UA 3DOSB 1J5HA 3VI3B 3X14A 3ATDA 4QJ3B 3M88A 2MMXA 1QBML 4H13C 4R5VA 4BD4A 5CZXC 3BDBA 4PWFA 1RZFL 2B15A 3ZKMD 1NBZA 3ILDA 3U6RA 2VLME 3FU7A 4WHYG 4ZG1A 1UM6L 4PREA 3INUH 3CSPA 4PR5B 4TLTA 1U8NA 4JAMA 1EAPB 4GKNA 4M7JL 2D03L 1FE8H 3QWOB 4JZOB 4M1CD 1LL1A 2V7NA 4XCFL 5D7SH 5F9OL 3PL6D 1PW3A 4YXLH 5CBAB 1XF3A 1NMBL 3FU3A 3KPSD 1A7PH 5CUSH 5DJ8A 1QNZH 4XRCA 3V4VL 4GQPH 5DHVB 3I75B 2ZF9A 3BYYA 3SKUD 3U25A 2VN3A 1DQJA 5C0GA 1C08A 4HCIA 1X6NA 2WLLA 5DHDA 3WE6A 4I0PB 4NN6C 5I9QB 5AAWA 1U8MA 1MFBL 2XICA 3ETTA 2ZOUA 5J8OA 4F1SA 2FYYB 3X1BA 1ZTXL 1A8ZA 1I7ZB 1ZRUA 3GLZA 3NZUA 4V2BA 3VGHA 4BEIA 1GJIA 1GGBH 1M7DB 2IANE 3QZNA 4ZFOB 1WSST 1A2YA 1M2VB 5T33L 4GBXA 4M43H 4Y4KA 4A2HA 4P2CG 3FAXA 1J8RA 4WK0B 1S7RB 3BDXA 1BM7A 1WE5A 4LLAA 4UIKL 3R8QA 4XNDA 2HA1A 3K2KA 3IJSA 1PU0A 4CN4A 3TF4A 4XX1E 5EG6C 5T1DL 1MRFH 3MRJA 2BVPB 1D6VL 5FW6A 1M53A 4OCNC 2OS7A 3IDIA 8PAZA 4ONHB 4HX1B 3MGTB 4TXVB 3R7RA 5DVLA 2WZ6A 3QO1B 2KKQA 3KJ6L 4QRFA 1PZUB 5E6IA 4OV5A 2B08A 4QRPD 5DRNB 3SKJH 5AVWB 4D2NA 3IVKB 5EUOB 5FO7B 2DRUA 4Q8BA 1EZVX 3KW7A 2JVUA 3B2VH 2H5UA 4XPTL 4CKVX 1CN4A 1AZZC 1OAKL 2Z7ZA 1ZSHA 3TNMB 2YQ3A 4MMYB 1NZRA 1JRHI 4AYFA 5EZOL 2UVFA 1SF3A 3B5HA 3P40A 4AQZA 3C8KA 4XVTL 3UAAA 1GZQB 4LDOB 3C2AH 1N19A 4DO4A 2CUIA 3R0MA 4LKCA 4OJAA 2X1OA 5CN1A 4YDMA 1JN6A 5KSUA 4FCAA 1OCRB 2G5BB 2WLIB 3NSXA 3SCMD 5TQ2H 4NJAL 5M94B 2IGFH 4XMUA 1HSBA 3HC0B 1ET8A 1FL5A 1W80A 1QSEB 2FRGP 3OZ9H 4KKNA 3B2VL 2HMID 1A7OH 1U33A 1OZUA 5HDBB 1SYVB 3RWHA 3N43B 4X7FC 4I18B 4WJKB 1J1OH 1AGEB 4JFYA 4NXSA 4X6BB 5C0AD 4E9WA 4G8IA 5CD3B 4GMSH 2HUEA 3C2AL 4JG1L 4GG6F 3BEWA 4FP8L 3BWAB 2WNKA 1RZIA 4IRSA 3S5ZA 2R56H 4M56A 5I2IA 4PRPB 4HSQA 1HZKA 1RZQA 2HJFB 5CEXB 5FKAB 5D4QA 1M7IB 3RDTC 2VLJD 3P3UA 1L9TA 1MCIA 1KCWA 1RZKH 3O9WC 5D5ME 5E6RB 1UA7A 1UWXK 3QXWA 1CD1A 3TIEA 3BESR 4KBPA 3K4AA 3MBWA 3ZHKA 2VDOH 3VMPA 2EIZA 2UY7B 3WL9B 2VN5A 4UIMA 1WT5C 3VSVA 5DUJA 3X11B 5KJRL 4KUCF 4PJXF 4YPJA 1PCXA 3LZFL 1Y0LA 2CKBH 3MCKA 4LEEA 3EH2A 1WA2X 2IGLA 5T3ZE 1X3DA 4J2QA 4WUKL 1FZMB 1FI8C 4OCXH 4V33A 2CUHA 3GMOB 2H1LM 2WV3A 4HFWA 1RMFH 3D9AH 4PJEA 4OGZA 4AL8L 5DMKA 3NJLA 1J9QA 2A83A 2CK0L 3U82B 2QVMA 1IBGL 1U93B 2F08A 4U6HB 4B9IA 4MMZC 1J8SA 4B97A 4G71B 2EE9A 4ORGA 5F9WB 1AHKA 1EGJA 3AAZB 1DUZA 3VTMA 4U4IA 3OG4B 2H2PD 3S34L 2YA0A 4B9YA 3MRFA 2HFEB 3LPWA 2X1XR 4HU8A 3VTAA 5JZ7C 4P59H 3HNVL 4JDTH 4A7TA 5EU6D 5IHHA 5IROA 3HZKB 3IJHB 5CR8A 3X3GL 1H9DA 1BVKA 3LKRA 4X5LA 4BFIB 2G3XA 1RULL 1MH5A 1IQDB 1UD6A 4TPRH 1S9YA 1MJ7L 2ARJB 2CK0H 3OC5A 4XO9A 4PJ5A 5GRVL 2FB4H 1RMFL 1SLUA 3D9AL 2W38A 5LVEA 1QYGH 2WLYA 4F27A 3NPZB 1O6VA 3EYOA 4U1NA 1E4JA 2YD3A 2F53B 3DTUB 4WNQA 1HQ4A 4QKXB 1QBLH 4M5TA 4P5MA 4DQAA 2XKNA 3B83A 3QR2A 2B1HH 2E9IA 2NNAA 4U0QB 3KPRD 1LEKB 1QX1A 3UO1L 4APQA 4HCRA 3V0GA 3CTTA 1ANUA 3A3YB 1CDJA 1KNOB 2P49B 2YIHA 4NIYE 2UWEB 4Z7AA 1KXVA 5J5EA 3BD3A 5CIPA 3FK3A 2JB6A 4QWWC 4AYFB 3BZ4A 4MX7A 2NY6D 2IAMD 1GKOA 3IAQA 4B7LA 2ZWNA 5SWSB 3HUJB 3GXFA 2D7NA 4HHWA 3WFDL 2KLSA 1KTDA 4XBEL 2IV8A 3IJ8A 4QXTA 5HD8C 2YK1L 2CO7A 5I8CA 2VAAB 3HE7C 1F58L 3EIFA 4I1RA 4P23D 2DEYX 3U2SA 5K9OB 4H7VA 5MENA 1BQKA 1EJ8A 1CR9H 2Q86A 2YOCA 4NO3A 2KPWA 2Y5QA 2JIXB 5MEOB 2MTPA 4HF5H 2IGFL 3SCMB 5IQ9B 4HD9A 2O5NA 5CJXA 1AO7A 3B9AA 3QIUB 1JZ6A 2QT6A 3SPGA 2WIIA 4HDIA 5KSBF 2WIMA 5C6WH 3JTTB 4K7FB 1KXHA 2GHWB 2FTAA 4OM1H 3KGSA 1HT6A 5CU5A 5K5YA 5G4MA 3LIZL 4PCTA 4MBRA 4ZI8A 2YPVA 1B6DA 1F02I 2FL5B 3PREA 2XN1A 2NZ1A 5F6HI 4X7TB 3U9UB 4FXTA 3AQDA 2PP7A 1L3NA 1RFDH 4KKRA 4Z7VA 2HVKA 3VD1A 5FA4B 3CHRA 4JRFA 4GH7B 3MBWB 2XZQL 1HYSC 4J6RH 5L2KD 1ZXQA 1XF2B 4ETQA 1XGZA 4O58H 5ESVB 3OSVA 4OTXH 4G83A 1CFSA 2GK0A 3FB8A 4GEJA 1SLVA 3QJQB 5I18H 1IJ9A 5K69A 1J05A 5IMLB 3EH5B 4LBEA 3GMMA 1ZA6A 1L6XA 3LIZH 1OP4A 1AXTL 4JRYB 4PP1D 1CXFA 2KZ1B 2X4SB 1E67A 5DJDA 2X89A 3GXMA 5HHME 4LXFA 1JXDA 2CIIB 3O11B 3Q9PA 5EDXA 4ZTEA 4JO8A 5FW7A 4YO0A 3SDDD 3ZTNH 5IGXL 3QUXD 1G9MH 2P7TB 1IC1A 1F4YL 3MFFB 3VX1A 4XCCH 2J44A 3ATEA 3KDPB 4E0RB 2Z8WC 3AG2B 2MQGA 3GSNB 5GJSL 4WHYH 1PYWA 5BUAA 3NP4A 4LCIL 3VYNA 2X89D 4MJJA 3T0XA 4W9ZA 5KSAD 1TVHA 1TJGL 2XHNA 3ARYA 4FLRA 5DUBA 5F7KC 4WI5A 2BS71 5EC2A 1VERA 3PUCA 4Y9BA 5F7NC 1QWNA 1HDMA 3ZZ1A 4BDVA 1VESA 3D51A 3DDFA 1AFVL 2WAQA 2FLBT 5G5DB 5ISZD 4LIQL 3RUGF 1T21B 1AIFA 4KJQD 1G7MB 1HEJC 4TTGA 2IALB 4PRHB 4RMSA 5DJ2B 5H37A 1WWWX 3ES6B 4AQAA 5KYWA 5E9DA 1NBCA 2VZ1A 2XV0A 4WCYL 3AWGA 2C3VA 4GO8A 2BP0A 2YUVA 2YQBA 2GEQA 2Y3AA 1RKRA 1NWOA 2GUOA 1FO0L 4OLUH 4QRPA 4HPYL 2W0FA 5LDUA 3CUPA 3DXAA 3IEAA 3NA9L 2OJEB 3RB7A 3QEHB 1L0PA 1KGWA 4FQLL 4QXUL 2EVIA 3IU3A 1ORQA 1EXUB 5CZVL 3Q2LA 3WDHA 2VSCA 4POUB 3DTDA 3SDXB 1QKZL 3ZTDC 1NSNL 2Q6WA 1A7BA 3E9TA 2ERJB 4HJGB 5E5MA 5ITFA 1HXMB 5FV2A 4Y2OB 3VFPA 2WLKA 2R59A 4PCKA 4WO0A 4P23B 4F5CE 2AK4D 1ET5A 2LABA 4I18C 2BSRA 4DZ8A 3BMVA 3GQFA 1A8JH 1FNHA 2C4XA 3ME0A 3I9IA 3NVQA 3FQWB 4IK6A 5E7BA 3BKMH 4K3JH 1BM3H 2X87A 2JCCB 4M8UA 4JZJB 1VEMA 4MWFA 3ULVC 5KVDH 1EGJL 2YN5A 3P0VL 1OGAB 2RA1A 3X1EA 4DW2L 4JGNA 5EU5B 4QNPF 4Z7UA 2DICA 2ID5A 2FL5A 4PRBB 4ZOBA 5AVXB 1ZK9A 5K93A 3IJEB 2W07B 4CVXB 3S96A 5JA8B 3I6GB 1IGJA 4WFED 4JPWL 2GJRA 5JQHC 4HH9A 1NCNA 3U83A 5BV7C 4OZHA 3UCQA 5JW4M 2C9PA 4TUKL 3BPCB 1BBDH 3EF4A 3UDWA 3ZTEA 4DP4X 5JW5A 3IDNA 5J12B 4H20H 3QDMA 4FG0A 1MAKA 5AD0A 1FIEA 2A2QT 3F85A 4BUQA 3TA3D 5HVHB 3CQQA 2V6HA 2FO4B 5I5MA 2TRHA 4OKDA 3G5YA 3QISA 3CFTA 4M62L 4Y2DA 3UP6A 1QNIA 1J1OL 1TTBA 4GUCA 2EEAA 1ZVNA 1XB6A 3ZN6A 2YZ8A 4FNQA 4JM0A 3V4PA 2EKSA 4WFGD 5K39B 4H40A 5KOVC 1EMTL 1W91A 1VZGA 2VR7A 1N5AB 4KOBA 2RJMA 3EDFA 4BA8A 4YC2C 1T0NB 5KBNC 5CHNA 4NPJA 1N0LA 3OV6A 1D5IH 4DVRL 4U1JB 1NCWL 1MAMH 1QVOA 2ZUSA 3AMLA 1A1OA 1HFUA 2BCMA 3FO2B 3CH1B 1B0RB 1B0WA 2XFXB 4AIZB 2BCKA 4HK0A 4JN1H 3WFHB 1NGPL 3DGGA 1MY5A 5D7JB 5HDWA 1UZ6F 3GIVA 4IRJC 5D6CB 3RX7A 3QR1A 4YQXH 4MVBD 1G1CA 4FQQA 3VFTB 4LL9A 4B7IA 3WY3A 2WQAA 3EOTL 4WI7A 3PIQB 4ZMPA 1IZJA 4P5KB 4H25A 1T7VA 4WNJA 2F5AL 4PV1C 1X44A 3ULVE 5EN2A 3LEXB 3AXHA 2H0JA 3P3TA 2NLJB 3LRMA 4ZUTA 4YWGH 5L9DH 4QHKJ 4PTTA 2HH0H 1M05B 4JQVC 4ANXA 4XP6H 4HOWA 4ENZA 5SWZA 4QGTA 4R4FH 4CNIA 5DJYA 4PRHD 1OF0A 1ICTA 1J87A 4J3WA 4X4YA 2BNUB 4MAZA 1FYTE 1D9KD 3OPUA 1X5JA 2W0FB 2AABL 1U8OB 2DQJL 3T3PE 1A3RL 2ZX6A 2EDJA 5BVJA 35C8L 3HPLB 5FXCH 4Z7OF 1UOKA 3CDFA 2XCMC 3LN9A 4GQRA 5JHDE 4KVCH 2R39A 2UZYB 1QRNA 5EBLA 3D5OF 2PXYB 1IEBA 4XMZA 3SYAA 2W92A 4HETA 1ZCRA 3JV6B 2X4OA 4M5YL 4N2IA 2JELL 4I3GA 5F1OB 1KYOJ 3UYPA 4Y5VB 1FL6A 1UT2A 3A5VA 4PUBL 5CO1A 2VAJA 4KKBD 2VN4A 4WFHD 2FB4L 3E80A 4KRNA 4YHNB 2Z35B 4AEIH 1QEWB 3SPHA 2WQ8A 5CNHA 5J13B 1J8HD 4P04A 3VXRA 1WISA 1YNKH 3MUY1 4EN3D 4H26A 2ODIA 4HXAH 3GUTB 4YHLH 3L6FA 3MVSA 1P1ZA 1DJHA 2YLKA 3T6QC 2UXGA 3TJEL 3HZMA 3RDTA 1PD6A 3NCEB 3N91A 3VNYA 2UXTA 1IV8A 2VMFA 4Z7UB 3VI3F 2DI7A 3MRBA 1LK2A 3HLAB 4LHJB 3T2NH 2CM6A 1J1XH 5FYKL 4WF7A 1EUUA 4KXZH 1GAFH 4NKIH 5CEZL 1WC7B 4P9HH 1CK0H 2JTDA 1E28B 1GYVA 3PDDA 4OZHB 4DKEH 1YC8A 3GTTA 3FO1B 2BIHA 2AJVL 1KGCD 3L5XH 4XAKE 2ZZUT 3ULSB 3ATBA 2WO2B 3BVNB 4ABQA 5FHBL 2I25N 4J3OC 1D7DA 4G59C 1YMMA 3ZL4L 2E3VA 3QG6A 5GS0C 1N3NA 3B7SA 1ADQA 5B1BB 4Y1SA 2H6PA 4KK8D 4L2LA 1IAMA 2NY1B 2F54E 4UQCA 3RTQB 2R15A 1M71B 4PRIB 1HWHB 2RB8A 2ZOTA 4KRPB 1UWFA 2W60A 1RP8A 1D2OA 1EEZA 2DQGH 4ZFFB 5D93C 5HGDB 5H2BA 4YK4C 2EDWA 3VD7A 2EUVA 4FL4B 3OHMB 2MKWA 1IBZA 5SX5K 2VXVL 5BV7B 4H44C 5CJ8A 4XN7A 4HUWA 3WFHA 2VWEE 4OD1L 5E2JA 3SPVB 1WZ1H 4P3DB 1CGSH 4GIOA 5D2NB 2VZUA 4N0YL 3DX2A 3FQ1A 1D9KC 5DK2A 4DGVL 3VXUE 2UZIL 5FOBB 3TN0C 3S8FB 1YAZA 2WXHA 1XCQA 1LWJA 5BQ7A 1T66D 3WJMB 1E5UI 2WWKT 4HC1H 3HE6C 2VSMB 1I8LA 2OMBA 4FKHA 3UBXG 3CN1A 5SWZB 1WRFA 2X6BA 3EOTH 3A21A 4WQOA 4KKBC 2WXQA 2NOYA 2B16A 4JEGB 2KBGA 1JGEB 1CBVH 5DEJA 2AJ3A 1JGDB 2P5PA 1OSPH 3QJOA 2ADGB 4HIEB 4UQ2A 5HY9B 3HUJE 3Q8FA 1OAYL 5T5NF 5JXED 1DFBL 4ZO7A 3LRKA 2XY1A 1H6TA 4G9DB 4OLXH 5D8JL 5HJBA 2ICWA 3FCTB 2E8YA 1HWWA 1RSYA 3QZLA 3B2UD 4LRNL 4M93B 2VR3A 1MHHA 2AI0L 3QDJE 4IRZL 1J11A 1KBKA 1UD3A 3S3BB 3TX4A 2B1OA 3IF1A 2F9BT 3L3KA 3PJSB 5EU3B 2EP6A 1Q9WB 1HCZA 3WO3B 1KJ3L 1L3WA 3U30C 4Q9QH 4FQJH 3WIHA 4Y88A 2NW3A 2G2NA 2OMZB 1XEDA 1M6OB 2WC7A 3FB5A 2ZOKA 4P3CH 3WKNA 3VM5A 4HZLA 3W82A 2DM3A 3TN0A 2OL3L 3WOVA 4Z0BL 3E3QC 5HI5C 3HMWL 1F4AA 4YXHL 1ND0A 3MRLA 3MUHL 3GJFA 5DJXA 2GCYB 3WFEH 5ISZE 1U8HA 1EFXB 5DS8B 2GTQA 3B2UC 1JGVL 2WUCL 1OTSD 4KI5C 3C6LA 3RHWF 5KUKA 2IH9A 4QYOA 4RFEA 3H6AA 4ZNCD 4LVEA 3VRJB 1H6UA 4KTEL 5F72S 3W3BA 1JCKA 4HBCH 4QOKA 3I02B 2FT6A 2ZJSH 5L0QC 5CBAA 1OM3H 5AAMA 4OGXH 3BO8B 2Z93B 5J13C 4MDIB 1MDAA 3IXTB 4PM1A 4YHKL 4L8SA 3TIDA 4FXKB 3KLLA 2E59A 1H19A 3N40P 5CK