3ARDA

Ternary crystal structure of the mouse nkt tcr-cd1d-3'deoxy-alpha-galactosylceramide
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
295
structure length
294
Chain Sequence
b'KNYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWGSLHHILDAQKMVWNHRHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title A molecular basis for the exquisite CD1d-restricted antigen specificity and functional responses of natural killer T cells
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 74
structure length 294
sequence length 295
ec nomenclature
pdb deposition date 2010-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ardA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3ardA01
4MHHI 4RZCB 2FZ3B 4J3SA 3MO1A 5LJYH 2W60A 1T2QL 1QSFB 4W68A 1WAAA 1UH3A 4MB5A 5A16B 4WW1A 5INDB 3C60C 3O8XD 3UTSE 2BOBA 1YY8B 4HJGB 3D3VB 2UWEE 1MVUB 1NCUA 1PQZB 2NY4C 1H5BC 3B5GA 4JFXA 2IMMA 3CVIH 4Z77A 3AXLA 3C60B 3V9FA 4NNYB 5E7FA 3Q3GA 3DIFB 1FSKC 4C56B 1CXFA 3UTSA 4AK1A 2UWEA 4ZYKA 4WW2B 4KK8D 1RULH 2P48B 4J4PC 4JM2F 5E8NA 1FSKB 4FG6C 5HHQB 3RGHA 2XWJB 3QDJE 1MCJA 4FFEX 1OTUC 1FG2B 4HZLA 2BVOA 1W2KT 2YD9A 2DWEB 4ZUVB 4YXHH 5HYEA 4TTDD 5C2UB 3QDJA 2AXFA 4B0MM 2AXHA 2AI0L 2WP3T 1CFTB 1UC6A 4M00A 1KC5L 1Q1JH 2BC4B 2DBJA 5C09A 2MQCA 1HHKA 3VCLB 5IT2L 5C0NC 2E9WA 2ID5A 3P73A 1KB5L 4UZGA 1YDPB 3DX6B 1QO3A 3SE9L 3KLAB 3KPNA 1C5CH 1DN0B 4WI8A 1FORH 4JHAH 1ZT7B 4OCYL 2AABH 3B9KC 2NY0D 1FO0H 5T1DL 4FMFA 3GM8A 2CRMA 1QLEH 2ZSVB 5SWSB 1JGUL 1KPVA 3DI2B 5A2JH 5HYQA 2DKUA 1RUQL 2Z31A 4H26A 1JGEA 4RWYL 1EGJA 2UUDK 3DX7B 4Z7NE 2P4AB 2P5ED 4I9WD 5E2VH 2GT9B 3V0WH 4KI5E 2ZUUA 1DDHB 4ZQKB 3BZEB 4Z95H 3PQYE 4QHMB 5I1IH 1P84J 2HJFA 2VDPH 1MHCA 1OD7A 1K5NA 1A9EB 4MLIA 1IGJB 4QTIL 4X8JB 4XWGH 3UBXA 3VH8G 4OFKA 4Y19A 2HKFL 4M7KH 4XWOC 5AUMB 3VE0B 4NDMB 3PQYA 5C0BD 4HIJA 2B2XL 3DTXB 1JPGB 3CK0L 3VFGL 4QT5A 1JF5A 2VUOA 4GAYA 3TO4D 4RBPH 2UYLB 2CJUL 3S4SB 1R3IH 1Z5LA 3M1BA 2CO7B 5GGQH 3I02A 1ORQA 2ERJC 1KN2H 5DD3H 1NCCH 2F54D 1OAQL 1MJ8L 3IFPA 1CVSC 4IJ3C 2VLKA 2X1QA 3VGGA 1KBGH 4LAQL 4O4YL 4WI6A 1YEKH 1WK0A 5DJYB 3QXDA 3QCTL 1T83A 4IJ3B 3LPWA 4NO0D 3G5VA 4HJ0D 4K3JH 1D6VH 3BEVA 4M7ZC 1P5VA 5ACMA 3JWOC 1IM3A 4MSWA 3CDGA 2RFXB 3F7VA 4EOWH 4HWEH 5DJCA 4LCCA 4NUJA 4JM2C 3NIDE 2D7TL 2PYED 4U1MA 5EOTA 4FQQB 1I3RB 4M7ZB 4XVJH 3W39B 2BNQB 4UMGA 1L6ZA 1L7IH 1QBLH 4KH2A 2QADC 4TPRH 5E94B 1UVQB 2FWOA 1LILA 2NX5B 3QFJD 2DJ4A 2XXCB 3FO9A 2QADB 2EKJA 1F02I 1BREA 2XTLA 4GW4A 3H9SD 4P5TB 3RDTA 2BHZA 4HUUA 1SVZA 4HWBH 1XGPA 2NY5L 2EC9T 2CLRB 1JNHA 1YMME 2MTPA 3B4NA 1QFWI 1NGWB 2W9LA 5D7JA 4NHUB 1UJ3C 3PV6B 3V7AG 1P7QB 2R29L 5K9JH 4JVPA 2PW1B 2MCPL 3TP4A 3BMVA 5SWZD 1R3KB 3IS1X 3QUYA 5HYJA 5J13C 3MV8B 5I1EL 4LDOB 3AFLA 3RX7A 1UJ3B 3BZFA 2JTDA 1YMMA 2WBJA 3MRFB 4IRSA 1YEHL 4TUKH 4XAKD 1X9QA 5DJ8B 2VO5A 4AG4H 4L4TE 2EDOA 4X7DC 4JFDE 5J13B 1IZKA 5JW3L 5I2IA 1RIVH 5D9SA 7FABH 2R0ZL 3RVVD 4OD1H 5GGVH 3GI9L 2A38A 4JZNB 4FZEH 1DVFA 1EUTA 3C5JB 5CP3A 1R0AH 2AERT 2XKSA 1ITBB 1J7VR 1V7MH 4L4TA 2DLHA 5HI3D 5JW4R 4JFDA 4ODSH 2NY1C 3TH4T 1RZJH 2XKNA 4DGYL 1ZHKA 5T1LB 5ESVA 5EU6E 5DS8A 1WTGT 2V9QA 2Z8RA 4P59L 2NY1B 5D2LF 3GJFB 2XA8H 5DK2A 1Z9OA 2FSEB 3CUPB 3GMQA 3OL2A 5DUBA 4F57L 5DFVD 1FL6A 3MA9L 2EO9A 3WL9B 3QUZC 2HWZL 1DFBH 2EYRA 2ARJQ 1CBVH 4TOYL 1MIEH 4X4ZA 5HJ3A 5EA0L 1TQBB 5L8JB 3VMOA 2X4OB 3MXWH 3SDDC 3QUZB 5JNYA 4BA8A 4F9LA 5ECJE 2D31B 3VXTA 4Z8FH 3RP1A 4LLWB 4KHTH 1K3IA 3D69B 5FO9B 4GAGH 4XTRD 3U9PL 2EICA 1DANT 1U8HA 5DRZA 5DD5L 2PF6A 2Y5EA 3AMKA 4EEEA 3DRQB 3E2HC 5IIEB 2ZUSA 1LEKB 3FQRA 3B9DA 5E8PB 2CUMA 5F1SA 5TDPB 1RAMA 2HFEA 5ADPH 1FIGH 1AXTL 4I77H 5KJRH 4RMWA 5DRXA 5EIQA 4GFTB 5AEAA 4LVOB 1CL7L 3DXAB 4LRNL 4LFHD 3CDCA 5TH2A 3CH8A 3IFNH 2PYFB 2B4CL 2Q3AA 4J8RB 3H9YA 4MX7B 3UTSD 4Y4HC 5F9WB 5A2KH 4QXTB 4JANA 3I2CH 3D2UB 4HIXH 4HFUL 4J6RL 4KQ3L 4X99A 4DW2L 1LK2A 5HYSB 4EXPX 2NXYD 1C7SA 4DN3H 3MFFA 3WXVH 3IDJB 4H20L 1BQLL 2W65B 4ORGB 3BKML 4FQ2L 4MQ7B 5DTFB 2SEBB 3GO1L 4QXUH 3VFWA 2IANB 5HVGB 5CLWA 1RZ8B 5C0AE 3PGFL 3QDJD 5GHWH 2VDOH 1N6VA 4FP8H 1BGXL 4H88H 5C0CE 4KGJA 3K2MC 3CFKA 1NBZB 5ID0B 3ZKMC 2EH8L 3QJHB 5JHDB 3X11A 2V17L 2NY2B 1S7VB 4XP1L 2VDNL 1OTTD 3O6MH 1Q9KB 4OLZH 4NNXA 3QNXB 5C0AA 5I0ZA 1MCWW 2O5ZL 3RU8L 3E3QA 3IDNA 1QBBA 3WHE1 3BP6B 5CJOH 1AXSA 5C0CA 2O26U 4NQXA 2E7LE 4N0FA 5JORB 2VN4A 4ONHB 3C8KB 5D4QA 1FP5A 1FGVL 5KANI 1LNUA 5FYJU 2Y6SD 1E6OL 1ZGLM 1CTNA 1CG9B 1BVLA 1IT9H 4I2XE 2GJJA 4BZYA 2Z31D 4CMMA 1QFWM 3CC5B 4KK9D 4KJYB 1NCWL 1YEIH 2YUWA 5KVFH 3TH3T 5CZVH 2K1MA 3MJ9A 1XGQB 1C1EH 2FHCA 2N7AA 4XPTL 3P11L 4I2XA 5IR1B 3VFUB 5JLZB 1JF6A 5DRWB 4OGZA 5IB4A 3SDAC 5D2LB 4WWID 2Z92A 4KI5D 4KTDL 4R4NC 1RU9H 3MJ8A 5I66B 5T1KA 4K9EL 5HD8D 5C6TH 3VG0L 4EDXA 4OAWB 3PQYD 2DQJL 4HGMA 1UWGH 2DQCH 4XPGH 4EUPB 3CDFA 3KLHD 1A9BB 3IGAB 2OP4H 3TZVC 4MQXC 4J3WA 2ICWA 5F96H 4WFHE 4PRHB 4MA3B 1FPTL 3LEYH 5MEOA 5B4MD 3IS0X 4MJ5B 4LSRH 3CDYA 4R26L 3RWJB 1FGNL 1LO4L 3V5DA 4S0UC 3X12A 5BXFB 4RISH 5TF1H 4M1CD 3VFMB 4YHMH 4O5LL 4HX1B 2PNDA 1T3FA 4Y5YA 2FDBP 4LLVB 5DDHB 1FYTB 5DVKA 5CSZB 1DUYA 1Q9OB 1Q9LB 1FVCB 1OL0A 4JDZA 5TQ2H 2YKLH 2CK0H 4OTXL 3DX9B 1B4JH 3T65B 2X41A 3MC0A 4WO4B 1CFSB 4NWUH 1JGLH 2YC1B 1NEZB 1PGRB 3ESVF 4ERSL 3G6JF 1WWBX 2VZOA 1B0RB 3EFFB 4LVEA 1YNLH 1A3RH 4U1GC 1U8PA 1C16B 5I1HL 3TJHA 1UWXK 2MCG1 2F15A 3NFNA 4PJHE 3MMEB 1ES0A 1BZ9B 3HAEH 4U1GB 4X5WA 4LPTA 5D71L 3MRRB 3V95A 1XGRA 1F6FB 1GIGH 1S9WA 2X9XA 1DL7H 3RDTD 2H26A 2Z91B 5LWYH 5DZLA 4YQXL 1F90H 1KNOB 3PHQA 4PJHA 2DWDA 4WVRA 5D7JD 3ROOA 3D85A 4U3CA 3V6ZB 4G6JH 3RRQA 4GKNA 5GS0D 4OI7A 3C08H 3MLSL 4MAYA 2KUTA 3S36L 4LBEB 2VISB 3T3ME 4YFDB 1FCGA 1G7PA 2WBJD 1YMMD 3NCCB 4IRSD 2PCPB 5CKGA 3PNWA 3FB6B 5CJ5A 4FQIH 4LDEB 5HYSG 1I7ZB 2X7LA 5KVDH 1IVLA 2EE9A 4K2UH 4OZ4B 5EZJB 4G9FB 2CIKA 1QPPA 4S2SB 1DVFD 5F7DA 4AMKL 2FX8L 4NOFA 1Q9WB 4L4TD 5JR1H 4JFDD 2V9TA 1HHHB 3HZKB 4DTGH 3KS0H 3JVGA 4XC1L 3T2PA 4RGNC 3NCBB 1TVBA 3SE3C 3T8XA 3FN9A 4LQFL 4M4RA 4NUGL 3QPXL 4ZTOL 3HI5H 1WT5C 3L9RA 1QRNA 3L3KB 3QNYA 4PRPE 3VG9B 3SKOA 5EU6D 3HC3L 3RZCB 4M5YH 1F11B 3KYAA 4DAGL 3MUGB 3KPSB 4PJIE 2G2RA 4PJ7F 1HXYB 2ICCA 1DQQB 4U1HA 2MKLC 4FXKA 3QG6B 4QRSB 1M1SA 1NUFA 4AQOA 5IFAL 4PRPA 1OF2B 1C7TA 4LHUA 4P9HH 2JJTA 2QSCL 3MGAA 1KCSL 2ZKHH 4HCRH 4XC3L 3C6LB 4PP8C 5J12C 5BS0B 3DMMB 3STLA 3TIEA 2R15A 3L5WA 1TMCB 4P2OA 1CI5A 4D9RE 1I9RL 5C7XH 2DQEH 2GHWB 4IRZL 4U49A 1KCUL 3LHPL 1Z9LA 2A6DA 1XF3B 3FT2B 1AD9B 4IM8A 4HKBA 3QUKB 4KMTL 3E6FB 5HVWA 2M8XA 5IK3B 4AEHL 12E8L 2JB6B 4HV8A 1OAXL 3BPNC 4HJJH 3LKPA 1UKTA 4PRDA 1MPAL 2NLJA 1IGYB 4C4KO 4B7IA 4V2BA 3MA7A 3G6JB 5IF0A 3EJJX 4YR6B 4PRNB 4KY1L 4OD3L 4J1UA 3VXME 3S35L 1LO0L 4EVNA 3U6RB 5EC1A 4QRQB 3N1FC 4GO6B 4HK3N 5FUZL 3MNWA 2VWEC 3RGVC 2EDDA 2AEIT 1EFXA 4RAVB 3UO1L 4Q9CA 4JY6B 1MH5A 3KPQA 4PY8I 5ISZB 4J12A 4I5BB 3VXMA 3DYPA 3TBWB 1U3HC 1N6QL 2X4QA 1DQML 1WZKA 2IF7A 4KVCH 5C0AD 2VQ1B 1T1WA 5C0CD 2C26A 5D7SL 1U3HB 1NEZG 4RDQF 4HAFA 4JRYB 4OLWH 4ZMAT 2ZOLB 4GT7A 1TJIH 5D1XB 1BIIB 4DQOL 3P9LA 3ZDYF 5HGHB 1FL5B 2X9WA 2R2HA 5JUEH 4JO3H 6FABL 3BWUC 3EYUL 5KSAB 1U92A 3L5XH 2NY7L 3GSUB 5DJ0A 3IDYC 5K9KA 4K3GA 3HZYB 3WN5C 5AYUL 1KJ2L 2W1NA 5FHAH 1A4JA 2AQ1A 2VZVA 3RNKB 1QQDB 2FATH 3CX5J 4QHNB 4E42A 2FEDC 4FN0A 2XFXA 3IDYB 3KPOA 4UUJA 2NW2A 1NMBL 1DBKH 4I4WA 3WJJC 3MNVB 5HDBF 3P2TA 2NY6C 4PJ7B 5IW1A 3EZ8A 1CFVH 1T0MB 4LSVH 3OX8B 4MNQB 1FCCA 4GMTH 3OKLB 1AIFA 4U7SA 1L0XA 1MCQA 1NGQL 2NY6B 3HCVB 3S9DB 1YC7A 1MRDL 3FB5A 3V4UL 4M43L 4J3UA 4BFIA 1XGTB 5EU4B 3ULUL 2FJFB 4OCXH 4WFHD 3B9VA 1IM9B 1KEMH 1HCVA 4JPWL 4YPGA 1IC7H 3VI4F 1G6RH 1CU4H 2X40A 3LKOB 5DK0A 4BZ2L 3KXFB 2ZJSH 5HBBA 4HS6B 3JV5A 1FFRA 2I60H 4R6UA 2XTJC 3GI8L 5EUKA 3L3IB 3CLEH 3BYTA 5IGXH 1PDKA 2CRIA 1IKFL 4WI3A 4Q97A 3MJ7B 5EN2B 4CW1B 5I76A 4OLXL 3VXSB 4YDVB 1WIOA 1JFQL 1VFAA 3S88H 4XP6H 3SGDH 1DUZA 3FOLB 2OZ4L 5JXEA 1D5XB 4NN7C 3KPRE 2DI9A 4MJIE 1FFQA 5KAQF 1V8HA 5D6CB 5E4IA 3HRZB 2WWKO 4YZFE 4NN7B 2JJUA 5CBEB 1I7TB 3GMLB 1GPOL 5IG7A 4MJIA 2ICWJ 2YK1L 3D85D 4NZJA 4XNUH 3KGRA 5I16A 3RY6A 2HJLA 5E70A 3RTQA 3JTTA 4R0LC 1GAFL 4GRWF 4MAYD 1NBYB 1G7MB 3AS1A 5FGCB 3C5ZC 3UYRL 4YK4C 3TH2T 5CMAA 3W9EB 1V3LA 5BO1L 2Q76A 3RWDB 1BQHB 2Q86A 3DO7B 3C5ZB 3P3YA 4FQCH 1I8IB 5FECA 2NNAA 1M71B 3PDGA 2VNCA 2NY3C 3LKNB 1KJVB 4PJGE 3MREB 1CGUA 4ODUA 1YEDB 5FOBA 1XR8A 1W0VB 1U8MB 4X7SL 5BVJB 3KPMA 3Q5OA 3KPPB 4G43B 2NY3B 2CGRH 2GUOB 3EO9L 5E56A 4G59A 4KPHH 5F44A 4IBLT 4K94C 4PJGA 3PP4H 4G6FD 4XBEH 3TBTB 1ZOXA 4G5ZL 4S1SL 3K1KC 3DROA 1MQKH 1YY9D 1MY7A 3MCKA 3HC4H 1CF8H 5EPMA 4OCWH 1S7QA 5CINL 5DHXB 4QGTA 2A6JB 4NQDB 3C5SA 2WSKA 4HH8A 3WEXB 3ZLQC 8FABB 2J8HA 2FECL 3T2QA 4PRPD 4WRLA 3VFSB 4LHUD 5ALBH 1KLUB 1JMXA 2H2SC 3SCMD 4WUUB 2DQFA 2OR9H 4EI5C 1FC2D 4JG0L 1NAMH 1FFPB 2GCYA 1PD6A 3O45A 4CDHA 3HI1A 1PG7H 1I4FB 1C5BL 4QGYA 1AE6L 4P2YA 3BQUA 3LRHA 2X4TA 1SYSB 4G8FA 4EI5B 2VAAB 4JDVB 1YUHB 1S7TB 5FCUL 4F7TB 3ZE0F 1I75A 4OCSH 1X7QA 1UWEL 4L8CA 5HDLA 4FQ1L 4I0CC 3UZEA 1NQBA 4F9PA 1A1MB 1H3UA 2VERN 3ARGA 4D9RD 3MLPA 2IGFL 1G9MH 4MNGE 4XCEB 1SY6H 2VDKL 5IESH 2A6IB 2EXYC 1C12B 3TT3H 1T22B 3VRLE 3NCYP 3TPUE 2EDNA 1X3DA 43C9B 4Z0BL 4MXWH 2K7PA 2HT2D 4S0TD 3IETB 5CEXB 2EE6A 3GMRA 4CVXB 3JBG7 1ZHNA 1E4KC 2I07A 4MNGA 1T21A 1IL1B 4O58L 4S10A 4BELD 4ZAKD 3MLZL 4KQ4L 2YD2A 3CVHH 4MA8H 4M62L 3CZFB 1QBAA 4UNTA 4NKMA 2V7HA 5HVFB 2B0SH 1HKLH 3RKDC 3U9UA 1NMAH 3VXMD 1DQDL 4HT1H 2GITA 3IDXH 3MRPB 1HHIB 5EZIH 4GRWB 4JLRB 1W0WB 3WFHA 2WINA 3U1SH 5DURD 3SGEI 3EO1A 3VWKB 5GSVB 3GHBH 4HHAB 1JTTA 2FX9H 1HK6A 5I15H 2P8LA 4F37F 1KLFA 2DBLH 1HEZB 2EH7H 1A6UH 4GUPB 1MCNA 1X5FA 3MQIA 4DGIH 3HZVB 4KXZI 1KYOK 5LQBL 2WK2A 5GXBB 5BVPL 4XH2B 3WUWB 4X0KA 4QF1B 1RHHA 5EO9B 1A8JH 1OQOA 4NO2B 1B0WA 4HUKB 2DQHH 1CLYH 3NCJL 1C08B 3QI9C 1IGMH 2BRRL 2W9EL 5GJSL 4JFQA 5J6HA 1LP9E 5E5MB 2DTSA 5D6DA 4YBQD 2YWZA 4PLJC 4HF5L 4Y5XA 4FQXA 4NQUA 1IGIH 4Z7WE 4GH7B 4HS3B 5C0IB 2R9HC 1BQHG 1LP9A 3E8UL 4YDJA 2OJZL 3EZJB 4UT6H 2GFBB 1DQJB 3RI5K 2JJSC 5HPMB 2A77H 4U2ZA 4Z7WA 1G7QB 3F7RA 2DIJA 5HGDA 4Y16D 4R7NA 4X6CE 2XNAB 2OK0L 2H1PL 4ELMF 3QUXA 1WWAX 4HH9B 2AXGA 4ELKB 4PR5B 5DEZA 2FR4A 2F58L 3SOBL 3PWLB 3FFCE 3FB7B 4O00A 1I1RA 3DYOA 1A6AA 5J1AB 2DQGH 2HVKB 4W70A 4X6CA 5DEGA 2YD7A 2ZSWB 1FDLL 1VPOL 2P8PB 5ICXB 2EYTA 43CAA 1ZA6A 3EHBD 5DQJA 1UM4L 1RZKH 4IMKA 2F19H 2VR9A 1RI8A 2XZQH 4JCMA 1ZLSH 3GSXA 1CTOA 4LSDA 5D8JL 3GJEB 3PWVA 4DKEH 4KAQH 1EV2E 1IBGL 4UTBH 4ZNEE 1KJ2A 2BJMH 4U6TA 4F15C 1NFDF 4WEBH 4OIIL 1RJLA 5DWUL 4L8SA 3C2AL 4MXVE 4PPTA 1P7KB 5HI5D 2VLRE 4XPBH 3G6DH 1JPST 3ARDC 3L3DA 2W92A 5LVEA 3B8SA 3LIZH 4LIQH 2XRAL 4ZNEA 3O6LH 1XGYL 1A6VL 1KTLA 3WS3A 3KPRD 1HNGA 4MJID 1AO7E 1MHPL 3UPCA 3ULUE 5BV7L 3ARDB 3B9KA 3RTQD 4JRXE 5A3IC 5T33H 1WWCA 2VLRA 1NC2A 2VSDA 1Q38A 4ODVL 5BJTB 5F7EL 2APFA 3BZDA 1TZIA 1IAOB 2I5YL 4N0UA 4JFEB 1S9KC 2Z8SA 2DQIL 1AO7A 2EE2A 4UAOB 3GKWH 4JRXA 5HHNA 4TN9A 5EU3A 1NFIA 3V6OC 5E95B 2DDQL 4HIHA 1AGCA 4YO0B 5F7NC 5FDWB 2ZUVA 1N3NA 3LKQA 5MHSE 3MPCA 4PS4H 3CPLB 3LQAC 4UV7L 1RZ7L 2JJWA 2ESVB 1G7IB 4LSUL 4RSVA 4P99A 1RUAH 2H45A 4BSWB 5J9PA 1IGTA 2FH8A 4LSPL 1OAZH 4NGHL 3SKNB 4Z76A 3CLFL 2OXGA 4OGYL 5ITFB 4OLVL 4QTHB 2I25N 5K9OB 1D5MB 4ZOEA 1LEGA 3UTPE 1MFAL 3OAYK 1F42A 1IEHA 2HTKD 1BECA 2EDXA 3ARFC 1CGYA 2BP3A 4HXBH 3NACH 3O9WA 4CNIB 4U6YB 3C2SA 3QEGH 1G84A 1CK0L 2CPCA 2EO1A 1QR4A 1P4LB 3C9NA 1M7DA 3RIFF 3GSWA 3ARFB 2PW2A 1HCFX 2X44D 1MLCB 2CKBB 3EYQC 2KH2B 3MLTB 3TYGH 3BQUD 4KI1A 5IHZA 1JUFA 4TUJB 2HRPL 2OQJB 3EJZC 4U1IB 2BNUB 5KTEH 1AGFA 1IAIH 4OF5A 5ACZB 4JPKH 4YNYA 3DSFH 1X5GA 4FZ8H 4X5XA 3BZ4A 1JYNA 1KG0A 4M1GH 3ALXA 4BQBA 1UEYA 4DZBA 2HAZA 2M1KA 1NDMB 4TNVF 5IEKA 4U31A 5MI0B 3PWUA 4WY7L 4ONGH 3BOVA 4YEFA 3QDME 2O5XL 2DQTH 1ORSB 1CE1L 1FYHB 3T77A 1NFDB 1A7NL 2AK4E 2BDNH 3B3IB 1RUKL 4XCFL 4WI5A 1I9JL 4ZOAA 1NUNB 3L5JA 1VFMA 4PJXF 3ZT5A 4NZRL 3FO2A 1EZVY 3SDYH 3BDYL 4G9DA 2B1HL 2BSED 4PBVC 3HUJE 5EO1B 3EIFA 1Q0YH 1KCRH 2ICEB 3U4BH 2AK4A 5IB1A 1N2RB 4LU5L 4X6DE 4G3YL 4DN4H 1JZ3A 5F72S 1MREL 2H32A 1OLZA 2N4IA 5B39B 4MS8A 4QWWC 4PJAA 3RBSA 2N56A 1EO7A 2ILLA 4U6VL 1BFSA 3L3JA 1PZ5A 4N68A 1JPSL 4JY5H 4YHLH 3HUJA 2AV1B 5FK9B 3SY0A 4FXGB 5DHYB 4X6DA 4XNQB 3BT2L 3MROA 3D87B 3BSZH 3ZE1F 4Y7MA 3QAZC 1XZ0A 3ILPB 3HC0A 4U6XA 5JW5A 4PJEF 5HTSA 2YN5A 2V2TA 3S96B 3D18A 5E8EB 3ZL4L 4IRJA 2GJ6E 4WI2A 2F53E 1AR2A 3ECBB 3QAZB 5K59F 4A6YB 4HWUA 1TNNA 5CZKA 1AY1L 4PV8B 2LFGA 3WFBH 2L0DA 3BN9D 4NM4H 4Z78A 2FHFA 5GJTH 1P6FA 2GJ6A 3GBML 3SQOH 2F53A 3TIDB 3F7PC 4PJCE 5LAXB 1BX2B 2O5YH 1PY9A 3JWDL 3X3GH 3RWGA 1FV1B 4G8IA 3CVIL 1BVKA 4FQXD 1RVFH 2DMKA 3BP5B 1X4ZA 2C9AA 4Y4FC 2GTZB 2VDLH 1UM6H 4BQ8A 4PJCA 3CXDH 5EORH 1ZT1A 4XMLH 4TRPH 1PFCA 4GJTB 2VIRB 5FA4A 1OP5H 4E41E 1XCTB 3MRJB 2OBGA 2EDQA 1V05A 3QUXD 4UQ2A 1YEGL 1TJHH 3LZFH 4XRCA 3F12B 3HAEG 2YPKB 4PG9B 2EDWA 4P3DB 4ZUWA 3MBEA 1M6OA 4NP4H 2XWBA 2Q8BL 4K7PH 1EIBA 4E41A 1ZVHA 1AGDA 2PTTA 3FQNA 5JDJA 1XAUA 3PIQA 2CO6B 1OAYH 5CBAA 4PTTA 5EULV 4QRRE 5CEYA 3PJSA 5SX5K 5D1ZA 4ZD3H 3FFCD 4JFYA 1DLFH 1F6AA 2L4OA 4GQPH 4Y4KA 1AR1C 4Y5VA 1I7RB 1KYOJ 3K3QA 1K8IB 1R3HA 1FORL 2AKRA 1MRFL 3QWRA 1YQ2A 2AEWA 4GW5A 1WSST 1FO0L 4QRRA 4HKXA 3H7BB 1XCQB 2PO6B 1SM3L 2DTMH 1ADQL 4P3CL 2H8PA 3T0EB 5D72H 2XT1B 1QKZH 2EYSA 3QIUC 4PJXB 1JHLH 3VFRA 4J3VA 4NQVA 5FKPB 4K23H 4X98B 1YNTB 3IAPA 3DVNA 4LRIC 5GS0H 2J6EL 5MEQB 3TESA 3QIUB 3TBYA 2VLRD 1NC2D 3LRSA 5TE7H 4PGEA 3WO4C 4H1LA 1ZVYA 5FUOL 4AT6A 4XWGL 1AO7D 1CT8A 4L9LB 4RMUA 3ULUD 3AM8C 3HKFA 1RIHH 3BISA 4JRXD 3KDMB 3WO4B 4FS0A 3GHEL 4V3DB 3AREA 2GKIA 3JTSA 4NN6C 1MI5B 1TQCB 3LQZB 4PDCE 4PJEB 3IJYB 1CQKA 1WBZB 1BEYH 3OGCB 3RWFA 3B6SA 2EXWC 3SDAA 5E6IA 1FZOB 4JY4B 1NCCL 5I9QC 4JJ5B 2RHEA 3ARXA 1HWHB 5SV3A 4X6FB 3CFJB 2HG5A 1KBGL 4YXLL 5MHSD 1U93B 2HLAB 3BIKB 4QRPE 4HIIB 5B39G 1UT9A 4U1SA 1HILA 2X1PA 1JRHH 2WUCH 4N1EA 3SDXE 1DSFL 1ZK9A 5GS1A 5DLML 5DEFB 5IFHH 1DBAL 2E5EA 3B2VH 4X7TB 3IVKA 4OQTL 5KSVB 5LCVL 4HWEL 5GRVL 4L9DA 4N0CA 4QRPA 3GKZA 4J3XA 4JQXA 2BXYA 3B2UD 1BPVA 4Z7VF 4M1DL 4YGVA 3SDXA 5I17B 4J3OC 3O9WD 3HNTH 2UV3A 3Q1SL 1INDH 4WU5B 4BFBD 1L7IL 3BXNA 3LD8B 4JN2A 3UTPD 3FONB 1R5WA 3AAZA 1CDGA 5EBLA 3V6FB 2AJZB 4GMSL 4YUEL 3QRGH 1WZLA 4ZFOB 3H3BC 1KCVH 3MUZ1 1RMFH 5EC2A 2AJUH 3PL6D 1MFDL 1U8JA 1QA9B 2V2WB 1H3WM 5F9JB 1A6WL 1HZHL 1JNNH 2G75B 5C0EB 4M3KB 2EDYA 1CDYA 4XI5C 1A7BA 1VESA 2CLVA 3DWTA 4HWNA 4NRZB 1FH5L 1W72H 1BZQK 4HKZA 1NAKH 3GIVB 4ZUUB 3WKML 4F7MA 3DUUB 4YIQA 1OT2A 3CFDA 4X9FA 2JK5A 3O8XC 1Q94A 1EA9C 1IC5L 3QDMD 4MA1B 2P1YA 3ARVA 5KSUA 5HDQL 1V7ML 1INQB 5BZWB 5JPMB 2UZYB 4JPIA 1HWGB 2YPVH 4F7EB 4R3SB 1ZWIA 5DJ2A 5FF6A 1HDMB 1YYLL 4BFGA 3O8XB 2AK4D 1U8QB 3MACL 1LO2L 1T1YA 4UOJA 1ODAA 1VACB 3MNZA 4I0PD 4LLUB 4NRXB 4MS8D 3LDBC 5E8OB 5KW9H 3MYJB 1T2QH 3ZKXC 2J7LA 2R1YB 2VLLA 4OZIE 3L3OA 1DQLL 4XT1C 4DKAA 4KK8C 2XA8L 5D1QB 3DBXA 4HMCA 4LEOB 3S98A 3H2WA 4K3DL 5J4MA 2W0FA 1C8PA 3ABZA 4JR9H 5K33A 1YZZA 2XG4A 2R56L 1KIPA 2KDGA 4MYWB 4NQEE 1LE5A 1RK1B 4QY8B 1CBVL 4G8EB 4OZIA 5F1IB 1K8DA 5C2BL 3TPKA 4LLYB 1LE9A 3QDHA 2AEQH 4M5ZL 4IRJD 4TTDC 3K1DA 1U91A 1VADB 2FNBA 3FQWA 1WT5A 1ACYL 4KHTL 4O2CB 5GQBA 3MLYL 2IMNA 1QG3A 4UTAL 2R8SL 3IAQA 3WDIA 5HHME 3FAWA 2XPGB 1JWUB 1JGDB 2GJ6D 3ARUA 5FEBA 2F53D 4QHKJ 1KT2A 4R7DB 1SMAA 3WFCL 3NZHL 4GAFB 5T5FL 2NY0C 5HHMA 4OF6A 4UIMA 1INEL 4ZPTB 3IU3B 2VXQL 3F5WA 4O2EB 3QXTA 2AI0H 4JG1L 2XQYK 5EU7E 4WJ5A 2DQDL 1KC5H 4NQCE 3T0AA 2NY0B 4Z7VB 4P23B 1T7VA 1EHXA 2ARWA 2RR3A 4HIXL 1KB5H 2IPUG 3K8MA 1IEAA 1EXUB 1P6AB 2Z9TA 5ESQB 2OTWA 3WXVL 4OCYH 2PUQT 1E4XI 1CFNA 2P5EB 4NQCA 3IFLL 3VFOB 2NZ9D 1CQYA 3BP4B 1JGUH 4S1DD 5D7IE 4MCYA 4QXUL 5B38B 3BWAB 3MBED 3LEXB 1RUQH 2DM3A 4E41D 2VDOL 3FRPG 4H88L 4RWYH 4PG2C 3LH2L 3S34L 3JV6A 3VWJB 4CAGA 1UXSA 3IDIB 3TO4C 5D7IA 5D1ZD 3MV7A 1EEYA 3N85L 4HSQA 5E8DL 3ROLB 4IOIA 4Y4KD 1KELL 5CJOL 1G7HB 5I8EB 3QBTB 3V4PL 4QTIH 3SQBA 3TO4B 3RGVA 3QWRD 1UB6B 2HKFH 3IXAA 2DL2A 3O4OC 4QRRD 4GG6F 3TN0B 1FFOA 1SEQL 4GW1A 4R2GB 2GTWA 3CSYA 4IIQA 4M6OL 5GGRA 1DEEA 2B2XH 3CK0H 3VFGH 4OD2A 4PFEA 2CJUH 3TBVA 3ZSSA 3MV01 3O4OB 2NPLX 4HJ0C 1WAAF 1B3JA 5E9DE 4WV1A 1WBXB 3DUSB 1EEZB 2BSRB 3V79C 1C1EL 1EAJA 4D0BA 1OAQH 1QRKA 1MJ8H 5L6YH 4NO0B 4PB0H 1HIML 5IVXE 5I30H 2Z35B 4CVWA 4PJDA 4O4YH 4OIBA 4AENA 4ODTL 5E9DA 5ENWB 3QCTH 4GXVL 2UWEF 1CLZL 2CLZA 4N8VA 4YBLC 2MWCA 5IVXA 1I8LC 3JV0A 5C86A 3GSNB 3ARED 4UOW0 4IDJL 2YEZB 2EKSA 5FA3A 3WN5A 2D7TH 3H3PL 5SWQA 4YBLB 4ODXA 3QFJB 3QNZB 5E6ID 5E99L 2YBRA 1XH3B 4OB5L 2V7NA 2E3VA 3H9SB 2LABA 5TGBA 4JCLA 4I48A 4MQTB 1AFVL 1YA5A 1ONQB 2FJGA 3V5KB 4EN3A 1JK8B 4EKXA 1FO0A 3KJ4C 3U30C 4RGOL 2AP2A 4V1DA 5SWZB 2NY5H 2CRZA 1VSCA 3IF1B 3MRGB 3JV4A 3KJ4B 4YDKL 3RVVC 3U30B 1MQ8A 5F1OB 5C9JB 4N0CD 2R29H 4QRPD 2VL5B 2G9HA 1FVEB 1WZ1L 4AJ0A 2J6EA 5IFJB 5IMOA 3IAGC 4F7CB 4HEME 4LLMA 5HI3C 1A3RL 3DURB 4XXCC 5FDYA 2J5LC 4MCZA 4FQLL 1U8IB 1YEHH 2FLRT 1ZKAA 5L8LB 4RBPK 3GSQA 5JW3H 2CIIA 2J5LB 5HY9B 2R0ZH 1ZTXH 3NZ8A 5TDOB 3GI9H 4D2NA 4DFIA 4HWZA 1JHTB 4YPJA 4JZJA 5DFVC 1HI6B 4Q6IC 1GGTA 1KIQB 5DVNA 3NOIA 2EDRA 5E24E 1X5XA 1GVIA 5IB3B 1QFHA 1BWWA 4KI5F 4NYLA 4OIAA 4DGYH 4OLEA 4JVUA 3U0WL 3R1GL 3X14B 1S7WA 4P48A 4KRPD 4P59H 3SPVA 5B3JE 3SKMB 4XTRC 4F57H 3PGDB 1J9CT 2VXVH 3MA9H 2Y5TA 3UDWA 1P9MA 4GG6B 2CDFB 3QEQB 5MERB 1JJUA 3VXUA 4UB0L 3O3EB 4O02L 2P5WB 4P4RA 4Z7QE 4TOYH 2LTQC 3MO1B 5EA0H 2W60B 4PY8J 1T6VN 4EIGB 5B38G 3DARA 2E27L 4WW1B 4BM7A 2Y23A 2IALA 4AQ1B 2LTQB 4OZHF 5ANMB 2CUIA 4ONFH 5DD5H 4OFIA 4JFXB 1U58A 3HI5L 4NKDA 4HUXA 4Z77B 3AXLB 1T0NA 3ZHLA 3HE6A 1P53A 3MRNA 3Q3GB 4LMQI 1PKQA 4HG4J 3UTSB 1AXTH 1CD1A 2NXYC 5L2JA 5ESAB 4M5YL 4ZYKB 4PREA 5H37G 3DVGA 2VZSA 1CL7H 2EECA 3MRQA 1I85A 1HSAA 3MODL 5E8NB 4NC2B 2Y25A 3BPCA 3DO3A 2B4CH 2NXYB 4W6WB 3NIDF 2WM0A 4MD0A 4RFEB 3MRHA 1EO5A 1I8MA 4Q0XL 3G08A 4HKJA 5BQ7B 4NQED 4HFUH 4J6RH 4KQ3H 5GSRA 4DW2H 4HZLB 2BVOB 3KHQA 4J23A 3KYOA 1MCBA 3ZDZF 1OTTC 2AXFB 3CD4A 4H20H 4YLQT 1BQLH 4E0RA 2DQEL 3BKMH 1RZFL 1JNLH 1T20B 2BVQA 3GO1H 5C09B 3OKOB 1TZGH 1HHKB 3PGFH 2QQKL 3P73B 5HHMD 2Y6SC 1BGXH 3OAUL 3PG2A 3QUMB 5IMKA 3KPNB 2YD4A 1MCEA 2V17H 2AXJA 2Z31C 4XCCL 2EEAA 4XP1H 1E28A 4UT7L 4Y2OA 2VDNH 4KK9C 5AAMA 3RU8H 2O5ZH 3VXNA 4LCWE 4IS6A 3PDDA 2Z31B 4H26B 1JGEB 2JCCE 1FGVH 4E9LA 1F58H 3MRLA 2FGZA 1XF4B 4LPVA 2G60L 4NQCD 1E6OH 1MCRA 1MHEA 3HNVL 5GGSA 3S37L 3BHBA 4LCWA 2JLLA 3JWOL 1X5IA 2A74A 2F8OA 4KI5C 1KCGC 3AB0C 2B1AL 5HD8C 2BHUA 2WLZA 4GS7C 1BD2E 1MHCB 1WCQA 1NCWH 4XNMA 1QSEE 1C5DA 1YEFL 1E4KA 3KLHC 1KFAL 5GISH 4XPTH 4Y19B 3P11H 3AB0B 1GZQA 4GS7B 4R4BA 3PQYB 5B4MC 3N9GL 5IJVA 4OSUH 1BD2A 3PE9A 1MCSA 5HGAA 5JIPA 4M1CC 1Z5LB 5DSCA 3M1BB 1EVUA 1WFNA 3WDJA 3KAAA 4K9EH 3VG0H 1TJIL 4CDGC 4ZG1A 5EBGA 4ALAL 2DQJH 2P44B 3ARBA 1S9VA 4FNLL 5GGUA 5GZOD 3IFPB 2Z93A 3NPZB 1T83C 2VLKB 4RMQA 4YHZL 1FPTH 1J87A 2APWA 1I9EA 1HQRB 4R26H 1FGNH 1GOGA 1LO4H 1Z0NA 2RJMA 4N5UA 3L5XL 5DHVH 3QXDB 3VGHA 4Q9QL 3P9WB 3QIWB 5D7LB 3G5VB 1SQ2N 5C6PB 4O5LH 3BO8B 4OZHB 3BEVB 2R1WA 1P4IL 1AKJD 2C4FT 1IM3B 2KL6A 5E9DD 1I1FA 4MSWB 1KLGA 3MBXL 3F7VB 5DJCB 4LCCB 4U1MB 4NZUL 5I1LA 1K6QL 1DTUA 1DBKL 1TPXC 3OPZL 4XPFH 4OTXH 3WKNA 3SDCA 4TSCL 3T0DA 1MLBA 3RDTC 2FWOB 3TA3A 1TPXB 4GMTL 3H8NA 1SJVA 3C6SA 3VJ6B 3BH9B 3MLRL 4NBZB 4Y1AA 3VU2A 3EOYG 5CD5D 4ZO8A 5D7JC 1J0YA 2C3WA 4GW4B 1UQSA 1GGIL 3RDTB 4HUUB 1T7WA 4NO3A 1XGPB 5I1HH 5GS0C 1JNHB 1IC7L 1B2WL 4EN3D 5DC9B 2WBJC 4IRSC 4PJFE 2YUZA 4U4BA 5HHOB 1JL8A 4BQ9A 4DWHA 3QUYB 5HYJB 1JFMA 1EZVX 4YQXH 2AJSL 1PX3A 4MAUL 3BZFB 2WBJB 1YMMB 3CLEL 4IRSB 5JW4M 1BF2A 3QH3B 1JE6A 2K7QA 3NCEB 4PJFA 3WIIL 3LN5A 1DVFC 3MLSH 4N8CL 3S36H 5I2IB 5IMMA 1NGXA 5D9SB 3T4YB 2JIXA 1JIBA 2I9TA 4GSDH 5CGTA 4HBQA 3BGFB 4N1CA 4RIRA 3BGAA 2ITDA 1OAKH 5CJ8A 1N8ZA 1BBDL 3KLDA 3GMNA 3EBAA 4JAMA 2XKNB 1I1AA 1XR9B 5KVMC 5I1DB 2IQAA 1P69B 1ZHKB 2Y36L 5ESVB 4P3WA 2DYPA 3IDMA 3A67L 2A73A 2ADFL 4YHNA 4AMKH 2GAZB 1Y6NR 5DQDL 4NRYA 3UJTL 2ZCKH 5DK2B 1NEUA 1CE6A 1J86A 1QEWA 2E6QA 2I9LA 5DUBB 4XC1H 1FL6B 1T7XA 4LQFH 1MCDA 4F9LC 4NUGH 4ZTOH 3ZDXF 4JQIL 2EYRB 5M94B 1QSFE 5D70L 3QXAA 4F37K 5C0FB 1DZBA 5JNYB 4LOUD 3HC3H 3VXTB 3D3VE 4DAGH 4RZCA 4C59B 2P8MA 1CR9H 1YN7A 1U8HB 5DRZB 1KTKE 5IFAH 4IEFB 3TCLA 5A16A 4LP4A 4C56E 2QSCH 3FQRB 1KCSH 4K3EL 1CXKA 3D3VA 4P57B 1T5WA 1OY3B 5F3HA 32C2A 3I6LE 4OLUH 4HBCL 3OXSA 3UBXG 1AHWC 3P0VL 3UPAA 1I9RH 3VFVB 5TH2B 1HH6A 4IRZH 4UILL 4C56A 3AS0A 1KCUH 3DSNA 3LHPH 2R1XB 3CJJA 1QUNA 2W38A 5C92A 4XNXL 2PXYD 2X4SA 1PAMA 4G80A 5CS7A 2HVJA 1LK2B 4AEHH 5FO7A 2J4WL 1RQ5A 1H3GA 1WGOA 1UACL 3MFFB 1OAXH 4YEEA 1G6VK 1ZA3A 4F33A 1MPAH 1FG2A 3FTGA 2DRUA 3B9EA 2DWEA 3VFWB 3VFPA 1GC1H 3BAEL 4ZXBD 4PJHF 4KY1H 4OD3H 3CFKB 3E3QC 3FO1A 1YEJL 3S35H 1LO0H 2NW3A 3MJGX 5FUZH 2ADIA 1QFWH 4NNXB 5C0AB 2RB8A 3IDNB 3O3BB 1AXSB 1SBSL 5C0CB 1SY6L 4KJQD 3I50H 5FUCE 3SO5A 1P2CA 5I8KH 1ZT7A 4B41A 1N6QH 1DQMH 1LNUB 3GK8L 3LAFA 3B5TA 1G7LA 1V7NL 3D25A 4L1HA 1BVLB 2DJSA 5FM4A 5JOFA 3ULVF 2ED9A 5D7SH 5IB2A 4AL8L 4LPYA 3PHOA 4W4NA 5DR5L 1F45A 5C71A 2BXZA 3QWOA 2RGSA 3E6HB 3VRIA 1A3LL 1WBYA 3UJIL 2OL3L 4LCWD 3MXVL 4DQOH 3RL1A 4I2XB 3QB7C 2NR6D 15C8L 2IEPA 3CXHJ 1NMAL 6FABH 3EYUH 2Z92B 1VCAA 3MJ8B 4PRAB 2NY7H 4ZO7A 5T1KB 3VE0A 2BNRB 4EDXB 3TEUA 3DRTA 4CL7A 1KJ2H 5J06A 1NLDH 2CXGA 3DTXA 5CAYB 1QHOA 4ESKA 1BD2D 3BGMB 3QDGE 2ICWB 1QSED 2DF3A 5E08H 5MEOB 4Y5YC 1NMBH 1OQXA 3ARBD 2C5DC 3V5DB 3RVWD 1PEZA 3KYMA 1CGXA 3U46A 3QDGA 3EDEA 1T3FB 4FXLA 4Y5YB 4RGMC 2CSPA 3MSPA 3PWJA 2WIMA 3RAJL 4XX1E 4UOW1 3T3PE 1DUYB 1MRDH 5DQ9B 2BNQE 4JDZB 2P7TA 3HG1A 4M43H 1HHJB 1MAML 3T0XA 4MXQD 5JDSB 4JPWH 5DVMA 4RX4A 1CZ8L 4BZ2H 3TO2A 4U3HA 1UJTA 2BNQA 2EIBA 3GI8H 3PF2A 3S3JA 3SDCD 1TZHA 5E2WL 4Z6AT 4JJHA 3AU1A 1U8PB 4GKZA 1QOKA 1BZ7A 4M6NL 1JF1B 3TA3D 1OWRM 3B43A 4L3EE 3NFNB 1IKFH 4NHUE 1ES0B 5DGRA 4BJLA 4X5WB 1XGRB 2FGWL 1S9WB 2VR4A 3N1QC 4OLXH 4P5TA 1JFQH 2H26B 1EO8L 2Z4QB 2OZ4H 4MAYC 1D9KA 1QLFA 4D8PA 3U4EB 4L3EA 3VDAA 3PHQB 4NHUA 3PV6A 2DWDB 4PJHB 3ROOB 4HQQL 5T3XL 1R3KA 1FJ1A 4GKNB 4MAYB 3PDOA 4OGAD 2G5BA 2I27N 2DAVA 5DFWH 1MIML 3P4LA 1GPOH 3MRFA 1T1ZB 2BCKB 5J6GA 3QCUL 5FGRA 5J0BA 5C9KA 5DJ8A 1RZKL 2F19L 1GAFH 1EMTL 2LV4A 3PNWB 3EOTL 2QLVB 2X7LB 3VGEA 3GRWL 3VDCA 3EO0B 4UTBL 1JV5A 3NMEA 2C7UB 5DJXA 3UYRH 1I9IH 1T7YA 1P4BL 2CIKB 3JVGC 2BFVL 5F7DB 3GMMA 5BO1H 3P40A 2JF1A 4YHKL 2GSGA 1JPTL 1Y6KR 2GSIA 4U05A 2BERA 4XPBL 3DHJA 1I1AD 3G5ZA 3BD4A 3LIZL 1ZHLB 2DYPD 4DZ8B 5IQ9A 1GHFL 1IGFL 1TVBB 1YY9C 1L9MA 4X7SH 3T8XB 2NY5C 3L9RB 1P5UA 1QRNB 4KZEL 4FFYL 4XHQA 3QNYB 3EO9H 3CH1A 1A22B 1IRAY 1R6VA 3SKOB 2J1KA 3IRPX 5C3TA 1UM5L 5DJ6A 1O7SA 2JJTC 2E8ZA 2WIIA 5ACLA 2G2RB 3FKUS 3SCMC 5IMLB 4G5ZH 4I3GA 4U1HB 1RURL 4FXKB 3VMPA 5HPOA 4S1SH 2FIRT 1D5BA 4PRPB 4LRIA 2D31A 3C8DA 3RPKA 4LHUB 4KJPD 2IPUK 3D69A 5CINH 2ZP0T 3X17A 2Z0BA 4N1HB 3KR3L 4MB4A 1QSFD 3TIEB 4JREB 4NN5C 3UC0L 4P2OB 2YA0A 4D3CL 1X6LA 5DJDA 5TDPA 3D3VD 4JG0H 3CIQA 2A6DB 5IKCA 4OV5A 1C5BH 1AE6H 4V2CB 1OAZL 4HKBB 3ZKSD 3C60D 3K4AA 3BIAX 1IKNA 3HMXL 2VLME 2AJ3B 4C56D 4J8RA 5DUPL 1BP3B 2HT2C 5H94A 3LKPB 1TVDA 1UWEH 1WWWX 4PRDB 2NLJB 4FQ1H 3I6LD 3LV3A 4ZAKC 3WIFA 3MA7B 3ZSTA 5IF0B 4POZC 2IGFH 2VDKH 2EEDA 2MHAA 5F21B 2W65A 5JHDE 2AK1H 2QKIB 4LSSH 3OKMB 4J1UB 4MQ7A 1S7SA 2FH6A 5IQ7L 4EVNB 5EC1B 1VGEL 4Z0BH 5DTFA 2VABA 4UQ3A 4R8WL 4XP4L 3MNWB 1I3VA 1EFXB 4TTGA 4O2FA 3ZKND 1XF1A 5KZCD 1MH5B 3KPQB 4O58H 1NBZA 5JHDA 4A2LA 3G9AB 2Y07L 3MLZH 2YSSB 1DBMH 4KQ4H 3VXMB 5KTEL 2VITB 4GQ9L 1S7VA 2YD6A 4X6BA 4M62H 1II4E 4JPKL 1E4WL 1ND0A 3QNXA 2BZDA 4OJFH 4FFZL 4JVWA 5C3LD 5AD0B 3O6FA 4EBQL 1T1WB 1F97A 4D0CA 1DQDH 3I6GB 1PG7X 1YECL 4JHWL 2B4CC 3ARZA 1OCWL 1B0GA 2DQTL 4AEFA 1FNGA 3V0VA 4F58H 1U9KA 4QHUA 3BFOA 2R2HB 3OHXA 4LPCA 1QR1B 4N9OB 4N5ED 5GGTL 4YBQC 1XGQA 2VXSL 3THML 5K9KB 4PJGF 5BVPH 1FNAA 4F3FB 1WIUA 4M48L 3U4BL 5IB5A 4F8QA 1AGBA 1UA6L 2D03L 3NCJH 2XFXB 4JRWA 5FFLA 5DXWA 4GAJH 3KPOB 4UUJB 1WIPA 2NW2B 4ZS6D 3VXQB 2BRRH 2W9EH 4L4JA 5GJSH 1ZT4A 4YHLL 4JY5L 4EUPA 1BHGA 5IW1B 2BSSA 3AVEA 4U1KA 4Y16C 4HF5H 3UAJD 5F7MC 5LXGL 4MJ5A 3WD5H 1AIFB 1P84K 5ICZA 3O11A 2Q6WA 3E8UH 1HOCA 2OJZH 3FHQA 4HX1A 3FB5B 3QDGD 3WIHL 1A5FL 3KNBB 1SY6A 4F7PA 4JO1L 4BFIB 3K74B 2OI9A 3KS0J 4LLVA 3B8YA 1CFQA 4YPGB 5EB9A 5DK0B 3EHBC 4QRTA 2VSCA 4H1LH 2OK0H 2ED8A 3UMTA 3D0LB 2YS4A 4HK3J 2F58H 4RX4D 3SOBH 1FLTX 5IV2A 4X80L 5JXEC 5BOZG 1OD9A 3CVHA 2OL3A 4ZFGH 1MFEH 2BNQD 3HNSH 3MLUL 1VPOH 5HI5C 1C16A 1VFAB 4K9EC 4XMLL 1DUZB 4LHUG 2Y7QB 5TQ0L 1EAPA 3WXWH 4X8XA 3VRLF 4NPYB 3C8HA 3MRRA 5D8JH 4P5TD 3RY6C 2YHGA 5DD6A 3RTQC 4BH7A 1XEDA 2CMRL 4X4YA 2A0LD 2OLDA 1D9KD 3LZFL 4OIIH 1WLHA 3BJ91 5IG7B 5DWUH 4L3ED 5I16B 2HJLB 3RTQB 3JTTB 3GM0A 2XRAH 2XG5A 1XGYH 2IFFL 1A6VH 1NMCC 3BRDA 4XPHL 2ZNWA 1MHPH 1HKFA 4PV9B 2PCPA 5BV7H 5CMAB 1QLRA 3U2SA 2Q76B 2Q86B 2BRQA 4ODVH 5F7EH 3SO3B 4ACPA 2I5YH 4HUNB 2G5RA 2ENSA 4OZ4A 1BAFL 3OJ2C 3TYFA 2VZ3A 3G04A 4PP2A 1CFBA 5CLTA 4ODUB 1IAKA 1IGCL 1Q9WA 4EQ2A 1L0QA 1IAMA 5C0BA 3HZKA 5D72L 1QKZL 5FIEA 2B5IC 3HFML 1AQKL 4JKWA 4M61A 5LBSL 3BKJH 2F54A 4UV7H 2HTKC 3L3KA 1RZ7H 3TM6A 2ZUQC 2B5IB 1F3JB 5F9AC 1TTUA 2FLBT 5T3XE 3MCKB 4LSUH 1RJZA 2GW5A 3RZCA 1S7QB 1A47A 5J56B 1LP9F 2X2YA 4LSPH 1ZS8A 3MRBB 4NGHH 5D5ME 5BS0E 3CLFH 3C5SB 1YPZE 2R4RL 3OKNA 1EK3A 4OLVH 1SBBA 1A3QA 4LKCA 4U1LA 3QUZD 5A43C 2FEEI 1FG9C 2QSTA 4Z7WF 3BQUC 1MFAH 3ARQA 2DQFB 2XZAH 2GCYB 3NH7L 3ETBF 2PYEA 5D5MA 5BS0A 3DMMA 5C0RL 1FFNA 3I9GL 1YPZA 3RWCA 1YQVL 3IT8D 1DLHA 3BQUB 1A6ZB 3RI5F 1CK0H 4G8FB 3EFDL 5B21A 1U8NA 2E7HA 4F9PC 1TVHA 3FQUA 2XZCL 1QVOB 5AG8A 2AS5M 1X7QB 2J88L 3FT2A 3QEUA 3GRWA 4L8CB 5LGHL 3EDDA 1F8TL 4H25B 1H3PH 2EC9U 1OB1A 5IK3A 4YFLI 3ARGB 4I18A 2DM4A 1TTFA 5FHBL 2JB6A 3NA9L 5ERWA 4JFHE 5F6HJ 3VI3E 2QQLL 3SGDI 1SJEB 3OKDB 2YXMA 4NM8L 1ETZA 4M8QA 5JTWA 2E6JA 2R0KH 3GMRB 2VLMD 1ZHNB 2I07B 5ISZE 5FXCH 2YD8A 1T21B 5JA9A 2IG2L 2R23A 3GFUA 2O5XH 1FLRH 1A6TA 4NKMB 1HXMA 1CE1H 2VN7A 4Y2DA 3QRGL 5JHDD 1RUKH 1VDGA 4JRYE 3U9UB 1I9JH 1KCVL 1RMFL 2F8XC 2NY2D 4M8VA 1PSKL 2GITB 2MSPA 1OHQA 2DJUA 4NZRH 3P30H 2VQ1A 3WFHB 5IHLB 2WINB 3BDYH 3REVA 2B1HH 3O6FD 5IOPA 5D93C 3FCTB 3ULUF 3S3PA 4LU5H 4OFDA 4G3YH 4JRYA 2P8LB 1OP3H 2N1KA 1GL4B 4U6VH 2ZPKL 3W9DB 5D93B 1BIIA 1OW0A 4OQ1A 5DC4B 3WLWD 4W4OA 4X0KB 3BN9C 3BT2H 3HMXA 4OCLC 1YEEL 5D2NE 1RHHB 5CWSA 4DEPC 4NWTL 5KOMC 5D6DC 3UCRA 3ZL4H 3GSUA 4LCYA 4XP5L 1MFBL 5T1MA 4Y5XC 5E2JA 2YPVL 2IPKA 4FQXC 4JFQB 3EGSA 2X4NA 4DEPB 5J6HB 1DANU 5MEPA 5D2NA 3DYMA 4RNRA 5CJQL 1F2QA 5KW9L 2Q7NA 1AY1H 3U7WL 5L9DL 1NCBL 3CAFA 3GBMH 1LVEA 3MNVA 4QNPF 1LP9B 3K0WA 4UBDD 4JR9L 4XMKL 4RMRA 3JWDH 3OKLA 3QUXC 3KXFE 4Y0GA 2OTUA 5FAAA 2AEQL 5HGDB 2QQQA 2HA1A 3MV9B 2NY4B 1LWRA 1U95B 1H5BB 2YUVA 3CFCH 3QUXB 1XGTA 5F9DC 4LQ1A 2AXGB 3WUZA 5GRZA 2JB5L 1KSRA 1UCBH 2C4XA 3INUH 3Q6FA 3KXFA 4DVBA 3VGAC 3MCLL 4IMKC 5DEGB 2KZ1B 4E5XB 1YEGH 2X4RB 1PVHA 4WO4D 1FNLA 2EYTB 1ZA6B 3VGAB 43CAB 3R06A 5DQJB 4M02A 3CFBA 3GGWA 2Q8BH 1FE8L 4ZDHB 5IW3A 3WDHA 3IJSA 4CW1A 3ORJA 5F70A 4L8SC 5C0DA 4YDVA 3LQAL 3QA3A 5CHNA 2FB4L 4OLYL 4LGRB 1PJ9A 1RJLB 4L8SB 5GRUL 5D6CA 1I8KA 2CXKA 5CIPA 4NBXB 4QHLA 1MRFH 1BFTA 4JFFE 3P9MA 1DBBL 3GMLA 1SM3H 1X4YA 3FL7A 1ADQH 4P3CH 1SYVA 1SEBB 2DLEA 3B9KB 4PJAF 3ULUC 4FFVD 1NBYA 1NC2B 2IH3A 1G7MA 2BY0A 1QFUL 2CKBL 4MJ2A 1TZIB 4JFFA 4NC1E 4N0UB 3HUJF 2OMBA 2J6EH 3WIHA 4MMXC 4WDIA 1OARL 5IHUL 1K9TA 2HKHL 3ZDYE 5L8KB 4OFVA 4X6DF 3WE6A 5SV4A 2Y06L 4I0KA 1FZMA 4JRXB 4HLJA 5HHNB 3ZTNH 5DJZA 5EU3B 1NFIB 5J7CC 5FUOH 2VH5L 1NBVL 1N3NB 1KJVA 3R8BB 1YEDA 4Q2ZA 4K7PX 4HMEA 5L2KB 3WNOA 3MOQA 4N9GB 3MRIA 4XAWL 4KXZH 3GHEH 5E00A 2BVTA 4G43A 1VEPA 1OP5K 2E8YA 3HZMB 5H8DA 2F9BT 4NQDE 5J9PB 1IGTB 1MWAH 5HDBE 2W91A 4Z76B 1MSPA 5L6YL 3P77B 3VDBA 1ZANL 4PB0L 2ARJA 3U0PA 3B2UC 5I30L 2ERJB 4YXLH 3RZCD 4UV4L 3O9WC 1LEGB 1J0IA 2QV2A 3OJDA 1XF5A 2A6JA 1ROWA 4NQDA 5HDOA 2V9RA 1ZSDA 1DSFH 5DLMH 3IYLW 3VA6A 2MOVA 3S8WA 4WENB 4PBXA 3VFSA 1VERA 3O9WB 2D7PA 1DBAH 4AH2B 3N1GC 2PKDA 4OQTH 5LCVH 5T3XD 3C9NB 1M7DB 4C54A 3C6LD 3GSWB 5BS0D 2ATPA 3DMMD 1V3JA 4M1DH 2W0LA 3PL6C 5L0QC 2A2QT 1L4IA 2H2PD 3Q1SH 1HHGA 5IHZB 1B9ZA 1JUFB 3VW3L 4G8GE 4JFOB 4PLOB 4JM2B 2DKMA 4OT1L 4BKLB 1BJMA 3WNMA 1AGFB 5TE6H 2WP3O 4PP1D 4YNYB 1KIRA 3QHFH 3BZ4B 1KG0B 4GMSH 4KJWD 4YUEH 3RWHA 2ORBL 4XCEA 4A6YL 4DZBB 3HR5A 5IEKB 4G8GA 3JXAA 1NDGB 5FCSH 3TFKA 2DLFL 1MFDH 1MF2L 4DGVL 3PWUB 3ZZ1A 3LMJL 4AEIH 1PLGL 1A6WH 3IETA 1HZHH 4PB9L 5CEXA 2MNUA 5EBMB 4CUCA 4JFHD 3T77B 1RY7B 2A9ML 5A2LH 2IC2A 2JELL 2BVUA 1J5OL 1FH5H 3CZFA 4I0PC 1KJMA 4MS8C 1CDCA 3FO2B 3WKMH 4MA7H 2J8OA 1LQSR 4G9DB 1R5VA 2LAGB 1ZTXL 5ISZD 4Y2DD 2CKNA 5I8OL 2AK4B 1LO3L 4PGCA 2H32B 1D5IL 1IC5H 3MRMA 4PJAB 5HDQH 3DGGA 3IDGA 1MEXL 1PZ5B 5GSVA 1YYLH 5I6XC 3MACH 4GG8B 1LO2H 4JRYD 3SY0B 1OTSD 4IRJC 4X6DB 2UY6A 3MROB 3DV4A 1G9EA 3W82A 1DQLH 1XZ0B 3HC0B 2QJDA 4U6XB 5D1XD 5I6XB 4AM0A 1JYVA 2X1XR 3HZVA 2V2TB 3D18B 4K3DH 4IRJB 4L3CB 3KG5A 2VXVL 5DUML 2OX5A 5EU6A 3QR2A 2R56H 3ALWA 5E5UB 3EUUA 4ENED 4UU9A 1CLCA 4P5KA 5C2BH 5KSAD 2AVGA 1C08A 4M5ZH 3JUZA 4R4FL 3LQMA 3MR9A 5ABDE 1EVTC 2F53B 2F5BL 1ACYH 3MLYH 3PP3H 4UTAH 2DQUL 2R8SH 1S7UA 4S1RL 4ONFL 1AJ7L 3SDDB 1REIA 3MRDB 3RWGB 5EFIA 4G8IB 1BVKB 4M9OA 5C07B 4XCYA 1MCFA 3WFCH 3WNNA 3NZHH 4DUXA 3E2HB 1ZT1B 2CDGA 4WFFE 2DOCA 5T5FH 5KSBE 3BPOC 4ZPVA 1INEH 3BE1L 4GKOA 2VXQH 2XIDA 5A40E 2IBZX 2NZ9C 4JG1H 1G7QA 5FA4B 4S1DC 3UX9B 4APQA 6CGTA 1S7XA 4P9ML 2DQDH 3MBEC 3CX5K 1FZKA 5DYOB 1AGEA 2NXZD 4L5FL 1L7TL 3O2VH 2OJEA 3BPOB 2QSQA 1JZ4A 1AHWA 3P0YL 2HLFD 3A6CL 4PR5A 5I18L 4XRCB 5KSBA 1HQ4A 4LP5A 4Y4HB 1MFCL 3KXFD 3MBEB 4ZUWB 1M6OB 2XWBB 2J8UF 4E41B 1AGDB 1W72A 4QRUA 5D1ZC 4CN1A 4Y4KC 4Y5VC 3IFLH 3HPLA 1JNLL 3PIQB 2X42A 3WHXB 5CBAB 4PTTB 5CEYB 1TZGL 3VXOB 1JGVL 5D1ZB 1QYGL 4WHTA 3LH2H 3S34H 4KKAD 5I71C 4Y5VB 3QO0A 3DETD 5HHVL 1G1CA 3REWA 1R3HB 1NKOA 2AKRB 2ADJA 5TE4L 1Z9SA 4GW5B 2M26A 4HGKC 4QRRB 4WTZA 4DVRH 3ILQD 3N85H 5E8DH 2F8VA 4HKXB 1KELH 3BKCL 1T80A 4MJ6A 1CD8A 1BM3L 3V4PH 1JZ6A 3EW3B 1TENA 1F58L 4H5SA 2EYSB 4U1JA 4JFEE 3VFRB 4NQVB 4L1DA 1H15A 3DVNB 1SEQH 4MZ3A 4M6OH 1YJDL 2D0FA 2P43B 4J7RA 5B8CC 3BYYA 4LSTL 2E7LA 3TBYB 3QQ3A 1QSZA 3LRSB 2DI8A 4PGEB 4X6EA 1S3KL 4JFFD 2BY2A 2EDKA 4TSAH 4IHOB 2HP4A 3AREC 5GISL 4G7VL 1B88A 1CT8B 2VUYA 4YDLC 2FX7L 4OI9A 1NGZB 1J1XL 3OR7A 1HIMH 3NCFB 3RVUD 4ZFOL 4OZIF 4OSUL 5E6IC 3VGBA 3AREB 4ODTH 4CJ1A 3JTSB 5CP7A 3V7MA 1BIHA 4YDLB 4GXVH 3RWFB 1CLZH 3BVNA 3SDAB 5E6IB 4J3TA 3UJJL 3G9VA 3UBXI 4CU8A 4Z18A 4YHIB 4IDJH 3GNML 4QYOB 5GS1C 1K2DB 4PLKD 1G7IA 2GK0B 1DEDA 3H3PH 1H3VA 3FQTB 5E99H 2RCSH 4Q6YA 4U1SB 1HILB 4OB5H 3L3HA 4QXWA 1KB5A 3HS0A 4N0CC 5GS1B 3TZVB 4JQXC 2H9GA 5KS9E 5FB8A 3IVKB 1FQ9C 1AFVH 2DICA 1NLBL 3FO0L 5HHXL 2OXHA 3K46A 4NQDD 4QRPB 1PY4A 4MDIB 4HMDA 3H9HB 2D7MA 4RGOH 1JWMA 5TPWL 4YGVB 4XPFL 1HN1A 4U6YA 2VDML 5F1KC 5IWLA 5KS9A 3ARYA 3BXNB 1B6UA 4YDKH 2D0GA 4JN2B 5BMFH 2CKBA 2ITCB 4OZFA 5EZOL 1U36A 2AV7B 4YE4H 1WZ1H 3ES6A 3DV6B 3MLTA 2HT4D 4I1NB 5EZLA 1JN6A 5F7HA 1R5WB 1NC4A 3AAZB 2QR0A 5GRXG 1EX0A 4U1IA 4FQLH 5F7WC 1I1YA 4Y8AA 1G7JA 1A7PL 1K3ZA 5EC2B 5ACZA 2W0PA 2J8UB 3SBWC 2XKUA 1HYRC 4RA3A 3MTRA 4KRPC 3H6JA 5D7IF 1NDMA 3FN0L 1ZEAL 4G8GD 2WWMD 2ZWLT 3TFKD 1N5AA 4K8RL 1GCFA 1U3ZA 4KRPB 2CLVB 4HKZB 4XB8A 2X6MA 1LDPL 2D2OA 1DN2A 1NUDA 3U0WH 3R1GH 5DMKA 1GGCL 1PZUB 4F7MB 1IC4L 4UNVA 1IMHC 4YIQB 4OM1L 5KN5A 4GSDL 3WS6C 2XWTB 2JK5B 4CVZA 1DE4A 1J8HB 1F2XK 5KSUB 1OAKL 3AY4A 1S9XA 2WBKA 4JPIB 5IHBA 2ZG1A 5JPNA 1ZWIB 4BUHA 2ICEA 4P46A 4UB0H 3JUYA 4O02H 2PR4L 4U3XA 1T1YB 3VFNB 3IJHA 3MNZB 3W2DL 1QNZL 4KV5E 1R3JA 1BOGB 4PJDF 3L3OB 3NAAL 4KRNA 4IMLA 2LU4A 1F4XL 2ZCKL 4M9PA 3VWKD 2E27H 2FO1A 4W6XB 3DBXB 2DM7A 3SJVE 2HT3D 3CX2A 1Z2KA 3CSBA 5CGYD 3WBDA 1F5WA 4FXGA 1KN4L 5DHYA 2W0FB 2VKWA 1RZGA 2YRLA 5IVXF 1IJ9A 1LE5B 1HYSD 4OZIB 1CXEA 1K8DB 2WBWB 1N5YL 1LE9B 4RGNB 3O2DH 3SJVA 5D96C 1U8KA 2OCFD 3FRUB 1U91B 3U4AA 1GGUA 2RIKA 4YDIL 3GSRA 5J89A 2DLGA 4EI6A 1CR9L 3MODH 1JRHI 3D1MC 3V4VL 3L3GA 2YUXA 4Z7OE 2D7NA 5I1CH 3RWEA 4RA0C 2F5AH 4Q0XH 1VFBA 3SCMA 1UYWL 4PJIA 4POYA 4OLUL 4H1LG 1OPGL 3SGKA 4YJZL 4PGDA 5HHMB 4UIMB 3F5WB 4N8PA 5J12B 1RJYA 1RZFH 4WJ5B 4O51B 4PGJA 3TF7A 4JGUA 3QCVL 1Q0XL 5EU7C 2QQKH 2R9HD 1IEAB 4X4XA 3OAUH 4APQD 3V8OA 3MRJA 3OKKA 1RK0A 3MRCB 2OTWB 2R2EA 4XCCH 4UT7H 1GGYA 1EJOL 4G42B 1CFNB 4WFFD 1PEWA 4RWHA 4MCYB 1F3RB 1WTLA 1GC1L 3BPNB 3GSNL 1EBAA 1MHHA 2YMXH 4XB7A 1CGWA 1WISA 3JV6B 2G60H 4ZAKA 1IEBA 3LN4A 5F8QC 3HRPA 1RUPL 1UXSB 3HNVH 3S37H 3JWOH 4XGZA 5D7IB 3LKRB 1U3YA 1QFWL 5MP6L 3LPFA 3MV7B 1EEYB 1G9NL 4IOIB 2B1AH 3QRFM 1T2XA 5SX4H 3T0EE 3L7FA 3I50L 4M7LL 4IIQC 5I8KL 4C83B 2XQBL 5GZOC 3JWDC 4PJXE 3OV6A 1N26A 3RGVB 1YEFH 3X13B 5DT1L 1OGAB 1KFAH 3IFOA 3IXAB 3LSOA 3P4MA 1FFOB 4GW1B 2GTWB 3CSYB 3N9GH 4WV1C 5GGRB 2HJKA 5FYKL 1NGPL 4KDTC 3T0EA 5B3JF 4KZDL 3TBVB 2P47B 4LKXA 4RFNC 4DCQB 4UI2A 4ALAH 4W81A 1AQDB 4FNLH 4D0BB 3UP1A 3A6OA 3WFDL 5HGBA 1ULVA 1QACA 4Z7QF 5FYLL 4RFNB 3ZE1E 4YHZH 2IAMA 2VE6A 4JFED 4PJDB 2R39A 5E9DB 2CR3A 3LB6D 4Z5RA 3ZTJG 4Q9QH 4PGZA 2CLZB 4N8VB 4JO2L 1NLDL 5KBNC 2GIYA 5IVXB 1P4IH 5CD5C 2P46B 1KPRA 3MBXH 5IBLD 3WN5B 5E08L 4NZUH 5SWQB 1OT1A 4ODXB 1FZOA 1K6QH 2NYYD 3OPZH 5GRYA 2CQVA 3F7YA 1BLNB 2YBRB 4X83A 5EWIL 5HYFA 4EN3C 1NSNL 1H0DA 4TSCH 4GBXA 5TGBB 1J05A 3GJFH 4LAJH 1CDBA 1U93A 4I48B 2HLAA 1A2YA 4R90L 3BIKA 2NZIA 3MLRH 7CGTA 4PD4K 3TBSA 1A7RL 1FO0B 4Y16A 2ZZUT 2ICWI 1CGSL 1GGIH 4V1DB 2YXFA 1F6LL 4NO5A 2HN7A 1VGKA 3JV4B 4BZ1L 1XF2A 3JSSA 1B2WH 4XBPB 3T2NL 1BVZA 2G9HB 5ICYA 5C0GA 1V3KA 3O6KL 5IMOB 4WU5A 4X9IA 4LLMB 2AJSH 4MD4A 4MAUH 1NCDH 2FBOJ 4MLSA 5DMIL 2DKSA 3WIIH 1BQSA 4JZJC 2XTJB 5H35A 3GSQB 4N8CH 1T03L 2CIIB 1NC4D 2GJZA 1OOAA 3HN3A 3GEWB 2EIDA 2VLJE 3FT3A 4X9HA 4HWZB 4JZJB 3EJYD 1QA9A 4O9HL 3RHWK 3BP7A 1BBDH 5F9JA 3DNKA 5I19H 2Y36H 2VLJA 3A67H 1S7WB 2ADFH 3KPRA 3MLXH 2YPLE 4NRZA 3UDWC 1P9MC 4LOUC 2AJYL 4UT9L 5DQDH 1CLOL 3UJTH 4DFHA 4N90E 1T6WA 4ZUUA 3QT2A 5DHVA 4JZOA 3L7EA 2Y5TB 2D7QA 2XQYG 3VXUB 2LQRA 3WMSA 2YPLA 1I9IL 3K7UA 4JQIH 4R0LB 4P4RB 5D70H 1Y0LA 5DI8A 3QUML 5MENE 1FHGA 5KG9A 4FQPA 1U2HA 2X4PA 4YK4B 1T04A 3PWPE 4P46D 2J3SA 3HE6C 4NRXA 2NTFA 5MENA 4NKDB 4HUXB 3S36X 2PXYC 1EGJL 5D1QA 1FIEA 3GSOA 3HE6B 1I85C 3IU4L 3MRNB 4K3EH 3PWPA 1PKQB 2XACC 1CD1B 2D9CA 5L2JB 4RAUB 4QEGA 1RK1A 4PREB 4QY8A 4HBCH 2WW8A 3DVGB 3MRQB 3P0VH 3OQ3B 4KVNH 4Z0XA 5DRNB 4UILH 3BPCB 4LCUB 3SJVD 3MRHB 1VADA 4OKVA 4XNXH 1I8MB 4O2CA 3EYOA 1IZJA 5BRZE 4HKJB 1UFUA 4QKXB 5GSRB 3I75A 2J4WH 4RFOL 3KYOB 4GRLA 1UACH 1B90A 3DVFA 3UTOA 1J0JA 4M7JL 4E0RB 1CVRA 4POUB 2EZ0D 4Z7VE 5BRZA 4KJQC 3RVXD 2NMSA 1ZGLP 2BVQB 2P42B 4EUPH 5JA8B 1RZJC 3BAEH 3TNNA 5FV1L 3P4NA 1A7OL 3G6AA 5EU5B 1YEJH 4X7FC 5IMKB 1M7IB 1JBJA 4PJFF 4N8VG 1SJXA 1NANI 2QBWA 5L88L 1E28B 4P23A 4YGAB 1JI2A 1MNUL 3BESR 4LLQA 3VXNB 5GS2D 4IS6B 1EXUA 3MV11 1SBSH 3BPLC 2HTLD 4JQVC 4NKOA 2AK1L 5C6WH 3GK8H 4LSSL 3WHE0 3MRLB 1V7NH 2NR6C 3QFDA 1TXKA 1BBJA 2W07A 5GGSB 3BWAA 3HMWL 3BHBB 4LCWB 4KKBD 2A74B 3QIBA 4AL8H 1BFVL 2L7JA 4H0IA 5DR5H 1LD9B 3VWJA 2WV3A 1DBML 3TPUA 2XA3A 1A3LH 1WICA 3UJIH 2OL3H 3MXVH 2AJVL 3HPJA 4OJFL 4TQEL 3ROLA 1GZQB 4OM0L 4R4BB 2FL5A 3CNKA 1G7HA 15C8H 2LVCA 5IJVB 2O61A 3QPQD 3ARBC 3O41A 1BD2B 3RVWC 5I73C 5HGAB 5DSCB 2ZNXA 1CD0A 5I1JL 4YX2L 3OAZK 4XNYH 2V5RA 4OF3A 2PO6D 2ADGA 3ARSA 3ARBB 3DX8A 3BW9B 5GGUB 4NJ9L 2FYYA 4PUBL 3S35X 2Z93B 3T0ED 4F58L 4OZGE 3MGOB 4L8BB 1FAKT 2DI7A 4LEXL 3DUSA 4GRMA 2V5YA 5K9QG 2BSRA 3NCYS 4MXQC 2WNGA 5FOJA 2YA1A 4XBGA 2FHBA 1OAUL 2Z35A 4OZGA 5AZ2H 2IAMD 3HTLX 3PGCA 3RAJH 1CL7I 3SDCC 4OFYD 1UXWA 4GAJL 4PRIE 3UTTE 3TA3C 3TNMA 1A0QL 5M7QA 5IVZA 3AC0A 1MAMH 3NGBC 2HH0H 1ZGLA 1CZ8H 3QI9B 3QZWA 4WEMB 3TA3B 4WI9A 1GJIA 3WD5L 4XZUA 3C6SB 1XGUB 4PRIA 4Y1AB 3UTTA 3EYVB 5E2WH 1UQSB 4GBXD 3RY4A 5FYKE 4M6NH 1CXHA 3H9ZA 1ZXQA 3ZE2F 4OGAC 4LNRA 1F4AA 5GIRA 4UNUA 3VXPA 3MZTA 1SJHB 2FGWH 1EO8H 3JWNC 4XVUD 3OG6B 4HC1L 5FYLE 3I3EA 3L1OL 3MRGA 2E7MA 5GGVY 1TFHA 4YHPA 3SE4A 1HSBA 4L4VB 3BH8A 4HQQH 1FVEA 4MNHA 4PJFB 2C1PB 5T3XH 1TTGA 4ZFGL 1MFEL 5IMMB 4F7CA 2GK2A 1MIMH 3HNSL 1NGXB 2R2CA 3J7HA 2JIXB 5FKAA 5IBTL 3ULSA 4FOMA 3QCUH 1I1AC 2P49B 3WXWL 3FFCA 5JOPE 2ITDB 1EMTH 3P4OA 3NPSC 1MCCA 4U1NA 3EOTH 3GMNB 3RJDA 3D6GA 4JAMB 1I1AB 3GRWH 2IQAB 3X3FH 1JHTA 3WNPA 1P4BH 2DMCA 5H2BB 3IDMB 1HI6A 2BFVH 2A73B 1E27A 5GGSY 4YHNB 1D7FA 4YHKH 1JPTH 4WHDA 4NRYB 3BRGC 3GIZH 1CE6B 4F15B 1QEWB 2I9LB 3WLBB 1XFPA 1BF8A 3Q5YA 3QEQE 4GG6E 2VLJD 3LKSA 4JB9L 1WFTA 1GHFH 1IGFH 1PYWA 2P5WE 4ODHH 4JFPA 2KPNA 4TUOA 4HS8L 5DC0A 4KJPC 4MWFA 4KZEH 1TETL 5JIIA 3PGDA 4FFYH 4F8TA 3QXAB 4M6ML 3O4LE 3SN6N 3QEQA 5MERA 3L95B 5T3ZL 1ZHBA 5A2FA 1J1PL 1UM5H 2OR8A 1ZLUH 2YPLD 2P5WA 2FIKB 5ANME 2P8MB 1YN7B 1U8OB 1RURH 3D39B 4N90D 4PD4J 2E9BA 1RJCA 3TCLB 3O4LA 2VDQL 4GLRI 2E7BA 4NBYB 4GOSA 1T5WB 2OTPA 5ANMA 3KR3H 1MUJA 5F3HB 2J12B 32C2B 5ILTL 3IKCB 1WC7A 5MEND 3OXSB 3BKJL 3D9AL 4WW2C 3UC0H 4MVBA 5D1QD 4D3CH 1HH6B 1XIWA 5AZEL 3PWPD 3KYNB 3HAEB 3T3PF 5ESAA 1VB9A 1AD0A 3MJ9L 5A1AA 3SHSA 2OZ4A 2X4SB 5CSGA 2NCMA 4G80B 3HMXH 3FQXA 4K7FB 3SGJA 2HVJB 4PRBB 5DUPH 5FO7B 2VJXA 4NCC2 4RFEA 5L7XL 1ZA3B 3ZKNC 4G6ML 4F33B 3KVQA 5BQ7A 2XZAL 5C09E 4TNWK 3FTGB 4HDIB 4K8RD 3BIBX 4GRLD 3VFPB 2OMNA 3F6IA 2IQ9L 1TCRA 2F74A 5KZCB 3PUCA 4DKFL 3FO1B 2EEBA 5IQ7H 1T20A 2NW3B 1VGEH 4JO4L 4ZUTB 2CDEA 4PGBA 5BRZD 2IPTL 1LO5B 3OKOA 4R8WH 4XP4H 2HFGL 2ADIB 1H3PL 4ELMB 3Q6GH 3PWNA 4LLDB 3QUMA 3IXTB 3MRKA 2Y07H 5HHPB 1P2CB 3RL2A 2VC2L 3VFTB 4JGMA 4GQ9H 4HEPG 3PL6A 1N59B 4P23D 5FUCC 1G7LB 1E4WH 2QSVA 4FFZH 5E2UL 3D25B 1ZVSA 4EBQH 4N5EC 1JCKA 5JOFB 2R0KL 4HPYL 5I0DA 4WNQA 1N0XH 5IB2B 1WFUA 2DD8H 2R4SL 3TJEL 3PHOB 1XF4A 1Y18A 3Q48A 3QWOB 1YECH 4JHWH 3VRIB 2FJHA 1A7QL 1OCWH 1WBYB 4Y19E 4WIQA 4LNVA 3QHZL 1FLRL 3RL1B 2XN9E 4P9HC 3QIBD 4ODBD 1U2CA 3BMWA 4OF7A 3VWJD 4ZS6C 3GMOA 5FGBA 3R0NA 1FC1A 5GGTH 1UZ8B 1ZE3C 3QDMA 2VXSH 3P30L 3THMH 3BEWB 2VXUL 1WCBA 2XN9A 3UAJC 5IW6A 3FFDB 3DRTB 1VKXA 4M48H 1S8DB 1DBJL 2VLKE 3ZT7A 1UCTA 3OGOE 4YAQB 4I0PA 3RNQA 1KPUA 1JWSA 1UA6H 2D03H 1SMOA 5EIVA 3TN0D 5CIPH 3W11D 3NIFF 2A9NL 4R2GD 3UTQB 5D7LE 1I7UA 2IWGA 4OZHE 3G5XB 3KYMB 1QFPA 3RA7L 3U46B 4PTUA 3QDGB 1HQRA 5LXGH 3PWJB 1HH9A 4DOHE 4YFLF 4BSVA 3QIWA 5D7LA 3VRJA 5F88A 5T5NG 2Q7YB 3BO8A 4OZHA 1K4DA 3R8QA 2P7TB 3WIHH 1A5FH 3HG1B 1I3UA 4TULL 4JO1H 3ULVL 1S7RA 3UTZA 3GMPA 4DKDC 3WJLA 4TYUA 3T1WA 4WI7A 4K3HA 3TO2B 4HUVA 1WFOA 4KKCD 1J0ZA 5CILH 3QXWA 4KRLB 2Q8AL 1TJGL 1TZHB 3AU1B 4P5TC 2Z8VC 4GKZB 1BZ7B 3D0VB 3ZDZE 4OCRH 4X80H 3MLWL 3VJ6A 3BH9A 3FOMA 2A0LC 4NQTA 1D9KC 4P2RE 3O3DA 4PRID 3QQ4B 5ALCL 5HHOE 3UTTD 4NJAL 4OV6F 3MLUH 3HR6A 3HE7A 3QULA 4P4KA 5HYJE 2IADA 3CFCL 5TQ0H 3RQ3A 1D9KB 1QLFB 2H6PA 4I13B 4D8PB 4Y4FB 4P2CG 1UCBL 4L3EB 4JHZA 3INUL 4K94H 4P2RA 1NGYB 5HHOA 5CCKL 4WWKA 1J18A 5F8RC 1FJ1B 5CJBA 2BHYA 2CMRH 3PDOB 2X4UA 2G5BB 1OM3L 4XP9L 5FYKD 1T66D 1MJUL 4N0YL 3QH3A 5J6GB 4FTVE 2Q3ZA 1HINH 3VD3A 3V6BR 2KQNA 1Z3GL 3GSVB 3CU1A 5KVGH 2IFFH 3T4YA 2EDTA 5FYLD 4XPHH 5DJXB 1JV5B 5GRWA 4UDUB 1KF9B 4BUGA 3GMMB 4FTVA 1BJ8A 4YXKL 1FAIH 2C3VA 4CJ0A 2GSGB 4FQHB 5CEZH 3L6FA 2GSIB 5JZ7D 1XR9A 5I1DA 1BAFH 3G5ZB 4XVTL 5JQHC 1G0DA 4CADA 4YWGL 3KPLA 1IGCH 5IQ9B 3EYFA 5IP4A 2XY1A 5JOPD 2GAZA 1ZLWH 3SE8L 5EG6C 1SHMA 4Z7UE 5DFTA 4QOKB 1TQBC 3CH1B 2WZPD 3HFMH 1VEMA 3HI6L 1IFHL 1WUNT 1AQKH 1U8LA 3TVMA 5DJ6B 5LBSH 2WIIB 4ZFFA 2BMKA 4Z7UA 1G6RB 3B9AA 1D5BB 4I3SL 3ZTNL 5C0FA 3PHSA 1D5ZA 3QEQD 4WHYH 5B8CA 2XZZA 2P5WD 4HC1A 1YMHA 2R4RH 5GZND 4LVOC 3A6BL 3O4LD 1A1NA 5DJDB 4GRWH 4P57A 1IKNC 4CKVX 4P2QE 5CJXA 3NH7H 5IKCB 4OV5B 4PJBF 3L5IA 5C0RH 4BH8B 1CXIA 5F9WC 3I9GH 1MWAL 1R24B 4MVBD 4NT6A 5DO2D 1YQVH 4W6YB 3VFVA 1BJ1H 3EFDH 4NN6B 5EOCL 1FN4B 1XIWD 2R1XA 2XZCH 5H94B 4WTWA 4P2QA 2J88H 5I9QB 5LGHH 5K93A 1F8TH 5DD0L 4EDWL 3S4SG 3LV3B 2X05A 5EO0A 1D6EA 3WIFB 1BFOA 2ZOKA 4UDTA 5FHBH 2VOTA 3NA9H 2LVEA 3STZA 2MHAB 2QQLH 3DI3B 4NM8H 1ACZA 1S7SB 4KHXH 5T3ZE 2VABB 4UQ3B 1EBPA 4NSKA 2NY2C 3E3QE 3M07A 4HG4K 4HK0A 4O2FB 3O6FC 3FHAA 2X1WL 5C0JA 2IG2H 4KKLC 5TE6L 1R5IA 5C09D 4X6BB 3WNKA 4KTEL 1ND0B 2CD0A 3QHFL 2V2XB 3O6FB 1RZIA 4XX1G 3O3BA 3S6CA 3O3AA 4ETQB 4D0CB 1FBIH 4XXDA 1PSKH 4KGLA 3WLWC 3S5LA 4AEIL 3QXUA 4KUCD 2QHLA 1LEIA 3W0WB 1B0GB 2H3NA 1YYML 1FNGB 3V0VB 4QHUB 3SBWA 3OHXB 1F4WL 3E6HA 5TJWK 2ZPKH 5EUOF 4G6AD 1KTDA 2BNRE 3LS5L 5INCA 4MA7L 2IJ0C 4NQSB 5F3BB 1JI1A 4UINL 4LARL 1YEEH 3ZDXE 4YHOL 3T4AA 5DJAB 4NWTH 4QHKI 3IDUA 2ZG3A 5IB5B 5I1GL 4EXKA 1E6JL 3LEVL 4PRAA 1AGBB 4Y19D 4UBDC 3AGVA 5CSBA 2IH1A 4ZFZA 4XP5H 1MFBH 1NAMB 2XN9D 2BNRA 1NL0L 3MCG1 4JHBA 3WCYA 5CD3A 1ZT4B 3WS6A 1FVDA 3BGMA 5CJQH 3TC9A 2BSSB 4U1KB 3U7WH 4JPVL 1T5XA 3G5YA 1EHLL 4ETYA 5L9DH 1ZLVH 1G9MC 1NCBH 2FECI 5C8JA 5ICZB 1ERNA 2OI9C 5ID1A 3EDFA 3PXHA 5D5MF 2WY3A 3K8KA 3LDBB 3O11B 2Q6WB 1HOCB 2VLKD 3ZKXB 4D9LL 1YPZF 2VMFA 3QJFA 4XMKH 1O5DT 4F7PB 1W8OA 2OI9B 1CFQB 5I1AB 4WO4C 4M6AA 4HPOL 4QRTB 4Y89A 3QIWD 5D7LD 5DQ9A 2AW2A 4PJBB 1HHJA 4NQEA 3QG7L 3RBGA 5JDSA 2JB5H 1DR9A 4OBRA 1FZJA 5IV2B 3CVHB 3MCLH 3CU7A 2OL3B 4DK6A 1P7HL 3H42L 4HIEA 4XCNA 1KJ3L 1JF1A 4JFZL 1EAPB 1FE8H 3VI3F 2UZIH 2HFFB 3H0TA 3I3BA 2V6HA 1OP3K 3MOAH 5BZDA 4P0DA 3M8OL 1L6XA<