3AQXA

Crystal structure of bombyx mori beta-grp/gnbp3 n-terminal domain with laminarihexaoses
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
101
structure length
101
Chain Sequence
SYEAPPATLEAIHPKGLRVSVPDEGFSLFAFHGKLNEEMEGLEAGHWSRDITKPKNGRWIFRDRNAALKIGDKIYFWTFVIKDGLGYRQDNGEWTVEGFVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-1,3-glucan-binding protein
publication title Structural insights into recognition of triple-helical beta-glucans by an insect fungal receptor
pubmed doi rcsb
source organism Bombyx mori
molecule tags Sugar binding protein
total genus 18
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2140 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3aqxA00
2KHAA 3AQZA 2RQEA 3AQXA 3IE4A 3AQYA
chains in the Genus database with same CATH superfamily
3IJYA 1CFMA 2DBLH 1EBPA 1EGJL 4ZUSB 3UZEC 1K72A 5IB1B 4HJGA 3WIFA 3VI3A 1RZ7L 2YRBA 2YPVH 4N8VA 2DQ6A 3I9GH 1ICTA 1XB8A 3FU0A 2KBGA 1OGTA 2HTLD 3HZMB 5DC9B 3UBXI 3WO4B 4HD9A 4PWHA 4OCWL 3WEAA 1A5FL 3EJQA 4QNPE 5IQ7H 2OSXA 1D5MB 1H0DB 3L6FA 2WZPA 1TJIH 3DURB 2IQ9H 4NDMA 4UMGA 1TZ8A 3ROOA 1L9SA 3LS4H 4R7LA 2CO6A 3AWGA 3UEZA 4AIXA 2R1XA 2WV3A 1FBIL 3HE6B 3QO1B 3VWJD 1QEWB 2WWKT 1IQDB 1FVDB 1MCDA 1V3KA 3B7YA 5I6KA 3NCJH 3OQRA 4PLNC 3BVDB 1QBBA 1U8HB 6FABH 3KPSE 4K9EL 5HPOA 1G84A 2FJGB 1HH9B 5DJAB 3E80A 1HYSD 3EJYD 4R7NA 1UT9A 1K8DB 5C09D 3D3VA 4PW4A 3MRHA 2J1ZA 1DBJH 3C5ZC 5T5FL 1CLZL 3E1F1 4N26A 3FQUB 1VADB 1JMZA 5IF0A 3VD0A 1E4WH 4QRPB 43CAA 1YY9C 4XI5C 3PWJB 3S6CA 1Y07A 2YD8A 3UZVB 5L2JB 5B38A 2OA9A 2YPLA 4DGIL 3US9A 1IE5A 4EIBA 2BP0B 3IMBA 5BQ7A 4OH2A 4NOBA 1SJHA 2DMBA 2V2TB 1SDAB 2ED7A 5LGJA 3VJ6B 3B3IA 4KJQD 1RK7A 3R18A 1TVDA 1XAKA 4FQ2H 4IU3A 5ISZA 1AIZA 5JXAL 3EIFA 4X6DE 3L3HB 2EH8H 2UVFA 3OX8A 5C6TH 2X9YA 2OMVA 4UBDD 1MH5B 4A7SA 4KH2A 4NPYB 3REWB 2GJRA 3FBQA 3OB0H 4NZTH 4EF3A 1LXMA 4I3RH 3X14A 3SGDH 3MVSA 5I8EB 1RZQA 3L7EB 1JWMB 5E56A 4F1ZA 4A39A 3O8XD 2WINA 4BQBA 5JNYA 1QSEA 1NCAH 1EXUA 4X5WB 4LVOC 3QIBD 5DUJA 3FSWA 2VXVH 3W0WA 2DJUA 2G3MA 3IFLL 5L9DH 2F0CA 3OKEA 2VR6A 4L1HA 4PB9H 1MRCH 5EORH 2DD8L 4CN6A 2HLAB 5DCCA 3FFDA 3MJ8B 4M7ZB 2Z1KA 5EU3A 3IDXH 3HR5B 5CJ5A 1AGFB 2OMWB 3QAZC 4M5YL 1R0AL 5DRXA 1NSNH 1KCSL 1U3HD 3NP3A 4HGWB 2D31A 1GL4B 5E94A 4Y5YB 3HNVL 3QWNA 5C3TA 3TTSA 1KCVL 1JPGA 5IMKA 3ROLA 2A6JB 1A3ZA 2W9EH 1C5BL 1XCTA 2BDNH 3ZTJH 3AQZA 1OE3A 3IBEA 4YSSA 2X6VA 3FTGB 2IPTL 3T65B 5I1LA 2QQLH 5IKCA 2BXZA 2BIHA 5LBVA 5KYUA 2XY2A 5F7KC 5BNXD 2FQDA 4ERSH 3KG5A 2HVJA 3RTQD 5C0BB 2B9BA 5JPMC 2P3YA 4DN4H 4KRPB 3FB5B 4S1DD 3CFDA 1JK8A 1ETZA 3H53A 5BO1L 3MLXH 2C26A 2IO5A 1XH0A 3P9LB 3EGDB 1OP9A 2JKIS 3LNDA 5I9QB 3BH8A 4JN2A 3HAEG 2VDPB 5LBSA 1GPOL 4RGMB 1A3LH 1SJEB 2BS8A 4IGBC 4WNSA 5IQLA 3T8MA 4I48A 1N6QL 4U05A 1G7IA 3QHFL 1TZGH 3KMDA 2HG0A 4PWGA 2WZ5A 1I31A 1VACB 3QNZA 4ZRGA 4GAAA 4PJXA 3X11B 4F15B 3OKLA 3MACL 3PWVB 4OZGE 1RJLA 3GSNB 3X12A 3BP4A 1FF5A 3EDFA 3PCYA 2F5BL 4WGVB 1P5UA 2BOLA 1EZVY 3FTYA 1GS6X 4ISVA 1U8QB 4IRJA 4B0MM 3W5NA 3SZ6A 4OIBA 5DVPA 3VDCA 1PS3A 1KPVB 3AAZB 2OYMA 3T9WA 3KM2A 3U2SA 3Q06A 3O4LB 2AI0L 4F20A 4PRPB 4UM8A 1U4EA 2MKWA 4G8FB 4DK5A 4JHWL 2P5ED 1KXQE 1OGAB 4NO0A 4QRTB 4B9ZA 2NSMA 2WLNA 5EBMB 4D94A 4AV5A 5IBTL 5AL8A 4YSCA 1N4XL 3QORD 3QUMH 4HLZG 5DZNA 4WCYH 3BZ4A 5B7EA 3CSBA 4LP8A 2A5UA 3ARFA 3KPPB 4EIGB 2H4EA 3FB7A 3JYCA 3G6JF 4O9HL 4PJGB 4Z7VE 1PSKH 5DA0B 5GJSH 2DWEA 4ZW7A 3TA4D 2NSQA 3WNLA 3DXAD 4LK4A 3D0LA 1LK2A 4CVUA 1NIBA 5IVXA 4KPHL 1AXSA 5FECB 4FQQA 4FTVA 3BUDA 1REIA 2CU9A 2ZX7A 4MAUL 5KEZA 4GBXC 4BFRA 1ZK9A 4ZMLA 5J3HC 4ELMA 3EDDA 4QRSB 1M7XA 1DQQB 4LCYA 3BEWA 3B5GA 4M1DL 2YPKB 2CUAA 4XP4H 4FQJL 2FO8A 2BRRL 3UYPB 4W4OC 3U1PA 1KJMB 4PCKA 1LDPH 5CHNA 4L3CB 3OZ9H 2ADJA 2DLGA 3FHAA 2H2PD 5DO2D 1A4JA 3HG3A 1DJWA 3DV4A 2OTWB 2H26A 3QJVB 4MRCA 4M8QA 4ZMTA 2EIMB 2QADC 4JRYB 2VJ0A 4OCSL 2I7OA 5ETUA 3FCTA 1R3KA 1NMBL 4BK5A 1JVOA 1RIVH 1IZJA 1E7UA 4LEEA 5DA4A 3DUSB 3HW7A 5MEOB 3ASNB 1YYCA 3VGFA 1BVNT 4M43H 4MAYB 4WEBL 4CC4C 4UTAH 5KYYB 1U8MA 5DFWH 1S7XB 3MMEB 4PHZA 4NSKB 1XEDA 3SDAA 4ZBJA 5FCUH 2H6PB 3U4AA 1ZSDA 2J1YA 1WAEA 5T1MB 2JNZA 2ID5A 4Q4IA 2GK0B 1X5KA 3QC5X 4NGHH 3FMGL 4LPWA 4PJAE 2C9VA 2OL3L 5HD8C 5DEGB 1T1WA 3U25A 3C60D 4ATWA 4HIIB 1FNLA 3QA3A 1ZHBA 2X1QA 3WS6C 3CQFA 1NOAA 3ARGC 1W9XA 4PR5B 3HBGA 3KJ4C 4YHIB 4DQOL 5TF1L 4YSUA 5IVZA 1EJ8A 3RZCB 3JWDL 1FGNH 1ODAA 4KK6D 1U91B 4TNWF 1NAMH 1SZNA 2CO7A 3GJEB 5KVDL 4N86A 5EU6A 4OZHA 1F58H 4GO6B 1DEDA 3QNFA 2VDOL 4HGMA 2WTRA 3CFKB 4PVNA 1PKQE 4FYRA 5EZIH 3L3DB 4TUKH 4F7EB 2X2UA 4XO9A 2J88H 3N50A 3MGTA 3AACA 1IQWL 3QQNA 3RIKA 2XN9D 5J89A 4J3OG 3T8VA 2LLNA 2G3XA 3QQDB 2HFGL 3TJPA 3ARDC 2CMRL 5CP7A 4NN5B 1WDAA 1F13A 1SEQL 1W15A 5D6DC 5CBAB 3MV8A 2DYPD 1JGLH 3BGAA 4XNYH 5DK3A 1JG9A 5E6IB 5BOJA 3VGAC 4WLCA 1JAEA 3CDGB 1FJ1A 3L1EA 1X5JA 3HE7B 3B7SA 4APXB 1FN4A 2DMHA 2W60B 1M7IB 1VFBA 4YQXH 3U1SH 4AM0A 3TA3D 1A9EB 4NQED 2QFPA 4PCYA 5C0ND 1OPGH 3BRDA 4B9YA 2CLRB 2GEEA 1BQLH 4W9DC 3ULUC 4P57A 3VFWB 2YRLA 1CBVH 2P5EE 3T5WA 1TTUA 4FNRA 1HKFA 1N5YL 2VZ1A 4YJZL 1RP9A 1E42A 1AOHA 1OAZH 1SHWA 2Y7MA 3FF8A 4HAFA 4FZ8L 4UOQA 2EECA 2DQMA 4RAUB 4ANWA 2ZXDA 2F58L 3ARBA 5DF0A 1IEHA 2HJLA 3HE6C 4JFSA 1E90A 3LN5A 1EUUA 1FFNA 4N24A 4WWKB 5A2FA 1OLZA 3T4AC 1KTBA 3SE8H 4MYPA 3DXAE 5F6HI 4QT5A 2FEDD 1BXXA 1T0MA 5CUSH 4Z95L 3ES6A 2UZYB 3PPSA 4OLXH 1KWKA 3WAKA 2ZYSA 3EFDH 2EEBA 5I1EL 5ECJE 3TBWA 4MDIA 4DKDC 3SEPA 2BWIA 1JFQL 3Q01A 5C0CB 4JDVA 1P2CA 3M1BA 4MMXB 5DQDL 4L8DB 1A6AB 2OJEB 5KSUB 3CH1B 4EN3D 5BRZA 3K6SB 5T1KB 1ZDQA 2KHAA 1OP4A 4L8CA 4WI9A 3ZTNL 2XY1A 4ELKB 3N42F 2EKSA 4IEFB 2R0ZH 2B1HL 4RFEB 4BH7A 3D2TA 1DANU 4LEXH 4GO9A 3FS9A 3NFNA 2ZPKL 5E1HB 4TTDD 3Q2NA 4B9CA 1C16B 1DFXA 2R0KH 1OM9A 3GB7A 3OSKA 1DVFC 2IH3A 4ZFFA 2LTQC 2VDRL 3CFEA 2PCPA 3CC5B 4N0FB 4GUPB 3VWKC 5FW7A 3U30C 4J2XA 4TPRL 1NCWL 3BIKB 4WI6A 1XZ0B 1KIQA 3L5XH 1BMZA 4GJTB 5GS1B 1MDTA 1ZY9A 1IGCH 1R9FA 3RWHB 1J18A 2WPGA 3P4MA 4NUJB 3SBQA 4L9LC 4EI5C 3BDYL 3C9NB 2EDMA 3VI4F 3SQBB 1EZSA 1UD5A 1WO2A 4A7VA 1BEYL 3F12A 5FYLL 3O3EB 1ZTXH 1JF1B 1NGZA 1X6NA 1T1YA 3WTSA 4M7ZC 4R6UA 1CGSL 3RWEB 3GJFK 3FUIA 3MJ7B 4UUJB 3BVNA 2GJJA 4WDIB 1CG9A 1ES0A 3KPRD 1QPPA 3D4GA 5EU7E 4PV9B 3LZFH 4YLCA 4N8VG 1S7TA 1E8ZA 4HUVA 4NYLB 3UBXA 3MZGB 1G6RB 3HC0A 1GRWA 3EYUH 1SLUA 4I8DA 1IZKA 2H1LM 3KPOB 4MJ6B 4OZ4A 3CVHH 4W6WB 3WXWL 2UX6A 2F8OA 1ZANH 3NCWA 3C5SB 2ORBH 3Q9PA 4E5XA 3KGUA 4Y8AA 2ENJA 4LCVA 3CVDA 1XF4B 3IJSA 1RMFL 4IM8A 2V3EA 1CFVL 4L29B 3UH8A 3CC1A 3VFPB 5J6GB 3AT0A 5F9WC 5IB2A 1Y6MR 3O3DA 5MENB 1ZTXE 2J4WH 2XIDA 3EDKA 3LRHA 4G11A 4MNGA 4DN3H 1PCSA 4NKDA 3CK0L 2EZ0C 3GGWA 1EK3A 1KCRH 5JIHA 4H4NA 4PJFE 3QFJB 4X8GA 3NIGE 3M88A 4DVRL 2Q7NA 3DX8B 2Q6WA 4MMYB 5JUEH 2AQPA 1VGEL 3QUXB 3K3QA 5E23A 4OF0A 4OD1L 3P4NB 3T4YA 2I69A 1J0HA 2IANB 1IGYA 5EWIH 3OKNA 3T6ZA 4WHTA 2BXYA 5EO0A 1QO3B 5HY9B 1YYLL 2F53A 5FKPA 1B4JH 3ATDA 2DQIL 2QKSA 5CZVH 3GXUB 4F15C 3BEVA 3D69A 3F6LA 4OKVB 4R84A 3MUGA 4I2XA 3HRPA 2HT4C 1KIRB 3X3FH 1SDDB 2JK5B 2RR3A 3QRLA 4FGMA 1A1NA 5GRYA 1J1PL 2BIIA 5B38G 4F8PA 1UH2A 2O6DA 2Z34A 1OTUD 4N9OB 4IIQA 4BDVB 3BQUD 1ONQA 2B59A 2BVTA 43C9B 4NZFA 4WI4A 5D2LA 4UTBL 4W6YB 5E9AA 5HVHC 3W9EB 4UU9B 4BRVA 1WH0A 3I6KA 4AH2A 2F1AA 2VDLH 4H0LC 4ZAKB 3SKOA 2Q76B 2IAMD 4QRQB 3CLWA 4W6XB 4AJWA 4NCDA 4AYFB 1RZGA 5CJXA 3GRGA 3MLYH 4JFVA 4LCCA 4CSSA 3VCLA 2AEPH 1BSIA 3GD1C 4KK8C 3DVNB 3IGAB 4N68A 3HI1B 3ESVF 1ZS8A 3PNWB 4LASL 2QGBA 1UWXK 1KV7A 4LPTA 1XGYH 3I2CL 3O2VH 2ZJSL 4AKPA 2J56A 4Z3HA 3AGVA 4LOUD 4FFTA 3U46B 1X7QA 3LQMA 4R7DA 1YEGH 4KOCA 4NKMA 3IMSA 1NUFA 2J2ZB 3WJJC 3EYVA 1U0QA 2GJZB 4EXKA 2CNYA 4P8QA 2APBA 4B7IA 4F92B 3PHAA 2ADIA 4LCIH 4PRAB 3GXPA 5EOCH 3IJ7A 5T5NG 3ZO0A 1PZUB 1LWRA 1MFNA 2DMKA 2JQZA 1MHPH 3ZTEA 4F33B 4ZOEA 2PYEB 4F80A 1G7LA 1U8JB 1I7ZB 2C8NA 1RJYA 1Z9NA 2ADGA 2DM7A 5I28A 1FO0L 3V5HA 4XCNA 3GJFB 4NP9A 3HBZA 5HJBA 3MRGA 3B4NA 3H9YA 3QARA 2CALA 1W16A 2IH9A 2O5YH 4X7SL 5B39B 1EAOA 2F5AL 2HFFA 3FQNB 2VSCA 4KKQA 3DV6B 4MZ3A 4NHCH 4XE5B 3UZEA 3B9AA 1G0YR 2K45A 1VDGA 1G4MA 2AZAA 4RMTA 1LDSA 4KRNA 4JKKA 1CFTB 4F8LA 1UZ8A 5KBDA 4AZUA 1AAJA 1I9JL 1H9VA 5C07D 4D9LL 3J2PA 3R0MA 4MAYC 1CB4A 4PJ8B 3JSSA 4K9JA 2JCCF 3B56A 1IAIM 3CMOL 2C7UA 1NLDH 4M9OA 4PLJC 2PTTB 4XGZB 4AYMC 2D73A 4ODVL 3PP4H 3KPRE 2XZAH 5DZPA 4TRPL 4LLDA 5DGRA 2MIZA 4N5UA 2IGFH 3WTYA 2ZUWA 3KR3L 1QLEB 2WXHA 1L0YA 1VLXA 3FU9A 3IBOA 3Q13A 4J8RB 4OZFB 3RKDD 5JXED 1JGUL 4JN1H 1KOAA 1QA9B 1V27A 4D0DA 4X4XA 1INEL 3OGCA 3RYMA 3RZCC 1A7RH 3NA4A 3AS2A 3GIVA 3U0TB 3AUWB 4L4VB 2WM0A 3PQYB 4X5PA 4XO8A 3SKJL 4NP4L 4M6ML 4GUOA 5IFAL 3GTTA 4YO0A 1CI3M 1S9WA 4TUOB 1WUZA 3MBEB 5GRJH 1WWCA 1OIOA 4D8PA 3VSVA 1K4DB 3KVQA 5K9QI 3Q0HA 3X3GL 3SBRA 3FFCE 3T08A 4K7PY 3OPUA 2EDHA 2G2PA 2ZUQC 4NERA 5E0QA 4ZUUA 4X7TB 4H0GA 3SDYH 3ZZSA 1XR8A 3UYOD 3A6OA 4HU8A 2A77L 5EHFA 4ZQKA 4UYQA 5TH2B 5LNGA 4WWNA 1FZMB 3GMLB 3MRPB 2EUZA 3PFQA 4OCLC 2VZSA 1BQSA 4NRYB 3DHPA 1DQKA 4YFLI 1LO4H 5ANMA 4KV5F 5D72L 1SF3A 4FQXC 3MA9H 4OJEH 5KSAA 3KCWA 1IC1A 3WMPA 2VZ3A 4P2QD 3W2DL 3SDXA 3WTTA 2V5YA 4HPHA 3OR6B 1JHKH 3HZYB 3KGRA 4AEIH 2KZKA 5AVTB 3HZVB 4DESA 1U42A 4ODHH 5AEAA 2DICA 5F96L 1V7ML 5MI0B 5F3HB 1HNFA 4MCZA 4HMCA 1XBRA 2NYZA 3QI9D 4DK3A 1HQ4A 2CKBL 5DSCA 2XHNA 4JK0D 4JFDA 5KVMC 1KLGA 4AYID 4GNKB 3IAPA 1SXZA 4YIQA 4DWHA 3MRJA 3TO4C 1H3WM 5C2BL 5FGRA 2YK1L 4JHAH 4Y5XC 3BN9D 4Y16C 4P23C 3UZQB 4PJHE 1QATA 2X1PA 1NEPA 1NL0L 1F6FB 3QQ4B 5F7DA 3M7FB 3VXUD 1NGXB 1NTDA 3BLPX 3GPSA 3JYBA 4GP4B 4KXBA 3BD4A 1UACL 4YBHA 2YMXL 3P3SA 1HHKB 3VMOA 2R2BA 5IHUH 3SO5A 3V7MA 4BUQA 4EIUA 2Y1YA 2VLJD 4P9HL 3GMQA 2FO1A 2OXHB 1PG7W 4X6EA 2IV8A 4OZIB 3R8BB 5FM4A 2CDFA 2DQHL 2QPUA 1U8IB 3II2A 1Q38A 2R0WL 3NIDB 3BWUF 3OGOE 1BM3H 2FR4A 5EZLB 1LE9B 1X9RA 2CIKB 3QJFA 4D2NA 2LVCA 3G6JE 3NPSC 1FH5L 1QR1A 2ZTBA 4F57L 4H2AA 3RY6C 3TBTA 2AKRA 5HI4C 5CD3B 3FPYA 4HG4J 1XIWC 5BO0D 2P8LA 1FE8L 5C07E 4MXWL 3BX7C 2NY1B 1BREA 1CGYA 2HX8A 1XR9B 4H1LH 2H7WA 4N2GA 5AAWA 1ZJBA 3H9SB 4KMTL 2AGJL 3VFGL 1U8KA 1U3YA 3ULSA 1FCCA 1QWHA 3SPCA 2K6ZA 1FNAA 5E7BA 3T0AA 2MFNA 3HMXH 1GW6A 2YPLD 1F8TL 1KGCD 3MPCA 2CUIA 3DO4A 3CFUA 5JHLA 1KYFA 2YA1A 4AQ1C 1T04A 1C12B 2CGYA 3G5WA 1OPOA 2ARWA 4GRWH 5F9OL 3TTYA 3M8OL 4PJ7E 5J12B 1RURH 3MXWH 2PPDA 3QDMA 2NW2B 4FNQA 4LIQH 1GZQB 1YNTA 4LKCA 2PWDA 4BXSV 1F3DH 2E46A 5IGXL 4EUPB 2XWCA 3DX2A 2R59A 1P9MA 3O6FC 3REVB 5FUCC 4IU2A 3IFNL 1UGNA 4M3JA 1SM3L 2VDNB 1PY9A 5I17A 4R9HA 2P1YA 2X3BA 4F8OA 1F90H 1D3CA 4XO4A 2GI0A 2X1XR 4G6KL 2X4TA 4P3WA 1UVQB 3V8CA 4FQHB 5I8KL 4FLHA 3W0WD 4U1JA 5DC4B 1HT6A 1AXTH 2WO4A 5JW4N 3H1ZA 1OCOB 2WVSA 4N2AA 1JN6A 4GRWE 3BRFA 2WBKA 2X4QA 1F4WH 1NMCC 2BNRB 3QEQB 3UGEA 5A1AA 4WENB 2WYHA 3LKOA 4HHAA 3VE0B 2YGQA 4XNZC 4JCLA 1UOWA 3I3DA 4FMVA 2R15A 1FG2B 2EE9A 4JFEB 4KAQL 1IAOB 2BSEA 4N0CC 1FH2A 1FGVL 4B97A 1O7DC 3EBHA 2GY5A 4RZCA 4B9PA 4CMMA 1WBZA 3D5OF 1MXGA 2I60L 1DQIA 2DW5A 1ASPA 3X2QB 2Z31B 3E2HC 3FB8B 1OCWL 4UWQB 3MXVL 4PP1C 1Q94B 1SBSH 5FS5A 5G4OA 4GRLD 4I9XA 2R23A 2BZ7A 5KW9L 2VDMB 5E99L 3FB6A 2JSFA 2XWJB 4X6FB 1A8JH 5EEWA 1CLYL 4TL4A 1G7HA 4JM2B 2CLVA 3CN0A 3MYZA 3ABGA 2V5SA 2OYLA 4N1EA 5DJ8B 4RRPA 1RZKC 5T1DH 4HIEA 4PBDA 3O2WH 4B3EA 5DRWA 3MUJA 3UGXA 1MAML 2JIXB 2A9DA 4NRXB 3OMZA 4Z7OE 4X98B 3IJHB 4PS7A 4YC2C 5D5MB 1E3XA 4JDEA 3VI3E 1OSEA 3V52H 1WZ1L 4GFTB 2ENSA 4K3DL 1P4LB 4JFOA 2WJ7A 3ARGA 4JPWL 5F7MC 5H35B 2HPTA 3SY6A 2C9AA 4QKTA 5AW2B 5JW4M 3VG9B 1OW0C 3OAZK 2Z7YA 3DX6B 3F7YB 1GC1C 3N9GH 1ZGLA 5BS0D 2QEJA 4OLEA 2TRYA 1M3IA 2KQMA 4Q58C 3VXNA 3X17A 4JZOA 5J1TC 3LRSB 1PZ3A 2QZ5A 1AZVA 4FERA 1B9ZA 1RIHL 1Q4NX 4W9FC 3ME0B 5KBPA 4QRUA 3TFKD 5ALCH 5CM1A 4UDUA 3QIUA 2HLFD 4LLUB 2PO6B 4XZUB 2ZKHL 3VD9A 3OKYA 1WCBA 2VM9A 2XLLA 4XAKD 2EVJA 2DQDL 4R97C 3VXPB 4DW2L 1IAKB 1V7NH 1WHPA 4NO0D 4J3UA 3O3AA 3LKPB 4UT6L 2VW7A 4FG6C 5CSZA 2ADFL 1YPZF 5D6DA 2HUHA 4TUJB 1L4IA 2V3FA 1ZOXA 3UBXG 2UZXA 1XCQB 4LVNC 2ADYA 1HTYA 3GK8L 4WFED 2X89A 2Y5QA 4E41A 4PTUA 4N28A 3A21A 1DDTA 3KLQA 4HUUB 2YPLE 4NIKB 4OTXL 4E5XG 1ILUA 3EH2A 3KVPA 1UJTA 3QJTB 4LXFA 4GW5B 5HGDB 3RQ3A 4ZUSA 4A7GA 1MLCB 4XWGH 1SOXA 5GS0D 4BD4A 4FTVD 1Z0NA 1G9MH 3GRWH 1NA8A 4EQ2A 5ISZE 3OHXC 3HZMA 1URZA 4PJ8C 3ZKXC 1RJCA 2BOCB 3HG2A 1EAPA 1HE8A 1D5MA 1H0DA 4FZEL 2WZAA 2EKJA 3DURA 3H42L 4XOBA 1R3JB 3B2DC 4KHXL 1NCHA 4G1MB 2OK0L 3HE6A 3QO1A 3TCLB 4PRBB 2E86A 1KB5A 1QEWA 4UNTA 5GZOD 1FVDA 1IQDA 2AQ1A 2VN5A 2WANA 4AYBA 1U8HA 2RD0A 2Z35B 4HUXA 3VVVA 2V5TA 4FL4C 2DTMH 4KJYB 3VI4E 3F7VB 1BQUA 3MCG1 3W0WE 1R47A 2FJGA 4M9PA 5E4EC 3BIAX 4AGMA 5DJAA 3BRGC 2DMCA 1WZMA 2DLFL 2E4TA 4PY7B 1K8DA 2J44A 2WSPA 3MX0A 4HULB 4HVBA 1F5WA 3EZ8A 3ULAB 1QFHA 5TE6L 1DBBL 1VADA 4KTYA 4ZXBC 4QRPA 1ED3B 2VR9A 3SDAD 2PXYB 4Z3EA 3QJOA 3L1OL 1E4KC 2PCYA 4L1TA 1JYNA 3PWJA 4WU5B 3EOAB 1AHWB 1JZ7A 3RWFB 4E9RA 3UZVA 5L2JA 5D7KD 4HMDA 4UTCA 4YN3A 2BP0A 4ZFOB 3S96A 2XWTB 1PAMA 4HF5L 1UT2A 3DO3A 5FWRA 2K6YA 1VERA 3VJ6A 4M7KL 3VB8A 2YR3A 1DVFA 3HFML 2J8UF 4XBMA 1CYXA 5L4JA 1YN7A 1RZIB 3L3HA 5J11B 5EU6D 5K9OA 1U41A 5C7XH 3HEIB 3STZA 4YPJA 1MH5A 4NPYA 1IGML 3SDXF 3FPXA 3TBYB 3Q2VA 8PAZA 3RIFF 3S2CA 3TEUA 3L7EA 1JWMA 4R8WH 3FN3A 3RUGA 3B2UC 1A7OL 4ETQB 5TFSL 2JJTC 2NY6B 2D3NA 4JHBA 3D85B 1P84J 4WWID 1TQBC 1ND0B 1J5OL 4GI9A 4PJXE 4D9QD 3B83A 2HLAA 2E4FA 4XP1H 4HIHB 5CD5C 3MJ8A 5HHQB 5J06A 3MV8D 1NBYB 1A25A 2ICEB 3HR5A 1FZOB 1MRFL 2VR3A 5F1OB 3QNXA 4HGWA 5AVZB 1LD9B 2AFNA 2FJUB 5E2UH 3C75A 4YGVB 1RUMH 4Y5YA 4N2EA 5D6CB 4BRJA 5HYFA 5DLLA 4FQCL 5IROC 3LNGA 1KN2H 1D9KD 2CJUL 3FDWA 4YXKL 3KLLA 4BXVA 3DNKA 3PP3H 5IJBC 4XAKE 1CZ8L 1T1XB 3KHQA 5ABZA 3ZDYB 3T65A 1NLBL 3ZDXF 4ACTA 2V8MA 4FXGC 2WGNB 5DD5L 2WZ6A 2DWXA 4P5KB 5C0BA 1NCDL 1VKXB 1N8OE 3D7PA 4WFEE 3FB5A 4MJ5A 1JRHL 3H85A 3QSKB 4GLRH 1S7QB 3ZKSD 4LL4A 3MNWB 4KTDL 5IEKB 5IWLA 2VRQA 3TJEH 5J13B 5JPNB 2ZOWA 3GI9H 1L7IL 2X7LB 3EGDA 1RPQA 3QXUA 3WU1A 3EJJX 4N8UA 3SPGA 2I24N 3WLBA 5IBUB 3WDIA 1DSFL 5IVXE 1SJEA 1VCAA 5BZWB 4FTVE 3HBQA 4QMEA 4FQ1L 3DMMB 1KMGA 1VACA 1IBZA 3X11A 3L3KB 3QDGA 4Q14A 3PWVA 3CE1A 2XTLA 3GSNA 4RESB 5CKGA 5BCAA 2XV6B 2MNUA 4LAJH 3IDMB 3VXRB 1V10A 4MXQC 1Z1WA 4HCGA 3AC0A 3AG3B 5ELIA 2NR6A 1SOQA 5FOBA 3RNQB 1UURA 1TNNA 1NCNA 3CLEL 1KPVA 2BC4A 4R4ND 3O4LA 4MRBA 4PRPA 4PW3A 1OTSC 4MD0B 2X4NB 1A6PA 3DA0A 3LSOA 2AXWA 4YDZA 3SGKC 4QRTA 3D6GA 5EBMA 1CYWA 5KBKA 2QKIC 1EJOL 5SX4I 5I30H 1VENA 3BKML 2ZCLL 3FO2A 1XDTT 5DGQA 2EIEA 2A0LC 1OO2A 4DP0X 2JCCE 4HISA 3L2NA 4XVSH 2W95A 4IBZA 4OSUH 5GRUL 2ERJC 3KPPA 4E9YA 5BV7B 5DMKA 4RGOL 5D1QB 4HH8A 4PJGA 3CFJB 4M8VA 3N91A 3UJIH 5D7KE 3OMNB 4PJIB 3S37H 3ZHDA 2VN3A 3RWIA 2BSDA 5EU5B 3F7QA 1LJMA 4Z0BL 2EXTA 4BFBD 3E7JA 3L2MA 3GEWB 1K4CB 5EC2B 1D6EB 2APSA 5FECA 3RBSA 4FP8L 3KCPB 4ZMPA 4QRSA 3BQVA 1RH8A 3LB6C 3CN4A 2RIKA 2YPKA 4FG0A 5EU6E 1N3NB 3ZKND 3UYPA 4KGJA 1JYWA 4BBWA 5L2KB 1KJMA 4U1GB 5DMIH 1V3MA 2Q5BA 2YKLL 5B4MD 1HZLA 25C8L 2WWKO 1OF0A 5C0DB 5C71A 5DZLA 4Q9CA 4YR6B 3ECWA 3IDGA 8FABB 4UV7H 4XAWH 4KTGA 1YECL 2WTPA 3D18B 5L8JB 2NY2D 4HJIA 1KEMH 1YEIL 4JRYA 3N2JA 4XCYB 1UM6L 4XMPH 1GVIA 3WEXB 1U8LA 1PDKB 4RH4A 1PZ5B 1G94A 3BKYL 3L4CA 2K8MA 3BUTA 4YE4H 1UD3A 1SMOA 4D9RD 2B4CL 4D9QE 1CTOA 5DJZB 5C70A 1OB0A 1YJDL 4WW2B 3MV8E 5LXGH 3M45A 4JM2C 4MAYA 3T3PF 3PGCB 4PRNB 5DUMH 5BRQA 1S7XA 3MMEA 5KYYA 1XAUA 2ZAIA 1FNEB 4NSKA 4OQTH 4GQ9H 3V5KB 2E8YA 2H6PA 1U2YA 3QRGH 1A1OB 1LILA 1FP5A 2OPCA 3NSDA 3QH3B 1K8IB 1RPUA 4KV5E 2GK0A 5IQ9A 1T7ZA 2JI3A 1FZKB 4Z6AT 3MJGX 4OIFA 3N85L 5DEGA 4XMKL 4HIIA 3GS4A 1H6EA 3EW3B 1TNMA 2FECI 3ET9F 4PR5A 5D7LD 1UWEL 3F83A 3FTWA 2X5PA 4XVJH 3SOBL 3RGHA 3VD5A 5IM7A 3RZCA 4G71B 4WEUD 4WWOA 2E56A 1E67A 1PLCA 2NX5D 3X1EA 1U91A 1UJ3B 3FNKA 2E7MA 3C6LB 4RFOH 4TSBL 3GJEA 4UAHA 5CBEB 3N1PC 2DKUA 2OP4L 5IW1B 4IQHA 2XJKA 2PR4H 3CFKA 2ZCKH 3ELAT 5HHVH 3LH2L 3LQAH 2VW6A 3P2DA 1EPFA 3Q1SH 2DKMA 1MFAH 2XZCL 4HCIA 4F7EA 2XG4A 5D4IA 4XB8A 5CLTA 2Y6TE 1OP3H 4M7JL 4OB5L 5D1ZB 2CM6A 4PIBA 5C0AD 1MW2A 3AVEA 1QR4A 2ETWA 3DTDA 3BE1H 4CGUB 5CBAA 1PZ2A 5FB8B 1CLVA 2CDEB 2WB1A 4NQSB 4JG1H 5E6IA 3RVXC 2MHAB 1UXSB 3FUDA 4MJ4A 3SJVB 5FO9B 1FLTX 3B9KD 1X5MA 3HE7A 4L8BB 2BVUA 1GSMA 1S78C 1M7IA 3CZJA 1OARL 1NGWB 2Y9RT 3ULUF 3HBPA 1NFDF 4ZUVB 4WY7H 5FV2A 2NUTB 5DS8A 1W8OA 2CLRA 1KGXA 2ZSWB 3I85A 4PV1C 3TWCH 1E40A 3VFWA 1JVKA 2BY1A 2B1AL 4KY2A 3EF7A 1JDDA 4BFGA 3ESUF 3H7BB 1UA6L 4ZDHB 4L05A 4FQIH 4W9LC 2MEJB 3Q8FA 1PJ9A 1ADWA 4KK9C 3N44B 2EE2A 4WI3A 4RAUA 3HPJB 1ULVA 5HHPB 1AYOA 3TO4A 2AJYL 4Y5XA 3RWCB 1P84K 2GFBA 4JMNA 5LQBL 3FRPB 1U8NB 4JJ5B 3TVMC 5D7IF 3HG5A 2ZIDA 3A22A 3FTZA 5EUOA 3TX4A 3NJKA 2JKSA 4OCYL 3KWWB 5AKRA 1I8UA 4KHTL 4QWWC 5GGSB 3T6WA 1F41A 2FBJL 3ILPB 3WJMB 3NESA 1NIAA 3IXTB 3OKMA 4JQXC 5HGAA 4YDJB 2EACA 4ZZFA 5C0CA 4MA1C 4RRPG 3F7KA 4MMXA 5GHWH 1I8KA 4L8DA 2HUEA 2O72A 2OJEA 5F9AC 5F9DC 5KSUA 2OMBA 3CH1A 3GPEA 5HI5D 4XRCB 5DVMA 2OXGB 5EULV 5T1KA 4YSTA 3T2QA 1OD9A 1WC7A 1EEZA 3FN0H 4ELKA 4IEFA 4NUGH 3TT1H 3NIFF 3KPSB 3ZPDA 4RFEA 3GSOB 2KI6A 1MHCB 1OCZB 3SCMC 3SB3A 4AYGA 2VZOA 3HCVB 4D9RE 1XIWA 2QSQA 3M07A 2AP2A 4WUUA 2FGWH 4N0FA 4GUPA 2P9RA 4U4IA 3C5ZD 1RI8A 4XPFL 2GHZA 4MNGE 4Z7UF 3TP4A 3BIKA 1XZ0A 1DDHB 4G9FB 3JV6B 5GS1A 1YY9D 4OCWH 4XI5D 1A5FH 2PN5A 2WLIB 1GY1A 2QDWA 1M7DB 2QVIA 2VKWA 3RUGF 4XCCL 4LVHB 4FA6A 4F7CB 2O61B 5GSRA 3F6JA 1TTFA 2CO1A 3SQBA 4H8WH 2VRAA 1DFBL 3ATFA 5JW3L 5DFVC 4FYQA 4NHUA 1NCBH 5D7LE 3S4SB 4A2MA 2MNJB 4X6DB 5KZCB 1JF1A 3W82A 5IB3B 2NX5E 2YQBA 2ZUXA 4YS4A 1MXDA 3FZUC 1KZYA 4C56A 5J4MA 1U93A 2BFVL 1P6WA 2FWSA 4DGYH 1AIFB 2BP5M 2HSIA 1XSKA 3MJ7A 4UUJA 4WDIA 3DBXA 2IIJA 1AQHA 4M6OL 3OPZL 4PV9A 5D2LE 5I18L 3B2MA 4JKWA 4WNQB 3UADA 1D5BB 1CDYA 3V4UH 2A2QT 2R69H 1G6RA 4E36A 4XN4A 1P0SE 1ZE3C 4OT1L 3LH8A 4CJ1A 4X6CF 3BI9X 3ABMB 5F7NC 1P4IH 4KO6A 3CZNA 4RDQG 4DH2A 2BVQA 5BVPH 2H9GB 1HOEA 1S9XA 5ALBL 2Y72A 1T2QL 2WUBL 3VFPA 2DDQH 4G6AD 4F9LA 5J6GA 4JGNA 1H8SA 3K80A 2WQAA 4JM4L 5JQ6L 1L6XA 1NFKA 1DQVA 3MR9B 5D96B 4J3OF 4BK4A 3QJZA 2JELL 4MYWB 3QFJA 5J13C 4Y4KC 2YS4A 3DX8A 1TG8A 4CNIA 2NXYB 1CICC 1DN0B 2IFFL 4EXPX 5GZNC 1MCWW 2J21A 3ARSA 3P4NA 1E50A 4LPCA 4K5PA 2WO3B 3MTRA 2PW2B 1MCIA 3UGUA 2MOQA 3DMMC 1QO3A 5HY9A 4HLEA 1W91A 1T0NB 4YHLH 1OEZW 2A4EA 2OYKA 1J0YA 3WJLC 4AK1A 2R9HC 5CCKL 2BY2A 4JPVH 2Y3AA 4OKVA 2R4SL 3HZKB 2EDNA 1F6AA 1SDDA 1ETJA 3HN8A 1ZHKA 1IRAY 1HVXA 4MKTA 1AG0A 1YPZE 2DQJL 1BZ8A 3S3BB 4BDVA 4Z8FL 1KBVA 3RL2A 3A6BH 3F5WA 1JFHA 43C9A 3V4PB 2D2OA 1PG7L 1M71B 2DPKA 3DTXB 2OM5A 4UU9A 3CFNA 3NPZB 4X8XA 5DZVA 2OYPA 4UT9H 7CGTA 5EIQA 4OCXH 3HNVH 4Z77B 5IBLC 3CXFA 4G7RB 3FCBA 4LNVA 5GGQL 3C8KA 5IJKC 3OMAB 3QP3A 4ZAKA 1KCVH 5IK3A 2Q76A 5FFLA 4UINL 4IGBD 4HOXA 4H5SB 5D4QA 4OZGB 4AYFA 4IMKC 4RA3A 4UQ3A 1QLRA 3BXNB 3PWPD 1OW0A 4B9GA 4P48A 4JFYB 5BUAA 3RILA 2EO7A 1BQ5A 3HS0C 3DVNA 3IGAA 3HI1A 4R83A 2BSSB 4Q6KA 3VWJB 4AQEA 2JWYA 3UTTD 5CEZL 1WITA 3AY4A 5AL0A 1I1FA 2WKOF 5JHLL 4K5OA 2ENYA 1S9VB 3WIHH 1T7YA 5DI8A 3U46A 1WWAX 2D3LA 2Y36H 4N90E 4MXVF 4LCUB 2CCVA 5E0FA 5BO1H 2J2ZA 3STBA 5C09B 3G5YA 1QRNA 4K73A 3VQ1C 3RU8L 1FI8C 4GMTL 1BIIB 5MP6H 3NSCA 1F4HA 3ZL2A 1V8HA 3E3QC 4DGWC 4JO5A 4F33A 1N6QH 5DZ9A 1WFOA 2Y7NA 1U8JA 1I7ZA 4XXWC 4BFOA 2JB5L 1TMCB 2J12B 2G9KA 2VXQL 3II1A 4Z7VB 2CR0A 1UD6A 4PY8I 2I7SA 3GJFA 3QUKB 3I9AA 2FZ3B 2WMPB 2LABA 2YD2A 4HFUH 4X4KA 2QHRH 4HQQH 4PJ9D 5LCVA 1L3WA 1LO0L 5B39A 2WP3T 1RVFL 2BVPB 3DV6A 3L1FA 3PDOB 4M5ZL 4KVPA 4G8IA 4NIYE 4AY0A 1CFTA 3BWZA 4L0ZA 3WHE1 2AI0H 4GBXD 5J3HD 1F4YH 1MZYA 5TQ2H 2VC2L 4PJ8A 1TFHA 4EBQL 2MTAA 3QUMB 5CR1A 5ANME 1A6WL 4CMHC 1UM5L 3K2KA 3O8XB 1SVBA 2D7TL 4KQ4L 1ESOA 1N4XH 3BMVA 3SDXE 2QTVA 4XCFL 1LM8V 1SUJA 2WXNA 3QIBB 1JZ2A 4C58B 4OQ1A 3TWYA 4OZFA 4L23A 2VO8A 3L3OC 1SY6H 4PBXA 3CBJB 4O9HH 1QA9A 4R5XA 5K9QG 1AJ7H 1DVSA 3CBRA 5I1HL 2J8OA 3PREA 4NT6B 2A4ZA 5CJQH 3U0TA 4UNIA 3PQYA 4JLRB 1U3HB 3BWAB 4YX2H 3TV8A 3LN9A 3K6DA 2ODIA 4MAUH 5AVRB 5T33H 1RULL 2WWMC 3NJJA 1AKJD 1QBML 3TCTA 5DYFA 4TUOA 3MBEA 4F58L 3QC6X 2ZICA 1X4ZA 4NM8L 4PJAB 2BRRH 1K4DA 5AZ2L 1NPUA 4XPHL 5GRVK 3HR6A 4RETB 5H4YA 5HD8D 4DO6A 1YEWA 4KUCD 3UDWA 4F27A 3BO8B 4AUYA 3F3HA 2FYYA 3ARGD 2BS9A 4HXBH 4L2LA 1I9EA 2E6JA 3R7QA 2AV1B 4OCSH 3RTQB 4X9FA 3ZDXE 3G6DL 2HFEA 5TH2A 3VDAA 1ITBB 1ZEAL 1FZMA 1XCWA 2NYYC 3MRPA 4NN7C 1JS4A 4P2RA 4NRYA 4AE1A 3K2MC 5A7BA 4L3ED 1PKQB 2IFGA 2OMYB 1U2HA 3WS3A 2C5DC 4WEBH 1KC5L 4P06A 2ED9A 4BHUI 1N59B 2WAHA 2JVUA 3OR6A 3HZYA 2QBWA 2VXUL 4MAZA 4U0RB 5E00B 5ITBL 4LPVA 5F7EH 3THML 5F3HA 3FMGH 3WEMA 4AL8L 3FU5A 3LXAA 4PG9B 4PQXA 1EHNA 5EC1B 4HSCX 3ARDD 3UAAA 1E6OL 4XPTL 3HG1A 3WBDA 5T3ZL 1NAMB 5JMRA 4DQOH 4O02L 3WY1A 3UTTE 7FABH 2WSKA 2X89D 1S5IH 4WJKB 1II4E 4I85A 4IBWA 3UZQA 5IFHH 3VXSA 5EEXA 4ZO9A 2JKRM 3LIZA 1NGXA 4FFYH 2YAPA 2FIKA 2P5EB 1T4KB 1HHKA 4TKWA 3ULUD 4IKKA 3M46A 4U6YB 3SN6N 1RIUH 2H41A 3IMUA 5EOTA 3D51A 4J5VA 3BPLC 5B1JA 3QDME 2OXHA 3QORB 4YMPA 4FXGA 3RP1A 4OZIA 1U8IA 1NUGA 3WNNA 4DPCX 1FFRA 2F1BA 2R2EA 3MC0A 4XNXL 3V7AG 3WDJA 2CLZB 1SEQH 1MCOH 5EZLA 3DXAB 1K6QL 4HWUA 4YSPA 1LE9A 2OQJA 2VWEC 4Y9CA 2XTSA 4APQC 3SD2A 2AJVL 2H6OA 2WXOA 2O6PA 3GHBH 1QPXA 3AXLB 4LO9A 3DSFL 4RA0C 4O2CA 5CD3A 4N8CL 1HE7A 2R29L 2WUCH 4L0PB 2BY0A 4H25A 4LBEA 2UY6B 3VRLE 3E9TA 3CN1A 4HOMA 1XR9A 1AP2B 1EERB 1ZA3B 3GSQB 5K59F 2GI7A 3H9SA 1IBGH 3A4DA 3QXDA 3ZBMA 3CSFA 4P9ML 3HI6L 2AJ3B 1KCKA 5E2VL 1TQCB 1THCA 4G1EB 5LVEA 2ITCB 1N68A 1C12A 5EB9A 5ESAB 3DIDA 3FBKA 5F0JB 3MAWA 4TSAH 1WFIA 1DVFD 1P7BA 1T4WA 5FO7B 4U7SA 2W80C 3VXQB 1CMOA 1MQ8A 2NW2A 4POZC 3VGEA 1GZQA 2X4SB 3VWKD 4EUPA 3W9DB 3IKCB 3KS0H 3CDCA 3H9HA 5E70A 1DO5A 3REVA 1JFQH 1H3XA 4HMEA 4OFQA 3IU4L 4K15A 5FGBC 5DQDH 1NCOA 5D1ZI 3C60B 3T71A 1PQZB 2XOTA 4FS0A 3QXWA 4U1SA 2XETA 3ZHKA 4EI5D 4Q9QL 3C5XA 2P80A 4JO1L 4P3CL 1UVQA 2VLLB 4FQHA 2BW4A 3ISRA 2B5IC 2X9XA 3NA9H 4OGQC 4ZMQA 3VSQA 1FRGL 1CD0A 5I73B 4JG0H 2G2RB 2BNRA 1J0JA 2XXCB 3VE0A 2K9FB 3FO9B 1T89A 1T03L 1KJVB 3NCMA 5LJYH 1ZS2A 5CINH 3NABL 1DZ0A 5MEPB 4DZ8B 1FG2A 3MV7D 4JFEA 5JW5B 3MRLB 1OAYL 3NN8B 4IOSA 4AZ8A 3NFPB 4MD5B 3ULUH 2BSTB 3NT0A 2F54A 1CL7I 3MYJB 2XN9B 4Z7WB 5I6MA 4LSSL 2K8QA 2BK8A 4NJAL 2JTYA 2VR4A 4FG4A 1U8CB 3E0GA 3BGFB 4OUUB 3F64A 3FB8A 4LB8A 2DYPB 4A2GA 3SDDC 3QGVA 1Q94A 2F9BT 1BEYH 4F8NA 2IQAB 1JIBA 4ZQTA 2XWJA 4NZRL 1AMYA 4JM2A 2BINA 2ZT9C 3NIGB 2EZ0D 5DJ8A 3EYOB 4E41E 5BUGA 1CGSH 4QRRD 3TA3B 4NQEB 2D7OA 1G7JB 4KKCD 2VDPL 2JIXA 1BAWA 1IC7H 1BYOA 2C34A 4TUUA 4Y9GA 3IJHA 3ZDZF 5D5MA 1PLAA 1COBA 2PP9A 3C8HA 3F2LA 4GT7A 3ULUE 3CVHB 4AT6B 1NFDE 1XSJA 1DVUA 4P4KC 3VG0L 3GSNL 1JV2B 1UQSB 5H35A 2VLRD 3FYEB 1ZLDA 1UWFA 5TDPA 3QDGD 4H0HB 2D9CA 1Q1PA 1R3LB 2YWYA 3DX6A 2HT4D 4G7VH 4OF7A 1J12A 2BP8A 3F7YA 4P46C 3MDJA 1RMFH 5J6HB 3NH7H 1KN4L 4TNVF 1RQ5A 3QHZL 4X0KB 5CLZA 5JA9A 4PJBF 1BFTA 2VB5A 5E6ZA 1SEBA 3LRSA 1O75A 4N20A 4PGBB 4TSCL 5CJ8A 3CK0H 3ME0A 3HHMA 4XOEA 5GGVL 5D7IE 4M29A 4X5XA 4LLUA 4TQ8A 1XGPB 4JO4L 2PO6A 4XZUA 3B8SA 1RLBA 4DVRH 1WVZA 2NNXA 3L9YA 1KELH 1MCSA 3VXPA 1IAKA 3T2PA 3BD5A 2MKLC 2FO4B 4P2AA 4EN3B 3COOA 3GBML 2DJSA 4F5CA 1BF8A 2C4FT 3SKUD 1J0IA 1YYLH 1HQRB 4KK8D 4E9XA 3V0EA 3N1GC 4TUJA 2C3GA 4QRPE 1H8OA 1XCQA 5F89B 2A1WL 2FEJA 3RB5A 3GSWB 2GT9B 3LKQB 3UX9B 2J43A 2C1PB 1J1PH 2XZZA 4HUUA 3GBLA 1DQDL 3A3YB 2YO3A 4IMLA 4OVUA 3ZYJA 1G9NL 15C8L 3OQ3B 3P0VH 4GW5A 5HGDA 2Q10A 2LV4A 1MLCA 3ZW3A 5JIPA 2VDLB 3ZZLA 5EO1B 3FQXB 1DVXA 2GIMA 1E43A 2Q7AA 3GQFA 1O5DT 1RFDL 2LE9A 2R39A 3P2BA 1U95A 2BOCA 2QPEB 2Y5EA 3IAQA 3V55A 4N2CA 1WRFA 1ROWA 1IEBB 3L2LA 1YYML 3OTTA 2EDYA 1R3JA 2LU5A 4G1MA 4Y88A 4BELD 3TCLA 3M1CA 4M3HA 3CCHB 4PRBA 4W9IC 3ZL4H 4MJID 3RUGE 2ENQA 4ZS7L 4YHPA 2XA3A 1TZHA 1ADQA 2Z35A 5ICUA 2F7QA 1GY2A 3AS0A 1L9OA 3RL1B 4GW1B 3S9DB 4KJYA 3D07A 3GC3A 5JR1L 4GSQA 4R90H 4JQXA 1MREL 4PY7A 3SGDI 1EEQA 2MPAH 3SO3B 2EE3A 3LMJL 3QIWC 4MAYD 3NSJA 1J0ZA 3D52A 3KPRB 2IG2L 3MV7E 4PLJD 2WXRA 1ED3A 2PXYA 1QX1A 4JKPL 4WU5A 1AHWA 2ATPB 5A43C 2X2IA 3RWFA 5FOJA 2QSCL 3NK3A 2GKIA 1TETH 2OULB 4AQZA 4ZFOA 4OLYL 4YSDA 2XWTA 1FFOA 4OLZL 5D55A 3LY6A 1G6VK 3DHMA 3UC0L 5EU4B 3DBSA 3FRUB 4H8UA 3H3PH 5I1GL 4X6CE 3RZCD 4JREC 4K3JH 1INDL 1GZPB 3WIIH 3GI8H 1A1MB 3UTSD 3G7TA 5C0BE 1X9LA 4NKIL 1KENH 3LRMA 4B6ZA 1YSOA 4RMVA 4QRRE 3VW3H 1EHLL 3QZMA 1HWGB 1MCKA 3CMOH 4ESKA 4YPGB 5AWNH 4NI3A 1IKFL 1BECA 4LLVB 4ETQA 1KIPA 2WN2A 4XO5A 2ATAA 4TRPH 3CXDH 3DYPA 5DVOA 3KR3H 3D85A 1FLRL 1VGKB 3QEUA 4A6YA 5JIQA 1JGUH 4AUJA 4K3EL 2FRGP 3QDGE 4Z3TA 5I5IA 1D7DA 4YDLC 2XBTA 4HIHA 3LZOA 2FHCA 3Q48A 1RUQH 1NBYA 2ICEA 4J6RL 1LD9A 2QV2A 4WAFA 4YGVA 5B39G 4FQXD 4ZYKB 5IT2H 2Y69B 3VQ2C 1LMKA 3MBWB 4N6QA 1BX2B 3CNKA 3FH7A 5IFAH 4GG6F 4AI7A 2J25A 4ZPTA 1EUTA 4DP2X 3BPNB 5D7JC 2IAMB 2L0DA 3P0GB 3O4LE 5T8IA 4PRPE 4RMQA 5CN2A 2WNGA 3V6OC 2WLMA 1T1XA 2IPUG 2VMJA 3PWNB 1OSYA 2Q3XA 2W81C 3RLSA 2YARA 5IESL 4P5KA 1VKXA 2A77H 3TO4D 4FLSA 3BIBX 4OZFG 1CFNB 4ONGH 5DHXB 1S7QA 4Y16D 5IEKA 2ZXQA 1NIDA 2QSTA 3MNWA 1I8MA 2H6UA 3AWEA 3NRPA 2Z8SA 4PJGE 3GBNL 1JXJA 4P23D 4ECNA 5JPNA 4Y4KA 1N8ZB 1MY7A 1AG6A 4UT7L 2X7LA 1WEJL 4HFWB 4RGNC 3WN5B 3U4KA 1A65A 1Q72L 2OV0A 4FXTA 1D5ZB 4BWWA 5BZWA 2EDKA 2YSSB 3K4ZA 4TYUA 3DMMA 3WIAA 2X3AA 5F96H 1TEFA 3NJMA 1S4IA 1LO3L 4H40A 2CKBH 2H2PC 3MCKB 3V0AC 1OF2B 3IDMA 3VXRA 4AJVA 2ZWNA 1JE6A 3O3UN 5E4IA 4KK5C 3K4AA 3S35L 1GS8A 4OCRL 2JJSC 3T0DA 3LDBB 3G6JB 5F1NB 1RZJL 2YK1H 3RNQA 1AACA 4X9IA 5KVGH 2ZOOA 3CLFH 2ZAGA 2E6PA 2CO4A 1NAKL 5FC9A 5IJKA 1NL0H 4H20H 3K8LA 4MD0A 5C07B 2X4NA 4NNPH 1XGRB 5HI4D 2WNWA 1XIWD 1UACH 1ZT4B 5LNDA 1IB5A 4WUUD 4KVCL 2YN3A 3KJ6L 3VQLA 3FSZA 5DD1L 4BHUA 4KOBA 3IN0A 1H3VA 1YEKL 5HJGA 1NQBA 5KS9F 3IMRA 3HS0A 3GSXB 3II3A 5GS2D 1OHZA 2VXSH 1LO2H 2UY7B 5EO9B 4MJ2A 3ILQD 4HP5A 3RBGA 5D1QA 4MNHB 3BH4A 3CFJA 3IDYB 4PJIA 4ZS6C 4YWGL 3V7AE 2P45B 4YXLH 1I9RL 4PJ7B 5EU5A 3BC9A 4HKZB 2ZG1A 1K4CA 1L9NA 1MJUL 5KVGE 1D6EA 2AQ2A 1A7PH 1UD8A 1FH5H 5FHBL 3QPKA 1IM9D 1YDPB 2BRQA 1F42A 3V8OA 2CJSA 3KH4A 4C56D 2APTA 2WYZA 2EDBA 1N3NA 3D39D 3KM1A 3O6FD 3BAIA 4H1LB 1IARB 4QUOA 5L2KA 1FE8H 1I8LC 2ZCHL 3HC3H 3RA7L 1G6RL 3O45B 1W6WA 3PFUA 1WAAF 4NN6B 4XNQA 3IDUA 5E08L 5C0DA 1BVLA 4YR6A 4P59L 8FABA 5E8NA 1AZUA 3KYKL 2VRKA 2O5NA 4XCYA 5LAXB 2PCFB 2ZCZA 3PIQB 1PZ5A 3BGFC 4GRWB 3VFMB 2H0PA 5CCJA 1NANI 2V0AA 3K1KC 4HWNA 4Z3JA 3TF4A 2F1EA 1JZEA 4EEEA 5IUCA 3CAFA 5DJZA 5F9OH 2XXMB 1A7QL 3M8OH 5DQJB 1PNDA 3PGCA 4PRNA 4P2QB 1J7VR 2RACA 3TBVB 4EDXB 4QTIL 3VXMD 1FNEA 4HUCA 5FA4A 2HKFL 3V5KA 1A1OA 2NY7H 4R26L 1K8IA 1FIGH 2R2HA 2KLSA 4ENZA 4F9PA 2FH8A 2IDCA 4N0CD 5D71H 1OOWA 3QI9B 1CK0L 1OSPH 2CHXA 4WGWB 3VTMA 3L3OA 1D2OA 4BSVB 4YHZL 3WTUA 1NIEA 2Y06L 4KNUA 1KTLB 2AF2A 2FQEA 3ZRCC 4X80L 4DK6A 1UZ6F 2VERA 5IOPB 5I8KH 4PP1D 1R1CA 1XBDA 4BKLB 1S3KH 3ZYZA 1UJ3A 4U3HA 5CWSA 3MLZH 1MKFA 5F0MB 4HWEH 5CBEA 1IBYA 5IW1A 2FEDC 3VXUB 3DC0A 1JZIA 1YY8B 3U0WL 3ZJAA 5EUOE 5CFHA 4YL9A 1CTNA 2VLJB 1MCLA 1QW8A 4HS3B 2GSIB 4EUPG 1OGTB 3UTZA 4OY9A 1I1AC 1AR2A 3FH5A 4BFNA 1WHOA 3WY4A 5GS2H 3EYSH 4NDMB 3MCLL 5D7SL 3ROOB 3UFIA 3R4DA 1M9WA 2CO6B 4M62H 2QR0B 4F7PB 4QRFA 2F7OA 2CDEA 4NQSA 1OCWH 5FB8A 4I1PA 2MHAA 3BKCL 4JUTA 5FO9A 3SJVA 4X99A 2WLKA 5E99H 5KW9H 4FLRA 1EFXD 2V7HB 1EHKB 4ZUVA 4M93C 1MFBH 3H2WA 1MAMH 1QRND 1F2QA 1NC4D 2CQVA 2ZSWA 3GMMB 3MRHB 2KDGA 4XPGH 3ZMEA 3FYIB 2G3ZA 4TVSa 1BQKA 3HNSH 4RQQB 3H7BA 3W38A 4WUUE 5IF0B 4ZDHA 4AITA 3AABA 4UQCA 3CPLA 2EINB 2H47C 4JPWH 4FG6D 4K3DH 4ETYA 5A2IH 2Q8AL 3OKOB 4OBRA 5HHPA 2CXKA 3HPJA 4WV1C 4LDOB 2YPLB 3CSPA 3RWCA 5AB9A 4H8QA 1H5BC 3SKMB 3FRPA 5F44A 1U8NA 3N42B 5BQ7B 1OAQH 3WY2A 1KFGA 3ARXA 1MW3A 1A0QL 3ULVC 2XV3A 3E6FA 3RGVC 1JF6A 3KWWA 3RB7A 3G3LA 4KMLB 4GS7B 5GGSA 3B3IB 4HSQA 1RIHH 3ILPA 1AC6A 4M5SA 3IXTA 3K8MA 2EEDA 1AFVL 1X7TA 1RU9L 3KYMB 4FLOA 4UB0L 4YDJA 3OX8B 1OT2A 5HTSA 4TQIA 3DOSA 1WTLA 4C56E 2JJVA 2H45A 2DQDH 4PJ8D 4DW2H 2G5UA 2E7CA 3X14B 4UT6H 5FUCE 1UYWL 4LF3A 4XRCA 5ID1B 1QLEL 2OXGA 4AEHL 1ITCA 5JNYB 3OJVC 2OMZB 3LNIA 1AZNA 2ZD0A 1ERNA 3PUCA 1M05A 1WFUA 2AW2A 3PP3K 3VI4B 3W0WB 4APQA 5CEXB 1JTPA 3GSOA 3A67H 1I3GL 2XJLA 1MHCA 3OKEB 3EHBC 1EIBA 3DX3A 5FYJL 4OTXH 1IX2A 4HC1A 2YPVA 4TQEH 4Z9KB 4ZD3L 1EO5A 1CXEA 4ZFQA 4TTGA 3HCVA 1DP0A 5A2KH 5DRXB 1FPTL 2R8SL 4WEMB 2CGRL 5HGBB 3VFVA 1NEZB 1GJWA 4M6NL 2BERA 1OWWA 4XP5H 2V7NA 1DDHA 4G9FA 4ZXBD 1N0XL 3M17B 4A66A 1I7UB 4FXKC 2B2XH 1M7DA 1J8HD 4CU6A 2YQGA 4F7CA 2O61A 3H42H 4GIPD 4ABWA 2KDYA 3BP5A 1DSWA 4J3XA 1O7DE 5I1LB 4QY8A 5ERWA 5IKCB 1MNNA 2EUVA 4K2UH 4OV5A 3GLEA 5KYUB 4NO3B 1KB9J 4GRLB 3S4SA 5AZEL 5JQIB 1MG3C 2WBJC 4G8GD 4X6DA 3W57A 1GC1H 1VFUA 2K78A 3VFTB 5IB3A 3FCSB 2A7BA 3L3JA 1ZCRA 2H5UA 1OTUC 3F7PC 3UJTH 3ULVL 3U7YH 4N1CA 1JK8B 4HT1L 4WK2B 4P2RD 2ICES 1AIFA 1SYSB 3PXLA 3SYQA 2ZZUT 3QR2A 2DL9A 1B9KA 3OJ2C 3AXHA 2YRPA 3D0AA 3EFOA 3GDCA 4WNQA 4BFIB 5IR1B 2CNZA 4HIXH 4Y89A 5I1IL 3B2UD 3OLGA 3NTCL 1LL1A 5KYWB 5EZOH 1PPIA 4GT0A 4RVBA 1RZFL 4TNEA 1RJLB 4G3YL 4HS6B 1QNZL 2BHYA 4KKLC 4JS7A 3TJHC 3MLVH 5BS0B 5L4IA 2H9GA 3B9EA 3T3MF 1MNUH 1D5IL 2ZX5A 3HG1D 5CD5D 3HFMH 2OMXA 2WGXA 3ARWA 1NDMB 3GXDA 4ISVB 4OM0H 3SBWA 2HX7A 3MR9A 4MMZC 4YK4C 5LCVH 2R0LH 1AANA 3ZO9A 5FHAH 3RX5A 5JIDA 3GZQA 3V4VA 3UO1H 3VXSD 5IROD 1JD7A 4TULL 1IGMH 3J27A 5HYIA 3U6RA 1WFMA 1DN0A 4FNLL 12E8H 3PWUB 4PJCF 1QRNE 2HWZH 2PW2A 3UTOA 5L0QC 3D50A 2Y5TA 3H3BC 3IFPB 4HIJB 2VAAB 2EDJA 1C8PA 2EDWA 5GJTL 2FECL 3HZKA 1QHQA 2NY5C 3FB7B 2FB4H 3KE0A 3POCA 2DWEB 4OGXH 4KZCA 3E8UL 2KH2B 4UMSA 5H37H 4W68A 4WK0B 4WSGA 4JGMA 2ALAA 1MRFH 4JO2L 4PWIA 1M71A 3QZWB 2R83A 2JE8A 2UZPA 2G5BB 4FTVB 4HZAA 4Z77A 4CADA 3TS8A 3MSPA 3AREC 1T2JA 3CPUA 4LCYB 4YNYB 4A7TA 2F2HA 4H5SA 1YMHB 3DHJA 2G0KA 4HX1B 4DP7X 3KYAA 4G5ZL 3BXNA 5LHDA 3EO0B 1CZ8H 3MUZ1 1KLUB 2MCMA 4IBUA 5AVXB 2XSKA 3BSGA 2BSSA 3NZHL 4URKA 4G8EB 1J88A 3H9SD 3O4OC 1WIUA 2H26B 1J87A 2Y7LA 4M8QB 1EMTL 2Y1ZA 4MXQD 5DD5H 3WD5L 3GLZA 2AXJA 3TNMB 3TEYA 1L9TA 1NCDH 5ETUB 1T20B 3KZ8A 3ZKMC 5F88B 1PEZA 4Q7DA 2LR4A 4LCUA 3V0WL 1WWBX 4XXDB 4DGVL 5J56B 5C09A 3EFFB 4R4FL 4M3KB 4LHJB 1E5YA 2D4FA 1OTSD 4HU2A 4I0PC 4D7BA 4P2YA 4XP6L 1UHVA 1BIIA 3EZJB 3UJJH 1F0LA 4A68A 5I0YA 3H8NA 3SDAB 2JCCB 2VDNL 1F4AA 2NOYA 1AQKH 4FQ1H 1TPXB 3QR0A 4KZDL 1SJXA 2C3VA 3AG2B 1GJIA 2A0LD 4Z7VA 2XFXA 1DBAL 1J8HE 4R7XA 1T1WB 4ADGA 2FZ3A 3QA3B 4D3CH 3JWOC 2A4CA 1OK0A 3EOTH 1MCJA 4GKOA 3VXOB 3LH9A 3U7AA 1RK0B 2BVPA 4WFFD 1PZCA 3O2DL 3PDOA 1PTZA 3IETB 5CJOH 3U4BL 3BJ91 1TU2B 2MOGA 4RMUA 5LG6A 4LL1A 5FFOA 2HN7B 5A7EA 5B8CC 5FYKU 3TYGH 4AQAB 3LB6D 2AJZA 5HGGS 4M8RA 1URIA 4P2RE 4AWJC 4AMXA 1JPTL 2FIRT 1XF2A 1JGVL 2FT8A 3LIZH 5IBUG 1EJOH 3O8XA 4IOSD 1CE1L 3BKMH 5DT1L 1E5BA 3BVTA 1FIEA 5E1GA 2D7QA 1U21A 3MGTB 4L18A 3BSZH 2F54D 1MF2H 2WLYA 5GRUH 3AXIA 1HESA 5SWZA 1NCJA 3LV3A 1D7CA 4QHUB 4WO0A 3WFBH 2VDML 5CXPA 5HJ3B 3MFFB 3NCYS 1B0IA 1FUNA 3MV8B 1J9TA 4NT6A 3U9UB 5FM8A 4Z0BH 4FA7B 2YMTA 1KJ2A 1U3HA 3BN9C 4B5EA 3KYNB 3HG1E 3IK2A 4IRZH 3BPOC 5MHSD 3B43A 5GQBA 2DKSA 2ALWA 2I32A 5F8RC 1JZ5A 2H1PL 1EA9C 1VFBB 2R56H 5DS2A 1D9KB 2AZUA 2DN7A 2J3SA 3VFOA 4NO5A 2A9BA 1ASOA 1U8OB 3FXIC 1BP3B 3QJHB 3VXSE 4AIZA 1X5YA 2H32H 3ZE1F 4O00A 4P57B 4QKXB 1AXIB 3SDCC 4O58L 4ZO8A 2Y07H 3MLWH 4RWYH 3WFHB 5BUPA 2A38A 5HYEA 1KSRA 3BO8A 3BAKA 3D1MC 4R2GC 4Z1PA 2AXFB 2X4OA 3ZHNA 5HPMB 2ZKYA 1YEIH 1SLXA 2AV1A 3RTQA 3MLPA 4Z7NE 3QE5A 4OZIE 2A74C 4YDNA 3UOAB 1YEEL 4QO1B 4PVMA 3FTXA 1ZLWK 2PW1B 2ZXGA 1X5ZA 3NIDE 3LN5B 2N7AA 2UXGA 3DUUB 1PKQA 3MKGA 4KZEH 1N70A 2OMYA 3MRIB 2FSEB 2H3XC 2X0VA 5A2CA 2O6EA 3MNMA 1WYJA 1SXAA 5DQ9A 3UABA 3MOBL 2D7NA 1N59A 5FFGA 5E00A 5L88H 1FG9C 3LHPL 4Y4HC 4C55A 5JLZB 5IB5B 1EAQA 1UB6A 2XT1B 1GSKA 3PV6B 4PG9A 4ZMZA 1LK3L 5K39A 5EC1A 2EIZB 2Z64C 1PU0A 5FGCE 2YLKA 3JWNH 1NAMA 3SOBH 4KH9A 3H9SE 3RVXD 1PL3A 2HXAA 1KB9K 1AQDA 1ET8A 3NJFA 4BH7B 1A3RH 1RUAH 2G5RA 3NFNB 1FV1B 3QG7L 1S78D 4JRLA 2GABA 3D25B 3GB7B 5D7JA 5F3BB 4GS7C 4EZJA 2Z9TA 1BQHA 1T4KA 3PGDB 3TN0C 4ZFFB 2PCPB 3G5VB 4U6YA 3I6LD 5TQ0H 2XZCH 1HL4A 4LSRL 4ANKA 1HILB 3QORA 5B7MA 1BVKA 4JX0A 4YBLC 1KIQB 4IS6B 3ZVVA 2EUXA 4LLAA 3N41F 1SVCP 3P4MB 3E9UA 1CU4L 3HG0A 3WSQH 2XXGA 3ZQWA 1A22B 3AFLA 4I5BB 5HI3C 3ZTCC 2CLZA 4DP1X 3LNFA 3TVMD 2GBTA 2X70B 3JV5A 4N3TA 4WFFE 4QWWD 5FYKL 4N4YB 3AXLA 5D9SB 1NGZB 5D8JH 3ASOB 2P28B 3GM0A 5KYXA 2UYLB 4HJTA 4DUWA 4OFPA 3TV3L 1CG9B 3K81A 3LD8B 2UY6A 1ES0B 2B1AH 2BIPA 4YAQB 3W11C 2AAVA 2VZVA 1ZA3A 1DVYA 3CN3A 3FJTA 1HDMB 1GHFH 3GSQA 3OF6D 3PDGA 3GNML 4X9GA 5C2UB 3QJQB 4LT7A 2NY2B 2AJ3A 3NGBB 2K4AA 4MKMA 2JJSA 4ZFOL 4OZ4B 2P26A 3ZR6A 2WQRA 3AROA 2AQQA 4L5FH 4G1EA 4GAGL 1RD6A 2F54E 2OTUB 4AV4A 5E5RB 2ITCA 4RRPM 3TPKA 1Q0YL 3ZE0F 3IJSB 3SCMD 5ESAA 1LO5A 2EXSA 2RA1A 4J27A 3WG7B 3ETBF 4KHTH 5FO7A 3VX1A 3FQ4A 3ZQ9A 4JRFA 5KJ4A 3CFBA 2X4SA 1IFHL 2FBJH 4L1DA 3NBNA 3W9DA 2XYCA 3LNHA 2RHEA 2Q6WB 3LPGA 3PHOB 3H55A 2XTJC 2J5LB 4NQTA 1ZGLM 5HHMD 1WT5C 3IMTA 4YOKA 5CCHE 1IGYB 3OKDB 5I16B 4IHBA 5I19H 5D5ME 1F3RB 2WP3O 4WHTB 4XN5A 3MOAL 5D7LB 4IBVA 2VLLA 3O0RL 5FKPB 3C09B 3PRZA 3L16A 4L5FE 2AITA 4NCC2 5LB1A 3BEVB 1CGTA 3D69B 2NX5B 2Z7WA 3OLDA 3PU7A 5DFVD 4LRNH 3C2AH 2VQTA 1G7QB 4YFLF 4IKLA 1AH1A 2PUQT 1H19A 3RWJA 2Y2YA 4KO5A 2G2RA 2IALB 2X05A 3FO9A 3FRPG 3FZUD 4ONFL 1IC4H 1KJVA 3H6JA 1X5LA 2BM3A 4FJYA 4RFNB 5MEPA 4P3DB 3LZPA 5ACMA 5JW5A 2CRYA 2W0PA 4XPFH 2WXQA 4WUKL 3NFPA 3APNA 4MD5A 3ZXAC 4EDWL 4KQ0A 4U3XA 3SKOB 4G83A 3MYJA 4Z7WA 2XN9A 5DU7A 4PD4K 2MMXA 3QW9A 1XF5B 4IRSC 3S37X 1JI2A 3MUHL 5C0AB 3CSGA 5CEZD 3U48A 4OUUA 4YLQT 4JVUA 2CD0A 2C4FU 2DYPA 1DFBH 3N0PB 3N5AA 4JANB 4F5CE 4C57C 2IQAA 1E0OB 5L6YL 1KV3A 3B9KB 2AQ3A 4LESA 4OFYD 4RISH 2Q2LA 4JO3L 1GGTA 3WNOA 2IDUA 4MQ7A 1HCZA 2BOBB 4O5LL 3EYOA 1UXWB 1DQJB 3STLA 3TA3A 4NQEA 4NZ8A 1RUKL 4NKMB 4Q8BA 2COVD 3EYVB 4Y4KD 4Y9EA 1Q9LA 1L6ZA 2ADIB 4LLQB 4ZX5A 1N2RB 4M6OH 1CICD 3H56A 5GZND 5I18H 3N43F 3CVHA 3OLEA 1EHXA 3I6LE 5E1IA 4TXVB 1JV2A 3IM1A 2KT6A 1G7LB 4OT1H 1R3IL 2WYIA 3NSXA 5C3LD 3IJ8A 5KSBF 2R9HD 4WHYH 3NJIA 3VH8B 1YPZB 1R3LA 2QZQA 3MFGB 3VTAA 5IHLB 3D48R 4MASA 5ES4B 5GZOC 3ZZ1A 4YVUA 1LQSR 2IDQA 2PNDA 3ESPA 5J6HA 4X0KA 1T2QH 1HL5A 4PGEB 4D0BA 2W65B 4JM4H 1GGCH 3S4SG 3S98A 4Z7QE 3K72B 4DPBX 1E2WA 3L95B 1M4KA 1NCIA 3O9WD 4HKXB 1XGPA 5FUOL 5IBLD 5HHOD 1SFDA 2OCFD 2UZIL 3PDDA 5EDXA 5KVEH 3S88H 5I66B 2ZG3A 2IFFH 2XC8A 5F6IC 2C7UB 2NTFB 2OZ4L 4JQIL 3KWUA 1Q9OB 2N3JA 4EN3A 1C5CL 5EA0H 4AG4H 1TPXC 1VEPA 4HOWA 5BV7L 3LEVH 4LLDB 2RCSL 4QR7A 2YBGA 5MERB 4TN9A 4I3SL 4HCRL 3ARQA 5F89A 3SD5A 1KXHA 4MDJB 5C0RH 1DN2A 4PBWD 5AOLA 2C1PA 1IBDA 2AMGA 4D0DB 4QXVA 4X4XB 4NBZB 5K1NA 2DQJH 4FKEA 1KYAA 4LSPH 1K3IA 4Z8FH 1QFWH 2Z7UA 5TPWL 1NMAH 1EJ6A 3OAYH 2APVA 1OAJA 5DWUH 1GZHC 5DUPL 5EO1A 4LU5L 1MJ8H 3C5ZB 3FQXA 1ORQB 4U6TA 5CZXC 1FAIL 1FSKC 1OGSA 2UXVA 4KXDA 2ZQKA 5F2FA 1Q1JH 5GGQH 1TITA 1MHEB 4YO0B 4KY1H 1K5WA 5KVEE 1MFVA 3LKSB 5A3IC 3NRQA 4KRLB 1EJFA 4D8PB 1U2CA 2EYRB 5HYJA 1KXVA 2Q8BL 5E6RB 4DTGH 1SPDA 4WV1A 4EZKA 4KC3B 3NCCB 5HHME 5FF6B 1ZE3H 1RP8A 2SODB 4X5LA 4XMWA 5CEZH 2NY0C 3QEGH 3NQKA 4W70A 3VMPA 1B0WA 1D5RA 3PHQB 3RAJL 4TV3A 3RL1A 3E6HB 2CCLA 3EJZC 3NOIA 5F0PB 3TBBA 4DUVA 3WFEH 2Y25A 4PAZA 1A6TB 1QSFD 2IEPA 2OJ1A 5D93C 2YGOA 2VQUA 3VD3A 5LG1A 5ANMB 2YFNA 4GFXA 4X4YB 4JPKL 4GMTH 1J1XH 3KPRA 4JHVA 4ZG1A 3SYCA 3X1GA 1DQML 1FHGA 3SDXB 1MRDL 4IBQA 1Q0XH 3VB9A 1ZWIB 2WIMA 2YA0A 2B0SL 2ATPA 4PEEA 3T2NL 3ZTJG 2E9IA 4PJ5D 4PHXA 3WNJA 2JB5H 1MVUA 4LVOB 2VXQH 2JV6A 1Z0MA 3GEFA 2AANA 4Z5RB 4MCZB 4MA7H 5T3ZD 2DQGL 1HQ4B 2IVFC 2C9QA 2WLZA 4XZ4A 4TS6A 3MCYA 2I9LB 5DJXA 1ZLUH 5EU4A 3FRUA 1CDHA 2I07B 1LO0H 4PS4L 3MRJB 1IVLA 3HNTL 5I8CA 1GZPA 2EXWC 5CR8A 3QAZB 1A1MA 3HMWL 4EKXA 3K74B 1F2XK 3LRGA 4JMXA 3T3ME 3I50H 2WWMD 3TEXA 3RFRA 1FAKT 3LZNA 4FXKA 4MQXC 4K7PL 1QP1A 1A6WH 2R2BB 4TF4A 3K91A 4OF6A 1UM5H 4LLVA 4B95C 1KBPA 4CDHA 1H9DA 1QFUH 1UENA 4XCFH 1GGIH 4X6EB 1V54B 1VGKA 1SYVB 3ZDXB 1S6NA 2J6EL 2WVTA 4L8SB 2CWRA 2CDFB 2WBJA 3F84A 5JPMB 2LLGA 3FF7A 3N04A 2NYYD 1BDYA 1OM3L 2ZUUA 3Q8BA 1OVZA 2MOVA 4K94C 2X2JA 2X3CA 2EP6A 4XR8C 4ZYKA 1XEUA 5E2WL 3MBWA 3OL2A 1QR1B 4TVPD 5HVGB 3GBEA 3LIUA 4OLWL 3PGFL 2IAMA 5TE7L 2NPLX 4IGBB 2DQCH 4PMFA 1DL7L 5EN3A 4NJ9L 4RMBA 4NM8H 3WXVL 4HBCH 3GXFA 2F08A 2IBBA 5AZ2H 3PWPB 3UAJC 2EEAA 4XPHH 2MCG1 2XQYA 4PB0L 1CL7L 2RAMA 4M02A 3BWSA 3PWNA 2BHFA 2DIJA 3UTTB 4Q9RH 1U8KB 4AJ0A 2D9QB 4IBSA 2LAAA 5CCGE 1T3FA 1BEXA 4DKTA 4CU7A 1GYWA 3PG2A 5FLUA 5GISL 1S9YB 4MMZA 1QHOA 3CFCL 3FW6A 4JFFD 4WJ5B 2AEQH 4R3SB 1M42A 1UUSA 4N0YL 1T04B 4XPAL 3ZT6A 4PJDF 3WFCH 3FSOA 1N8ZA 2E6QA 2G30A 4JAMB 5D70L 2QSVA 1I7RB 3FUFA 4QYAA 4XBPB 1YMMD 1OP5H 3T0WA 1BG9A 2VH5H 1D5ZA 1G7MA 3B9VA 4UQIM 2YSSA 2VAJA 2QDVA 2LAGB 1N64H 2YAMA 2MQGA 4B53A 5HDLA 5LNEA 5LDUA 2F8IA 1MWOA 1FVEA 4CU8A 3DECA 3MLRL 3H2PA 1Z6JT 3MCKA 5L2KE 1OF2A 4TOYL 2YGPA 3LQZB 4OD3L 4XPTH 2ITEA 2DBLL 4PJ9B 4UDTB 3G6JA 4QXUL 2X4TB 4WHCA 5F1NA 5F7LB 5T3ZH 4O02H 4RAVB 4APQD 2YPVL 3AG4B 3TEZA 3BZEB 2UUDK 2DWYA 2W9LA 4UILH 4GBXB 2X4QB 1XGRA 3AREA 3P11H 5HDBF 2JLPA 1YCSA 4MGXA 1TJIL 3OG6B 3KXFA 3CUPA 3LS4L 5E5UB 2FJFB 4GAJL 4HA1A 4CSTA 3GSXA 4G9FD 1XXFC 3D08A 2UY7A 4LARH 3NZSA 5EO9A 2J5LC 2K4WA 1SLWA 5H2BA 4MNHA 2VLMD 3FTSA 2PPCA 5BRPA 2AEWA 3Q2CA 4XNXH 3KVDD 4PJEF 3TNNB 2XVGA 4HKZA 4JVWA 5TTRA 2R23B 2W91A 1DBJL 1SN0A 4I0PA 1YLBB 1YDPA 3V10A 2CLVB 1T5KA 1IFGA 1E4WL 1AKJB 3GRBA 4OAWA 1EXGA 4N8CH 3T3PB 1BFOA 2IWEA 2R29H 4H1LA 2BP3A 4TVPH 2F74B 1CVSC 3LPPA 1NC2A 1DO6A 3DVGB 3PABB 2HT3C 1DVZA 1KUMA 3V5DB 4MS6A 5J1AB 5KJRH 2P8MB 4JDEB 4NRZB 3HMXA 3IE9A 4OGAC 1TJHH 3ARGB 4P9MH 3KJ4B 5E2VH 5LAXA 5EEZA 3QZPA 4OGYL 2OI9B 4FQ2L 2E7BA 5F7UA 5DJCB 1KGWA 1JZ6A 3ARUA 4RZKA 1K2DB 2EH8L 4LNRB 4K9EC 4GQPH 4L3EB 3ZMNA 1ZVSA 3PF2A 5B8CA 4UF7C 3IGFA 4JGJA 3ZK0A 4P2QA 4NZTL 3QPXH 3LRLA 3TBVA 4EDXA 5AKSA 1AD9B 5KG9B 4MNQD 2Q7YB 1X5XA 5IG7B 2HKHH 3T09A 1NCAL 4B9KC 3D09A 2NSXA 1F4XH 3WV0A 4TLKA 3FUEA 1WCBB 4HJSA 4UAOC 5I23A 3QI9A 4HHWA 4PB9L 5EORL 1MRCL 4BSVA 3F00A 3MRRA 5AW7B 3DRQB 3ARDB 3S5LB 1TLMA 4GRMB 2FX8L 4P3CH 5IOPA 5I0DA 4AMKH 3SDDD 4Q52A 1NSNL 2HRGA 5LDSA 3CSYA 4BKLA 5JOFB 4NNXB 3VGAB 5AG9A 2YD3A 1FRGH 4HIPA 1SHXA 3QPQC 3V4PL 3BKJL 4ODTL 4E9VA 4JFFE 1R24B 2FBOJ 4FI8A 3QUYC 3SE4C 1LWHA 4XX5A 3VXUA 1T03H 1YY8A 3H9ZA 1QPKA 3O6KH 2W9EL 5KAQF 2BDNL 3D05A 4HC1H 1CLOL 1P4BH 2F61A 1NFDB 3GTNA 2VLJA 3EG9A 1SBBA 1YMME 2QQLL 1XF1A 4YLBA 3FUJA 4HS3A 2GSIA 2IH1B 4LCWD 4AGLA 4P4KD 2Z91B 2G60H 1EAPB 3E38A 4Q0XL 2ZOLB 1I1YA 2ZXWB 5HI5C 4MHHI 4M6AA 5FW6A 3RVVC 1TR7A 2A74A 3BT2H 2QR0A 2FE0A 3K8KA 4F7PA 2FAUA 4P46D 3MLXL 1CI5A 1KB5B 1R19A 3T4AB 1CD9B 4HUXB 4NZRH 2DYRB 5D7IB 3T2OA 4NO2B 5SX5K 1KBKA 4HUWB 1LNUA 2V7HA 2DS4A 3MJ6A 4XN8A 1TZGL 1IKOP 3K5RA 3MX0B 3GMMA 4X8JB 4WRLA 4Y1AA 1J5IA 4RQQA 3L4WA 4QXWA 2NQCA 4N2LA 3SGJA 4MX7B 3OWRA 3P4LA 2FWLB 3JT0A 2X4PA 3ARTA 5B1AB 4BSJA 3OKOA 4G9FE 2QGEA 2JJUA 4GW4B 1A6UL 3AUVA 3ULVF 4JY5L 3SKMA 5AB2A 1P1ZB 2VLME 3EDJA 3NIFB 3QCVL 4GYBA 3S96B 4AQ8C 4A2EA 2UXTA 1KN4H 4M7LH 1AE6H 1JNHB 1DVFB 2H2SC 1OKEA 4TSCH 3UBHA 2LTQB 3ZZQA 1YN7B 3VWKB 3B2VL 3TH2T 2AMUA 1UOLA 2YUVA 2GIYA 3U30B 3KYMA 1PLGL 3QUML 4JO4H 5K9OB 3STZB 1ZPUA 2VL5B 4XB7A 4WCYL 3CH8A 1KTDA 4PP2B 3CU7A 3IDNB 2BSBA 1UWGH 3V4VH 3MLUL 1DLFH 2AK1H 4L9LB 2GJPA 5ID1A 4K3GA 3EYFB 1AS8A 3MZTA 3RUGB 4EI5B 2X87A 3MRQB 2VDQL 1DLHA 2OMZA 3NUKA 1YG9A 1AO7A 4XXCC 2OSLB 2MQCA 3EGXB 5FPIA 3VI4A 5CEXA 4JZJC 2HVKB 4MCYB 3UACA 3FHEA 5SWZD 2BSRA 4BIKA 4GUCA 4LFHD 4JQVC 4YEEA 1DQDH 3AM8C 3N6YA 4PWEA 4ZOAA 4G6AC 15C8H 1HOCB 3GRWA 3EBGA 5AUMB 1C1EH 5I8OH 1XL6A 3QNXB 3ZE2E 3MV7B 3EO1B 1LDPL 5HGBA 1NEZA 3QIWD 4YE0A 1JZ4A 4QJ5B 1IGFH 1ID5I 3DPDA 1SUHA 3M17A 4PWFA 1RFDH 1I7UA 4Y5VC 1X5AA 1GCFA 3OXRB 4KI5F 3FU7A 3D12B 1MZZA 4JR9H 1JP5A 2TAAA 3KLAA 1J86A 1RIVL 2PPFA 4PRDB 1MCWM 4X6CB 4KXZH 4NO3A 4GRLA 4ZS7H 4L8SC 1HWWA 1KIUB 3GIZH 4FG2A 1GMIA 4Y4FC 5F9WB 3I9PA 4UTAL 3BUQA 4M43L 1MWAA 1R17A 3VFTA 3P0YH 3FCSA 3NACH 4KKBC 1G43A 1YC8A 4DEPC 1TQVA 1I3RB 2B7DT 4MJ5B 3RHWK 5IFJB 5FCUL 5E9DD 2UXFA 3WMSA 5JR1H 4QRRB 1L9RA 3SKNB 1SYSA 2BJMH 4ZOCA 5EF3A 3LTVA 4NGHL 3WLBB 1BG1A 3ERXA 2FNBA 4JW3A 1YC7A 3JTSA 4F24A 1T6WA 3ALWA 1AZZC 4QOKB 4WO4C 3Q3GB 4EJ1C 4BFIA 5IR1A 4XPBL 4Q56A 2EEXA 2VSMB 3MLSL 1A14H 4MB1A 5IMMB 1B2YA 2X6UA 4NQXB 3V6ZB 5KYWA 3P30L 2VLRB 1TXKA 3UEQA 1FGNL 1DJXA 4M1CC 3QDGB 3SPJA 1G0DA 1LWJA 2NRDA 4HS6A 4AENA 2FATH 4CJ0A 1TQTA 4OLYH 5BS0A 1JNJA 2ITDB 4ADIA 1F58L 4AYDC 2X44D 1W0VA 5KSBE 4RIRB 2EH7L 1NDMA 4L4TA 3U6XS 1INDH 4AYSA 2F7RA 5FOBB 5HVHB 4TUKL 1B0GA 5AW1B 2BC4B 1DCLA 3BLBA 2J88L 1T22B 4QLRA 3CZFB 4S1QH 5M7QA 5D7JD 4ZUWA 3BYTA 5KN5B 1EHLH 3LSOB 3PWUA 5C09E 3FTUA 2DQEH 4IRSA 4JEGB 5AYUH 3RPBA 5EF1A 4XN9A 4GAFB 4QHNB 4DP5X 4HOZA 3FO2B 2EXYC 3IFPA 4HIJA 1JGLL 2VAAA 3QB7C 2AHIA 1CGVA 5KVFH 5DMKB 2DWTA 3O6LH 1KCWA 3JWDC 2XA8H 4P49A 5JDJA 4U2ZA 2ICWB 4YQXL 4PJ9C 4FABH 3CZLA 4HBQA 3RWIB 1OPGL 5EU7C 4ANXA 2G4GA 3MV11 1KACB 2PWGA 1BQLL 3FUHA 3QZWA 1MW1A 3HTLX 4LOFA 3UYRH 2G5BA 1CBVL 4RGND 4XNDA 5EIIA 1KJ2H 4UQ9A 3S36H 3UG5A 4YNYA 5FA3B 2FX9H 2WNKA 1OAZL 3PHSA 4KWUA 1UH3A 1YMHA 4HX1A 4HLJA 1JYVA 3EO0A 2MTPA 1KLUA 1J0KA 4PW9A 1FQ9C 5DHYB 5GZOA 4G8EA 4MJIB 3IDGB 1MI5D 5DLML 5I1DB 3VGDA 4KK5D 3SE8L 1GR7A 5KVFE 3MV9D 3TNMA 1CIUA 5CUSL 1T20A 1NH6A 4M4PA 3TXAA 2A73B 2B9AA 1U8LB 1BMWA 5F88A 5GRVL 5SWZE 2Z6FA 3EFDL 4XXDA 3KPLA 1W0WA 3EFFA 2E76C 2OJZH 4UT7H 2BPBA</