3AQZA

Crystal structure of plodia interpunctella beta-grp/gnbp3 n-terminal domain with laminarihexaoses
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
100
structure length
100
Chain Sequence
b'SYVVPSAKLEAIYPKGLRVSIPDDGFSLFAFHGKLNEEMDGLEAGHWARDITKPKEGRWTFRDRNVKLKLGDKIYFWTYVIKDGLGYRQDNGEWTVTEFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-1,3-glucan-binding protein
publication title Structural insights into recognition of triple-helical beta-glucans by an insect fungal receptor
pubmed doi rcsb
source organism Plodia interpunctella
molecule tags Sugar binding protein
total genus 17
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2140 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3aqzA00
3AQXA 3IE4A 3AQZA 2KHAA 3AQYA 2RQEA
chains in the Genus database with same CATH superfamily
3KPQB 4FNQA 5E1AB 2F7IA 2FD6H 4M48H 4GBXB 3RG1C 5J56B 5JDSB 3OZKA 2ADIB 1WWWX 3DX3A 1H8LA 2YKKA 3JWDH 4B97A 1F02I 1IIKA 5TE6L 2I5YH 1HEJC 5A3ID 4IGBB 4Y9CA 5DMGC 3BUDA 3HMWH 3U4BL 5C0DB 4PB9H 3QHFH 3CK0L 2V5YA 1GIGL 1S8DA 1F90H 1WC7B 4ABVA 3CN1A 2NT1A 5EU6B 1RZKH 4PJGB 5EUOF 5CR1A 5C97A 4HS3B 3HI6L 2P48B 2EDDA 2DS4A 2DMBA 1A9BB 3H9SE 3MJGX 3QDJA 2GTZA 4M7JH 4WHYG 4PTUA 4XN4A 3BKCH 4KRMB 2V7HB 3RURA 3ECBA 2IEPA 3POHA 3ZKMD 1AE6L 4N22A 3MGAA 5EC1B 2F18A 2VDRH 2OJEA 2KYIA 2X7LA 3KGUA 5C0JB 3RIAF 2NY2C 4GP8B 3SOTA 3CDGA 4MJID 3GMPA 4A68A 5LGHH 1I1FB 1KFAH 3FF7A 4Z7QF 1VA9A 3DPDA 2QMJA 5L88L 2B3RA 4DGIH 1L7IH 4IU2B 3QGVA 3EOTL 4PP2A 1MQ8A 2NTFA 3D5OF 4U1MB 1EXUB 3MX0B 3GPSA 4TUKH 3LZFH 5DWPA 5E5MA 1A7RL 2JIXD 3EYQC 1MCKA 4EKXA 1OPOA 3HE6C 4J3OF 3ZT5A 4HOMA 4WW2F 4WJG3 4AJYV 2E7LA 1XH1A 2ADJB 3JBG7 4XBGA 3EJPA 3B2MA 4NO0B 5D7IB 1UGKA 1ZLWK 4M8QB 5EOCJ 4BFBD 2GJ6B 3ULUF 5I18L 3MPCA 1UOVA 5L0QB 1I8LA 4QRPE 5CWSB 2E9JA 4DKDC 1LO3H 1E3XA 3L5HA 2F5BL 4OZGE 3QNXB 4F37F 2E76C 2HN7A 3RX9A 4AOFA 3RHWK 5KTEH 3VXQB 1JYVA 1XGUB 1E4JA 1W0YT 3PGFH 3QFJE 2WUCL 2IH9A 1MUJA 3LPFA 4QXGL 3FT2A 2E7DA 3TH4T 3B2UC 1SDDB 4MAZA 1UD3A 2EDLA 4HPOL 5CSZA 3TVMC 3VYOA 5EBLB 5MP6H 1W0WA 3IFNL 1C5DA 3L1FA 1R5IA 1OARH 3O9WA 3T2NL 1TZHA 2WHVA 3VGGA 1G0YR 3FUIA 4PJ9D 2W5PA 2XACC 2N0MA 5FK9B 1A7NH 4NKMB 5HYSB 1LHZA 5IB4B 5JLZA 3VSQA 3V6OE 4JRLA 2A9NL 1QSEE 4RDQG 3SE9L 5JNYB 5JIMA 1T1WB 1G5AA 1J0HA 2XFXB 1VACA 4MNGA 3LHAA 4L9DA 3RJDA 5C2BH 1LGVA 1TT6A 3TBTB 3AADB 1T04A 1EHAA 4PB0L 5CJ8A 2JK5A 4RGOL 3B34A 2WINA 3SGEI 5FYKL 5HGDB 4Z0XA 3K71B 3I50H 2EXSA 4FFVC 4GKSB 5DMKA 2IAMD 4LT7A 1KJMA 3P0YH 4RFEB 1NGXA 1OAXL 5IWLC 3VWKC 1ZA3B 4V2BA 4LFHG 4ZI8A 3V6ZA 4PVLA 2H6OA 3MC0A 3MNVB 2DYPD 3S36H 1DE4B 4X8GA 1J8HB 1J12A 1Z0NA 2FATH 1H5BA 1RPQA 2Q3ZA 4U3CA 2AEWA 3B7RL 1A4CA 1BBDL 4PUBL 1K85A 1JF1A 2FIKA 3IT8D 3BP7B 3KLAA 1I3VA 5EIIA 2G9HB 3QQ3A 1E28A 3HG1B 3HRPA 3ULSA 3W38A 3II2A 3P3UA 2H47C 1CICD 1UWEL 2AK4D 3CVDA 3LRLA 2OMWA 1DLFH 4KV5E 2PPCA 5KYNA 1FLRL 1RHHB 2YWYA 4J8QA 1JZEA 2NR6A 3PDOB 4XN8A 5GS3A 4UT6A 4L0ZA 5ID0B 2FX8H 3HPLB 3MLPA 4YNYB 2Q3XA 3P77B 1N7MH 3OR7B 4XVSH 3KL3A 3WXVH 4A2MA 9CGTA 1Z5HA 2XV3A 4P3CL 3ABLB 2X1XR 3ETTA 3QH3A 4HK0A 4PWHA 1CTNA 5IROA 4O5LH 3AT9A 3VH8B 2EH7H 2VR5A 3KH4A 5IMMA 3AXLA 1YNTA 3EO0B 4G8FB 1E43A 2J1KA 2AEIT 3UC0H 2DM3A 4MZIA 1MZZA 4XPAH 3TBYA 5F7BA 4A6YA 1QRNE 4PLOB 1R0AH 2HP4A 4JZNB 2Q76B 4IBQA 1FN4A 4ZTPH 2AKRA 1H6UA 4GSDL 1J0KA 1S9YA 4RMWA 3UIYA 2EIZA 4G42A 4GS7B 4TVSa 4N87A 5DJXA 1F3JB 2IMNA 3ULVH 1CFTB 1NMAL 4Y7MA 2HRPH 2B15A 1DUZA 3LNIA 2ZKMX 3WKMH 1PDKA 4OZGA 1DVSA 5DJCB 3UOAB 1VAHA 5E2JA 4UQBA 2AQ1A 2I60H 2ICEA 4XGZA 1ORQA 2FECL 3QFJA 3EXLA 5KJRL 4P4KA 3GSNB 1XF2A 5DFAA 1M7DB 4TVPL 3MLYL 4XMLL 2YQ2A 5EEYA 3QUZA 2ZKXA 3R1GL 1CGWA 4A2LA 5E99L 1TNMA 3EJQA 3GGWB 1QBAA 4H0IA 1M6OB 4JFED 1Y18B 5AB1A 3A6BL 5HGBB 1QBLL 1MEXH 1EQWA 3HZYB 3TIDA 4LCUB 6PAZA 3SQOL 3G5XA 1C08B 3IWVA 2DQIH 4C59B 1FGNL 4AQ1B 5G5DA 1W80A 1OQOA 2VN4A 1FFPA 4TV3A 1DBAL 1TIUA 2XNAA 1EJFA 4UI2A 4UTAL 1OCCB 4H8QA 4LAQL 4ADJA 2B9BA 2VR6A 4JFQB 3CFMA 4YLQT 3GBEA 4LVOB 1UOLA 3SBRA 1JPFB 4ZNEE 4CADA 3VRIA 4B27A 4LCCC 3HE7D 3LKNB 5IBTH 4UQ2A 4OGAD 4LO9A 3RUGF 4JDZA 1NCDL 4H8WC 3I6KA 4OLWL 4NGHH 3J27A 4MA3B 1OGAA 2DIAA 2NY4D 2JB6B 4BSWA 4OGQC 3EH4B 4IMLB 3SQBA 4JB9H 1M1XB 1ZEAH 4KO9A 1JWUA 3VG9C 4RISL 4AQZA 2WQRA 4A04A 3SIKA 4EIGB 5B21A 1A7OH 3V5HA 1JJUA 5IUCA 1NCWL 2QZ5A 4GNKB 4O51A 2OMVA 2RR3A 4NQQA 1WA0X 3GPEA 1M9SA 4J1UA 1HHIA 1IFRA 3UTSB 3LKPB 4IDJL 5D7JC 5A6MA 1CT8B 3DSFH 4FERA 5A2KH 3SDXE 4OUUA 2ZSWB 5A7BA 1UXSB 4ZOBA 5FGBA 4DAGL 5KN5B 3KLLA 1I7TA 4GLRH 5IUSA 4YE4L 3AS1A 1OP4A 3V4PH 1OAKL 1I7UA 5DJ8A 5TGBA 4P46D 4HCRA 3ZDYE 3MAWA 1K9TA 5PAZA 3VQLA 3PY9A 4U3HA 5IESH 2QSQA 4AL8H 4IKIA 2Z1KA 2JQMA 5GRUL 2WZ0A 1MLBA 2HCZX 1BQRA 4XN5A 1CI3M 1QRNA 4P2RD 3VYPA 5JOFA 1RIHH 1DJSA 2MNJB 3DUUA 1S8DB 3QXDA 3OPUA 4YGAB 4IRSA 5F6HI 4MJ5A 4ZMXA 1UA3A 1MN4A 1N19A 4KDWA 3UERA 1EXHA 3GHEH 3QDJB 1JZHA 4G9DA 1NCAH 4UT9H 2GTZB 4BFFA 4PTUB 4UV4H 3QDME 1LLAA 3LS5L 4DKFL 3ECBB 2CXKA 4XBEH 3BZEA 4JM0A 2OJEB 4XPHH 2X7LB 3NCWA 5C0CD 1D2PA 3CDGB 3QI9A 2F54D 3GMPB 3QWRA 4HU8A 3L5XL 3PHOA 1YEFH 1B88A 3KR3L 3IKKA 2DAVA 5IK3A 4ZW8A 3CQPA 1KJ2L 5GGQL 4NN5C 4P2QA 3IMSA 1BYOA 2Z8RA 1F13A 3HFML 4UCFA 5DLMH 1NFDE 1USZA 1QLEB 4PP2B 1KCWA 1FYTD 1ZPUA 1TQBC 1ZS8A 2JJVA 2R69L 3APFA 1BYPA 5E5MB 3V6BR 2XZZA 4YSAA 4L05A 3Q8FA 5SWQA 4XVJL 3CSFA 4L8CA 1QO3A 4XBGB 1ACYL 2WB7A 3ZE2F 4R97C 4F8NA 4L1HA 1AY1H 4XCFH 4JZOA 1TTUA 3LTVA 1NKOA 2BVTA 3CNKA 4U4BA 3U1QA 1JZ3A 4EDXA 4R9HA 2B4CL 4HUKB 1P9MC 2HN7B 5FYKE 5KYUA 3FU7A 2Q7NA 2QVMA 3S88L 5IB3A 3IWUA 3ZKXB 1MUJB 4BEIA 4QTIH 1CLOH 3FT2B 3CLEH 4HXAH 2W80C 2WO4A 1RH8A 4Y5XC 3LKSA 4NI6A 5I24A 5AVWB 4AEIH 5CSZB 2FBJH 3LH2L 1H6FA 1W0WB 1C5DB 1R5IB 5DZOA 3O9WB 1TZHB 5G4MA 3VG0H 3J2PA 2Z31A 3H3PH 4I0PA 3WSQH 5BV7B 5JLZB 3U6XA 4XCCH 3FTGA 5DEZA 3A24A 1XB8A 3WO3B 1X7QA 1YNKL 1NBVH 4LE8A 1VACB 4MNGB 4NC1C 4GQ9L 3Q7JA 5DA4A 3AY4C 1D7CA 2ZUUA 4Q9QL 2MTPA 2IFFH 3CU7A 1T04B 3U0PA 2IWKA 4HT1H 4X4KA 1PW3A 2JK5B 2O6PA 2WINB 1FL3A 4HUNB 1TTAA 3SDXA 3G3LA 4Z0XB 1TENA 2G0LA 5DMKB 1PY4A 4MFHA 1KJMB 4YBQD 4ZQTA 5HHPA 4BQBA 3VQ1C 2V2TA 1NGXB 2GSMB 3SE3C 4GUOA 3F2LA 2R0LH 3V6ZB 1GY1A 3VU2A 1OTTD 3BAEH 3FO2A 1MQKL 3HNVH 1I9EA 2O6EA 1KBGL 1TCRA 3D3VA 4CDHA 3PP4H 3T8MA 1H5BB 5KVFH 1IKNC 1KGXA 2EEXA 1WT5A 2H2PC 1N2RA 4JFHD 4KPHH 4UMSA 5F7UA 2YUVA 1ODUA 4PHZA 4FFWD 1TTCA 1QNZL 1JF1B 2FIKB 4ENED 2DKSA 3KLAB 5EIIB 3VI4F 2FTAA 1BVZA 3QQ3B 1E28B 1MNUH 2EXWD 1FNLA 1JGDA 3ULSB 2OL3L 4DN3H 5MEQA 1I8IA 4X4YA 4OF5A 2OMWB 3NH7L 5E2VL 3PREA 5EZJA 2LABA 1F0LA 3P4MA 1DVUA 3LOWA 3P9LA 1LWRA 2VZTA 5FS5A 3PDDA 1NMBH 2BHYA 4HK3J 3RI5F 3WGUB 3JWOH 2ALWA 1DQKA 3LZPA 3PXHA 1UFGA 5IGXL 1JXFA 3FFOA 2HYMA 1TVDA 2MHAA 3QH3B 4HK0B 4D3CH 4JO8A 3FH7A 1F4HA 1Q8MA 2CRMA 4NHCH 2D9CA 4TVPE 1SUHA 1JOIA 1PD6A 4GFTB 4BIKA 5IMMB 2BWIA 1YNTB 3AQXA 3AXLB 3SYPA 3ZKND 1BECA 1X4XA 2JQAA 4MD5A 2IBZY 3GMMA 1YMHA 5BRPA 1TO4A 4PRPA 5ESVA 3TBYB 5D1XC 2E8YA 1Q72L 3E9TA 4A6YB 3WUWA 4MNHA 1FN4B 2UUDK 3IE9A 2AKRB 1S9YB 1MLCA 2EIZB 2RJMA 4G42B 5TE4L 3UYRH 1U9KA 3BUQA 5DJXB 5KG9A 4M56A 1T83A 1GKOA 1DUZB 3LQAC 1YMMA 2GBVA 1PDKB 4JFXA 4OZGB 3OBAA 4TUUA 4EI0A 2EZ0D 2VT0A 2ICEB 2YGNA 4XGZB 1ORQB 3BN3B 3QFJB 4HZLA 1NOAA 3L48A 4P4KB 1XF2B 3KNBA 2MPVA 1MRDH 5GS1A 4LEXH 3QUZB 1ZDSA 5JA8B 2YAEA 2WWNA 1BEYL 2Q9OA 4OQ1A 4ZS6C 3IGKA 4AZUA 4G80A 2GQHA 2Q0ZX 3CHOA 4JRYA 3TIDB 3GLZA 3G5XB 2VZSA 2VN7A 3FU9A 3KGRA 4WJKB 3TBWA 5ITBL 1RURH 5G5DB 3KEDA 1FFPB 2MPAL 2H1PL 3QT2A 2AJZA 4PJHA 2XNAB 1RP8A 1E5AA 3MCLL 4PP1C 4RQQA 4YN3A 3ESUF 3BQVA 1NUNB 2CCLA 1QI3A 3ULUL 2F0CA 3BDYL 6TAAA 1ASOA 1E5ZA 4QTFA 4CADB 1MJ8H 3VRIB 4BUGA 5M95B 5LWYH 4UQ2B 4LARL 1DQML 2ZUQC 4FEMA 4JDZB 4M7ZC 4Z7UF 3IXAA 3I6KB 5CNHA 5LGYA 2WYTA 3CCHA 1NAML 4JPKL 3U4EA 4JN1L 4KVCH 4MB1A 3VAEA 2OS7A 1FC2D 1OGAB 5FC9A 3SDDA 5HGAA 4S0HA 4BSWB 1Q90A 4XC3L 3SQBB 3EYOA 2BNUA 1JWUB 1TVBA 4KJQD 3BSZL 3PAZA 4OQTL 3CLFH 5A7EA 2VLKE 2WXJA 4HCGA 3TA3A 3V5HB 3QJRB 3WY4A 1E6OH 3FRUA 1S5IL 4O51B 2OMVB 2CDEA 4R7NB 4ZXBC 1M71A 2K8MA 3OB0K 5K1JA 1ODAA 1HHIB 2EDTA 4J1UB 2P24A 2NXYD 1FUNA 3A0OA 5DZNA 4OF3A 3CZEA 3KLDA 4LMQE 4HZ1A 4OUUB 5I1LA 3N50A 1O0VA 1JDAA 1TZGL 5AW7B 3HHRB 1PEZA 1UWXK 2K3HA 3K7UA 3OAWA 3MZGB 5HDLA 1QACA 1I7TB 4TULH 1DN2A 3WJJC 1R3HA 3BFOA 1N0XL 4XCYB 1I7UB 5DJ8B 4FADA 4XO8A 4HMEA 5E23A 4RRPA 5TGBB 3BOVA 2WXOA 3ZKSD 1SZNA 1OF0A 1F6LL 2DY2A 3P9WB 5LDSA 3IAQA 5GS0L 2EDWA 3Q8BA 4MDRA 5CGYC 3TJEH 4CN4A 5ADPH 5C71A 3RBGA 4G82A 3KPLA 3OC5A 1MLBB 4FQPA 1P6AB 4MX7A 1QRNB 2BWQA 4K94H 5D2LE 5JOFB 4LSTH 1HVXA 3DUUB 3QXDB 3JWNC 2YRLA 4IRSB 4GAJL 4MJ5B 3Q9QA 5HVFB 3CHRA 1LE9A 4G9DB 2XN0A 4C56D 2DH2A 1AYRA 1BM3L 2ED8A 5LNEA 4U05A 5KANG 2E75C 3OKYA 3BMWA 3MV7E 3TXAA 4Z7AA 1GPOL 4LOUD 2GIYA 3BZEB 4R26H 3SOBL 3NABH 4OY9A 2ZXCA 3LZOA 3QI9B 3PHOB 1A6WH 1CGYA 2H45A 4GUQA 2ZG1A 2JCWA 1WUZA 2WSDA 3KYKL 4KKAD 1J05A 5IK3B 3E0GA 4XP5L 3V6OC 1EEQA 1D9KC 3CZSA 4P2QB 4B96A 1XCXA 1MIMH 5I66A 3EOBB 1BMWA 4LEOA 1ZS8B 2GAZA 3GRBA 5HYSG 3GMNA 4ZUWA 3P73A 4HPHA 2LTQC 4ZMAT 5SWQB 3CSPA 2X1OA 3BPOB 4U3SA 4YK4B 3K2UL 3S8GB 1KG0A 4I1PA 4L8CB 1IAII 1QO3B 1JPEA 4YHYC 3VSUA 1FGVH 3N0PB 5T1KD 2A1WH 2CM6A 2ERJB 3MKGA 1AR1B 4GAYA 1YPZE 1AS6A 2JXMA 4JZOB 1G9NL 3QUMH 4E9VA 3X1NA 5HDQL 3NN8A 5IVNA 3I9GH 4EDXB 2UY6A 3INOA 1E4HA 2GTWA 5KYUB 4PSRA 3FU7B 1U42A 3CUPA 1ETJA 5ACZA 1E67A 4JPVH 5IB3B 4PG2A 3H0TA 5JDJA 3F7RA 2QKIC 3E2HC 4XMXA 3BJ91 1BQUA 4HWEH 4AEFA 3HC4L 4W6YB 3LKSB 3PAUA 1LO5A 2ARWA 1XWVA 1BZEA 2LVCA 2YD7A 3QAQA 2X2IA 4JHVA 2VOTA 2K45A 4KI5C 4WTXA 1X5KA 1E90A 4PJBF 2Z31B 2NCMA 4I0PB 1EAPA 5HDOA 1EAQA 5B7MA 4HWUA 5IQOA 4HC1A 3FTGB 3MCG1 43CAA 5DEJA 3A3YB 4WFFD 1X7QB 3FDWA 1PFCA 2W38A 3JQOB 4FZ8H 2V3FA 3MUUA 1EDYA 5IHLB 3RAJL 4PWFA 5EBGA 5EF0A 3UGEA 4ZO9A 1OHZA 1MCIA 4ADGA 3U0PB 1RK7A 4GT0A 5LAPA 4EI5A 1EERB 3MOAH 3H2QA 2OCFD 3SDXB 4FYSA 2WXGA 3DGDA 5E08L 3APCA 5LQBL 4HMDA 5HHPB 3GSVA 2V2TB 2LU5A 3TESA 1T5KA 4R4NC 4D9LH 5BW7C 2F58L 1CJYA 5GZND 3VH8G 4PJEA 3ZDYB 3FO2B 4G2AA 2W9DH 3SE4C 3D3VB 1TCRB 4IKNA 4P5TC 4KKZA 2OTWA 1RZIA 3PWVA 4G83A 2PCFA 1N2RB 5DC0A 2G2NA 2R69A 5T3XD 2FUQA 1EEUA 2QGCA 1Q9WA 4BRVA 1IGCL 5MEQB 5AL0A 1JGDB 3TN0A 1KCVH 1I8IB 1V3JA 4GJTB 4X4YB 3LMJL 1PGRB 5CEZL 2FDBP 5FCUH 5CU9A 5EZJB 3VFNA 3P4MB 2NY1B 4YHLH 3FO0H 1ADWA 3P9LB 4TSCH 4WHYH 4WEBH 3CMOH 5EUOE 3S2AA 2IO5A 3EO1A 4KC3B 1XCWA 4OD3L 5MI0B 3WNOA 3ZYOA 1A6PA 1BAFL 2MHAB 1Z9PA 5I5MA 3BAWA 1XTMA 3BUIA 4DPBX 3RRQA 1JN6A 4NZTH 1OWRM 3RFRA 1I85A 1KDIA 1KIQA 3U9PL 2X4OA 4H88L 5C0AE 4MD5B 3GMMB 4NLHA 1QBML 1YMHB 2YRPA 3ZN6A 2X1PA 3EIFA 1OY3B 4PRPB 5ESVB 2VQ1A 1IQWL 1XVSA 3WUWB 3RKDC 5JHDD 4MNHB 2BWDA 2ICES 1MLCB 2IJ0C 1C5BH 1YPZA 2X38A 3HG3A 3NBNA 3WLWD 3NP3A 2QPEB 4NJAH 4K5LA 3GEWB 5KG9B 2VJ8A 4KAQL 3DGGA 4PRHD 1MOEA 4POZD 1YMMB 4JFXB 4IYKA 2SEBA 3C6LD 3ULUE 4YO0A 4HZLB 1GZHC 3ARBD 3UJJH 2JCCA 3QG6A 3KNBB 4N25A 4GXFA 2C26A 5GS1B 1T66C 1GS6X 1C16A 3V10A 3TT1H 1EVUA 4IOSA 1CYGA 1XAUA 4XAWL 4NS0A 1MRFH 1BIIA 1ORSA 5TQ0L 4G80B 5C6WH 2EVGA 4JRYB 4P5KA 2EIJB 3QPQD 3MRBA 2IG2L 4MQTB 3HKZA 2X4NA 2COVD 1N64H 4JUTA 4DEPB 3TBWB 3T9WA 4NN6B 3GJFA 4X8XA 4ZZKA 1H6TA 5ISZD 1BF5A 4ZOAA 2JKXA 4XNBA 4UOW0 1U93A 2OL3A 2AJZB 4PJHB 4RRPM 3ARDD 3Q1SL 4U6XA 5KSAD 4N85A 4RQQB 4XMVA 5C09A 1ZLSH 5I1HH 1SVBA 2HLFC 3K6FA 1G7HA 5I1KL 1ZK9A 2VAJA 2XWEA 1A25A 3JVGC 3NIGE 3AWFA 4X4ZA 2XPGA 1LWJA 5E9AA 4XC1H 2LAAA 3UADA 4GRWF 3SQRA 1P4IL 4EJ1C 4M93C 3KXFE 1TLMA 2B1AH 3VFTA 1FNAA 2CBPA 2WQXA 1PLCA 3IE4A 4G72B 3V7AE 3IXAB 1UM5L 3AUVA 3CCHB 3Q43A 3U4EB 1MI5A 2WQVA 1CMOA 1RZJL 4WQOA 3SDDB 5J1AA 5HGAB 4NUPA 3LS4H 1FZKA 3BVVA 3QW9A 4X7TA 1YYML 1MCPL 3EYOB 3G6JF 2BNUB 3AS0A 3AB0B 1TVBB 4G59C 4ZRGA 1MCCA 3WD5H 4A63A 3WJMA 3TA3B 2BVUA 1I1AA 1CXKA 3FRUB 1U8MA 4JFFA 4WTQA 1CLVA 2CDEB 2IC2A 1M71B 2QZQA 4PLKC 2CLZA 2XX1A 3MOQA 1DBJH 2P24B 3ULVF 3PGCA 4XP4H 4TQ8A 1VADA 2DIJA 4XE0A 1X6LA 2ZX9A 1TG8A 5I1LB 4E9WA 3B83A 3FJTA 2GUOA 5EEZA 3NPSB 4P59L 1R3HB 1WTGT 3AREC 1Z5LA 4KUCF 3ILEA 3KEHA 4O58L 1IJNA 1FFQA 4Y0GA 5DVNA 4YEFA 1IMHC 1J9RA 1F11A 1T89C 5GRXG 7PAZA 4MD0A 3QJTB 4P05A 5EBWA 3EZJB 4PWJA 1RJLA 4GSUA 4Y2DD 1ZTMA 4XT1C 1FH5H 3CFCH 3KPLB 1RZPA 1TQCB 3FFCD 4MX7B 4HEME 1URIA 1FO0H 1PBYA 4XHQA 3WKPA 4MDJA 4R7DA 3ECQA 5ADOH 2AJVL 1JGUL 3IDXH 4XVUC 1LE9B 3KJ4B 3S96A 4WW2A 1UD4A 1DDHA 1BMGA 2K1MA 3ZTDC 3IPBA 3F6JA 4JFDA 2EICA 2WAHA 4MXQD 2VR9A 4KKCD 3WFEL 1GXEA 2M83A 3ZGHA 1EZVY 4WFEE 1KGCE 1QYGH 3UTPE 2QQLH 4E0RA 4I9WE 1OKEA 1NIFA 4JFYA 1J05B 1IC7H 1KZYA 2VDOB 2GHZA 2FGZA 3HNTL 5B1CA 1WITA 5I66B 3OG6B 2O4EA 1NAMA 1SVZA 3QEQD 4LEOB 4KRPD 3VRJB 1FORH 2GAZB 4Z6AT 2ZD0A 1PL3A 3GMNB 3P73B 1NCUA 1P53A 4FCAA 5FA3A 2OPCA 4ZUWB 3SJVA 4S10A 4U3SB 1O7DC 2OM5A 5I71B 4IBVA 1KG0B 4CSZA 3ETBJ 1H15A 3MACH 3MJ6A 1J5OL 5LJYH 1T7YA 1CLCA 3QQXA 3FHEA 4U1KA 1B9KA 1UT2A 3P0VL 3VXSD 4L0YA 5JTWA 4YH6A 4GAYB 4GY4A 4ZYKA 2JXMB 2MCPH 3AQZA 3L1OH 4Y9GA 4LLAA 4DP2X 4QHNA 1BLIA 3NN8B 2XY1A 2UY6B 4HUVA 3GT6A 5FW8A 2GTWB 3CUPB 3RVWD 5ACZB 1E9OA 4IRJC 3KXFA 3H0TB 5I8KH 2WQSA 2XN9D 1HYSD 3AU1A 1EHXA 1YECH 3U2SA 3ZTNL 2DQGH 2I85A 3ZRSA 2RQEA 4X42A 4UTCA 1TJHL 1NEZA 1EHLH 2WZ5A 4KTEL 2P5ED 3SYOA 1P7BA 5E8DL 3DRTA 3T4AC 4EAEA 1EAPB 3ARYA 3N3EA 3NCBB 3RUGE 5E1QA 2P5WD 3PQYA 43CAB 2CNYA 5EIIG 3ZE0F 1Z9SA 3OQ3B 4ANXA 4X4MA 2XCMC 1VFUA 3WFHA 5IHUL 3TEZA 3NJXA 2FGWL 2X4UA 3WNMA 4X7FC 2R0ZL 4Y4HD 1TJMA 2P9RA 3HS0C 4JKPL 1ADQH 2KC0A 1WICA 1U3YA 2JJTA 4EI5B 2VGLM 3K1KC 3O45A 2HJKA 1OIOA 3WIHH 3UTTE 1W16A 1HWHB 3N42B 4MAYC 4NZRH 3GSVB 3L5WA 3F05A 1AOZA 1EZSA 3MUJA 3TTSA 4HWNA 1NGQL 5J8OA 4PJEB 2UWEF 3I75A 4ZAKC 5JW4R 4DGYL 4RWYL 3QPXH 3U7YL 1CFQA 3CSYA 2OTWB 3MNDA 1RZIB 3PWVB 4NOFA 4GAGH 1XQ4A 3EH1A 4AE1A 1TQSA 1IBYA 1PG7W 1UM4H 1HNGA 1X5FA 2BVYA 3R0NA 4ZFOL 5IVXF 2DMKA 4HEMA 5EH1A 1AC6A 4L8SC 4DQOH 2HVKA 1Q9WB 2B08A 2D3JA 2EKJA 3MRJA 1QBBA 1LK2A 4AMXA 3TN0B 2NY5C 3A6OA 4OBSA 5EIQA 3LVEA 3ZKMC 4MBRA 4H2AA 3S8WA 3AT0A 5CLZA 5F7YC 5B1AB 3VFNB 1MFCL 3CSBA 4GUCA 3JV4A 5HVHB 3K4ZA 3EO1B 4Q97A 3V0WH 1JG9A 2EC8A 3ZY7A 1NPJA 1QSFD 5DD5L 4Q0XL 5AW2B 1QFUH 4L1SA 4OZFA 1UM6H 4GIPD 2PWHA 2WB1A 4HBCH 2CUAA 1JN6B 4UTBL 5TF1L 4Z95L 4Y9FA 4H8UA 4BK4A 4LU5H 2D4FA 1KIQB 2X4OB 2LLNA 1RQ5A 3OQRA 1HJCA 1H3TA 2D7NA 4TQPA 4U6HA 5AL8A 2ZYIA 3H85A 5JXEA 2VQ1B 2E7HA 2GEEA 3GDBA 2MOQA 1D7BA 4UV7H 1F42A 1R17A 2J5LC 1GOHA 1MHCA 2OR8A 5CUSL 1KN4L 1TJIL 3QVAA 5AVUB 1YPZB 3MLSL 4BFJA 5D71H 3G6DL 2WZAA 3WTWA 3DGGB 3BKML 3ZE2E 1UTDA 5DRWA 4KOBA 4BH7A 1U3HC 4Y5VA 1CS6A 1YUKB 1CCZA 4LQFL 2SEBB 3LDBC 2FX7L 3LHPL 2GJJA 2YFNA 4YO0B 1H9VA 1IB5A 2JCCB 3QG6B 1PG7X 4JR9L 4WNQA 4BQ6A 4POUB 2NX5A 2QV2A 5GHWH 1QPPA 3T71A 3ZQWA 4L3CA 5CGBA 1C16B 3FN0L 3L9RA 3N9GH 2BJML 3TV8A 1HC1A 2DL2A 2IWFA 2R0WH 4N1HB 5DVLA 5EB9A 1Y1DA 4EN3A 1CIDA 4ZMLA 1BIIB 3WEXA 1ORSB 4YS4A 4QHLA 3ALXA 2BSTB 1Q0EA 2MRYA 3BJLA 4P5KB 4ZPTA 1JZGA 3FOMA 3LIZH 4XN2A 3MRBB 2IPUG 4PY8J 2KLSA 5I8CA 2X4NB 5KVGH 2YMTA 2EP6A 4LRIC 3GJFB 5T3ZL 3HAEA 3BT2H 1U93B 2OL3B 3CFJA 1UKQA 2YO3A 4PN6A 5D5MF 5GRVL 1UZ8A 2DM7A 4U6XB 1X5AA 2ZUXA 5C09B 4XCNA 4LCYA 3BFWA 1G7HB 3R18A 2KQMA 3T0AA 2VDMH 4CU7A 4NNYA 2D0GA 1CXEA 1FL6A 2XPGB 3C87A 1FNEA 4NQEA 2VZ3A 1CLZH 2H32A 1KIRA 5FDYA 4OM1H 5C7ZA 7PCYA 4PWEA 1HESA 3VFTB 4HIJA 2G2RA 3BRDA 1QFWI 3AFLA 1CF8H 2DQMA 1JRHH 3NAAL 5TK4A 1MI5B 1WF5A 4G9FE 1ETA1 2GYSA 3SPVA 1JYNA 5J1AB 2FD6L 1FZKB 3ILDA 4M48L 4X7TB 2OXGA 2WXKA 3F3HA 1T3FA 3U1PA 3V8OA 4XTRC 4W9IC 3UO1L 4IJ3B 3PWNA 3KD4A 3WJMB 5HHOD 3FRPA 3HMWL 1I1AB 4PB9L 2B4CC 1U8MB 3QHFL 4JFFB 3GIVA 3FCSA 4G6KH 1F90L 4QRRE 2CLZB 4AYSA 1U8OA 1WBZA 1RZKL 1PZSA 4JO4L 2XTJD 5DUBA 3PGCB 1GL4B 3NA4A 1X9UA 5AOLA 4M7JL 1CU4H 1VADB 4R4FH 2DLTA 4FJZA 4DKAA 4OGZA 5H37H 4QNPE 2B8OT 1ANUA 2GUOB 1P9MA 2VDRL 4D9QD 4MNQE 2OULB 1D5IH 1Z5LB 3SYQA 5EZIH 2GC7C 5LGHL 2AAAA 1F11B 1KFAL 4MD0B 3P9MA 1DTUA 5EBWB 3P2BA 4Z7QB 2A77H 2Z92A 1KMGA 1RJLB 3FULA 1OM9A 4DGIL 4I0KA 5AW5B 4OGYL 4B3VA 1FH2A 4FKHA 3RTQC 4N5ED 4O4YH 5TQ2H 1AI1H 3ATDA 3BH4A 1CDUA 4TUKL 5D55A 2CO7A 4MDJB 1ZLEA 4R7DB 4CAGA 4KHXL 3P30L 1DVQA 3NDYE 2DMGA 3VX0A 4JM2C 4WW2B 3S96B 1JTTA 1DDHB 2GB2A 3SCMA 4JCWA 2CBQA 4JFDB 2LU4A 3LD8B 3SY0A 2NLJA 3MTRA 3U0WL 5CFAA 4JFWA 5F96H 5SX5K 1PNDA 3FTZA 2A9BA 4E0RB 2V17H 1DYZA 3FT0A 4B9GA 2QEJA 2F61A 4UBDD 2NQCA 3PABB 1FL5A 1IAIH 2PXYA 3AGVA 4JFYB 3EH2A 3RDTD 2DIEA 2AVFA 3U9UA 1N12A 4BFNA 2YQ3A 3IYLW 2WBWB 1ZV9A 2JTDA 1NAMB 3DO3A 2CD0A 3PWPD 4DK3A 2Y23A 4YSSA 3K6OA 1AQHA 1Q1PA 1SMDA 5FA3B 1U8KA 4OFDA 3SJVB 4G6AD 3KCPA 5AD0A 2GBAA 1B2YA 2AXWA 2J55A 2CBMA 1OARL 2ILLA 1H15B 3ZHKA 4G1MA 4M5TA 3C9NA 3VXME 3HPJA 3BWUC 4U1KB 3TO4A 2IGFH 1MHEA 4HIIA 4K3DL 3MRQA 2OP4H 3Q05A 3IDIA 4U1NA 3F7LA 3FUFA 3Q5TA 3MROA 2CRYA 4UU9A 4ZYKB 3BWAA 5DFVC 3ABZA 5D8JL 2EDJA 3BDXA 2PABA 4QHNB 3TC9A 5EF3A 5C2BL 3BX7C 3RWFA 2AEPH 3BVNA 5DZJA 1EEZA 4HUVB 4W9JC 1DBBH 2D9QB 3VW3L 1LE5A 2XBZA 4JGNA 1E9OB 3KXFB 4JHZA 3AU1B 3IPEA 3K4AA 2H0JA 3ZDZF 3U2SB 2V37A 5LG6A 3REVA 1CDJA 4KGJA 3FO9A 5LN8A 3FF8A 1NEZB 1WP6A 3S35X 3WBDA 1HT6A 2VDQL 3DRTB 3S36L 1OE3A 4Z7UE 3ZT7A 4C4KO 4W9LC 3PQYB 2FATL 1Z9SB 3GS7A 2AP2A 3KPRD 3PPEA 3T0DA 4OJEH 4F92B 2YPLE 5D1XA 3IJEA 3WFHB 5C3LD 3VSVA 3VI4A 3MRNA 3VD4A 1SY6A 2J8HA 3NCMA 5AZEH 3NOIA 5A6LA 4MA7H 2J4WH 3O45B 3AVEA 5C0BE 2R56L 2HJKB 3FH5A 1JPTL 4WSGA 1TPXB 2Y24A 3H7BA 3WUZA 1X9QA 3TOPA 1UZ6F 3L5WB 3AJ7A 3FXIC 3WXVL 1N7ML 3VSTA 4P2OA 2LVEA 1IGIH 3ECUA 1HH9A 2R2HA 3I75B 4Y4FD 2GC4C 4I2XE 4QUOA 5FV1L 5AQ0A 5TFSH 1CFQB 3CSYB 1OCRB 2OCJA 4O5LL 5F44A 3FCBA 2EH7L 2OJZH 1HKLH 4J3OC 4L23A 1D5XA 3OHXC 2GUYA 4KWUA 1NIEA 3D18A 1IEBA 3IJ7A 1DVZA 3WUWG 3NTCH 4PJ5E 4DP7X 3VI3A 3L3DA 2AJXH 2HVKB 3UC0L 4APQC 2QTVA 2CAKA 3MRJB 1LK2B 1HINH 1LO2H 3A47A 1RFDH 4KXZI 1KY6A 4HF5H 4G6MH 1R0AL 5IB5A 2Y7QA 4ZTPL 4XNYL 5B22A 1AFVH 1KTJA 1OSEA 2CQVA 4FNLH 5KS9A 2VZOA 3QQNA 4QTHA 3JV4B 1MXDA 2ATAA 4YDKL 4K3EL 3ULVL 3O81A 1J1XH 3SDAA 1JZ4A 2YD5A 4OZFB 2DD8H 5IQMA 2BCMA 2I60L 3IDJA 3QJSB 4MRBA 2ADYA 4ORGA 3TBCA 1JERA 4G7RB 2W9EH 2N4IA 2XRAH 1RAMA 1GGIH 4U6HB 4M7LH 3CBKB 4WI3A 2PR4H 2EE6A 1FLTX 5IV2A 2CCWA 2J43A 2Y5TA 1MHCB 2PO6A 3BYYA 4N8UA 1MEXL 1MJUH 1NKGA 2EDNA 3I6LD 5T3ZE 4P9HH 4TNWK 3ZQXA 4CVUA 4Z7VF 4HLZG 4DIXA 3FC8A 4UB0H 2FL5A 1U8NA 5DRWB 1N59A 4BH7B 2H3KA 3IBOA 4MWFA 4Y5VB 2BS71 3DUSA 2VUKA 2PKDA 4YHOH 4LCVA 4WNQB 2NX5B 5D1QD 1J0IA 4L3CB 2YAHA 2EDYA 3D9AH 4PGJA 1MCLA 3L9RB 4ZFGL 3DHJA 4EQ2A 5T5FH 1KIUA 5E0QA 5I30H 5E9DE 5IBTL 1MFDH 3U25A 4EN3B 4M7KH 4PJFF 5F7WC 3WEXB 4Z7UA 4QHLB 1WDAA 4YDIH 4ZPTB 4I1RA 3FOMB 4NGHL 2AHIA 2BSEA 3BDBA 5I8CB 4R2GC 3C12A 1G7IA 1FE8L 2BZ7A 4PJBE 5CU5A 4DN4L 3EFFA 3NP4A 3HAEB 1PQZA 3J07A 1YEWA 1ZEAL 2WZPD 2XWJA 3CFJB 4Z7WF 2HX9A 1NFAA 1UZ8B 3CXDH 4L4VA 1DVFC 2P43B 1E0OB 4WJ5A 4XCNB 3IDGA 4LCYB 3QORA 4NNYB 4XBMA 1X7TA 4X4XA 1FL6B 3V52H 1FNEB 1D5ZA 2R29H 3NJLA 2H32B 4NQEB 1KIRB 2OSXA 3OXRA 1AACA 4EKJA 4JHAH 2FB4H 4HIJB 2G2RB 5D1ZD 2YK1H 3GS4A 2N1TE 5SWSA 3V9FA 4HG4K 3SGKC 4HQQH 4UTBA 2W0KA 4MHHI 4LEEA 4FFWC 5IQLA 1RUKH 2BP3A 5CZKA 3SPVB 2E4TA 4ENEC 3F5WA 4UQEA 3MSPA 5DO8A 5SX4I 3VNZA 2OXGB 3B4NA 2KPNA 3MODH 1T3FB 2X28A 4PJ5A 3TYFA 3F7VA 4AL8L 3WELA 2YA1A 3PWNB 5DRXA 5AB9A 5HHME 2YXVA 5LBVA 3ASWA 3FRPB 4E9RA 1UD8A 1RIHL 4P23D 3GIVB 1Z3GH 3FCSB 4H13C 4NNPH 4CVZA 4B9JA 4R97B 4U1GB 3IJ9A 1U8OB 1WBZB 1X5ZA 5DUBB 3GHEL 2LAGB 2O61A 3UBGA 3LEXA 4NB7A 4UV4L 1JPSH 4CN1A 4JN2A 5IVOA 3B9KD 1XR9A 4U2YA 3WMSA 4XBEL 3GSNH 5GGUA 4FG4A 1RY7B 3C60D 5EF2A 4Z7NF 3FNKA 3QIWA 1T2QH 4BDVA 3BH9B 3H3KA 3R19A 3QUKA 3FT4A 3FUEA 3P9MB 3GZOA 4QXWA 1ZLUH 5DDHA 2Z92B 2J1XA 1BPLB 2ADGA 3TCLA 3QR2A 5DLML 3QZMA 2CO7B 5BRZD 5DJ2A 4UF7C 3SYAA 4IK6A 5HY9A 1NSNH 2DLGA 4RDQF 4ZDHA 5KBNC 3M07A 3SCMB 5JW4M 3I2CH 1A4AA 3VDBA 5D96C 1WD8A 4OFQA 2EZ0C 5DQDH 2ESVE 3ZE2B 3SY0B 2NLJB 2AMGA 4M6OH 4NCDA 3VWJC 2QHRL 1OVZA 4CVXA 2XUWA 4XCFL 4FQ1H 5L9DH 1X5HA 1IBGH 1KXVC 5F7HA 3X3GH 4GI6A 2CM5A 3WY2A 1FL5B 2PXYB 4J8RA 4MB4A 3BAIA 3EHBD 4H2CA 4DP6X 4HOZA 1PZAA 1E4KA 1CE1H 4IBLT 3U9UB 5F71A 4QTIL 1CLOL 5BXFA 3CLEL 5JPMC 1TVHA 4LPVA 4EBQL 1U8KB 5AD0B 1S78D 3KCPB 5AKRA 5F9JA 2FEEL 1VPOH 4G1MB 3PCYA 1A6ZA 3C9NB 1ONQA 3WSQL 3F6LA 3HPJB 4XCCL 3TO4B 5D4QA 1MHEB 4HIIB 5F7MC 3MRQB 1TOXA 4UOW1 3FQWA 4U1NB 1PU0A 1R5VA 3FPYA 3MROB 4UU9B 3L6FA 3BWAB 4KKLD 1PMYA 1CBJA 1BF8A 1OGTA 5L2JA 2AEOA 3RWFB 3BVNB 3BQUC 1EEZB 2IFFL 4PLJD 1RK0A 5FEBA 3CFDA 1I1RA 4HT1L 5J9PA 1LE5B 4TVUA 3S7GA 4HJIA 1PJWA 3RGVD 1UXMA 4FQCL 4GRWE 4JFVA 3REVB 3FO9B 3QZNA 1FAIL 3T0ED 1C8QA 2ZX5A 2IANA 2R0LL 4NRZA 2O5NA 3HNVL 4B3EA 3LKRA 3SHSA 3PP4L 4LHJB 4I3GA 4WUUD 1TSHA 2MKWA 4N0CC 3F04A 4PJAF 5KVFL 4KPHL 2UZXA 4CKVX 5HYJA 4FTVE 5JOPD 5D1XB 3IJEB 4IHBA 1AH1A 1J9SA 5DURD 3G6JE 3A21A 2P80D 2VMJA 2YARA 3VI4B 3MRNB 5E8EA 3JV5A 4OLVH 1MNUL 3GZKA 5JYLA 2Z91A 2DQJH 4R0LC 2G5BA 3O6FA 4ESKA 3H7BB 3FN9A 1REIA 3NCEB 4H1LA 4N2CA 1WZAA 2FNWA 3UBFA 1NMBL 4DK5A 3ULVE 2YGPA 2NYYD 3JWOL 4P2OB 2WC7A 3ZX1A 2R83A 4NUGL 1HH9B 2R2HB 2VL4A 3MBEC 4X7CC 4D3CL 2X42A 1GJWA 2HA1A 2Z65C 4NZDA 4NHCL 1QLEH 2XWDA 2FWUA 1Y1UA 2PLTA 2BP8A 2M8XA 4R90H 3J7HA 3OAYK 1ZE3H 1D5XB 3G5VA 4RMBA 4ZW6A 3ZL2A 3D18B 1IEBB 3VI3B 3L3DB 4CU8A 1JBJA 3B8YA 4ERSL 1EV2E 2HUHA 2CIKA 4F37K 3IS1X 4RZKA 2XBTA 3L4ZA 4F9PC 1XSKA 5IB5B 2Y7QB 4B9YA 2WTOA 4JHWH 2ESVA 4PGBA 3T6XA 3UTQA 5KS9B 4JG0L 4QTHB 3UYRL 3HB3D 3CQQA 1A3QA 1UKSA 3RJOA 3JVGA 5MENE 3V4UH 2X3AA 5E4IA 1MFAH 4HOWA 3SDAB 1RZJC 5LBSA 1J5IA 3E8VA 4L4TD 3QFGA 1YC7A 3IDJB 1DHKA 3FUJA 3NJIA 3QHZL 4NQDE 1ZHLA 5FXCH 1UOKA 4XOBA 4ORGB 1MRDL 4LEXL 4U3XA 4ZX5A 3KM2A 5GS2D 2R9HD 5BV7H 3OG4B 3QB7C 5IV2B 3DMMD 3F85A 2Y5TB 4HH9A 2QLYA 4JDVA 2PO6B 3HMXA 1IJ9A 2W65A 2E74C 1FZOA 2BIOA 4NKIL 4WO4A 2I25N 3VCLA 5JMOC 2G0KA 2VXTH 1HILB 4ZMZA 1RURL 3C09B 2FL5B 1U8NB 2XVGA 1N59B 2VMCA 4MWFB 4TL4A 5F1KC 4CDGC 1DFBH 1T6WA 3DUSB 2DIBA 3QC5X 4L3FA 2E27L 4X7DC 4XNUH 3SSGA 4DGVH 4QYOA 2IAAC 3HS9A 4PRIE 5BCAA 5EEWA 1B6UA 4L1BA 5CILH 4LNVA 4QHUA 2OI9B 3CN4A 5SWZD 2AFNA 1KIUB 3CU1A 5TD4A 4IIQC 5IJKC 5LWYL 1W6WA 2QTEA 3DOIA 2WQWA 3GK8H 3D25A 3V2AR 1Y6KR 5FLVA 2BW4A 4Z7UB 1NC4A 4ONOA 1IZKA 5D7EA 2WLLA 2YSTA 4HMCA 1J10A 4KVCL 1HXYA 1XO8A 4XOAA 2XC8A 2X6CA 3GEFA 1INEL 4FTVA 1G7IB 2NY6B 3EFFB 4MA1C 1PQZB 2WYHA 3G6JA 2EIDA 2XWJB 5E6IA 3RX7A 2W81C 5DEGA 15C8H 3ZE0E 4LKXA 4N0UE 4QCIA 3CLFL 4L4VB 4X6CF 2HT4D 5EU3A 1F6AA 4WJ5B 1OW0C 3O4LD 3IDGB 4LNRA 4MJ4A 5D70H 2CK2A 3QORB 3B5GA 32C2A 4UT6H 1EGJL 4X4XB 4HETA 5DJDA 1D2OA 1YQ2A 4TNVK 3EJCA 5EMYA 1D5ZB 3OXRB 4P0DA 3UAJA 3X1FA 4J39A 3RZCD 1XGYH 2KPWA 1ML0A 1MCSA 2ZKHH 4MQ7A 1E7VA 5SWSB 2H6UA 3ZRFC 2VW6A 4P04A 2X53A 1XBDA 4YDNA 3F5WB 1RERA 2UWEE 1C7SA 4Y1AA 2CR0A 3ZYJA 3PDGA 5KBLA 3HZ3A 4IBUA 2DL9A 3HNSH 4PJ5B 3TYFB 3F7VB 1M57B 1OCOB 3FQYA 4A6YH 3BVWA 4HJJL 3B5HA 5DRXB 2X1QA 5FO7A 1MCBA 4ZODA 3TFKD 3G04A 2H1LM 5IVXE 4K94L 5CZXC 4CBZA 4LSTL 4MKMA 2CJ3A 2YD0A 4CVZB 4NZ8A 2O61B 4QXUH 1DJHA 5CHNA 3LEXB 2F5AH 5HSFA 5MENA 4JN2B 4RVBA 3LKQA 3IN0A 1XR9B 4YMPA 1GAFH 2WO3B 4R26L 4WWKA 3NABL 4ODHL 3QIWB 5ILTL 1G0DA 5C07E 4BDVB 2RHEA 4FHBD 3QUKB 3FT4B 1NGZA 4C8XA 4NZFA 2Z0BA 5DDHB 3SBQA 4LFHD 2ADGB 3LRKA 3TCLB 1MIML 3Q44A 1S5HA 2HJLA 3T4AA 4TOYH 3MFGB 1KB9J 1UG9A 4GQPH 4FYQA 5DJ2B 3TT3L 3GNMH 1WZLA 5HY9B 1I1CA 4ZDHB 3EDKA 1FGVL 5C3TA 1HTYA 2A1WL 1NIBA 3CLWA 2EJ1A 4HYTB 4CVXB 1HEZA 1OB1A 2H9GA 2VE6A 3M1CA 3K74B 1I9IH 4N8CH 2X0VA 3MREA 2FAUA 4PRIA 4H26A 4YX2H 4J8RB 3TM6A 5A16A 2F1EA 1J48A 5DK2A 2ZXGA 1XDTT 3QAZC 4JPVL 1HWGB 1NEZG 4OLUL 4BQ9A 1J1PL 1QPKA 5BXFB 4HWEL 1TVHB 1V10A 2XU9A 4L1LA 2KLTA 2UZIL 4I5BA 2NY7H 4EEEA 5F9JB 5I0XA 1CXFA 4LP4A 3NJVA 3SKMA 1HHJA 5FM8A 1A6ZB 1FJ1A 1ONQB 3WV0A 4F27A 4CJ1A 5KVFE 1LQSR 3POCA 5DHMC 3GDCA 4GUPA 3FQWB 1DLHA 1R5VB 4WY7H 5MHSE 1HS6A 3L6FB 2ZX7A 1OGTB 3MJ7A 5L2JB 4XNQA 1JVLA 3T3MF 5D5ME 3VXUE 1RK0B 4MJIA 3CFDB 4QPEA 5J9PB 3MOAL 4FABH 4DHLA 4YFLI 4TTGA 3LKOA 2VDRB 2UYLA 2VH5H 5IQ7H 4V11A 1PX8A 4CC4C 2LHAA 2SODB 4W9EC 4HCRH 1U91A 3GLDA 2IANB 1QD0A 4D9LL 4NRZB 2I69A 1Q4NX 3VFPA 2BVPA 3SD5A 2W9DL 2JIXA 4WGKA 4NQSA 2JQZA 4JKNA 3LKRB 4Q9BA 2WKGA 5FGCB 3CVBA 3AACA 2D3LA 2FSEA 3ARVA 3BIAX 5BNXD 2UZXB 2GK2A 4WEEA 5HYJB 5T8IA 4XVOA 2LR4A 2Q3AA 4HAGA 5E8EB 1NCGA 3RWCA 3FTUA 3QIBA 2O5YH 3HBPA 3C5ZD 3QRGH 1KCVL 2BZCA 4XP9H 4UT7H 2H2SD 2Z91B 3DK2A 4DP5X 3MJWA 1L9QA 2G5BB 4MJHA 5FCUL 3O6FB 4F57L 1CN4A 4G11A 1HXKA 3ZL4L 3HTLX 3FO0L 4YHLL 5AAWA 4TSCL 4Y89A 4H1LB 2WP3T 4GOSA 1ZK5A 4WEBL 3QE5A 3CMOL 4YC2C 4OZFG 4RFNB 1X5LA 4G5ZL 3RWHA 4P2CG 4NRYA 1I8UA 3GMRA 3U7WL 1OO2A 1KCKA 4PJ9A 1A9VA 1G6VK 3BVTA 5LNDA 2BP8B 1TQTA 1UYWH 4QHKI 3G5VB 4AV5A 3UDWA 2CO1A 3IDMA 3FSZA 4Q9RH 1R4XA 4K3JH 4Z5RA 2NY3D 4D94A 4FYTA 2CJTA 2CIKB 1JGVH 3KPSD 4KKCC 1P2CA 2ESVB 3L3OA 4PGBB 2BNQD 1OTSD 5HI5D 5HJBA 4KKPA 1HL8A 2CU9A 2W0FA 3WN6A 3M1OA 4NJAL 3C5JA 1OAJA 1GTFA 2IAMA 3FH8A 3TYGH 5CIPA 4F24A 3U6RA 3EXJA 4N3TA 1RUMH 3ATAA 5JPNC 3FUDA 3CC5A 2WLHA 5B8CC 4ZFQA 1R24A 2V8LA 4H44C 2ZOOA 1AO7D 3UJJL 3JWDC 1ZHLB 3EADA 4HIEA 4QT5A 4OIIL 1IE5A 3DETC 3NK3A 3TT1L 1BOYA 2B2XL 2F6AA 2H6PA 2VDQB 3UABA 4HIXL 5TE6H 4QRSA 3INUL 4OFVA 2CUIA 2PYED 2I7OA 1UACH 4X0KA 3P3SA 4HH9B 1YEIH 1JHTA 4JDVB 4OFYD 2D31A 3HAEG 3ZTCC 1RZKC 2W65B 1CICA 3CK0H 1GIGH 1GGTA 1PLBA 1FZOB 2AK4A 2CLRA 4GW5A 2NXZB 4WO4B 3DO7A 3VCLB 4PJGF 1N64L 5E4EC 2WBJC 5EWIL 2WXQA 4TUJB 4W9HC 3RVWC 1NBCA 3OKMA 4N2KA 1JCKA 4ISVA 1AE6H 1J0YA 1OWWA 4HEPA 4K5MA 4QYOB 1WGVA 4BGDA 1ACCA 1KPRA 1OK8A 3GF8A 4QHUB 3QDGE 3VMOA 3ZDXF 4GRWB 3G5WA 1EO7A 4LL1A 2B1AL 2XQYK 3FU5A 4AQEA 2DBLH 3D25B 3ZDZE 1NC4B 4QI3A 1KOAA 4IS6A 5IOKA 2WLLB 1HXYB 1CXLA 1A7RH 1BIHA 3RTLA 1AZVA 4W9GC 4G7SB 4FTVB 1E5UI 1NEUA 1ULVA 3FRPG 4XB7A 3RI5K 2CPCA 2X10A 12E8H 3G6JB 1JL8A 3LSOA 2E7CA 4HJUA 5E6IB 5I74B 5DEGB 4QRTA 3DIVA 2YWZA 4LKXB 4QCIB 4QJ3B 1G94A 5EU3B 4IRZL 1F6AB 4LNRB 4X9GA 4XAKD 5I18H 32C2B 4O2FA 3WIFA 4JZJC 3KZ8A 5DJDB 3L8QA 1P84K 3C2SA 2B5IB 5I73B 1F45A 5E6UB 2F5BH 4XP4L 2QADD 1D5RA 3ARGC 1G9HA 3ETSA 2WUCH 4FJ6A 2XWXA 4MQ7B 3QUXD 3GQFA 4PI0A 4QXGH 3VB8A 2ARJA 3VE0A 1KB5A 2HG5A 1UZ6E 4TNFA 3O6KH 4Y5YC 1FYTE 4JFEA 1QLFA 1JMZA 1H6EA 1NOLA 1XV8A 4Y1AB 4G7YH 1CXIA 3HJEA 4K5PA 1HZLA 1FNGA 3EFOA 5I6XC 4HXBH 3V6FA 2CRZA 2VDLB 1NBZA 4A37A 5FO7B 3CFCL 2EDKA 2ICWI 3K6NA 4K8RD 4F9LC 4JY4A 1T2XA 3G04B 3SPHA 4LQ1A 2Z4QA 4LIQH 5J6SA 2D73A 4KX7A 4UQIM 3SY6A 1B9ZA 2HG0A 3IDXL 4DP1X 5CHNB 4RGOH 4N2AA 3VA2C 5MENB 3IVKA 3HE7A 3LKQB 2Z8WC 2EDMA 3BLBA 2CXGA 1CFBA 2VZ1A 2E8ZA 2VQUA 4J3WA 4WWKB 4BFIA 1QYGL 3K5RA 2QQLL 1K3ZA 3IAGC 3WNLA 4PS7A 2E6QA 1NGZB 1C7TA 4MJJA 4KHTH 4N5UA 3ARQA 4L37A 3EFDL 1S5HB 2HJLB 1BBDH 3T4AB 2MOGA 2D2OA 4KFMA 3WN5A 3LY6A 2FIRT 4PUBH 5BJTA 3P4LA 3DV4A 3MV01 3W0WE 1MZYA 2H41A 4FRWA 3JYCA 1IFHH 3MACL 1EUUA 1WZMA 2ZOUA 4H40A 2X4TA 1S7TA 4IMKA 4YFEA 2XYBA 2NDFA 1CZ8H 1O6SA 1EHKB 5ESAA 1HEZB 1LP9E 4HLZH 1OB1B 2H9GB 2VE6B 4N3UA 1EGJA 5HHNA 1P4LA 5T1LD 1DBKL 3L1OL 3MREB 2C8NA 1T1XA 1BLNA 2HRHA 1EFXD 2J1YA 4Z7VE 4PRIB 3N1PC 4P3CH 4H26B 2X4PA 2VLJE 4EPSA 1MG3C 4P46A 3GUFA 4JPWH 4OF7A 5A16B 1P7QD 5DK2B 1P5VA 5FO9A 3NQIA 1KCUL 5I8KL 5FF6A 2WYIA 4EDWL 1AMXA 3LN4A 4MVBC 3B7YA 2DQGL 1DQTA 3FQRA 1PEWA 3NJKA 1KYOK 5IBLD 3BGFB 2NY2D 4I5BB 4Z78A 4P2RA 4YSPA 2OZNA 3BVUA 3SKMB 1HHJB 1FJ1B 4RMVA 5ACLA 1HHGA 2AI0H 1J5DA 5L4FA 4GUPB 1DLHB 1DQIA 2EH8H 4C55A 3ULVC 1VZGA 3FT9A 3GXPA 3AXIA 3MJ7B 1ETB1 5C0CA 4KROC 4XNQB 1NMAH 3EYQD 4Z7WE 1QVOA 2YD3A 3F7KA 3HE6D 4MJIB 2F54A 4BA0A 1BV8A 2VKXA 5EN2A 3S5YA 3MKKA 1ZLWH 3LKOB 1QTPA 5KJRH 4M02A 3RVVC 2UYLB 4HHWA 4NZRL 4LVNB 3NIFF 1FYTA 4OVVA 1QQDA 1U91B 2Z35A 1WAAA 4IBWA 1BJMA 1EFQA 4HIPA 3VFPB 3ZR6A 5E99H 2JIXB 4NQSB 5F3BB 3UC2A 1ZT4A 4RBPK 4A1RA 3FN3A 2W07A 2YPKA 2FSEB 2XWCA 3QEUA 4GAGL 4RFOL 3D39D 5A40E 4M29A 1UM4L 3SQOH 1Z7JA 2XIIA 3B2UD 3K2MC 3D48R 2YUXA 2XTJC 3NRQA 3NEOA 3TVMD 5IHZA 2Y5EA 1I3RA 2YEVB 3D2UD 2QLVB 3PAVA 1F56A 2OR7A 3QIBB 4Y9EA 1KTBA 5CGTA 5BQDA 3R06A 2P7TA 2PPAA 4M62H 4N2LA 1A14H 1LJMA 1CFNA 4QXVA 4TKWA 5D2NE 3LDBB 4S1RL 4F33A 3DVGA 1OL0A 3RWHB 1OOWA 2C9SA 2AGJH 2VDOH 3DWTA 3TA4D 1OQXA 4NRYB 3PJNA 1NCDH 4JQIA 1UM6L 1S6NA 3GMRB 4X9FA 4N5EC 5GRVK 4OLWH 4PJ9B 1U2HA 4DTGL 3MGTA 4Z7NE 2EDBA 3BISA 4FFVD 5E94A 4LU5L 1OP5K 4AJWA 2XZAL 2APTA 1HE8A 5F6IB 3IDMB 1GCFA 4CC1A 5CEXA 2KUTA 4Z5RB 1J86A 4KMQA 1F6FB 3ETBF 3BAYA 3WHE0 4UV7L 5DJYA 3AU0A 1P2CB 2D03L 1M3IA 4YGVA 1J9TA 3L3OB 4FTDA 3U4AA 3MLUH 2EIKB 2W0FB 4IDJH 1G1CA 3C5JB 4YQXH 5CLYA 2IAMB 3H9YA 4ZMTA 3RDTC 2H3XC 5CIPB 3U6RB 3FYIB 5AVVB 2J5WA 2Q8AH 2P26A 1WH0A 2EECA 5ID1A 4JFOA 4PM1A 3CC5B 3U30C 5IBUB 1QR1A 1R24B 2ATKA 1MRCH 3DBSA 3F58L 4LVHB 3SBWC 1OAKH 1DQVA 1EUTA 3C6EA 4HIEB 4QT5B 4AL8C 3N9GL 4A39A 4IW4C 4Y19D 2H6PB 3F12A 3M7FB 4KVNH 4OR1A 2R0WL 4QRSB 5GRUH 4BCYA 4HC1H 4PJFA 4OZHA 4X0KB 4HFUL 5FB8A 3ZE1F 1U2CA 1JHTB 2D31B 1GYWA 1CICB 2XPYA 2CLRB 4GW5B 2AK4B 1AMYA 3LIZL 1HCZA 3UZQA 3DO7B 5BS0D 4ZMQA 1F4WH 2JI1A 5AAMC 2C4XA 3KL5A 1SLUA 3K5SA 2ZAIA 2BZDA 3BT2L 4RETB 3LS5H 3OKMB 4Z7WA 4CNIA 2FT6A 4ISVB 1IAKA 3FK3A 3TWYA 2VDML 2K8QA 3T6VA 1CPUA 5ITFA 1KPRB 5CXPA 2X4RA 2Q2LA 1ZV5A 2ZNXA 1CLZL 1YN7A 2Q8BL 4OM1L 3PYCA 5CJOL 3C08H 3KL0A 1SFDA 4OVUA 4AQEB 1W8NA 3VD1A 4IS6B 5DR5L 3UZEC 1JRHL 3GXMA 4EMZA 1LEIB 2R69H 1JWSA 1FZJA 4U1HA 1IL1A 3ROLA 3I3DA 5FHBH 1XF3A 3K0YA 1QSZA 5D7LD 2K6YA 4H20L 4PJ7A 2UXVA 3LSOB 1ZGLP 4XXDA 4TS6A 1AYOA 3QG7L 2JSFA 4PJAE 4QRTB 4F8LA 4J5VA 1ET7A 2WCSA 4NCC1 4ZMWA 2WLJA 1SLXA 1N6QL 4O2FB 3WIFB 5JW5A 3BAXA 1XSJA 4G6KL 2DOCA 2V4LA 5LGKA 3MQIA 4D9RD 5IZ7A 2OSYA 2VL5A 4GKOA 2UZYA 4RX4D 4R4FL 4WAFA 5B1BB 3VVWA 1L6ZA 3NZHH 4ZFZA 3S88H 2QGDA 2FO4A 4C4UA 4QIRA 4OTXH 4K0OA 3VE0B 2M1KA 3PLYA 2ARJB 1N4XH 2IBBA 3IJSA 2HG5B 4N26A 3V0DA 2JFCA 1MCDA 3ZJAA 1OOAA 4JFEB 1QLFB 2CRIA 3FU6A 1K4DA 5EZIL 4NQCD 4ONHA 2YZ8A 3GO1H 1G9EA 4WDIA 3N41B 4RAHA 2ZUVA 1FNGB 3VNYA 3EFOB 2CKBA 4PGEA 2HVJA 3SD2A 3V6FB 1NBZB 3RY6A 4GAAA 4FDWA 5FW7A 1SJXA 5CKGA 2W8CA 3TZVB 4JY4B 3P3TA 1AI1L 3ARTA 3TO2A 2Z4QB 1MJJA 3MV8D 4ZBJA 4GQ9H 4ZMYA 3MJ8A 1MREL 3FQ4A 3LX9A 2VERA 1YY8A 2E9BA 3CDCA 3ORJA 4PQXA 4MZRA 4M7LT 3ZU8A 3IVKB 3HE7B 2EXYD 1ZAGA 3UG5A 5GZOC 4KK6C 4Y1SA 2NTSP 4L9LA 5F96L 4D7BA 1MFMA 4MMZA 3QDAA 1NANI 4JQXA 4NI3A 4BFIB 2V17L 4WWID 1XIWD 3FUHA 5IF0A 1NUGA 5K39A 3TL5A 2A74A 2NY4B 1IAIL 1UUSA 2YBGA 5D7JD 1KGJA 4XNAA 1M9WA 1KBGH 1WJ3A 4PCYA 4OCNC 5BMFH 4NQUA 1RU9H 4L37B 4PV1C 2PW1A 4QLRA 1J8SA 1PNCA 2F1AA 3WN5B 4AGMA 5BJTB 1DQQA 1H8SA 2EDHA 3DV4B 1W8EA 3WO4C 3GJFH 4RGNE 4XPBL 2KDYA 4AQOA 1MHPH 2OL3H 4XE5B 2G9KA 1S7TB 2X4TB 4Q74A 4Z9KB 5GRZA 4FMVA 4E41D 5EO0A 3JVFC 2IGFL 2AEQL 5I1GH 4IRZA 5K93A 2OP4L 1O6SB 3JWOC 1GHFH 4EIUA 5ESAB 5HHNB 1P4LB 1T1XB 1BLNB 1U8JA 3VXTA 5IGXH 2LT9A 2AEPL 2X4PB 1LQBC 3A6CH 3VFRA 2ZSVA 1DBBL 5C0EA 4P46B 1E30A 2WK2A 3K0WA 4K9EH 1TZAA 4WK2B 2G75A 4C4KT 1P5VB 5FO9B 5FF6B 3WJLC 3WTUA 2DQEL 3LN4B 3ZDZB 3BPLC 1ICTA 3FQRB 1RSYA 2IDFA 4Z78B 4P2RB 2AXFA 2CR3A 4FQXA 2BOLA 3T8XA 3OJDA 1SQ2N 3GXNA 5KW9H 2K4WA 1CFSA 1Q72H 1O9ZA 2HXAA 3SN6N 1HHGB 1P1ZA 3R4DA 3N1FC 3SKNA 4PJAA 1R3LA 5FCSH 2A73B 4C56A 4JQVA 4YXKH 2YUZA 2KDGA 2LFGA 3ZBMA 1AHWA 5TE4H 5C0CB 3PFUA 1QVOB 3T04D 4AT6A 2F54B 4H1LG 5D1ZC 5AZEL 4X6CE 4MA7L 1AGDA 2DJMA 5EN2B 3ZHLA 2ZWSA 5HD8D 2TAAA 1A9EA 5D4HA 4W4OC 3PXLA 1L7TH 4DJMA 1FFOA 5FM5O 2Y25A 5EN3A 5FYJD 3GTTA 3OMAB 1FYTB 3DTXA 5CP3A 5JIQA 1QQDB 2Z35B 3VGAC 4JBSA 1IGIL 4BM7A 4WI4A 1LO0L 1ZT4B 5TFSL 1IIIA 1JPST 2W07B 3Q5YA 2YPKB 3QEUB 4P23C 5JHDE 5T1KA 3KE0A 4W9CC 2RD0A 2QPDB 2L7QA 5IHZB 3NTCL 5ITBH 5M94B 1I3UA 1I3RB 3IKCA 2AJXL 2JB5L 2MPAH 4Y16C 1HINL 3R06B 4CKQA 2P7TB 1LO2L 1RFDL 2ED9A 4HF5L 4G6ML 2CO3A 1RULH 3A22A 4KXAA 1UWYA 3C60C 1AFVL 1CFNB 2AABH 3ULUH 3BDYH 1KV7A 3KPPA 5EA0L 2NNXA 4F33B 3DVGB 3RB5A 43C9A 1J1XL 4HJSA 2GPZA 4LARH 4A67A 1P4BH 3RFZA 3D34A 1OK0A 1T1ZA 4AZ8A 4X5QA 5CINH 2DD8L 5EC2A 1NAMH 5ICXA 1HE7A 2AERT 1QFPA 3MGTB 2RCSL 1HHKA 5E94B 2WKOA 5T33H 1FSKC 1T1YA 2QVTA 3B43A 2W9EL 2XRAL 1UJTA 1GGIL 3HG0A 5CEXB 2XQYA 2PR4L 3A4FA 3BXNA 5B1JC 2D3NA 4KJWD 4N20A 1MPAL 3LH9A 3N44B 4NWTL 4RIRA 3O3EA 5DJYB 1KEMH 4ELKA 1TO5A 1TKWA 4LCIL 4QXTA 1OV8A 2DWSA 4YGVB 2Z1PA 1MJUL 2H2PD 5KVGE 3X1BA 1JZFA 3SB3A 4B9FA 2YMOA 3ISYA 2J20A 2ZXBA 4P9HL 2ENJA 2FWOA 4PJ8C 1OW0A 1UB6A 2BY2A 4WCYH 5I0DA 4UB0L 4CW1A 3WXWL 4XNDA 5F7DA 1TZGH 1WFIA 5ID1B 5F7AA 3PAYA 4JFOB 5GZNA 5AOIA 1F41A 1QR1B 2ATKB 1OZUA 4YHOL 1S78C 2BXYA 3N43F 4XMKH 4XXCA 1KTKE 1S9WA 3D9AL 3IN2A 5I30L 1GRWA 3D69A 2BY1A 3F12B 2VUOA 4K94C 4M7KL 4PJFB 4OZHB 1EK3A 5FB8B 3ELAT 1I1YA 3HC3L 1XF5A 5E70A 4N1EA 4KKLC 3S4SA 4YDIL 3IBEA 1HL9A 3L7FA 3UZQB 2WSKA 1IM9D 4G6JL 4GAJH 4IJTA 2W94A 2A6KA 5HYQA 1QW9A 3QARA 1ET5A 4N8PA 3IB4A 4Z7WB 4CNIB 5J12B 1U4EA 3CXDL 5G2NA 3S3DB 1E2ZA 3CN2A 2VDNH 1IAKB 3LRMA 3BUYA 1IILE 1JMXA 3UACA 4H8VA 2EIBA 2Y0SA 2YGVA 5ITFB 2CKNA 2JJSC 2X4RB 3DA0A 3UG3A 4MLIA 3T3ME 3V52L 1Z9MA 1YN7B 2Z7WA 3KYKH 1DEEA 2AV7A 4JHAL 5EO1A 1WWBX 2ZUWA 4XP5H 3MNZA 3T2PA 4N28A 4M8RA 4I77H 2YK1L 4XMTA 4X83A 5KSBA 3DXAD 4HQQL 1JWSB 1FZJB 2EDOA 4U1HB 1IL1B 3ROLB 5JHDA 5AG9A 1XF3B 5F7EL 2YS4A 4PJ7B 3R0MA 4OI9A 3M45A 1ZDQA 4XXDB 3IMUA 3LNEA 4KJPC 2N1KA 1P69B 2IDSA 5JUEH 2VIRA 2VB5A 3CFBA 4PRHA 3AMKA 1F4XL 3GRGA 3GWJA 1G9NH 4OI8A 3C6LA 4RCAA 1Z3GL 4NNPL 5JW5B 4L2YA 5HDQH 4D0DA 2PPEA 3UTSD 3CFEA 3ARBA 1FVEA 4YBLB 3H4FA 3DYMA 2VL5B 1AZRA 4G8GD 2UZYB 1OLZA 4ZFZB 4PJIF 1JPSL 2FO4B 3ESPA 4OZFH 3MGOA 4XP6H 1BXXA 3F83A 4KK5C 3IJSB 4HKBA 4MCZB 4O02A 3SGDI 4PAZA 3EBAA 2EEDA 4IOIA 2E86A 3LPGA 1K4DB 3HVDA 1SHMA 3BGMA 4ONHB 3UBXI 3DI3B 4WDIB 1OLLA 2A38A 4A7GA 5ISZA 2CKBB 4JVUA 2HVJB 4PGEB 1F1GA 4DGWC 3ARDA 1NBYA 5HHQA 5KSAA 3TO2B 1MJJB 3M8OH 3QBTB 1NSNL 3MJ8B 4JEGB 1MCOH 3H9SD 4PS3A 5DC4B 1MDTA 1ZHBA 1YY8B 3I2CL 3QNFA 1EZVX 1RL1A 5C08E 2B1HH 3FCGA 3KM1A 1IV8A 3T77A 4L9LB 5AOJA 4MMZB 4FXKC 3L4CA 1IBGL 4I4WA 4RESB 5F3HA 3X3GL 4ZXBD 3ISRA 4OD2A 5IF0B 2F7RA 3OL2A 5K39B 2A74B 1K5NA 2Y6TE 4CC4A 2R51A 3DMMC 5J4MA 4KTGA 4E9LA 1CE1L 1QX1A 4NNXA 4TLTA 3GXUB 4YUEH 2PW1B 2BSCA 4WI7A 5F9AC 1PLGH 2DKUA 1BZ8A 4G8IA 4HH8A 5L6YH 1DQQB 4WWOA 1NGPH 4BBWA 2F19L 1URZA 3MJ9A 3TNNA 5AEAA 3HAEH 1RMFH 1VPOL 2HRLA 3C5XA 2NXYB 3O3DA 3FPXA 2AXJA 1IO4C 5EO0B 5CEZH 1QFOA 5D93B 4XNZC 1KCSL 5LNGA 1U21A 1Z9NA 3OKNA 2X70A 1KPVA 4PJGE 2Q5BA 3LPWA 4QRPD 4J6RL 1U8JB 1YVLA 2H32H 4OD3H 5A2AA 1ZLVH 3VXTB 4AQ8A 1BA9A 4KZDH 1IVLA 3VFRB 2ZSVB 3PWLA 3RWIA 4GMSH 3T8VA 5C0EB 4CMMA 3WTXA 5H37A 3QFJD 2YN3A 4F91B 2G75B 2VQ4A 3D7PA 4R5TA 2EYSA 3TFBA 1PCXA 4ZMVA 1NCOA 4TN9A 3FSVA 3QEHA 1T5XA 4Y2DA 4JG1L 4FXLA 2APWA 1CYXA 5AW8B 4ES8A 3U9PH 3GI9L 2VRQA 4HAKA 3JSSA 1U4FA 2AXFB 4FQXB 1QBMH 4Y1TA 3T8XB 3OJDB 5L8KB 1CFSB 1MWAA 2HT4C 3N04A 1D9KD 3PL6C 1IQDA 3D2TA 1P1ZB 1KELH 4H5SA 3S97C 1QSED 3SKNB 4F15C 1AG6A 1R3LB 1S7UA 3APDA 3FQNA 4PJAB 4C56B 1FCGA 5HP5A 5D2NC 3ZMNA 1AHWB 3IDYB 1UCBH 2Q20A 4KAQH 4AT6B 2ZKYA 4L0PB 1AKJA 1TTBA 3CPLA 1PAMA 1AGDB 3OKKA 2GJ6E 1A9EB 4OCRH 5F21B 2DICA 1RKRA 1SFHA 1Z6JT 1FFOB 1IGTA 2JELH 2Y2WA 4ZTEA 5FYLD 2TSAA 1EX0A 5DLLA 3DTXB 1E8ZA 3GIZL 3QULA 2EE3A 1SJEA 3PG2A 5JHLL 1DL7L 5TQ0H 4MMXA 4NAJA 3K80A 5T1KB 3VXSA 4R90L 2CHWA 3FB5A 2P8LA 3N85H 2ZJSL 3IKCB 4KO6A 3H53A 5KVDL 1V3LA 3RWGA 1J9QA 1SMAA 4AGLA 4JREC 3NSDA 1FAKT 4JHWL 2OYLA 3WY1A 2XN9A 3KPPB 5KUKA 1URLA 1T7XA 1BREA 3CVHA 4LOVA 5IBUG 1FF5A 2TSBA 1J1OH 4I88A 43C9B 2Z4TA 1NMCB 2P5EA 3RFZB 4AZ8B 1T1ZB 1T0NA 1E8XA 4G8AC 5ICXB 1U41A 4BZ1H 3DJZA 2P5WA 2J8OA 1HHKB 1BGXL 1T1YB 1YYMH 1MCPH 2PETA 3IPFA 2BLFA 1UGNA 1J8HE 3APNA 1OAQH 4R4ND 2WPGA 5ECJE 3TH3T 2XWTA 5JHBA 3BXNB 3W9EA 4RIRB 4Y4HA 1QRND 1J9CT 3O3EB 4ELKB 4P5TD 1DVXA 1TKWB 5E2WL 4URKA 1JNNL 3KVDD 4QXTB 4X98A 3DO4A 4Y4KC 1QW8A 3QIUD 2EACA 1L9RA 2FWOB 4ACPA 3HG1E 5L4IA 4HEPG 1UB6B 2VXTL 4GG8A 1MCFA 1XSOA 4Z3EA 4CW1B 1OM3H 5F7DB 4ZJ9A 1DFBL 3EBHA 4FLHA 3DGCR 4XNUL 5DF0A 5DVMA 1DJZA 4DGVL 1S46A 3MXVL 3NJNA 1BJ1J 2FLBT 1BD2D 4YZFF 2OJ1A 4IKKA 1TEGA 4ZOEA 1S9WB 2ZXDA 2IOIA 4XXWC 3RILA 3F8UB 5KVEL 3D69B 3RHWF 2B0SL 5J13B 4FJYA 1O6VA 1U3ZA 1I1YB 3OAUH 2GSGA 1XF5B 3S4SB 2OQJA 2APSA 1JIBA 3CZJA 3L7FB 1NEPA 2WYZA 4O00A 1JGUH 5EU7E 2NY0C 2C9VA 3OLEA 4OKDA 2A6KB 4R84A 4QDGA 5HYQB 1SY6H 3FB6A 1QFWL 4OJYA 1HJBC 4GRLC 1WRFA 1QSFA 5FUZH 1KC5H 3BUYB 2DQHH 3RKDD 5D70L 1FVDA 3LQAH 1VFMA 1J18A 4UT6L 1EDQA 1ZHKA 4HSAC 5IM7A 3DX9A 4X9YA 5EO1B 1DEEB 3AM8A 3RGHA 3BKJH 3MNZB 1ZLDA 1XGYL 2ZKHL 3MA7A 2ZT9C 3FBKA 2FO1A 1V3KA 1RHFA 2CWRA 5FFOA 1MXGA 4J4PD 5KSBB 1NCHA 5C0GA 3MUHL 5DXWA 4PS8A 5JHDB 1T66D 2ZXAA 5I8EA 3TF4A 1J5OH 3BLKA 3Q8EA 3STLA 1WISA 4MGXA 1QWNA 3P0VH 2VIRB 4A6YL 3QJUB 3CFBB 4PRHB 3D0LA 1UD5A 3L4UA 1TUPA 3BESR 3C6LB 3O8XC 4NZJA 4D0DB 5I6PA 4DOHE 3CGTA 3LZQA 1ND0A 1NLDL 3ARBB 3CFEB 1FVEB 3QPKA 4A7TA 4F5CE 5JOEA 3JUYA 5F7LB 3K91A 5BVJA 2RH0A 3Q1EA 2F5AL 3HUJA 3L13A 1SVCP 3MGOB 5AENA 4LMQI 3RA7H 3QK0A 4E2OA 1GAFL 4HKBB 2HLFD 4L3ED 3Q48A 5EFIA 5TK2A 4O02B 2HFGH 3AG4B 3E38A 3JYBA 3VD0A 1TZ8A 4IOIB 2V0AA 1EHNA 1TJHH 5BVPH 2EDXA 4RGNC 1EAJA 3BGMB 4BKLA 1IAMA 2Y9RT 3H3BC 5I6OA 4JK0D 4YDMA 4U7KA 3DECA 1DP0A 5ISZB 1KACB 5GGSA 4NJ9L 3ARDB 3WHE1 1NBYB 5HI5C 5HHQB 5KSAB 4TOYL 2FGWH 3T1FA 2F74A 1DSYA 3QRLA 2R0ZH 3FMGH 3S6CA 2Y1YA 3TBBA 4N9GA 1MHHA 3L4YA 1ZHBB 3QDMD 4MKTA 3EJTA 3KWTA 3PS6A 5KBKA 4PREA 1MJ7L 1G9MH 3T77B 2XSKA 2AQPA 3N42F 5IY5B 4N8CL 3FAXA 4I4WB 5F3HB 1O75A 4PLKD 4OD2B 3TEYA 1FWXA 1NGQH 5FYJU 2HAZA 4PJEF 4YX2L 1QLRA 4QGYA 1N5YH 1K5NB 4GP4B 4RWYH 3F84A 4A2GA 3DBXA 5B4MC 3S2CA 1KGUA 3SEPA 1IFGA 1XAKA 5F97E 5J5EA 3QUYC 3T6QC 3QEGH 4KDTA 4G8IB 4CILA 5HHOA 1JFHA 4AMWA 5HHXH 2ZCKH 3ZMRA 2NY7L 3ARED 2FUTA 4XN7A 4PJXF 2O6CA 3TNNB 3MRLA 5BZZA 3OHMB 1CUOA 3FL7A 3JWNH 2E3VA 3ZE1E 1YNLL 3O3DB 1SHSA 5E56A 3QJHA 1BG9A 3NG5A 5B7FA 2L8AA 2Y7OA 3OKNB 2X70B 3US1A 1RD6A 2EUVA 1KPVB 1MFCH 4B9ZA 4WY7L 3FAWA 2A0LD 2VXQL 3D87B 3QDJE 3B3IA 1IC1A 3T3MB 3PWLB 3NDZE 5FYKD 1TZOA 2XXCB 2CJUL 2ZP9A 3RWIB 4CMMB 4YC2B 3LZLA 4AMKH 4W9FC 5T5NF 3SDCA 1YAZA 2EYSB 4IKLA 4CVWA 3FUKA 4KX8A 4ONFL 4LHUA 1VDGA 4UTBH 4KY1H 3DYOA 1T5XB 1HH6A 4Y2DB 4QRQA 5TF1H 1BQKA 5IQ7L 2ZZUT 4HWBA 3WNNA 4HCRL 3VGEA 3ZZQA 4POYA 5BO1H 3H8NA 3EDDA 1E4XI 1GC1H 4FNRA 1MWAB 4EZLA 1IQDB 3B37A 4H5SB 5CUSH 1KN4H 3PWUA 1S7UB 2OMUA 3FQNB 4N2GA 3DHMA 4JNXA 5EOTA 1M05A 3G6DH 1KXTA 1S4IA 4KO5A 5KVDE 2FHFA 3BAKA 5L4JA 3COOA 4F5CA 1AKJB 3QRGL 2O5YL 3CPLB 5JZ7C 3OKKB 4HALA 4XP9L 4UT7L 1XMWA 5I9QB 5E1GA 3LHPH 3RDTA 3U82B 1ROWA 4JR9H 1IGTB 1KB3A 3PWPA 4KRPB 1WE5A 1FRGH 1SDYA 1XH2A 3QULB 1SXAA 1SJEB 3SBWA 2LOEA 5EZLA 2V5RA 3PHSA 3BP6A 3NCYP 4MMXB 4S1QH 3OAZK 2VYRE 5G55A 3TV3L 4IRJD 4LBEA 3S9DB 1TF4A 1F1DA 3VXSB 5CCJA 1UYWL 4L8DA 3O6MH 1BDYA 1A64A 3GHBL 3I6LE 4OGXL 3FB5B 5T3ZH 2P8LB 5HYFA 5E5LA 4Q9RL 2E6PA 4K3JL 3RY4A 4B7IA 4U0QB 3EBGA 4LPYA 3RWGB 3TA3D 1JGVL 5AAMA 5E4EB 4N6QA 3REWA 1C5CL 2J25A 1GJIA 4B60A 4G6FD 5SV4A 2XN9B 1V7ML 3CVHB 4MQSB 2CA3A 2FBRA 4EVNA 3TYGL 5IREA 2ID5A 3QYCA 3NCFB 5L7XH 2DKMA 4U1LA 4ENZA 2W0PA 3SYCA 1RUML 2DQUL 2LQRA 1YCSA 2P5EB 1PIGA 3AQDA 1T0NB 3EG9A 3NAAH 3S5ZA 4TVPD 3Q2CA 1JFQH 3F7YA 2P5WB 2HRGA 4MAYD 4YVUA 4HLEA 2PNDA 3KPRA 2ZTBA 4HZAA 1OT1A 5IT2L 2VLLA 4N90E 2DI8A 2XWTB 2AS5M 3VFSA 4ZAKD 2X87A 3UPAA 4YFLF 2DF3A 3IGFA 1Z3RA 1UACL 4Y4HB 1F2QA 3UO1H 3W9EB 4HGWA 4NN7B 2W1NA 1YEIL 3V0EA 4X98B 1V7NH 2WAQA 4U6TA 2FQDA 4JO4H 1ZOXA 4X7EC 4GG8B 2ZIDA 4CBPA 2C7FA 2DLEA 1B3IA 2C9AA 3EO9H 2WXNA 3DIFA 4KVPA 4Y4FA 2HPOA 4V1DD 5CCGE 1UH3A 2VAAA 5IBLC 4LSPH 2GJZA 2AMUA 4B5ZA 1LXMA 4TSBH 3ZDXB 5K9QI 4ODXA 4WTWA 4K73A 4NZUL 4X6DA 5AVRB 5AKVA 1CD8A 5JHLA 3EDJA 4F20A 2DBLL 4IM8A 3QXVA 4OGYH 4UWQB 5FA4B 2GSGB 2OTPA 2OQJB 3RYMA 3BZFA 4H0HB 4YE0A 4KHXH 2D7MA 3P30H 3ZXAC 1UOWA 2UX6A 3M17A 2YAOA 3X3FH 1N0LA 4HJGA 3B2XA 12E8L 3FQTA 3FB6B 4PWGA 5F93C 3U0WH 1QSFB 3RL1A 5I75C 1L9SA 1FVDB 4QY8A 4H1LH 1ZHKB 1W8OA 4XVTH 5IM7B 1JDCA 1NL0L 3DX9B 2G4EA 1D5BA 2LGNA 5EULV 5B3SB 5ETUA 1W72A 1USQA 2X6BA 3MA7B 1U3HD 3BFQG 1HI6A 5F0JB 3O6KL 5C0GB 2ZF9A 4UNUA 4ATTA 1VCBC 5IFJA 1G6RL 4HBQA 2AZAA 2OA9A 5I8EB 2P5PA 2I32A 4G7YL 3STLB 3S34L 1VJSA 3LNGA 1OHQA 1RCYA 4K3DH 4HXBL 2VLKD 3GM0A 1TEFA 3EYSL 4CRPA 4M1DH 4P5RA 3D0LB 5JIHA 5D8JH 3U7AA 1XB6A 4LIQL 2XFGB 2XG5A 4M8UA 1ND0B 3FTYA 3NCCB 4Q6IA 1SXSA 4WFGE 4XP1H 5D1QA 3VW3H 5BVJB 4BCZA 3HUJB 5LBSH 3CBRA 4OCLC 4GBXC 1UT9A 1JXGA 1ZWIA 5EFIB 3BN9C 1UURA 4FNUA 4DETA 2VUYA 1QAWA 3L4TA 2K7QA 4BELD 1OD9A 2DLHA 3N1GC 4G7VL 4BKLB 2VDQH 2MIZA 5HDWA 1JAEA 2DEWX 4K2UL 3PNRB 4KHTL 1XTLA 2L7EA 3OV6A 4QRAA 2WZPA 1E5BA 1OGAE 3HMXH 4HKXA 5GGSB 4BE6A 3I02A 4UMGA 1XGQA 1KN2H 3GBLA 2MCG1 2K7PA 3T1FB 2F74B 3QUGA 4HW6A 2OR9L 1IFHL 2XVKA 4N9GB 4UM9D 1MHHB 3M86A 5DC9B 3ZZLA 2HJFA 1CD9B 1U8IA 2R56H 1ZVSA 3MV7D 4PREB 4XTRD 1CZ8L 1XL4A 1JPTH 3KDPB 1U8CA 4M3JA 5D1ZA 1T4WA 2BIPA 3T2OA 1NICA 4R5XA 4GRWH 3QJOA 4U1JA 4W4OA 1QLRB 2OZ4A 3DYPA 4XPGH 5DMIH 5JIIA 4WI5A 3DBXB 4JPWL 5CKAA 4GQQA 1VFBA 4C4BA 4YEEA 5I1CH 4GQRA 4AYEC 1INQA 5HHOB 1AQDA 3HLKA 4PCSA 5AFAA 2ZYRA 4PVNA 3MRLB 5J11B 2F15A 3L5IA 3QJHB 5L0QC 2AI0L 1S9XA 4FZEL 4XNYH 1KXHA 2EH8L 3RTQD 4WGWB 3B9KA 4YSQA 3OTTA 4Q4IA 4HJ1A 4UDTA 1F86A 4YDKH 3B3IB 4JG5A 4K3EH 5T1JA 1UJ3A 1KTRL 4JGJA 2NSMA 4UQCA 4I9XA 4JM2D 4BSJA 2X0WA 3SDCB 2ZWZA 4TSAL 1JZ2A 4LHUB 1GGCH 3NCXA 2OYMA 3D12B 1HH6B 3OZ9H 4QRQB 4WFHD 1TR7A 3T2LA 4QRFA