3ARFC

Ternary crystal structure of the mouse nkt tcr-cd1d-c20:2
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
204
structure length
203
Chain Sequence
TQVEQSPQSLVVRQGENSVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title A molecular basis for the exquisite CD1d-restricted antigen specificity and functional responses of natural killer T cells
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 41
structure length 203
sequence length 204
ec nomenclature
pdb deposition date 2010-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3arfC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3arfC02
4TPRL 5E95B 1YMME 1K4DA 1YMMA 4PRPD 5CGMA 3ECBA 3ARDD 3QCUL 2VN7A 3EOYG 1H8SA 1Y6KR 2J5LB 2PXYA 4QHUB 3PHQA 3MYJA 1QOKA 4UTBL 2EDBA 4NO0A 3S4SG 2CIKA 3QUXC 4G8GE 4G8GA 5D5MF 1EXUB 3EYFB 5TF1H 4I18C 4LMQE 4MNHA 4S1QH 1JF1A 2EDDA 5E6IA 5C6TH 4MJID 1W72L 5F21B 1ED3A 1HZHL 2H26B 4J1UA 1GH7A 2R4RH 3MV01 3QAZC 4KKBC 3VG0L 2Z8SA 1EEQA 1IC5L 4KRLB 3EDJA 1RUAH 3GB7A 5T1DH 3B9DA 1CFTB 4WU5A 1BVKB 3B3IB 1TETH 4S1RL 2P5EA 1OD7A 5GJTL 5D6CA 5D9SA 3V4PL 1ZVSA 2P44B 1NPUA 3P4NB 2PYFB 3VXOB 2EDYA 4DGIL 4JFDE 4JFDA 1KLUA 4DUXA 5T33L 4WGWB 2APXA 2QADB 12E8L 2F9BT 3NCYP 1P9MA 1UWEL 2ZCLH 2AP2A 4GSDH 3LPGA 4KY1H 4X6CF 1ZVHA 4P99A 5DZLA 2PW1A 1IM3A 1T21A 2VO5A 3PWJB 4WEUD 3RGHA 4MMXC 1CU4L 1QRNB 2FEDD 5GGTH 4IOFC 4XNUH 5KSUB 5L2KA 4XRCA 4MCZB 4YPGB 4V1DE 1X5GA 4V1DA 5IB5A 4KKAD 1MFDL 2FDBP 1YMMD 1EHXA 3JWDC 3GSUB 3TO2A 4Q6YA 1UCBH 2DKSA 5F89A 1F00I 3IU4L 3U6RA 1DN0A 2LU4A 4JPVL 2VXVH 3CK0L 4PBWD 1H8OA 4NO0D 2Y5EA 3K74B 1R3KB 1CXEA 4GRLB 3NACH 5FV1L 3EYUH 2P8LA 4G8GD 1J87A 4Y5XA 1RJYB 3SE4A 1DQJB 4PR5A 4HF5L 5ESAB 5E6ID 2Z31A 1ZLVK 3O41B 4NNXA 3VWKA 1IGJA 4MA8L 5KVFH 4LRIA 1HH9B 5IBTL 1WQVT 4A6YA 4DZ8B 5GRVK 3NABH 3R8QA 2NY4D 1P4LB 3LB6D 1W0YT 4ZDHB 4KTEL 5D1ZC 1BM3L 1C7SA 2NY0C 4P5TA 3S7GA 5TQ0H 5I1IL 1EK3A 4OFIA 1LO3H 1T7ZA 3L1OH 3KS0J 2R9HD 4G8FA 3PP4H 2Z35A 4EBQL 1A6VL 1DZBA 4FS0A 2QQLH 3O3AA 3WIHH 4JFDD 5MP6L 4JG0L 4NKQB 4LSSH 4NHUA 2FO4A 3GMMB 1U8HA 4IDJH 1FFPA 3UC0L 4N8CH 5EIQA 4ZUSB 1ZHNB 2CDEB 2F8OA 1ONQB 2JB5L 4QY8B 4WUUE 4ZFFA 4G7VL 2YEZB 1JN6A 4NJ9L 4K55A 3PWUB 1E4KC 3CMOL 3ROOA 1KNOA 4HV8B 3IDUA 1Y18B 4G3YH 3RWGB 3N1GC 4JANA 1D6EB 5DI8A 4FHBD 4V1DD 4IMLA 3K0WA 2PO6B 2VXTH 1ZHBA 4P2RB 4LASL 1PKOA 1OPGL 3TN0B 2W60B 2UYLB 4YE4H 2EDFA 5HJ3B 2XZQH 5CGYD 4ZPTA 3H6JA 4JGMA 3RL1A 4W6YB 1BJ1J 1ZT1B 1T04B 4KKCD 1J5OH 3QH3A 2YD9A 1JYXA 2CLRA 2Z31D 5TF1L 1S9YB 5E94A 3WKMH 2WIMA 4S1QL 2X6MA 4L3EA 1OL0A 2ZNXA 3UBXA 4EN3C 5C6TL 2NLJA 4HKZB 2R4RL 4P5TD 3O3DA 3K8KA 2HLAA 3G08A 1RUAL 5HVHB 1NKRA 2OZ4A 5T1DL 4POYA 1I9RH 3CU7A 3DX8A 1TETL 2PCPB 1OTTD 4OZIB 2OK0H 4Z7WF 3EFFB 1BBJA 1U8MA 3IVKB 1PKQB 1EVTC 1OP9A 3BH8B 3WFDL 4DTGH 4X9GA 1WCQA 3KYMB 3H3PL 4WUUD 4HZAA 2R0LH 1GAFL 2ZCLL 5IVXE 5IVXA 3QI9B 4GSDL 4KY1L 4LSRH 3RX5A 2J5LC 3SCMB 4L29B 1ES0A 5EFIB 5GGTL 3S5LA 1TNNA 4LNVA 4NKOB 2XNAA 3E6FB 1ZANH 3MRMA 4ETQA 5EZOH 4LCCA 1YY8B 1Z6JT 4HQQH 3BW9B 2NR6C 5EDXA 5IJVB 4XMKH 2IANB 1DUZB 2VXVL 3AUVA 3EDEA 1U8NA 5HYSA 2KUTA 3RUGF 3BIKB 3RY6A 1TJGH 3P9MA 3NACL 3IJYA 3EYUL 3ULUH 2ZG1A 4Q97A 3FN3A 1WBZB 4L3ED 3X14A 3K80A 2I5YH 5J12B 4XHJD 3BZFA 5ECJE 5KVFL 1F3RB 4P2QB 1DDHA 5F88A 2QADC 3NABL 1MLCA 2D9CA 3N9GH 4JJ5A 2IFGA 1OY3B 2AV1B 5TQ0L 4PJEE 1EBPA 1LO3L 3L1OL 2IG2H 4OI7A 3PP4L 3W9DA 1A9EA 4YXKL 1VADA 4OIBA 4QKXB 2QQLL 2XN9E 3WIHL 4LSSL 3QXTA 4JVUA 1UZ6E 4IDJL 1YEGH 4MYWB 3BP7A 1OP5K 2BSSB 5FO8B 1Q0YH 3LHPH 2B39A 3SJVA 2WWKT 4PRBB 4HMDA 4XBPB 1BQHA 4ZFZA 3RI5K 1A64A 3S9DB 3VD3A 2YPLE 3BDXA 5D71H 4GRLC 2R2HB 4G3YL 3ARSA 3DXAB 2ICWB 4HFUH 2GW5A 1VB9A 2QQQA 2P24A 3DARA 5IKCB 4MQ7A 2VXTL 2LV4A 4NT6B 5DVMA 1BZ7A 4EKXA 4HCRA 4YE4L 3RJQB 3QG6A 5BQ7A 5AD0A 2XZQL 3VXSB 2YXMA 3GBLA 5DHYB 1HK6A 4YXLH 4AIOA 3H7BB 5CSGA 5DEGB 4XP1H 3MRIB 4WIQA 4R4BA 5BXFB 1IGMH 1J5OL 4XHQA 5KANG 3D1MC 1WUNT 3GSRA 4LPXA 3GMQA 5ACMA 3STLB 5INDB 5K59E 1O0VA 4LLDA 3FN9A 5CLTA 5EG6C 2A73A 1N7MH 3BMWA 4RZCA 3TPUB 4QXWA 1DLFH 3QCTH 3RWCB 3MA7B 3BP6A 5EU3B 1BFTA 4HPOH 4BYHA 3KXFA 7FABH 1J10A 2OM5A 4RIRA 4G9DA 1S5HB 5HDLA 1F6AB 1I9RL 1S7RB 1AD0B 1TZHB 3F12A 1HILB 3EAKA 3QZWG 1JIBA 4PB0H 3V5HB 1NL0H 2DWDB 1EFQA 4ZOCA 2XN9D 3F65A 1AGEA 3OGCB 2BY3A 1T1YB 2OK0L 5HGBA 4HPYL 2PO6C 4N90E 1FG2B 2G9HB 1C08A 4U31A 3TN0C 5FA3A 4XNZB 4DTGL 1MCBA 3L7EB 3WUWA 2RAMA 2R0LL 3VW3H 2YPLD 3EKCA 4HGWB 4JFOB 1LGVA 2RCSH 4LSRL 3EO0A 5B8CB 4QXGH 3VCLB 1JHLH 3DBXA 1R3HA 1GOGA 4HJJH 2IADB 3V7MA 4Q7DA 3M1BA 1MWAH 2D0FA 1TVBA 1ZANL 1LQSR 43C9A 5EZOL 2F58H 5DD5L 1CD1A 3T3PE 3FRUB 3VXNB 3RFZC 4HQQL 1YY9D 4KGJA 1U36A 3CFDA 4XMKL 5BJTA 3ARUA 4HSQA 3C2AH 2UWEF 5TDPB 3ZKND 5HVHC 1TJGL 1S7WB 3FFCB 5DUBB 4HWEH 1UXSA 2DYPB 3ULUL 2A77H 2AQ1A 1B6DA 1R24B 3H0TB 2NZIA 3JV6A 1MJ7H 2I5YL 3WS6C 5DO2D 5IW6A 4HH9B 1FLRH 4JRXA 4U1KA 2FNBA 3N9GL 2Q8BH 4Z18A 3HLAA 3QI9C 4UAOB 3KPRB 3STZA 4OGXH 4KJQD 4KZDH 3IDGA 3SCMC 4BJLA 3WDHA 1MCEA 2JCCE 2JCCA 2IG2L 3UJJH 3WUZA 5I15H 5HPOA 1INQA 4N90D 1RZ7H 1XAUA 5C07A 5C07E 1S7UA 2JJTC 2X4OA 3BPCA 4X8JA 1YEGL 1QVOA 3MUHL 4PJFB 5MEPA 2W07A 4ORGA 1Q0YL 2GQHA 3LHPL 2F54E 2XY2A 1MQ8A 4WWID 2CO6B 4FTVB 4O2FA 2XA3A 1I9EA 4K3HA 1U9KA 3BEVB 4K7PX 4ZUVA 5HI3C 4KXZI 1OW0A 3MPCA 1YN7A 5D71L 3NCFB 5CD5D 4G6FD 4O2EB 1CE6B 4HFUL 3WNKA 4E0RA 4JFHE 3VXQB 3M07A 3VXRA 4RAVB 3LKOA 1JGEB 4DZBB 3BQUA 3V4VH 5J12C 2HFFA 5JR1H 5HD8C 1OT1A 3MJ9A 4UOW0 1W0WA 2BK8A 1UB5A 2A9NH 2BNUB 4GFTB 2EIZA 4YXLL 2IPUK 4XP1L 3CFCH 5F9JA 2C7UB 4NGHH 2OJEB 1G7HB 2C4XA 1IGML 3RKDD 4TTDD 4PJIB 1IEBA 4OQTH 5TQ2H 1HHKB 3G6JB 4N8PA 1G0DA 4PP2B 4TNWF 3QEUB 3H2WA 3VFUB 4IRZH 5GXBB 4NO2B 4GG6F 1MVUA 2VTFA 1UADC 1V5JA 1L0YA 1N7ML 4ZPVA 5E7FA 3BD5A 3MRGB 1DLFL 2X05A 4NRZB 3QCTL 3MXWL 1UH4A 1UM4H 3EDFA 4L3AA 4HPOL 4L8CB 7FABL 4AM0B 4R96A 1AO7E 1AO7A 5GRXG 3BFOA 3JTSB 2EKSA 1JNHA 5IV2B 3T4YA 1U8PA 4PB0L 3TJHC 3MBEB 1NL0L 3BVNA 1FIGH 4LP5A 5B4MC 5C07D 3OKKA 2XWJB 4FZEH 2EYRB 5AEAA 3FO1A 3HPJB 1XF5B 4ENED 5KG9A 5CJ8A 1RZGB 4HKXB 1M1SA 4LAQH 4UU9A 1UXWA 1I3RB 4NZRH 5HHNB 3VW3L 3ZHDA 2A0LC 1TLKA 2RCSL 4GAJH 1I1AA 3LS4H 1QFWH 4QXGL 1ACZA 4FMFA 1JHLL 5JW4M 3RL2B 4P4KA 4HJJL 4JFHD 3D39E 2IH3A 1RIHH 3BQUD 1MHEA 1XGUA 2EDEA 3BN3B 3VH8G 1MWAL 2NX5A 3ARRA 2F58L 3J7HA 4PY7B 4HW6A 3W11D 1JTTA 4CMMB 4X98B 1JV5A 3V0VB 4PRDA 2XZZA 3PIQB 3CFIC 2HFTA 3VFRB 1MJUH 3C2AL 4GKNB 4HUKB 4ELMF 1ZTXL 5E8NA 2NY2D 1LEIA 4XPHH 2JLLA 2FHCA 4HWEL 4JO1H 1NGXB 3GSVA 3WN5B 2JJUA 4OUOA 1UM5H 4PRAA 4G6MH 2A77L 4RAHA 5D6DA 3DX6B 2QQNH 5J9PB 3TO4A 43CAB 3ULUC 1MJ7L 2WWKO 4FFYH 5I1KH 5BOZG 3QR2A 1T03H 2AXGA 4L4VB 4XNZC 2Q3AA 4MJ4A 3RY5A 1FLRL 5JO5B 5E1HB 2J4WH 1R3LB 3GSXB 3U0PA 2Q8BL 1AO7D 2Y9RT 1F3JA 1ZV5A 3FQNB 4NFDA 2EDOA 4KZDL 5B8CC 1I4FB 1ZT7A 1K4DB 1K8IA 1MI5E 3ECBB 3UJJL 5I15L 4NO5A 4XWOC 3DVNB 4LSPH 1RZ7L 2O5YH 5DJ8B 5I8EA 3S37H 3K8LA 4AH2A 1MCPH 3L3JB 2BVOB 1J1OH 2I24N 4N5EC 2CIKB 4RDQG 4KK5C 1EV2E 4LCWB 1H3GA 1SJEA 1C16A 3TVMB 1I1AD 1UB6A 2YR3A 1JF1B 4LLUA 4XVSH 5IG7A 5TPWH 3D39D 2XG4A 3FQWA 4GAGH 3TFKC 3KPSE 3KPSA 1BP3B 4OCNC 3FT4B 2A6IA 5F9DC 3ZDZE 2NX5D 1T7XA 4UIMA 2KDGA 1WISA 5TH2A 5JW4N 3HZMB 3T77A 5E8OB 1EH9A 3VGAB 1NBVH 1A22B 3MRNB 3V4VL 5JR1L 4OGYH 3V6FA 5C1MB 2A9NL 5DK2B 5C09A 2UUDK 5C09E 4OZ4B 4DN4H 5H94A 4OI9A 5D9SB 1T3FA 1ZVSB 4PRHA 3CFCL 1ZLWH 3B2UD 4NGHL 4UAOC 3GK8H 3KYOA 3QIBB 3PHOA 5DJZA 3TO4D 4FQQA 4HIJA 5EUOF 4OQTL 5JORA 4ODWB 5TQ2L 2DOCA 3V6OC 3ZSSA 2PW1B 1IM3B 4IRZL 4WU7A 3FB6B 2BSTA 4P57A 3GMRA 3DGGA 2XXMB 1IGFH 2ZOLA 5SV3A 4NP4H 2D03H 2EEAA 4JHBA 1TENA 1UM4L 1KEGL 4JZJA 3RWFA 1LK2B 1UJTA 2QR0A 35C8H 3WL9B 3BPLB 5F89B 3U6RB 4WI9A 3TT1H 1FIGL 4IHOA 1YQVH 3EZ8A 3HMWH 3DRQB 2FR4B 4FZEL 3AVEA 1IQDB 4Z77A 4HS6A 4M6AA 1U2HA 5K9JH 2YBRA 1FNGB 1EVUA 2VQUA 2YC1A 2ZPKH 4LAQL 1S7SB 1HSBA 1MCNA 4NZRL 1X3DA 3WO3B 1HNFA 2Z31B 3NBNA 4GAJL 5F9AC 4IS6A 3MRKA 3LS4L 3OKNA 3KPSD 2E7BA 5D7LE 5E1AA 1NBZB 1XCQB 5I19H 1RIHL 3GJFA 3PWLA 4P5TB 2ADFH 3O8XD 3I6LE 3TIDA 5KN5A 1BF2A 5BOPA 2VQ1A 3U83A 5C09D 1M4KA 4G8FB 5EA0H 5IQ7H 2DMCA 4PRHD 3O3AB 1MJUL 3PNWB 3CH8A 3IU3A 5DT1H 3CC5A 4NHUB 3EO1B 1J0YA 1FFPB 3V5KB 3EGSA 4JO1L 5DJAB 2GTZA 1DQLH 1OF2B 3BT2H 4JZNB 3MBEC 1UM5L 1MF2H 1UVQA 4WUUB 4ZFFB 1AQKH 5DGRA 2VB5A 4FFYL 3O3UN 5I1KL 1QBLH 3WNLA 1T03L 1OAKH 1MHHA 4LK4A 2DKUA 1KSRA 1QFPA 4IMLB 2J4WL 3D0LA 1XGPB 5J0BA 4M00A 4W6WB 4FNLH 4APQB 5ICZA 2AJSH 4QNPE 3AS2A 1MCHA 3HI5H 1YYLH 2UZYB 3L3IB 1UACH 4ZPTB 1R5IA 4GW1A 5EOQH 3HI6H 3ZKMC 3H3BC 4DVRH 4MLSA 4LSPL 5DUPH 4B7IA 3E6HB 4YR6A 2O5YL 5KS9F 3T1FB 3S37L 4H5SA 3SQOH 5FUCC 4O9HH 2E8YA 2HFGL 3VXPA 1J1OL 5JMRA 4WWKA 4R90H 2CLRB 4HS3A 4OZHE 3CZFB 2EDHA 3L5XH 3MUZ1 4XVSL 5D7LD 5TPWL 3UBXB 3SEPA 2NLJB 4TULH 1URLA 4GAGL 1QLEH 4IMKA 3WN5C 2VKWA 1NCNA 2VN4A 3I6LD 4OF3A 4J7RA 1FZKA 4PJ7E 4PJ7A 3V52H 4O2CB 1NBVL 4OGYL 2X2YA 1QBAA 5IBLC 4LQFL 2CUIA 1T1XA 4CVWA 1YEHH 3PWPE 3PE9A 3PWPA 5CJ5A 4DN4L 2H41A 4F37F 4UINH 2FLRT 2E7LC 5C08E 5C08A 3IDMB 4FQPA 1JFQH 3GK8L 3L5WA 3WJJA 4IRSA 3MRBA 1EEUA 3VFOA 2AGJL 2OR8A 5DSCB 1WV7T 2X4NA 4D0CA 5IVXB 3H7LA 2Y6SD 3L3OA 2MQCA 2H6PA 2XWTA 1RJLA 2N7AA 1GPOH 2MOVA 3RX7A 1IGFL 4NP4L 1QBMH 2D03L 4P2OA 3MRMB 4ETQB 1REIA 3GSNH 4NQCB 3TVMC 4YJZL 2YPVH 4I48A 3CH1A 2EXWD 5L6YH 3BKYH 1NMBH 35C8L 2VQTA 3MROA 3I6KB 3MYZA 1ZSDB 1YDPB 3TT1L 2JELH 4HGKC 3LKNA 4QRPE 1YQVL 3LKQB 4QRPA 3HMWL 3FB7B 2EZ0D 2BVUA 3LB6C 3P9MB 3IJYB 3VGAC 4HIEB 3D48R 5CP3A 1I1YA 5F7EH 4M7LT 5K9JL 2EDLA 4E5XA 2ZPKL 4UQ2B 2EDTA 4M48H 3U7YH 1FFNB 3X14B 1CICA 3VFVA 3D85A 4ERSH 3FN0H 2X4QB 4YWGH 5I2IB 3VFNA 4YZFF 1QQDA 2HKFH 3QIBC 1KFAH 1QD0A 4FG6C 1MLCB 5I19L 5DQDH 4JJ5B 3RWJB 1INEH 4XNXH 1VACB 3T04D 4CBPA 1LEGA 2ADFL 4PJEB 4NQEA 3FAXA 3TBWB 1RHFA 2D7OA 2H2SD 3MV9A 3MV9E 1JCKA 3GGWA 3PWPD 3T3ME 4L8BA 5EA0L 1A9BB 1FIEA 2I07A 5IQ7L 5E5MB 5C08D 5D7IE 5D7IA 5IB2B 4ACPA 2XN9B 5DT1L 4IRSD 1HQ4B 3I9GH 3QDME 1QLRB 1YEKH 3VFMA 2ATPB 1P2CB 3CNKA 4PJGB 1FRGH 1DQLL 3DJ9A 3BPLC 3SDAA 3BT2L 5GGUA 1MF2L 3PUCA 5T1MB 3L3DB 4P46D 1IVLA 1VHPA 1AQKL 4MMZC 2YPLB 1BREA 3DSFL 1YNLL 1BWMA 4Z7UF 5I8KH 3D25A 1QBLL 3DHJA 1T0PB 1VFAA 4P9HH 3SE4C 5EU5A 4YAQA 3IFNH 3RWHA 5KVDH 1BZ7B 2Z31C 4FNLL 2WM0A 4LRIC 2X4PB 4JRYA 5BQ7B 1OAUH 4HEPG 3HI5L 1YYLL 5AD0B 3IAPA 4QRPD 1UACL 5EOQL 5FYJU 5C0EB 1SBBA 4LPWA 4OLUH 1KF9B 4PGDB 3WFCH 4PG2A 4DVRL 1FYHB 5DUPL 4BQ6A 4P5TC 5CJQH 2DI7A 4R4BB 3KDMB 3SQOL 3MLTB 4O9HL 2GSGA 4P48A 3GSRB 3H9YA 1NBQA 3VXUE 3VXUA 1CICD 1Q9KA 3GMQB 3VFPA 4R90L 3D85D 3P73B 1NGZA 1P7KB 2I9LA 3MV7E 1WJ3A 3BD3A 4KI5E 3ZYZA 4D94A 5CMAA 1ZGLP 3GSNB 3TYGH 4TULL 1OOAA 1QLEL 4ZXBA 3QDGE 3QDGA 1ZLUK 4Q9QH 1UG9A 1QA9B 5T1LA 5L2JB 4FN0A 1WAAF 3MV9D 3V52L 1S9XA 4KHXH 32C2B 3CSPA 4HG4J 1BOYA 3VRLE 1F11B 3IS1X 3O3BA 3F12B 3MRHA 1I7ZA 1YEHL 5B38B 4EI5A 1AGEB 1UYWL 4CVZA 4UINL 3X17A 1C08B 4PTTB 4APQC 3ESUF 1JFQL 5FA3B 1EZVX 1A7RH 1IQWH 5E7BA 5KSBA 3QP3A 4KV5F 3WUWB 4R4ND 5EBLA 5DGQA 3WFHA 1VGEL 2CIIA 1D5ZA 2LAGB 4LGRB 1GPOL 1FP5A 2C26A 2BCKA 1MPAH 2BNQE 3MMEB 1QBML 2Q7NA 4XPTH 3S3JA 4JKKA 1LK3H 3N1PC 1KB9K 4HKJA 3GSNL 43C9B 4OCSH 4JRYD 2YPVL 1EO8H 5L6YL 3BKYL 1NMBL 3ZE2F 4U1MB 4XHJC 4MCYB 1GJIA 3O0RL 4MHHG 1RI8A 2JELL 3BHBA 4QGTA 3MOQA 4PJDE 4PJDA 1K85A 1CDCA 2CPCA 1HCFX 2V2WA 3JUZA 3VXUD 2HRLA 5F7EL 2VABB 3HNSH 4WO4B 1A7OH 2AK1H 4M48L 3MV7D 4MXVF 4F3FB 3U7YL 3UZQA 4KI5D 2W9EH 2W0FA 3VI4F 5L0QB 4ERSL 5HTSA 3U4AA 3FN0L 4YWGL 1SJVA 3QDGD 5ID0A 1CGUA 2HKFL 4F7EA 1T5XB 5T1LD 4D0BB 5DQDL 1A0QH 1INEL 4XNXL 1DR9A 3HLAB 4XCNA 2EH7H 2W9DH 3VWJA 2HJLB 3S4SB 4EI5D 1S9VA 4MZ3A 3QXAA 1QFWI 5FKAA 4QXTA 1INQB 1MAMH 3NFPA 2VR4A 2EEDA 4DCQB 3HPLA 2X4OB 2R56H 3I9GL 1YEKL 5DQ9B 2CSPA 3KPMA 3LOWA 1FRGL 2QLVB 1RHHA 5E00A 3L9RA 2F54B 5ALBH 4PJBE 4O2FB 4F8TA 4EQ3A 4PD4K 1YUHA 5BZWB 1N3NA 3B8YA 3T0DA 1IGYB 4XCEA 1FVEA 5DJYA 1NUFA 1PZ5B 5DRNB 2BNQD 5I8KL 5I17A 1IMHC 4WDIB 2OJZH 5F3BA 1C7TA 4P9HL 1GCFA 5BZDB 2N56A 2B8OT 5ADOH 1WTGT 3IFNL 1JGDA 5KVDL 1M7IA 2OL3B 2HFFB 4X7SH 4GLRH 1QSEE 1QSEA 2OMBA 3VI3F 2H9GA 4PJAF 5IB1A 1OAUL 2C3XA 2RGSA 1CFQB 3G5ZA 5JW4Q 4OLUL 2EIZB 3WFCL 4ZS7H 3LKRA 4G5ZH 4R2GD 3EZJB 3TJEH 4EUPH 4MVBD 3OV6A 5CJQL 3S88H 2NY2B 3QULA 2DQCH 4P4RA 5DVLA 5D72H 3NFNA 2XQYG 2R1YB 5I1DB 3B5HA 4IEFB 4HHAB 3GDBA 1J11A 3JSSA 2FLBT 4I0PB 4Q9QL 2E27H 5JIKA 2CKNA 2D7TH 3EJYD 4NO3B 4R96B 4KHXL 4Z78A 1AO7B 4TYUA 1JNHB 1LMKA 4XPBH 3T4YB 2EIDA 5E6ZA 4YHMH 5LAXA 1T20A 3WKNA 1R3IH 1IARB 2OL3L 3OKKB 4XI5D 5GS2D 1SJHA 4KK6D 4CVUA 3QFJE 3QFJA 3IGAA 4F80A 2PTTA 5HGAB 2B0SH 1KULA 4LGSB 1A7RL 3HR5A 5I9QB 4WW2A 2WWMD 3QNYA 1FFQA 3CX2A 4Y2DB 3CFJA 1YY9C 4E41E 4NQSA 4JPIB 1JZ8A 5F96H 3GM8A 1KG0B 3W0WE 2W91A 4FXKA 4BM7A 3D39B 3QBTB 1MPAL 1R0AH 1EGJH 1G9MH 3IRPX 4XPTL 2D31B 1LK3L 4GJTB 5DJXA 1QSED 1T0MB 2DQFB 4OCSL 4KMQA 4UOJA 3PP3K 1EO8L 1BFOA 5HI5D 5EPMA 4LIQH 4PRDB 3IFPA 2VDPH 4JEGB 2HH0H 1NGQH 1IBGH 2JB6A 1D5MA 5EZJB 5E8NB 3QNZB 4WW1A 3L6FB 5JDSA 5AG8A 3HNSL 2VZ3A 5M94B 1A7OL 1N6UA 2AK1L 1KIRA 3P0YL 1Q0XL 2NY5C 4QWWC 2W9EL 1A7BA 5CHNA 5E5RB 3P4LA 2R2BA 4LCYA 3OJDA 1XF2A 4JHWH 4YDVB 3UROR 1Y0LA 1YPZF 3MCKA 2IH1B 5L88H 4YEFA 1RAMA 4YX2L 25C8L 2CK0H 4RQQA 3D6GA 3REWB 3U0PB 3RGVA 1A0QL 1F6FB 2KQMA 5FHBH 4N1CA 5FK9B 5F6HJ 5IEKB 5HVFB 5IFJA 5C9KA 5DMYA 4OT1H 2DBJA 2EH7L 2W9DL 5EN2B 4NSKA 4EUPB 4JFQA 1MI5B 3EJJX 2HP4A 1SYSA 1BEYH 2BX5A 3QFJD 5IB3A 4R3SA 2OR9H 1MAML 2EE6A 4HJGA 3T2NH 5F1NA 1JPGA 2R56L 3SGJC 1JK8B 4J3OC 2Q20A 4ZAKA 1T22B 4E41D 1ZGLM 5ALBL 1KLGB 1IFHH 2RR3A 3W0WD 1UB6B 5LGHH 1IEAA 3QIWB 3CDYA 3X12B 4LLUB 3RWIA 4XGZA 5I1AA 5IG7B 3FQWB 1NCDH 3TBTA 4WO4C 5EIIA 1TVHA 2A6IB 2DS4A 5ADOL 4WHTA 4LKXA 4TTDC 1PY4A 3GRWA 3T77B 3QEHB 4P9HC 4X7SL 5L0QC 3RIFF 2GHWB 3KYNB 3O8XB 4XT1C 3V6FB 5F6HI 1ULVA 4PJCE 4PJCA 3C09B 4GRWE 2CRZA 3RHWK 2IALA 5L7XH 1T3FB 3I84A 4ZS7L 4G5ZL 3TJEL 2O93L 3JV5A 1F4HA 2GFBB 4UBDC 4FXGA 4PJ8B 5GGSB 4F7PA 5F7UA 4LEOB 4U1LB 3S88L 3M17A 2DQCL 5DJZB 3QUYD 5C0AE 1P84K 4NUJA 4PS4H 1SJXA 5D72L 2HRPH 5DD6B 2HLFD 2ICEA 4WFGE 1KTLA 2DM7A 4WU7B 4X4YA 2V2TB 3D5OF 3RGVD 4ENEC 2ZOLB 1OGAE 1OGAA 3NIFF 3AY4A 2D7NA 5D5MA 2LTQB 2E27L 2X70A 2D7TL 2ZSVA 2NCMA 4JZJB 4TUOA 3RWFB 2QR0B 2E9IA 5CJOH 1OW0C 4NDMB 4X9BA 4XPBL 1BOGB 4RMTA 3ESVF 2BVYA 1XR8A 4M1DH 4YHML 3F7YB 2YPKB 1R3IL 3BZEB 1HWGB 1WBYB 2IGFH 2NZ9D 4OTXH 3KNBA 3B4NA 5DJDB 2B0SL 2IPTH 4ZAKD 2YC1B 1JZ7A 5ITBH 4H1LG 2YA1A 3RAJH 1OQXA 3W11C 5GRJH 1CI5A 5IF0B 2FGWH 1B90A 5DC0A 1MHCA 5D7JA 1CE1H 4IS6B 5F96L 1G7PA 4EEEA 1W0VB 5CILH 2NY2C 1FORH 5D7LB 5E1AB 2D7QA 5FUOH 2PN5A 1VGKB 5J11B 4EIGB 2EDRA 1EGJL 1G9ML 1E27A 1R0AL 3GJFB 3PWLB 2I60H 3IDNA 4X6CA 3CUPA 2EEBA 2NNAA 1CS6A 3P9LB 5HYQA 5CKAA 1PQZB 5TF0A 1RMFH 1XGTA 4YDIH 5CCKH 5CJXA 3PV7A 2VDPL 4N9GB 2HH0L 1NGQL 5C71A 2DLTA 3K4DA 2EECA 4I0PC 2GKIA 2IPKA 1U3HB 2VL5A 5C0AD 4R0LA 5GJSH 4OD3H 1P6AB 3CSGA 3VMNA 4WFGD 4Y1AE 4Y1AA 2B5IB 1JHTB 2VERN 1CXFA 3MNVB 4U7MA 3FQUB 1P4BH 5EUKA 5JOEA 1KPUA 5IVZB 1OGAD 2DQGH 4JHWL 4LCIH 3OKYA 2XFXA 4LFHG 2CK0L 2A9ML 5I9QC 2H45A 3K7UA 4GW4A 4Y2DC 5C0JB 2E7MA 5DMKA 5FHBL 3G5VB 4MXWH 1YJDL 5ICZB 1CXLA 2GK2A 3WNOA 4OT1L 4NQDB 2L0DA 1BEYL 1KOAA 4LHQB 4U1GB 3LD8B 2OR9L 4PGCB 4QRUB 5LBSH 5ITFA 3T2NL 1IAKA 3PF2A 4BUGA 2BXYA 3VGHA 4X5XA 2KZ1B 4WI8A 1SMAA 2C1OB 2J88L 2ZCKH 5ISZE 2C9AA 1GVIA 4OZHB 3CPLA 5ISZA 3REVA 1IFHL 1K2DA 5MEQB 2CGRH 1CN4A 4F57H 5LGHL 2R1WB 2FB4H 1FE8L 5C0GA 4UT9H 1NCDL 3OKEB 1Q8MA 1Q9OA 3B2UC 3QZWB 3T0EB 4HBCH 3CXHJ 3QWQB 2A74A 2YUZA 4RBPK 1FZKB 5CINH 1VESA 4KDWA 1U6AH 4KMLB 1LWRA 3BN9D 4IIQA 3UZEA 4XPAH 5LKNA 2VLLA 5DJ2B 1T1XB 5E2JA 4PLKC 1A2YA 5L7XL 3D2UB 2ITCB 4AMKH 1IC4H 3ZYJA 3QQ4B 2VAAB 3LEVH 1H3UA 3AREB 1WZKA 3BWAA 4OFPA 4IRSB 1P6FA 3LRSA 4Y1AD 2GUOA 1BQLH 5MHSE 5H2BB 2R2EA 4G9FB 2MHAA 1CDYA 1HHIA 2ADIA 3GMLB 4OKVB 4PS4L 2HRPL 3ULVE 3KPOB 3LQZA 3MJ7A 2V9RA 5IBUG 2YRLA 1KIQA 2H6PB 3OR6A 4P46B 5I18H 3QUKA 2RFXA 1X5XA 3BIBX 1TDQA 5BRZB 4PJXB 2GJZA 2VWEC 1MIEH 4BFEA 3QIWC 4HAGA 2AXJA 3JVGA 3UYOD 1BD2E 4DQOH 4M1DL 1T1WA 5D2LE 4MJ6B 3PGDB 3ZHKA 1CG9B 2IGFL 4OTXL 4FOMA 4DK3A 5C6WH 1I1YB 5K33A 4LDLB 4MA1B 5DC9B 3O8XC 5ITBL 5ISZD 3RAJL 4JKLA 5DDHA 2ZG3A 5GRJL 3C09C 4ZFOB 2DF3A 2CH8A 2FGWL 3F7PC 5CAYB 5JXEA 4Z7WA 3BDYH 1IZJA 1CE1L 1XR9A 4PJHF 5DYOA 4PJ8C 5J3HC 5CILL 1YEIH 2FGZA 1FORL 2X4TB 5FUOL 3SDYH 3CGTA 3FT3A 4JFPB 2I60L 1KCRH 3HZKA 3MV9B 4QYOB 3UO1H 4WHDA 1UEMA 3BE1H 4YDIL 2BOCB 4LSUL 5CCKL 2YD7A 2OR7A 5AZEH 3ILPB 3HRZB 5D7IB 3LRHA 5T5FH 3OJVC 2LTQC 5E0QA 2W65A 4XBEH 1BQUA 4JZJC 3RTQA 3QDMB 1DBJH 2X4RA 3MLPA 4YHZH 5GJSL 3TCLA 3VFMB 3O2DH 3TF7C 4OD3L 1S78D 3ULVD 4I1NB 1CDBA 3DRTB 5CKGA 3TA3B 3FAWA 4KZEH 2IBBA 2XWBA 4IRJB 2MJWA 3RUGA 3RUGE 1IKFH 4KU1A 4M3JA 5C0FB 1IAMA 4HDIA 1PW3A 1P4BL 4Z7VF 1LE9A 1DLHB 3FO2A 4KK8D 3WLWD 4ZFOL 2DQGL 1XH3A 4LCIL 3KHQA 2X42A 2BHUA 1JRHH 3RPKA 3QXVA 1BD2D 4MXWL 1U0QA 5T3XE 1YJDC 3H9SB 4X4XB 1ODAA 2OTPA 5J11C 3R8BB 3WDIA 4U1NB 4S1DD 1A1OA 5LBSL 3SPVA 3QEGH 3X11A 3U0WH 1X5LA 1ZT4A 2DLHA 1Q9KB 5JXED 3FB8A 2ZCKL 4MNGE 4MNGA 2I9LB 2VIRA 3MV7B 2CGRL 4F57L 4JDVA 1Z0NA 1U3HC 2WV3A 2FB4L 3U82B 3LN5A 4JY5L 3HCVA 4UT9L 5HHQA 2DQEH 3VRIB 3HE7A 4N8VB 3QDGB 3UYPA 3SKNB 4HBCL 1YNKH 3Q6FB 4KDVA 1X4XA 4HXBH 1XF1A 2B5IC 5CINL 4PPTA 1U6AL 4M03A 4I2XE 4I2XA 1AC0A 1Q9LA 4NZJA 2Y6SC 3MGAA 4HX1B 1G7QB 4XPAL 3QHTC 2DBLH 2EXYD 1TMCB 4EI5B 1NGWA 3P3YA 1FCCA 2A6JB 2UVFA 3L3HA 3RTQD 4AMKL 5SWQA 1SHMA 3DO7B 1WBXA 3LEVL 2FX9H 4QRRE 1BQLL 4GLRI 4EI6A 3SOBH 2EXWC 4GMTH 1FL3B 3SDCA 4U1GC 1J8HB 1XGYH 5CWSA 1C5CH 3LD8C 3VH8B 1CL7H 1ZS8A 5IEHB 3GSWB 2Y23A 5CIPA 4J4PD 5I18L 1BPVA 1OB1B 2EZ0C 1JTPA 3QG7H 2BCKB 1NKOA 2BNQB 2O5XH 2QL1A 4IJ3B 3S35H 4CJ0A 4DKEH 1MIEL 4LF3B 5T3XD 1VA9A 1T5WA 3IXAA 2CJUH 3BKJH 4RFNB 4QEGA 4XH2B 4DQOL 1AHWB 5FA4A 2XV6B 4JFXA 4IMKC 1FNAA 3BHBB 1I8IB 3T0EC 3VFTB 4ODVH 5FGRA 5BVJB 2FSEA 3RRQA 1K5NB 4QHLB 4PJDB 1P4IH 1U92A 1OGTA 1EUTA 3ALPA 2B1AH 4R2GB 5HYJE 1CGTA 5HYJA 2DM4A 4NKMB 5CEXB 2ZNWA 4G80B 4QRQA 5F97E 3DVIA 7CGTA 3BDYL 4QRSB 4PJ5E 3T2OA 3HE7D 3AREC 2PTVA 5GGVY 1YEIL 3IDYB 4IRSC 3SDYL 2VDOH 5L9DH 1GZQB 3L5HA 5J13B 2H32H 1KCRL 2Z9TA 1MCLA 2B7DT 1JWUB 2HJKA 4G6AD 3UO1L 4P46C 4MA7H 4WEBH 4M02A 2XQBH 2LU7A 4BQ8A 1S9VB 1BHGA 3QXAB 4WTZG 3BE1L 4QXTB 3U1SH 5AZEL 3OKLA 3MNWA 3UTPE 5T5FL 1XZ0B 1HNGA 4XBEL 1J1PH 3HPLB 4Y88A 2BC4B 1DBJL 4YHZL 2HFEA 3O2DL 2DQIH 4M6OH 1RHHB 1OWRM 3VFWA 4Y4KD 4PJBB 3N1FC 3RIAK 5F93C 4OF0A 5FO7A 4X99B 1FFOA 5JPMB 2OTWA 1YUHB 4OZGE 4P5KA 4KZEL 2UWEE 1IKFL 3HA0A 1AGDA 3B83A 1T80A 1T4KB 1AE6H 3TWCH 4MA1C 2A6DA 1BZ9A 2QSVA 1JRHL 1JGDB 4RNRA 2HT2C 1K3IA 4OUUA 3NPSB 5FCSH 3CDGB 1ZKAA 3V6ZA 2IPUG 4EQ2A 3G5ZB 4ISVB 4BZ1H 3LKRB 4ZNEE 1SEBB 5HYJD 3MRQA 4P59H 3QEGL 3U0WL 4XCCH 4AJ0A 3OZ9H 1VKXB 4PJ5D 2FEEL 4L8SB 1INDH 3CXDH 2DJSA 3OAYH 4R8WH 2DAVA 2DQEL 5H35B 2ESVB 1YNKL 4U7KA 3TP4A 4DAGH 2YSSA 4HXBL 3TA3C 4F58H 2IAMA 3PGCA 4IRJC 3SDXF 5GZOD 4I0CC 2DBLL 4J3VA 3UTPD 4H1LA 2F15A 4QF1B 2VITA 1HDMB 2P4AB 4LKCB 2GSIB 2FX9L 4GRWH 3SOBL 4NN7B 4GMTL 4U6VH 1FSKB 3CFJB 4K7PH 4ZTPH 5HBBA 2BHYA 5I6XB 1XGYL 4E41B 1C5CL 4PG2C 1DN2A 4HWZA 3RJDA 5D2NE 1HXMA 4NWTH 5D2NA 3W0WB 1KTDA 4PLJD 4PG9B 3ZTNH 4EJ1C 1EAJA 3G5YA 3SN6N 3S36X 2NY3D 2WBJA 4WHYH 3SKOB 4IBLT 2R0WH 3S35L 5I1LB 1P7QB 2QSCH 4DKEL 5IB4A 3KPLA 3OKDB 1UJ3B 1BFOB 4KI5C 4GG6A 4GG6E 3BKJL 5EPMB 2W1NA 4P3CH 1ZEAH 2N1KA 3U46A 3O9WA 2E5EA 1KCKA 5C0RH 1G1CA 3MLYH 4U49A 4ODVL 5DFWH 4U6HA 2DWEA 4ODBD 1P4IL 1T1ZB 4LPCA 3QNXA 4LBEA 2B1AL 4GKSA 5GZND 2DIAA 1DJSA 2JJSC 3QUYB 5E5UB 5KSVA 4EI5C 2EKJA 5TGBA 4F9PC 1BF8A 3JWNC 2R2BB 3I6GA 2FATH 4XVTH 4DFIA 1FL6B 3D18A 1NGYA 4RQQB 2Q3ZA 4JY6B 3GMPA 3BP5A 2VDOL 4MDJB 5L9DL 2IAMD 4KFZC 4OLZH 4R7DA 1ZMYA 1MAJA 3O2VH 2DL9A 5HDBF 4XB7A 4HC1H 4MA7L 4WEBL 2XQBL 3QFDB 2V2XA 1NFDE 2CLZA 3QO1A 3MRCA 4FQHB 1KIUA 1PEWA 2H2PC 2X1PA 3U1SL 4IJ3C 4R3SB 4S1SH 5DHXB 4EZMA 4FMKA 3BKMH 2VZUA 1G9NH 4LEXH 4YNYA 3LEXA 1F4WH 3VXME 3VXMA 1WSST 4RFNC 4Y16B 4HIHB 3VFSA 1V3LA 1AC6A 1AHWC 2DQIL 4NQXA 4M6OL 5LGKA 5D7KD 2BVTA 3C2SA 1KIPA 2V7HB 1Q94A 4NOBA 2ZUUA 3DUSA 2Z8WC 4ELMA 1LE5B 4BQ9A 1AP2A 2WBJD 3TBTB 4CNIA 5A16B 4R2GC 3TWCL 2WINA 4D0DA 5EIIB 4Y8DC 1EBAA 1UZ8A 1S3KH 2M8XA 2HJFA 3DI3B 5JOFA 4OM0H 1XIWA 3DYPA 5IW1A 3O9WD 1A1NA 4U2YA 4ALAH 3QQ9C 3IDYC 4GRWB 4MAYA 3QSKB 2R4SH 3BJLA 1E28A 4BZ1L 1IC7H 4JO2H 2XY1A 5J13C 4OZIF 4Z7OE 4P59L 4GO6B 4WVRA 1IL1A 3EJYC 4C54A 5JLZA 3NOIA 1XGQA 4LFHD 4XCCL 5C0AB 4PJ9A 2P7TB 4X5WB 4YPJA 3OZ9L 5FECB 4JZOB 1KTLB 1INDL 3EBAA 4ZQKA 3HMXL 3HS0B 4R8WL 3SE9H 5I1JH 4R7NB 1OTSD 1OGAB 4M5ZH 3MNZB 4DAGL 4TVPE 5EO0B 4K3DH 4F58L 4CL7A 1R5WB 5EOCH 3MLVH 5C0NC 1BAFH 1ADQA 3RWDA 1KEMH 1KYOK 4TNVK 3KPQA 1N0XH 5KZCB 5E8DH 3HRPA 5TE7H 4UDUA 3VXMD 4HG4K 4C57C 4B50A 3NPSC 1DCLA 3TBSB 5FM5O 3OF6A 5IFHH 2AJ3B 3ROLB 5HI5C 3TNMA 4LCUA 4U6VL 4X6EA 3IKCA 4K7PL 4ZTPL 2DLGA 4OZFH 4YHPA 2YD8A 4NWTL 1G7PB 1PZUB 3MRPB 1RK1A 3FL7A 4JREB 4GAYB 4ZOAA 4C83A 2R0WL 5EUOE 1W8OA 2QSCL 1XIWD 4NC0B 1MELA 4OCWH 5IT2H 1DBAH 4L8SC 4O58H 5IMMA 4F7CB 3F7QA 4P3CL 4JO4H 3QDJB 1ZEAL 4U1IB 3GIVB 1AFVL 1LNUA 4WI7A 3D3VE 3D3VA 5C0RL 3MLYL 1JNNH 3G6AA 4KPHH 5IK3A 1I85A 4R0LB 4J8RB 1MAKA 4PJ9D 4Y1AB 1ITCA 1B0GA 1KTKE 2PETA 1OARH 4OD2B 2DMKA 4P23B 5B3JE 2GY5A 1KPUB 1U8OA 2FATL 2VH5H 4XVTL 5CP7A 4JFYA 3PABA 4KH2A 5KSAA 2R1XA 2VLRE 3FB5B 4TVPD 4GW4B 4NN7C 1FSKC 4JGJA 4OLZL 5I6XC 2FX8H 3F58H 3OKMB 3WFBH 2NYYD 2JK5B 1H9VA 4UTAH 5DRZB 1X44A 4ODUB 5HI4D 1CDJA 4BSVA 5IGXH 5D1QB 4Q2ZB 1KJVA 4PGZA 1TZGH 3BJ91 3MACH 4S1SL 3BKML 3D87B 2WUCH 3OF6D 1QPPA 1G9NL 1U8LB 1UJ3C 1IAKB 1DBMH 1TZIA 1WFNA 4LEXL 4NPYA 1U93A 1IM9A 1Z5LA 1F4WL 1K6QH 4MSWA 3CPLB 4PGEA 3TBYA 2CKBA 3BUTA 5C0GB 4Z0BH 4K8RH 5F7DA 1T89C 2BVQA 4KDTA 1NC2D 1T66C 3QRGH 5FDWB 3NZ8B 3FKUS 3QUYC 2O26U 1S3KL 4MA3B 3MXVH 3MFFB 4ZNCD 3NFSL 4OM0L 3PWNB 5DHVH 2E9JA 5JHLH 2G5RA 1MH5A 3D3VD 5GS3A 4DOHE 4YGVA 4ALAL 5KVGH 1G7MB 3GEWB 4ODXA 1A2YB 3HB3D 1U8QA 5EU6B 2R4SL 1A02N 5T3XH 4JDZA 5CGTA 1IC7L 4M7LH 3BZ4A 1L6XA 4JO2L 3ULUF 5FYKU 1I9IL 4OZFB 5J4MA 2Y7QA 3O6FA 3BWAB 3SKMA 2GUOB 2MTPA 3K2MC 3OGOE 1MCIA 3ZYIA 4YHNB 3UMTA 3SDDA 3LQZB 2BY0A 2OXHA 5KS9E 5KS9A 5KSAD 1HEZA 1T83C 1UT9A 3MRDA 3VGFA 2VLRD 1DBBH 4LGPB 3V8OA 3SE9L 3RPIA 5FM8A 5I1JL 4Y16C 1ZA3B 4M5ZL 3O4LA 1A4KA 5J1TC 3SBWC 3ARGB 3ARBA 5E03A 4K3DL 4NNYA 1UA6H 1DL7H 1BD2B 3QUMH 2FEEI 4GQPH 1FZOA 5HHMB 5EOCL 3MLVL 4L8DA 1T1WB 4XPGH 1BAFL 5D2LB 1KEML 1JZ6A 1N0XL 2ENYA 4MAUH 1DQTA 5TE7L 1IM9D 2FECI 3SGDH 2I25N 5IFHL 5DD1H 1KPVA 4YFLI 2AKRB 5J89A 4P5MB 2IBZX 3DVGB 1UWXK 5DDHB 2D9QB 1RZIB 1BECA 4WNQA 3W82A 3ZE1F 2XTJE 1S8DB 1XR9B 5DYOB 3GM0A 2Z91B 3ET9F 3ULVL 4WTZA 5IJKC 3RVTD 1RURH 3SGKC 3C6LD 4OCWL 4HUWA 5IT2L 1DBAL 4O58L 3EW3B 1RZKH 4AENB 5K9KB 1CL7I 1B4JH 1M05A 5IMOA 1LEKA 3H9HA 4JO4L 4KTDH 3T65A 4EOWH 2G5BB 1G7JA 1NAMH 3AY4C 1C12B 1JNNL 1QR1A 3O6FD 4KPHL 2WBWB 3KG5A 3V5DA 5IWLC 4CN6A 1S9WB 5I16A 4J3XA 3ARQA 3SDDD 2HG5B 4FQCH 5EU7E 4RGNE 4F9LA 1XFPA 3MV8E 3MV8A 3CVHH 1OARL 3RUGB 3E8UH 3DV6A 4HDIB 2BZDA 1AKJB 4UT6L 4UZGA 4TOYH 1LE9B 2VH5L 5DA4A 2VISB 3I50H 1CQKA 4O02H 3ARBD 3RDTB 4JRWA 2N4IA 5DEFA 2FX8L 3F58L 5D93B 1BLNA 3WFBL 3CSYB 3DMMA 5F44A 1Z9OA 3C9NA 4UTAL 4JDTH 3GMNA 2BSED 5IGXL 4JREC 5I66A 2EE2A 3PQYA 1TZGL 3MACL 1EDQA 1B88A 2SEBB 4ZUTB 1X4ZA 4KGLA 1A1OB 2WUCL 3C60A 4HAFA 2Y1VA 1TTFA 2YZ8A 1DBML 4YUEH 3U7WH 1A5FH 3WEXA 4PLOB 5JHDE 5JHDA 1G6RA 3GI9H 1ZT4B 1K6QL 1G9NC 2XI9A 3BN9C 3ZTJH 1CCZA 3FB8B 2XTJD 3W39B 1ORQB 2OSLA 1J88A 3G6JF 5JNYB 4Z0BL 4NKIH 3VXTB 4XCFH 4R0LC 4HXAH 3N50A 3QISA 3QEQB 1XF3B 3IETA 3QUMB 4M61B 3UTQA 1N2RA 4K2UH 3QRGL 3TPKA 1D9KA 1TXKA 2Q1EA 5A40E 1IAIH 5CEYB 3MLXH 3MXVL 4I2XB 3AAZA 4P23C 1X4YA 1JWMB 4Z7UE 4Z7UA 5JHLL 3Q5TA 1IKNC 2GJ6E 2GJ6A 4J6RH 5IQ9B 5KVGL 3GIZH 5T3XL 5SWQB 4M7LL 1HI6A 4EDWH 1B0RB 2FJGB 1JZ4A 4QRRB 4RGND 1XT5A 4JLRA 1HINH 2APWA 3MV8D 2HTKC 4KK9D 5JIIA 5D1QC 5GRYA 1OVZA 4N0UA 4Y4KB 4J23A 1SY6A 2GK0B 3L3KB 2CDFA 4TSCH 2R69H 2VC2H 3D0VA 3F5WA 1DBBL 4ZO7A 5DJ6A 4MD5A 3LV3B 2C4FU 2BERA 3TNNA 5GIRB 2VAJA 2WZPD 1VFUA 3IXAB 1NAMB 2CDGB 3DMMD 5IHUH 1UA6L 3QUML 3DX7A 3MRFB 5ID1B 4L3CB 4XPGL 1OP3K 1FYTB 4YBLB 3MGTB 4MAUL 3C60D 4PV8A 3U30B 1HYSD 1WAAA 4DGYH 5JHDD 5IR1A 5HYJB 3CVHB 4CVXA 2A2QT 5DD1L 2YWYA 3MSPA 3N06B 4U05A 5JW5B 4QRQB 1L7TH 3V9FA 3QXUA 1EEZB 4LDOB 1JWSB 4PJ5B 2Q7YA 4C4KT 4WI2A 1QNZH 1CFSB 3UDWA 4ZMAT 4BKLA 3O45B 3UAJD 1D9KD 3ULVC 1RURL 3FOLB 1P1ZB 4K71B 2HJKB 1RZKL 4NJAH 2GT9A 3ULSA 1JGUH 2GJ6D 1A7NH 4OKDA 2ZUQB 3QQ3A 2EYTB 4KTDL 1EZVY 3OSKA 4XXDB 3OKLB 5DWUH 3INUH 1NAML 3MNWB 3WLWC 5CJBA 4HUNB 3LSOB 5EBWB 3ARGC 2HVKA 4TNVF 3JVGC 5CBEB 4TUJB 3ZE2E 1DTUA 2X09A 3VFWB 3IB4A 1I8KA 1ZA6B 4WI4A 5DRWA 2V7NA 5FO7B 1QFHA 1MFNA 3CVHL 3NCEB 4MS8D 4OJFH 4OZGB 2UWEB 3JWDH 3V0WH 3U2SB 2EDWA 4TOYL 1WZMA 4QOKB 1MCWM 3K81A 3D9AL 3HE6A 4X0KA 3I50L 2NY3B 4NQVA 4O02L 4MXVE 3EOBA 3QWRA 2AK4E 2AK4A 4OQ1A 4FFVD 3VI4E 1F42A 1KT2B 3TLRA 4EDXA 4PRNB 4WV1A 1DEEA 3V6ZB 1JPST 4LPYA 1U58A 2RHEA 4G43A 2QSTA 5SWSE 5SWSA 4MXQC 3U0TB 1WCBA 3O11B 4OGZA 3Q3GA 3T4AA 3VRJA 4B53A 4Y89A 3U7AA 1KB5H 1RUMH 4YUEL 5EU4A 3U7WL 1YEJH 1A5FL 4H25A 1QBBA 3DURB 3GI9L 5EO9A 4I4WB 4D8PA 4HC1A 1P5VA 4LLYA 5E9DA 1FV1B 1JNJA 2X1OA 3QXDB 4NKIL 3ZLQC 4XCFL 4HXAL 3G9AB 2VR9A 2W0PA 1R5VB 4K2UL 3GNMH 3T08A 3VJ6B 4RMVA 1IAIL 5KTEH 3MLXL 4X7DC 3Q48A 5AAWA 1FC1A 4J4PC 1XF4B 4J6RL 1MFCH 3GIZL 3RDTC 3DV4B 4HUUA 5DQJA 1FG9C 4EDWL 1NC4A 2LVCA 3ZDXF 1DP0A 5CSZB 5D93C 3VI3E 1UH3A 2DD8H 3BXNB 4PJAE 4PJAA 1HINL 1MUJA 2DQJH 3QB7C 4LLMA 1QEWA 8FABA 1FO0A 2XIDA 3DUUA 1FL5A 2B20A 2Y07H 3FRPG 4ZOBA 3LKPB 3DIFA 1FVCA 5IIEA 2R69L 2VC2L 4UUJA 5C0CB 3OR7B 3IJHA 1AGBB 3Q0HA 2WBJB 3QWRD 1MCDA 2I9TA 2AK4D 2BVEA 5F71A 4G8EB 3FTGA 1XGRB 5FYJH 5IB4B 3KPLB 4MJ5B 5E8PA 5SWSD 1N8ZA 2X4UB 3TIEA 3RKPA 2VDQH 5B39G 3MODH 1J0HA 5FKPA 5A43C 1K3ZA 4YDJB 5GSVA 3F7RA 4DGYL 1OHQA 3O2WH 3RX8A 4W81A 3LS5H 3GBNH 1W72H 4M1CD 4IOIA 4G6AC 5E9DD 1NUNB 1T7WA 2ID5A 1L7TL 1EPFA 4B7LA 5GRVL 3I75B 3UTZA 1U8JB 2HT3D 3T1WA 1QNZL 1JPFA 3NA4A 2Z4QA 4Y5YA 4F33B 4MB5A 3C5ZA 2JIXB 2XKNA 3BP5B 2UY7A 5H37G 4JFEE 3B2VH 5GJTH 1GIGH 3HG1E 3HG1A 4X6DF 5E2TH 4Y4KC 4HIIB 3FZUD 4NJAL 1JGUL 1X5KA 1A7NL 4IDLA 1MLBB 4XP6H 2CLZB 1D5IH 1HCVA 1NFDB 2VXQH 3MRCB 3L5JA 1I9JL 3TC9A 1RZKC 5DWUL 3INUL 4NC2B 1NDMB 5ANME 4HLZG 5GPRA 2A83A 4X83A 2XPGB 3T2QA 2DQDH 4YNYB 5ESQA 3FONA 4DEPB 3VFSB 3CCHB 1X7QB 5DFVD 1M71A 2R8SH 4YBLC 5AUMB 2VDMH 1Q94B 3DUSB 4OJFL 3V0WL 3JWDL 4X7FC 1AP2B 3U30C 2WINB 4YHYB 3LN4B 2MSPA 1S7QA 3IFOA 3OMZA 2CLVB 4XBGA 3KJ6H 4PRPE 4QT5B 1XIWB 4BH7B 5IW1B 1I8LA 4ONGL 3ALXA 4KKLD 3PJSA 4QO1A 9CGTA 1YPZE 1RUPL 1YPZA 5IMKA 1H3TA 3KAAA 1FC2D 4NZDA 3RVWC 4MWFA 3ZDYF 5ESVB 4ODHH 5IBUB 5BCAA 4K71C 1RUML 3DETD 5JLZB 3ZE0E 1YEJL 1A4JB 3WCYA 2J12B 2ZUQC 4PJ9B 4NRYA 5GZOC 5IHZA 2AJYH 3WDJA 1IJ9A 3HR6A 2K3TA 4GG8B 1YC8A 5F7MC 5ICXB 4BK5A 5DRXA 2C4FT 2XKUA 4ZQKB 5MENE 5FYLH 1X5HA 4NC1E 4PTUB 3C5ZD 4KJYB 1B2WH 3OKOA 1H0DB 4JFED 2O61A 3HG1D 1WT5A 3GNML 4UILH 5KTEL 1WWWX 4U1JA 4LSDA 2GCYA 4PLJC 3RWDB 1MFCL 4RWYH 1F90H 1DVFB 5FUZH 3ORJA 2NY3C 2YXFA 4CADA 1H3XA 2BOBA 3GFUA 2H3NA 4JPWH 4JQIH 2VLJE 2VLJA 4N0CD 3G5XA 3GMOB 2DD8L 4YQXH 2DQJL 4Y0GA 5D96B 3OTTA 4GW5B 1YEFH 2VR5A 2Y07L 5DJCB 1EJ6A 3LEYH 2CK2A 4UI2A 5DS8B 4C4KO 4LNRB 4C83B 2AV7A 5GZNC 5EUOB 5FYJL 3MRRB 1NC2B 2GYSA 4JY4A 3B43A 1CDUA 4U4BA 3FMGH 5C8JA 3D69B 3EYSH 2D4FA 3IXTA 2GITA 2VDQL 3MODL 3NIFE 5C86A 1JMZA 3EYVB 3QUZD 1ND0A 3M45A 1LO2L 1SMOA 5IK3B 4XPFH 4DVBB 3F62A 3OAZK 3P4OB 3GJEA 1KXVC 3O2WL 5FGBA 1VERA 1FGNH 2W92A 4W4OA 3LS5L 2Q6WA 1F3DH 4KUZH 3GBNL 4HJ0D 4U33A 4CW1A 4PJGF 4P2YA 3FHAA 1N0LA 5MEND 1I3VA 4BSWA 4YK4B 1D7FA 3OX8A 4JFYB 1SYVA 1HSAB 2XACC 3PABB 4F7TA 3T0VA 3CJJA 4UV7H 3SGDI 2VLRB 4CAGA 1MCWW 2P5EE 3IAGC 4M4RA 15C8H 2HN7A 3B2VL 1IAOB 1GIGL 1KJ3H 5E2TL 5SV4A 3OXSA 3Q1SH 2X10A 5ETUA 3IF1A 4XP6L 1D5IL 1L7IH 2VXQL 3WFDH 2FL5A 4KQ4H 2WBJC 2WQRA 3H3PH 5ERWB 3AM8C 1GAFH 2VLJD 1NJ9A 2IMMA 4HFWB 5JZ7D 2DQDL 3DROA 4JQXC 1IM9B 1LO0H 1Z5LB 3UXFA 3SE3A 5ACZA 1ACYH 5DMIH 1NEZA 3JV4A 2YKLH 4YHKH 2C3GA 4QTHB 3IDIB 3UPAA 1WK0A 5ALCH 4PGEB 2R8SL 2FJFB 5FIEA 2VDML 5L2KE 1OAZH 1D5BA 1ORSA 2P8MA 5F7DB 5HY9B 3OPZH 5C0BB 1CFNB 1G7LA 5DD0H 1DUYA 2KPNA 3CMGA 3F7VA 3BH9A 3KJ6L 2PXYD 3ALWA 1GGIL 2EDXA 3C6LB 5DR5H 3C5SA 5GGRB 4S2SA 3BEWA 3MZTA 1T7YA 1G7IB 1KJ2H 3WE6B 1WLHA 1BIIA 4M6NH 2X9XA 4JDZB 3V4UH 3MRLA 1KXQE 3QIUA 4JAMB 4ODHL 2Y7QB 1FN4B 1W2KT 4Q6IA 3QDAA 2AJYL 3SDDB 3GSQB 1JYNA 2DMBA 1YMHB 1HEZB 5FYLL 3MRDB 4MD0B 3RVXC 4B41A 1WIOA 1BX2B 3U36A 3DECA 2EE3A 4DEPC 1RVFH 4WJ5B 2P5ED 5GSRA 1B2WL 5EC1B 1A4KB 3GKWL 1IEHA 4YXKH 3ARBB 4UILL 4FQXB 4GRMA 4GUPB 4NNYB 3U9PL 3QWOA 2BDNH 4RMQA 4RCAA 3HI1B 3RNKA 4LOUD 3CFEA 4POUB 4TNWK 4YHYC 5F8RC 4RWYL 1G84A 5JIHA 1F90L 5FUZL 3B9AA 3RZCA 2Q76A 1EEYA 3CVIH 3FOMB 1D5XA 4JPWL 4JQIL 5E8EA 1U42A 1XIWC 1IAII 1S7TA 3C6SB 4AIZB 2EO1A 1GYAA 3HZYA 4YQXL 5L2KD 1LO5B 4WNQB 3FJTA 1YEFL 2HVJB 2XTJB 3RNQB 1IGIH 1FZJB 3LEYL 1A6ZB 2P43B 4Z7QE 5C9JA 4MDIB 4J12A 1LHZA 2X40A 4PJ9C 1CR9L 5E24E 4Y8AA 4Z0XB 1S7VA 4JKMA 2FYYB 1OCWH 1TIUA 2HWZH 3MFGB 5C3LD 1ZGLA 1LEKB 1M05B 3AC0A 5IMOB 3H9HB 1YN6A 3FMGL 3T65B 3EYSL 1L9NA 5EORH 1B6UA 1G7JB 3CFBA 3QIUD 1QR1B 2NXZD 1T2XA 1YNTA 3VWKD 3MJ8A 4XPFL 5FO9A 1MFBH 5I16B 4AY0A 2PW2B 4JN2A 4L3EE 3K2UH 1FNHA 2X9WA 1FGNL 4W4NA 4KUZL 2PYEE 2PYEA 4LLWA 2NYYC 1R6VA 3QUXA 1K8DA 3LQAH 1DVFC 3MV8B 5HHOE 5HI4C 1TJIH 5HHOA 4I18A 4M5YH 2E8ZA 5DJ0A 3NMEA 3FQTA 1PY9A 2EH8H 2GTWB 4UV7L 3R0NA 1YC7A 4HWBA 3W5NA 4YO0B 5D96C 15C8L 1KJ2B 2D3VA 1OTUC 4LLQA 1KJ3L 3NN8A 4AT6A 4HPYH 1BLNB 4PJHE 4PJHA 2LFGA 3Q1SL 1XCTA 1L7IL 3RZCD 4KQ4L 1NEUA 1JUFA 1FNLA 6CGTA 2DRUA 4U6XB 1AGFB 3VA2C 5I1HH 5F3HA 1LO0L 3DVFA 5GS0D 3S96B 3KHOA 1ACYL 3QJHA 4YHKL 5DMIL 2YKLL 1AQDB 3UTOA 1LDSA 2QKIA 5ALCL 1NANI 3FFDB 2GAZA 1AXTH 5F7NC 4GKZA 3HFMH 1OAZL 3HB3C 3BUYA 1FZMB 5DD5H 4LSVH 3OPZL 4ZUUB 5J8OA 2X7LA 5DD0L 4ZS6D 4AIXA 2V9TA 4BFBD 2UUDH 1ZHKB 3BWUC 2BFVH 4YK4C 5D1XA 4N68A 5DR5L 2C1PA 4Z7VE 4Z7VA 3EFDH 5HGDB 2GJ6B 1KJ2L 1I7RB 4Y4HB 3A6BH 3QPQD 3OQ3B 4M6NL 1JZ5A 3V4UL 5IMLA 5M7QA 4O51A 1HI6B 3FRPA 4KVNH 2Y72A 1E4JA 2PYED 4JLRB 1VENA 1WEJH 1NDGA 5C0DA 5HHOD 3QRFM 1BFSA 2FBJH 1S7XB 1ETZB 2LU3A 2ZSWB 3VDBA 3HNVH 2AJZB 4UDTA 1E4WH 1GZPA 3D0VB 3F5WB 5FOBA 4PP1C 1RVFL 4KKBD 3VDAA 5B39A 1KB5A 5IOPA 4WFEE 3G6DH 3KR3H 1OLZA 5D1ZA 2G75A 2CRIA 3B8SA 5EBMA 2B1HH 2BDNL 5LGJA 4KDTC 2VLKA 3SJVE 4H8WH 3CVIL 3RVTC 5D70H 5HPMA 2JF1A 5IR1B 1U8IA 3C6LC 1X5YA 1IILE 1WWCA 2NY6D 1HHJB 2X1XR 3KPNA 3FO9B 2A1WH 3P0VH 4ZSOE 4ZSOA 4XC3H 3C8KB 1IGIL 1E4KA 2Z8VC 3RVUC 1R3JB 1QSFE 1QSFA 4BKLB 4H26A 3W9EA 3TBVA 4IOFD 4UV4H 3S37X 3JTTA 1C5DA 5LWYH 3SDDC 5D1XD 2BSRA 2R23A 1QLFB 1OCWL 2HWZL 3BMVA 3ULSB 2GT9B 1FVDB 3QQ3B 5CS7A 5EORL 3A67H 2FWOB 3O6MH 2HVKB 1GSMA 3ARBC 2ATKA 4JM4H 1MFBL 4FQXC 5DURD 1LP9B 3ILQC 3K2UL 1HXYB 4MNQE 4MNQA 4XVUD 3MX0A 1H15B 4CN1A 2MCG1 4U1HB 4QXUH 5FM4A 5DRWB 1N59B 2VJXA 3LQAL 1ZWIB 3MXWH 1TJIL 1MY5A 1A1MA 3KXFE 4M5YL 2EDNA 5I0DA 5HHVH 2EH8L 4EN3A 4PREA 1JGVH 4WFED 2C3VA 3UTSA 3UTSE 4OF7A 3WLBA 1U91A 1UFUA 5D1ZD 3ZDZF 2ITDB 1W72A 4K07A 1PEZA 2XTJC 3ISWA 1FNEA 1ZHLB 1L6ZA 1VPOH 2P45B 1ZE3C 1U58B 4G43B 3HAEH 5HYIA 2VLKD 2AW2A 4HK0B 4BFIB 4Y19E 4Y19A 3SJVD 1OSZB 1MREH 3UPRB 5FB8B 3AU1B 4MQTB 2J6EH 3MO1A 5I1HL 5I74B 1NFIB 4L4TE 4L4TA 3RWEA 5EU4B 2NW3A 4F7MB 1PLGL 5DMGC 3WIFB 3HZVB 4RGOH 3V79C 3EJZC 1AXTL 3HFML 4OIAA 5JA8B 1QSFD 1TTUA 3NIDF 4QHUA 4LSVL 5F7YC 1J0KA 2YN5A 3P4MB 5EU7C 4JVWA 5GS1A 2BFVL 2PNDA 1A6AA 1VFBB 1ZTXH 3OHXB 1MOEA 3UCRA 4XNYH 3EFDL 1JTOA 1CXIA 4G6KH 2I27N 3TZVB 3A6BL 2ZUSA 3VMPA 3PL6A 2V6HA 1HHHA 5E99L 4KVNL 4MNQD 1QPXA 5I8CB 1J05B 1B9ZA 4BFGA 1WEJL 1CFTA 3HC3H 3HUJF 4OV5B 1AXSB 1H5BA 1BVKA 3B3IA 4LLMB 1QEWB 1I8MB 2FBJL 3OB0K 4JRXE 3KXFD 3HNVL 3DIFB 1FVCB 1E4WL 1CFBA 1PG7W 2XG5A 1HYSC 3UTSD 3P4NA 2NW2A 3VXOA 4F37K 2RJMA 2DIJA 4NBXB 5FYKE 3TGXA 1KLFA 3FTGB 3L3GA 3K3QA 2AEIT 3G6DL 3KR3L 1F02I 2EYSB 1VSCA 5E8PB 3DTXB 3TIEB 2B1HL 4M8QB 4Y19D 1A6UL 3QA3B 3PWJA 2CXKA 5JQ6H 1QRNE 1QRNA 3OG4B 3QT2A 5DZNA 2X89A 1MCKA 4H8WL 4L4TD 3UAJC 2QV2A 5KSUA 5D70L 2IQAB 3EYQC 4MCZA 4XB8A 3SDXA 3SDXE 3WHXB 4YPGA 2OI9B 3E3QC 4IOIB 4B5EA 3GSUA 2A1WL 2NMSA 4Y4HC 3P0VL 3UTZB 1OLLA 4XC3L 3VXRE 4GS7B 1YZZA 2Y5TB 1R3KA 1F3DJ 2QEJA 2Z4QB 1CT8B 4D3CH 2XKNB 4UV4L 5LWYL 3QPXH 3HAEB 2ZJSH 1DQJA 4JFEB 4WGVB 2BVPB 5EZLB 5ESAA 2LQRA 4M4PA 1IGTB 4MS8C 3AS0A 3PL6D 1HH9A 4MB4A 5ANMB 4G42B 4DZ8A 3A67L 3O6ML 1P4LA 4JM4L 2VYRE 4FFVC 1QHPA 1A3RH 2Y25A 4JRXD 1QUNA 4QXUL 1CLCA 3S97C 4ONFH 4OZHF 1KEGH 2EDKA 3U9UB 3LQAC 5FYKD 5HHVL 1JGVL 2XXCB 3V8CA 4PRPB 4ZUSA 1ZHNA 3ARDB 4QY8A 3MC0A 2YEZA 1VPOL 3NCJH 3PWUA 5J6HB 3UDWC 2OBGA 1Y18A 1P69B 1QRND 2Z93B 2V9QA 3ES6A 1MREL 3MUGB 3RWGA 2XZAH 3CX5K 4BZYA 2J6EL 3QUZB 5DF0A 2PO6A 4ONHB 5HDBE 4P2RA 1C5BH 2FCBA 3TN0A 5IHZB 4NRYB 2YRZA 5C0IB 2UYLA 2QHLA 5HJ3A 4MJIB 4LSTH 4RGOL 1ZLUH 3VD5A 3VXRD 3QO0B 3UX9B 2FD6H 5MENB 1F2QA 3R06A 2NX5E 4ZYKA 4L4JA 3H9ZA 4JE4B 5IM7B 1ZT1A 1T04A 3VE0B 5KJRH 1PAMA 2VZSA 3C5JA 4E9LA 1IC1A 4PJXF 4NOFA 4D9RD 1S9YA 1QHOA 3DX9B 1I7TB 5GGTA 2AS5M 4XNYL 5SX5H 2D0GA 4G6KL 3EDDA 3E0GA 4HKZA 2BP3A 5JQHC 5ICYB 1BJ8A 3TYFA 2VLJB 2X9YA 5E2VH 3WJLA 5H8DA 5A2LH 1MEXH 4A2LA 4QHNB 3HC3L 3I2CH 2PCPA 3UJTH 1UKQA 4BQBA 4OZIA 3MZGB 4BZ2H 3DPBA 4A6YH 5I74C 3EFFA 1PKQE 1PKQA 2V5TA 1YMMB 2AV7B 3BH8A 5D4QA 3MLUH 3KYMA 4M1CC 2P46B 3PV6A 2PXYB 3QI9A 3PHQB 4M7JH 3MYJB 1F13A 3WBDA 3SCMA 2HTLC 4NO0B 1EMTH 2HFGH 4L29A 2EDJA 2HT3C 4JM2F 2NTFA 4G8GB 5IROC 1ND0B 5JQ6L 2PO6D 5EFIA 4P2RD 4MNHB 4NKOA 3E6FA 2ADJA 4U1SA 4H8WC 4P4KD 3CFKA 5E6IB 1MIMH 4PGJA 4CW1B 3WIHA 1F2XK 1ED3B 1ZLSH 1YY8A 4J1UB 5I71B 3BW9A 3TZVC 5IJVA 2IANE 2IANA 4BSWB 1A8JH 3AFLA 3GB7B 2NY4B 4FA8A 1SYVB 3BIKA 4F7TB 4WU5B 4OGAC 5ADPH 4LQFH 4D3CL 2P5EB 3QPXL 2ZJSL 5D6CB 5A2IH 4UIKH 5DFVC 1WBZA 4PRHE 1HWHB 2YD3A 3OXSB 5L8KB 2ICWJ 4JFDB 1KLUB 5ETUB 3IF1B 4W6XB 2MQ3A 4P2QA 2AGJH 4P9ML 1NJ9B 2VXUH 2EIEA 1GGTA 4OF6A 4CRPA 2AV1A 5JMOC 1T21B 1HH6A 1JNLH 1JYVA 1A3RL 4EXPX 5AYUH 1MVFA 1CQYA 4KKLC 5L2KB 3EYOA 4XRCB 4ONFL 1D5BB 3ZL4H 4V1DB 5IB5B 4LLAA 2Y36H 2P49B 3B9EA 2OI9C 2YZ1A 1WZ1H 3TO2B 5IESH 4DGVH 1DN0B 2BSSA 3BH9B 5FO8A 3QI9D 5I1CH 3SCMD 4PRBA 2YUXA 4XBPA 3NCJL 4GS7C 2P8LB 4XXCC 4Y5XB 2R2HA 2ICWI 3DXAA 3DXAE 2ICWA 4PR5B 5T3ZE 4OCRH 2XZAL 5IKCA 2NXZB 4NNXB 1BJ1H 1IGJB 3VWKB 1EUUA 3BIAX 3DOSA 1C5BL 4NT6A 2XICA 4WFHE 4A6YB 2IAND 3HTLX 3BDBA 4OFDA 4LSTL 5HI3D 2FD6L 4X7TA 5LQBH 3H7BA 5DEGA 5LVEA 1U8KA 3MRIA 4JN1L 4N0CC 5KOVC 5BXFA 5KJRL 1HQRA 2Z35B 3RA7H 2X4SA 3Q5OA 5CBAA 3STLA 5HD8D 5INDA 2FO4B 1U8HB 3TM6A 4MJ2A 4FXLA 4P2QD 5HGGS 3TPUA 1MRDH 5TFSH 1QACA 1JN6B 3WFZA 5CD3A 1EHLL 2CUHA 3ARDC 5E8EB 4K9EC 4Q58C 3ROOB 1CLZH 5E2VL 1KNOB 3DSFH 3HKFA 2N7BA 1MEXL 1YNLH 2GJJA 1PX4A 1S5HA 4MX7A 5DLMH 3I2CL 4JANB 1F6AA 1YECH 1AD0A 1TZHA 5DI8B 1HILA 4M62H 3V5HA 3UJTL 3OGCA 1ZHBB 1T1YA 3QUZC 4BZ2L 5C9JB 4A6YL 3PP3H 1FG2A 2G9HA 5CSBA 1RJCA 3GZKA 3MLUL 1BVZA 3L7EA 3RL1B 3S8WA 5BV7H 4JFOA 4B0MM 4M7JL 2CR3A 5JTWA 3DXAD 4NC1C 4WTXA 1EMTL 5T3ZD 4X80H 5HYEA 3VCLA 5CLWA 4RDQF 3QH3B 2AVGA 2IADA 1LDPH 1YNTB 3MJ8B 1UKSA 5E94B 4WFHD 4L3EB 4Q9BA 4W70A 1MIML 3UEZA 3VXNA 1ZLSL 1K8DB 3KLDA 5HHOB 3O3DB 2HLAB 4PJBF 1T2JA 3G08B 5DJ0B 2ZOKA 5F1OB 5GS0L 5TDPA 3SHSA 3FFCA 3DX8B 5ADPL 2DYPA 4YFLF 1UYWH 3ZE1E 3UJIH 4HCRH 4UIKL 5IVNA 2FEDC 1BBJB 1R24A 1U8MB 2QBWA 3F8UB 4KKAC 2IBZY 1JUFB 4XVJH 1VGEH 2YK1H 2VXUL 5F3HB 2PXYC 3KPRA 1JNLL 1PG7X 1OAQH 4ZUWA 5AYUL 2YD6A 3IAQA 2NY6B 1Q72H 1ES0B 2QKIB 2VNCA 4RA3A 1KELH 2GAZB 3S5LB 3ULUD 2PUQT 4Z8FH 2XNAB 3V6OE 3V6OA 3ZL4L 4LCCB 2Y36L 1UENA 4R9HA 1WZ1L 5E6IC 5IESL 3O0RH 4DGVL 3I02A 5I71C 1U8NB 4JHAH 4NKDA 2OZ4L 5HYSB 5JDJA 4CU7A 5D1XB 4JVPA 4FTVE 4FTVA 5I1CL 3BEVA 4NYLA 2NY4C 4WWKD 1J0JA 4XNMA 2NY5H 4XWOD 3MOBH 4O2EA 2R9HC 2FJHA 5IMLB 1CE6A 4OCRL 4MLIA 4O51B 5DD3H 3VXQA 3ZT6A 1PDKA 4HUXA 3BZFB 1JGEA 4N5ED 4DZBA 1Q9WA 4KK5D 5DURB 1T6VN 3FT2A 5ILTH 1DDHB 2EICA 5F88B 3RZWA 1EERB 4LOUC 3RIFK 2BNUA 1P9MC 5LQBL 4NQEE 3SE3C 5BV7B 1KPRA 2OJEA 4O5LH 2CO7B 5FGSA 3W9DB 5IOPB 3RA7L 1A9EB 1DBKH 1VADB 5IW3A 2ENSA 2G75B 3G6JE 3G6JA 5EBMB 1X6LA 5K9QG 4PP2A 3QEUA 3VFUA 1AI1H 1FAIL 1BZQK 3LH2H 4NO2A 3BP7B 1MWAA 1BVLA 4I13B 4N1HB 2A6KA 3SJVB 1MRDL 3MRGA 5TFSL 4NRZA 1BQHB 2YOCA 4ZFZB 5HPMB 5CGYC 2YUVA 3E2HB 3RY4A 4L8CA 1CLZL 4AM0A 3JTSA 2WMPA 3DI2B 5IV2A 4Y5XC 5DLML 4P2OD 1FCGA 1YECL 4KKCC 4M62L 3BRFA 3MBEA 2P24B 2VSCA 1MY7A 4MQ7B 2EYRA 2NXZC 3W2DH 1QSFB 3VWKC 4H26B 3HPJA 3W9EB 1XF5A 3TBVB 3QG6B 4JRYE 1RK0A 5A1AA 1RZGA 4HKXA 5B38G 2P5WE 2P5WA 4FTVD 1JPSH 3WYRA 1S5IH 1I3RA 4OBSA 5HHNA 5FYKH 5BV7L 4BUHA 3FCTA 3SKUD 2AXHA 3OXRA 4X80L 1WZLA 3RL2A 1LDPL 2VDKH 3V95A 1A47A 1OTTC 4LLDB 2AI0H 2A73B 4PY7A 4RZCB 2VZOA 4CMMA 4X98A 3V0VA 3A6CH 4ZD3H 3BP6B 4KXZH 4NQED 3PIQA 4YHLH 2F74A 2ICES 3KXFB 3VFRA 4GKNA 2ERJB 4RIRB 4G9DB 4PREB 1KTRL 1B4RA 3L5IA 2C3VB 3UTSB 4PIRF 1C1EH 1NGXA 5GS0C 2OL3H 3UJIL 4J3UA 2WW8A 4HCRL 1FNEB 5HGBB 3MJ9H 5J9PA 3VA6A 2VOTA 5TDOA 3SDAD 3EIFA 4NBYB 4L4VE 4L4VA 5KSBE 2FBOJ 4GRWF 4XVJL 5JO5A 2YK1L 1R3LA 1TCMA 1VDGA 2EC9U 3UYRH 2E7LA 1MCQA 3EO0B 3G04A 4RWHA 1OAQL 3DBXB 1R3HB 1I4FA 3MBED 1WGOA 1Q72L 1KELL 4G6FB 4Z8FL 3M1BB 3ZT7A 3QPQC 1TVBB 4RBPH 3DVNA 4MD4A 1CD1B 4OQTA 5DJ8A 4JG1L 2P5WD 3L3JA 2BVOA 3ARPA 3CFDB 5BJTB 5GS1B 4HMEA 4NFBA 4JHAL 4LCWE 4LCWA 4JCMA 4LMQI 1A6AB 3TVMA 4RMUA 1X9QA 4OLEA 5DTFA 1GXEA 1UXSB 2NY5L 3ZKMD 3MOBL 3PL6B 4YHIA 1HHHB 3MREA 4PLNC 3FT4A 1Q0XH 3P0YH 3PWVA 2OLDA 3JV6B 5DD3L 3HZMA 5E8OA 3VG9B 4ZXBD 3MRNA 4HK3N 2VDLH 5ILTL 1H5BB 3U48A 4NCC2 5IW6B 4YX2H 25C8H 2KQNA 4JRXB 4XP9L 4U1KB 5DK2A 4OZ4A 2ICCA 3CLFH 3STZB 2QQKH 1H3WM 4ZODA 3IDGB 2NW2B 2VUYA 2JCCB 4O5LL 3L3GB 3QIBA 2NY6C 5INCA 4KKNA 1DBKL 3VDCA 4X4ME 1KB9J 4ODWA 4X4MA 5C07B 4RAUA 1S7UB 5IBLD 4LCCC 5AZ2H 2R0ZH 1AI1L 3BPCB 4L4VD 4NCDA 3LH2L 4X8JB 4XC1H 3FB6A 1QVOB 1CGWA 5HGHA 3STBA 5MEPB 4ORGB 3BYYA 1BFVH 4ZUVB 3LY6A 3SDXB 5D1XC 3RY6C 1YN7B 1LK2A 2DQHH 3WL9A 4E0RB 3L95A 3EOTL 3VXRB 3LKOB 3DRQA 3BQUB 1P53A 5DK0A 2FR4A 4Z6AT 3ZDXE 1IQDA 3W2DL 2IEPA 4HMCA 1W0WB 1UB5B 2VZTA 4LCWD 1FNGA 3RBGA 4XVUC 3TVMD 3K1KC 1JPSL 1S7SA 3WHE1 1S5IL 4K3GA 5F9JB 2YRPA 5FYKL 5AAMA 1P7HL 4Q0XH 1EJOH 5BV7C 3TEUA 1IEBB 1NBZA 3WIIH 1XCQA 3L7FA 2VDKL 1MVUB 5F7HA 1KCLA 2AI0L 3B9VA 4ZPVB 1OQOA 5C92A 3A6CL 4ZD3L 4YHLL 4GMSH 3PNWA 4PD4J 3VWJD 3E2HC 3M8OL 2EKSB 2XTLA 3FQRA 3EO1A 3QIBD 1O7SA 4FG6D 1U8PB 2A38A 5DJAA 3V5KA 1C1EL 3BVNB 4RRPA 1OF2A 5I76A 4JZNA 4PB9H 4WUUA 1JMXA 3MJ9L 3FO1B 1HYRC 5KG9B 3U79A 1DQDH 3ES6B 4UU9B 3O6KH 1UXWB 4X6DE 4X6DA 3UYRL 1I1AB 1XGPA 4APQA 3BYTA 3ZKNC 4L1DA 4P4KB 4X8XA 2IH3B 3L3IA 1JVKA 3MLRH 1MHEB 3ULVF 1XGUB 3R06B 3TV3H 2NX5B 4ZYKB 4WI5A 3E6HA 3S3SA 3T1FA 1JV5B 4EUPG 3C5JB 3K8MA 2VE6A 5DO2C 2DKMA 3CZFA 1LEIB 3QYCA 5E70A 2ERJC 2ZWLT 3UBXI 3GSVB 3ZKSD 4BA8A 4KJQC 5D2LF 2XRAH 4PRAB 3TO4B 2E6QA 3TYFB 5J1AA 1VCAA 4O2CA 5FXCH 5T3ZH 2AXGB 2VDLL 1NCTA 2A9MH 4I77H 3WO4B 4XZUA 1H3VA 3O6LH 3ZDYE 4MGXA 1HKFA 1IAIM 3CLFL 1YJDH 2QQKL 1F3JB 4LPVA 3SKJH 3IDMA 1ZT7B 1L9MA 3B9KA 1K8IB 3GJFH 1FJ1A 2EC8A 1OD9A 1UC6A 4NO5B 1WTLA 5DXWA 5CD5C 5DSCA 5DK3A 3PV6B 5E6YA 1I75A 5I8EB 4AH2B 5AZ2L 2R0ZL 4XC1L 1QSZA 2VUOA 1LVEA 2UY6A 2NTFB 3BPNB 2J88H 3Q2CA 5GS1C 1SJEB 1C16B 4XNUL 1BFVL 4APQD 2VZ1A 2ADJB 4NQCE 4NQCA 4U1SB 1FE8H 3CFKB 2HKHH 2LE9A 3I6KA 2DQHL 3KPSB 1UCBL 3KLHD 1TJHH 5HHPA 4KC3B 3WSQH 1ZSDA 1YDPA 2WANA 3PL6C 5K93A 3KLAA 4UIMB 3RKDC 5TH2B 2E7CA 3LKQA 5J7CC 3WNPA 3FB7A 1L0XA 5BS0E 5BS0A 5LJYH 3VG9C 4HIEA 3PDGA 1H5BC 3DGCR 5C09B 4UQ2A 4NZUH 2BMKA 5H94B 4M93B 4OSUH 1FFNA 4PRHB 4KVCH 3ZKXB 1H3PH 3KYOB 2B2XH 2X4QA 2WQ8A 4Q0XL 3MJ6A 3PHOB 5I2IA 2EC9T 1EJOL 4FQQB 2HA1A 4HIJB 3WIIL 5JORB 1II4E 3RWJA 5BW7A 1VACA 5EWIH 1HH6B 2G2RA 4PJEA 2BSTB 4P57B 3TBWA 4POZD 3GMRB 3DGGB 4EIZC 5IVOA 1MCCA 1YEDA 1A9BA 1DEDA 5D5ME 3EYOB 5E5MA 4GMSL 5IB2A 2XN9A 1MHPH 3B9KD 2NY1D 4XCYA 1HQ4A 1QLRA 3KLSA 2ATPA 4PJGE 1P2CA 4N8CL 4PJGA 3NIGF 4IHOB 4JO3H 4QRTA 1X5AA 2AQ3A 5T1MA 4GAFB 4PB9L 5C6PB 3MLWH 3L3DA 1EAPA 4Z77B 3BQUC 4HS6B 4NRXA 2XYCA 2YPLA 2YBRB 1QO3A 1DQDL 5F70A 1HSBB 2D4DA 3O6KL 1HIMH 3OWEA 4QHKJ 4NQCD 4D9QE 3S35X 3MRKB 3OKNB 4NQTA 4K23H 2X4PA 1X5ZA 5E56A 1P84J 4JKWA 4LAJH 2ARJQ 3MLRL 5C0EA 1X6NA 3TV3L 4X7TB 4PGDA 5BS0D 5K9QI 4X6CE 3TIDB 5KN5B 1U8KB 2VQ1B 5GGQH 3SQBA 4M43H 3KDMA 2ED8A 3MLTA 1X5FA 1HQRB 4LSUH 4HS8H 4M1GH 5F1IA 3IYLW 5F1KC 2X4SB 5CBAB 4U6TA 2NXYD 3IU3B 3P73A 1P7KA 3CC5B 1ROWA 3WKML 3EGSB 2RBLA 2VMFA 2GTZB 3BP4A 3GSNA 5DUMH 4XP5H 2HAZA 2Z0BA 1BWWA 1UVQB 2XRAL 5CD3B 5CP3H 5ENWA 1QA9A 4OLYH 5L2JA 32C2A 4QHKI 5TDNA 5T3ZL 2F19H 1F11A 4FQJH 1MHHB 5DA0B 4MX7B 1NCBH 4I77L 4M3KB 5B38A 1NCAH 3O6LL 3D0LB 4UNTA 2FIKA 4GBXA 4P3WA 4FZ8H 3GUTA 2J8HA 3CZJA 1I1AC 3SKJL 4PTTA 1A6PA 4LPTA 5J6GA 1R5IB 4GW1B 4P4KC 1PBYA 5A2FA 1NH6A 4YR6B 2J8OA 4H5SB 3TESA 3VXPB 3ELAT 4FABH 3S98A 4WWKB 5B3NA 2AEQH 4D9QD 1FFRA 2E6PA 4HS3B 5D7JD 3MMEA 3I3BA 1RQ5A 1AJ7H 1EHAA 2CMRH 4JY5H 2HKHL 3SGJA 4NN6B 5ABDE 4U1MA 4MCYA