3AQZA

Crystal structure of plodia interpunctella beta-grp/gnbp3 n-terminal domain with laminarihexaoses
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
100
structure length
100
Chain Sequence
b'SYVVPSAKLEAIYPKGLRVSIPDDGFSLFAFHGKLNEEMDGLEAGHWARDITKPKEGRWTFRDRNVKLKLGDKIYFWTYVIKDGLGYRQDNGEWTVTEFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-1,3-glucan-binding protein
molecule tags Sugar binding protein
source organism Plodia interpunctella
publication title Structural insights into recognition of triple-helical beta-glucans by an insect fungal receptor
pubmed doi rcsb
total genus 17
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2140 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3aqzA00
3IE4A 3AQZA 2KHAA 2RQEA 3AQYA 3AQXA
chains in the Genus database with same CATH superfamily
1G6RH 4JHAH 3U6RA 2QR0B 4YSUA 5EIVA 2IOIA 2AF2A 4PJCE 2VM4A 4J5VA 2AK1H 4KU1A 1DQJB 4F8NA 1ZVYA 2KZWA 2DL2A 3I6GB 4A7TA 4U1JA 1J5DA 4N0UE 1BVKA 4FYQA 3DETD 2ICEB 2O6DA 2XN2A 4PRIE 1QEWB 2W9EL 4KV5F 2Y5QA 2ZWLT 3ECUA 4L8SC 1EZLA 3BO8A 4HKXA 1DUYA 4IGBA 1TTUA 4MYPA 4W9ZA 1G9EA 1GZQB 3ARFC 4J6RH 4UIKL 5BVPL 3KXFE 1RK1A 2FGZA 3G9VA 2EVFA 4QNPE 2WO2B 5D1QA 1AYOA 3C6LA 5B22A 5JORA 2PKDA 1I8IB 1IC7L 1ZHKB 3F83A 3WS3B 5CJOH 5T3XL 4L37A 1PIGA 3BHBB 3QJTB 1YJDH 4UM8A 1HZLA 3RWIB 3DMMB 2MQCA 1ZDSA 2XV6B 4TQIA 2NY3D 2CKBB 4G5AA 2K4WA 4OQTA 2K78A 2YMOA 4AH2B 5B38B 3MRIB 4ZPTA 1A02N 4RX4A 1G7HA 5LGJA 4LVHB 4YXHL 4WY7L 3PJLA 4YHOH 3VXOB 3GK8H 2DWTA 4N8CL 3E8UH 5JHDB 1YECH 3GHEL 1CS6A 4BELD 4AQAA 1GPOH 5ISZD 4XZ4A 3PUCA 3VQ2C 3HZKB 1UD4A 3IU4L 3G7TA 4OGYH 3K5RA 4AKOA 3BAEL 1P7KA 2UUDK 3ARDC 2ZKYA 3LQAH 5FYLD 3SDXE 4ANXA 5EBMA 2W95A 4O2CA 4G9FA 4HEME 1NFDE 5E6RB 1F4YL 2XICA 3L7FB 4FL4B 4DGVH 3IVKA 1VFOA 3IF1A 4QOKE 2NZ9D 1HI6A 4RWYL 5KVEL 1Q1JH 5CN3A 3F84A 2JKLA 1HCZA 1IC5H 2OJZH 2W9DL 2BVEA 2EP6A 3RBGA 1ONQA 3ECQA 2P52A 2YXVA 4EUPA 4XGZB 1KPVA 1LO4H 5JW4M 1ZHBA 3L6FB 1B9KA 4HULB 1U8IA 4P2QE 2EDJA 4CDHA 2NTSP 2ZUUA 4HFUL 5DJ0A 2GSGB 2OW7A 4HMDA 5D7KD 5C07E 4G70B 5CGYC 1EGJA 1GOFA 5A2KH 5JPMB 3ALWA 1TG8A 2VMDA 3LKRA 1G7QA 2A4EA 5FCSH 4MD0A 4JL2A 2AITA 3WL9B 5DT1L 1EXGA 4PTUA 1I8KB 2QPEB 3T8XB 4ALAH 4PCKA 4LLWA 4F58H 3MRKA 2DIEA 4YGVA 4GRLB 5EF1A 2CLZB 2I60H 3OXSA 1IBFA 1A2YA 5DD1L 5TE7L 3U0TA 1IBGL 3BH9A 3ZTJH 2Y7LA 1AI1L 4B53A 4FQIL 4Z6AT 4LVNC 1CFMA 1D5ZB 1XXFC 5K9JL 4S2SB 3ULUD 1HH9B 4K94L 1TMCB 1WBXB 3HAEG 2GQHA 2OSLA 1WFMA 3C5ZC 3BPCB 4XCFH 2IGTA 3ETBF 2E76C 1J8HB 1RU9L 1VACB 4HLJA 1N10A 1XB8A 3QUYB 3SD2A 3VFVB 5D2NE 2B16A 4DHLA 1MI5D 1SLXA 1GYUA 4N90D 1G5AA 3WDHA 3VXSA 4DF9A 4B9GA 1G84A 3VGHA 1VSCA 2ADIA 2DYSB 4N0UA 1BWMA 4KXAA 4TQ8A 5D7HA 3UL4A 1MPAL 3PL6B 1MWOA 3HC0A 3NABH 4O58H 2MWCA 3BVVA 3LZQA 4Z7VB 1DBMH 5JUEL 3RDTD 4ZDHA 5JTWA 2JJTA 3GO1H 4NQDE 1KLUA 3HPJA 3ESPA 3KPLB 3FTWA 3RY6C 4NKMA 1QSFE 3V0WL 1VACA 4O5LH 4QTIH 3KPRB 1KYOJ 1OE3A 5IJVA 3V4LA 1EEYB 3D0AA 1D5BA 1X7SA 5FUZH 1ZT4A 3FO9B 1AQDA 3HFFA 4DERA 1EJFA 1JMZA 1S78D 3ZN6A 3WFHB 2XIBA 3FAWA 5IF0A 3QQXA 5FGBA 5D1XE 4UQBA 5F0MB 3VH8A 1AIFB 3EAKA 1TEGA 3D85B 5B3NA 1PKOA 4CU7A 4YHLL 4G82A 1U6AH 5ENWB 2V5RA 5KYYB 4ZFOA 3F6JA 1RCYA 2R23B 1KJMB 1U8CB 3NAAL 4PV8A 4QKTA 3CDGA 2OXHA 4AV4A 4UNTA 1HHKB 4JFHE 4ZFZA 1BX2A 1KIRB 2IPUK 3BD3A 1DBKL 4PUBL 4YHPB 4BQCA 3GIVA 1P84J 2X9YA 4FXGA 1EHLH 1BF8A 1AGBA 5EZIH 2QMJA 4NOBA 3SO5A 3WFBL 4YHZL 3NDYE 2BOBB 3WFEH 4LRNH 4BZ2H 1UA6L 5EV7A 2V7HA 1R5WB 1VGKA 3FQXA 4JHVA 1VKXB 3SKOA 2WVTA 3ABLB 5FA4B 2FJUB 1DLFH 2DD8H 2Y7OA 4WEBH 4P04A 3S88L 4GBXB 3O6MH 2QVTA 4C83A 3RFZC 3SO3B 2X6VA 1L9NA 3O6FA 5C0IA 2ZSVA 1S9WB 5EWIH 4PJDB 1RJLA 5IMMB 4FERA 4AKPA 5F7FA 4XVSL 1IM3B 2AQSA 2YKLH 3I6GA 3CMGA 4WHDA 2XJLA 2O6CA 5CN1A 3SYPA 4EZJA 2PR9A 4TTDD 1JL8A 1QBMH 4JY5H 4S1QL 2YQ2A 4AENB 2BWIA 2Q76A 1ZLWH 5D4IA 2Q5BA 3OHMB 1U3HA 1S5HB 2Z64C 3B7TA 4RGOL 3S3CB 4UT6H 5BJTA 5JPNC 1WWWX 4JKNA 4KY1H 4N87A 4XPBH 4P5MA 1ET7A 4WV1C 1Z9LA 5SX5H 5BO1H 3OZ9L 1EEZB 3QI9C 2E7LA 3QR2A 2EUXA 3ZHFA 1INDL 2QSVA 3Q2NA 1WH0A 3NZUA 4UTBL 1F1AA 4YQXL 1MRCH 4KZ0A 4FNPA 5EIIG 4Z7NB 5IV2B 3ZE1E 5FCUL 1QLRA 2QHRL 4KFMA 1WD8A 4I0PB 3C12A 2HMID 1WJ3A 5TDOB 2LVCA 4MJIE 5LGJB 3VI3E 3OQRA 4PJ9D 4PREB 1G7JB 3R7RA 1JAEA 3PGCB 3CG8A 1PX3A 3RU8L 3EKCA 5DUMH 2LU4A 1COBA 1YMMA 4WGKA 4WO4A 1U8MA 2H2PC 3KPNA 3ZMEA 2BP8B 4EN3A 3L5WB 3JTSA 3CH1A 3CFEB 3CFJA 4Z0XA 1IVTA 3T3PF 3LEVH 2GK2A 3QQ3A 5IM7B 1I3RA 1JF1A 2Y06L 3VRIA 4TSBH 4P2CG 1AR1B 4JGNA 1A9VA 1PL3A 4WEMB 3VXRB 4P23C 3VFNB 5BS0B 5A2JH 3NAAH 4M6NL 4HJGA 2VDLL 4F58L 4OZIA 4F1SA 2VLME 4JFTA 3IRZA 4WWKA 1CE1L 3OTTA 3QFJD 3VSUA 4ZX3A 1UWEL 3DHUA 2DLEA 4MHHG 4FQIH 5FYKU 5E08H 3D5OF 3TIEB 2XQYA 2ZP8A 3OJ2C 4X98A 5E1GA 5GS0L 1C8PA 5E99H 4NUMA 1KPVB 3MNDA 1RIHL 1DVFB 3E3QE 4DN4H 2A9AA 4DTGH 2VLRD 1DL7H 1D9KC 3KJ6L 1K5NB 4JY6B 3S3PA 2J1YA 4I1RA 3US9A 3LQMA 4WWID 3PF2A 5I8CA 1Z0NA 5A2AA 2WWOA 4KKBC 1XIWC 4J39A 5J1SC 3BZ4A 5KBNC 1K4CB 4WV1B 5IJKC 2B9BA 4PV9A 4EIZC 1A7QL 4NBXB 1CL7I 1A4KB 3NCBB 1ZLSL 4KK6C 2V3EA 2R0KL 3IMUA 5C0CB 3FONB 4R4FH 4LQFL 4AGMA 1IGCL 1SHWA 2AS5M 1MF2H 2R1XA 3FS9A 3CN0A 1IJ9A 4AYFB 1XZ0A 3NCJL 4KQ4L 4WTWA 2NCMA 3V6FB 3QPXH 5C9KA 1L0XA 1NBZA 1MPAH 2AEOA 4LFHD 3VWKA 5ECJE 3O6LL 4NO5B 3BZ4B 2R0WH 5FUOH 2HLFD 2W59A 2GITB 4ACTA 5L88L 3D50A 4PI2A 2M83A 1OM9A 3UTZA 1TZAA 3FB7B 4GAGH 3I9GL 5F89B 4DQOL 1GYAA 3EF7A 2YWZA 3P77B 1SJVA 4G2AA 5SV4A 5HHOD 3FU7A 2H8PA 2VLKB 4C59B 1ZV5A 3PGFL 1KLFB 3NPSB 2E9GA 5IROA 5A6LA 2NY0B 5IUCA 3ZO0A 2OMUA 4DEPB 1WFOA 3CDYA 4NC1C 3K6IA 3IXAB 1NH6A 2WINA 3M1BA 4G71B 3QQ9D 3VCLA 4CVZA 1PZ3A 3K2UL 1MWAL 4G5ZL 4ZOEA 3D9AH 3W2DL 3J27A 3O2WH 2HLEB 1BBJB 4NQVB 4YO0B 1UH3A 1EHLL 3KPMA 3TO4D 2XFGB 3WFBH 3HBPA 5HVGB 1PZAA 1NGXA 2VLKA 2WTPA 4YWGH 1X5KA 2FZ3B 3ESMA 2JH2A 4NQSB 4Y9BA 3MRFB 2CO4A 2H0EA 3S3JA 4HWEL 1QUNB 2XA8H 2O5YH 3QNZA 4S1RL 3MV8E 1FGNH 2VT0A 4P2QD 1KGIA 1P69B 3J2PA 3T0DA 4UM9D 4UTAA 3D0VB 3EJZD 4M48H 4L23A 1MVUA 2C1PB 4BSVA 5I2IA 2B4CC 2XTJC 4XMVA 3B3IA 4NGHH 2YPLE 4Z5RB 3PL6C 3WKML 3UYPA 1BA9A 4TVPE 4NDMB 5A2BA 4WO4D 1HHHA 4GIAA 1QHOA 3JTBA 3HG3A 3HAEA 3QPQD 2WQWA 3MUZ1 2CJUH 4EDWL 1V8HA 3POHA 3H2QA 2H3KA 5I16A 4PJBB 5IW6B 1MIEH 4UBDD 1R24B 1FG2A 2GSGA 1AGCA 1GS7A 3LKPB 2NNRA 4X6EA 4UQ3A 1KJVA 3WN5B 1UKSA 3QISA 2FX9L 2NR6D 4WNQA 3QUZA 2QELA 4EI6A 4NN7C 1QEXA 1XBDA 4XT1C 3ROLB 3OR6B 4FI6A 4RWYH 4WHYG 2EYTA 3L13A 1HNYA 1R3LB 3P1VA 1AZRA 5LG1A 2VDKH 4JFOB 4GRLC 3CU1A 1G0XA 5FB8A 1KB5H 4K9JA 4JGMA 3KNBB 5D1XB 4CKQA 3C5XA 1TZHA 2MCAA 4P23D 2HFTA 3UZVB 5I8OL 1A1MB 2PLTA 3V6ZA 1NDTA 1Q0YH 1JTTA 3ZE2B 2X1WL 4ZMZA 4FFVC 5DJAA 5JPMC 2AJZA 4G83A 3KLDA 5J13B 5TGBA 1UKQA 3OL2A 3GB7A 1LP9E 1OTSC 2P9RA 2NYKA 2A77H 2FL5A 2EINB 3AT0A 4G3YL 4W9HC 4KKCD 1IGFL 1CR9L 2DQEH 1UGKA 3WHE0 1NGYA 1Q94B 4PJIF 4QRRE 5JHMA 1ZLVH 1KJ2H 2GJ6D 4N2LA 1LQSR 4C55A 2X89A 1YJDC 4D9LL 5AALA 3N40P 2ORBH 1JFQL 1WVZA 1NCGA 4LCWA 5LJYH 3I9AA 3QEGL 3MRPA 3SJVD 1U8MB 2VRKA 1SXBA 4AIZB 1KTDB 4HIHB 3QEHA 4PLOB 1S7QB 3P0VH 3O4LD 5BPPA 4AQ1C 2ZP0T 3R19A 3ECBB 1QW8A 1P1ZB 4ATTA 3NIFF 3GIZH 3MV8A 5C2BH 3H9SD 4X5WB 3MKKA 3RIFF 4JDEA 1QRNE 2YEZB 1MHEA 1HCVA 4I18B 5BRZA 2DQHL 4H7VA 1FL6B 2Y25A 2CDGB 4AIZA 5GGTA 2WY3B 4WO4C 1M71B 2R27A 2H1XA 1G9ML 3QNXA 4JG5A 4M6ML 1P5UA 4MCZB 5ACZB 1ZV9A 5EU5A 2AJVH 1QFWM 1PZSA 5DYFA 2Y2YA 5D5MA 1TU2B 1KDIA 3OKEB 3VFUB 3BUQA 1E8XA 1H15B 2ALAA 3W39A 4U0RB 1UWXH 5E94A 3VGEA 1M2VB 2JB5L 1CXIA 5AW7B 3QJHB 1CBJA 1I1RA 1QBLH 2VRQA 2RBLA 3VXRA 1O7DC 3IMRA 1PKQE 3TIDB 4NKOB 2ZWKA 5GS1A 3HZVA 4X0NA 5DFTA 1EXUA 3I9IA 4JDVB 5IB1B 1D5IL 2HX8A 4M5ZL 3T4AB 1B0IA 1AJ7L 2VDPL 1G4MA 3ZDYF 4L8SB 3T2NL 1BCIA 1PYWB 1RIUH 4KAQH 4LCVA 1MWAA 4NC0B 3QPXL 3ZTJG 1CT8B 1KUMA 4QTHB 3MBWA 4LDOB 4PLKC 4PJFA 4OZGA 3ELAT 4YEEA 4JANB 3ZKND 5HHPB 1R19A 4GRWB 5M94B 3GSOA 5GRWA 2WXGA 1J0KA 2ARJB 4PIBA 5HJ3A 3VXQA 4CKVX 2ICES 3LNEA 5IQLA 4IMKC 3HFML 4D2NA 1KJMA 1U8CA 1ZS8B 2F68X 3ZYOA 3ZDXB 3PY9A 4BA8A 2OZNA 2Q1EA 3KM2A 3DURA 4X8JB 1IE4A 2KT6A 2YZ1A 2CLVB 4CU8A 3LZLA 4H5SA 4N6RA 4YXLH 2V5TA 3S5LG 4PJHF 5C0CA 5I1EH 3S35L 1VCAA 3AQZA 4QHLA 4F7CA 2XQYG 2DEWX 2EADA 2ZX8A 3A6OA 5C09D 1BFOB 4HJ1A 5AOKA 4G8GB 2AXJA 4S0SD 4AC2A 1QSFA 4P99A 2QVKA 1JPFB 4J3VA 4TLKA 4JRXB 5JDSB 1YSOA 4QAWA 1N64H 1O6VA 3NSJA 4U33A 3KGSA 4JQXC 5CSGA 4C4KO 4LBEA 4M62H 2EDYA 4IOIA 3LZFH 5HJGA 3GBNH 3UTZB 4WWOA 1IV8A 2WWNA 4WI8A 4A37A 5FO8A 4EDWH 3FQ4A 2X4PA 1R4XA 2BIHA 2J8UF 2W80C 1QVOA 1PJ9A 2K3HA 4JUTA 5CLYA 1N2RA 4UV7L 1MLCA 2E7DA 1A14L 1ZS2A 2IWGA 2QZQA 2H6OA 2WBWB 2P4AB 2X28A 3MLZH 4AYBA 4XNMB 5CBEB 4IHOA 4NDMA 3O4OC 4QJ4B 1IGIL 2AFNA 1UM5H 3S4SA 4XPTL 4HPOH 2Y5TB 4YDKL 2FYYB 4OCSL 4GW1B 4XXWA 4AX3A 5AVQB 3RVWC 5ANHA 4G3YH 1IGJA 1XR8A 2Y36L 3BQUB 1IGFH 4K15A 1K4DA 3QEQE 1FO0L 4GG8B 4X7SL 1U41A 2FJSA 3AJ7A 5D7IF 3UX9B 3VD4A 3D30A 4Y16D 1HHGA 1P84K 3UO1H 4FA8A 1MDTA 3PFQA 1B0WA 2IADA 3KPQB 2BHYA 1XHHA 1BM3H 3DV4B 3DXAE 4YGAB 3MZTA 4L8BB 3L6FA 5DK2A 5F7HA 4PGDA 3VFSB 1GGIL 1QSEB 3MREB 4H26B 4Q9RH 1CICB 2AC0A 3QG6A 4JHWH 3WY3A 3MV9B 1YNKH 3LB6C 2GVYA 3UTSB 3VE0B 1URIA 1CJYA 2EDOA 1NGPH 1MJ8L 4HLZH 1EEQA 1F8TH 3DO4A 3KHQA 4NO2B 3PNWA 4RQQB 3S5ZA 2G4GA 2I07A 1LLAA 2JKSA 4IHBA 4KOBA 4MNQA 5DK0B 5GPRA 4CW1A 1HTYA 5IQ7L 3CFDA 4HS3B 4E41D 5BZZA 1U33A 2EYTB 4AZ8A 1ROCA 1SJMA 1FZJA 2EDTA 3QXDB 1KFAH 2QVIA 3TNNB 2ERJC 2FLRT 3IS0X 5EOCJ 1XF4B 1N5AA 5GGSB 5ADPH 4Z18A 2WBJC 1CG9B 2Q6WB 1CE6A 1U0QA 3IGAB 2QMKA 3MJ8B 3NCJH 2FYVA 2Q7NA 4LO9A 4KKQA 5D70H 1CGXA 3VM5A 2ENJA 5DQDH 2PPDA 1AGEA 2RMNA 3O41A 1Z5LA 2WGNB 1JS4A 3TEUA 5F7BA 4Z7WA 4FJZA 4JNXA 3O3EB 4Q6IC 3S36L 5GZNC 3ARGC 3FOMB 3HI6H 4GAJL 5BRZD 4JRYE 2R4RL 1G43A 5A2FA 3V4VB 1H0DB 1KTLA 2CBTA 2KH2B 2TAAA 3QIBD 1IAIH 1WSST 4J3UA 1T0PB 2DICA 2NY2C 4Y1AD 4U7KA 3JWNG 4LMQE 4B60A 2DBJA 5I1CL 2WVVA 5C0AB 2F5AH 1D5IH 4M5ZH 3GSNL 2EUVA 2CRYA 1FV1A 2BNRA 3KYKH 3UBXB 4G7VH 2EDLA 4H8PA 4LSUL 5F7LB 1NAMB 3WAKA 3WY2A 3K7UA 3SDCD 1DJZA 2FJFA 4GPVA 3WIIH 3LIUA 4XP6L 1LWHA 3QCTL 7PAZA 5L4JA 2X4QA 2FWLB 4YHIB 3WEMA 2IPTH 4QRTA 3DJZA 2C1OA 3L7EB 5I6XB 4XCCL 1NEZA 4NKOA 4O00A 4C56A 1ZLWK 3IBOA 3VXUD 4BM7A 4BZYA 1IGML 5CFAA 2Z8SA 3F7VB 2LOEA 4WTQA 3VCLB 4BUQA 2G3MA 1QFWL 4LVOC 4W6XB 1PD1A 5I1AB 4J3OF 1AVAA 1JWSA 2OTUA 1ZSHA 3IJEA 1AGBB 4MVBD 1K2DA 1KIUB 1HOCB 2W60B 3OPZH 2H6PA 1S9VB 2EH7L 2PCPB 2OJ1A 1J05A 4JFWA 2A74C 5E03A 5JIDA 2EIZA 4UT6A 2X2YA 4I5BA 3MRIA 4ZPTB 1RZFL 3CN4A 4A04A 2NXYD 3WAJA 1JPEA 2FSDA 1KCVL 4XPFH 4PJXA 3LQAC 2AJSL 2OTPA 3PWJA 5F93C 4FZEH 2DH2A 4K9EH 3DRTA 4LSVL 3QZLA 3HG1B 5CIPB 5KYUA 1BP3B 3QIUC 1TZOA 4KMTH 5E1QA 1MRFH 2XIIA 3KGRA 3FCGA 3NTCL 4DZBB 1KIUA 2X70A 3G3LA 4OGXL 5D7JD 2G9HB 3MA9L 2AEPL 4M1DL 3GJEB 4FQ2H 3ZDXE 3CPLA 1OCWH 1BIIA 2NOYA 4GYBA 1IO4C 3MR9A 5BJTB 1KWKA 2FSEA 4JPWL 3U0PB 3VXSE 1EHNA 2CQVA 2Y07L 3HPLB 1H5BA 1QHQA 3HS0A 4FFYA 3K4DA 4JKPH 4DCQA 1TMQA 1OTSD 2FBRA 4H1LA 4GP5B 3ZDZB 4XGZA 5MHSD 4M7JL 4HJ0D 3FT2B 2O5XL 1KPRA 4UTCA 2P5WB 2BZCA 5HHQB 3G5YA 1QI3A 3EJTA 4BUGA 1EAPA 1TNMA 2VCOA 4XNUH 5I1CH 2BRRL 3QDHA 1BM3L 1GYCA 2R69A 4RIRB 1DBJH 3P2TA 4Y4KA 4NZTL 3EH3B 3H9YA 3QWOB 3VFGH 4TVUA 3PP4L 2F5BL 2YD9A 1J48A 3HR5B 1G7LB 5I30L 1FFOB 4NZRH 4Q9RL 2BXYA 2UWEB 4PTUB 3DECA 4BFRA 3FT0A 1U8LB 5MP6H 1MUJB 1QFHA 5F2FA 1ND0B 2L3BA 4LDCA 3AXLB 5AW2B 4QJ5B 2BZ7A 1ZGLM 5F0LB 3RWHA 1B9ZA 5GQBA 2H9GA 3IXTA 4ZMWA 3KDMA 5CKGA 1S3RA 2X0UA 3QZMA 4A55A 4B9PA 3B2DC 5HD8C 2DQMA 3FZUC 2KZ1B 4U6HA 3SKJL 1UG9A 3JWDL 1HVXA 2IH1A 3IJ9A 2WLYA 2DBLL 4YHMH 1QWNA 2X4UA 3FDWA 5JOPD 2YAMA 2EDEA 3IDYB 3U9WA 1ZEAH 4N9GA 4ZPVA 3BCDA 2LW3A 4Y9GA 4YGVB 5FOBA 4AJYV 2DTMH 1JV2A 2VR7A 3HZMA 2Z91B 4V33A 1I1AB 2H9GB 3IXTB 4I0PD 5SWSB 1MW3A 6TAAA 5E9DB 2VMJA 1AC0A 2DIBA 2UZYA 3MGTA 1UJTA 3TBYA 2NY6D 4ZD3H 3L3DB 3NYKA 4PP2B 3TBWA 5F9OH 3V6BR 3G6DH 4MA3A 4NCC1 4P48A 3G5VA 5C08E 4A2DA 3ZT7A 3PQYD 3KYAA 1CU4H 2VDQB 4O5LL 4WRLA 5DLLA 4TNFA 3DV6B 3BT2L 3N42F 3TN0A 1EXHA 4H25A 2JQZA 1FIEA 2D0FA 5L4IA 2QKIA 4KH9A 5L2KE 3E38A 1J5OL 1FH2A 4DGIL 2ICWJ 4G7VL 2YEVB 2VB5A 4JFVA 2A9NH 4J8RA 5TQ2H 4XHJC 4MQ7B 2KLTA 1TT6A 4B96A 4X2UA 2XV2A 3UBXG 2GITA 1I85A 1FPTL 1TVBA 4OCWH 4LAQL 3GTVA 2FAUA 4P57B 4E2OA 2ZAHA 4A6YL 3CHOA 1S9XA 2VN3A 3HI6L 4GAJH 2JKWA 3G08B 4GBXD 3T0XA 3EJCA 3P77A 4J3OC 4U3SB 4F7PA 2EE0A 4ATWA 2WN3A 4YHLH 1NC4D 2JTYA 3BAJA 1QWUA 5H94B 3U7YH 1KBBA 1DBJL 2MJWA 4POZD 4GRMB 4NO3B 5HGBA 4XMTA 2V3FA 4PJ8A 4QWWC 4XCEB 1U91A 3BN3B 1P4UA 3GXMA 2B0SL 2QADB 3OJDB 4FN0A 1QR1A 4FE9A 4JB9L 1XF4A 1IQDA 5D2NA 4K7FA 1YG9A 4NQVA 3EUDA 2D03H 1IGTB 3LSOB 1TJHL 5TDPB 1RZGB 2VR4A 3HNSL 3RWIA 1HZKA 4R3SB 2A74A 5CEYB 2AQQA 3O2VH 1D5BB 1KTBA 5HDQL 4PWJA 1NDMB 3VDCA 4IU2A 1U92B 2J8OA 2GG1A 4YL4A 1KLFA 3HEIB 4RLDA 2BOCB 3QARA 2MNUA 2IANA 1U9KA 2WQAA 3GBNL 4IJ3C 4NQDB 4O9HL 4CUCA 3RGHA 5JIHA 5D7IE 2BRQA 3BQUD 5HHVL 3V8OA 3GSWB 1MRFL 2IWFA 2DLGA 3KLQA 1SNRA 2Z31B 5KVFH 1MXGA 3C5ZA 2BNQA 2BX5A 4P2OB 5D7LD 1JHTB 2ITEA 4NZDA 4IKIA 1K72A 4O02B 4PJEB 5LLIC 2WIIB 1CXHA 4EZLA 2ZUQC 4PJ8C 1JK9A 5E6IA 3KH4A 3AITA 3S2AA 3ZQ9A 5SX5K 5E6SB 3EDKA 4HAGA 5C7XL 1YMMB 4LLAA 1G7HB 4UNIA 5DJ6A 4OGXH 4KQ3H 4BKTC 3MRBA 5LBVA 3VX0A 3BCFA 3GRBA 3QRGL 2BS9A 2F18A 3IMTA 12E8H 1T1ZB 1WFJA 3C5SA 4ODXA 5D1QE 2O1AA 4DESA 2IAAC 1ET5A 4K7PL 1CFQA 1EGJL 3EBHA 3UZVA 1RPKA 3Q6GH 4PJGB 4KX8A 4JKPL 3GZKA 3GUTA 4KVNL 2WV3A 4KV5E 1N0LB 3V8CA 2E7MA 4AQ8C 1E4XL 2XACC 1CBVH 3K0WA 4PRAA 4PJCF 3L3OA 4U6XA 1ECZA 3TOPA 4K55A 3ZKMC 4D7PA 2GIYA 3QIBA 4LPUA 1JIBA 4PHXA 3TEXA 2P7TB 5JXED 3VXME 2KLSA 1MEXL 5F7EL 4HS6B 5B8CB 2ZZUT 4BFEA 1GL4B 4I0CC 5GS0C 3VWKC 1Y6KR 3CDFA 1FSKB 3QQDA 1RJCA 3ZZQA 4OZFH 4U7SA 3H7BB 3SDAB 4TSCL 1T0MA 5FK9A 3S4SG 3KVPA 3TFKC 2MNJB 4HETA 4H8WL 5TTRA 4KKLC 2BP8A 2C3XA 5LN8A 4U3HA 2MPAH 2D9CA 4Q4IA 1R3IH 4M8QA 3PWNA 2E5EA 4FF9A 1V7NL 3ZRFC 2MTAA 3SCMC 2WD0A 2CMRH 1U8PB 3MFFB 2IGFL 4LOVA 2ISDA 1YJDL 3GEFA 3L1GA 4ZSOB 1HCYA 4BWTA 4L0PB 1N3NB 4P5RA 5AVSB 3U46A 2X44D 2N3JA 3DBXA 5CINH 3IJHA 4FXTA 1XGRA 5C8JA 5AAWC 4G59C 3SQOH 4M8QB 1XTLA 3ARDA 2IWEA 4HXBH 1IAMA 3NQKA 3NH7L 5K1JA 3TNMB 1Y0LB 2PO6C 4ZFGH 1G7IB 2FX7H 1GZHA 4X7TB 3WXVH 1L9PA 1AZBA 1TQVA 2OR8A 2W65A 2PW2B 3IGFA 4HYTB 5I74C 1AS6A 1XGTA 4KQ3L 2DQIH 3RP1A 1HILA 1S7SA 2IMNA 3A22A 2RIKA 2GEQA 1A6ZB 5GGVY 4NRZB 1FIGL 3BP6A 3FUEA 1KXHA 4AXWB 4AWJC 3LNDA 2D0HA 4O2EB 2ADYA 1XGUA 3RZCD 3GMQB 3LEXB 3KPRA 4XNDA 4GRLD 2OR9H 2XN1A 4K2UL 1AE6L 3GQFA 5KSUB 1UEYA 5D9SA 5CR8A 3SKOB 2PW2A 2X4RB 3RDTA 1GTNA 2J4WH 1J1XL 4L4TE 4PWKA 3V6FA 4NWUL 4Y2LA 4DP8X 2V2XB 3M1BB 2FSEB 2WB1A 2XBZA 3EYVB 4E0RB 1LEKB 3II1A 5DVNA 3JBG7 3BT0A 3IT8D 2PTTA 4HIXH 3SY6A 4Z23A 2MOVA 2WLHA 5TE4H 4ORZC 2CD0A 1CD0A 5M7QA 4H2CA 4GXVH 4J2XA 3QUXC 3MV7D 1G7PB 1Y18B 4TL5A 3OKDB 3VFOA 1QACA 1AAJA 3VSQA 3WIHA 3O2VL 1ZGLA 1MCBA 3MTRA 3N40F 4M48L 4HALA 5T1DH 2BCKA 2APSA 2JMRA 4K0OA 2VERA 1OZUA 2A4ZA 5AOIA 3SKNB 5AOLA 4UQ2B 2YAEA 3KWTA 4WI4A 2GTZA 2IQAB 4WU7A 4YDVB 3RWGB 4PGZA 3HRZA 4GP4B 4PJHB 1PEWA 3ZDXF 1H6EA 4LSPL 4I13B 3WMQA 3EO9H 1ZT1B 2P49B 3X2QB 1ZT7B 5DJXA 2A6DB 4JFPA 3ZRCC 3K8LA 3DGGB 5ID0B 1QSEE 1FI8C 1A5FH 3RGBA 5FYJL 3DX7A 3VQMA 2VDPH 1FNEA 2Q76B 3D7PA 1UXSA 1K3IA 2KMWA 1UZGA 1WUZA 1S7UB 4OT1L 4I2XE 4S0HA 2FE0A 3SBWC 4OUUA 4B9ZA 1ASQA 4QAMB 3Q6GL 4IDJH 3OPUA 1OF2A 4NQDD 4PWHA 2EXSA 1CYXA 5FS5A 4X0KB 2Q8BH 1KPRB 2FO1A 1TQCC 3CHXA 3FCTA 2ZOKB 1SF3A 4L9LA 5DGRA 1XCTA 4MB3A 3MLSH 3X1GA 1F3JA 1ACZA 4YE4L 5TF1H 1BZ8A 4GY4A 1GSMA 1KB5L 3HI5H 2AJUH 5GZNA 1UQSA 4Q4EA 4U1GB 3RZCC 3WJJA 2P1YA 3GPSA 1CLOL 1E27A 1ZA3A 3GBML 1TIUA 2F7QA 2DY2A 5GGQH 4CC1A 5JOPE 4OLWL 4YIQB 5EC1A 2X9ZA 3ARSA 2XYCA 3RL2A 2CO3A 5J3HD 1XB6A 4NLAA 1AE6H 4QRQA 1L9RA 4Y4KC 2CJTA 2EDNA 1ZLVK 5IKCB 2OSWA 1G9HA 3QIWB 2L7UA 3QIBC 4R5VA 1QNZH 4BSJA 5FFGA 5CBAA 1R46A 1CI3M 5GS2D 3BPLB 3R4DA 3B3IB 1NCCH 1OAXL 2ED9A 3ZVVA 4DVRH 3T0ED 5FUCC 3WOVA 2BSCA 2HUHA 3GXNA 4UIKH 3OD3A 5BVPH 3VFTB 1DANU 1SYVA 3AUVA 4RAUB 3CFTA 3NIGF 3GMLB 1P2CA 1OSYA 2Z4QA 2KZBA 3PNWB 4RQQA 4DETA 1D2OA 1JYXA 4P4KA 4CW1B 2A7BA 1JF5A 5DJ8A 2IALB 1SUHA 2QGCA 5D7KE 2ZYIA 2IH3B 2VLMD 3ZR5A 1AD0B 4HHWA 2PXYC 5KSBA 1UOVA 1J86A 1XAUA 1E4KA 4QRUB 1NGQH 3IDIB 4N2AA 1CIUA 1F4WH 3E0GA 3IK2A 5D5MF 2VDNL 3WXVL 1HAWA 2Z34A 5F1KC 1N12A 4OKDA 4Y4HC 3WD5H 4KI5F 5C0GA 1BMWA 5DJYB 5D7SL 3UG5A 4I0KA 5J57B 2X0VA 1MLBA 3VRLE 2X4OA 3ME0B 2NZ1A 3G04A 3LAFA 5HYJD 2OBGA 2GBAA 3CQPA 1J0IA 2BFVL 3MN8A 1HIMH 4XC1L 3FU6A 3G5WA 4R0LC 4DNLA 4HOMA 2H3NA 3BXNA 2CG9X 2DEXX 3BIKA 4A6YH 3EFOA 2E47A 4LF3B 5ESVB 3MRJB 4I18A 4XNZB 4G9DB 5I6MA 1GW6A 1A2YB 1ORSA 4W1TA 1S9XB 5D1ZA 5ISZE 1FZKA 5HI4D 4OY9A 1Q4NX 2TRHA 4NKMB 4MRCA 1RSYA 2YPLA 4FXKB 3UG4A 2AEWA 4JPVL 4D8PA 3BGFB 3CMOL 1PKQB 1U8NA 2WO3B 1RUKH 2RFXA 3V6OE 1QEWA 2Z6FA 3OGCA 1KXVA 2CO7B 4M3HA 4MDRA 1SY6L 3WFZA 1LVEA 1AO7E 1KBWA 5GIRB 1H6FA 2ZX5A 4JFSA 3UTTA 1W0WA 2VZUA 4ABWA 4RAHA 4XN8A 1K8IA 2HPTA 1TJHH 4H20H 4NQQA 5AW5B 4IJ3B 3ARBA 5DRXA 4NQCD 2ENYA 2VXSL 2A6IB 4KRPB 1J8KA 1AKJB 1GAFL 4CVXB 1DSFL 1CGTA 2Y69B 3UBXA 4JO2L 1TJMA 2BVOB 4ELME 5DI8A 3ARVA 1NPUA 1B0RB 1M7DA 2JWYA 3AB0C 3P0YL 1AQKL 1VFAB 4QTHA 5E24E 2NCEA 3VD1A 2A99A 1XX9C 5AUMB 1QSFB 2XQBL 3EJYD 3FFCA 4MWFA 3LPPA 5FA4A 3LN4A 4PD4K 1J0JA 4GKLA 4Q0XH 3ELQA 4UV7H 3TBVB 5AG9A 5KSVB 5L9DH 4H88L 2Y7SA 3U25A 2NUTA 4HKZB 5KSBF 3ZL2A 3ZR6A 3RDJA 5IW1B 3II2A 4MTMA 2ITDB 3AREA 4AY0A 5MEQA 3ARFA 3ARGD 3IRCA 1JZ6A 1R3HB 4H5SB 4EI5B 2VM3A 3GXUB 3H42H 5C0FB 3GI9H 4MZIA 4MA1C 4X6FB 2BDNH 4JCLA 4ZFZB 2A1WH 3TBTA 2WUCL 3IFLL 3VXTA 1ZHLA 2BJMH 2J7LA 1CD9B 3MLRH 4HUUB 4B0MM 4KMLB 5A16A 5C86A 3RVXD 3U30B 2X9WA 1WIPA 1N6VA 2J8UB 3HNVL 3UC0L 5D7SH 1E8YA 5EIIA 4M29A 4LHUB 4XP6H 1VEMA 3UJTH 3MPCA 1N8OE 2NYYC 4L1TA 3K1DA 4DVBA 4QHUB 5CCKL 2Q8BL 3N5AA 4LT7A 2JB6B 3N42B 4YXKL 4XO4A 2WKGA 2XWEA 5GS3A 4PJ7E 1E5AA 3S96B 4N8VA 4XVUC 1WAPA 3C6LB 3OC8A 2D7TL 4UV4H 5C6TL 1OWWA 4KTEL 4AVIA 2OCJA 2CJ3A 2D4FA 2AQ2A 1QFOA 4UQDA 4EXKA 4ZMTA 5JR1L 1NUDA 4AVHA 4FNRA 3QG7H 2CK0L 2OMVA 1IC4H 4FNUA 3WNMA 3RIKA 3AQDA 3T6VA 3OJVC 1MAML 3IFNH 2IXQA 2RCSH 4LSRH 4PMEA 5HVHC 1A4BA 3KCPB 4LCCA 4X4ME 4U1JB 3DV4A 3EDDA 3FTYA 1N0XL 2WIMA 4M7KH 3ZL1A 3CAFA 1RZFH 1S6NA 3F85A 4KROB 5DZLA 4M43H 5FO7A 4ILDA 5SX4I 2B39A 1OP5H 4F2EA 4EN3C 2JKIS 4AG4H 2HVJA 4K9EL 3T6WA 1CLVA 1HDMA 1F8TL 1OB1A 4XWGH 2JFCA 1MCSA 1RL1A 2IWKA 1XO8A 1UACL 4XMZA 3SDCB 4EBQH 1T3FA 3UJIL 2X3AA 3IAPA 2WZPD 2YR3A 3IF1B 3D85D 2D31A 1QI5A 4G6ML 3L4YA 1FAKT 4JFDD 3QIWA 3H1ZA 1HWHB 1TPXB 3KPNB 3ECBA 2XWTA 2VAAA 1L7TH 4P8QA 4NPJA 4ONFH 4XB7A 2YLKA 1MOEA 3CDZB 1KLGB 3PS6A 3VYPA 1OE2A 5KYWA 2X9XA 3LV3B 3QAZC 3FHQA 5KS9E 5GSRA 1N6QL 2ZXDA 3FF7A 3GSQB 3MJWA 2J73A 4XRCB 1CG9A 3CQFA 4PV8B 1CVRA 4DWHA 2WXIA 2BNRD 7FABL 3BAWA 5MENE 3MRRA 4OZ4A 3CSYB 4M7JH 1ZDQA 4MA7H 4OW6A 5TQ0L 2DKUA 1OOAA 1RV6X 1U58B 2LGNA 3BWUC 4URKA 4R5TA 3WLBB 3QXUA 1MH5A 5D8JL 5DZVA 3K72B 5HHPA 2CM5A 2IAND 2R2HA 3IMSA 3ULSB 5HPOA 3DUUB 2QHRH 5HYSA 1AO7D 4KITB 2F8OA 4L0ZA 3W82A 1O9WA 2VC2B 3DPBA 5DUML 3V95A 2JELL 1KB9J 2F61A 4WI6A 5J89A 4E68A 3CMOH 2QKSA 3TBCA 2DWDA 3K6OA 3C6LC 1A7NL 3FT3B 5F70A 4PBDA 2K7PA 5BV7L 3FCSB 5E5RB 5ALBL 2LQRA 1JPST 2H2PD 3ECVA 4LHJB 3WLBA 4BGLA 5M95B 4MMYB 3NESA 4G1EB 1YMHA 3QQ4B 1S3KL 4Q2ZA 4OGAC 4MXVE 4FXGC 4L5FE 3NQIA 5LQBL 1ASOA 1J8HA 5LNDA 1ZIAA 3FB5A 4D9QE 1W8OA 1VGKB 1U91B 1MAMH 3FQXB 3IFNL 4Y5VC 5D7JC 3DX7B 1VKXA 4APXA 2W91A 5HJ3B 3VXQB 3ULVL 1A6VL 1RJYA 4WI0A 5D96B 3FFOA 1J8SA 3HE7B 3O6ML 1RJZA 1BX2B 3U0TB 1UD8A 1ZAGA 1DP0A 5JORB 4GW4B 2OSXA 5EWIL 4Z76B 3BVTA 4OGZA 2X3BA 3CK0L 1C5BL 1I31A 4F2FA 3L4VA 5J11C 1EBPA 2G3NA 3FT9A 2DQGH 3QNZB 4OKVB 4QRPA 1CK0L 1LJMA 4WK0B 3NCCB 2OMTA 4DUXA 3QUHA 5I6XC 1QD0A 1B0GB 3QCVL 1OCWL 2F19H 3D3VB 2Q87A 1T7WA 4PU2A 5I18L 3A5VA 4Q6IA 4X99B 4IOIB 5KBLA 4ZW7A 3AS3A 4OFVA 5DJDB 5GHWH 1GVIA 3ZZSA 4UAOC 1OANA 2MKWA 2VQ1A 3FUKA 4KNQA 3DROB 1V3LA 2J6EH 3MJ6A 1NFAA 2P8PB 1PFOA 2AJZB 3L48A 3I3EA 1YEHL 3MRMA 3VYOA 2M26A 5DWPA 3M07A 5IP4A 2NY2B 6PCYA 2C5DC 4ODWA 5L7XH 1BOYA 5GRZA 2JQAA 5TH2B 1EHAA 3DBSA 2OQJA 1R0AL 1JNJA 1MJUH 1MY5A 3DA0A 2NT0A 3TH2T 4JFYB 5EU3A 5AW3B 3DVGA 3RAJL 3H7LA 3T4YA 3JV6B 4H0HB 1XR9B 1AKJA 1NSNL 3DTDA 4XCYA 4CVXA 3O6FB 3O3AB 2AXHA 4TVSa 4MAYC 5DMKA 1FVCA 3RVVC 1BLNB 3F7QA 2ZXAA 2IV8A 4JJHA 2OI9C 2R1WB 5IESH 3V55A 4X6DE 2NY7H 1C16A 1J05B 1HU8A 1KB5B 3WN6A 1MCNA 1GKOA 4Y5YB 4QRAA 4ZBJA 2ITFA 2VDKB 2ZIDA 5IHUH 3L5IA 3CZGA 4YVUA 2O5NA 4U31A 2F2HA 5DZPA 1TJGL 4TPRH 5DYOB 5E9DD 5ESQB 1M7UA 3GRWA 2IV9A 4GRLA 3FYEB 2QPDB 4O9HH 1H8NA 2ZNXA 4BK4A 3TO2A 2CR0A 2UX7A 1MW0A 1UCBH 3N41F 3NSFA 4JS7A 4K8RC 4K5NA 4G6KL 3QDJD 4PH8A 3MV7B 2PR4H 4XE5B 4ZZFA 1LE9A 1ACYL 1DVXA 4PREA 2RGSA 3Q43A 4DEWA 3MKGA 4MA8H 4MB1A 4Q9QH 4N8CH 3X13B 3VFUA 1V3JA 3KBFA 5D2LA 1CDYA 5JIIA 3FFCD 4ZW8A 1OGTA 4DEUA 1FO0B 1SYSA 3P4NB 4GQQA 3PL6D 3O6KH 4BCYA 1RIVL 1E4XI 3WD5L 2FATH 4KDTA 2AI0H 4WEUD 4UDUA 1W0WB 4OF7A 4RGNE 3HC0B 3TBWB 3ZU8A 3L4ZA 2YJQA 1UURA 4H13C 4KO6A 4QY8B 2OZ4H 1KXTB 2FH8A 3WUWA 3AROA 4D0DB 1TDQA 4Y4KB 3KMDA 4LEXH 1VENA 2X7LA 3IJSA 3BJ91 4GEJA 4NUPA 5B38G 3HOGA 4WFFE 3ZGIA 2CNZA 5BW7C 4JFUA 1WCBA 4Z0BL 2YK1H 4WUUA 4IGBC 4ZMYA 5HYJE 4QXTB 5DHEA 3VJ6B 3PWLA 5TQ2L 4JPVH 3MNMA 2NX5E 2BSTB 3QEQD 2YGPA 4MD5B 5L2KB 1MI5A 1I8IA 4PRPD 1T2XA 3FHAA 5DHVH 1KPUB 3UTTE 4YO0A 3WELA 4WDIB 1VESA 4IRZH 3O0RL 4BINA 2AXGB 1E6JH 4NNYB 4Y2OB 4X9HA 5CGTA 3D18B 4XAKE 1FA4A 1S5HA 1KGCE 1OCRB 4BBWA 3GZPA 3FSOA 3FFDA 3ILDA 1M7XA 2ZG1A 2WKOF 3CZJA 1TU2A 4XOBA 3KYOA 5FM5O 5CIPA 1X4ZA 4LIQH 3X3GL 2O61A 3VH8B 1QTYT 2MTPA 4JB9H 5IR1A 3ARXA 4KJWC 4P2OA 2D3NA 2G0LA 4R3SA 4X9YA 5KN5B 2DL9A 5IMMA 5IK3B 2H1LM 2HT3D 3QO1B 5C92A 5D1XD 3ZT5A 4CRPA 4XMUA 1IQWL 1PZBA 2F19L 4U1IB 2BOCA 2OMWA 1CGVA 2X1PA 1OP5K 1VAHA 5E23A 3FQYA 4M6OL 3LKPA 4LCIH 4Q74A 5HYIA 5IT2L 4JAMB 4XB3A 1DSWA 5HXMA 1FNFA 5FDWB 5I1GH 3UACA 1IX2A 4JQVC 4NUGH 1FP5A 1U93B 2K6WA 2UVFA 4GB9A 4AQZA 2IPKB 4NUJB 1XH0A 5D70L 1NCWH 2V37A 1D9KA 1F18A 1ZHLB 3GS7A 4WHYH 4TMPA 5FW7A 3NABL 4BHUI 4K23H 1OF0A 2VL5A 1WA2X 1JZFA 1H3PH 3F58H 3S36X 1NM4A 4ODHH 5CJXC 4K94C 3VGBA 4JFFB 3ETTA 5DC2A 4WHTB 1N5YL 3TGXA 5DLML 2DDQH 2YN3A 3SPIA 3GMPA 3WLWC 3TEZA 2Z7ZA 3F05A 3PAUA 4RVBA 1YDPA 1V54B 2NY7L 4U0RC 5HY9A 1N6UA 2GUOA 4AYEC 3L9YA 2CLZA 3OXSB 4ZQKA 4OZGF 3UTSE 1MFVA 3BYTA 1NLDH 4R2GB 1DBAH 3EGDB 2EE2A 3BLKA 4K7PH 3QXWA 2CH8A 4JN2A 3DGGA 1KJ2L 4KK5C 4ECNA 2OI9B 1SXSA 3E6HA 4V1DB 4KVNH 3QUYA 4B97A 2VOTA 5LN4A 1XMEB 4WI2A 3DJSA 3H3BC 3KPSD 2QQLH 4KC3B 1CTMA 4FNSA 4LHQB 5IHZB 5F1IB 3JUYA 1KEML 4H1LG 3BWAA 2NY4D 4GW5B 2AK4E 3U9PH 5DUJA 4UWQB 5EUKA 5HDBE 3QEUA 5K39A 1YN7A 4JM2B 5ID1B 1P7QD 3NBNA 2OS7A 1D5ZA 2NY1B 2K6YA 5EEZA 4BYHA 3KJ4C 4N8VG 2B1OA 4WGVB 2PMZA 4LLVB 15C8L 2GKIA 4BZ2A 2IGFH 4AV0A 1IKNA 4G80B 4B9CA 2BOLA 1CF1A 4HXBL 1SMDA 5DJ6B 2AJVL 3S88H 3QIUD 4IBQA 2VR3A 2IQ9H 3SDAC 1WAAA 4GW5A 1R3IL 2AZAA 4QHMA 1NOFA 1ANUA 1EUTA 4A7VA 3KPQA 3JXAA 5CINL 4G8IB 4L4TB 4X7FC 5FYLE 2ED6A 1W72A 4PBXA 5B8CC 3CDGB 2B1HL 1NLBH 3GXFA 5IGXL 3VFPA 1YYCA 4C47A 5I8CB 2KHAA 1UH4A 4YE0A 5AVYB 1U8IB 2YKKA 1J87A 3FTXA 4QXUL 4F3FA 4RMBA 3NJLA 2I7OA 2B5IB 3KEDA 3CXHJ 2QLVB 3LZNA 3ERXA 4Q8BA 4WUUD 4JPQA 2N59A 2W0FB 1I8LC 1AD9B 3VMOA 4HOWA 4HCGA 1X5FA 3ZO9A 3N9GL 1AD0A 3OZ9H 3OHXB 5CZXC 3ZQWA 4DPAX 4HK0B 4I1PA 4OI9A 3SDYH 2EYRA 3B2MA 3PWPE 5GJTL 4OF6A 4X5WA 4WWNA 4OT1H 3V4UH 1M2OA 5I1AA 3IPFA 4Y5VB 4MQTB 3D51A 4FDWA 4HS6A 4HUWB 3ILPB 3Q44A 3RGVB 3KLLA 1SEQL 1QATA 3MXWL 2J4WL 4FXGB 1IBHA 4UQEA 2WWKT 3PIQA 5LCVL 5DVLA 1I7UA 4B27A 1TF4A 2Z8WC 4LCUA 4JQIH 2A83B 4EDXB 4QT5A 1WBXA 4DN4L 2YGQA 2XTJB 4AH2A 3PWLB 2DOCA 2HRPL 4FEIA 2EQDA 3EH5B 4PJ8B 3RNKB 4M9PA 2Y06H 5IB4A 2P5WD 3INOA 3TV3L 4B9IA 4DGWC 4EJ1C 4EQ3A 5I1JL 3QNFA 4YMPA 1YNTB 1KEGH 1OAZL 1X4YA 2VABA 5E2VL 3L4XA 4M6NH 1G7PA 1Y18A 1JCVA 1FZKB 1J5HA 1EFXA 2E4FA 4XN4A 2Y72A 2PYEE 2CKBL 3HNTH 1FH5L 1FDLH 5EO1A 2AMUA 4QGYA 5CCJA 2VSKB 3X3GH 2LE9A 3ARED 1UM6L 2QDVA 3ENEA 3QCVH 2GTWA 1FVEA 1YRKA 3LKRB 4TVPH 3ZKSD 1T04B 3IU3B 1BVKB 3K8MA 2OTWA 3KPOB 3GS0A 3JT2A 2VJXA 3WNKA 2AEQL 2XC8A 1NCOA 3TZVA 5BS0E 1OQOA 3FQTA 4EI5A 1DVUA 2FO4A 2I24N 4ODVH 3V0EA 4W6WB 4Z7VF 2R4RH 4ZUVB 1CC3A 3LD8C 1S9WA 4HJGB 3QVAA 4X6CE 4NNYA 4ZMQA 4FQ1L 5ALCL 4EIUA 1FGVH 4OCYH 1R0AH 1RVFH 3BP5B 2YWYA 3VE0A 4TUOB 3I6LE 3CZFA 1BFOA 5T1LD 1MAKA 4G6AD 2XNAB 5MERA 4EN3B 1U95B 3JWOH 1II4E 1RUAL 3BDBA 1SY6H 3L3GB 2AXFB 2G75B 3U7WL 2C3VB 1YYLH 3AG4B 4OLUL 1YA5A 1JI2A 2LLLA 4H26A 4WUKH 4L2YA 2WP3T 4FQJH 3ZUCA 2KDGA 4X5PA 3FUFA 1YUHA 4JO3H 1WITA 3PHAA 1IGMH 1C16B 1Z3RA 2O30A 4FYSA 3GJFK 5MHSE 1RQ5A 4PJEE 4U1NA 2C9VA 1DDTA 3FTGA 3CFCH 2AW2A 2IG2L 2R1XB 4FQXA 3QXAB 4B9JA 3LH9A 2WSKA 4TNGA 2KC0A 2E0PA 2YD2A 4JFZL 4PJCA 3VDAA 1B2WL 2OL3A 3CLEH 3RTQD 1UD5A 3VFWA 4NRXB 4HWEH 5B39B 1JPTH 2XOTA 5AVVB 4M61B 2JLLA 1AG0A 2QTVA 2CR3A 1WO2A 2DWXA 1ACYH 3H6JA 4H8HA 4HEPA 3WE6A 5GGSA 3TJHC 4OZHE 3S7GA 3GPEA 2E7HA 3SDCA 1V27A 1NAKL 4Y9CA 3LPWA 4ZTOL 1KTRL 1B2YA 4QXGH 5ANMA 2AJYL 5HHOA 1EAPB 3OG4B 4ERSH 4KMTL 3CSPA 3F00A 1GAFH 1I75A 4OU3A 4X6BA 1FFPB 5IMOA 3GBDA 1CVSC 4FP8H 5EZOL 3MJ9A 4GSUA 4P2AA 2OMXB 3B1UA 3P4OA 4LGSB 1IVLA 4LLQA 2GCYB 3TM6A 5KS9A 5C08A 3CLFH 4UCFA 3QUYD 3QR0A 5FM4A 4NUQA 4XXWC 4AGNA 5HHOB 3MREA 3U4BL 4HV8B 3F7YB 1SEBB 3LEYL 2AJXH 4G6JL 3V7AE 1YAIA 1HEHC 2XPGB 3U46B 2ARWA 1B88A 2DLIA 1U8OB 1GGUA 3H56A 4JM4H 2PW1B 4IU3B 4LBAA 3EFFA 4M03A 1B4JH 2X4UB 4NM8H 1BQKA 1CGSH 5LCVA 3ULVE 1ZPLA 1K8DB 2P47B 4QMEA 5LXVA 4KRPC 4MNQD 1BSIA 3U6XA 1JERA 3PWJB 3MOBH 3SOTA 3GMRB 3VNYA 1CD1A 2P3YA 3LKSB 3IDGA 4OB5H 5JPNB 2EVIA 4J1UA 3QO0B 3FQ2A 1KZYA 1MHHB 1UXLA 2JLPA 2Z65C 1Z66A 3HKZA 1OTUD 4WHCA 4B5EA 1IAKA 3UJTL 5HHMB 3PWVB 3MLVH 5A6MA 4Z7UE 3EW3B 3SE4C 1T6VN 1S9VA 3ZL4L 1EIBA 3IJEB 3QUML 3LS4L 3NIFE 4R7NA 4N68A 2JV6A 4PJDF 3TFBA 3VRLF 4PBVC 4OJEH 3H3PH 4N1HB 5I17A 1PD6A 2HJLB 4LEOA 2E6PA 3P73B 4KI5E 3RX8A 4HUKB 1FZOA 1XGPB 4E41E 2BWDA 3NCYP 2VZOA 3MBWB 2WPGA 4NQDA 1RZPA 4CGTA 3AFLA 4ES9A 2WZ6A 1IKFH 4A38A 3D0VA 1SDDA 2PTVA 5I0WA 3P0YH 3O8XD 1EV2E 5FYLH 1SLWA 5BZXA 1YDPB 4IBUA 4UU9A 3VRJA 3AWEA 5TDPA 3ZX1A 4YSPA 3ZDYB 4GKZB 5L9DL 1IB5A 3IDNA 2ILLA 4I0PA 4BWUA 4AIOA 5LKNA 4R26H 4F5CA 1I9JL 2QQKL 3FO0H 4LPVA 4N0CC 4L3EA 3LN5B 1UJ3C 4G42B 3MR9B 3G6DL 1JOIA 2ZD0A 1DR9A 5DTFB 4MLSA 2IH8A 1HINH 1Z0MA 4KXZH 4C56E 3WFDH 3KWUA 2K45A 5TK4A 2TSAA 4JZNA 1H19A 1AHWC 3F58L 3HI1A 2B59A 4WI9A 1VERA 2WTRA 5IREA 4FKEA 4OCRL 2BERA 5I19H 1BV8A 2NXYC 3GFUA 1Q9KA 3N1QC 2YXFA 1JV5A 5IQ9B 4Z3EA 4R7DA 5JYMA 3K6NA 3C08H 3QG7L 3LZPA 1N18A 2PYEB 1WICA 4QF1A 4DK3A 4LAQH 4X4YA 3WUZA 1H6UA 3TZVD 1N59B 4WF7A 4MA7L 4B95C 2E7CA 3UC0H 3P54A 3R8QA 3UTQA 2KQMA 4MNGA 3SYOA 4PJ6A 4KHTH 3BPOB 5AZ2H 4OCMC 2D4DA 4WI3A 3I85A 5C07D 3QIWC 4P3DA 1FYTB 3U7AA 2DYPA 1XSOA 1JGLH 2ZOLB 35C8H 2XDHA 1XGYH 2H0PA 3P9LB 3VX1A 3NJGA 3PAZA 2BCMA 3TVMD 4PQXA 2XTJE 4FQQA 3GKZA 5JW3H 3C5ZB 4HCRH 2AKRB 5FX3A 1M71A 2UY7B 1CICA 4ZNCD 4W9EC 3RUGA 3MV9A 3T3ME 2EAEA 2JI3A 1WZ1L 3FRUA 5D2LF 5KSAB 3CFCL 2CPCA 2Q3ZA 1EVUA 1YN6B 2CDFA 1NINA 1TQCB 1KGYE 3AG2B 3AS2A 3HFMH 4QHUA 4N9GB 5C09E 4DN3L 1HHGB 2F6AA 4YDIL 4JJ5B 1S4IA 2VSMB 4P2OD 2WBJB 3G5ZA 2FECL 3KPTA 4L05A 3KW8A 5GRUL 1L4IA 3VI3B 2ERJB 4TVPD 4E42A 1YEDA 2FNBA 1F58L 3UIYA 3DHMA 3KL3A 4CMHB 1Q0EA 1EHXA 5DFVC 3VXTB 3DX8B 3ARWA 5CNHA 1I7RB 1Z2KA 3QWQB 3WIFA 4NFBA 3TNMA 2X4NA 2BY3A 2XTJD 1EEUA 4DGVL 3D39B 1ID5I 1VRSA 4RA0C 3NFNB 1PG7X 1P6FA 4K3EH 5C3TA 5IOPB 4IDLA 4B7LA 4X6CA 4ES8A 3GLDA 2XN9A 5IVNA 5KVMC 1NCJA 1Q38A 1MG3C 4BJLA 5I8EB 1NSNH 1HWGB 3CBRA 2BWQA 5AYQA 3MVSA 4PJXE 3QUKB 2WZAA 2IAMB 3UPAA 1T1WA 3NOIA 4K07A 3QUXB 3SE4A 2Q2LA 4IDJL 5EO9A 1C5CL 2QKIB 5K1VA 5GRXG 2FZ3A 4P3CH 2EC9U 2IAMD 3TIEA 4IS6B 2YA0A 3C8KA 4M61A 2Q20A 4X6CB 1JV2B 5ALBH 3M8OH 3SE8L 4UTAH 3WHXB 3DIDA 3O4LA 4V1DE 4JM4L 4JFQB 3WKYA 2X3CA 4JHWL 1A7RL 1INEL 1KXQA 1RJZB 4LVHC 4KKAC 1OL0A 3O4OB 4RZCA 5DHDA 4D0BB 4F15B 1RZGA 5A43C 4ALAL 4PRPE 1Q9OB 2XU9A 3NFPA 3T0EE 2B20A 4NP4L 2ZWSA 2VERN 3RUGF 2HRPH 4NC2B 5C0BD 3UYPB 4U6HB 1KIRA 3BH8B 1HX0A 4LQ1A 4YHPA 4D3CL 4MZRA 1A4JA 3ZE0E 3FB5B 3VFMB 3A4AA 4GRWF 4OVVA 4RFEB 3X1EA 1S7RA 3FKUS 1XVSA 2RQ8A 4KVCH 1A1OA 5D6CA 3GMRA 5LB1A 1FLTX 4QI3A 4P9ML 4IK6A 4IOFD 2UXTA 3ULUH 4PV1C 4OLZH 1OP9A 3FB6B 4XP4H 2ICWI 3ES6B 3WSQH 4Z78A 43CAA 1KN2L 1M56B 1MJ7H 1WTLA 4KPHH 2BFGA 4W9GC 1YEGH 1M6UA 3N04A 2XPGA 1RK1B 5C9JB 2YC1B 4M8VA 4DKAA 2EVGA 3HZVB 1C12A 3MLUL 4OZHF 4XO9A 3FTSA 3MOAH 3OKLB 2ADFL 2XWJB 1DO6A 1DBML 5F71A 1ZANH 1RY7B 4LL4A 3V5DA 3NJFA 3C9NB 4HZLA 4IK7A 5G5DA 4FFZL 4Q6YA 5DZNA 1NCAH 2WXNA 1JXFA 5T3ZD 3SCMB 3HMXA 4M3KB 2VN4A 1EWHA 4BSWA 3N1PC 5T33H 4Z7WF 1IAKB 3RIFK 3MRHB 2OLDA 3FRPA 4HBCH 3MNZB 4K3EL 3QPKA 1R5VB 1OXYA 5FWRA 3D3VD 2ZYHA 3RVTC 3FAXA 1AZZC 4HWBH 2F7RA 2OSYA 4TNWF 2LAAA 3QFJB 4NQXB 2F5AL 2GUYA 4JY4A 3HUJB 3IDUA 1YYLL 4EQ2A 2VR9A 1ZKAA 2Q3AA 3P69A 5DZ9A 3OJMB 5FYKD 3CZKA 4YDJB 5D6DC 2G5BA 5IVXB 4IRSD 3VMPA 5BOPA 4NLHA 1KJ3H 1P1ZA 1N7ML 2QJDA 4EZKA 2GHWB 1FRGH 1RH8A 1MDAA 3BESR 4JDZA 3T4AC 1CF8L 3DX6B 5T1JA 2DYPD 4AEFA 1ZTXE 3A0OA 2EEXA 2PP7A 2HA1A 2WAQA 4WEEA 2QFRA 2EXTA 3SDDC 3QQ3B 4UZGA 3U4AA 2NLJA 1JZ8A 3QHZL 4JZOA 1LO2L 2V5SA 3ARRA 3PRZA 2V6HA 1JK9B 2R9HC 2CXGA 3KCWA 4PAZA 4GSDH 3FSWA 1LWRA 3K6DA 1KIQA 5GJSH 4JMXA 4GQZA 4J3OD 3QW9A 2EKJA 35C8L 5CP7A 4U0QB 5C70A 5HGHA 2L04A 1GGCH 4HJTA 3BIAX 4MNQB 1KCUH 2FLMA 4QRFA 4CGUB 3QJOA 3MC0A 3N0PB 3NSDA 1NCIA 4UMSA 1W72L 5EBLB 4OI8A 2PR4L 3WKQA 2JIXB 2ZWNA 5CCGE 1NCBL 3PAVA 4P59L 2CMRL 1SHMA 2DQTL 3K0YA 1ITBB 4Z7VA 1XCTB 1QA9A 4UYQA 2EVJA 3QG6B 3S8GB 4ZUUB 1INDH 3HBGA 5GXBB 1NCWL 2CWRA 3BFQG 3O0LA 3P30L 4Q58C 4LEXL 1U8HB 3TA3B 2ZX6A 1EDQA 3MA9H 1JMXA 3T09A 1LK2A 3OLEA 4DO4A 1MY7A 3QDMA 2HB0A 3ZZ1A 1DEEA 4S1DC 4PR5A 3GWJA 5IQNA 3WIHH 5HYQB 3U83A 1LE5A 5K93A 2FWOB 3CC5B 4UAOB 1MN4A 4ONHA 3O8XA 4F7KA 2H7WA 5C08D 1WWBX 2WVVB 5C0AA 3MGTB 4CJ0A 5I1GL 4HC1H 1NMCB 2YPLB 4B3EA 3BH9B 1CFQB 2R83A 5SWSE 4N26A 1CWVA 2X40A 3CXHK 5T1MB 3D12B 1VLXA 2H41A 3ABGA 1ZTXH 3V0DA 3K72A 5I71C 5EU4A 1AQ8A 1O6SA 1HXYA 2DW5A 2JJSA 4KWUA 4OLVL 4TQEH 1ZVNA 1VPOL 2JKTM 3WEBA 4UDTB 3WFCL 4LOUD 1K6QH 4NZRL 2I07B 5DK0A 2B3RA 3MMEA 2XY1A 4GAYA 2YBRA 5IVXF 1JHTA 5JHBA 4ZMXA 3HE7C 4NP4H 2AZUA 1SHSA 3LQZB 2X41A 3LZOA 3GLZA 5ILTH 1WGVA 2NY3B 4LLDA 4L37B 5BNXD 3SGEH 1JGDA 5E2TL 3BSZH 3UZQA 1NCTA 2R1YB 3EDJA 4X5QA 2NMSA 4G7YL 2X10A 3BEVB 2H3XC 3B9VA 1HE8A 1RAMA 1GGYA 5KVGE 3T2PA 2VABB 3TCTA 4FOMA 4PY7A 5F9OL 1IKNC 4DP0X 3EYQD 3WJLA 3ZE1B 3OR6A 4QLWA 3KGTA 2NYZA 5DJDA 4PJBF 1WG3A 2OMZA 4DUWA 1LO5B 3MOAL 3BT2H 4P9MH 2OXHB 1ZGLB 2Y5TA 2GEEA 3T3PB 3WFDL 1DQQA 1E67A 1YNLL 3R06B 4LSQH 5ICYB 4XC3H 1XFPA 3BLBA 4NQCA 4Z7WE 5FYJH 2TSBA 1ZE3H 1CO1A 1L0PA 3VGGA 3EH2A 1MFDH 1PLAA 2FIKA 2R2EB 1ND0A 2IPKA 3GT6A 4F9PC 2FL5B 2HT2D 3TJHD 5CUSL 4LQFH 2JJUA 4S11A 1JDAA 3B9EA 5KW9H 4NN6B 1PD0A 1VZIA 5T3ZH 3IDYC 4P46A 4ENEC 1KBGL 1G1CA 5CU9A 5KJ4A 2YSSB 1DQQB 5D8JH 1YC7A 4CN4A 2HT4D 1IFHH 1YQVL 1F6FB 4KH2A 5FF6B 3GMNB 3L1OL 3VAEA 3K2UH 4RMQA 5IGXH 2UWEF 2WSDA 1LK3L 3UXFA 1OGPA 1TPXC 4BZ1A 3Q8EA 1A0QH 3LY6A 3GBMH 4IW4C 4DGIH 1ADQA 5IUSA 2E46A 3LRKA 4X98B 5F1IA 1ADQH 4YH6A 3VFVA 3ARQA 3J8F7 3WI9A 4FRWA 2O61B 4GIOA 1OHQA 1D5MB 4MQXD 2OL3H 1HE7A 1DANT 4FTDA 1XCWA 5E8NA 3WEAA 3QHZH 5IOPA 1FL6A 2X4TA 3MRCA 2BC4B 2KI6A 4KUCD 2AK4A 1MCWM 3B83A 4RBPK 2KERA 2CKBH 1A6VH 3AM8C 1HI6B 4IKKA 2R2CA 5FOBB 4ZQKB 2HG0A 3WL9A 3HUJE 2VAJA 3SKNA 3QQNA 1MIEL 2G30A 5J1AB 2B9AA 5K39B 3DSFH 2CGRH 4BRJA 1XIWB 4OF0A 5EZJA 4O2FB 3P3UA 4PRHA 3INUH 2QVMA 1JDCA 2HRHA 2I5YL 3LXBA 5BRPA 1YYMH 3EGXA 4NIYE 1D9KB 1PNDA 5JOFB 3OAUL 4KZEH 4XNXL 5AAMA 3GEWB 3HG4A 1Q9OA 5EO0A 3ISRA 4BCXA 4ZXBD 2E6QA 3U1QA 1Z5LB 2X5PA 4JRYD 1T1XA 4JANA 5K59E 3HR5A 1MHPH 4X9GA 1TQBC 2GCYA 3QIUB 1I8AA 1ET8A 4OLYH 5KS9B 4A2FA 1ZJAA 3G6JB 3UAFA 4S1SH 2CBPA 2EUZA 4K3HA 1P6AB 3U4KA 1HEJC 4TUJA 4HKJB 4Q7DA 4EI5C 5C0RH 3D2UA 5DC0A 1FE8H 1SRDA 3FCTB 3UABA 3WJMA 4X80L 3BUDA 4OFYA 2A74B 3BP6B 3WFCH 4B5ZA 5C7XH 2UXFA 1NFIB 4KHXL 1SYVB 5ICZA 4N2EA 2NYYD 1O6TA 5F0PB 4XBPA 1IFHL 2W38A 4C4BA 2O6FA 3MHZA 6PAZA 2IANB 4GKNB 5C0ND 5FGRA 4FNLH 5PCYA 2JF1A 3DPBB 3K6FA 4RMWA 2HFGL 4AV5A 1I3VA 5K59F 2F54B 1URZA 3C9NA 4HZLB 2OYLA 2Y0SA 1H3UA 2Y22A 4I88A 4NI3A 3W9DA 3ZKMD 4AYFA 2OCFD 1B2WH 3BZEB 1U6AL 1A8JH 1OAZH 5I8KL 4K5MA 1ETZA 4UOW0 3ZDWA 5CEZE 4PJ9C 2X70B 2VDML 3MBXH 2V17L 5I0DA 4IBZA 3IGAA 1TQTA 2Z0BA 2OMWB 4GKNA 5HHXL 4Y9FA 2Z4QB 4CU6A 3HG1E 3MI6A 4RDQF 4XXDB 4ZO7A 1THAA 4Y0GA 2Q10A 4X9BA 4E9VA 4PI0A 5HI4C 5B38A 4I5BB 3HMXH 1AQDB 4TF4A 3TT3H 4LU5L 3BIKB 4ZRGA 4FXKC 2RQEA 1TTGA 4Y5VA 2DZEA 4QOKB 1IAIM 1KMGA 1DQLL 3LKNB 1QQDB 5H4ZA 1BPLB 5K9JH 2HKAA 3SKMA 3V4PB 4PWIA 2CGRL 5JW4Q 1JWSB 2OTUB 2W92A 2WANA 4XNZC 3CHRA 2E9BA 3BGAA 4G7YH 4XVSH 3C5JB 1OK0A 4WAFA 3NJKA 2P8PA 4KROD 4UT7L 1RU9H 2AEQH 3C60D 1O9VA 1ZY9A 2VXQL 3T2OA 3IFLH 4NM4L 1T89C 4LRIC 3DMMD 2YMXL 3QH3A 4NQCE 3F65A 1UZ8A 3P9MB 2ZXEB 5F6IB 2CR6A 2C4FT 5C7ZA 2G3ZA 2N56A 3U1SL 1QLEB 3NJMA 2W81C 4IRJB 3MJ7B 2XJKA 1OSPH 4GMTH 2IADB 2JTDA 1JWMA 4RFNB 2NY5H 2XG5B 1J0HA 2ROYA 3L5WA 4R84A 4WWKD 1BFTA 2C9SA 5EN2B 5EF0A 4BKSC 4GINA 5J6HA 4KTGA 4OLXL 4AJVA 1KJ2A 2A0LD 1U42A 3S3DB 3PU7A 4QWWD 4B50A 4HIJA 4BIKA 1W9XA 3DX2A 4JRXE 4LSSH 4PJFE 1H9DA 3V79C 1MIMH 5MI0B 2F8IA 4BD4A 3ZL4H 1A7PH 3MRGB 2HN7B 2ATKB 1CICC 3D0LB 3FTUA 3M17B 3RBSA 5CF3A 3U1PA 4MHHI 1S9KC 3HJ0A 1W91A 4WIQA 3U82B 5DYOA 3SZ6A 1JZ4A 1G7QB 1MUJA 3EJJX 2O72A 3FUIA 3N6YA 4B9KC 3GZOA 1N0XH 2XQYK 4JZNB 1X4XA 3O3DB 2UWEA 3A6BH 1I9RL 1TLKA 4UQCA 1DBKH 4M7ZC 4PUBH 2ZCLL 5CMAB 3NSYA 4Y19B 1UB6B 4KTDH 4UUJB 5E6ZA 4XVTL 1AFVL 4JE4B 4JO3L 4DK5A 6FABH 4PLJD 3BQUC 4WKZA 2VUYA 2CIKB 2ZE0A 2YGVA 3OBAA 1J9RA 3LZFL 3GMOB 4PP1C 5EUOB 1TJIL 4JREC 4XX1G 5BVJA 3HS9A 3NJVA 2VDLB 5TH2A 4RESB 4U1GC 2OYKA 3RZCB 5E99L 4DGUA 3TBVA 1F02I 4QXGL 2DQGL 5SWSA 1HILB 1S7SB 1DBBL 5EU7E 4NO0A 3MRDB 3VGAB 5INDB 3K3QA 1D6EA 1HDMB 1OB1B 1T1ZA 2PPFA 3I6LD 3ML8A 5JHAA 3E8UL 2RR3A 5SWSD 3FU0A 3QJUB 2EYSA 4E36A 3WIHL 1C1EL 1EPFA 1U4EA 1MH5B 2AJYH 1B3IA 2DIAA 5EC2B 1HXKA 1PEZA 5JNYB 4HBQA 3KPRD 3Q48A 5DDHB 4FQHB 1QLEH 2VITA 3TP4A 4QRRA 5B1JC 1KC5L 1K8IB 3O9WD 4GUCA 4OLYL 4U2YA 1PQZA 1R5IA 4E9RA 5IHHA 5HGBB 2J71A 4HQQH 5GSRB 1GC1L 2EKSB 2HWZL 4XO3A 5IF0B 4GO9A 3MCLH 3RTQC 1QMUA 3STZA 2VC2L 4AE1A 3QEQB 3R18A 4Y2DD 1BOGB 4JM0A 1PSKH 4FA7B 4BZ1H 4OCSH 2YUWA 4N8VB 4GW4A 1NDGA 4KXCA 3OKDA 8FABB 5CSBA 2D7PA 4YDLB 2BXZA 3EHBC 2YIHA 1OAYH 5IQOA 3IFOA 1BAFH 2ZOWA 3QI9A 5DRNB 5FECA 3DYOA 1W6WA 3RVXC 4LSTH 1XH3A 3UAJA 4PRIB 4EO5A 2X6BA 1RURL 3IJYB 1MI5E 4Y7OC 2GBVA 3FONA 2R0LH 4Y1TA 3RNKA 5CJ5A 4LLQB 1MAJA 4NJ9L 1MFNA 3QWRA 2EXYC 2ICEA 4APXB 3W38A 4D9RD 1NGPL 1LO0L 5EDXA 1TJGH 4APQB 4MS6A 3DUSA 3CN1A 4R90L 3DIFB 1QR1B 3H6AA 1MWAH 2PPCA 3T0EA 1MREL 4ZS6C 4GKZA 1FORL 1YMHB 4HWUA 4OD3L 1TZGL 1BW8A 4ZW3A 5HHME 4HSAC 4LOEA 1GW0A 1MZZA 1C5DB 1Q9LA 3IJYA 4L4VB 5ADPL 2ODHA 3P4MB 4JRWA 3UIZA 4LPXA 3LIZH 1J5CA 4JMNA 3DMMC 2XXFA 4LAJH 3IDXL 1YNKL 1SPDA 2LAGB 3QCUH 2YD7A 4DVBB 4KK8D 4AIEA 3STLB 1R5WA 1YEJH 4X7TA 1NCCL 2YD0A 5IMLB 3HI1B 1D7CA 3GDBA 1MCRA 2P7TA 3FW6A 2IBZX 4O4YH 5EA0H 4QLRA 3CVHL 5BQ7A 2PWEA 1DDHA 2VDOH 3BW9B 3OLGA 4HH9B 3NCXA 5C0BB 3TBTB 4L3EB 2BFVH 4R7VA 3H3KA 4Z3HA 1BHGA 2ICEC 3GJFB 1L6XA 4XC1H 4W9CC 3DHJA 3GINA 3F7RA 3NRQA 3WGVB 3RWFA 2OX5B 4I18C 1WRFA 4AM0A 3LRLA 4W9LC 1CICD 3CPUA 2VUOA 1HNFA 1H3VA 3APFA 3CH8A 3LS5H 4MJIA 3SZKC 4FQCH 5FUZL 1V5JA 2GHZA 3RAJH 4XMXA 3NA9H 2RD0A 4AIXA 3MJGX 1B4LA 1CGYA 3OMAB 3HB3C 4P5TC 3SPJA 1OK8A 3WMSA 2MMXA 3IBEA 3MV11 5CR1A 3EHBB 1IM9B 4FFWD 1IAIL 1FNGA 1NPNA 1SHXA 4OIIL 1FZOB 4O2CB 1BZ9A 3J7HA 1MG2C 5IW3A 3OX8B 4N86A 4JFEA 3KXFB 1BXXA 4CILA 2OL3L 1G6VK 2DQJH 1BQHG 1MCDA 1KV3A 2EH7H 2ZJSL 4L8DB 2IDUA 4NO2A 5JW3L 1TUPA 4RFOH 4H0IA 4UILL 1E6JL 3M1OA 3P11L 5JZ7D 1C5CH 1JVOA 5D7LA 5JHDE 2YS4A 2N4IA 1AKJD 2EEDA 1MFUA 4ZZKA 1S78C 1WZ1H 4W9DC 5CZXD 5F21B 1A47A 3I9PA 3CZSA 1TJIH 2WXQA 3FH5A 4OD2A 3THML 5J13C 5G55A 1LEIB 4Y1AB 1NCHA 2WJ5A 3CDCA 1INQB 4XP4L 4JZJA 3WSQL 3VVWA 1T5KA 4G7QB 4MYWB 4NRZA 3D87B 3CXDL 5BZWB 1IU1A 3FJTA 4QIRA 3L08A 3P02A 1NMBL 4HA1A 4GMSH 4L3ED 5CILL 4XPAH 3WIFB 5BRZB 1QFUL 5JQ6H 2GY7B 1T03L 3S3SA 2XPZA 2D31B 4ZOCA 3GNML 5FGCE 4ZXBC 1X5ZA 1ETB1 2LVEA 1DVSA 2CIIB 4PRHE 2ZUTA 2C26A 3AC0A 3FC8A 2QSQA 5HYFA 1BMGA 4FI8A 3VI3A 5IB3A 3DKHA 2F54D 3MRJA 1MXDA 3TTYA 5CJBA 1LDPH 3CFDB 1INQA 3WKMH 3CSFA 3V9FA 4K7FB 4J8QA 4LGPB 4RGOH 2XTLA 5GZOC 2NX5A 2FHBA 4G6FD 4FXLA 1N3NA 1X44A 2H4EA 2WYIA 4IOSA 2VNCA 3L5HA 4GFXA 4HIPA 1MCCA 1DJSA 5C0GB 3FSAA 2EIKB 1J18A 1PJWA 2BSBA 3G5VB 3E6HB 3MROB 4U4BA 5DJ2B 2BJML 3MLRL 3DRQA 4M7ZB 3SGDI 1GOHA 3NGBC 1CYGA 1FE8L 2C1OB 1D6VL 3BP4A 3CNKA 3LXCA 2ZUQB 3M8OL 3SE8H 5KSBB 2C9XA 2VC2H 2BIPA 4FGMA 2DWEA 1OP4A 1J0YA 4IRSC 4HEPG 1BFSA 4P2OC 3VI4E 2X6UA 3QEUB 4Y4KD 4QOKA 5LXGL 5IK3A 4AXWA 3QZOA 1M7DB 4LBEB 4KRLB 3L81A 2P80A 4MMZC 1HYRC 5B1AB 4YHYB 1I1YB 1RZQA 5IEKB 3C2SA 1B4RA 5CEZL 3U7WH 1YEKL 1GHFL 3KL0A 1S7UA 1AGCB 2VDLH 4PYHA 4FD0A 3MUJA 2FH6A 1OGAA 2D7QA 2FEEI 3NFSH 4Z7WB 2M2DA 2NY0C 3L9BA 4EBQL 2PYFA 3P11H 7CGTA 3K1KC 4RMSA 5F6IC 5HHXH 2WQ8A 2YC1A 1P4IL 4OD3H 2QADC 4MDIA 5CJOL 4Z5RA 5D7JA 4YHML 4P57A 1UQSB 3S35H 1RZIB 4LPTA 4JRLA 4X8CA 3BMVA 3L4UA 3PREA 4U1IA 3ZYJA 1YEFL 4YSAA 3D2TA 5DQ9B 4RA3A 2DTML 4PTTB 1ROWA 4LESA 4TL4A 4ZQTA 4JFDE 4OZHA 3HJEA 1BYNA 1H3GA 5T3XH 1ZLSH 1QUNA 1YAZA 1RD6A 3ZGHA 4JR9H 4MCMA 3QA3A 1M7IB 4ONFL 1DQTA 4IIQB 2GAZA 4YSTA 5F7AA 1GY1A 1SXNA 3IDJA 2BNQB 5FR3A 4JN2B 2OV0A 1ZXKA 8PAZA 5AWNH 3AXHA 3C09B 2WOYA 4GMTL 4L9DA 2NY5L 4QRBA 1GGBH 1A3RL 2COVD 2LLGA 1N26A 3TLRA 4MS8D 3S5YA 3VXUA 3I3BA 3O81A 3GHBL 4RMRA 5EA0L 5TFSL 2WWMC 1U92A 1D2PA 2XY2A 3FOLA 4FLHA 1JZ7A 1DVFC 4OD1H 2YRLA 5BQ7B 3O8XC 1SFDA 3NN8A 1P4BH 5A3IC 4XMKL 4YSOA 5T8IA 3VG9B 3QXDA 4MMXB 1S3KH 4WSJA 5FF6A 1NKRA 3B6SA 3D52A 5J8OA 3V5KA 1UWXK 3RIAF 1IGYA 3QHTC 1BZOA 2WM0A 5L4FA 1CYWA 2X4OB 3ME0A 1NPJA 4P23B 1PTZA 3ZDZF 3VD3A 1UOKA 2WSPA 2JELH 3DDGA 3CDZA 3O41B 2YPVA 3HVNA 4KDTC 3CGTA 5F9AC 1U8LA 3QB7C 3L5JA 3M7OA 3W39B 4EI5D 4N0FB 4FQLH 3B7YA 4PGDB 3VFSA 3AY2A 4LNRB 2WXOA 2ZONA 2XZQH 3B4NA 3O9WB 1AGDA 2H45A 1KGUA 4O2EA 1OQXA 3CFNA 5I82A 2EDKA 2BIIA 3LKOA 3FO2B 4WZ9A 3QDMD 1NAMA 3DNKA 4KK9D 4FG6C 4TULH 2C4XA 1K4DB 4GG8A 1MJ8H 4PJ8D 5DZAA 3HZ3A 2JVUA 1U8KA 4W9KC 5DD5H 3VXSD 3QI9B 1QZ1A 4ZG1A 1KDJA 5HBBA 2LLNA 2AV1B 4OV5A 1RUMH 2A0LC 4GG6F 4P07A 1E3FA 1GY2A 1EANA 1S7TA 5DUBA 4G8IA 4L4TA 5INCA 4CMMB 5DVPA 3UGEA 5CBAB 1HL8A 5E2UH 4W81A 4QCIA 3MV9E 1AXSB 3BP7B 3GKWL 3N85L 4WTXA 5IFHH 2V3DA 1FNAA 1OSZB 1EO5A 2CCVA 2CLVA 3L2NA 4QYOB 1KIQB 4ODVL 3AADB 3A4FA 4WK4B 5B7EA 3IGLA 3P3RA 1IAOB 3IJHB 2CHZA 1BF2A 1XSJA 4J23A 4RNRA 2Q6WA 5IROD 1TETH 2OSLB 3ASNB 3RURA 5IB5A 4AKQA 5FW8A 2WQSA 3DVNB 5EIQA 3GHBH 3JUZA 3OB0K 3IAGC 5E00B 3BXNB 1WHOA 4X4XB 1DVQA 1G5GA 1G6RA 4EUPH 3STLA 2NY0D 4HFUH 1ZK9A 1RUAH 3OKKB 4JUSA 5H35B 5T1MA 4G8GD 3IWUA 4Y4FC 3TZVC 4HJUA 1BBJA 1EXUB 1QKZL 1SM3H 4JDVA 5DJYA 1A9EB 5E51A 4YBQD 1WFTA 1BZEA 2AQ3A 4XCNB 3UZQB 2P5PA 4NO0D 1N4XH 1P4IH 4NN6C 5B3SB 5E2WL 2OMXA 3UEZA 4FQPA 3WTYA 4APQA 3D3VA 4PGBA 2VRAA 1RZ8A 1Z1WA 4GO8A 2QGDA 4E41A 1XB3A 3KBEA 2QEJA 2V9UA 3TONA 1BD2B 5T3XE 2A6JA 2CGYA 1P7QB 2BMKB 3RX9A 4RAVB 4ZUUA 4CVZB 4A63A 4M5SA 5CD3B 2A9ML 3HN5A 4KJQC 4CVWA 1TTAA 1E65A 1PKQA 1FH5H 1U8NB 4XXDA 3BEWA 4JY5L 4XP5H 4P2RD 3APNA 1LM8V 3ZDZE 1PLBA 4I3RH 1LD9B 4JGJA 4XPFL 3BP4B 5KANI 5EUOE 1BDYA 1G9MH 3Q1EA 5IWLC 3QJFB 1UTDA 5F6HJ 1NCDL 1XGZA 4Z78B 2XWCA 2E74C 3H2PA 4WGWB 3VNZA 5GZOD 2APXA 1RHHA 1QBML 2DI9A 1RUML 4MJID 4QRSA 5C0DB 3EG9B 1T5WB 5EZLA 1BQSA 3LRSB 4N1EA 2FD6L 2BHZA 3BUTA 4I3SL 1XDTT 3GJFA 4HUUA 4PHZA 5A16B 2FQEA 3W3BA 4O02A 5FO9A 4XHQA 3SQOL 3C6SB 3PXJA 4KQ0A 3NK4A 1A3RH 1RVFL 3L8QA 1WF5A 1KGWA 4NNPH 1EUUA 4ZO8A 3VXUE 3DUHA 1HWWA 4MAZA 3B37A 1KCWA 5CZVL 1U95A 3DVGB 5KAQG 2LR4A 4Y2DC 5CUSH 5AW4B 4MDJB 4HLZG 1AQMA 4L5FL 4N2FA 2IIJA 4IRZL 4WUKL 1JGEB 1E5YA 3IRPX 3VTMA 3DC0A 3NCMA 4JFOA 1AP2B 3VW3L 2YFOA 4JO1L 4XPGL 4IQHA 3BVXA 3DXAD 2VDMH 3MBXL 5JW5A 1TYRA 3QEHB 2BNQE 5E6YA 3EOAA 1BD2D 3BUPA 4FMVA 3BPCA 1QZNA 2P5EB 3X12A 5CP3A 1VFUA 3KCPA 1BM7A 1F97A 2N01B 5MP6L 4P0DA 3VSVA 1OD9A 1FL5B 4WFHD 1I8UA 4Z7OF 1LL1A 2R56H 4WJG3 4WWKC 5T5FL 3AU1A 4X6DB 3OV6A 2FNWA 4WW1A 2JKJA 3VU1A 4R83A 2F8VA 4PJDE 1OLLA 2OP4L 3QDAA 1ZIBA 1J9QA 1EFXB 3RY4A 3ZXAC 1N64L 4M6OH 3KLHC 5AW8B 3G08A 3I75B 1NBQA 2XIDA 1E30A 4F8QA 3EO9L 4TUOA 5C0CD 4QHKJ 1I9IL 5DQJA 4A2HA 2ESVB 4Q56A 1YCSA 5HD8D 3BFOA 1Y07A 3BAIA 5HJDA 5KUMA 1BQHA 2OM5A 4NAJA 3RWEB 4WI0B 4LCIL 3O6LH 5IT2H 4NZ8A 4V1DD 3LXUX 5I26A 2XBTA 4UNVA 1YUHB 2MFNA 9CGTA 2NNFA 3WJLC 3MLZL 3ZY7A 4TNEA 4AI7A 4Y5XA 3OKYA 1TR7A 5L8KB 1BXVA 1A8ZA 3EADA 4FTVD 4MMYA 4X6BB 2FCBA 1T7XA 2R59A 1RZJH 1TTFA 2ZX9A 3CBJB 4AQOA 3DVIA 1F1DA 5AW9B 5INCB 3PDOA 3MXVH 3OHXA 1SVCP 2H8PB 4HWBL 3M7FB 3LRGA 1P9MC 2WOBA 2Z91A 2DQFB 5FLUA 3VXRD 4ODXB 3EGXB 3TX4A 1NDGB 5SWQB 3FO1B 3DK2A 3RL1A 1QNZL 2VE6A 3GXPA 5C0EA 1O75A 3FO2A 3H4FA 3ORJA 3LS4H 1Z5YD 3FN3A 3F12A 1HHKA 3ZYIA 4WKXA 4PW9A 5LO7A 1KXVC 2YQBA 3UYRL 5E4OA 4EDXA 3RVWD 1YUKB 4JG1H 4U1LA 3C87A 3I50H 4CC0A 3U0PA 1GOGA 3HI5L 3W57A 4UQ2A 5GIRA 3IDGB 5JPNA 2VAAB 1G94A 4EXPX 4NCDA 4TUUA 3D39E 1KLGA 2V7NA