3ARDA

Ternary crystal structure of the mouse nkt tcr-cd1d-3'deoxy-alpha-galactosylceramide
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
295
structure length
294
Chain Sequence
KNYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMSPKEDYPIEIQLSAGCEMYGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWGSLHHILDAQKMVWNHRHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title A molecular basis for the exquisite CD1d-restricted antigen specificity and functional responses of natural killer T cells
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 74
structure length 294
sequence length 295
ec nomenclature
pdb deposition date 2010-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ardA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3ardA01
5JOPE 5ESQA 1TQCC 1D5ZB 1OCWH 5EBMB 4GW1B 5KANG 2VTFA 3CFDB 2Y6SC 4JFFE 5EOCH 4UT7L 3MOAH 2Y06L 5FKAB 2B39A 5LGHL 4O58H 5IGXL 4XNYL 3VH8G 2HT4D 4QRQB 2VDPL 2DQDL 3H3PH 4KK9D 3SE9H 1ZT7B 1RIUH 4LPVA 3AXLB 3O41A 1BZ9A 1DTUA 5DMIH 4GO6B 2GSGA 2AGJL 1TPXB 3B6SB 2P7TB 1OPGH 4P3CH 1FLRH 1A6AB 3DV4A 1KOAA 4RBPH 3QIBC 3GHEH 5D6DA 1DFBH 3GBMH 1LD9B 1LO0H 3IETA 2Y7QA 4R90H 5DRZB 3QQNA 1NGWB 3ZYZA 1FAKT 3P73B 4MMXC 4NHUE 2FECL 2KZ1B 4NCDA 4ZS6C 5HGAB 3VGEA 3TCXA 3OAZK 1V7ML 1R0AH 1OAXL 1FV1B 1HHKA 1DQML 3BDXA 4WW2B 1QSZA 2VXTL 2VXVL 3UTQB 1YEGH 4JPIB 1A7NH 3RWIB 3NCJL 4GAGH 4Y19A 3O6KL 3MR9A 1YNLL 5DJ2A 3IGAA 1D5BB 5CSGA 4PREA 1A9EB 5JW3H 4P5TB 4HUMB 4Q0XH 2UYLB 4MCYA 1BVKA 5D6CA 1Z3GL 3H9YA 1INQA 1QSEA 4XWOD 4YQXL 1LO4L 3VDAA 4LLQA 1A7OL 2XWTB 4FFZH 3HC3L 4UAOB 5GGQL 4S2SA 3I3EA 4PP1D 4PRAA 3VFPB 2Y5TB 3GSQB 2F5AL 3KYAA 4Y4KD 5ICZB 4MX7A 2VLMD 3CX5K 4HK0A 1EVUA 3F12A 5BV7C 1TVHB 2W38A 2CJUL 5EPMA 4GW4B 4KRPD 2PTTB 2NW2B 1YY9C 3UZVB 4AG4H 3KYNB 5HYSB 4XMKH 1UACL 1CICA 1OVZA 3UJIL 4F7TB 1A47A 3H9SD 1KJVA 5E2WL 5IM7B 2W0FA 3MXWL 4I0PC 4MZ2A 4R8WL 4NN5B 3S7GA 1CG9A 4C83B 2EH7L 2FD6H 3T65A 4BK5A 3IFOB 4S0TD 3VFNA 3ZKXC 1SBBA 5DS8B 3GSUB 4OZGB 1GGTA 4YUEL 1S7QA 3FZUD 1YNKH 3DMMC 5EU7E 4BUGA 4IEFB 3SDDC 4LLVB 4DGYL 4GS7B 3HRPA 3SDAC 2A0LC 1GL4B 3CMGA 1DBKL 4F3FA 3EDJA 3A6CH 2IAND 5EFIA 2OR9H 4WHDA 1CQYA 2HT3C 1U9KA 3R8BB 4L3EE 3UYRL 3MRJA 4DQOH 2ORBL 3VFSA 3HI5L 4MVBC 1FNGB 2ZJSH 1GAFH 1HK6A 2OZ4H 4J23A 4UT9H 4PY8J 1FLTX 1RU9H 4I0CC 1SHMA 5B38A 4L3CB 3B3IA 3RRQA 1NLDH 1C5DA 1G0DA 1TETH 3IU3B 4EN3A 2Z0BA 4OZGF 3QWOA 1SEBB 2ARJB 3T09A 3IJYA 5DVKA 4LSPH 4OCXL 5D7LA 1DUYB 4MJ6B 1I1FB 4RMSA 1OGAA 5CZVH 3HAEH 5JW4M 3V0VA 1A0QH 1QLEH 1AGEB 4PJIE 5IVXB 1RZKL 5C0BD 2BFVH 4KAQL 4KK6D 3MBEA 2BY1A 4HK3J 3JWDH 1M6OA 3AS0A 1SYVB 4L1DA 4NQVA 2UY6A 4KRPB 4RAHA 5GGRY 1CBVH 2ZUXA 1J05B 4P4RB 2FWOB 3TJHD 3PQYE 4PD4J 1BBJB 5D1QD 1BX2A 5I9QB 2VUOA 1MJJA 4PR5B 3X11A 5EN2B 5CEZL 1F42A 2DWDB 1JPST 5F71A 5FYJU 4OKVB 1HWGB 4MS8D 3OKDB 4APQB 3BQUD 5KVGL 4WCYL 5DMKA 2R15A 1T6VN 4NC1C 1S9WA 2ZSVB 3CFIC 4NM4H 1JF5A 4HUXB 1FVCA 4MNQA 5HYJB 1WT5C 3GMLB 3X3GL 2XZZA 4JVWA 2WUCL 2NY3C 3DURB 4U7KA 4QRPD 4XNQB 1TJHL 2BMKA 1MVUB 2ICWJ 2IANB 1KCSH 1EA9C 2OMNA 4PRHD 4MXVE 1GGIH 3PDOB 3KLHC 3MV8E 1T7XA 1HILA 1L7TL 3KLAB 3R0NA 4XP9L 1NFKA 2EKSB 3KJ4B 5J9PA 1T0PB 4YX2H 2E3VA 4NDMB 1Q0XH 1B0RA 3QIUC 5ENWB 5DEGA 3RWEB 4Z5RB 1CTNA 2NY6B 1G6RB 1W8NA 2BNRA 1JNHA 3BIKB 5J1SC 2VL5B 5GZNC 1FZOA 2Y36L 3G5XA 4OZFA 3B2VH 4G6KH 1IKFH 1NFDE 3QIWB 5D9SA 4YHIA 4WI2A 4X8JB 5D72L 3UDWC 2AK4A 5I1LA 5HDOA 4CW1A 5T5FL 1Z5LB 1J10A 2VE6A 5IVOA 2IAMC 4JFOA 2R1YA 5GRVK 1GSMA 3P0GB 1Q9WB 4QHLA 3RY6C 1U8NB 4CVZB 3HZVB 3OXRB 4OF7A 1INDL 4RGND 1XZ0A 2VRAA 3T08A 4JDTL 3BZ4B 1OTSD 2OI9B 4X4YA 4EXKA 4XNUH 1WWWX 3HG1E 1R5IA 2X70B 3QQ3A 4G6AD 4Z95H 4ZQKA 1P9MA 4WI9A 3P11L 4M7JH 1JPFA 1CD1A 5FO8A 4UV4L 2ZG3A 1IM3B 1KCRH 1JHTB 2NY7H 1G9NH 4JDVB 3S4SA 2C3HA 3MACH 3UZQA 3MRQA 3L5XH 4YJZL 4AEFA 4JQIH 2X10A 4I2XA 5LJYH 3T2NL 1NGQL 4ZD3H 4R2GB 3VGAC 2PO6D 4MSWA 4B0MM 4XVSL 3ERYA 4OBRA 5L88H 3BGFC 1CDHA 2CKBL 1ZV5A 3BPCA 3RNKA 2QKIB 5B22A 1N0XL 4L4VB 1AGFA 1UG9A 3C6SB 3MRFB 2M8XA 4JR9H 2DD8H 3EO9L 3T3PF 2HKHL 2IQ9L 1J1OL 3N85H 2VABB 2DBLL 4S1SL 1GOFA 3IAQA 5IEKB 3GGWB 1FGVL 3SKMB 2VERN 5ACMA 3ZSSA 3WLBA 4PJAA 2VXSL 3PIQB 4Z7UA 4Z7QE 3LPGA 1VACA 5I1KL 1RHHB 2VAAA 4XPTL 5SWZD 1MRCH 3CMOL 3HRZA 3T77B 1FNAA 3P30H 4N8CH 1CVRA 3VH8B 1LK3H 2B7DT 4X6BA 4HMDA 5FO9A 3AM8A 4HG4K 2C5DC 4ONFH 3E6HA 4NNPH 4IIQB 5CHNA 4LSDA 3E3QA 4M1DL 2VC2H 3C5SB 4M7KL 2Q76B 4JVPA 5A2LH 1KCKA 3UBXI 1WCBA 1ZHLA 4GUPB 1FFRA 4U1SA 1YZZA 3RTQC 3D25B 5IHLB 4JQXA 1U8KB 3BFOA 4XCYB 5K33A 3CNKA 2IG2L 4CRPA 5FA3A 4Q2ZB 1QA9B 3IDMA 2MOVA 1JBJA 2GTWA 3WFHA 2WIMA 3ULUE 3WHE1 4CN6A 3R06A 3T0EB 1KNOA 3RL2B 3STBA 3F7RA 3KPRE 3OG4B 5E7BA 3SO3B 2EYRB 2E9JA 3U48A 4ZUSB 2NLJB 4I3RH 5CJXC 4B41A 2ZZUT 2PXYD 4DGIH 2ED8A 3MNVB 1I9IH 4P59L 4HJJL 3HAEG 1ADQA 4YPGA 5AZ2H 1VEOA 1IBGH 1T83C 3KHQA 4KROB 3TFKA 4G7YH 4QGTA 1OSZA 1MCCA 3DUSB 1SM3H 4O2FA 5F9OH 2RB8A 3SDXA 4EBQL 4PS4L 4JFDE 4OV6F 3PL6D 1NCDH 1RUPH 3U4EA 1JWSB 1PG7L 3FB6B 4M7LL 4RFEA 5SWZB 1NBVH 4IHOB 4J4PD 2FEDC 3TV3L 5GS1B 2EICA 3TO4B 2DDQL 2XRAH 3MLSL 4FN0A 2JB5L 3CC5A 4ZAKD 3Q2CA 4JE4B 3DV6A 5JHDA 3ZHDA 1A1OA 4QTIH 1LO3L 4NFBA 4XRCA 5F7WC 5ADPH 4LGRB 1IEAB 4IOIB 1N8ZA 4M5YL 3EKCA 4X6EB 2W9DL 4AEHL 1YYLL 2GHWB 1FHGA 2AXHA 2I27N 3H3KA 4WV1A 5FM4A 5I1JH 4NRYB 2D7PA 5CZXD 3V8OA 4UIKH 2ADIB 3ILQC 4D9QD 1IE5A 1MAJA 4M00A 4QRRE 1QFUH 2V2XB 1OGTA 4OLZH 3TPUA 3RL1A 4YHKH 5ACZA 2ZOKA 2R9HC 5K9QI 4WUUA 1L4IA 3AS2A 3KPNA 3V0AC 1MCJA 2DIAA 2XQYK 3RVTD 1D5XA 4L4JA 3B2UC 1T5XA 3O45A 4G8GB 4O58L 1B88A 1D5ZA 5DZOA 5EBMA 4GW1A 3CFDA 5IJKA 2ZUUA 1DVFB 5HTSA 4MXWH 5FKAA 1X7QB 1XIWC 5F6HJ 2VWEC 3KAAA 3U1SH 1Q9OA 4QRQA 5C09D 1MOEA 1ZT7A 1FLRL 5KN5B 3BP4A 3Q3GB 3ZT6A 3QI9B 3AXLA 4LLAA 3AFLA 1EK3A 3B6SA 3TJEL 2P7TA 4DKDC 1A6AA 1OP5K 5IB3B 1AQKL 2VLKD 5E95B 5KSAD 3GNMH 3OAYK 5HPMB 2VZ1A 1S7UB 5DRZA 1KGCD 1NGWA 5D7LE 4MA7H 5J4MA 1OGAE 2R0WH 3P73A 4OM1H 5FGBA 1FCCA 4B50A 1PFCA 1U91B 1YEGL 3PWNB 4LVEA 5HGAA 1BFVH 3S3SA 1FV1A 3QEHB 4WW2A 5K9JH 2PYFB 5I1CH 3ULUL 3HE7C 3UTQA 1CGUA 4JPIA 1NKRA 2G60H 3RWIA 1FPTL 4OLUL 2VDQH 2FR4B 3C60C 3L7FB 2EZ0C 5D7SH 4HIXH 1NL0H 3GJEB 4XPBL 1XCTB 4OLYL 1D5BA 4NQSB 3RGHA 3MLXL 4L8SC 1A9EA 5JZ7C 2EC8A 4P5TA 4AIZB 2RIKA 2UYLA 2B4CL 3REVB 3K7UA 4FFZL 5BW7A 1SMAA 3NACH 2VLJD 4IDJL 3KWWB 4FQIH 5D1XD 1F4XL 4OSUH 1C5BH 2XWTA 2EDRA 1X4YA 12E8L 3B5TA 4LCUB 2APXA 3UJJH 3VFPA 5C09B 4X80H 3MUHL 2Y5TA 3GSQA 3BKML 4X7EC 5FHBL 2D31B 2E27L 2YD3A 4GXUN 3GI9L 2A9NH 4LLYB 5ICZA 1AGDB 3VXQB 4CDGC 1TVHA 4XHJC 2G75B 3MOQA 4KMTH 5TGBB 4CU7A 2PTTA 2UZYB 2NW2A 4PJCB 3KYNA 5HYSA 4C4KO 2BNRE 4AMKH 2ADFL 2FD6L 2VLKB 3UTPD 5I1DB 4F7TA 4Z7OF 4PG2A 2HA1A 3RI5F 5IM7A 4YDLB 1GCFA 4BZ1L 5D1ZD 1E4WL 1NGZB 4C83A 3KVQA 3IFOA 5E2JA 3MLYL 5DS8A 4JZNB 3GSUA 4OZGA 1OTTC 5D2NC 1QO3B 1HZHH 1KBGL 4X5LA 4LLVA 4QXGL 4X4MA 4DQOL 4KRLB 1PZUB 2OZ4L 3ZKSD 4RA0C 1SQ2N 3BJ91 3IS1X 1E4XH 5CJQH 4F9PC 3GSNL 2CIKB 4LVNB 3DI3B 5KVFH 5TE6H 2E7LA 1FNGA 5FIEA 4HBQA 4XP6L 3ARSA 3F65A 4CDHA 3QUZB 1QQDA 2I60L 4I0KA 4L3CA 4KPHL 3PP3K 3NTCH 4DVRH 5CZVL 3IU3A 5I30L 1A0QL 5EDXA 2ARJA 2VLJB 5EORH 1CT8B 3K8LA 1DUYA 4MJ6A 2EIEA 1I1FA 3WO3B 4GRMB 2YKLL 2GEEA 5CJ8A 1G7JB 5J56B 1F8TH 1CBVL 3UO1H 1EO8H 1SYVA 3X13B 1FGNH 4PYGA 1QVOB 5SWSD 4XB8A 5F21B 1J05A 4P4RA 2FWOA 3BT2H 4XPGH 1BBJA 4PR5A 5EN2A 4PJAE 4NM4L 3FQNB 1MRDH 2DWDA 1BMGA 4DKFH 1HXYB 4LCIL 4EI5D 1YEDB 4OKVA 2F19L 2DLIA 3OKDA 3UMTA 2Y07H 2ZSVA 4WW1B 2GCYB 1J87A 4HUXA 4P5KB 5HYJA 3GMLA 1IJ9A 1H5BB 3C8DA 4ZNEA 3DURA 3GHBL 4HWBL 4QHUA 5CGYC 2ERJB 4XNQA 1NEUA 1MVUA 1ORSB 2IANA 3ARGD 1Q0XL 3E3QE 1JNNH 3PDOA 3QHZL 2H41A 1ZLUH 4BSWB 3KLAA 3RHWK 5M94B 3TP4A 4U05A 4FZEL 1CQKA 4H1LH 4NDMA 4DUVA 3TPKA 3WUWG 2IF7A 2FLRT 3OGOE 3RWEA 1SY6L 1G6RA 2CXKA 5C0EA 1T66D 4LGSB 3BIKA 4ETQB 3VFGL 3KYKH 2VL5A 5JIPA 4XWGH 4XNZB 1E4KC 3HAEB 3O6ML 3QIWA 2P49B 3HR5B 5BS0D 4MHHG 3EYUH 2DQGH 1ZLWH 2ATPB 4X8JA 5C0BA 4EOWH 2ENSA 4QWWD 1Z5LA 4NBZB 1DBML 1LMKA 4XNUL 5DJXB 1Q9WA 3SCMD 3CGTA 3T8XB 3HZVA 3VXUE 1CTOA 3BZ4A 3ZYOA 2OI9A 4JFXB 3QB7C 5DZNA 2X70A 3QUXD 3Q6GL 5M95B 3L5XL 3Q0HA 2WQ8A 2EDQA 4MS8A 1IM3A 5CJOH 4NT6B 5TDNA 1JHTA 3RWFA 4JDVA 3U9UB 2R0LH 1I1RA 4ZD3L 3SBWC 1A9BB 3I3DA 3NIFE 1J8KA 3RU8H 4HT1H 2AEQL 3TBYB 2AJVL 2DOCA 2FX8L 4LNRB 4QRPA 3HCVA 5D96C 5LQBL 3RFZC 1EJ6A 1ZKAA 2UZXB 5AWNL 1FYTD 5L0QC 2HMIC 3ARGB 4UOW0 2A74B 2AK1L 4Y16D 1MCPH 4PJEE 4ZO6A 4K2UL 3BPNC 1CK0L 4OQTH 3GJFH 2QKIA 5IHBA 3ARBB 2BDNL 4L4VA 4X4XB 3C6SA 1FO0H 1NANI 3MRFA 3O2DH 5DUMH 1EGJH 4JO2H 4W4OC 5F96L 3MV11 3C5ZD 4IJ3C 3QNXB 2VABA 1OWRM 3AC0A 3GGWA 4RRPG 3SKMA 4CL7A 1LHZA 4JLRB 3OR7B 2FO4A 1QHPA 1CYGA 3MRPA 3PIQA 3TPUE 3P30L 3DX9A 5TQ2L 1LO2H 4G9FB 2H1PH 1RHHA 4WUUE 2O61B 2VXQL 1QP1A 2NY1C 2YPKA 4ONFL 1MFDL 3T77A 1HOCB 2UZIH 5A3IC 2PW2B 2WIIB 3VH8A 4KMQA 3OJMB 3WFCL 4AL8L 3TLRA 2A6KB 3V0WH 2AJYH 4IIQA 5ITBH 1INEH 2A9ML 3MLZL 3C5SA 2Q76A 4WGWB 4GXVL 3QUXB 2APWA 3MUZ1 1BPVA 1T22B 2A2QT 4PLKD 4GUPA 1B0WA 5SV3A 3KXFD 5I66B 3D25A 1NCCH 1F6LL 2FBJH 6CGTA 5E8PB 5FYKU 1U8KA 5JNYB 3QFJE 3MUJA 3SQOL 2LV4A 4XCYA 1YQVH 3V52L 2P8MB 4Q2ZA 1QA9A 3OB0K 1U3HD 2UVFA 3L3GB 3IRZA 4I3RL 3T0EA 1XH3B 3H8NA 3RL2A 3ULVC 4LAJH 4ZUSA 2NLJA 1FSKC 4MAUH 5D6DC 3LEVL 4YXHH 4RGMB 3MNVA 1NGYB 4OD3H 3FRUB 4IRJB 3C5ZB 4M8VA 4YH6A 3DNKA 5DMGC 3G6DH 3MYJB 1WSST 4Y5VB 4FQXD 4ZFOB 3DUSA 5JOFB 3I02A 1N5YH 1DUZB 1QFWH 4NGHL 3P0VH 2BJML 4F8QA 4JRXD 3VMOA 2J5LB 4POZC 4YBQC 2IALB 5SWZA 3V6OA 4DK3A 4IHOA 4P46C 7CGTA 5GS1A 1RZJH 2R29H 3TO4A 5J1TC 4K94L 5F7UA 1AKJD 3WKNA 4QNPE 4PJDE 3F7QA 1IAIH 1R3IH 3U9PH 3BEWB 4U1IB 1IEAA 4NM8L 2AQ1A 3HI6L 5J3HC 3ZL4L 2V17H 4X6EA 3WJJA 4Y4HD 2VZOA 1DEDA 4OLZL 4NRYA 3BD3A 4ODVH 3T0VA 3D48R 2ADIA 2P8LB 4NC2B 3K1KC 4P49A 1U3HB 1EPFA 2V2XA 2XN9B 1P4LB 4POUB 5EULV 1MCWM 1ZEAH 2XKSA 4ODBD 2DTMH 1RUQH 1ERNA 2VZ3A 2FHBA 4MXWL 4B53A 3JVGA 5DQDL 1CICC 4G8GA 1Y6NR 4OZGE 1NCWH 3OV6A 4FZ8L 4V2CB 4XXCA 4HLZH 1H8OA 3H7BB 1DVFA 5CSZB 3WFEH 5K93A 3TNMB 1AO7D 1X7QA 2DL9A 2GYSA 4KJWD 5J89A 4MQSB 2BSRB 4GBXB 3IDYB 4G6JH 4GMTH 1RZIB 4PGZA 3S37X 4QRSB 4WTXA 3VXRD 5KN5A 2OTWB 2O5YH 3PL6A 3Q3GA 1Y18B 4JRXB 1EEQA 4OLWH 3QI9A 4M6NL 1B2WH 1Z9SA 2D0GA 1WZ1L 3QCVL 4G8IB 4FQ1H 5LWYL 2VN4A 2R0WL 5IB3A 4NNYB 2DAVA 5HPMA 1I9RL 4LNVA 1MIEH 3RVXC 2IBZX 1BJ8A 1Q38A 1NAMB 4IS6A 3KNBB 1U91A 1O7VA 3PWNA 8CGTA 2G60L 4EXPX 1LK2B 3QEHA 2VLME 1JPGA 2PYFA 4PJ9B 1ZLSL 1EEZA 5D7SL 3VA6A 3VD5A 1QFOA 4YK4B 2FH8A 4K3DL 3CDGB 5DD0H 2FR4A 5KW9L 3FFDA 5F6IB 5GS0D 1K4CB 1HI6A 3MBEC 3GJEA 4M48L 3H9SE 3CFEB 3AMLA 4ODUB 5F9WB 1XCTA 1CZ8H 3IDNB 2YMXL 2BVPB 4NQSA 1JRHH 4QYOB 5L2KD 4AIZA 1EAJA 2HKFH 3O8XD 5KVDH 1C5BL 3REVA 4CN1A 1N6QL 2D9CA 4N68A 4MQ7B 3KWWA 4IBLT 3TZVB 1UM6H 3WUWB 3RVVC 4HCRH 1AO7B 5T1DL 2F54D 2IANE 2X09A 4LCUA 2QQNL 2OYPA 4KMTL 3ABZA 5F1SA 5C09A 1HHHB 4L9LB 2D31A 4LLYA 5TDOB 4DN3H 1AGDA 4AMKL 3VXQA 1I85A 3D5OF 3IDGB 1CE6B 2G75A 2UY7A 4OCRH 4NJ9L 5TGBA 3P4OB 2D2OA 4JGUA 2VLKA 3JUYA 2QHRL 5I1DA 4BA8A 4N1EA 1RJYB 1X6NA 3QG7H 1QBAA 1NGZA 1OQOA 1BOGB 1AFVL 3SKOB 4HW6A 3EYOB 1PX3A 2DTSA 5C0BE 5HGHB 4JZNA 1O7SA 1JYNA 1QO3A 4U1JB 5CJQL 4OI9A 5EU6D 5KVFL 4YAQA 5HHXL 2DQJH 3MV9D 2CIKA 1H0DB 4HUUB 1AJ7H 1HDMB 3I3BA 1YEEH 3QUZA 3PHQB 5HI3D 2QSCL 3CCHB 2D7QA 3T3PE 2WBJD 4PYHA 3CDCA 3MODL 2VDLL 2GUOB 1S9YB 4ZXBD 3SDCD 4LRIA 2YD5A 4LARL 4XPAH 2VLJA 5GRYA 4LSUH 2CK0L 1P9MC 3GMQB 1CT8A 2FO1A 4QRPE 1MHPL 3UO1L 3KPTA 1HKLH 4OGYH 1KEGL 2YZ1A 4GRMA 2F54B 3N1GC 1G7JA 4PRHE 3LQMA 3V95A 1FGNL 5FB8B 2NY0C 3PWUB 3DUHA 5IB4A 4KI5D 4U1NB 3QULB 5JO5B 2WM0A 2Q7YB 1WFTA 1E28B 3QHFL 4OT1L 2A6JB 1FIEA 4K3EH 5JXAL 4Q9QH 3L3HB 1S78D 1N0LA 4TTDC 1A7RL 2X1WL 1AC6A 2H2PC 4NN7C 5JPNB 1JWUB 3IRPX 3FQNA 1NGXB 3WDJA 5BO1H 1HXYA 1UWEH 1TVDA 1YEDA 4R4ND 2Z93B 4PGCB 5GRJL 4WW1A 2BOCB 4O2CB 2GCYA 3HZMB 4P5KA 2W60B 1N5AB 4W6XB 5FEBA 5GGTL 1H5BA 3BP6B 3DGGB 3G08B 4RGNE 1UM4L 3MV9B 1ORSA 4FP8H 3D87B 4ISVB 2W0LA 3VWJD 5SX4I 4BSWA 4HLZG 3WLWC 4O2EB 1I7TB 3BN3B 3RVWC 3AM8C 1RZ8B 1CIUA 5C0CD 4PRNB 3DX6B 3OAUH 3LN4B 1DQQB 2FRGP 3QH3B 4JHAL 3E3QC 4XC3L 1CE1L 1UKQA 3FQTB 3V5HA 3EYUL 4ETQA 4UB0L 5DD3H 2BRRH 4M5ZH 1JUFB 4R96B 1KG0B 3HAEA 3HR5A 4NQTA 1I1AB 1WWAX 3EJZC 3F62A 1CN4A 3DX8B 4JQXC 1GVIA 4LSVH 2ATPA 1G7MA 3QJFB 4IRSB 5LAXB 4YDKH 2Q8BL 3JZ7A 3SKNB 1AHWB 2XZAH 5J12C 4R97C 3STZB 3WNKA 3T8XA 2H26B 4U3XA 4WHTB 3U4BL 5SWSA 2ZP0T 4PLJC 4P0DA 2HT2D 1JGUH 4JFXA 1QSFD 5T3XD 2VH5H 1BVLA 4HZLB 3KHOA 3TYGL 1ES0B 4HT1L 3CVHL 4YWGL 4NT6A 4OCYH 3U9UA 3HS0B 5SWZE 3V6OE 1YEJL 4NZUL 43CAB 3TFKC 2OL3H 3DX7B 3QUMB 3TBYA 1BECA 4LNRA 4K71C 4DWHA 5DVMA 4TOYL 3RUGB 1NAKL 3DWTA 3DRTB 3O2DL 3ARGA 2A74A 5DUML 4U6YB 4CU6A 2X7LB 4J8RA 2J12B 3LKSB 2JCCE 1LP9E 5I8EB 4H1LB 2XTJD 3RJQB 3ARBA 4X4XA 5CBAB 4TVPD 3LOWA 3MRLB 1B90A 1I7UB 2IQAB 2E6JA 4LK4A 4CMHC 3QNXA 2H1PL 2EDBA 5JIIA 4G6ML 1KPVB 4JLRA 4RFOH 3OR7A 3MUGB 4P9MH 4Z0XB 3EHBC 3GI8L 4G9FA 4WV1C 3RUGF 5GPRA 1DEEB 4EEEA 2WV3A 3NFSH 1HOCA 2AJYL 3MRCB 4MA1C 2PW2A 2WIIA 1ZGLP 5ITFB 4PV9B 5FGCE 2NY2D 1JK8B 4NUJB 5EWIH 1ZS8B 3MA9L 3GSOA 3SCMA 2AV1B 3OKEB 2Y6SD 1KULA 1H15B 4H8WL 1QR4A 2B8OT 4QY8B 3QUXA 3QJHB 3MXVH 1T0MB 1T22A 5I66A 2P43B 5I71B 4OLEA 5D7KD 5IJKC 1CLZL 1KEMH 3U0PB 5E8PA 1F58H 3HTLX 5JNYA 1JTPA 1KIRB 2P8MA 5HI5C 4WI3A 3L3GA 3KYOA 1RJZB 3S3PA 1XH3A 4XCCH 2FATL 4XNMA 2F53B 1TPXC 4OD3L 2DRUA 3GJFB 2NW3B 3F7YB 5ID1B 2HTKC 2XTJB 1FO0B 5TE4H 4CUCA 5DUBB 1NGYA 3FRUA 4IRJA 1N5YL 3EAKA 3C5ZA 4FFYH 3PHOB 3OAZH 5FGBC 4D9QE 1NBQA 4Y5VA 3D3VB 3UP1A 1AQDB 3RX7A 5JOFA 1KN2H 3NCYS 1DUZA 2E7HA 3O6FB 2R29L 4WW2C 1OD9A 3KPSD 3FFCD 1F11B 4Y1AD 5E6IB 2IALA 4WNQB 1BIIB 3I6KB 4ESKA 5MEPB 1FP5A 1IEBB 3S9DB 1IAIL 2JK5B 4N1CA 2AXJA 2VLRD 1P4BL 2V17L 1HQ4B 2P4AB 3Q5TA 4P5TC 3BEWA 3G6JB 3LKOB 1HNGA 3DVFA 4P5MB 4U1IA 1YY8B 4ODVL 2C3VB 3PF2A 4R7DB 5C09E 5BW7C 4H26B 5BZWA 5HHMB 5C0JB 2MPAH 3I85A 4O02H 1CXEA 1CGSL 4H0IA 1BOYA 1TZHB 4UAOC 1L9NA 2P8LA 2VQ1B 1BJMA 2HT4C 1U3HA 5JXED 4LMQE 4P2OD 5C3TA 2VLKE 2XN9A 3TH2T 3ZYJA 1P4LA 1RURL 5CMAB 1KGCE 1NCWL 3LQAC 2GQHA 5IWLA 1EH9A 4FS0A 1WEJH 3TYFB 1RUML 2H8PB 3G6JF 3LZFH 4MA8H 1OARH 3BDBA 5E08H 2EDJA 1BFTA 1CL7H 3HNSH 2PR4H 3DMMD 5EA0H 1JCKA 2LQRA 2EKJA 1T5WB 1RMFL 3SDDD 1EHLL 3H7BA 5CSZA 3TT1H 4NN5C 2A0LD 3TNMA 2X4OB 1RUKH 1BP3B 4OLWL 3IXAB 1CXFA 5FCUL 3ROOB 1B2WL 2HT3D 1RZIA 3SKJL 1EVTC 4QRSA 2OTWA 4FQ1L 3P0YH 4JRXA 1Y18A 5A1AA 4GS7C 1A6VH 1VDGA 4YXKH 5I19L 1VFMA 3MGAA 1IL1B 4G8IA 3U82B 5K9OB 4K9EL 3VG9B 4NNYA 4TULL 1CD8A 5T33L 2VLRB 2E7LC 2VLJE 3LS4L 3BMWA 3CFBB 1RAMA 2XTLA 5HDBF 3QUYD 3ZTNL 2QQLL 1NAMA 2HJKB 3TT3L 3KNBA 1IMHC 1T21B 3FKUS 2Z8SA 3NBNA 3QDGD 4N0RA 1L6XA 4ODXB 1LK2A 4X9BA 5I2IB 4JO3L 4PJ9A 1XF3B 5ISZD 3WV0A 1NDGB 4WU7B 3VA2C 3VDCA 3CDGA 1T4KB 4PP1C 3V7AG 5IQ9B 4P2OB 1YECH 3UTPE 1K4CA 5IOPB 5IW1B 2HKFL 4M6OL 4ODUA 4RWHA 5KVDL 1A6ZA 4LBEB 5DWUL 1Q72L 2YPVL 4WEBH 2IPTL 3IDNA 2BVPA 3UAJC 5H35A 4KRPC 4QYOA 3T3MF 5FYLD 4UTAH 4KC3B 4L1HA 5FGRA 4JRYD 5IB1B 1AR2A 3SEPA 2AEWA 4HCRL 5LBSL 4GG6B 1HHGB 2F8VA 5E99L 5I9QC 5IT2L 1NCAL 3O81A 4I48B 2NY3D 3HC4H 4MQ7A 5MP6H 3O2VH 2V5RA 3SGKA 3TZVA 4D2NA 3C08L 3WUWA 1MAKA 4APQC 4LIQH 1AO7A 5L8JB 5KJRH 4M1GH 4XH2B 1D6VH 1KTKE 4PRPB 5E8NB 3KLHD 1WWCA 1HHHA 4L9LA 1S9VB 3FZUC 5TDOA 4PJXB 4E0RB 3O6LH 3LIZH 1GC1L 1P53A 3IDGA 5B3JE 1CE6A 3HNVH 1CD0A 4TNVK 3QIUD 3M1BB 3P4OA 3QG7L 3BHBB 2H9GB 2C1PB 2C3WA 4PJ5B 3KJ4C 1RJYA 1RUAL 3QUYB 5F1OB 1BOGA 3SKOA 3OKNB 4IM8A 4N0YL 3EYOA 2NY6C 5HGHA 4JM2D 3S37H 3QDGB 3RWGB 1MCEA 3EDFA 3MRNB 4TN9A 3Q48A 2IAMD 3MRDA 4U1JA 4PJXF 3QIWC 2XG4A 4XCFH 2VB5A 5SWSE 1MWAL 1CFVH 5FYJH 2IPKB 5IUSA 1A3RH 1MNUH 5E56A 2WWMC 2OJZL 2ESVD 1H0DA 4HUUA 3DXAB 5TDPB 1DBBH 5IROA 4HS8H 1HDMA 2PYED 1LILA 4LOUC 5GJTL 1TJGL 2VZTA 3PHQA 3CCHA 1IC7H 5L2KA 1J5OH 3GKZA 4LSRL 5F9DC 1HKLL 3GMNB 5DRWB 4OGYL 2GUOA 3LY6A 2OI9C 3R8QA 1S9YA 3WXWL 2XZCL 2GJZB 3V4UH 1A4KB 3GMQA 5GJSH 3UTTD 5CWSB 1HINH 4HHAB 1BFOB 4MS8C 1JGLL 4J12A 5INCB 4XP1L 3B9EA 1MF2L 2F54A 4XXDB 1GPOH 1XGYH 5ECJE 3K2MC 3DETC 4RRPA 5FB8A 3TNNB 3PWUA 1OLZA 2DLHA 1ITCA 4F57H 5CP7B 4U1NA 4MWFA 5E5UB 2FL5B 4DZ8B 3QULA 5JO5A 2P47B 1QBMH 3WIHL 1E28A 4K7PH 4R2GC 5C0DB 2A6JA 2JJSA 3L3HA 4ZTPH 1J0HA 2OCFD 1JFQH 5JPNA 4ELMF 1KENL 5EO0B 1NGXA 5FYKD 2EE2A 2IH3B 1K6QL 1DL7L 4QRUB 4NZTL 5BS0E 1BEYH 5GSVB 5I1IH 3SE3C 1FE8H 1V3JA 2Z93A 3MO1B 2N56A 4PGCA 2LVEA 4O2CA 4JM2B 3HZMA 2W60A 1N5AA 1P6AB 2HWZH 2Q87A 1TZGL 2OX5A 3BP6A 4M7ZB 4L8CB 5EU6A 3S5LG 3DGGA 5BVJA 3S35L 2CUHA 3MV9A 4GLRH 4ISVA 4O9HH 1JI1A 4NP4H 4GT7A 2ESVB 2APFA 5DMJB 4O2EA 3NABL 4EVNB 1FC1A 1R5VB 1I7TA 1RZFL 1RZ8A 3RTQD 5CEYB 2BRRL 4PRNA 3DX6A 3LN4A 4IIQC 1DQQA 3QH3A 1BGXH 2NY4B 3HR6A 3NIGF 3MSPA 1OW0A 4JM2F 3K74B 4DFHA 2R56L 4NUGL 1MI5B 1JUFA 2IFGA 3UTTB 3T4AB 3WEXA 4R96A 4LHJB 5I1HH 4ZFZB 2ZUQC 2J3SA 1I1AA 1NMCB 1ZVYA 4JAMB 4KKCC 5DD6B 2FJGB 1FYTE 5D93B 3DX8A 1I8KA 4UNTA 4IRSA 3QJFA 5LAXA 4O5LH 3SKNA 5FHAL 3ZTJH 1T0NB 2DQHL 3CFCH 3GBNH 3STZA 2H26A 3F58L 3T0EC 4WHTA 3F6LA 5D5MB 3SO3C 2VSCA 1EERB 5EZJB 1AR1D 1F3DJ 2VISB 3EOAB 1XF5B 2BOBA 4YC2B 4HIHB 1ES0A 3HFMH 2OL3L 4QF1B 3EYFB 1WJ3A 4Z0BL 1RVFL 4KROC 4OCMC 1MCRA 3VD3A 3AAZB 2FEDD 1C5CH 2XFXB 43CAA 4OF6A 3DX7A 2PTVA 3QUMA 1YUHB 1NC4D 2X1OA 1S5IL 4LAQL 4OD1L 2V7HB 4WTZG 1HKFA 3EIFA 3RUGA 4JN2B 4YE4H 4XMLH 1FIGL 4TTGA 5DHYB 5GGSB 3V6OC 3DRTA 1A1MB 4U6YA 5D5MF 4FMFA 4OV5B 5GS1C 2X7LA 4GG8A 1CXLA 3LKSA 3TO4C 2DQIL 4NO3B 1YMMB 2A73B 5I8EA 3BP5B 5CBAA 3S6CA 3V7MA 1X4ZA 1OAUH 3KXFE 3MRLA 3ARED 2R1WB 1I7UA 2IQAA 1LDPL 1UB6B 3BKJH 3MLTB 4URTB 1KPVA 4JJ5B 3H6JA 3MUGA 3THML 1P5UA 1QRND 5C0GB 4Z0XA 4UQ2B 4X4ZA 2YD9A 2R9HD 3WJJC 2I24N 1F4WH 2P24B 4FTVB 1G84A 2R23B 3RWDB 3V6BR 1FZJB 2AV7B 3W0WD 2HJFB 3MRCA 4PLOB 3B2UD 1QNZL 5J6GB 2W59A 3JV6B 4BFEA 5ITFA 1FH5H 4N9OB 4PV9A 2YHGA 4NUJA 3KGRA 1ZS8A 5EZOL 5DC9B 1PD6A 2AV1A 1WTGT 3OKEA 4QTHB 1H15A 2HRLA 4AEIL 1XIWD 1IC4H 1QSFA 3QJHA 3JVGC 5E03A 4C56D 1T0MA 2FDBP 1L0XA 4XXCC 4JRXE 4OZHB 1KXVC 1DVFC 1PEWA 2NY5L 2A77H 1DCLA 2DLFL 3U0PA 3O4LB 3MRKB 2DBJA 2D7TH 4FXGA 1P7QB 1KIRA 4OQ1A 5E8DH 1JJUA 1NC4B 5CCKH 3PABB 2DJSA 1RJZA 3NA9L 1EIBA 3QI9C 4WENB 4HWEL 2CLVB 4OQTA 2YN3A 3SJVB 2R4RH 3GJFA 1OP5H 2NW3A 3F7YA 1M71B 1U58B 4G42B 3ARZA 5ID1A 3O3EB 2A6DB 1FO0A 1E6JL 5DUBA 4QLRA 3AREB 4OZHF 3K46A 1KN2L 3HE7D 4XX1G 1YJDC 4RX4D 2VDOL 4KZEH 3PHOA 1GIGH 4NYLB 3C2SA 3RZWA 3C60D 4H20L 2FIRT 1AQDA 1OAYH 1QRNB 2MKWA 3TVMB 2EZ0D 4PJGB 2I5YL 3O6FA 3NFNB 1JF1B 4LGPB 4X5WA 5E6IA 2FB4L 4WNQA 1BIIA 3I6KA 5FM5M 4EKXA 15C8L 5MEPA 1IEBA 3F5WB 2Z91B 2JELL 1V7NL 2IGFH 1I8IB 2D3VA 4XVJH 3V6ZB 2QQKH 4XPFH 1JTTA 3PUCA 1HQ4A 4TRPH 5AG8A 2Y23A 4NQCB 4A6YL 1AO7E 3RVTC 2MPAL 3G6JA 3LKOA 1UCBH 4P5MA 5C92A 2X05A 5L6YH 1YY8A 2XA3A 4OUUB 2XWBA 4R7DA 2C3VA 4C56B 3OB8A 1C16B 1F2XK 4H26A 4PJGF 1JYWA 3KJ6H 3VXRE 5HHMA 5C0JA 2Z31B 1NBYB 4NRZB 4XHJD 3FO1B 5TPWH 4NZRL 1CFNB 3QCTH 4YHML 1TZHA 3I50L 1IFHH 2VQ1A 2J6EL 2I9TB 1XF1A 3TO2A 4P57B 5KAQG 5K9KB 3LZFL 5EBGA 2JJUA 5CMAA 1I85C 4KXZI 2NNAA 4KZDL 1IRAY 2PR4L 4Z18A 3TYFA 2H8PA 1HHIB 3TT1L 2DQEL 4H0HB 5C0AD 1G0XA 3JTSB 1MLBB 1QSVA 1OTTD 4HXBH 4M8QB 4ORZC 1JWMB 3MFGB 1T5WA 5TQ0H 5IHUL 2EC9T 4YDLC 3U7WH 4RMWA 1S7TB 3AU1A 2X4OA 3P0YL 4HSQA 1GOGA 2AXGB 3QEUB 4G43B 3IXAA 3ZTJG 5ANMB 3ROOA 4AK1A 5HYFA 5FUOH 1FBIH 2XA8L 3MA7B 3QDMB 4GRWE 1CIDA 1MCSA 1ZT4B 3UJTH 1ZGLB 4ZSOB 5DJDB 1IL1A 2OXHA 5L2KE 3X12A 5CAYB 1BZ7B 2C9AA 4UILH 5GRZA 5K9OA 3T1FB 4MJ4A 4LVNC 2VDNH 1OAKL 2VLRA 1CI5A 2FJHB 3C6LB 1F13A 3QUZC 4MJIB 5CILH 2RCSH 2HJKA 2F54E 5L2JB 4OZ4B 3BP7A 4KKLC 1T21A 1UVQB 4OIBA 3VD7A 1QFHA 1MPAH 4ODXA 4LRIC 4M61B 4OTXL 5I2IA 5E70A 5TF0A 4YHYB 1CF8L 1H3XA 1XF3A 1ACYH 4BYHA 5D70H 1NDGA 4WU7A 7FABL 3DO7B 1NMBL 1T4KA 4WEBL 1U6AH 3LKNB 5IQ9A 3WFDH 5JXEA 3ARQA 5EO1B 3ARPA 4P2OA 5IOPA 1HYRC 4TPRL 5IW1A 1BJ1J 3S5LB 4LBEA 4JANB 4HPOL 4M3KB 2EXYC 1C8PA 3O2VL 5IB1A 4LIQL 4GG6A 1HHGA 3LQZA 1CGTA 1R3JB 4RAUB 5KJRL 4L29B 3DMMA 5D71H 2X1XR 4TQEH 3QCUL 5CGYD 5EU6E 2RHEA 3MRHB 1MHCB 4V3DB 2VMFA 2E7CA 3BVNB 1WC7B 1OP3K 3MV9E 4XH2A 5I1GH 4WFGD 3UX9B 4PRPA 5E8NA 4XC1H 5DR5H 3WXVH 3RWCB 1VHPA 1H5BC 2XQYG 3DYPA 4PJXA 4E0RA 1J18A 2ERJC 4G3YH 2Q8AH 2E7BA 2DQCH 1LNUB 4L8BA 3M1BA 4OF3A 3BHBA 5AYUH 3MOBL 2H9GA 5D7IB 2X9WA 4IOSD 5EUOB 4CADA 1Y6MR 4PJ5A 5LCVH 2P5WD 2FJFB 3QUYA 4NQUA 5F7LB 4LSSH 3OKNA 4MYWB 1OAZH 4KDVA 5GRUH 2XWJB 4D9LL 5KANI 4YGVB 1VB9A 3QDGA 3RWGA 3DPBA 1YNTB 3HZKB 4PDCE 4KI5E 4XAWL 3OPZH 4HZAA 4I18B 4XNZC 1A3RL 3GIZH 4PRDA 1JPTH 4ODHL 3N50A 1A6UH 4LCWB 3PV7A 3ALWA 2YXMA 1I1YB 4HS8L 3QA3B 2A83B 2IPKA 5E6ZA 4UINH 4Y89A 3JWDC 2BVTA 5D7IF 1FDLL 1HE7A 4Z7VE 4JCLA 4P23B 5T1LD 1IGTB 1BZQK 3DXAA 5TDPA 5HSFA 1CDJA 4LHQB 1H3TA 3O11A 1MFEH 3GMNA 4UQ3A 5DRWA 1GGBH 2OSLB 2ZNWA 4WI4A 1NDMB 4YFEA 1IGFH 3K4AA 4KVCL 2AAVA 1GPOL 2GJZA 3F7VA 4AM0B 5B3NA 1A4KA 3QEGH 5CWSA 4HHAA 5MERB 1BFOA 4PUBH 5INCA 1KACB 3PXJA 4XXDA 2HMID 1CFSA 2R0KL 4K7PL 4PJ8D 1ITBB 3TNNA 1EAPA 3ZE0F 2UUDH 4NHCH 5CP7A 2FL5A 4DZ8A 1NCUA 5C0DA 3JWOL 4PJHB 1MJ8H 3ARGC 3Q1SL 2B1HH 4RFNB 4XBEH 1CXKA 1MHHB 3W2DH 1NCBH 3ARBC 5EO0A 4NOBA 2G2RB 2IH3A 2AVGA 5E7FA 4QRUA 5C0NC 5GSVA 3D2UB 1MSPA 5EO9B 3MO1A 2NY1D 3N1MC 5EZIL 3RBSA 4FQLL 4JM2A 1GZQB 1A7PH 2ZWLT 4RISL 5A3ID 1ZLWK 3WIIL 4Z7NF 3ET9F 1YEFL 1S7VB 3U6RB 4ODTH 2V6HA 4L8CA 4U0QB 4NP4L 2R2HA 3CSYB 1Q1JH 5KSBE 1AGBB 2F8XC 5JUEH 4PJHF 5CFHA 2R0ZL 3K8KA 4Q9CA 2M1KA 2VKXA 1AXIB 4WO4D 4K8RH 1QSFE 4QWWC 2ESVA 5T3XE 5HYEA 3O4OB 3MUY1 2Q1EA 4EVNA 4EZMA 1R5VA 4LPWA 3CXHJ 1BQHG 4XP5H 5CEYA 1XT5A 2BCKB 2NTFB 2PKDA 3EJYC 5I1HL 3MLWH 1DLHB 4EI6B 3QUXC 2LU3A 1MI5A 4DN4L 1KB5L 3UTTA 3T4AA 2FGZA 1X5ZA 4ZFZA 1G9NC 5KZCD 1P7HL 1BD2B 5LXGH 3CFCL 5DD6A 2FJGA 3ULVD 1DQDL 4YHOH 4W6YB 3O2WH 4PJ8B 1T89A 3B83A 5CIPH 3OB0H 1CR9H 4R0LB 3K3QA 4HC1L 1T0NA 2XTJE 4NQED 1NBZB 3MV01 4MQXD 1QD0A 1BF8A 1Z9LA 1VADB 4TVPE 4AYFA 5JW5B 3E6FB 1CDBA 2VKWA 3BSZL 1T1WB 1N4XH 3DVGB 4LRNH 5D5MA 1OM3L 1CLYH 1WBXA 3MRIB 2AABL 4G9DB 5EZJA 5DHVH 1F2QA 3EOAA 1PQZB 2VISA 3EDDA 2NMSA 1C5CL 1XF5A 1UYWH 4RGMC 2NR6D 5AUMA 4HIHA 4QF1A 4LVHB 2B5IB 1G9MH 3EYFA 4IRJC 4YBQD 3GKWH 1V05A 3C5ZC 3FN9A 3AAZA 4P46D 5I15L 2ZNXA 2XFXA 1CCZA 4LASL 4PJFE 4Y5VC 4Y19D 1YUHA 3GSXB 1TENA 2V7HA 1KELL 2J5LC 4JN2A 2AEPH 4OCLC 1A5FL 4HH9B 5DHYA 2G9HB 5GGSA 4JPWH 1OAUL 4G7VH 4WO4B 1A1MA 3JV0A 4OV5A 3ARXA 4TUJB 3VXNA 2A38A 2XOTA 2A73A 3RNQB 3LAFA 3BKJL 3BP5A 3INUL 4U6XB 4M3JA 1QSED 2OR7A 1RZGB 5D7KE 2R1WA 1M7IB 3TIDA 2FBOJ 3OG6B 4KTDH 1UB6A 3HNTH 5I75B 1JTOA 1ZANH 4HH8A 4MCZB 3MLTA 4OLVL 4OGZA 5C0GA 4UQ2A 4UT7H 1YEHH 2Y06H 5KZCB 2DLEA 2P24A 4FTVA 2WANA 5IGXH 2R23A 4XNYH 3RWDA 1QBLL 1W72L 1FZJA 2AV7A 2VDPH 2HJFA 5GS3A 2DQDH 4JFYB 2VNCA 3OJVC 5IMOB 5CJXA 5J6GA 3JV6A 1F3JB 1QPPA 4NQEB 1U3HC 1CICD 5KAQF 4AEEA 4WRLA 1GHFL 2AGJH 1PY4A 1XR9B 1EFXB 1W8OA 4DCQB 2QQQA 5IWLC 2ZPKL 4X7FC 2A77L 4X6CB 5IJVB 1A4JB 2W91A 4ZOAA 1F97A 2BHZA 3T0DA 3PNWB 1ZOXA 1R3LB 3A0OA 3KPSE 4OZHA 3EDKA 4Y1AE 2DLTA 3O4LA 3QISA 3MRKA 4KJQD 1V7MH 5E1HB 4YDJA 2MQ3A 1DQMH 3GMMB 1P7QA 2OK0L 3IDYC 1KT2B 2PETA 1NC4A 3FB8B 2R4RL 2VXTH 3VFVB 3KPQB 3PABA 4BQ6A 5FUZL 3QXAB 1DANU 2VLRE 1ZHNB 4LMQI 3NCJH 3RVXD 3O6KH 2CLVA 5F89B 3T3ME 3SJVA 2Z35B 4HUWB 4DTGH 4YLQT 1M71A 1U58A 4G42A 3V5KB 2X4NB 4V3EB 1M05A 3O3EA 4X6CF 2Z8WC 1A22B 2A6DA 1YNLH 5DO2C 4YFDB 5GHWL 1FFPA 3UXFA 1H3WM 2YSSB 4WDIB 1OWWA 3AREA 1OAYL 1B4RA 1T04A 5IK3B 1A3LL 4HF5L 3LRSB 2HTLC 1MFCH 3WFBH 4F2MA 1PKQA 4P9HL 1UXSB 2L4OA 4NYLA 4PV8B 5KS9E 3MJ9A 4YQXH 5F97E 5EIQA 2JJVA 1QRNA 3MREA 3TVMA 2V2WB 3MBED 2EDEA 4PJGA 1GH7A 3NFNA 1A7OH 1JF1A 3DO3A 5CGTA 4TVPL 4PJ9C 1MCBA 3ECBA 3HB3D 1SJHB 3W0WA 4YK4C 2YPLB 2F5AH 2BSSB 2QSTA 2W9LA 3F5WA 2Z91A 1IGYB 4TRPL 5F6IC 2CJUH 4HGWB 5T3ZD 1I8IA 4KRMB 4PLNC 1BM3L 5L6YL 4XT1C 1J7VR 3V6ZA 5F9WC 2BVEA 4EJ1C 3KJ6L 1UACH 4HPYL 5T1KD 3GRWL 4NQCA 3UJIH 3TC9A 4X9IA 2I07B 2DI8A 5HGGS 4OUUA 4MNQD 4C56A 1AC0A 3MXWH 4R8WH 1C16A 2MJWA 4PJXE 2EH7H 2HLAB 2EE3A 2EIZB 1PEZA 1HQRB 1NBYA 2P5EB 2Z31A 3FO1A 4NRZA 3SGKC 3TM6A 3TZVC 4A2LA 1VGKB 9CGTA 1CFNA 2CRZA 4KJWC 1UFUA 1P84K 2YK1L 3WDIA 4L9LC 4DGYH 3PV6B 5K9KA 2AKRB 3TN0B 4G6FB 2EDDA 5B39G 4J3VA 5A16B 3P4LA 2ORBH 1HHIA 2AQ2A 3BIBX 3QDGE 3DJ9A 1MLBA 4M8QA 1JWMA 4Q9RL 3ZHLA 1FBIL 5F7EL 1S7TA 4ZUWA 2FYYB 5ISZE 3L3KA 4A2MA 2AXGA 3QEUA 2X1QA 4G43A 2AK4D 5ANMA 1MCDA 4TUKL 3UJTL 4OCXH 2Y72A 1KXQE 1FFQA 3MA7A 5GZOC 3SO5A 5FV1L 2YOCA 4KHXL 1RZKH 1EO5A 4KAQH 1ZT4A 4ZSOA 5DJDA 5FYLE 1RV6X 3L1OL 1MJ7L 4JRYE 1BZ7A 2YUVA 1TQBB 2GJ6B 1S8DB 5GS0C 1IGIL 3B5GA 1N64L 5CILL 3T1FA 4ELME 1G1CA 1YC7A 1KB9K 5IROC 2MQ0A 3C6LA 1HNFA 2FZ3B 4CN4A 4YO0B 5T1KB 4MJIA 5L2JA 4OZ4A 1G1YA 3EYVB 1UWXH 4M61A 1YYML 4NIKB 3CAFA 3WFDL 4WCYH 4MGXA 5JQHC 5IP4A 3ZMRA 3GK8L 1P2CB 2JF1A 2WUCH 3NAAL 4YHPB 3FOMB 3LKNA 3U0TB 5EO1A 3D0VB 2C7UB 5DJCB 1TJHH 2H2PD 4OZIF 3IKCB 3S5LA 4JANA 4TYUA 5BV7L 2AJSL 1ZLVH 1L7TH 2JJSC 3NIGE 3CXDL 4JQVA 1R3JA 4PGEB 1K4DB 4RAUA 4L29A 1KXTB 4RA3A 4DAGL 3WXVL 5DR5L 1I3GL 1BQHB 3DI2B 4LDEB 4LLWB 3MRHA 1MHCA 3P9WB 2ZKHH 3BVNA 5KVEH 1R24B 1WC7A 1QLFB 2QR0B 4MXQA 1JIBA 2DQCL 4E41B 3RWCA 3UCRA 2ESVE 3PWPD 3WLWD 2KQNA 5D7JB 3QYCA 5AYUL 4DUWA 3RVWD 4F58L 5FFLA 3ARWA 3FAWA 5D72H 2PYEE 4RGOL 3G04B 2CLRA 3BXNA 1XGQB 1UADC 3OR6A 4S1QL 1LNUA 2X89A 3TGXA 3NZHL 4JGMA 5D7IA 1OAZL 1INDH 5EUOA 4PTTB 2FJFA 3UTTE 5IB5B 3MRRB 1WIOA 3RPIB 5J0BA 2XWJA 4YGVA 1OW0C 3P11H 2VLLB 4MA3B 3HZKA 4M6ML 3LB6C 4UV4H 4I18A 3RZCB 3HLAB 1KJ2L 4QXUL 3KPPB 4HKZB 1I1AC 2VR4A 4LCWA 1I1YA 3CD4A 2E9WA 3QA3A 2A83A 4IRSC 4PLJD 3CU1A 1P69B 3T2NH 4XMPL 1GGYA 1NGQH 4ORGB 1CD9B 3IFNL 2JIXB 4P23A 1IGTA 5FYKE 5J11B 1J8HB 4WTZA 2DM4A 1F4AA 1T2QL 4K7FB 1FAIL 2CKBH 2MMXA 4UT6L 1FORL 1N0XH 1BQLH 2OSLA 1NDMA 4MMZC 2DM3A 3TFKD 1U95A 4BK4A 3AB0B 1HIML 4AM0A 3MBXL 3EO9H 3HMXA 2HKHH 2W07A 2IQ9H 1J0YA 4PD4K 4N0UB 1UB5B 4S1SH 5JR1L 5MERA 4R4NC 1QYGL 1FGVH 4NC0B 3QDAA 4M62L 4ETYA 1JGDB 2VXSH 4CGTA 3PWPB 4I13B 4FQJL 4P2RB 5JW4R 4XPTH 2QSVA 4CVUA 5DJZB 2MKLC 3MCG1 5FM8A 3CMOH 2VJXA 5JHDD 2UWEB 1ZVSB 3W2DL 2B0SL 4PJHA 5ACLA 2ADGB 1F00I 1G0YR 3FTGB 4I5BB 4KH2A 1CFQB 3KLSA 1A7PL 2G2RA 3BI9X 2YD2A 1WTLA 4M7KH 3D2UA 3C09B 5EO9A 1N7ML 2O26U 4KV5F 4UUJB 1KJ3L 3U6RA 1EFQA 1S7VA 5KSUB 3OKKB 4S10A 3HE6D 4WY7H 3RPKA 1KUMA 5I8CB 4MD0B 3CSYA 2UWEF 1AGBA 5C9JB 2IG2H 1UCTA 2QEJA 2KUTA 2ICEB 3MLWL 1JNJA 1ZK9A 2UVEA 5FOJA 3U30B 1VKXB 2L7JA 1C12A 1EJOL 1UKSA 1J88A 4BQ8A 3QDJD 4OZHE 2P44B 2BCKA 2NTFA 2D4FA 4AENB 1DLHA 3UTSB 4EI6A 2AJUL 4P59H 5HI5D 2VZUA 4E42B 3FONB 1EUTA 4LEXH 2CGRH 4QXTB 1GZPB 5I71C 1BD2A 1UA6L 2O93L 1MAML 4PFEA 4S1DC 4PJ8A 4R0LA 4PS4H 3V7AE 1F4YL 1T1XB 2IBZY 3E0GA 2GKIA 3WSQL 1NBZA 1QR1B 1PG7H 4IMLB 4LLMB 4M7LH 5JW5A 4PBWD 3E6FA 4RDQG 3TV3H 4JFEB 1T1WA 1UYWL 2DDQH 2DMKA 1PKQE 3DVGA 3MLSH 5IG7B 2JB5H 1BHGA 3MRIA 1A14L 3GKWL 4G9DA 1N59B 1MHEB 2XTJC 1PQZA 1QRNE 1LO3H 4PJGE 5JA9A 5DK3A 3SPVA 4D0BB 3LV3B 4HS6A 3W0WE 4M5YH 1UJTA 2W9DH 1T2XA 4AEHH 4JPWL 4KKBC 4G7VL 3GSXA 3LPWA 4O4YL 3O6FC 5FYKL 1U8JB 5F7DB 5E6IC 35C8L 4HH9A 2G9HA 4WO4A 4Z78B 4KTDL 4TUJA 1X5HA 3OKMB 3NH7L 3RNQA 4QHNB 4C56E 4XZUB 2EYSB 4U6XA 4UOW1 4ELKB 3QDJB 1RZGA 5FDYA 5B39B 3W5MA 1M7IA 5DD5L 3EDEA 1YEHL 3NGBB 5DQJB 4MCZA 3TIEB 1MCOL 1BFSA 5KBNC 1XAUA 5CIPB 3L9RB 4JFYA 3SDYL 5J06A 3Q6FB 4G8EB 5IMOA 4ODWB 1F3JA 4NQEA 4L9DA 3BESR 2J88L 1HYSC 4PJ7E 1XR9A 3TJEH 1KFAH 1EFXA 2P48B 4DCQA 1DQJB 2M2DA 3OHXB 1AQKH 5DHVB 1DN0B 4OBSA 2XXMB 2P8PB 4X6CA 5IJVA 1A4JA 1B6UA 3VFUB 2EXWD 4LHUG 5FA4B 2R8SL 1R3LA 2Z9TA 3EOBB 2JE8A 1MEXL 2DWEB 3BYYA 4LCCB 4P46A 4ZSOE 4I8DA 3NCMA 3GMMA 4MHHI 3K1DA 2RQ8A 3ULUH 3FB8A 3VFVA 3KPQA 1Z0NA 4DTGL 3QXAA 1ZHNA 1FPTH 4OLUH 2YA1A 1RZJC 5F89A 3DHJA 1MCIA 2Z35A 4HUWA 1TXKA 3V5KA 5IMKB 2X4NA 3VRLF 1MFCL 4XPBH 3WFBL 4JKPH 4OLYH 3VG9C 2GT9B 4PY7A 3MLXH 4WWKD 4WW2F 3MLPA 2YSSA 4WDIA 5F1NB 3CSPA 4OFVA 4M9OA 2B4CH 4L5FL 3EJJX 4RMVA 5IV2B 2L7UA 2YRPA 4NWUL 5EOCJ 1UXSA 1EHXA 1PGRB 4IDJH 2NZIA 4U1GB 3ZKNC 2V2WA 1F4XH 1EMTH 4KQ4L 12E8H 5DVNA 5A2FA 1NC2D 3UAJD 1SJHA 4JRWA 3BKMH 5FHBH 2E27H 3GI9H 1IGYA 5C0AE 4L4TB 5JXEC 4P2OC 2ID5A 4HGWA 5F7HA 1K8DB 5D2NE 3G6AB 4J1UA 2ADFH 4APQD 4HV8B 2APTA 2I07A 1M1SA 4XPHL 3L3DA 5HYJD 3S36L 5AG9A 5ABDE 3JWNC 5DFVC 4BZ1H 1E4WH 2EIZA 1HQRA 4L3AA 4JFQB 4PGDB 5ERWB 1VGKA 3MLYH 1UGNA 1YN7B 5T1MB 1KBGH 2CDGB 3O0RL 2WUBL 4QXGH 4KY1L 3PV6A 1B4JL 3OGCA 3VI3F 2AKRA 5IQ7L 1AY1H 3TN0A 3FHAA 2V9RA 5A16A 2R39A 4HGKC 3GSNH 5E5MB 2NY6D 3RX8A 3IJHB 5EUKB 4XP6H 4WWKB 1KCGC 3B9AA 4XI5D 1RFDH 2XIDA 2I60H 5HHOD 4KPHH 4ZUTB 3QUYC 4Y4FB 3QIWD 5ELIA 2FYYA 3OX8B 5I30H 1MH5B 1W0VA 3BPLB 1MCNA 5FK9B 4BKLB 3ZDZE 1VFAB 2WWMD 3ZE0E 3CU7A 1E4XI 3BH8B 2YKLH 4BH8B 1NC2B 4LOUD 1G7IA 2GJ6A 1S8DA 4MNGB 4F15C 5HHNB 2IFFL 4OZIA 3OKOA 5IMMB 3PXHA 1WIUA 2B1AL 1G7PB 5CSBA 2FZ3A 4YO0A 5T1KA 5CEZD 2A1WL 4WFGE 3PJSB 5IVXF 4OIAA 2PUQT 4XCNB 3DETD 3TWCL 1EHNA 1JHKH 3EYVA 4C4KT 2QJDA 4LCIH 4W70A 2F19H 3VXOB 4R2GD 4X0KB 1U8IB 5AZEL 1KIPB 4PJHE 3WE6B 1WVZA 1P2CA 5EBLB 4YHPA 3FOMA 5EU5B 5H2BB 3GHBH 2BNQB 4HWBH 3U0TA 3D0VA 2C7UA 5DJCA 3BUTA 4L4VD 2P5WE 3IKCA 5DJ8B 4PP2A 4NO5A 3QHZH 4J3XA 3GEWB 3MCKB 1HH9B 5D2LE 4JFFB 4FZEH 3BH9B 2ZKHL 5KVEL 1JNLL 4PGEA 1K4DA 4U0RB 2X4PB 1TTGA 1WK0A 2OXGA 5HHOB 1BQHA 1M4KA 1SY6H 4LLWA 3PG2A 1BJ1H 4M6AA 3VFGH 1R24A 1V3LA 1LEIB 1I1CA 2QR0A 5DJAA 4JM2C 4HJ0D 4E41A 3FQRB 3O6MH 2C3GA 4MB3A 3D6GA 3WL9B 5D7JA 4M7ZC 1B0GB 3GMOB 3G04A 1XGQA 1DBMH 4RIRB 3ARDB 4ZFFB 5HGDB 4BQ9A 4DVBA 3CFJA 3M07A 4PTTA 3QEQD 4NHUB 5C86A 4PB0H 5IB5A 4KKCD 4XX1E 1U2HA 3LEXB 3MRRA 3RPIA 1LEKB 2NY4C 5ILTL 3T0XA 3Q6GH 1CXIA 2VLLA 1HSBB 5BCAA 3RZCA 4JN1H 2K7QA 2HYMA 3HLAA 3KPPA 3T0ED 4HKZA 1NMCC 5I74B 1T89C 2AEQH 4UDUB 2AJVH 2FX8H 1NFIA 2H2SC 4ORGA 5LQBH 2LU7A 4ZPTB 2JIXA 3VXTB 2YR3A 4JDZB 5AWNH 1BQLL 3WKML 1J8HA 2QBWA 1A2YB 4RDQF 4BQBA 2AK1H 4K7FA 1P1ZB 4K2UH 1CK0H 2DJUA 4KROD 2GK0B 3VDBA 4XTRC 2BDNH 4J3UA 3ILPB 4FXKB 3OKLB 1BWMA 4GAJL 3BDYL 5F96H 1VA9A 4YC2C 4N0UA 1UB5A 3CX2A 3K0WA 4U31A 2XPGB 4HMEA 2X4SA 1JGDA 5F9JB 4LQFL 5TQ2H 1ZA3B 5JTWA 3TO4D 2GI7A 3WMSA 1RULL 3PWPA 4P2RA 2RGSA 2WAHA 3DVNB 1H3GA 4LSTH 1AE6H 3B8YA 2ZG2A 2SEBB 2VXQH 5DJZA 3CK0L 3NCCB 1MFDH 2UWEA 1ZVSA 5EC2B 3KPMB 1JF6A 3BGAA 4ZPVB 2N7AA 5JW4N 2ADGA 3WFCH 2MCPH 4AL8H 4M7LT 3LD8B 3QWRD 3FTGA 1B6DA 4D8PB 4I5BA 2BVQB 1CFQA 32C2B 3QEQB 2BC4B 4HIEB 1FCGA 2A9MH 3MLZH 4FHBD 4GXVH 3ULVE 4WY7L 1FNSL 2K9UA 1RK0B 2F9BT 4UUJA 4ZYKB 3STLB 2OP4H 3TF7C 1KLGB 4LHUB 5KSUA 3OKKA 4NQEE 3AMKA 1WAAF 2ICCA 1NGPL 5I8CA 3IU4H 3KS0H 4M93B 4MD0A 3SQOH 1J1XL 5C9JA 3V52H 1HWHB 3U7YL 2WP3O 4F37K 2X40A 4OI7A 4X6CE 3DHMA 2ICEA 4DJMA 4GRLB 1AD9B 4G8GD 3RGVB 4DFIA 1VKXA 2CKBB 1DVFD 2HG5B 4LEXL 2CGRL 1ACZA 3LEVH 1Z0MA 4Y19E 1D9KB 4E42A 1AR1C 1GXEA 4PJIB 2YA0A 4QXTA 4RZCB 1YA5A 4KJYB 1AXTH 5EIVA 2V2TA 1GZPA 1ZHKB 3ETBF 3E2HB 3ARYA 3ALXA 3QI9D 4QXWA 4LU5L 3VGGA 2ED9A 2WQRA 1S7RB 1T1XA 4NGHH 2BJMH 5C70A 3UEZA 1QR1A 4IMLA 1ADQH 4LLMA 3SOBL 3PQYB 1JZ8A 1QSEE 4U1MB 4JFEA 1PX4A 5B8CB 1OP9A 5I0DA 4K94H 1ZE3C 4OCWL 4DOHE 1N59A 1MHEA 3ZO0A 4CVXB 3F8UB 3MJ8B 4DZBB 1CS6A 4K3HA 4YHZL 4JKKA 4X9HA 4PJIF 5KOMC 3JSSA 1MJUH 3AREC 4D0BA 4H25B 3LV3A 1QFWI 2G5RA 4NM8H 3HI6H 1EZVY 4WHYH 3ZL4H 5GXBB 1F90H 2QLVB 4UBDD 3TVMC 4H0GA 1XEDA 3HE6A 4R6UA 4EIZC 3SN6N 1U8JA 2DN7A 5F7DA 4Y7MA 3MV8B 3VE0B 4YEEA 1NMAL 4ALAH 2NCMA 4Z78A 3OKMA 4KMLB 5BVPH 2NZ9C 4FA8A 4XZUA 4NFCA 1T1YB 2EYSA 1QACA 4X9FA 4ELKA 4Z7WB 3QDJA 4NQXB 5B39A 4F8TA 4OGAC 2ZSWB 4R3SB 3VJ6B 2YC1B 5DQDH 5DQJA 3OKYA 1RIVH 4U3HA 4FZ8H 3VG0L 3MC0A 5H94B 3TIEA 2IBBA 4LPCA 2E6QA 3AS1A 4FABH 2Z31C 3IDUA 5CIPA 1L9MA 5FV2A 5J13B 3L9RA 4RMTA 1TLKA 1KFAL 2EDWA 3SE8L 3Q6FA 4G8EA 4HIIB 1PAMA 4ODWA 2ENYA 1R3KB 4OI8A 1LD9A 3QPXL 4M6NH 1UEMA 4BFIB 4Z7WF 1WZ1H 3GMRB 3QCVH 1CGXA 3HG1B 2HFGL 5LWYH 4FFVD 1DQJA 1KTLB 5E2TL 2NYYC 3ULVL 3OHXA 4FOMA 5DHVA 2DF3A 1DN0A 3WJLA 4NNXB 4DEPB 3VFUA 4YFLF 1PLGL 1I9RH 5FA4A 3TA3B 4BSVB 3EOBA 2DWEA 3BPNB 3C2AL 2WBKA 1T3FB 1QG3A 5FCSH 1ZLSH 5T3ZE 5CEXB 4G8FB 4K3DH 2D0FA 4OZIE 4JKPL 2DKMA 3PHSA 1OB1B 5GRXG 3QUZD 5KW9H 1S9XB 2BHYA 2DI7A 1S9KC 3ES6B 5IMKA 4M48H 1ONQB 4KKLD 4Q6IB 4MNQE 1CDUA 3G9VA 2YMXH 1IZJA 4KUZL 2GT9A 4YZFE 5F1NA 1G7LB 3WIFB 3C6LC 1EMTL 1XGTB 5IV2A 3TESA 2YZ8A 1N6QH 3HUJB 1LDSA 3NN8B 2BRQA 1T6WA 4UV7L 3GM0A 5GS2H 5ALCL 1LGVA 5K59F 5T1DH 4YHYC 5DUPH 4GW4A 2QQNH 2EXYD 1JRHI 2DL2A 2XV6B 4YR6B 4L4TA 1I7RB 1T03H 1K8DA 5C7XL 5FDWB 3S35X 4NJ9H 1KN4H 3G6AA 4JG1L 1H8NA 4JO1H 4HV8A 2QHRH 3BWUC 4RSVA 1EO7A 3TBWB 1BREA 2AK4E 3HUJF 3NCEB 3BGMB 4V2BA 4JQVC 5CP3A 2D7OA 3CLFL 4WJ5B 2Q6WB 1AFVH 8FABB 3RKPA 1OP3H 3EFFB 1RIHL 4PGDA 5ERWA 1MRFH 1AY1L 1YN7A 1NKOA 5T1MA 1P4IL 1SEQL 2CDGA 4PJCF 4MXQC 4ZNCD 3KPRB 4I3SL 5HHXH 5JOEA 4FFWC 1RFDL 5E5MA 3DIFB 4JJHA 3IJHA 5EUKA 4HULB 5DT1L 2X4RB 1XGUB 4I2XE 1SEBA 1U42A 2QSCH 4WWKA 3GSWB 4ZUTA 5F88B 3MODH 5KG9B 2XZQL 2VDLH 3OX8A 1MH5A 4HEPG 1AGEA 4JFDB 4LARH 5IVXA 3ULUF 5FK9A 4BKLA 3ESUF 1WITA 5DLML 2CK0H 1MHPH 1KEGH 3DARA 3BH8A 2DKUA 1X5IA 4N5EA 4I18C 4NKDB 4BH8A 1G7HB 1NC2A 4OF8A 4MCYB 5I8OL 4JM4L 43C9B 1D5MB 4LLQB 4MNGA 4GW5B 1CU4L 3IDJB 5HHNA 3QHFH 4OT1H 4P23C 5IMMA 1SYSB 4Z7UE 1JHKL 1QFPA 3GFUA 5JXAH 4JFPB 1II4E 4N0UE 1G7PA 4APQA 1A7RH 1MREL 3ZKMD 2AJXH 1MUJB 4KV5E 4MX7B 2MCG1 2EDHA 3PJSA 1AGCB 4XCNA 5E4IA 3MMEB 4F7CB 2OBGA 1UEYA 3JTTB 5DMYA 3PWPE 3QXVA 3VXOA 4HK3N 5T3ZL 5GRJH 1KYOJ 2YD8A 4IMKA 4JY6B 4PB9H 4QRRB 2CD0A 1U8IA 3MFFB 4X0KA 1KIPA 4JZOB 3WE6A 5GGTH 4KXZH 5EBLA 5H2BA 5EU5A 1I3RB 3PGDB 4HJGB 3SGDI 1DP0A 1UM4H 2EKSA 3ARBD 4BFGA 3T65B 5DJ8A 2GK2A 5GIRB 3GSNB 1U93B 5C0ND 5TF1L 3QRGL 5ENWA 4Z5RA 3MCKA 1S7QB 2IBGA 1HH9A 4XB7A 1FQ9C 4JFFA 4RFNC 3BH9A 4FQCL 2X4PA 6FABH 5HHOA 4JHAH 2VDMH 3R4DA 2NPLX 4GOSA 2VYRE 4XC3H 1CE1H 4G9FD 1M7DB 4UB0H 1LEIA 5ESVB 3QNYB 4MDJB 4K3JL 4QCIB 3LKQB 4WGVB 1HHJB 3FQRA 4TNVF 5I73B 2BY2A 2DS4A 3WL9A 3J8F7 5EH1A 1B0GA 4UMGA 2ZCHL 1KCVL 1U8NA 4KDTA 5GGRB 4CVZA 3OXRA 1OD7A 3GMOA 4JPVL 2Q8BH 1T80A 2XY2A 1G6RH 3EJYD 3WNPA 4EN3B 4RIRA 2WK2A 4PB0L 4XP4L 1DLFL 2QTEA 4AIOA 3ARDA 4ZFFA 5HGDA 4LVOB 4U6VL 4JHZA 1IZKA 3TEUA 3O4OC 3U4BH 3SDXE 4NHUA 3V0VB 1A7BA 4TSBL 1X9QA 2BXZA 1UWGL 3LEXA 4AY0A 4JN1L 4V1DD 4Y0GA 1LEKA 3VFWB 1VEPA 1JYVA 1I9EA 3LVEA 1JZ2A 3TYGH 1HSBA 3CVHH 3QT2A 4YWGH 3C9NB 5IFAL 5EG6C 3VGDA 3VGFA 4Y88A 2UUDK 5JHDE 1YEJH 1XF4B 4NZUH 1W0WB 1A64A 4PJ8C 3T1WA 4UDUA 4R0LC 4PTUB 1U92B 4ZPTA 1UZ8B 4ONGL 3VXTA 2HLFD 4JDZA 4TOYH 1NAKH 3IAGC 2BK8A 4LL9A 3IJSB 3I84A 3DVIA 3RKDC 4IRJD 3SE3A 1P1ZA 2WBWB 2GK0A 5FF6B 5IEKA 1UKTA 3ILPA 4FXKA 4LSQH 3OKLA 2BMKB 2JKXA 4Y5XB 3WNOA 4FFEX 4MAYB 3W5NA 4LSTL 2B5IC 4G6MH 4LVHC 1AE6L 2BSTB 2XPGA 1HILB 3U4AA 5F9JA 1UH2A 2X4QB 3GI8H 5C0FB 1ZA3A 2NX5D 4HKBB 1U2CA 1OAQL 2MCPL 3KLDA 1RJLB 1WAAA 3DVNA 2AI0H 2SEBA 4N0CA 1Q9LB 3MCLH 4KDWA 2O5XL 4LDLB 3QDJE 3KPMA 5EC2A 5I18L 1VPOH 4ZPVA 4XBGB 1JGVH 2NXZD 4WO4C 1ZTXH 3MA9H 3V2AR 4U1HB 1BQSA 4D8PA 2BVQA 32C2A 3QEQA 2BC4A 2OP4L 4HIEA 2BHUA 1FZKB 4H8WH 4JY5L 3OMZA 3K2UL 4V1DB 1RK0A 3IU4L 3QZWG 4ZYKA 5I75C 1PBYA 4JFOB 4MB4A 5LVEA 4JB9H 1KLGA 4LHUA 4LPUA 2DB8A 4N1HB 4J7RA 4BQCA 1CLZH 1XZ0B 3VD9A 2XN9D 4Q74A 3TBSB 1XGRB 3BUYB 5F44A 1JPSH 1VERA 3UZEA 3QQ3B 4F7PB 1DSFL 1QBBA 4W4NA 1IC1A 2GY5A 4JREB 2EYRA 3BRGC 3GB7B 3QXUA 1PVHA 3VRLE 4GRLA 1AD9A 2FATH 3ARUA 1IILE 4MQXC 3RGVA 2CKBA 2EDYA 2YBRB 1KJMB 2HG5A 1IEHA 1AXTL 5GGVY 1JGEB 1IGML 2KPNA 4RWYL 5F3HB 3NCYP 4GBXD 1D9KA 1F4HA 4IDLA 3S34L 3WCYA 2NR6C 1JZ6A 4PJIA 4RZCA 1WISA 1K85A 4KJYA 3S97C 4PRBB 1CGWA 1ZHKA 3E2HA 1JWSA 1C1EL 1UH4A 3FB6A 1JZ4A 1ADQL 4TSAH 3BPOB 4NWTL 3B4NA 2NX5B 1S7RA 5C08D 3LMJL 5E4EB 3BW9B 5BRZD 3AVEA 5DO2D 3EBAA 5EB9A 3MJ7B 3PQYA 4U1MA 4LFHG 3GO1L 2HTLD 3DUUB 5B8CA 2NXZB 4PJAB 1MJUL 1KPRB 4I9WD 3QWRA 4IOIA 4CVXA 3RIAK 1P4BH 3MJ8A 4DZBA 2OTPA 1F90L 3NMEA 4J3SA 2VL4A 2J2ZA 3X3FH 4H25A 4H5SB 4PJ9D 1EUUA 1Z2KA 1CDGA 1T1ZB 2VIRB 5IVZB 3OL2A 4X6BB 1JHLL 4ALAL 3VFRB 1WBZB 5GQBA 1D3CA 4H1LG 3PGFL 5DXWA 3VI3E 1CGSH 4HIJB 4NZJA 1WF5A 1L7IL 3FN0H 5BVPL 3VE0A 3QPQC 3GSVB 3PWJB 2H3NB 4Y2DB 1RURH 1V8HA 2OJEB 2P1YA 2DQTL 3OZ9L 1RIVL 1T1YA 2XI9A 4AT6B 4NJAL 4Z7WA 4NQXA 1Q0YL 1RUMH 2VXUL 5LKNA 3TZVD 4R3SA 4X4ME 3JTCA 3VJ6A 4FABL 2YC1A 2I26N 5H94A 5ICXB 1RMFH 2A6IB 1EHLH 2HN7B 2RBLA 2ZCLL 2CXGA 2DQFB 2E7LE 3ALPA 1JVKA 2L0DA 3IB4A 5FCUH 4NKIL 2XG5A 4KJQC 4N9GB 4ERSL 3SKJH 3NZ8B 5C08B 1KPUB 2WY3A 5BRZB 5A2KH 4HIIA 4HBCL 4NKMB 2QSQA 1R3KA 3VXUB 4BFIA 5I19H 1S7UA 4HQQL 2LU4A 3TN0C 1CL7I 2CDFB 3HG1A 5HXMA 1R5WB 2R4SL 1KTLA 4K9EH 4BZYA 4TULH 5IVXE 1DBJH 5T33H 1OY3B 3LS4H 4NNXA 3BKCL 3S88L 4NPYB 3TA3A 1CGVA 4BSVA 3RWHB 3ZTNH 2QQLH 1UM5L 3TT3H 5GZOD 4I77L 5JQ6L 1T3FA 1J1PL 1UH3A 4JO3H 3L7FA 3W81A 3LEYL 3R1GL 5CEXA 4G8FA 4PJEB 1OB1A 3HB3C 4JVUA 4K7PX 1S9XA 4DUXA 5I0ZA 4LKCB 3HC0B 4M6OH 2DMBA 1ONQA 2V9TA 1TQBC 4Q6IA 3MJGX 5HYJE 5DWUH 1Q72H 2YPVH 1U41A 2IPTH 5HBBA 4M43L 4ZNEE 1YEIH 1G7LA 3DSFL 3UTOA 3WIFA 5DSCB 5LBSH 4MZ3A 4OLXL 1XGTA 5E99H 5IT2H 5DUPL 1NCAH 3VD4A 3HUJA 4JPKL 4NQDD 3A67L 3NN8A 4Y5YB 3C08H 3VFTB 2EYTB 3W11D 4R4FL 5CD5C 1D5XB 4PJEF 1T03L 1S7XB 3O45B 1NCTA 3EZ8A 3IDXH 4PJCA 1KCLA 5JW4Q 1KN4L 2ZUYA 4YR6A 4QOKD 1P84J 3MLRL 4UNVA 4JO1L 1GC1H 1I7RA 2K3TA 1QTYT 5FDWA 5HHOE 4YBLB 1Q9OB 1G6VK 4Q9BA 4BM7A 3LQAL 5MHSD 3TBWA 5JHLL 3BP4B 1MRFL 3BGMA 1C7SA 1RUAH 3EYQC 1NUDA 3QFJB 4WJ5A 3VFOB 3R0MA 2Q6WA 5ADOL 4DW2L 5CINL 4N0YH 8FABA 3EFFA 4ZO9A 5HVHB 2ZUVA 5CKAA 2PF6A 5EBWB 3ZZ1A 3KPRA 4P48A 1SJXA 4P2CG 5IEHB 1IARB 1MWAH 3OF6D 5D7JC 4BZ2L 2IPUK 3WS3B 4UTBL 3CLEL 5CEZE 2OJZH 3DIFA 5BZDB 2QV2A 5HDQH 4EUPH 2X4RA 5GJTH 1XGUA 1TJGH 3LB6D 4X8XA 3GSWA 1UWXK 3UYPA 2YWYA 4LSRH 2J8HA 5F88A 1MQKH 1KB9J 5KG9A 1OL0A 1I1AD 4KQ3L 3WXWH 1FL6B 2XZCH 4JFDA 4NQDB 4IRSD 4HFUL 4ZO8A 3RJDA 2DYPD 1JGLH 4XP1H 2R69L 1MF2H 4L4VE 4NKDA 3X13A 1WZKA 3RZCC 1G7HA 2HRPH 1NLBL 5DRXB 3TBVB 3L3JB 1QVOA 3RIFK 43C9A 2H6PB 4QOKB 1D5MA 1ZLVK 4PJDB 2CUIA 3WIHH 1FZMB 1SJVA 2AJXL 4GW5A 4KVNL 3IDJA 4CKVX 1TNNA 2IC2A 1SYSA 4OM0L 5J11C 4JFPA 5C8JB 2AEIT 4LFHD 3CZJA 1MUJA 4PB9L 1OOAA 1KENH 1AGCA 1ULVA 5I8KL 3MMEA 4F7CA 3VW3H 3BAEL 3JTTA 1K6QH 1DL7H 5DRNB 3H9ZA 4NZTH 3AB0C 5IBTL 1WAAE 2BNUB 3VGHA 4JY6A 4ONHB 1EEUA 4QRRA 3MFFA 3QZWB 4JZOA 1TZGH 2YRLA 1VEMA 2FX7L 3C87A 1I3RA 1PSKH 3P77B 3Q5YA 4QNPF 4PJDF 3PGDA 4HJGA 3S35H 5HVGB 3U36B 2OZ4A 4EDXB 3QEQE 1FJ1B 2HFFB 3T0BA 1BIHA 5GIRA 3GSNA 1U93A 1XF2B 5HI4D 6FABL 4WHCA 1F6FB 1FRGL 1WCQA 2VDML 4D0DB 3NABH 3LN9A 1RZFH 3MLVH 5EU3B 4KHTL 2EC9U 3JV5A 1UXWB 3U2SB 1X4XA 1H9VA 3PP4L 3T0EE 1M7DA 5CKGA 3Q5OA 2FHCA 2R56H 3C09C 5ESVA 3QNYA 4YIQB 4NUGH 4MDJA 4ODSL 4QCIA 3LKQA 1HHJA 4GLRI 2DYPB 1G6RL 5L9DH 1QQDB 5C2BH 4U1KB 3U0WL 1DQTA 5DJXA 5GGRA 5DJYB 2PN5A 4PJBB 1TFHA 4GQ9L 5TFSL 1O0VA 3ZT5A 2O5ZL 1AI1L 5DA0B 3FHQA 2FEEI 5FHAH 2DQHH 1F02I 4EDWL 3E8UH 4ONOA 5SX5K 3F58H 1HSAB 3U30C 2LTQB 5DFWH 5C0RH 4I1NB 2CMRH 4Y4KB 1GGCL 2VSDA 3QWQB 2GW5A 2V9QA 4S1DD 3VFWA 1VSCA 1A9BA 4TSCL 3HHRB 4ZOBA 1VFBB 3NPZB 4QHKI 3V4VL 3C9NA 4Z0BH 5I1AB 1RVFH 2BZDA 2ED7A 4PJBF 5HHPB 1XF4A 4HXAL 1W0WA 1QPXA 4HWBA 3H9SB 2F53D 1GOHA 1S5IH 2IMMA 4Q6YA 4LAQH 4OD1H 1U92A 4PTUA 3UPRB 1UZ8A 1KCUL 4TNWK 1FIGH 4LSQL 4GAYB 5SV4A 3IJSA 1C7TA 3RP1A 3C5JB 1TIUA 2DQIH 4YEFA 5FF6A 3LH2H 2FGWL 25C8L 4OCNC 4QHUB 4HLJA 3D3VD 1SY6A 4KKBD 1DJSA 4Y5XA 1LDPH 3O6FD 5HD8C 4MAYA 5E6ID 2BSTA 2O61A 2AI0L 5B21A 3MCLL 4QO1A 3THMH 1KIUA 4UU9B 2X4QA 1A21A 2ZG1A 5C0FA 4X6DB 4HUKB 1VPOL 4HKBA 3O3AB 1JGVL 1RJLA 1ZTXL 3HE6C 4G8GE 2A6KA 1Q9LA 4F9LC 5IR1B 4MDIB 5C0EB 5DJ0B 4Z7WE 1I9JL 5DC0A 1J11A 1QNZH 4XBGA 4K8RC 1QFWM 4MJ5B 5EZOH 2NQCA 2N1KA 4U1HA 4L8DB 5DZLA 5JA8B 1FZKA 4GJTB 5C0BB 3BISA 4JB9L 5HHMD 4AEIH 1IKNC 3EUUA 3QG6B 4V1DA 3NGBC 5I1EL 1FYHB 5FUCC 2C26A 1ZMYA 5GRWA 1JPSL 3CVHB 4X6DF 1IAIM 4OJFL 1U3JA 4M02A 2NY5H 3LRGA 2DLFH 4J3WA 3BJLA 3TBSA 1A1NB 1HYSD 1XGRA 5DEZA 3BUYA 5D1QB 3NIDF 2EH8L 4F7PA 4YNYB 4EUPG 2DQUL 3GB7A 1E6OL 2GITB 3NA9H 3BQUB 4U4BA 4JGJA 3RWFB 5TDNB 5GGVL 2J4WH 5F93C 4HWEH 2KBGA 3RDTD 2YBRA 4AH2B 1KJMA 2LE9A 3MZGB 3SKUD 5HGBB 3MYJA 1QOKA 1JGEA 1F6AB 1E6JH 4QRPB 3HCVB 5F3HA 3WJLC 4ZFOA 4TSAL 3WO4B 3I2CL 1DANT 4PRHB 1G9MC 2VDOH 1KLUB 5K59E 4PRBA 4JZJB 4H20H 4LCCC 1KC5L 2H32H 2NX5A 2I5YH 2ZUSA 3BW9A 3VGBA 3LKRB 2FB4H 3GMPB 4Z7OE 4P3DB 3MJ7A 4X7CC 15C8H 4NBXB 2JELH 1V7NH 5I76B 4Y8AA 2VDRL 3DUUA 2FO4B 3MRPB 1KPRA 3X3FL 3DX9B 1K8IB 2NTSP 4PP8C 4BJLA 1Q8MA 3HUJE 2VQTA 1A3QA 4M1CC 3ZKND 2YPKB 4NZDA 4A6YH 4H5SA 1IGCL 1T1ZA 2VIRA 4P3WA 5IVZA 3FN0L 3AY4C 4ZODA 1LE9B 4PJCE 4YGAB 3SGEH 4RGNB 1CVSC 3VXPB 4S0SD 4U1GC 3VFRA 1WBZA 3H2WA 4XVTL 3UROR 4HIJA 2PCPB 4NZRH 2CPCA 1JFMA 4YHMH 3I50H 4D94A 3MV7D 2WLYA 4RCAA 2J6EH 3GSVA 3GM8A 3PWJA 2H3NA 2OTUB 3S8WA 4Y2DA 1KTRL 2ZUQB 2OJEA 1PW3A 4KZDH 5DFVD 4AT6A 3RDTB 2DQEH 1ZA6B 2BSRA 3QDHA 3P9MB 4WVRA 4GBXA 4PRPD 2PO6B 5ICXA 4F33B 5BJTB 2A6IA 5IHUH 2EXWC 4FQ2H 2HN7A 3K80A 2DQFA 4XAKD 3CVIL 3MPCA 4N9GA 4GXUM 3RVUC 3NZ8A 5C08A 1KPUA 3EFDL 5DVLA 2XA8H 5BRZA 1VFOA 4NKMA 1LQSR 4YDIL 5FAAA 3VXUA 5B4MC 1DBJL 4PJ5D 2CDFA 1R5WA 1CLOL 4AQ1B 1BBDL 3I02B 4KGLA 1VGEH 5EOQL 4NO0D 1OAKH 3N06B 3KR3H 3BIAX 4WUKL 5I6XB 4NPYA 3WD5L 3RWHA 1RK1B 1L8JA 4WWKC 2JLLA 1URLA 3UPAA 5L7XL 2OMBA 4Y4FC 5EOTB 5D8JL 1MFBL 4JEGB 1LQVA 1YJDL 4C57C