3AQXA

Crystal structure of bombyx mori beta-grp/gnbp3 n-terminal domain with laminarihexaoses
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
101
structure length
101
Chain Sequence
SYEAPPATLEAIHPKGLRVSVPDEGFSLFAFHGKLNEEMEGLEAGHWSRDITKPKNGRWIFRDRNAALKIGDKIYFWTFVIKDGLGYRQDNGEWTVEGFVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-1,3-glucan-binding protein
publication title Structural insights into recognition of triple-helical beta-glucans by an insect fungal receptor
pubmed doi rcsb
source organism Bombyx mori
molecule tags Sugar binding protein
total genus 18
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2140 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3aqxA00
2RQEA 3AQXA 3AQYA 3AQZA 3IE4A 2KHAA
chains in the Genus database with same CATH superfamily
1OHQA 2ZOKA 1FN4B 1FGNH 3IKCA 1P5VA 5LJYH 1AMYA 3B2UD 4JDVB 4A7UA 2WLKA 1HL5A 1BZ7B 2VWEE 3UEZA 5TDOA 5GS0L 2R2HA 2F1AA 2XG5B 3BKJH 4GG6E 3KXFA 2UWEE 5DJDB 2OR9H 2GK2A 2MNJB 4YHLH 5KSUA 2P49B 1T5XB 1QPXA 4PLJD 4N3TA 3BSZH 1ZLVK 2DM7A 4OJDH 4WFEE 3HE7A 5F3FA 5C07D 5LGHL 4FG6D 4AE1A 5IQLA 4UT9L 1B0WA 3FOLB 3O2DL 4WCYH 4ALAH 2Y5QA 1TZIA 1RJLB 5IP4A 5KSBA 4LDEB 3FT3B 1S7QA 3REVB 4XNYL 5E6SB 3MLYL 3VFOB 5IB5A 2JFCA 3VB8A 2YGVA 4OGYL 2WBJB 3KHOA 4GUOA 2FGWL 15C8L 3N85L 3AU1A 4JFEE 3FHEA 2A6IA 2MTPA 1CF1A 3OQ3B 2A38A 3FB7B 1LO5A 1JHKH 4GIOA 5HVWA 1KJ2A 1KLGA 1Z3GL 1ZGLM 2DTML 4U1SA 4ESKA 1NQBA 3DVGA 4R8WH 5T3XE 1OAKH 1ACCA 5LLIC 3D85D 5DFTA 1U91B 1IX2A 4M8QA 1TQTA 1MFUA 2ADGB 1D3CA 4OFYD 4KDVA 3HZKA 5B7EA 5B8CB 1MCCA 2J1WA 1KUMA 4PP1C 2HKFL 2F58L 3X13A 3PFQA 1QFPA 3V4PB 4I3GA 4DEPB 5SX5K 3S2CA 2D7OA 4PJFE 3O6ML 3ZHDA 5BOJA 4PIBA 4PG9B 4BELD 3DUUA 4LPCA 1P4BH 4KKAD 4C4KT 4J3OD 5I18L 2DI9A 5FV2A 5T5NF 4K9JA 1WUNT 2BSED 4K3EL 1KCRL 1Z66A 1OP5H 3BP5B 3W9DA 2CLZA 2EE9A 5IWLA 3QJXA 1RL1A 4KOCA 2J1YA 3WMSA 4JFTA 1I1AC 5DDHA 3GWJA 3RI5F 3UADA 2VLKD 1AG6A 1KJVA 2NW2A 2FQFA 4RNRB 5HYFA 3EKCA 2WYZA 1CXEA 3H3PH 2FJHA 1FNHA 3PGDA 2YPLE 2BS71 2MHAB 1LQBC 3PNWB 1X4ZA 4LPVA 1L9RA 4GH7B 4LLDA 2DQEH 4UAOB 1XGRA 1F3DH 1G1CA 4D9RD 4DEWA 4YDJA 2JWYA 3UBGA 2H7WA 3P4MB 4Q6KA 3CDFA 1XSKA 1AY1L 3PP4L 4PV8A 5IJCC 3SKMA 2LAGB 4AYEC 3G9AB 4CSZA 3B5HA 1ZMYA 4JY5H 1XXFC 1QLFB 3L9YA 3QIBA 2V2TA 4NC1E 1MCWW 2Y6TE 1HCYA 5I73B 1EZUA 3BAJA 3QRGH 3MV8D 5BW7A 4P4RA 3SBWC 3QXDB 1GVIA 2BWIA 1BF2A 1NCAL 3QZNA 3UYRL 4CJ1A 1MAJA 1E43A 4XRCB 2ZAHA 4PRDA 1DVFC 1L5GA 3BLKA 4KZEL 2WO4A 4LLYB 4XC3H 5FA3B 1SYSA 2ZUVA 1S46A 1Y07A 2Z35B 4PS4H 4M61B 4QTHB 3APMA 2NY3B 5JNYA 2Y23A 2D4DA 3OGCB 2QGDA 3WEAA 2D03H 1E5ZA 3GSNH 4LCWE 1RLWA 3X11B 1KIQA 4G6JH 1FZKA 3O0RH 4XMKH 3NBNA 3KYNB 1BJ1J 4XP1L 4PUBL 4PG2A 4TQ8A 4ERSL 1UJ3B 1NEUA 2XOTA 4AC2A 2ZJSH 1AR1C 4AENA 1ZXQA 3HVNA 1J9CT 4PGEB 1AQKH 4EXPX 4OIAA 2NQCA 4FABL 2NR6D 1T4WA 3AS2A 5CEZL 5GGSB 1FZMB 2W60B 3P9LB 5DJYA 4XX5A 4IS6B 2NTFB 2XZAL 2HLFC 5HYJA 4ZTOH 3ZVVA 5EBLA 3VD2A 3PY9A 4PI0A 1E5CA 1JOIA 2I9TA 3MROB 2NY5H 4G8AC 4JZJC 4KDTA 4NZJA 1X5FA 2R56L 2YAFA 1NAMB 5DT1H 1KELH 1QRNB 4FMKA 3ASOB 1FO0H 4LCIL 4L2YA 5FCUH 4G11A 4K23L 2VDNH 4J3SA 4LEBA 1WWBX 4HXBL 3SPIA 4PVNA 2KI6A 4JUSA 3U7YL 3B2MA 3GMMB 1VF5C 4PBXA 1I1AB 5GGQH 1A7NH 1IQWL 3AT8A 4TSAH 3I9GL 1Z0NA 1N18A 4QRTB 3KPRD 1R33A 2ZF8A 3SDAA 5I30H 4B9JA 3EF7A 4PSPA 4WI9A 4N85A 3MBXL 3OAZH 4N9GA 1OOWA 4QPEA 5E8DH 5FO9A 4EI5A 2BRRL 1EMTL 2JI1A 1IJNA 5J0BA 4JO1H 4O02L 4TLKA 4CU7A 1H8SA 1ACYH 4F58L 4YC2C 1LDPH 2ZXQA 2R4SH 2FEJA 2XVKA 5CHNB 4QWWC 2XPGA 4YSEA 2V7HA 3VFPA 1JZ3A 3O9WB 4ZTPH 2WO2B 3SGDI 2CG9X 2YUVA 1A1OB 3DI2B 3CVIL 3FU7B 3HPJA 4W9FC 4WENB 5ERWA 5KWYC 3AREA 3QIWA 2AP2A 5ID1B 2EP6A 3RGVD 4OF7A 4MRBA 1JZ7A 3UTTA 4GAYB 2DMGA 2VN5A 1UZ8A 3MLTA 5BZWB 4OCYL 4JPVL 2DJ4A 1OE2A 2F61A 2X4QA 2UX6A 4P23C 3DX9B 4RMVA 1XCQA 4HW6A 1HYSC 4TSCH 2VTFA 5KVEE 5C08B 1U6AL 4G7YL 3SODB 4P0DA 1SJEA 5DVPA 5KTEL 4P2QA 1MLBA 1D5IL 2JKLA 4IHBA 5E6ID 4APXA 2Z0BA 4PRHE 3T0WA 4PY8J 4GUPA 4LRNL 1M05B 3MV9D 1L4IA 2Y0SA 1A9EB 3NJVA 1AXIB 4J4PC 4K3DL 3HRZC 5I8KL 5BPPA 1MVFA 4UBDC 2L0DA 1WFJA 1IVLA 1XF2A 4BFIA 1OE1A 2ZWNA 3FCBA 2HUHA 2VSDA 3RDTB 4MAUL 5E5UB 1A3QA 3DX1A 1T80A 4QRBA 3KYAA 4MCYA 1A0QH 1UB6B 3U0WH 4HOWA 2EIKB 2EH7L 2EEDA 5IT2L 3KE0A 4S1SL 1PBYA 1J1XH 5GGRA 3NFSH 4ICXA 4H0LC 1GTNA 2DDQH 2QPEB 3ZE2F 2IDCA 2ODHA 5JTWA 4NO5A 3FSVA 1SVCP 1OGAA 4UF7C 5E2UL 5ALCH 3SHSA 4A66A 3FUNA 1AHMA 3EJSA 2DN7A 1JPSH 1NGXB 1O7DE 1I9EA 3ESUF 2TRYA 3GUFA 2P9RA 3GK8H 1IFHL 4MMXA 5GGTL 3AXHA 3L4UA 3NTCH 3IFOA 1BFVL 1CLOL 3FN9A 3MRFB 3M1CA 2VR8A 3OKOA 1JZ4A 1FC1A 1KN4L 1TPXC 2YSSA 2IH1A 4MJIA 1KJ3H 3GNML 5DHDA 1HSBB 2F1BA 1VFBA 4J39A 4B7IA 4P57A 2A9MH 3SGDH 2V17L 1KCLA 1MJ7H 2OAAA 4L3CB 4NP9A 5CU5A 2JB5L 5DUJA 3ILQD 4MZRA 1XT5A 1N68A 1FE8L 1X7SA 4G8EB 3UX9B 2G60L 4UV7L 5TH2A 4GKOA 4AYGA 1HAUA 3EBAA 3WNIA 4ONFH 3H4HA 5D71L 5EO9A 1EWHA 3L45A 3ZZSA 1KWKA 2IQ9H 3QDMB 4FFZL 3IPBA 1NLBH 3VI3F 2W0FA 3LY6A 2F53D 1YDPA 2CZNA 1UXSB 2ROYA 3U9UA 1TOXA 2CA3A 5IJKA 4WV1A 3D39B 4R3SA 3SN6N 1LEKA 4NJ9H 1P0SE 4YFEA 1PIFA 3APCA 4M3JA 2P52A 2BNQA 4OZHA 3ZIMA 4CA4A 5TPWH 4FQ1L 1T1XB 2XX0A 2R29A 6FABL 1HSAB 4YSQA 3DC0A 4FYRA 3FB8A 5D1XE 4NXKA 2BJMH 3O8XD 1SBSH 1VEPA 3VI4B 4PAZA 1S7WB 5D2NC 5BV7L 4EE2A 1LD9B 4DGWC 4EI6A 4AI7A 4X6DB 1S9XB 2YC1B 1EGJH 5C09B 4DGUA 3IBEA 3L3HB 1MW0A 2OTWB 1FFOA 1U2YA 4O2EA 4ZOAA 5E1AB 1SJHA 4MNQA 1F4AA 2VDKB 3ESVF 1VENA 4X8JA 2FO4A 2VDMH 1IQDA 4IRSC 1PZSA 3LZFL 1UT9A 4MDIA 3PQYB 5EFIA 1Y7VA 3MJ9A 4I77H 2DKSA 1UD4A 5IM7B 3WIHH 2R7EB 1JWSA 4K7PX 3WS3A 1GC1H 3NFNA 4NO2A 2WZPD 3QUYC 4GRWE 1CIUA 4HOZA 5CBEA 4ISVA 3TBSA 1A4BA 4WJG3 3EO0A 4R5XA 5FOBA 5KVDE 3DTDA 4L4VA 4L5FH 4L4TA 4LXFA 3TOPA 3GDBA 3KPQB 4QCIB 2LAAA 1M7IB 3GMRA 1I9IH 1H9DA 2CMRH 2FDBP 1UWXH 2JB6A 3BUQA 3TNNA 3WIIH 5CINL 4W9EC 3QFDB 4O5LL 2Q8AH 4AQEA 4ZMWA 3CXHJ 3V6FB 1DTUA 1F18A 4KUZL 5CD5D 3FKUS 4ZNEA 2JKTM 1N5AA 2BOCB 3BPLB 1OP3H 3RVTC 1MI5A 3QEQA 1EFXB 3QXTA 1U33A 1A2YB 1AS7A 2EE6A 2GK0A 3D5OF 3NJHA 4JDEB 3JUZA 5CP3H 2YRLA 5HD8C 3QUZC 5LNEA 5L4FA 1C08A 2FZ3A 5K9OB 2ESVB 1VFMA 3EDFA 3MRRB 5JPMC 3P54A 4KH2A 1QPKA 1NMCC 3QQ4B 4L29B 5H94B 5GRVL 5BS0E 3CLFH 3CD4A 1S7XA 2CDGB 3OXRB 4Y9CA 2BVQB 1XVSA 1FFQA 2DQJL 3D1MC 4F8OA 1ECZA 5IEKB 1CFQA 5CILL 1W72H 4FEMA 1EHNA 4Y4HC 3BZDA 1MFBL 5IESL 2JI3A 5HVGB 2O5YH 2N0KA 1CN4A 1RUAL 2VWEC 2N01B 2X42A 4NT6B 2A1WH 1T0OA 2LVEA 3QZPA 2YO3A 4JFDA 2V6HA 1AQHA 3QDGA 4OF8A 1J5DA 3VFTB 4F57L 1TQSA 3OLDA 1YJDH 5MEQA 1W91A 1P5UC 4YBLC 1CXHA 3MUY1 4HH9A 2OQJA 4QHLA 3ECVA 2APXA 1AC6A 4AQ8A 2J8UA 3PJSB 1URLA 4XNUH 2NUPA 3CZLA 4HKXA 1HEHC 2VZUA 2J4WL 3LNEA 4HQQL 4TM9A 4BFJA 4FFWD 4ZMAT 4KTDH 4WJ5A 5DMIH 5D1ZA 1SDDA 3CHPA 4YGVB 1KBKA 1T89A 2IG2L 3NP4A 4KH9A 1I8IB 1DBBL 4N0UE 5K9QG 1WBYB 3WNOA 3TJPA 4ZXBB 3TP4A 3ULVF 4M62H 4GIPD 5JW4N 4EOWH 3SKNB 2ZP0T 3M8OH 3CHSA 4F7TB 4NRYB 2DRUA 3MREA 3SYPA 3MACL 4YWGH 1G0XA 2NNRA 1TJHL 2WNWA 3DGGB 4HCGA 5IB4B 1JNHA 2B77A 2A5UA 2EDEA 5JDSA 1ZLSL 2P5EE 2BNRB 2Z4TA 3HOGA 4HPOH 4JRLA 4WI3A 3NJXA 2ZCKL 1Q9OB 3NH7H 5EEUA 1RY7B 3OAUH 4MHHG 2OV0A 1AP2A 4FQIH 4NKOB 3BUYA 3ARFB 3L16A 4XMLL 3Q8AA 3LNIA 4HJ1A 1JRHH 2KZ1B 5BRZD 2FWOB 1ZSDA 2WTOA 3L17A 3B2XA 4EN3D 1NC2D 2VR5A 3FO9A 4QF1B 2TAAA 2QQNL 1HE7A 2YSTA 3NIFE 4UYPA 5FW7A 3SCMD 2OJEA 4J3VA 4YHNA 2FD6L 5GGRY 1Y18A 4JRYD 3SDDC 4DH2A 3WE1A 3QUZB 4IDJL 3UZVA 2DYPA 1YMMB 5CIPH 4XVTH 1ZHLB 1GW6A 2WXIA 5DRNB 3VSUA 4A7TA 3D2UB 5D7IA 1IE5A 4UILH 1OT4A 2QELA 5K93A 1QQDB 4OLZL 4Y1AD 1T6WA 5JPMB 3MRIB 5TFSH 1H5BC 3VXME 2CK0L 3MGAA 4LAJH 5DUPH 2DV6A 3FZUC 2C9VA 4ZW7A 5E4EC 2X2IA 4N20A 2HTKD 4JPQA 2DLHA 1HQRB 3BCFA 3VD5A 3STLA 3GMOB 1HEZA 5ENWB 2WTPA 2WZ5A 5CEZE 4LDOB 1BQHA 3BO8B 3K0WA 1DCLA 4NC1C 4JX0A 1KYDA 1UOVA 4RMQA 4X9IA 3GSOB 5I5MA 5KVFL 2Z93B 3E8UL 5KBLA 2VLLA 3MJWA 4HJTA 2IO5A 4QTFA 1FVCA 3LKSB 5CU9A 1EZLA 3CLEL 3UTSE 4N2GA 2LQRA 1G6RB 4PJIF 4W9IC 4QTIH 3WO3B 4OLXL 1I7TB 3QO1B 3DXAB 1GGCL 4QRRE 1BQHG 4YBLB 4TUUA 5B1KA 3QPQC 3LD8C 4K7FA 4G1EA 1XV8A 2PPAA 4YK4C 2N7AA 2QQKL 3V4VB 1V55B 3AAZB 1NFDF 2QKSA 4HUMB 1H6TA 3O6FD 3C6SA 1YYML 4KVNL 1PPIA 2BSBA 4OCRH 5GRUH 2W95A 5ALBH 4G8IB 1D9KC 1HX0A 1I7RB 1IEBB 5IMLB 4IOFD 5TE4H 1U4FA 3M46A 5F7FA 3N41F 1BYOA 3PGCA 3CSTA 2QGEA 3GSRB 1SLWA 5FGBC 2AEQH 4LLWA 3T08A 2WAHA 1G5GA 1ROCA 2JJSA 3BFQG 3LZOA 3CSYA 4KMLB 2RCSL 3FQXB 1GZQB 3DX3A 1WA1X 4TQHA 4XMTA 1U3NA 2NXZB 3B7SA 5CJQH 3PWVB 4CC0A 3DHMA 3NPZB 1E7VA 2G2PA 5EZPA 4L0YA 3BXNB 2ALWA 3OMIB 1EO8H 2HCZX 4MYPA 4KKBC 2MCAA 3FC8A 4ODVL 3L08A 1A14H 2J1KA 4GAJH 4U1HB 4OBSA 3MX0B 1CWVA 2I07B 3HI5H 1MCPL 3N04A 4GKNA 4JDTL 3JTBA 3SPHA 1LO2L 4OZ4B 4Y4FD 1G87A 3LKOA 4H8WH 3VD1A 1YO4A 1SVBA 5ACLA 4ZS7H 4IK7A 4JY4B 3DX4A 1N6VA 3D4ZA 3WXWH 2LU4A 1AZVA 3ILPA 3RX7A 3UMTA 5GS3A 4ZX6A 2CJTA 2YQBA 1RJZA 2HN7A 3EGDA 2E7BA 5T1KA 1BFOB 1CDYA 1KB3A 2ZKHH 3QEUB 3L3DB 4M48H 4XI5C 4YEEA 4APQC 4HJJH 5E23A 1E4KA 3AVEA 3MLVL 3RIKA 3AWEA 2DQCH 1EO5A 4YOKA 1XH1A 3K1KC 3OLIA 3PWUA 4NN5B 2VQUA 3RL2B 3HB3B 2PPFA 2CBTA 2F74B 1ZVHA 2XTSA 2VDQH 3WS3B 4H2AA 3BWUC 4ACTA 5HHPB 2DQ6A 1KXTB 2V8MA 4PFEA 3CBJB 2VSMB 4PYGA 5L2KA 4ELMB 3RKDC 3MKKA 3LPOA 4FXGB 1DLHB 2FLBT 3AT9A 3C5ZC 4NO3A 4F3FA 2X9YA 2YMOA 5AZ2H 2AVFA 4TUKH 3ZRCC 4P4KA 4ZFZB 2CKBB 4N9OB 3B3BA 5IUSA 3MJ7A 2EUWA 3EDKA 1BJMA 4UWQB 3Q5TA 5IFAL 3CSGA 2GHWB 4L0PB 1UM6H 4FLOA 5AW9B 5C8JA 4OZGA 2BY1A 4PTUB 3WLBB 4BE5A 1A7PL 4R5TA 5DVMA 4JQIL 1M6OA 3GKWH 4N6RA 4A6YA 1QMUA 3IJ9A 2HKHH 5EOTA 5IMMB 4YSUA 4XMPL 4GRLC 2GUOA 3HG5A 4I48B 3S5LA 4Z7OB 3NCCB 1BGXH 5E08H 4JRXD 4IMKC 4GMTL 4ES9A 2EDNA 4K5OA 3QUML 4O2FA 4AEHL 3BT2H 4JQVC 4HG4K 1UD8A 4X8XA 2YA2A 1D9KB 2M83A 2EDWA 2ED8A 3NQIA 4Z7UF 5EF0A 4K5NA 3D3VB 1KJ2H 4JKPL 5GRVK 1R24A 4FADA 4IGBB 1F86A 5AZUA 4ODBD 2IANE 3OKKA 1ZT1A 5EBMA 4BD4A 1E2WA 2X4PA 4AL8H 1JF1A 1T66D 3BN9D 5C3TA 5BZXA 1VFOA 4I2XE 4CADB 1JERA 2OXGA 4PD4K 2PYFB 5ID0A 5TF0A 4DPCX 3LKRA 1UASA 3GSUA 2FB4H 1AJ7H 1TZHB 4NHUB 3TT1L 1ZV2A 1O7DC 4R0LC 4LASH 1JNNL 4F7CB 4Z7IA 2J3SA 5IB3B 1X5AA 3N9GH 4DZ8B 4F37F 3BN3B 5LGJA 1T1YA 2F8OA 2V3EA 4IMLB 1UFUA 1NCOA 1SLVA 1A3LH 1TMCB 3S3CB 3STBA 3NSXA 2Q86A 3ARBC 4NNYB 5B3SB 1LQSR 1YEGH 4YDIH 4DWHA 1M53A 5JDJA 4NPKA 1FFNB 2GG1A 5IMOA 4WWKD 1KGWA 1EJOH 4F92B 2R0WL 4LGSB 4MJ5A 1FSKC 4BKSC 3U7AA 4QLRA 4HHGA 4XVOA 3KPPB 4G80A 4KKZA 2KH2B 5A3ID 2ICWB 3IGFA 1S7UB 4CMMB 1OGSA 3OSKA 2JIXB 2E7CA 2EXYC 4XVSH 2VXUH 3ZL2A 1XL4A 2ERJC 5F21B 5J89A 1Q1JL 1T22A 3RUGE 1MG2C 1T7ZA 1U8JB 3EAKA 1IGJB 4MA8H 5DLML 5FUCE 3F7PC 4MD4B 5E51A 3E6FA 3SDXB 3ULVD 1T03H 1O6VA 1E9PB 4FTVB 2MNWA 1GJUA 1U58B 2DQGL 1MFEL 1RCYA 4PJAF 3G5WA 5J11C 3JTSB 1SJVA 2VN3A 1A7QL 5F89B 2OMYB 1JTTA 5KYUA 3JXAA 5DMKB 5FB8A 4ZYKB 5D2NA 3FTGA 4JG0H 5I66B 5MENA 5D1XC 3FFOA 1MCRA 4I85A 2E27L 2RJMA 1XGTB 5E9DA 5T1MB 2D7TH 2BHYA 1OPOA 1WBXB 5DK0A 5MP6L 1WRFA 2RTTA 3RZCA 5D4JA 4GOSA 2WTRB 3WDIA 1P1ZA 4HYTB 4HHWA 4CN4A 3G5YA 4UINL 2ICEA 4LMQE 3AW5A 2NUTA 5IJDC 4K7PY 2AKRA 3QUYA 4JZNA 2MPAL 1G43A 2PYEE 5I74C 2NQ3A 3EJPA 3G6JB 3MUGA 1KFAH 1IKNC 3QNFA 4O2CA 5D93B 4DW2H 5IF0A 3GXIA 2OYPA 2VDRL 1IKFL 3DV4A 5D6DC 2WSKA 4DN3L 2YMXL 3KVDD 5HPMA 1GKOA 4AC4A 5JHMA 3ATEA 4Y2NA 5EO1A 4EXKA 1I3GH 4G7VL 1VZIA 1XGPA 4I0PC 5GS0C 1T04B 4N2MA 3C60A 3U48A 3F12B 3GBNH 3SO5A 5I6XC 5AKSA 1T4KB 2X4NA 3F5WA 5A2KH 5E8OB 4HSCX 4XBMA 4RZCA 2B0SL 4C83B 3QQDA 2ATPA 5ESQB 2NX5D 4LP4A 2B5IB 5GSRB 3NCFB 4H0IA 4YDZA 4F2ME 3BT0A 3H56A 4Q8BA 2VDPB 4TUOB 2JQZA 2XC8A 5JYMA 2N3JA 4R97C 3BVTA 3BGMB 5C0GA 5KS9B 4FMFA 3ABKB 3DMMD 2QBWA 4X9BA 1EAPA 2G2RB 5ABAA 1RZJH 3QFJE 2C7FA 4XXWA 2HWZL 4AUYA 1H3TA 4YS4A 5IFJA 1KLFB 4XO3A 1UJTA 1LP9B 3HC3L 4AEFA 1QD0A 3D25A 4Y4HA 3DX7A 3NCYS 4HKBA 2CDEB 1J0IA 3AGWA 3HR5A 4ZAKB 4ICWA 5A2BA 3BX7C 3NPSC 3TCXA 3Q6GL 3N44B 2LLLA 3CU7A 3SY6A 1CS6A 5JW4M 1FV1B 1M42A 2CQVA 3A4AA 4ZPTA 3WELA 2R2EA 4G6ML 3FB6A 4NQDD 5CSZB 8FABA 4UNIA 3ISRA 4M7ZC 4NNXB 1F1DA 4BSWB 3VB9A 2ED9A 1INQB 4B27A 3PWJA 1E3XA 1CF8H 1GSMA 1BAWA 1MAKA 1D5BB 2XVBA 3B8YA 5CZRA 3HNSL 5AVUB 5GSVA 4LEOA 4BH7A 2P3YA 3ZKQD 2ZD0A 3F85A 3RKPA 3QPKA 3HG1D 5D1XB 5I1EH 4XVUD 3UZEC 4HWZB 1SEQL 5C97A 1TO5A 4D2NA 4HAKA 3NIDF 3CH1A 1TDQA 5DZ9A 3TN0A 4EBQH 1OF2B 1TTGA 4W9ZA 1MIEL 1UURA 2P48B 2ZUYA 4A2HA 1PZCA 3MNZA 3B9KD 2GTZA 2IFFL 3UC0H 3UFIA 5C9JB 5EC1A 5LN8A 1BZEA 3SZ6A 1HH9A 2V9QA 3GI9L 2PR9A 3P0YL 3NIGF 3IPFA 1TJXA 3VXRE 3WKMH 2APBA 3IDUA 3MBEC 4G9FD 4L3AA 4N90E 5I74B 1JFQL 4RIRB 3I74A 1F2QA 3HG4A 4FFYL 1LK2B 4LEXL 3E38A 3SJVE 4UM8A 2YPKB 1ZA3B 3KPTA 4ONOA 3NJIA 5KBDA 4FJZA 1BQ5A 2G3NA 3ZE0E 4W4OC 4H26B 2DL9A 4YR6B 5E94A 3HI6L 1FI8C 5KVFE 2PO6B 1IC5L 2MCG1 4U3CA 2X0UA 3NT0A 1GGBL 4MZ3A 3ARGD 2BNUA 4RA0C 2VR6A 4P2RD 5ANHA 2DIAA 1Z5LB 2XIDA 1S9YA 3UAJA 1J9TA 3UJIL 2X88A 4OF3A 5EUKB 4XBEL 3ZR6A 2VLRA 4K73A 1R5VA 5DD3H 3WY2A 5D9SA 2WQRA 3GYRA 1R75A 1Z6JT 4Z3GA 1FPTH 3RWCA 1ILSA 2HFEB 5JHDB 4ES8A 4YHIA 3AM8A 5FYJH 3FB5A 4O58L 4JREB 5AUMB 2GC7C 4P5TD 3U4EA 2B59A 1CYGA 1S7SB 3HE6B 1BZQK 4Z7QF 1FIGH 2BXZA 5FYKH 3HZ3A 2EIJB 2XN9E 4HUNB 3QK0A 2WHVA 1BVKA 5E5LA 3RFZB 3RBSA 5I0VA 1JTOA 3S3PA 4GKZB 3GS7A 4LGRB 4U0RC 3QWQB 2OYKA 1IM3A 4POYA 2F8XC 5G2NA 4S1QH 3HZVB 3IGAA 3IEAA 4HPYL 3V0EA 4MLIA 4FZEL 5J6GA 1ZV9A 5EEVA 4XNAA 1AR2A 1S9VB 5IROC 3KZ8A 4ODXA 1DBJL 2R29H 4NERA 2OPCA 1OARH 3UTOA 1D5XB 1CDGA 3L3OB 3SD5A 4HWNA 2DIEA 3TWCH 2GSGB 4OZIF 4FQLL 5DRXA 3D18B 4IIQA 4PW9A 5DS2A 2NNXA 4P3DB 4QKTA 1FBIL 4U1IA 4XE5B 3EG9B 1FNEB 3UJTL 4UT6L 2EACA 4PJXB 2WLJA 1TQWA 1MF2L 3ES6B 1IKOP 1H3PL 1WFUA 2FEEI 3WS6C 2EEBA 1ZSHA 4WO4C 4CVZB 1GAFL 5E8PB 1IGMH 5FGBA 5PAZA 1O9VA 4GLRI 3DTXA 5C0IA 5F3HA 3WEOA 3M7FB 3SYCA 4AM0Q 3MJ9H 2EDOA 4AV4A 1C5DB 3HKFA 3QNXB 4N0UB 1Z9PA 3U30C 2E74C 1I4FB 4M1GL 5EF3A 3Q06A 4BJLA 1ERNA 2DWSA 4RFEB 1I1FA 5LXGH 1FORH 1RZKL 1OALA 1R4XA 1TJGL 3CFIC 3WV0A 4NENA 3MNVB 3TASA 4UTBA 3Q13A 5CEXB 2GJRA 3D85B 3L95A 1S7VA 4LHUB 2PCPA 4HOMA 1LO3H 5C0BD 1E0OB 3UP6A 1B9ZA 3VSTA 4GP4B 3FQ4A 4ONHB 4ABVA 1ZEAH 4WW1A 2E4TA 3U6RB 2P45B 2CLRA 1OY3B 3FQYA 5C0DA 3ZL4L 2C1OB 5C0CE 1MHPL 1XGYH 3MCLH 3EFFA 2CNZA 2OMWA 3F7KA 1WCQA 1L9TA 4LSUL 1HCZA 3FQNA 5BCAA 4MHHI 1AGDA 4LE8A 3VXNB 4PWJA 2AJUH 3UMNA 3VWKA 4BFOA 4U31A 4C56E 4F2FA 2Z6FA 3GT6A 2KMWA 3PWLB 4LU5L 1BVOA 3WN6A 7PCYA 5AKRA 3FQ1A 3LPPA 5I0YA 4ZMVA 5AW4B 3OZKA 2VLKB 3REWB 1UM4H 4AV5A 3CFJA 1IAIL 3P2DA 4AGOA 4EAEA 4LPYA 4K94H 4FQHB 1N4XL 4Z78B 1T83C 5C0FA 5IMKB 4JPIA 4G8GE 3MLZH 4FA7B 1VFAB 4Z77B 2VXSH 1J9QA 2V0AA 2CUIA 2VLJE 2H8PB 1U8LA 1HZHH 3VGDA 3DSNA 1XX9C 5ES4B 3OF6D 3X1EA 5EU6E 4NRXB 1KNOB 1JZ8A 3EXLA 5KVGE 1B4RA 4HIIB 5FW8A 1P7QD 3UO8B 4GLRH 1U8QA 2O5ZH 4BFRA 3SE9L 4M7JL 3ZSTA 3MV8B 1UT1A 2FBJL 3AITA 3F62A 3WENA 2BSRB 2VUKA 3HG0A 2FGZA 4QRRB 3IJHA 2FATH 2W07B 1P4UA 1NFIB 3TBWA 4U3HA 5K9KB 2Q1EA 1H0DA 2OP4L 2F08A 4GRLA 4XCYA 5F9OL 2VISA 3SE3A 2WVTA 4CGTA 1IO4C 5I6NA 4L8BB 2OX5B 2L7JA 4RH4A 4BH8A 1CGSH 4Y8AA 2QPUA 3NJJA 1JXKA 4N8UA 3LCYA 1JZIA 1G9NL 3QB7C 4ZO7A 1RPUA 3QWNA 4XP5H 1BZ8A 2YGQA 4WO4B 4XX1G 2QSCH 4R7DA 5HY9A 4P46D 1NFKA 3RWEB 4NQEE 4Y2OA 4GQ9L 1UXMA 4K8RD 1ZDSA 1PFOA 4X80L 4PGDB 4MXVE 1TSRA 4MA1C 1WO2A 1HI6A 2PXYD 3GMPA 5JW3H 3VDBA 1NDGB 1E4XL 3ZBMA 3X12A 1IEHA 3CZGA 1YSOA 5DGQA 3T1FA 3U36A 5GS2H 3EBIA 5I2IB 4TF4A 1RQ5A 1TTCA 3GBMH 3BQVA 3TVMC 3H7BA 2MCMA 4OFVA 1KFGA 1TNMA 4P2OC 3A6CH 1U8NA 5EBWA 1Z9SA 2FH8A 2Y3NA 4CNIA 4NWTL 4MQTB 1KXVA 4YL9A 1CD1B 4F7EA 3C9NB 2I69A 2Q9OA 3INUL 5T3ZH 4ZBJA 3L3GA 3ARBA 3CAFA 3P2TA 2AERT 1NGPH 4N24A 3TM6A 4XCFL 5FYLH 1IAKB 4JCMA 3G04B 3N42B 5BV7C 4PS7A 1LE9B 3VJ6B 2H3NA 4ONGH 5I17B 2CO4A 2EVGA 1QBLH 3SSGA 5FPIA 3RY4A 3BSZL 4B9YA 1G7IB 3B4NA 3KPRB 3B2DC 2F18A 4ALAL 3LS5L 2MOVA 3QVAA 5I5IA 3KLAA 1YY8B 1KEGL 1CDJA 4X83A 4MTMA 2X7LA 4KK5D 2VE6B 5MEND 3VNZA 5BXFA 3PABB 4MA7L 1UWEH 1F02I 4BFGA 4ZRGA 5FFOA 1G4MA 4HKZB 1CBVL 4H25B 4HIXL 5DD0H 3HUJF 5ILTL 5FUCC 2AJ3A 1BVNT 1QSED 3U1QA 3HMWL 1NPNA 2VH5H 1I3RA 2ORBH 4ZOBA 1RLBA 2DQHH 5ICUA 3H9HB 4LLVA 4ZO9A 2OJZH 3T04D 1M6UA 4GB9A 1CICB 5KVMC 3SD2A 3PDDA 2FYYB 1NC4D 5KSAD 3ECBA 3RGVB 1WZ1H 4KI5C 3W38A 3L5IA 4HUUB 3GSWA 3DARA 1F4YH 1ZDQA 3NAAH 4KK9D 2K78A 4TTDD 1M7DA 4MB4A 3IJSA 1HK6A 1JHLL 4XVJH 3WSQH 1OAQL 2QKIB 4PJ9D 5F1IA 1M3IA 4ZUUB 4B60A 4QYOB 3VW3H 1F3JA 1NEZA 4GAGL 3HN3A 3A67H 4PJBF 2H6UA 3MA9H 4EDWL 2XV3A 4HUWA 4L3EA 1TKWA 5I19H 2X9WA 4DZBA 1DN2A 2WQSA 1KACB 3A0OA 3MV9B 4MKMA 2HRGA 1PZ2A 1PYWB 5DC4B 2VN7A 2JLLA 5CFAA 1UD2A 3WJLC 1WS8A 3UTQB 4J8RA 5ICXA 3H3PL 1NEZG 2Y06H 3ZDYE 1DJIA 1TFHA 4HWBA 1JZFA 5IG7A 4L8SA 4PRPD 4HK0A 4Q97A 3KLHC 1NIFA 2XQYA 4S10A 4CAGA 2HT2C 4JAMB 3FO1A 4I0PA 3THMH 2FEDC 2P7TB 4X50A 4L8CA 1KIUA 1CE1L 4PJGB 4NUPA 1Z0MA 4IBSA 3ECWA 4E41D 3CTTA 1RZGA 1RZIA 2X3AA 4GPVA 1GJWA 5GZOA 4XP9H 1XCXA 1BQRA 1HQ4B 3ZMEA 2XQYG 3MGTA 4P2OB 1WC7A 4OJYA 1NOAA 1FFPA 1XZWA 2ZPKH 5E2WH 1FNGB 5FK9B 4HEPA 3KWXA 3GLEA 5JHBA 2XG4B 3BEWB 1FNSH 4NCC1 5AW1B 2R1YA 4AW4A 1DVXA 4P9ML 1MCSA 4LGPB 4PJ8C 4GAFB 5CBAA 1AD9B 1HILB 2GUYA 3R1GL 2Z91B 1GH7A 3X3GH 3I6GA 4F93B 3FQWB 4LARL 4UDTA 5HYQB 3BZ5A 3GLZA 3Q3GB 4LFHG 4HEPG 2VL5A 4W9DC 3HHRB 4N0FB 2BSSB 4KKLD 5AOKA 4PCYA 1VA9A 2F2HA 4S2SA 4NM8L 1K5NB 1A6UH 2C26A 2G2NA 2HT4C 4QOKA 5D7JC 4WNSA 5EOCL 3LKQA 3QR0A 3GSNL 5SWSA 5K59E 3D08A 4PJHF 4OCLC 4ZZKA 2DAVA 4DGVH 2CHDA 2O61A 4YNYB 3TBTA 2GI0A 4RRPA 2O6DA 3O0RL 4XMKL 3SE8H 1YQVL 4HC1L 3RX9A 2X53A 3MLSH 2K1MA 3TLRA 1P7HL 1A9BB 1CXFA 2ZCHH 4OLWH 2YFOA 1V10A 4QY8A 4RRPG 3VXPB 3U4BH 1GOHA 1QO3B 1RVFH 1H9VA 5H35A 1JGDA 4IU2A 2L7EA 2Y24A 3IXTA 3U9PL 3RY6C 3OHXB 1J8HD 4A6YH 5I75B 4A67A 1LO4H 1RUKH 1YNLL 1RFDL 1A7BA 5DF0A 3AG3B 4AM0A 1FHGA 3BQUD 5JORA 1VAHA 5B1JA 1JHTB 3RVWD 5FCUL 2Y07L 1JTPA 1VDGA 2IADB 1U8MB 1A6VL 4JY6A 4XBGB 5FECA 1YEHL 5D1QD 1ETA1 3IPEA 4N5ED 1JAEA 5GGQL 1U8IA 5AYUL 1J8KA 5F9WC 1FZOB 2BP3A 1XMWA 5I30L 1CB4A 4D3CH 3CFUA 4N1EA 3BMVA 3GMQB 1AACA 5BO1H 4Y5VB 1KYAA 3KLLA 1MHCA 3L4CA 1LWRA 3NFPB 1PZAA 1UACH 4GW1B 5HHMD 4HIEA 5E8DL 1M2VB 4M5YH 4NQCE 2ZXCA 2ADFH 3NVQA 3LXAA 1NUFA 1KTRL 4YDVB 1OW0A 5DTFA 3WFHB 1ACYL 2YJQA 3W2DL 2HRPL 4AVHA 1FVEA 1JPEA 2R4SL 3L81A 3MA7B 1QLEB 5BVJB 4I18B 1JGVL 4EUPB 5KSVB 1CXKA 2XZCH 2Z31D 2IQAB 4XE0A 4NCC2 3RWFB 2LHAA 1V5JA 3I9AA 4DKEH 4Y2DC 4Z95L 1EQWA 3BAEL 3E3QE 2DWXA 4HT1L 2IDUA 3QR2A 1E7UA 1JPGB 2VMJA 1K4CA 2APSA 2OMVB 2PPEA 3B1UA 2N7BA 4QXTB 3US9A 43C9A 3QJZA 3EOBB 5JUEH 1ZGLB 3HN5A 1MRFH 2HLAB 3OVUB 5C0ND 3CFDB 1BD2D 2I7SA 3ME0A 3MDJA 3QFJB 4MB1A 5TQ0L 1KCSH 2VJXA 4W9GC 1G7HA 5E0QA 3MOBH 3T77B 2A6DB 4AY0A 3OL2A 4AH2A 4J28A 3SDCC 1X5KA 2P24A 5D55A 1KXQE 4C59B 4YXLL 3QORD 3BZ4A 3RBGA 3KDMA 3WNLA 3VXTB 3BLBA 4HPHA 3FQRB 1PLBA 3RJDA 5ISZA 2N4IA 1ND0A 2AXFB 3OLEA 5BQ7B 1ANUA 1AXTH 4PJCE 3FFCE 1JE6A 3UPAA 5IROA 3PHOA 1J86A 4ZQKB 3CVHL 3EOTH 5D4HA 2EIEA 5DZVA 5IQ9A 2E76C 1UCTA 4Y4KD 1RUML 3L6FA 3CXDL 4S11A 5ANMB 4DVBA 3G6AB 3B2PA 2DDQL 5C7XL 4D9QD 3SBQA 1EPFA 2MCPH 5ALCL 1A6WL 4B7LA 2QVFB 4LDLB 5MI0B 4P5MB 1JPSL 1TVDA 1Q9LA 4S1DD 3IMVA 1U95A 3I3EA 3GK8L 3QQ9C 1E27B 1YPZA 3T4YB 2ADJA 1PCXA 1QBMH 2RA1A 1KPUB 4CSTA 4YFDB 2QV2A 3N55A 4OSUL 3BH4A 2YR3A 1ZGLP 4FXKB 1EEYA 1URIA 4M7LL 4OD3H 1XIWD 2YEZA 3NA4A 3UACA 3Q1SH 4HFUH 3G5VB 1OPGH 1NINA 3W0WD 1V54B 3D30A 2F8IA 1KGYE 2UZYB 4ENZA 4LSPL 2HT3D 3OJ2C 3MLUH 5D2LE 1S8DB 2WUCL 3T1WA 4X6FA 1HIMH 5G5DA 2C1PA 1NLBL 4LSQH 1WAAA 1ECYA 4GBXC 4R5VA 5HHXH 2P8PA 1P69B 3CQFA 3QIUD 5DZPA 3AUVA 3B2VH 4FNRA 4NJ9L 4RAVB 4LCCA 3WO4C 4PJ7F 1HTYA 3DV6A 1QUPA 4HHAB 1QACA 2X40A 3DHPA 5BRZB 4EPSA 4A2MA 3TH4T 5I1AA 4EN3B 1NC2B 4KHTL 1TVHB 4M8VA 4WAFA 2DH3A 3MRGA 4XAWH 3SCMB 4RGMC 4QRPE 4JRYB 4GW5A 5GS1C 1ZWIB 1YUHB 1INEH 4JHAH 4XC1H 1LNUB 4OU3A 3RB5A 3VFUA 2X89A 3R18A 2JKSA 3PWNB 4Y1AB 3F6JA 1L9QA 1FN4A 3HS0A 1TVBB 2QDVA 3D0VB 4JDVA 4UYQA 1BZ7A 1TITA 3QEGL 1PY4A 2GSIB 3QAZB 4ODTH 4Y5YB 1EDYA 5EN3A 1MCFA 2XKUA 3WYRA 2XG5A 3MV7E 4KY1H 3BIBX 1WGVA 4Z6AT 1L9OA 1GC1L 5EU3A 1T5XA 3KLSA 3QS3A 4KQ3H 3BYYA 5GGTA 1A5FL 1DJWA 3O2WH 2JJTC 3ZYIA 2IAMC 4HS8H 3RLSA 4G3YL 4PBDA 1NMAL 5FHAH 2Z92A 3JWOL 4ZW3A 1DUYB 1TYJA 3ISYA 3FOLA 4X4ZA 4NZUL 1VB9A 1RJLA 3FT3A 3REVA 1EA9C 2MEJB 3W11D 3S35L 1GYUA 3VFOA 4AYMC 1UWFA 4OH2A 3EYQD 2WBJA 4N0CC 4YE4H 5I6LA 1QHOA 2XACC 3S8WA 1KYUA 4OIIH 3L1OL 1G9ML 3O6FB 1IT9L 3MRPB 3FB7A 2Z4QA 1TTFA 1AQDB 4BK5A 2XN2A 2IWFA 1OE3A 3C8KA 5JIQA 1U91A 1PG7L 2ADGA 4Y9GA 1BYPA 3ATDA 5IBLC 1QFUH 1RD6A 4RMBA 3BCDA 3LZQA 3VXSD 3UERA 3ABMB 3JWNE 4IRJD 3WNPA 2ZXBA 3CLFL 3MNDA 2AEWA 4TLUA 5I76B 4Q9RH 1DVTA 1YHPA 1GGIH 4PG9A 3RX8A 4NRZB 1CU4H 4R83A 5L9DL 2WLIB 3GTTA 4LRIA 3LPWA 4PWFA 1TUPA 3A5VA 2PPCA 3EJYD 2Y7NA 4WTZA 2VC2H 4AX3A 2ZCLH 4WI4A 1CL7I 4FZ8L 5EBGA 2A1WL 2XWJB 1NLDL 4LSSL 4Y4FB 4YFLI 1NPUA 2IDSA 3WO4B 4L1HA 3TA4D 2JELL 4RNRA 1YJDL 4B95C 5I1CH 2XI9A 4FGMA 3RILA 3FCTB 5FWRA 4WTZG 4Q2ZB 1QFWL 4KV5E 3VFSB 1FYTA 1DQJA 4JM2F 1BG9A 5I16B 1RIVH 3P4MA 1DQLH 2HJKB 1P53A 2R1XB 5CJXC 5EZOH 1K8IA 2ZOTA 3KWWA 5HI3C 1JNJA 3QI9D 2D2CC 5KZCD 3FBKA 1D5RA 1NBZB 5HHOD 3T0EE 2WCPA 3H9SD 3K6SB 1U8OB 1QLFA 3WNMA 25C8L 4JM4L 4FCHA 4NM4L 2VMFA 4KZDL 2ODIA 3O4LE 3ARDC 5KBMA 3QJFB 4P9HC 4FLHA 2X4RB 4GKLA 3OZ9L 5AB0A 4XNZC 2P5WA 4EOWL 1WIUA 3CK0L 1GY1A 2LTQB 1ZLVH 4BRJA 3KYOA 4FNLH 4UI2A 1PIGA 4AMKH 2DLGA 2H41A 2H32H 1E6JL 1RXLA 4UTCA 3DBXA 3RIFF 4FNQA 1E5YA 4NCDA 2Z35A 1T1WB 4YZFE 4M61A 4UQ9A 4QTHA 3ZKSD 1BZOA 3OGCA 4F9PC 3K8MA 3OAUL 3X11A 4FQIL 4MNHB 1A1MB 4A7GA 4K4KA 4OV6F 2I9LB 1JRHL 3M07A 5C07E 3K6DA 2WLMA 3KYNA 4JL2A 4XNXH 2VQTA 1ZTXH 3NRFA 3ALPA 1UJ3A 2B1HL 2W0PA 4JRXB 1MQ8A 1P84J 5LWYL 3P4OB 1CL7H 2AK1H 1RKRA 4PGEA 1DUZB 2NRDA 2JE8A 1T1ZB 2W65A 1QPPA 5DJ0B 5EIIB 2BVUA 1ZLWK 5AAWC 5SX5H 2DB8A 2F6AA 4UZGA 3LB6D 4NNPH 4X9FA 5TFSL 2WXOA 4IS6A 2DKUA 5DR5H 3T2OA 1U8HB 4UMSA 2GIYA 4KMTL 5IHBA 3IDYC 2XPZA 1BVLB 3MROA 1N59B 1NAMA 3R8QA 2LU7A 1RP9A 1MCDA 3ELQA 3LN5B 3UGXA 2LU5A 4PCTA 2IWGA 2ZT9C 1YEFL 2QSQA 3UOAB 2EDFA 4TRPL 2GITB 2UX7A 3BIKB 5FHBH 3BUPA 3TO4D 2WXFA 4FQPA 3GMMA 4HU2A 4WUUE 4Q6YA 1E9OB 2V5SA 1OGPA 1XF3B 2P8LB 4HIHB 4X0NA 4QRTA 5IVXF 5C2BH 2H2SD 4LHQB 4DJMA 1RK0B 2H1LM 1P4IH 3CUPB 4MCMA 3TIEB 3ZOAA 1YEWA 3NZSA 4W6XB 2WXGA 2QSTA 5L6YH 3BYTA 3MZGB 3SKOB 4PEEA 3U1PA 3TTYA 3QHFL 3K3QA 4WWKB 5CMAB 2X4TB 5C70A 1MRDH 1J05B 5ESAB 2LVCA 1UZ6E 5HHNB 4LCUB 2ENQA 4HD9A 3VM7A 4I9WD 5CHNA 5AD0A 1OLLA 1ZVSA 3O9WA 4OM1H 1N0XH 1XTMA 4GI8A 5C3IA 1TQBC 4H0HB 3KW7A 2G9HB 3V9CA 3KPSD 5ID1A 2AEQL 2EEFA 5T8IA 3E6HB 4PH8A 2CJSA 5PCYA 4GAYA 5BZWA 5DD6A 4ZK8A 3GKZA 2X05A 1KMGA 3O3AA 4QYAA 1ETZB 2GHZA 5DWUL 1PZBA 2KLRA 1BBDL 3MODH 4JJ5B 1TXKA 1ADQL 3BGFC 3SQRA 4D0DA 3WTVA 3FF7A 2DQIH 1FC2D 3PWPD 3RHWF 1F3RB 4H8VA 4L1DA 3OXSB 1M05A 1B2WH 3GBLA 3HE7D 4UQ2B 1A9EA 2HXAA 2LFEA 1MNUH 4V2BA 5L0QC 4Y16C 3MN8A 1QHPA 4WEEA 4LSTH 4ZS7L 4Z7NF 2OSLB 2EILB 3CDGB 4HLEA 3ZK0A 5F3BA 3LZNA 4I87A 4KKCD 4YHZH 4NZTL 3LSOB 1L6XA 3A6BL 4OJFL 5F1OB 3VWJC 3ETBF 3KYKL 1I85A 4LCVA 5B1AB 2KUTA 3FSAA 3B3IB 1SLUA 1S7TB 1ID2A 2W92A 3MRNB 4OQTL 5EIVA 3VG9C 1YEKL 1HL4A 2BIHA 4Z76B 2CO3A 1J0HA 4GI9A 4BZYA 2JKRM 3IE4A 2ZONA 5CCJA 1PZUB 2ZP9A 4ELKB 2BDNL 4Z7WA 4UV4H 5CJBA 1VGKB 5I6PA 4PS8A 1NGXA 3QJQB 8CGTA 3O41B 1NGQL 3S36L 1DBAL 3P30L 1U8KB 2W94A 5DMGC 5JPNB 3EGSB 3A4FA 4W9HC 2MSPA 3V6OE 1MHHA 2V3DA 1CDCA 2FVNA 3MRFA 2P28B 4MX7A 3HAEH 3L2NA 3U2JA 1QBAA 2WZAA 1SGKA 1HSBA 1WTLA 4CU8A 4AWJC 5AZ2L 3L5XH 1GGUA 2XVGA 4LL9A 4L3CA 3V7MA 1IL1B 2WD0A 5KANG 1CLZH 1DEEB 4PJIB 1MCWM 5F96L 4G59C 2ZOUA 4G8EA 3DMMB 3FH8A 1OAYH 1TJMA 4YDKH 1MVUB 1OM9A 5HHVH 2HKHL 1NBCA 1MFAL 4E9YA 2VM9A 2ZAIA 1QHQA 3QDMA 3VGBA 4EQ3A 1JJUA 2KQMA 1NFDB 4K3GA 1MREH 2NPLX 1RZKC 1UXSA 3D33A 2AJXH 3MJ6A 1LMIA 4GKSB 4BYHA 5AW3B 4UB0H 5A7BA 3B43A 1RMFH 5KYNA 1KJ2L 4P99A 4I5BB 2X9XA 4WW2C 1M57B 1B0RB 3CN4A 3N41B 5L8LB 1T1XA 4MJ4A 2WCGA 4AL8L 1TCMA 3AUWB 1RI8A 4NQDB 3RTQC 5EOQL 3RVUD 3MCYA 4G7RB 5DO8A 3VI4A 3BRDA 2R2BA 1LD9A 3QG7H 3TYGL 4F33A 1WHOA 2AK4E 2AV1B 1AJ7L 1S9XA 2YC1A 5FKPB 5IK3A 5C09A 3WJJA 4QRQB 2EUZA 2OTWA 5E1AA 3HG1B 4PJEE 2QPDB 2FR4B 2YD4A 3IMTA 1B6DA 4NO0D 3FH5A 1EXHA 1KIRA 1OAZH 1W2KT 1JN6B 2XNAA 1TLMA 4OFIA 3TPKA 5IM7A 2F15A 2R7EA 4GRWH 1BEYH 3CFBB 3T8XB 3B9KB 1XHHA 1IUZA 1YEGL 2IPKB 4HWBH 3BVNB 3DETD 4X0KA 5DJ8B 2VNCA 5FUOH 4BSVB 1ZLEA 1CT8B 1BZ9B 1CK0L 2K7QA 4JM2D 1EJOL 3RI5K 3PDOB 5IHLB 4G9FB 1MFMA 3KPQA 4QCIA 1ZAGA 1M7IA 4TNVF 4QHMB 2X6CA 3D52A 3POCA 4IQHA 4NQCB 3JT0A 2DLEA 2YAMA 4XVSL 3NDYE 5DJCB 2VXUL 1JK8B 4TXVB 3V6FA 2XU9A 5EUOF 3L3KB 5LGHH 2ZWKA 2ZSWA 4X6CF 4UT9H 4FA8A 2GFBB 1S5IH 3ARGB 3C8DA 3O2DH 4GW4A 5CM1A 5IB2B 1EFXA 2OXHB 3BP7B 3F01A 4P2RB 1PKQE 3G3LA 4QHNB 4L5FE 1EJFA 3L5JA 4XNYH 3S4SB 1A2YA 5GGSY 1T03L 4JDEA 1DSYA 2DQUL 3PL6D 4OGYH 2FGWH 2LGNA 3CFMA 2EVIA 15C8H 1AHWC 3N85H 5K9OA 1U3HC 4PJ5D 1J5HA 4M5ZL 2ESVA 4MBRA 4TNEA 2V2XB 4F5CA 4BA0A 1ZPLA 4YSTA 3QQ4A 4ZJ9A 1G9NC 4XNQB 2VDOB 3S34L 4L29A 4CW1B 4EDXA 5H8DA 2DTMH 2V5MA 3MHZA 3NESA 2Y1ZA 2CDGA 4P5TB 4HJIA 4X2UA 3V0FA 2EXWC 3UEQA 4LBEB 3K0YA 3G7TA 5IEKA 5FGCE 5ICZB 2FT6A 1UC6A 1UA3A 1G7PB 2F58H 3IFPB 1CFNA 1KB5B 3NCXA 3FYIB 3O6MH 5CEYB 4E9VA 2VSKB 4L8DB 2UVEA 1Q94A 4A7QA 4N0RA 4PJCB 5C0AD 1U2HA 1BHGA 1KLUB 3VFTA 2JJTA 4PJDF 4KRNA 5I18H 2ZX9A 4JFFD 4XWGH 1CPUA 5I5JA 4Y9EA 2F53E 3IKKA 3QA3B 4K3EH 4QNPF 3R19A 5IW1B 4J1UB 1NIAA 1ED3B 4ZMNA 4CC4C 3PJSA 5GJTH 1I7UB 3C6LC 4JHVA 5DC0A 3DYMA 3FU0A 1K2DB 4FNPA 5L4JA 4M00A 3QSKB 4XPGL 3X1NA 4YGVA 3ZHFA 1BOGB 1AY1H 3PP4H 1WBYA 2FNBA 4TVPH 1CGXA 5LBGA 3WN5B 4RGND 4ZXBA 3AU0A 1S5HB 4ALAC 1DVSA 3KD4A 5JW5B 1TIUA 2PMZA 4MD5B 4F7TA 3FTUA 2H0JA 4I4WA 3D0LA 2DS4A 5IB4A 2YAOA 4HJUA 2X3BA 5T5FA 3QC5X 5DSCB 1ZHKB 2BNRA 4FL4B 3JWNC 3L4VA 1KTLA 5ETUB 3GRBA 3AY4C 3NSDA 2ZUQB 5IBUB 4NKOA 4J2QA 3ARFA 1LGVA 1AFVL 4KZEH 3W5MA 5C0BB 4A7VA 1I9RH 2FWOA 3ARYA 3WTXA 3K72A 5LCVA 4QF1A 1KY6A 4A04A 1BX2B 2EIZB 2V7NB 4RAUA 3NGBC 5DWPA 3WTSA 2R69A 4HJGB 5F72S 4HLZH 2NY1D 1YMMA 5DRNA 4J3WA 2WOYA 4XP1H 4PJAB 35C8L 3D2UA 4PUBH 4ERSH 2PABA 1HHIB 1CLCA 1QQDA 5D7LD 1AGBA 3L48A 4YSPA 2E7LC 3MRIA 1PQZB 5CJXA 2OCJA 2OI9B 5HDWA 4Y2LA 2Y5TB 5GRXG 4FABH 3QDJE 1RHFA 2ZUXA 4EBQL 1RHHA 4DSYA 4FKEA 3T0EC 1WAPA 1HQRA 3BWZA 5I1JL 4HWEL 3GMOA 5ENWA 3ARDA 3BAWA 1EERB 3BO8A 3N1QC 5FYKD 3GSOA 3X1BA 1A21A 1A25A 3H85A 5J4MA 1X9QA 1LL1A 3SOBH 1N0LB 3ZO0A 3MV7B 2WMPA 2R56H 3V0WL 4UQAA 1G6RA 1WZAA 2YAEA 1C7TA 5CGYC 3QO1A 3DXAA 4IIZA 4LCIH 5IOPB 1TQCB 1P7QB 3CFCL 4K23H 1K3IA 3APDA 4XP6L 4HXBH 3I02B 2A4CA 2DL2A 3U7YH 2C9PA 3GXDA 2V33A 1IQWH 2X12A 3TBBA 3V4VA 3I9GH 1C5CL 3AAZA 4GXUN 3SQBB 5SWZD 1CD8A 3K46A 1HH6B 3L1FA 3CGTA 4PLJC 5IR1B 4G8IA 4OLVH 2KS0A 3N3EA 1I7RA 2H47C 3ZT7A 5IMLA 2BSTB 1WF5A 2LFGA 1OTTD 2BRRH 1EMTH 3GSRA 5EEYA 3FO2B 4O02H 2JLPA 4POZD 4F58H 3IDGA 3D4GA 3FQXA 2APWA 1GZQA 2X5PA 5FYJL 5AAWA 4P46B 3UZQB 4OM0L 3QXAB 3PWVA 5HGDB 3BXNA 4K9EL 3CVIH 1FIGL 3DURB 2PXYB 4U1HA 4YPGB 3H6AA 3MX0A 4G82A 4V2CB 1IM9A 2A83B 2XA8H 3WHXA 4OCYH 4JPVH 5LQBL 4D8PB 4OZ4A 4Z8FL 3VD9A 1UZGA 3OBAA 4FERA 4G7YH 5D5ME 1QR1B 4L9LB 4X6DF 1TEFA 2PW2B 1D7CA 4UNUA 3MMEB 4L37B 5IGXH 4OV5A 2HSIA 4S1QL 5KTEH 4HWUA 1D5IH 3AWFA 4XNDA 4WWNA 3B7RL 3HBGA 2OA9A 2JXMA 4LRNH 1V3KA 3BWSA 1UOWA 4TNGA 5I8KH 3EDEA 4B5EA 2VJ8A 1MW2A 1T5KA 1RJYB 1PSKH 3TBVA 4G5AA 1BFOA 4YQXH 1KWGA 3KHQA 3QEUA 3L3DA 1UQSB 4UU9B 4MAUH 4GQQA 5ADPL 2B14A 2VAAB 1KGCD 2P8MA 3F7YA 3SB3A 2WKLA 3DPBB 4ODUB 2XWCA 4JFZL 3X14A 2EH7H 5IT2H 4G6FD 2WLHA 4S1SH 3QHTC 4ZDHB 2F74A 4E9XA 2AJVL 3NIDB 5HHPA 2YD6A 2YS4A 2FWLB 3HZMB 1KXTA 5MENB 1TZAA 1YZZA 3JTTB 1AQMA 4QO1A 3MJ9L 3G5XB 5E2UH 2A9CA 4PTTA 4FXGA 1DLHA 4LCYB 5BUGA 4JO3L 2ZNWA 4ZFZA 1ULVA 3WY3A 1IFHH 2YUZA 5GGTH 1GSKA 1QSEB 5LXGL 3QWRD 4BHUI 1VZGA 3NIGB 1BFVH 1CLOH 3PS6A 2FL5B 5IEHB 1WFMA 4UOZA 1KN4H 1TTAA 2DLIA 3FUKA 3WLBA 4E9SA 4B9KC 3GNMH 1AI1L 1BECA 5HDBE 5IV2A 2GY7B 3FQUB 2P1YA 4PRBA 2V17H 3KXFE 1NC4B 5IMMA 2XZQL 5KSAB 4WGWB 1LO3L 3K2UL 5AW5B 1ZEAL 2NY3D 2PN5A 2JB5H 1WTGT 1FP5A 1G7JB 1ADWA 3U46B 5B3JE 5F7BA 3WGUB 4E5XA 1FE8H 2F54A 2G60H 1FG2A 1VZHA 1SPDA 1XGYL 5D7SH 3ETBJ 1ZD6A 3VD4A 4UDUB 3IXAB 3D3VA 5DJ2B 1JBJA 5GQBA 1MSPA 4NBZB 5D71H 3WTWA 2AJUL 5DZJA 3FOMB 5KSBE 3EO1B 1VACB 2DLTA 2J72A 5KBPA 1Z9NA 5E7BA 3LRMA 1ODAA 4LOUC 4UM9D 4MASA 2DWEB 3B9AA 4CADA 1E90A 2MKWA 2CH8A 2PYFA 3GXPA 3F00A 2WXLA 2BERA 1VRSA 3U0TB 3H2QA 4KVPA 4Z7QB 1BXUA 2VXSL 4GSQA 4PP1D 4HZLA 3VQLA 2OL3B 1N6QH 2Q7NA 4MQ7B 4F7CA 2JF1A 1MUJB 1T6VN 6FABH 1ZRUA 4E41B 5IB3A 4X7TB 3V6OC 3LVTA 5L2JB 4DZ8A 3LHPL 1U41A 1QRND 1EXGA 4H8UA 1BSIA 2NTSP 4IMLA 4PSRA 3S7GA 2ENJA 3X1GA 3IDIB 5IZ7A 2A0LC 4V1DD 1KCWA 4WUUB 3G08B 3GXTA 5A2CA 2JV6A 5I71C 1I1AD 1QSFA 1FFNA 3V6ZB 1AGFA 3S0PA 4C4BA 2GJ6D 3IN0A 1JMXA 2FATL 3MBWB 4YDLC 3HI1B 2J1ZA 4B50A 4XTRC 1C1EL 1FO0B 4HSAC 2ICWA 1S7UA 2EC8A 5J3HC 4CMMA 2JIXA 3G6DL 4Q14A 2VDNB 5KAQG 1CR9L 1DFXA 1NJ9A 5DJZB 4OZIB 3TONA 2JCWA 3VH8B 4HX1B 1FL5B 4DP7X 4OD2B 1J0YA 4HJSA 3RWJA 3WNJA 3OKEB 5ABZA 3ZKNC 2H3KA 1IGJA 2OZ4A 5AW8B 2QSCL 4MD4A 3SDXA 3B7TA 4BWWA 4GP8B 2CR6A 5I1DB 2NNFA 1E9PA 4FTVA 5CINH 4MAYB 3FU9A 2HYMA 5I1HL 2AJZA 1YC7A 3RTQA 4M56A 4KUZH 3QYMA 4FN0A 5F89A 3OV6A 5DJXB 2X9ZA 3DROB 5HJ3B 5DMKA 1OXYA 3GLAA 3G5ZA 4ZYKA 5I66A 4WU7B 1I75A 5I1LB 5EO0A 5C08D 4HGWB 5DFAA 1XGTA 1NPJA 5DHEA 3UDWC 1DVFD 1WWWX 3LZLA 3DO7B 4M29A 1WBXA 2C7UB 5DGRA 2LU3A 3IJYA 4LF3A 4AQ1C 1ZOXA 2WTRA 1F45A 1FFRA 4O9HL 4YHKH 1J5OH 4XXDB 4CMHB 1TJIH 2XJKA 3CMOL 5FUZH 1MPAL 3BQUB 4U6HA 2W38A 3RU8H 4BA8A 1NGPL 2CAKA 2DQJH 2V5YA 3CFEB 1SY6L 3PF2A 3G6JA 1TF4A 3RDTD 3BRFA 3V79C 2ALAA 2R23A 3NSJA 2YIHA 4X6BB 5IESH 5GZNA 3CXFA 3IETB 1MJJB 1AR1D 5C92A 4GG6F 2UWEF 4JB9L 3EZ8A 5H2BA 4QHUB 1XR9B 1UWYA 2DJUA 5I1GH 3QNYB 2ZXDA 4F57H 1T04A 2Q5BA 3F12A 1T4KA 2J57A 5E8OA 5HHMB 4C83A 1MW3A 1GC1C 1UWEL 2HLFD 3KPNB 5ESQA 4JLRB 5GSRA 3VQMA 3VD3A 3QJVB 4KRLB 2D31B 5ESVA 4TUOA 3JWOC 1MZYA 2J4WH 2Y36L 4HQQH 4JFSA 5AVWB 1KIPB 2Z31B 3BGMA 5HYJE 4XWOD 3L54A 5KS9A 2DQHL 2E56A 1EUUA 2A4EA 3BPCB 4K7PL 3VFGH 5KJRH 5HGBA 1RIUL 3GEWB 2G2RA 3L7FB 1P4LB 2IG2H 1PKOA 1DBBH 5EU4B 3B7YA 3Q1EA 2BY0A 4IBUA 4HP5A 2G0KA 1KLFA 1G9MC 1LP9A 1F4YL 1C12A 1CUOA 1PW3A 4NUGL 1H6FA 3WOVA 4MCNA 3EGXB 4XVJL 1R19A 3WSQL 3UGEA 1BD2B 3MACH 4JFOB 4TL4A 1TJHH 2CDEA 3AC0A 1ZLSH 2GAZA 4PJFF 3MA9L 3QORB 3KMDA 3CPLB 1KB9J 2BMKB 3PIQB 1FV1A 2Q76B 2ZCKH 3DOSA 1WWCA 3KAAA 1W6WA 4QWWD 2IOIA 3D39D 2EKSB 5CGBA 2H5UA 5CSZA 2PP9A 2IAAC 3WLWD 5AL8A 3HFMH 1H3VA 4NNXA 3QRFM 2Q2LA 3CLWA 3ROLB 4BSWA 1WV7T 1S3RA 1INQA 3CIQA 2CO6A 4CVXB 1KTKE 1K85A 1D5BA 4L1BA 4WK4B 4NEHB 4P23D 4Y4KB 1HYSD 5IVNA 4RMTA 3IAQA 1T21B 1IGTB 3HNTH 2WSDA 3TBYB 3BMWA 3UTTE 5F7EL 1UT2A 1JYWA 1YJDC 4OLZH 4G71B 4PR5B 2CK0H 3FDWA 2ZPKL 5E2WL 5C9JA 4MGXA 2QL1A 4YBQC 2VABB 3VVWA 1CTMA 3ZMRA 4J4PD 1N8OE 4K2UL 4UBDD 1HJCA 2JI2A 4P2QE 3PQYD 2W9EL 1VHPA 2ZWZA 1OAJA 4ELMF 1NCWL 3L5WA 4RIRA 1I8LC 3QZMA 1XGUB 1LK2A 2AQ3A 2WYHA 3X3GL 2CA4A 5E2VL 4ZO8A 5HGGS 2ZCZA 1QLRB 2YPKA 3KBFA 5KVFH 1ZA3A 3DRTB 5K1VA 3E8UH 3AY4A 4LLUA 5DC2A 5I8EB 4H26A 5GGVY 4YR6A 3CLEH 2VN4A 3Q2LA 2PO6A 2VDMB 1Q0YL 1A6UL 1ICTA 4A2DA 2AXGB 4Z7VA 1GGCH 1MZZA 3W0WB 4BCXA 3RX5A 4U6YB 1Z5LA 5EZJB 2X4UA 3II2A 2WOBA 1FAKT 2XXFA 1JF6A 3MNWA 5EUKA 2WW8A 1WCBA 3MTXA 3VGAC 4Y19A 4NZFA 3AJ7A 4R90L 5AOZA 3MLSL 5TD4A 1PKQB 1YYMH 3LN9A 2AF2A 1MWAL 1OGAE 2MIZA 3CQQA 3HUJB 4Q56A 5DQJB 4AOFA 5CCGE 5JHDA 2ZCHL 2Q20A 2QADC 4NSKA 1MH5B 2BM3A 5TDPB 1IBBA 2IWKA 5BJTB 1M7UA 1S7SA 4NKIL 1BV8A 1KF9B 3HE6A 3QWOB 3UPRB 1ASPA 3GJFB 1MHEB 4ODSH 3AQDA 1DANU 4LOFA 4A6YL 3MRCB 4MJIE 1MCLA 4TL5A 2X0WA 1KPRB 2HVJB 1PG7W 1URZA 4YFLF 3TYFB 2PWFA 3EJRA 3RFZA 4AXWB 4IKNA 4PBWD 3OAWA 3L7EB 5C2UB 3WI9A 2HKAA 1X7QB 4GKZA 4JM0A 5FYJE 4A1RA 3FT4A 4ODVH 2CK2A 2CDFB 3SZKC 1KV3A 1F6FB 4PMFA 4EIBA 1PMYA 4JDTH 5D7EA 1MCPH 1LO2H 3VYOA 1WA0X 5J13C 1CCZA 2I60L 3FU8A 4NUJB 5EV7A 1JP5A 2D7QA 4FQXC 3QJUB 1S9VA 2I85A 3T6ZA 1D5XA 3BD4A 3L3OA 1JV5B 5HJBA 1RU9L 1E8ZA 3QUXC 4P05A 5AVXB 4JFHD 4A2EA 1J11A 4R7VA 5L8KB 3D18A 4P3DA 5FO7B 2ADFL 4U1GB 1WJ3A 3EG9A 1FNEA 4FI6A 4KBPA 4PJXA 5C07A 2ZKMX 4F15B 2BNQE 4OZHE 2EDLA 2VDKH 2B9AA 1BCIA 2RD0A 3ATFA 5DA4A 5E8PA 2CCVA 2XZCL 3MLVH 3GXMA 5JXEC 1W0YT 1C5DA 2FECL 1XEUA 3QNXA 1I4FA 4DKEL 4RFNC 4FFWC 3BWUF 4IRSD 1X5YA 4RBPK 3K4DA 4F8PA 3V52L 1ORQB 4PRID 5HDRA 2MWCA 4MNQE 3Q8BA 3MNVA 3BDYL 3B6SB 3U6XS 3D85A 1KCSL 3CZFB 3ZKMC 2BOBB 4KRPC 3KL0A 4FQCL 4XHJC 4OFYA 3U2SB 3VXSB 5FLUA 4IJ3B 2ZX8A 4ONHA 1SQMA 4IRJB 3U6RA 5T1JA 2XXMB 2ZYHA 2C1OA 2NSQA 3P3YA 2I32A 4PJHB 1GOFA 1AXTL 4PJ6A 2AW2A 4L4VE 3FW6A 2WN2A 4L4TE 3UROR 3VXNA 4XMPH 5E1QA 4ZUTB 1KN2H 2BSEA 2RIKA 4GMTH 3RVTD 1V3LA 1JUFB 3PWLA 3QUMH 4LIQL 4AEHH 4WFGD 3HBQA 4ODWB 2BP5M 3O3EB 1OSZB 5HD8D 2VLKA 1AO7D 5EA0L 3IRPX 3QUZD 2HFFB 1OSPL 2N0MA 4J3OG 4JKPH 4ZNEE 3TZVC 4AGMA 1MI5E 4FQHA 3QEQE 3VXUB 1S3KL 4ZS6C 1IB5A 2GC4C 1VFAA 1QR4A 4Z77A 3QZWA 3T71A 5J9PB 2AQSA 3L4YA 4OKVB 5F1KC 3VFVA 5BVPL 4JPSA 1A9VA 2FTAA 4WFHE 1RV6X 4JCLA 3QI9B 5KZCB 5CIPB 2ZYIA 4NRXA 2DMCA 5HHOB 1KNOA 1QUNB 3H9SB 4HIIA 3TT1H 1E8WA 1RK1B 4LLMB 3QZWG 3AY2A 1JNNH 3UBXB 4P04A 3ML9A 3DIDA 2ADIB 1EZVX 3MV8A 1CFVL 4LVNC 4Z7UE 5F6HJ 3Q1SL 4DN4H 2BSRA 3HBPA 4I0CC 4DQOL 2W07A 3O6KL 4JFWA 1NFIA 4NQTA 5K9KA 2E0PA 4OF6A 3QUXB 1NEPA 3MOAL 3SQOH 3LKPA 2HRHA 4L8BA 2OX5A 4JFDE 4WFED 5F6IB 2G4EA 4NUMA 3QDGE 4RGOL 3GEFA 4PGBB 4CVWA 2EZ0C 3TA3B 1E67A 1GS8A 1GS6X 3QJTB 4TVSa 4HIQA 4KX7A 2SEBB 2JCCA 5I26A 3B2VL 5IVZB 4LAQL 3D07A 3RWEA 4F2EA 4JFED 2J8UE 4YHPB 3W57A 2H0PA 2LR4A 3TU6A 1HS6A 5KEZA 5AG8A 3UTZB 1Q1JH 3QPXL 2PPDA 3V9EA 3APNA 5DLMH 1NDGA 2ZYRA 1F13A 1XO8A 2EO1A 1WICA 3K6NA 2W8CA 4XAWL 2ZUTA 4DO6A 3RWIA 3LIZA 5T3XD 2GABA 2NR6A 2R83A 1INEL 8PAZA 5DVNA 1MFEH 3CVHA 5B7MA 5K69A 4GO9A 1ZLUH 1JWUB 4U1JB 1A7QH 1R47A 2NW3B 2AQPA 3PNRB 1JZDC 5LN4A 2YGPA 3CHXA 5D7KE 5DRZB 1XH0A 2C9AA 1U92B 4AL8C 2E27H 2HB0A 4LL4A 3AB0C 5LCVH 4ZO6A 3EBHA 3ETSA 1IAKA 2JJWA 3G04A 4F7MB 3HEIB 3D48R 4JZOB 4HF5L 5DHVH 2VR3A 4RRPM 3BHBB 5I17A 3IJ7A 4PWGA 5DQ9B 3TO4B 4PB0L 3RJQB 4CILA 4R4BB 5KOVC 1R1CA 3SDDD 1W8OA 2NLJB 5CNHA 5DZAA 2YQ2A 4MYWB 2N56A 3WKQA 3KPRA 2MPAH 2HUEA 2YPLD 5DJAA 4BBWA 5IWLC 1FLRL 4CVUA 4GRWF 2FLMA 4ZD3L 5T3ZE 1JXGA 4K5LA 3E1F1 2VE6A 1IKFH 5DEJA 5FYLE 4DN3H 4ZTEA 4YO0B 3FZUD 1T7YA 4W6WB 3HB3D 1KDJA 4OIIL 4H25A 1DJSA 2H6PB 4G7VH 5D7IE 4WUKH 3V0VB 3VX1A 4X8CA 1JWMB 1HZKA 2B0SH 1G6RH 3H9HA 1W0VB 4AYFB 1BA9A 4H44C 5ELIA 2YEVB 4IYKA 5GISH 3KPSB 2FYYA 3RGVA 4E9QA 1X5GA 2ATKB 3ZTJG 1P5VB 3IMWA 3QIBC 4HUUA 1ML0A 2VDQB 1IGYA 5HVHC 4WHYG 3QPQD 4AQ1A 2QKIA 4LK4A 2WBWB 3CQPA 1CGYA 4ZUUA 1JPTL 1CU4L 4QYOA 4S0HA 4XHQA 2Y7MA 3C09B 5I6MA 5E6IA 5IQNA 2H0FA 1ZS2A 2WQ8A 3PWPB 3KJ4B 3RQ3A 4XH2B 4LCWD 5I23A 3HC3H 3MV9A 3HE7B 1T7WA 4N2LA 4RETB 1D9KD 1PYWA 3GRWA 5HTSA 3UTQA 3PPEA 4PJ7B 5HYSB 5I1CL 3HS9A 1TZIB 2DWDA 3ATBA 3Q6GH 3JYCA 1YAZA 4IGBD 5TF1L 3QQNA 4JAMA 1YG9A 1FL3B 3AU1B 4PJGA 4G6MH 5HP5A 4PG2C 2VXQL 1MKFA 4XNBA 4K5MA 5K33A 1ET8A 4LVHB 2UXVA 5EZOL 1QW9A 1LO5B 3LMJL 4NN6B 4WKZA 3OKNA 5CXPA 4B5ZA 1DCEA 5LBSL 1HQ4A 4PV1C 2YXWA 3DVGB 1T66C 3EZJB 4FNUA 4OFKA 5D4IA 4PY7B 5HDLA 1DBML 3LPFA 3GXFA 3ZRSA 3EFOB 5FK9A 1SEQH 3RL1B 2XG4A 1G7LB 5HDQL 3AMKA 2EDBA 3BEWA 3KPOA 1XSIA 4MQSB 1RPQA 4OAWB 3X13B 4BFFA 1MIEH 1HILA 4ZMQA 2Z91A 3R0MA 4OB5H 4J2XA 4FNLL 4KDTC 5E7FA 2IFFH 4AMKL 5HYQA 2K45A 3Q3GA 1UXWB 1D6EB 3DDFA 3MYJA 4FNSA 4N0FA 3GI9H 3P0YH 4FHBD 5CD3A 3D34A 4YHYB 2CUAA 1K5NA 3HFFA 4KO5A 1JFQH 4XI5D 4APQD 1NKOA 4LEXH 4JO4L 3QISA 32C2B 2WJ7A 3MGOB 1Q4NX 4YNYA 3SDAC 2NOYA 1I3UA 3I9IA 3W56A 4BXSV 3W9EA 3HI6H 1W0WB 1QRKA 4ZSOB 1I8MA 1IC5H 3OJDB 5DEFB 1GGBH 3I6SA 2F53A 3BIAX 1A9BA 2IF7A 4UOQA 4BQBA 2WPGA 2WQXA 3RKDD 4E9RA 3UJIH 1QO3A 4MJ2A 3C5ZD 4XBEH 1WITA 4TPRL 3SO3B 1P7BA 4M43L 3BAYA 4RMWA 3OHXA 4UTBL 3SYOA 3IFNL 4QJ3B 1WIOA 1IFRA 3LYRA 1FDLL 4G7QB 5L2KE 2V2TB 5E5MA 2B3IA 4WIQA 4O58H 3AREC 3FQ2A 3QIWC 3BC9A 2JKXA 3O8XA 2HX8A 3HPLA 2CE6A 3OC5A 4X9GA 1JHTA 2IGLA 2Y7LA 4PRHD 2IADA 3ZDZE 1QZNA 1U8MA 4XMWA 4KJQC 3PAZA 3VXQB 3C5JA 4OZGE 4XBGA 5FHBL 3FS9A 1KBVA 2YFNA 5AOLA 5IQMA 4JHZA 1SYSB 3ZKXC 4NO0B 1AD0B 3VGHA 1FZOA 2PWGA 4X7CC 4MNGB 1XR8A 2UV3A 3GMQA 4MD0B 4XXCA 1M56B 5C71A 4Y5VA 3EOAB 4Z0XA 4CU6A 4HPYH 2WZPA 1BXVA 2K9UA 4LVOC 5T5NG 4FZEH 1TTBA 1M2VA 2WYIA 1KBWA 4GY4A 4B41A 4EZMA 2A74C 4JM2B 1IAII 2JK5B 4YDVA 5A2AA 3BSGA 1DBJH 3WFHA 3LKNB 5AZEH 4AGNA 2Y22A 4AJYV 2A77L 5BVJA 1FZJB 4I18A 3H3BC 4L0ZA 4EUPA 5KSVA 4IOSD 4BFNA 2IQAA 3II3A 2E9GA 4RX4D 3HMXL 3W3BA 1FBIH 5DJYB 5BOZG 3EJZC 3FUHA 2HVKB 4UT6H 3T8VA 4IBTA 4H1LH 3UO1L 4DPBX 1MF2H 3PXHA 1NCDL 2XUWA 2OMVA 2AQ2A 5JHLA 2HA1A 4QXTA 4EUPG 1ZGLA 3EOBA 2WXNA 1MN4A 3PL6B 2OS7A 2HLAA 4DP5X 3CFDA 4C57C 3T77A 4PJ5B 3MODL 4RESB 5E24E 3WD5H 3ZE1E 1MAML 2PWDA 1EHLH 3IU3B 4WZ9A 1TJGH 2MOQA 3FQRA 1S7RB 1OQXA 2QFRA 2EXYD 2OZ4H 1UM5L 4LSTL 3MRQB 4ZAKD 3B9VA 1KCVL 1JD9A 5JIHA 4YHZL 4ZQKA 4EI5B 4OGQC 2QR0A 3BFOA 3QUKB 1P2CB 5C0AB 1MHPH 1BPVA 1JK9B 1SF3A 5ANMA 2AQRA 4LSUH 5KBKA 3G6AA 4JFXB 3GM8A 4ZI8A 5IJKC 1BDYA 4WV1C 1SOXA 3PPSA 1X7TA 1E4XI 4G43B 3PV6B 1LK3L 4C4UA 2EKJA 4LU5H 5C0EA 4P5MA 5D1XD 4DAGL 3Q7JA 1TETL 5EN2B 3QIWB 4LIQE 1E27A 3T4YA 1IAIH 1FWXA 3UTTB 4ADJA 2O5XH 3T3ME 5F7KC 1KPUA 3K80A 3JVGA 4NN7C 5ECGA 4PLKC 2VZ3A 5E9DE 1HOCB 4TTGA 4APXB 5KUKA 1YNTF 2VRKA 1JPST 4P59H 1O6SA 4RGNB 3ZU8A 3G5VA 4GUPB 2FQDA 5IVXB 2YBGA 2CALA 2AANA 4JFUA 4ORZC 2WIIB 2UZYA 1XF2B 4QT5B 4BFIB 4U1NA 2YA0A 2Q3ZA 2WGNB 4E0RB 4M7JH 4XCNB 2L7QA 1FRGH 3IMRA 2GW5A 4YE0A 2HMIC 4KROC 2R0LL 5GS0D 1BF5A 1JD7A 2VZ1A 4M7LT 1U3JA 2OP4H 2X3CA 4KVCH 5F9OH 2A3TA 2AJXL 5JIDA 2I26N 4UB0L 2X2JA 2AZAA 2IOMA 5FM4A 4HHAA 4YAQA 1MY5A 2FSEB 5BRZA 1BBJB 1OGAB 4EN3A 3M1BB 1NC2A 1G9NH 1UVQA 2PLTA 1TVHA 4P2AA 3KPMA 1W80A 2N1TE 3QH3B 1BVZA 4AK2A 3SCMA 3SE6A 3K7UA 4JRYA 2BIOA 1ZWIA 2R0KL 1L0XA 1YUHA 2NY1B 1HCFX 4MMXB 3W39B 4GQ9H 1LNUA 3BP6B 2CGYA 4JFQB 5D7LB 3PWNA 4X80H 4MQXD 4Y1AA 4Q9BA 3RNQB 4OQTA 1TVBA 4NKDA 5BS0D 1E4XH 1AXSB 1KSRA 3D0VA 3AQYA 3L2LA 4WTWA 2GSIA 5B1BB 1UKSA 4Y5YA 3ZGHA 5AB2A 3HG2A 5J5EA 1CVSC 3Q2NA 3ULUL 4K94C 1BEYL 2PCFA 3T6VA 4Z7NB 1EZVY 2RACA 3ZX1A 4NPYA 2Z3FA 4HWBL 1X9UA 2VDLL 4NWTH 3KLKA 5FUOL 1F4WL 5EO9B 2ZE0A 2EYRB 1U8CB 3INUH 3WFCL 3F84A 1DUYA 4W81A 2XXGA 4N68A 3BPNC 2YEQA 2YN5A 1YDPB 4XCFH 1QZ1A 2HLEB 2E8YA 1G0DA 4R3SB 5EEZA 3GMLA 5KN5B 3SYAA 1KBGH 2FHBA 1GRWA 1I7ZB 1XEDA 2BOLA 4K15A 1J1PL 3GSVB 1J0ZA 3BKYH 1U93B 5SWZB 3O6FA 4NFCA 1BXXA 1S5IL 3LS5H 3MRPA 3PHQA 2YHGA 1JNLL 1AQDA 3RPIA 1KEGH 3DVIA 3FB8B 4DOHB 2HX7A 1T0NA 4NQVA 4AQ8C 1XF5A 2V4LA 4YIQB 1AH1A 4MA7H 1XSJA 3V5KA 1B0GA 3RUGF 2ILLA 3Q05A 1TEGA 1Z2KA 1G5AA 3V9FA 1AMXA 3JWNH 3TF7C 1CBVH 3GDCA 4HIXH 5ILTH 5D1ZC 1FFOB 3EYUL 4L48A 4HS3A 3MBED 3HMWH 4DEUA 4QRUB 2H1PL 3ZUCA 1T89C 4MB5A 2J1XA 3CC5A 1S9WA 3GZKA 1QWHA 2WWNA 2P5ED 5E6ZA 2WLIA 4LHUD 4N2IA 4HCRA 4CDGC 3PUUA 1P6FA 3D4YA 4F27A 5GJSL 4JGMA 1HCVA 4GS7C 4Y4FA 2XWJA 3VI3A 1BFSA 3CVDA 1JHLH 3TBSB 1OAQH 1F42A 5H4ZA 4L4TB 3ALWA 3NCYP 5G4MA 3KBEA 1YQ2A 1E6OL 1UCBL 1XQ4A 4GAGH 4MJ6B 4TQIA 4XWGL 1Z7JA 4KK8C 2NY4C 3J27A 4EDWH 2GBVA 2YXFA 3FCTA 1YMHB 5E4IA 5I1IL 1GXEA 2O4EA 4Q2ZA 3VFSA 2ZSVA 3MPCA 1CIDA 2VLRE 3E2HB 2D9CA 1HXYB 2HJKA 5GJTL 1WZKA 2R1XA 3Q6FB 1MI5B 3QEQB 2Y69B 4EEEA 4PVBA 5IW6B 2XTJE 1NBZA 2ZUWA 2GCYA 4MWFB 2Y25A 3VXMD 1H6UA 4MS6A 1SHMA 1U8OA 3HHSA 3K6SA 1DN0A 4KHXH 1CE1H 3O3DB 3FUFA 2YD7A 1MCEA 1CGWA 4G6FB 4NDMB 2ZICA 3QJFA 4PGZA 4TVPL 2FJSA 3B37A 4MJHA 3BEVA 5CEZD 2NY2C 5F9DC 1N5YL 3TPUA 3DJ9A 2FWSA 5CP7B 1HKLL 2V2WB 5CJ8A 1XFPA 5L4IA 4MXWL 1AZNA 3UTSD 1CFQB 5F7AA 5JW4R 4LSDA 3CZJA 2FLRT 3HLAB 3U2IA 1T1WA 1QOKA 2WLNA 2ZAGA 1HXKA 3CFQA 4P9MH 4QRRD 1MG3C 3K5SA 3JWDL 3MFGB 3R1GH 4S0SD 4Z1PA 1REIA 3FRUB 4H88L 3EJJX 3OMAB 4LARH 4MNHA 2CPCA 2GT9B 1KPVB 2I9LA 4G6KL 3NG5A 5MEQB 5GHWL 3CFKB 1I9RL 4NM8H 2QVIA 4JRXA 5CJOL 1QI5A 5EUOB 3MRLB 5EOCH 4X6CB 4WO4D 2D3VA 3UG5A 3P4OA 4YXKH 5E00B 3IF1B 1DUZA 1VIWA 1T1ZA 4HKXB 3NCWA 2J44A 1YQVH 4HC1H 2HJFA 4I1NB 1FH2A 4WJ5B 4HULB 4UTAA 3GIZL 3LX9A 3ARPA 1ZTXE 3MKGA 1BLNB 3LS4L 3AACA 4UM9B 4WTQA 3EHBC 1BVLA 1FVDA 1OTUC 3OLGA 4WDIB 4X9YA 5LGYA 2JJSC 5EIIG 2EDYA 3BPOC 1I8KB 5FR3A 4M7KH 3U9PH 4L18A 4AJWA 3NDZE 4C47A 3CN2A 5MEOA 2XV0A 4J3OH 2GITA 3ABZA 2YD0A 3BIKA 3U82B 2DI7A 2LT9A 1YNLH 1RFDH 4YUEH 1NCCL 4DF9A 5JDSB 2VQ4A 3SOBL 1E9OA 5E0FA 4CKVX 2P8LA 4HIHA 1XF3A 5JXAL 2WIMA 3BUTA 2O6CA 4KJYA 4PHZA 1X5IA 1RK0A 2Y07H 2I5YL 2NY4B 5D4QA 1A6VH 4PJDB 1WG3A 2KT6A 4V1DB 3TIEA 3T6QC 2K6WA 1YEHH 4UQDA 3SKOA 5AYUH 1M9WA 4ZX5A 3SEPA 4WWKA 5CMAA 2X4TA 4URTB 2GJ6B 1J05A 5ESAA 3MLPA 1R6VA 3L13A 5HHNA 4LCUA 3ZE0F 1N70A 4YHNB 2CIIB 3L5HA 4OLVL 2E9JA 3UZVB 1YYLH 4ZOCA 5EEXA 2GJZA 3FUJA 1OB1B 3E0GA 1SXSA 2G9HA 1E4KC 1Z9LA 4ILDA 3W2DH 2HRPH 1B6UA 4G42B 3ABGA 3SBPA 4WI0B 2MRYA 2VCOA 4FXLA 1JGVH 5FX3A 2VR9A 2MMXA 1I1RA 4CSSA 4ZMPA 2N7SA 1ETZA 1KZQA 1FQ9C 3IDMB 3STLB 1CICD 4Z95H 3TF4A 4EKJA 1MJUH 3BAEH 4HT1H 1GYCA 2BZCA 4KK6D 2XA8L 2L04A 2EECA 3HC0B 4P06A 1OCOB 4P4KC 4C54A 3AFLA 4UQ2A 3V0AC 3MLRH 4M8UA 5TQ0H 1DVFB 2H2PC 4IBLT 1THAA 5I0XA 2IGTA 5IGXL 2OSLA 3CDGA 3TS8A 4JMXA 4YXLH 2UZXB 4D0CB 5BUPA 4PJ9C 4XX1E 4MAZA 1UKQA 3LSOA 4DPAX 4HIPA 3WMQA 1ZLWH 5L4MA 1ZT7B 2YLHA 3B3IA 3MRNA 1S7TA 1PSKL 1EAQA 4TOYH 4QXVA 4JEGB 4YQXL 5HGHB 1OD7A 5DHMC 1CD9B 3LIZH 2A74A 2AJSH 3CHQA 2H9GB 2IAND 5HI4C 4NQQA 4KNQA</