3ARFC

Ternary crystal structure of the mouse nkt tcr-cd1d-c20:2
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
204
structure length
203
Chain Sequence
TQVEQSPQSLVVRQGENSVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A molecular basis for the exquisite CD1d-restricted antigen specificity and functional responses of natural killer T cells
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
total genus 41
structure length 203
sequence length 204
ec nomenclature
pdb deposition date 2010-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3arfC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3arfC02
3MRPB 4LPVA 3NCFB 1R6VA 2V2TA 1MRCH 1JHTB 2DWEB 4KKCD 3V5HA 4TQEL 2YZ1A 4XVSH 3GMRB 1YMHB 5I1KH 3MFFA 3HAEA 1U8PB 4M1DL 5CGYD 5JOPE 2Z4QA 1X5IA 1I7ZA 3VXTA 5J06A 3Q5YA 3BKYH 5DD3L 12E8L 3BGFC 4RGMC 2NY7L 5FYKU 2GJJA 2AV7B 5HYJE 1F2XK 3ARPA 4LSSL 4OQTA 3N9GL 4OD3H 5HTSA 1A3RL 4FQHA 4YWGL 4MA3A 2QADB 3TT3H 4PFEA 5GISL 2R2BA 5SWZA 1OAKH 5DJ2A 1H5BB 3IETA 5F9OH 2VDOH 1CK0H 4GKZB 3TN0B 5IESH 4XXDB 3HR6A 3BP4B 5LGKA 1HXMB 1ZOXA 3MBXH 1DBAH 2EZ0D 2HJFB 4XH2B 4XBGA 5DQDH 3WUWG 3SJVE 3C9NA 1J9CT 1JGDB 5DJYA 4F7EB 1IL1B 3O4OB 2J12B 3CVHL 4NQVB 5IVNA 1YYLL 3BAEH 4R4BA 4WRLA 5HYSB 1KC5H 1FGNL 5C8JA 4RBPH 1P4LB 2AI0L 1EFXD 1KTKE 3HE7D 2A0LD 2EO1A 3TCLB 1WCBB 1O7VA 4LVOB 4Y2DC 3MOAL 1CTNA 4YHLH 2JJTC 3MV7B 2X89A 1I1RA 5M7QA 3RKDC 4ZTPL 4Z78A 4K3JL 4HWBL 1N5AA 4A2LA 2YD3A 2ZCKH 4P4KD 4ZTPH 3SOBL 4M93B 5L0QB 1NFIB 4UB0H 2EEAA 4I8DA 2WIIA 3TO4D 1JGDA 5FO7A 1F4YH 3I6KB 1JNHB 3Q6FB 3ULSA 3RWCB 4UB0L 2MCPH 4DZBA 5ICZA 4NNYB 3HC4L 3BW9B 3FB8A 3HZMA 3AS0A 3VWKB 2P8MB 3ARDC 5BV7H 1GGCH 2BY3A 4ZFGH 3SDXA 5IJVB 4MNGA 4U0QB 4DUWA 4Y1AD 2CK0L 1DUYB 3FO9B 1GGIH 1F4XL 3O4LA 4GKNB 4U2YA 4MWFB 2X6MA 3K1KC 3FO1A 3W39B 2F54D 1U8OA 4RFOL 1F3JB 3SN6N 1MCBA 3T77B 4OBRA 2YPLE 4FABL 4PGBB 2NW2A 4UIKL 3I75B 2VLRA 4U1JB 3T0XA 4MA8L 1QSFB 4P2YA 4NM8H 4OUOA 3UAJC 4TPRH 2WM0A 5IMMB 1SVZA 2I27N 5JDSA 1RJCA 2BSRA 4DZBB 4YHNA 1BX2B 4PJ9C 1QRNA 3NCYS 5CEXB 1Q0XH 4PRHD 1XH3B 4HLZG 2AK4A 5SV3A 2GUOB 1C5DA 1FYHB 3KPSE 3O6KL 4HKXB 1DBKH 3JXAA 4WDIB 5T33L 3VG9C 4DFIA 3JV6A 5E08L 4Y19A 1TLKA 2GK2A 5F1IB 5ADPH 3ARFD 2ADJA 1KCUL 4P57B 4ZSOE 1Q9OA 5E08H 3UTSE 3OAZH 4QXWA 4QY8A 1RK1A 1ZAGA 4X5WA 3T3PF 2AI0H 2AJXL 4K9EC 1BBDH 5HGBA 4YFEA 5KSUA 5F70A 3GRWH 1UA6H 3IDJA 3RWHB 5AD0B 4ZNCD 1JWMB 4HUMB 3VFMA 3V5KA 5GGQL 1NL0H 3OKOA 2D7NA 1FC2D 4QYOA 4YHPB 5CILL 1NFDB 2NY2D 3AMLA 4PV9A 2FDBP 3O11B 4ZAKC 4NZRH 4D2NA 4NC1C 4QCIB 1EUTA 3EFFB 4NN7B 1EHLL 4ZPVB 5E0QA 1JWUA 4PGCB 3BKCL 3GO1L 3HRZB 4I4WA 4MVBD 5JZ7C 4R0LB 4YZFF 4OFIA 4GKSA 1FQ9C 1YC8A 4JPWL 3KPLA 3C6LC 3SDDD 4N1CA 2V9RA 1A2YA 4JHAH 4ZSOA 3WN5C 1EPFA 4OIIL 3LEYH 1QSFE 3IXAB 1T5XB 2OTUB 1H3PH 2A9NH 3MRQA 5T5NF 3UBXG 1NC4B 1S9XB 2VDLH 4PJBA 5I8KL 1OOAA 4UI2A 2AJ3A 1HHJB 5SV4A 15C8L 4G6JH 3QDGA 3UJTL 3BEVA 5JXEC 2EE9A 3QPXL 4LQFH 4OBSA 3RWEA 1BEYH 3OTTA 3REWB 3DGCR 2E3VA 4PJ7F 4NC0B 1CD8A 4OT1L 1U0QA 3VD9A 4BQ8A 4QOKB 1WT5A 3BE1L 1J18A 3PHQB 4PRID 4FG6C 2H41A 3G9AB 3E8UL 3PWUA 3I3DA 4KTYA 4Q9BA 2H9GB 2A83B 4O2EA 2XN9A 1I4FB 3VH8B 2HVKA 5EU5A 1MJUL 4JKPH 2GCYB 4XHJD 1QFUH 3KYOB 4HEME 4P48A 3OF6D 2Z31A 4Y1AA 3O4LE 4C83B 4A6YB 3KVQA 1HDMA 3S37L 1N2RA 1N8ZA 5FUCE 5FUZL 2Y9RT 1ORSA 4WJ5B 3D0LB 5TPWH 2ADGA 1CS6A 1BBJB 2YUXA 3S8WA 5LCVL 3CFDB 3O81A 1FFRA 3VA2C 5IJKA 1MCEA 4G8GE 2O5YL 3QEGH 1QQDB 1JFQL 4KAQH 5FM4A 4PB0L 3ZYJA 2OZ4H 1OAQL 3HZKB 1F45A 3A6BH 4CN4A 4C56B 3WIFB 3GMPB 3LKSB 1AE6H 1DDHA 2VYRE 2DTMH 5HHQA 4CN1A 3ILPB 5LAXA 1YECL 2I9LA 5DFTA 2X42A 2A9NL 3CVHB 3DSFH 3WNLA 3QUZD 4HUWB 4TTDC 2JCCE 1KENH 5HDBE 3RVWC 3GEWB 4QOKD 3WBDA 3DMMA 3T65A 5IQ7H 2ZUQB 3DX8B 3WIIH 4JPWH 3QDGD 2A6KA 4H26A 4XMPH 1NLDH 3QNZA 3EO9H 2XG4A 1MCKA 5DD6B 1CIDA 4PGJA 3JTTA 3FQNB 4HUXA 4XNMB 3CX5J 3RAJH 3DMMC 3KHOA 3KPQB 5I1EL 2WWKT 1CT8A 3V52H 3OL2A 3V7AE 5LWYH 2AXFB 4M02A 4YK4B 2QJDA 1EFXA 3HE7A 5J6GB 4F15C 5JLZB 5FYJH 1U8NA 1FVCA 4JG0H 4JFED 4MNQB 4FFZL 5HDLA 4AT6A 5KVFH 5GSRA 4LMQE 5FYLH 4ZD3L 1HZHH 1EO7A 1MJ7H 3W11C 2PW1B 5EZOH 5BRZE 3CDCA 3MCKA 3FQWB 4WUUA 4Z95H 1U95B 1XFPA 5T1LD 4EJ1C 5MHSD 1BPVA 2W0KA 1YYMH 1U91A 3I02B 4HS8L 5ESVB 2J2ZA 5BS0D 3HAEG 3G08B 1P84K 4DVRL 4NKIH 3DROB 1HHIB 2CQVA 4PLJD 5DD6A 3ARBB 3AB0B 3FQNA 4N0YL 1MHCB 1WK0A 2X40A 3R06A 5JPMA 4O5LL 1MAJA 3OGCA 4ENEC 2VWEE 4P5TC 3EO1A 2R1WB 2DKUA 4UILH 5GSRB 3VXMD 1NGXA 4U6XA 5EU3A 5B8CC 3ALXA 4NCC1 3M17A 4W6YB 3HNSH 5C86A 3QRGL 4L3EE 5DD1L 4Z78B 2QEJA 4PJIF 2A1WL 2WK2A 4HXBL 1QACA 1GGUA 4GRMB 3V8CA 4LGPB 2BRRL 4W6WB 5HHMD 3T2NH 4ZDHB 5J13B 3U7YL 3EUUA 1KN2L 4IMLA 1BOGB 3ZE2F 1F8TH 4NIKB 3NZ8B 1VA9A 4DK3A 3HA0A 4MNGE 1YN6B 4XP5H 3VW3H 5T1MA 2P8MA 4X7SH 5JMOC 3RTQB 3S88L 2VC2H 5T1LB 5FYLL 5BW7A 1T4KB 4OGZA 1NEZB 1Z2KA 1DR9A 3M17B 3O3BB 3I6LD 4KKBC 4U1NA 2XKNA 5HPMA 2NY1B 3AY4A 4PLKD 3QIWC 1NQBA 3VG9B 1NUGA 4G7VH 5GJSL 2Q3AA 4K94H 1F3JA 5D96C 2B20A 2E27H 2Q7NA 3MRBB 3SGDH 1SY6A 5CCKH 1MUJB 3K2UH 2EYSA 2XNAB 1U58B 3MGTB 4NRYA 1N7MH 1AGCB 5JW3L 5K9QG 1YEIL 4NNPH 1UB6B 4FTVB 2W38A 4M43L 3RUGA 1FVEA 4QTIL 1OP3K 4IRJC 3VGAB 4RWHA 3IDXH 4JFZL 5JW4M 3NN8A 1REIA 4AIOA 5DJ2B 4FFVD 3QDMB 1ZEAH 5LKNA 4X6CE 4XAWL 1AHWC 1DBJL 2H1PL 4ODVH 2ZSVB 3UTPE 2YN3A 1HXMA 1FZOB 2DI8A 3CFIC 4ISVB 5E2VH 1FV1B 4XBGB 3GKWL 5FYLD 3QULB 3FRUB 4U1SA 1RJZB 5DA4A 5TJWK 3C9NB 5BMFH 5BV7B 1WQVT 1T0NA 5HVGB 1MI5E 5IJKC 4OD2B 5F1KC 3VWKC 5KVMC 4MD0B 4R97C 5LVEA 3GKWH 1MI5A 4F57L 1T6WA 4UT7H 3UYRL 1O5DT 5EUOA 1CBVH 4LDLB 3S37H 3B9KA 3VFRA 2C9AA 5DVKA 4JFEB 4MYWB 2YBRB 2VXQH 1B0GB 4V1DB 3LN4B 4YHPA 4H0HB 1KOAA 2Q1EA 1E4KA 2OP4L 1N6UA 2BP3A 4HWZA 1N4XL 2KL6A 4L9LB 4XCFH 4CU6A 3F12A 4Y4FB 3B6SB 3W81A 4JFDD 2UUDH 3GSUB 1RIUL 4QXTB 4OLYH 4QXGL 1CFQA 1CXHA 2QKIA 4YDJA 3JSSA 4NFBA 3FFCE 4FTVD 2NMSA 4F9LA 1YZZA 5IG7B 4Y5YA 3STBA 2J8UB 4JY6A 4U1MA 3WLBA 5GS0H 4Y16A 1YNTA 2OTUA 2DDQH 2BNUB 4JGUA 2A77H 4Q74A 4P23B 2JE8A 2D7MA 2Y6SC 3ARGD 2KDGA 4NQEA 4XCYA 3HG1D 4PLNC 1EERB 2IH3A 4PB9L 1P7KA 3NIFF 2GT9A 3QCVL 1S7WB 1J10A 1B0GA 4HV8A 1H8NA 1A1NB 1FE8H 5DWUL 1Y6NR 1EA9C 4HK3J 5EZLA 4QRRE 4BUHA 4P5TB 2EXYD 4NKDA 2W1NA 4IHOB 5EUKA 3SGKC 4HKBB 1QLFA 3D18B 3LQAC 4EBQH 5DHYA 4PGBA 4YBLC 5GJTH 5I15L 4RX4D 2HVKB 1HNFA 5T3XE 2M1KA 3GFUA 4LCCC 4NNYA 4UNVA 4O9HL 4WI5A 4JFPB 2J88L 2WLYA 3G6AA 3PQYB 1S7SB 5FGRA 1BQHA 3LAFA 3SDXB 4WI8A 1QVOA 3F62A 4JN1L 5D7KE 3KYNA 5KN5B 4FXGB 3QCTH 4JZNA 1I8KA 4NO0D 2CUIA 3FT2B 4NKMB 2JELH 4J6RH 1NBYA 1AY1L 2OP4H 1ZA6A 1CDUA 1VFMA 2P7TA 3I6GA 3WFHB 1J87A 1RZ7H 1YJDL 1TMCB 2JJSA 5EZLB 2ZWLT 4ERSL 4PJDF 2MKWA 1F4WH 4H88L 4IIQC 1RUPH 4WEUD 5FM8A 2OXGA 1MCJA 2PO6B 5A2KH 4LSTH 5EU7E 5DJZA 1JMXA 4DKFL 2R0ZL 4XGZA 3QUYB 2EYTB 5JDSB 1DBBH 3AVEA 2VZTA 2H6PA 5CEXA 3T3PE 5C0DB 4GRWE 2FH6A 5C71A 1YNKL 3CCHB 4LHJB 2OSLB 1UGNA 2UZIH 4RFNC 5C0AD 1I8KB 4C59B 5L2KD 3WN5A 1HSAA 5B3JF 4PJDA 2AK1H 1M7IA 2YKLL 1EO8L 4DJMA 4U0RC 4PPTA 3ES6A 3EDDA 2DIBA 1A6AB 4TVPL 5D93C 2NX5E 1JPFA 5HDOA 3RGVA 3BQUC 4O2FB 1ZT4A 4JM2D 2AJUH 5D1QB 2BFVL 2GTZA 5L8LB 4P2CG 4YR6A 5HYEA 2HT4D 3TN0D 5IBLD 5E9DE 2IAMB 1TPXB 3HE7C 3TA3A 4KKAC 1A64A 1GGCL 4G7VL 2OQJA 5D6DC 3HN3A 3U9UA 2PNDA 1MWAB 4CAGA 1OTTC 1I8MA 2J6EL 4P9HH 3FB6B 3H8NA 3BRDA 1LE9B 1OP5H 1MH5B 2CJUL 2X4PB 1WT5C 1DUZB 2VLJA 2X2YA 3K81A 5HD8D 1KNOB 5FHAH 3SDAB 4F3FA 4JO4L 1ORQB 1AHWA 4H88H 4PBVC 2ZOKA 1QG3A 1NUFA 4YK4C 4YHZL 4Q58C 5D7SH 3GIZL 5KVDL 5T3ZH 3BH9B 3C5SA 1NSNL 4TSBH 3R8BB 2IAMA 4WNQB 3SEPA 5C08D 1EO5A 3SKNB 3VFGL 2NTFA 1A6UH 3ZTJG 2EDWA 3ALPA 3TM6A 1F4WL 4FNLL 2R9HC 3HI6L 4WJ5A 3S3PA 3V4VH 4EN3B 3F5WA 5DJXB 2AEQH 2DMKA 1J0JA 3C87A 3SE8H 5C0JA 1OP3H 3MO1A 3STLA 3O6MH 2NW3A 2EIBA 5F9WB 1PX4A 4P2RE 4PJGF 3VXSA 5KSAB 2OR7A 3TBTB 1BZ9A 5D7JB 3PHSA 4PJ5D 2UWEE 4RMWA 3FCTB 4FFWC 4JQXA 3QIUD 3SKNA 4WCYH 5D7LE 2PYFA 1ORSB 4NCDA 1BLNB 4OCRL 2X09A 5D8JH 3HI5L 4OM1H 3W0WD 4ZD3H 2APVA 1MJ7L 4OCRH 1F3RB 1U41A 5CD3A 4HHAB 5I9QC 4ODSL 2A6DB 1PKQB 3EIFA 4HIJA 2AEWA 1I1YA 4BKLB 4F7EA 1U58A 3QDMD 5C0GB 4YXHL 3VFVB 4NCC2 3VXMB 4BZYA 4EI5B 4H0IA 4K71C 1KEGH 5HHVH 5LQBL 3EKCA 1MFCL 3BDYL 5C9KA 25C8L 2EKSB 4ZMAT 1LO3L 3MREB 3EYUH 3H9ZA 3QDHA 3EOTL 1F42A 3W0WA 3N1PC 2MMXA 1HIML 4ZNEA 5EC2A 3HMXH 2AK4E 3HMXA 2A73B 4G8EB 1U95A 1L9NA 1HXYB 5AAWA 5KS9E 1NGZA 3LD8C 4S2SA 2HFTA 3Q48A 5D6DA 4MVBC 2HLAB 1A22B 2BVPA 1KXVC 1ZHLB 5C0RH 3K1DA 3SDDC 4KV5F 1FZJA 4OD2A 1TFHA 3QG6B 2Y4SA 4K7PH 4PRNA 3VFVA 4BFIB 4MNQA 3UC0H 3TZVB 5CEZE 5FDWA 1D6VL 1UZ6E 2UUDK 3TVMA 1NCBH 5I19L 1KJ2B 3FOMB 3MMEA 5F1NA 3MPCA 1ZVYA 2HFEB 1EV2E 3LV3A 4K3EL 4YXKH 4V1DA 5ESAB 2JIXD 3ESVF 3NIGE 1CU4L 1UCTA 2F74B 4KHTH 3LZFL 4Y8AA 1KFAH 3W0WB 4RBPK 4NJ9H 1TNNA 3QDJE 4MXQC 1INEH 1IGCL 1NCTA 2IAMC 3QFJE 1KELH 1JI2A 1GC1C 1V3LA 4P23D 1DVFC 1U8OB 1I9JL 3EFDH 1OP9A 1M05B 5DZNA 3WUWB 3C5JB 4WEBL 1MCPL 1M4KA 2HLAA 3QEGL 1MCDA 4IRSC 5F7DA 4HFWB 4CMHC 2GJ6B 3FOLA 3TYFB 3EYVA 1S8DA 1FDLL 4HKJB 4K94C 4WFGE 1RIHL 1IZKA 4GBXB 5I30L 3AS1A 3LV3B 2EEDA 4U33A 3B9KD 3EOTH 3FO0H 4XVUC 4HBCL 2V2TB 5BQ7A 4M7LL 3S34L 2CH8A 2YS4A 1MHHA 5J11C 2DBJA 1CL7I 2Z91B 3BUYA 5GZOD 2P5EE 3ZZ1A 4WGWB 2QBWA 1YDPB 3E8UH 5DK0A 4KI1A 5MP6L 5DZLA 5JORB 4ZOEA 1R5WB 5B39A 1LQSR 1SJHA 4Z7VB 1TXKA 3U4BL 2G9HA 5GRJH 4X0KA 4LGSB 1TQBC 4NFDA 5M94B 4JDTL 1VFBA 1NAMH 2C1PA 3QWQB 4P59L 5CLWA 4KUZH 5EBMB 1QVOB 5H37G 5I0ZA 3BKJL 3RVWD 5T5NG 2R4SL 3GRWA 5BQ7B 2CXKA 3QDMA 2OX5A 4JFFD 4QRQB 1JP5A 4PGCA 4U2ZA 3MLWH 3MV7D 4YHZH 3E6FB 3DURB 5IROA 1T2QL 3NMEA 4Y5VC 5E03A 5DK0B 1BF8A 1S9WA 4R2GB 4YDLB 1OGAA 2W65A 3VE0B 1W0YT 3IDGA 3X11B 1J11A 4OQ1A 4JDZB 4FNLH 1GZPB 5I75B 1VKXA 1HH6B 1KTDA 2EDQA 1UACH 3MV7A 1C8PA 2NX5D 4I3GA 4QHUB 1NGQL 3FTGA 1P7QA 1X5HA 5KSAD 5ERWB 3Q3GA 5CIPA 5KSBA 3G5YA 3SE4C 3PHOB 1ZLSL 5A2FA 1TDQA 1KCLA 2ESVA 2IFGA 4ZXBA 3EO0B 1HEZA 1ZLSH 1A8JH 5FO7B 1TNMA 3SGEH 2W9EH 1JZ3A 4PREB 5IG7A 2ADIB 3OXSB 4MCZA 3SE4A 43C9B 2X4QA 1JJUA 1WTLA 4P23A 4UOW0 4P4KA 2J3SA 3P4NA 1LNUB 3MC0A 3U9UB 2ITCB 5I15H 5I1JL 5FA3A 3WSQL 4CJ1A 5DF0A 5E8OA 1RZKH 4NM4L 1A1NA 7FABL 1OTUD 3QJHA 4NQXA 3EYSL 4QXTA 5ERWA 3DV4B 3L5HA 3EGSA 1KNOA 5D5MF 3SDAA 2GITA 1XGUB 2CRIA 4WVRA 4Z0BH 1YUHA 3U30C 4LHUD 5JW3H 4PREA 4OT1H 2XWJA 1XGYH 3PWNA 1EX0A 3HLAB 2IBGA 4R0LC 4JY4B 2F15A 4FXKB 1HOCA 1UACL 3KYNB 1NBZA 3DRQA 4KKBD 3QFJA 2ZOLB 1DQMH 1KJ2L 1HQ4A 4H26B 3QDJA 2EXWC 5BJTB 3U2SA 1A1OA 2D7OA 1FVDA 1BQLL 1OGAE 4GAYA 3CFCL 4Q2ZB 4MHHG 2DLEA 4ZAKB 2BDNH 2AXFA 3VH8G 2PO6A 3QYCA 4JRXA 3CC5A 2YK1H 1PZ5A 2BNRD 1NC2D 3GSNA 5IKCB 2VAJA 2X70A 2D9QB 3D3VB 4RDQF 1BQHB 3MRKA 2OXHA 3HLAA 3UTTE 1G9MC 2BC4B 4V2BA 5DURB 3GSWB 5C0BA 3QG7H 4H25B 1NFDA 3QUML 5I73B 4JFHD 1QBBA 2PYFB 3CFKA 2XXCB 1W72A 3B9VA 3MA9L 1FGVL 5FDYA 1WEJL 3VXOA 3LRSA 3EDEA 5CGTA 4YFLI 1U92B 5LJYH 4KJYA 5D2LB 4YWGH 1PKQA 1OAXH 5D7JC 5HJ3A 3G5XA 3SO3B 1CD1B 3L3JB 2FZ3B 5GGSA 2VLKD 2DQJH 1NCNA 1J12A 4NDMA 3V0VB 3CC5B 4P9HC 2CJUH 3UTOA 5L9DL 2N56A 1NFDF 1P53A 2DLTA 5EO1A 4JRYA 1ZGLP 1M6OB 3HI1A 2F53A 2YD7A 4G8IA 5ICYA 5HGHA 1SBBA 2BC4A 3TO4A 5HHOB 3DETC 4M62L 3LKPA 2OJZH 1KLGB 2DM4A 3MQIA 4Q0XL 4FQXB 3HR5A 2QQQA 4TVSa 1JF6A 2Z93B 3QIUA 3FMGL 1LD9B 5A43C 3TC9A 4J3TA 1CR9H 3VFGH 2VLJB 1M7XA 1NANH 4KRPD 1FSKB 4D9LL 1IGYB 3AB0C 5FEBA 1TJIH 1BVKB 3VH8A 1TIUA 5DJ6B 1C5BH 1ZHBB 4AJ0A 2PTTA 4LEOB 4OZFA 4LL9A 4LCUB 3B2VH 3DX7B 3TVMB 1IAOA 1MHEA 4KGLA 4R7NB 5IQ9B 4XPHL 3FQUA 4RISL 3RNQB 2WNGA 3CX2A 4DW2L 5I1LB 1IEBA 3RY4A 1RZIA 2DD8H 3DIFB 4OGXH 2LQRA 5IVXA 4C4KT 2XKNB 1I8IB 2EH7H 5I1HH 1SY6H 1EHXA 4MB5A 3HAEB 4NP4H 3VJ6A 2Z4QB 4M3KB 1LEGB 1CE1L 2GSIA 5C2BL 4ERSH 1WBXA 3LSOA 4F3FB 4HWBH 1SBSL 3S35L 2EYSB 4AK1A 5EZJB 1A9EB 4FQ1L 4UDUB 4JB9H 3KPTA 3TYFA 6FABH 3HI5H 4Y4KA 3TBWA 4J3WA 3AU1B 1UXWA 3RDTA 1D9KA 5DJ6A 4JPVL 4PJBE 5ID0A 4KDWA 4TNWK 2HFGH 5DVNA 1DN0B 2DQDL 3CLFL 3DX9B 2PO6C 4HIEB 4I2XE 5BW7C 2OBGA 3A67L 4HK0B 3DBXA 4F15B 4U6TA 1WTGT 1IEBB 3RDTC 5DRZB 4TUJA 3CLFH 1OARH 4ETQA 4NO5A 2P46B 3WHXB 4CGTA 4MSWB 1G6RA 1N3NA 5CUSL 5E24E 4ISVA 1DQTA 1RVFH 3PGCA 3DOSA 4LVNC 2R0LL 3HNVH 2FR4B 5JA8B 2V2XB 4I3SH 2CKBH 4LCWE 4HIXH 3B2UC 3KLAB 2ERJC 4DQOH 3LB6D 2UVFA 2QHRL 4YHYC 4ZO8A 4AT6B 1SM3H 4X4ME 3QDGE 1MRDL 4LVHC 1A02N 2P43B 3WYRA 4JPIA 1NEZG 4PJ8B 2NXYD 4BFGA 4HIEA 5ITFA 3GJFH 2AGJH 5K9OA 3BP5B 3K4DA 2XYCA 2JB5H 4YGAB 4LSQH 1NCUA 3CMOH 1NAKL 1U8PA 1Q9WA 3KJ4C 1IM3A 1MCFA 4HF5L 3VA6A 4PJXE 3WNMA 3CU1A 4GT7A 5AEAA 3GBML 5E5MB 1VEMA 2OCFD 2I60H 3ZLQC 4M6MH 2NY5C 4OFKA 2HT4C 3GI9L 3VWKA 3LEXA 1YNTB 2DQTH 3OAYH 5DJ8A 2ATPA 5TDPB 1GOGA 1YNLL 5FA4B 5JHDE 2WZPD 4KKAD 4LMQI 5C0BE 2DI7A 1KJ2A 2EKSA 3FOMA 3MMEB 4ODUB 2P8LA 3ULVE 2LABA 1AQDB 3KPMB 5CJ5A 3O4LB 4GKNA 4WU5B 1QBMH 1RULH 3BP7B 1SBSH 5D1QD 4YHLL 2Y1VA 1CLOL 5GGUB 4Y4FC 1EHAA 4HKBA 2BVPB 1QLRA 3I75A 1MIEH 1KG0B 1RU9L 2DL9A 1IM3B 1F8TL 3R0MA 2H8PA 1S9YB 3HZYA 3QPXH 4LAQH 5E2UL 1U8KA 2NY7H 1SHMA 3UROR 3IJSB 1RU9H 2W9DL 3JWDC 3NZ8A 2X89D 4UQ2A 3EYVB 5MEPA 4WWKC 4QHMA 4ZUVA 1RZJC 1MLCB 4ONHA 3DUHA 3GSXB 3MRMA 3P4NB 1IARB 2IJ0C 2WBJD 3ARDB 2R2EA 5DC4B 4YHOL 5F9OL 1L0QA 4ZOCA 3IF1A 4L8CB 5CEYA 3WXVL 3TJHD 4YHOH 1EBPA 4HIXL 2UV3A 1AH1A 2YWZA 1MFEH 1X5FA 2FHBA 5E1HB 2HFFA 3O9WD 1S7RA 3MRHA 4F7MA 1MAMH 3CLEL 2Q8BL 3DI3B 1ES0B 1ZT7B 1JYNA 2VRAA 1AGCA 4XTRC 3TWCL 3Q6FA 3ULSB 5L2JA 1C7SA 1UYWH 1HKLL 5LCVH 5I2IB 3RY6A 2IANB 4LGRB 4UOW1 3QPQC 5C0DA 3ZDZF 5FGCE 4R97B 4RMTA 4AYFA 2ZPKL 3R1GH 2XA3A 3SGEI 5F89B 5DK3A 4P3CH 3QFJB 3UDWA 3V4VL 5BRZB 4GQ9L 3RZCB 3HNTH 5CEYB 1OT2A 2GAZA 4P46B 1CFTB 3W39A 4Z7UB 4H8WL 2ZCKL 5I17B 3HNSL 4E42A 3QULA 3FRUA 1SEQH 5T3XL 2LFGA 3NCCB 1OQXA 4FQ2H 4Z0XB 3H9SD 4DFHA 1E6JL 3NABL 3X11A 3HE6D 3C60D 3IVKA 4K8RC 4S1DD 5IUSA 4R26H 1RULL 3ARSA 4YHNB 3VFSA 3MZTA 1MCCA 2N1KA 2D7TL 4JDVB 3WFZA 3DVFA 2DQCL 3OJMB 5HGAA 1BF2A 2C3GA 2ZUYA 4HC1L 3QUZB 4JHBA 3VI4F 5L88L 1J8HA 5HI3D 4GSDH 4HIHA 1JHLH 4G42A 1AGDA 3LKOB 4M5ZH 1IFHL 2VLLA 1D6EB 4N1EA 4OJFL 3DUUA 3B3IB 5CWSA 1FG2A 2DLHA 3RZWA 3MRGB 1F6LL 5T5FH 1IFHH 1GJIA 2XY1A 1OCWL 1T03L 3L3JA 2IAND 5I16A 1A47A 4FQJL 2K1MA 2YA1A 4G9DB 4YFLF 1U8HA 4NOFA 4Y1AB 5TE7L 3TYGL 4LPUA 4NO3B 5C6WH 5D72H 4UV4L 4L3ED 1I8LA 3OR6A 1VFOA 3TA3C 1CGVA 1LNUA 2XKUA 3L3IB 3MLXH 4J4PA 4Z0BL 2JLLA 3BZ4A 1LK3H 3GMLA 5DD3H 1JNJA 1MQKH 5HHME 4GQ9H 3IDXL 4NNXA 5IOPB 1DQLL 5F7HA 4X7CC 4OFYA 4NFCA 4N8PA 3O6FC 4R0LA 4WUKL 2BNQE 1GOHA 1KJ3L 4OZFH 4PS4H 5DHYB 1NFKA 1CGWA 1B6DA 2A6JA 4PJ8D 3BO8B 3MGOB 5KAQG 3K8MA 4ZYKA 1V8HA 5K59F 1U42A 4LCUA 4NUGH 3ZL4L 3EAKA 3NFPA 1MPAH 1S9XA 4EQ3A 3MLZL 4YNYB 1T1YA 3RUGE 3LOWA 4FXGA 4Z7WA 3BRGC 3BPLC 3U7YH 2A6KB 3AREC 4GFTB 1NBZB 5KSBE 2GFBB 1SEQL 1DQDL 4MAYD 3HUJA 1GVIA 3D69B 2JJWA 2D0FA 1ZLWK 3I50H 5CD3B 4RGOH 4M6OL 3QUMH 4Q2ZA 5C0CD 2VDRH 4CMHB 4JO1L 4AH2B 3BO8A 2NLJA 3TF7C 1ITBB 3RDTB 1A4KA 1LEKA 3NIGF 1UJTA 3GGWA 4ELMA 3QCUH 4RGNC 3D1MC 3EYFA 3MREA 4N0UA 4M7LH 1UCBL 3MLXL 1H5BC 4GW5A 2ZOLA 5ANME 4TUJB 1LDSA 3MNVA 3W5MA 3G08A 4PJDB 5HHOE 1LO5A 2EDOA 3U4EB 1FFPB 3BGMB 4MA7L 3GBNH 3SE9H 1T2XA 5C0IA 3CMGA 1HHKB 3ARBA 1A6TA 3BRFA 4I48B 1DQQA 1TVDA 1V7NL 5D7IB 1ITCA 4NQTA 3MJ9A 1JTPA 5K59E 3P0YH 5CSGA 2R56H 1MCOH 3HG1B 4O02H 4R9HA 5L2KA 4E0RA 2E27L 5D8JL 4Y4HB 4KXZH 1LEKB 3O3DA 1XCQA 5IB4A 4B7LA 3T0ED 1CDCA 1WWWX 5ICXA 3PGDA 5FV1L 1X4ZA 3KDMA 3QO1B 3VXNA 2YD9A 1CD0A 5FCUH 5BXFA 1MSPA 1LO0H 4XXDA 4ZODA 5EH1A 3ZKXB 1W0VA 4TRPH 2JCCA 4RAUB 3IRZA 1DSFH 2VZOA 1QSEA 5KSAC 3QXWA 4Q6IB 5FKPB 1U92A 4GAJH 4RISH 1DZBA 5EU6E 4HS8H 1CLYH 2XQBH 4X8XA 4P3WA 4ODTH 3L5JA 1X5ZA 2VIRB 3GSQB 4LLMB 4MJ2A 4POYA 5DJYB 3QUXC 4PRAA 3DI2B 3RWFB 3T0EA 2V7NA 3UO1L 1TITA 1CXFA 1KJVA 3V0VA 1MREL 2FNBA 2VLME 4AEIL 1NJ9A 1U8NB 2XWBB 4MD5B 3ZKQD 2OI9C 4NPYB 4JRYB 4Z6AT 1GZQA 2WUCH 5EIVA 2O26U 3UTPD 3BPCA 1QYGH 3OKMA 1BMGA 1YPZE 1KCSH 5KS9A 1LO4L 2XN9D 4EN3A 3UTZB 2DM2A 4KRMB 1KLGA 1HILB 3PGFH 3VXQB 1WFNA 3HC3L 4N5ED 2HLFC 3UZVB 3VDCA 2AJVL 1CE6B 3GRWL 3VMOA 4YXKL 1QR1A 5B8CB 2FJGA 2G9HB 1H3GA 3R06B 4Y5YC 3T3MF 3N06B 5MEPB 2RJMA 4LEXL 2NXYB 2C1PB 1F11B 1L0XA 1FPTL 4F9PA 4APQD 3SCMD 2VDPL 4MA1C 4U6XB 4WFGD 4Z76B 1P4BH 3RX8A 4EBQL 3IDMB 5JO5A 3MCLH 1XGRB 5ACMA 2RR3A 5KS9B 4BQ9A 4M4RA 2X1XR 4XAKD 4Z77A 4ETQB 2NR6C 2PYED 2Y7QA 3UTZA 3IAGC 1CFSB 1S7VA 1A9BA 2ICES 3SPVA 2YMXH 1Z5LB 4HHAA 4WI6A 3WKML 4HBQA 3RY6C 4GRMA 1S7RB 4XPFH 2Y36H 2B1AH 5FK9B 4S11A 5C0CB 3CFBB 1JRHH 2HKHL 2Y36L 1GC1H 1LO3H 3EYUL 1BQUA 3WIHA 4S1RH 3ZKMD 1YN6A 4DUXA 3U79A 1LO0L 1N26A 4XBEL 3MJ8A 3NH7L 5JHDB 2IALA 4X9BA 5CIPH 3MV8B 5C07D 2R2CA 3ZT6A 3D39D 2MPAH 5J0BA 1DQML 3TBYB 1KCSL 1EEZA 4U1NB 1ZT1A 3KYKH 2VXVL 4L8SA 1NAML 4ZOAA 3WE6A 4HIIA 1NC2B 4XZUA 5HGGS 4OD1L 4OZ4B 5SWSB 4J4PD 2NX5A 1HE7A 3WL9A 5SX5K 3H3PH 4QHNA 3QG6A 2YXFA 4FXLA 2R0KH 3CZJA 3OXSA 5JHLH 3MXVL 2EDLA 3CDFA 3TZVA 3DXAB 3SOBH 2ICWJ 4RMSA 3OG6B 5GSVA 2V9TA 2GT9B 4E5XB 3U36A 1KB9K 2VC2L 1AP2B 1QBAA 1N6QH 4ODUA 5I73C 2DL2A 1LGVA 2W07A 3G6JF 1J8HB 4LU5L 3QXTA 1H0DA 3VWJD 3FZUC 4HS6A 3WKNA 1AFVH 1EZVY 4NRZA 1UQSB 3QNXB 4L3EB 4J7RA 1XZ0B 2W0PA 3AREA 5B3NA 5GGTH 1NMAL 1S5HB 5DR5H 1JWSA 4O51A 4MD4B 2M2DA 1Y0LB 3ROOA 5C0EA 1UM5H 4TVPH 8CGTA 3U0WL 5C0AE 4ZUTB 1EMTL 3E2HC 3DXAA 1UM5L 3PL6A 3EOYG 3LMJL 4C56D 4MNGB 3I3BA 1NAMB 3ARXA 4OI8A 1U36A 1OSZA 4UT9L 4NQCE 5IOPA 4E9LA 4ZS6C 1DCLA 1CN4A 1J0ZA 1LHZA 3B9AA 3VXUE 4JKMA 2DYPA 4DN4L 1CFQB 3R1GL 5ADOH 1S5HA 2YR3A 1A1MA 4QXUL 3K4AA 4PJFE 1IBGL 1PZ5B 1T83C 2BSRB 1J7VR 4NZJA 2J8UF 4MMXC 1A3RH 4OSUL 3BGFB 4RGMB 4JREB 5IMLA 4PJGE 2VAAA 5J6HB 1BGXL 4XNQA 3RDTD 2ZNWA 4X98B 1Z0NA 4V2CB 1G7JA 2B1HL 4KKCC 5FYKE 3T4AA 2IGFH 3VXOB 4J6RL 4X4ZA 4G6KH 4JRXE 2P24B 3BZDA 4YEFA 1IJ9A 3D18A 2ZCLH 3H7BA 1T7ZA 2HKFH 5HVHC 4X99A 3B2UD 1D5MA 4HT1L 4G6KL 1I75A 3JBG7 3OZ9H 5E2WH 2HJKB 1B3JA 5F3BB 1QYGL 1KJ2H 3BKCH 1PEWA 3TA3B 3P4MA 3KHQA 1XR8B 4KK9C 4ELMB 1S5IL 5TH2B 5EIQA 1HH6A 1QRNE 1EIBA 2NY3D 4JFEE 4IMKA 2E9IA 5JW5B 4TQEH 3V2AR 3O11A 2C5DC 3TO2A 2KQMA 5DEGA 5TE4L 4P9ML 4PD4J 4P46A 1J1PL 3BYTA 1V3MA 2E7BA 2A2QT 1EDQA 5I17A 4WFED 2YZ8A 3NIDF 3U0WH 4MQXC 3S35X 1LILA 3PP4L 3BN9C 4PJBF 2PXYD 1IE5A 3ARGB 3L9RA 1MCNA 4K3DH 4RFOH 3HE6A 4U7KA 1IAOB 2HYMA 2ED7A 1BQHG 3FQUB 3K46A 4Y2DD 2ZCHL 4PP1C 3EZ8A 5HGAB 2JK5A 4QRUA 1G7PB 3L3IA 1AXTH 2R23B 2OSLA 1VDGA 1NMCB 5MEOA 3PUCA 3REWA 2WW8A 1RUAH 1MIML 3PHQA 3GMQA 1Q0YL 3R0NA 4O58L 4AMKH 5FECA 1JPFB 4Y8DC 3RGVB 1ZHKB 1XGUA 3DVIA 3RWFA 1R3HB 4NQEE 1CDBA 3Q6GH 1TZHA 2XN9B 3QQ3A 3C6SB 5DYOA 4UQ3B 4FTVE 3DYOA 5TGBB 2FX9H 1HINL 4L9DA 2AK4D 1IC7H 1K4DA 3EO1B 4PTTA 4P2OD 2I26N 1JK8A 1C5CH 3KPOB 3QT2A 3NFPB 5EU3B 4UV7L 4LOUD 4D9RD 3F7PC 3QUKA 5KSVB 1KIPB 4Z7WE 3C60B 4JG1H 1N2RB 1TJIL 2CR3A 5IHUL 2C3WA 5DLMH 2VR4A 3E3QC 3DTXA 1MLBB 5DHXB 1T1WB 1FYTE 4NJ9L 4EN3C 3H9HA 5SWSD 4UTAH 2CUHA 2J8HA 3X14A 1F4YL 1SEBB 5H94B 5I30H 3QUYD 3OAUH 2HJLB 2BNQA 4EI5A 3HC4H 4M61B 3RZCC 3S97C 2GJZA 2EH7L 3ORJA 1DVFB 4K3DL 3UPRA 3TPUA 4UQ3A 3JWNC 4BUGA 5T3XD 2NXZD 4WO4B 4JPKH 5D1XB 3MRKB 2DQIH 4X9GA 1T4KA 2N7AA 5D96B 1F90L 4MXWL 5IEKA 1B4JL 4XT1C 1FSKC 3BT2L 1A6VL 3AY4C 4PJCE 2R2HA 3L5WA 4S10A 4A6YL 3JZ7A 3LRSB 5D2LF 3U4EA 4Q7DA 2ILLA 1ZHLA 5DO2C 2QQNH 3WD5H 4QRPD 1DQQB 4I48A 5D7IA 2V2WB 2EIZB 4AEEA 3D2UB 3WFBH 4BZ1L 4CW1A 3CFBA 2DYPD 5IW1A 5IR1A 4QRSB 4JFQA 1OAUL 4JFHE 4LCIH 3QZWA 5DXWA 1EFXB 3HE7B 2ATPB 1HH9A 5TDPA 5J6GA 1R0AH 5KSAA 4K8RD 4S1DC 1JTTA 2YUVA 3QXUA 3NCBB 2CMRH 3L6FB 3GZKA 2HH0H 2E6JA 4UV7H 1AQDA 2CR6A 4NRXA 2YEZA 1U3ZA 2PTVA 2XA8L 3DGGB 4QO1A 3J7HA 2R8SH 3DXAD 3OPZH 4B50A 4C4KO 3QWOB 1GHFH 3MNWA 4LNRB 4PG9A 3JV4A 2XA8H 4RAVA 4HJJH 1A6TB 4Y5XC 3MRCA 3BVNA 5KANI 2A6DA 5B39G 1OTSC 5BVPH 2ADFL 4M48H 4OKVB 4I0KA 3RWCA 4I77L 5D1XD 5JPMB 5GGVH 4YO0A 1AJ7L 1CICA 3HC3H 4LFHG 3QZWB 1MHEB 2MCPL 1NJ9B 4MGXA 4CN6A 2IBZY 5EBWB 1NAKH 2D31B 5DLML 1LE5A 2R1WA 4GBXD 3LN4A 4M1CD 1IRAY 4J8RB 1ADQA 2Q3ZA 1K5NA 1RMFH 1A6ZA 4LVOC 4Y2DB 1B4JH 4YGVA 4UBDD 3QQ4A 1UKQA 4KROC 1G0DA 2D03L 3FO1B 2PW2A 5H2BB 4Q6IA 3QNXA 4L3EA 5FKPA 4X83A 1BD2B 4R4FH 3ZO0A 3QEQD 4BSWA 5F9WC 2B2XH 5DRXA 2VR5A 3NZHH 1ZSDB 4PJ8C 4X0KB 3VG0L 5DK2B 3DARA 1OAQH 3JTSB 1FZJB 2GKIA 1NKRA 3TBWB 1KJVB 4XPAL 4ODWB 1DL7H 4DEPB 3C8HA 2FBJL 5DDHA 3MRIA 1CZ8H 1MFCH 3BDYH 5T1MB 4ZUWB 3G6DL 3DSFL 3IXTA 4TUKL 2DQHL 2YKLH 3IJHB 3MRPA 1LK3L 1T20A 4IOSD 3NAAH 4CUCA 1Q0XL 4PRIE 5I1KL 3F7RA 5I8CB 5JQHC 4LAQL 2IG2H 4IOIA 4NO5B 4I3RH 5HPMB 3SKOB 2Z8WC 4KTEH 3MFFB 5BCAA 1CFTA 1GHFL 1MFNA 1LO2L 3OB0K 2GTWB 5H2BA 2IG2L 2MQCA 4LKCA 3HPLB 2V2XA 2QHRH 3Q0HA 2ORBL 3U48A 4CDGC 4F7CB 4Z7NE 3RL1A 3MLYL 3MGTA 4NRYB 4RNRB 2ZG3A 3RVTD 3V4UH 2DWDA 4X6DF 3PDDA 3IDJB 1TQCC 2EEBA 1JHKL 4FQLL 1F11A 4ZFOB 4OZIE 3U4BH 3UC0L 5GXBB 1PY9A 1S78C 4GUPB 4CVZA 1I3RA 1YY8A 5IHBA 1Q8MA 3MV9E 5D7LA 3IETB 2IALB 2NY6B 1BVLB 2PXYA 4GKZA 3TN0A 5BS0A 3LN5B 3RNKB 2P7TB 4WFFD 1S7XA 4QCIA 3EFFA 3UXFA 3GNMH 1MF2H 4MCYB 3VCLA 4UNTA 3VXRD 5BVPL 3MGAA 4MS8C 1RZJH 1A9BB 3SPVB 2GJ6E 4N90D 4HIIB 1MQ8A 1PQZA 1W0WA 1JGUH 4GH7B 4MZ3A 1R5WA 4X6DA 4LU5H 2CO7B 2ZPKH 1A2YB 2EC8A 1E0OB 4XP1H 4IMKC 4QF1B 1FL3A 3ARUA 3QUYA 4XWGH 1Q9KB 2HRLA 4Y0GA 5F97E 1OVZA 3CU7A 1YEFH 2ATKA 5SWZD 1JN6A 1GGYA 5FA3B 2XZZA 2ZP0T 2UWEA 1K8DA 3QFDB 1JGEA 5FF6A 4PRIB 4U7MA 3H42L 1E6OH 2DQGL 4K2UL 4HS6B 4FQXC 4HX1B 5BV7C 4L4TB 1BEYL 3DV4A 3BJ91 4Z7VE 3VFPB 1MJ8H 4F7PA 3BISA 2NZ9C 4PJEF 2ENYA 1I7TA 2KH2B 3OB8A 3U7WL 3WJLC 3VXUB 1FNGA 1I4FA 1NCWH 1JWSB 3KLDA 3VE0A 2L7UA 4AG4H 3MRDA 4IOFC 4Y5YB 3OQ3B 3ZYOA 4B5EA 3PWNB 4KVCL 1A0QH 32C2A 1ACYL 5C6TH 4LLYB 4P5TD 1ZA3A 3QAZB 1LEIB 4XHQA 3OKNA 2ATKB 1FH5L 1VKXB 3SO3C 2VDPH 1MFDH 4L4VD 2EDYA 3IF1B 4L8CA 4JO3H 2DAVA 4QHUA 3OMZA 5FF6B 1CFNB 5IVOA 5BJTA 2FIKB 5E5RB 2QQLL 2VLKE 1EAPB 1P84J 5CIPB 2VLKA 2EICA 5ESQB 1FC1A 1JHKH 1JPSH 4DKAA 2XKSA 5J56B 5E5UB 1QSFA 5L0QC 4M6AA 4YIQB 1D7FA 4UIMB 2Q6WB 3GSNB 5HDQL 3P30H 2VZVA 3MRDB 4PRPE 4EDWH 3MJ9L 4PR5A 2BVOA 1ZS8B 1VSCA 4K23H 4H25A 2I60L 5F9DC 5KSVA 1JZ6A 5CS7A 1CBVL 2HP4A 1GGBH 4I2XA 4PLKC 3ULUC 4YZFE 4UMGA 3RVVC 4Z7UA 5C0IB 1IAIM 2E8ZA 1Q9OB 5E99L 3HUJF 4PJAE 5GGRB 4QY8B 3KPQA 1QBLH 4JQIH 1MJJA 5TE4H 2IADA 4DGVH 2BDNL 5L2KB 1YUHB 5AD0A 4HG4K 3SKUD 4ZFZB 3HI1B 1T1XB 4DGVL 3UMTA 4FFYH 3WXWH 1NDGB 1FH5H 3GK8H 2BY1A 2AJUL 3QR2A 5I1JH 3D0VB 1TZIA 1ETZA 4I3SL 2VAAB 3RKDD 3TH3T 1HOCB 5J6HA 3LPWA 2C4FT 4HIHB 3DWTA 3DRTB 3GK8L 5EU6A 4PYGA 3L1OH 4C54A 4XNZC 3IFLL 1FVDB 4G9FA 2VJXA 4PLOB 4WUUD 4KMTH 3O0RH 3O4OC 2NTSP 3D2UA 3IDUA 5GS1A 5FAAA 1I7RB 4M1DH 1ZT4B 3THMH 1OAXL 3TYGH 5F6HI 1JIBA 4FZ8L 4OLWL 2C7UB 2D9CA 4OLEA 3ARDD 3G04B 2Q8BH 4EDWL 3MBXL 3TIEB 3IRPX 3X12B 1GZQB 3BSZH 3P2TA 4YDIH 3T08A 3QCVH 1FN4A 1VFAB 2CIKB 5IVXB 2MQ0A 4PRHE 3KPSD 4NYLB 4YPGA 5MEOB 2H1PH 3IS1X 4NBZB 2E7MA 1C16B 1M7DB 3VJ6B 3OKLA 4D8PB 4TSBL 5K9KB 4QRRB 1GRWA 4UT9H 3MTRA 1LE9A 1CDJA 4GG6F 1QO3A 3P30L 3L7EB 1MJUH 1ED3B 4U7SA 1NCDH 4ZXBD 3W9DA 4U1GC 4Y4KB 5CBAA 2B7DT 5ECJE 1I7RA 4ODBD 2DTSA 4TRPL 4NDMB 1ZANH 4IRZL 5L2KE 1HSBA 3SCMA 1GIGL 5T1LA 4JFOA 2Q20A 4ODHL 5AAMA 3IU3B 3MUGA 4A6YA 3LS4H 4HAFA 1HCFX 1JHTA 3RQ3A 3AXLB 1IILE 1NGWA 1G7PA 3QCTL 4F37K 1PAMA 5BZWB 2D4DA 1G6RB 3JWOC 5D6CB 4P99A 5K9KA 2W60A 1YNKH 1AGEA 3V5DA 2WV3A 4JLRA 4ZUSB 3L7EA 3QO0A 3HC0A 1WUNT 1SEBA 4M5ZL 4QNPF 2ZCLL 4L3AA 5GS0L 4NZUL 1NLBH 4PG2C 2NYYD 3HG1E 3EYOA 4WI7A 2ZUTA 2VQ1B 3O8XB 3OJDA 2OK0H 5DURD 3J8F7 1DVFA 1CWVA 3GMOB 2OMNA 1UCBH 2R2BB 5SWZB 3RGHA 5T3ZE 3H42H 4NNPL 2J4WL 4WO4A 4O2CB 3FN9A 5ENWB 1KIPA 1XMWA 3QNYA 3AXLA 2FCBA 1MHHB 3STZB 1BIHA 1ZE3C 1FNSH 1XIWD 1MLBA 1MRCL 3QDJD 2DLFH 3IDNB 5J7CC 1U3JA 3MX0A 1EO8H 3QDME 3H9HB 3IS0X 3I9GH 1RUML 2NX5B 4HJGB 1XAUA 5FHBL 3R8QA 1IC5L 2GI7A 4OM0H 5A40E 4QXUH 1T0NB 1YEGH 3WO4B 4F7CA 1QEWB 2W59A 2A6IB 4L3CA 1MOEA 1CDGA 1QA9A 3P11L 4P3CL 4QRSA 1MWAL 1VFBB 4OZFG 1UXWB 5HYJA 43CAB 5IMOA 3MUZ1 5FYKL 3BH8B 5IW6B 3AM8A 4K7PY 1OAZH 1BHGA 4LSSH 5CZXC 5INDB 2ADFH 4GG6B 3VGBA 4HWZB 5TFSL 2P5EA 3ISWA 3UTTD 2B1HH 4HK0A 1N5AB 4MQSB 4HXAH 3H9YA 3M1BB 5BOZG 5I66A 1AJ7H 1NDMA 1BECA 1TTGA 2IMMA 1HXYA 3C8KA 2BZDA 4LKXB 2XV6B 1NBVH 1XZ0A 4MJIB 3N1GC 3RWGA 4ONFH 5F21B 5HYJD 3LY6A 5D2NE 3RVUD 5HVFB 4PRAB 2JJTA 4JFDA 4AEIH 3BN9D 4OV5B 2D0HA 4HG4J 1A7NL 1E4XH 3PABB 4N0FA 4XVJH 1I3GH 4PRNB 1KT2B 3MLTB 3FFCB 3AUVA 1TQCB 3KWWB 1MLCA 3SDAD 2XWBA 4R4FL 3W82A 4ZQKB 1UH2A 1F13A 5DQJB 3S7GA 2DJ4A 5ESAA 2YHGA 3LEVL 4PJ8A 4CNIA 1WF5A 4Y2DA 5IGXL 5ISZB 1Z9MA 3WHE0 5I66B 3PWPE 2OS7A 4NKDB 3FAWA 3G5YB 1FYTA 3O6FB 4K3JH 1FAIL 2FEEL 2R0WL 5I8KH 2VLRB 1AD9B 1KSRA 1RI8A 2CO6B 4PBWD 1I7TB 5L8JB 1LP9F 1RJLB 1YEEH 4TSCH 5HDBF 2BJMH 5F7DB 5D70H 2EDFA 1Y6KR 1YEGL 4WHDA 1L7TL 2C4FU 9CGTA 3DX6A 3O41B 5DEFB 1G9EA 43C9A 32C2B 1P9MA 1JPTL 3CH1A 3GB7B 3U6RA 1DQLH 2GQHA 3LKNA 4O02L 5IMLB 3WS6A 4OB5L 3O3BA 5AYUL 1NBYB 5DFVC 3VGGA 5L6YL 3NACH 2R9HD 2XWTB 4OGYL 2XPGB 1CG9B 5IROC 4EXKA 4HUVB 1RUQH 1QFWH 1VCAA 1UXSA 1U8JB 2Y7QB 2Y72A 1XEDA 5AYUH 4E41D 1KLFA 1W72H 2X4SB 1QPPA 4KY1L 3EGSB 4NHUA 3I6LE 3BKJH 3O6FA 3MRBA 2VR9A 1KLUB 1JRHL 5GGTA 3U1SH 5KSBF 4KWUA 1OM3H 5C70A 1A5FH 2YWYA 2ZUSA 5FV2A 1X5GA 2VXSL 4F7TA 5DK2A 3RX5A 3QIWA 5J1AA 3WFBL 5IF0A 5KANG 1XF5B 3WNPA 2IPUK 3WCYA 4UQ2B 3SQOH 2Q76A 4JDVA 3ARBD 3LPGA 1C12B 1A3LL 4WTWA 1YC7A 4FFWD 3NN8B 4PJGA 2HTKD 1WV7T 1WWAX 4K7PL 4AZ8A 3HI6H 4LRNH 1VB9A 5D7IF 1X5YA 2ITDB 4TULH 4WHCA 4KI5F 1UJ3B 1M7IB 1DQJB 4M3JA 5DO2D 1YEHL 5E2TL 1ND0B 2X4SA 2VMFA 5TQ0H 3VD4A 4ACPA 2I07B 3DVNA 3RP1A 1W0WB 4O4YH 5ADPL 3RTQC 2WLZA 1KB5L 2G75B 1T04B 2APWA 1ES0A 2O5YH 1L7IH 4XMLL 5E2UH 4G7YH 3CH8A 4I77H 1AGBB 2DD8L 3AAZA 4PJHB 4OLUH 2X70B 2VXTL 4PJIE 1JBJA 3MNZA 2A74B 4X6FA 1EHNA 3ME0A 3K2MC 3CXHK 2P5ED 5CSZB 2XTJD 4AQOA 1ETZB 3W0WE 3GMLB 5JW4N 2R23A 4OB5H 1K8DB 1W72B 1ZLVK 4DCQB 3F12B 3ALWA 1IGCH 4MJ4A 1I1AD 3VI3F 1S9KC 4HX1A 1FO0B 1P4BL 2HAZA 2E7HA 4PJ7A 1P6AB 4FP8H 4KQ3H 5KVFL 3O6LL 1PW3A 1CQKA 3MA7A 3O2DA 5IB3B 5T1DH 2HFGL 2HN7A 3O6LH 2KPNA 2J8UA 2NCMA 4JY6B 4U1MB 4XWOC 1R0AL 1U8QA 1FL3B 1BJ1H 2N4IA 4DK6A 3BH9A 1X3DA 3ZSSA 1IGJB 2X4QB 1JWMA 1M6OA 2R56L 3PL6C 4KI5C 4ALAL 1GAFL 2A74A 4X6FB 4HV8B 2CLRB 4HWEH 3MRFB 1RK0B 3MLUH 2ADGB 1XGTB 4NYLA 2YSSB 3MJ9H 3NH7H 3RVXD 1DVFD 3PWLB 4IHOA 3X3GL 5DA0B 1M71A 1EAPA 1MCIA 1I85C 1T21B 5EOQL 4P2RA 3MODL 1SM3L 4JFXB 4GXUN 4EQ2A 2WWMC 4C56A 3WIFA 2HJLA 2P4AB 4JZJC 4FQQA 1ZHBA 5D1ZA 4OF0A 2Y5TB 3MLWL 1NCBL 4TYUA 5GZNC 3UPRB 4POUB 1BWWA 3G6AB 5IQ9A 4JKPL 5D71H 1CXEA 4I0PA 3OR6B 1T7VA 2JB6B 4XAKE 2Z8SA 4JY4A 1INEL 4YBHA 2DMCA 2YK1L 4XNQB 3D25A 1I8IA 4ZTOH 3RWEB 2AQ3A 4HGWB 3CVIH 2WP3O 2ZNXA 1K2DA 1HHKA 4IDJL 3DO3A 3RU8H 4R6UA 3QISA 2BHZA 3ZDXE 5IFAL 3L5IA 4JLRB 1URLA 3VXSE 2IPTL 4R3SA 4XNUL 1UC6A 2V2WA 4IDJH 4M7ZC 5TE6L 5EZJA 1A9EA 5DJZB 4S0SD 2H9GA 2A83A 1KYOJ 4U05A 1A7QH 2BMKA 1MJJB 5IB5A 1D9KB 2XQYG 1E27B 1XGPA 2VQ1A 2R29H 5FFLA 1XR9A 2X4TA 3BQUA 4MAUL 1ZS8A 4N8VB 3KPSA 4HBCH 3OG4B 1ZGLA 4GW4B 3KR3H 4JFYA 3S34H 3SGJC 3DBXB 4KJPD 3TNNB 2E7CA 1U91B 3I02A 3OAUL 2ERJB 2HWZL 1CFVL 3F7QA 1ZVSA 4PRDA 3O2WH 1K85A 1IT9L 3HMWL 4PTUA 4UZGA 3T1FB 4PGDA 2XIDA 1NLDL 3OWEA 4OAWB 6CGTA 4E41A 1JZ7A 3VU2A 4R3SB 4WW2C 5J3HD 4G80B 3BWAB 2JTDA 1XF2A 3SDYL 4EI6A 2CK0H 2W91A 2AERT 4S0TD 4X8JB 4Q6YA 1JF1B 4R7DB 1OD9A 1CR9L 4Q9RH 3G04A 3L3HA 4U6VH 3CSYA 2X5PA 1S3KH 1AXTL 2OQJB 3PNWA 3WEXA 4TOYH 4YX2H 2JJSC 2Z8RA 2VITB 4QRUB 1RHHB 1OWRM 5IV2A 5ITFB 2P5EB 3RWDB 1X4XA 1VESA 3LKPB 4WI2A 3DX8A 3MYZA 2PYEA 1A7PL 1ZV5A 4DTGH 1ZVSB 4PRDB 2B4CH 3SGDI 3T1FA 2BNRE 3L3DB 5I76B 4XC1L 5L7XL 4LASL 1K3IA 5DRXB 3V79C 1JPSL 1A3LH 1IGYA 4Z5RA 1P1ZA 1AR2A 4D0DA 4Y89A 1A4JA 3T8XB 1AE6L 3QUXB 4HGMA 3RTQA 3C5SB 5TGBA 4PJFB 4Y4HA 4Z9KB 5GIRB 4O5LH 1DLFH 4UAOB 4XMKL 4ONGH 5CGMA 4PJDE 4M6NH 3PF2A 3SDDA 2V6HA 2NTFB 5IWLA 1T20B 4DZ8B 1X5JA 6FABL 1RHHA 3AS3A 1DN2A 1OHQA 4TUOA 5C08E 4QRRA 2CLVA 3U0PA 1UB5B 2AEIT 1LEGA 2CXGA 5DJCB 1KG0A 1PGRB 2I9TB 4OCSL 5FK9A 5E99H 5B39B 1NCWL 5ID1A 4K7FA 1H3TA 4YH6A 3MOBL 2DS4A 5EWIL 1D9KC 1RUKH 5MENB 5I1CH 2YRZA 3OR7B 1TCMA 5GISH 2P5WA 5INCB 5BV7L 3TPUB 3QZWG 5EWIH 1F90H 1HSBB 2CIIB 4MXWH 3ARVA 4JQVC 3GSXA 1CFVH 4JFOB 4NO0A 3SGKA 2JF1A 4OJFH 2DDQL 3RL2A 1T7WA 3O3AB 1CDIA 1J8KA 1NGWB 4ZFOL 1G1YA 3ULVC 3QNYB 5AZEH 4HUVA 3LKRB 4JM4L 2XZCH 3HTLX 1VEOA 1T6VN 2D7QA 3KLSA 4WWKA 1FV1A 4KPHL 2CRZA 1U3HA 4OFDA 1U8LA 3BQUD 2Z92B 1KLUA 2V5YA 1IAMA 4KPHH 1D3CA 1ZLVH 1RZGB 2AXGB 2FJGB 2PKDA 1BOGA 2BVTA 1N5YH 3FMGH 4LHQB 1PG7L 3KGRA 4KKLD 5F72S 1G6RH 4Y4KD 2HKHH 4HJ0D 5ISZD 2BHUA 3VFWB 5T33H 3MV11 2B4CL 1NKOA 1NGPL 1OTTD 2VH5H 3C2SA 4FQIL 2O61B 2DQTL 3W9EA 3OZ9L 4NRZB 3BP4A 3MACL 5ACZA 1PG7W 5F96L 4Z77B 1KCUH 5KOVC 3VDAA 2AJYH 4D3CH 4YQXH 4M9OA 3F7VB 5F3HA 3MRCB 4HQQH 4OF7A 1DBJH 3T3ME 1IGIL 5B3JE 4LFHD 1VFUA 5C0EB 5SX4H 1IL1A 1G7QA 2R1XA 1RZGA 4EKXA 4OCWL 3GJEA 4P2RD 1TJHL 4KGJA 4HT1H 1BIIA 2NY1D 3RUGB 3S3SA 3TGXA 4XVSL 2ITCA 3CUPA 1TVHB 3P4LA 5INDA 4KK5C 3GSOA 1EH9A 1H8SA 4KKNA 4JRXD 3KXFB 1NDMB 2L4OA 3TVMC 4BELD 3PWVA 3P4OB 2XZCL 2VLLB 1P9MC 3MOBH 1FL6A 1N4XH 3O2VL 3PJSB 5EFIB 4NP4L 2DTML 2F9BT 1IAIL 4GAFB 3HFMH 1HHGA 3GHBL 1OGTA 4MAUH 5KVEL 1J0HA 1F4XH 4NWTL 3X3FH 3SBWA 4FZ8H 4LVNB 5I16B 3IJSA 5E56A 4TSAH 4MX7A 1QNZH 5DJDB 1YN7A 4P2QB 4AIZA 2JCCF 4CU7A 3L3GB 5AZEL 1H3UA 4HH8A 3GB7A 3U6RB 3U36B 3V6ZA 3QIUC 1N0XL 2DQEH 2EDNA 2R2EB 3ULVL 2QADD 1U9KA 3BPLB 4AG4L 1AO7A 1OY3B 1MRDH 1N0XH 2DQEL 3KXFA 5MP6H 5EA0H 2BVQB 4MJIE 4M7LT 5IVZB 1MCOL 3UBXI 4AEHH 3IU4H 2GTWA 1M71B 3QHTC 4JG0L 5EOCJ 1A6WL 4LKCB 1CLZL 4LSVL 4NHUB 4OLVH 4C57C 1BFTA 4HQQL 3OPZL 3MRHB 4F7MB 1DBMH 4QRTA 2HJKA 2BY2A 3L95B 3O41A 3ZE0F 4WEMB 3MOAH 5F6IC 5IF0B 2H6PB 5KS9F 1LVEA 2ICEA 4G6AD 4GUPA 4CVZB 2GW5A 2PO6D 4WHYH 5K33A 2AK4B 1FO0H 3CD4A 1JYWA 1WIUA 3D3VE 1NMBH 2F5BH 5B4MC 4BM7A 3NFSH 5LBSH 4YBQC 1PDKA 4L4TE 3O2DL 4DAGH 2LU7A 3DURA 4M7JL 4JHAL 3UYOD 3O2DH 1ND0A 4DAGL 1AQKH 1TETH 2NZIA 5CP3H 4F7TB 4P2OA 4EI5C 1Z3GL 1YEKL 4FQPA 3TJEL 1JNLL 4UTBH 1XR9B 3REVB 1KN4H 4JVWA 1UWGL 2ICEB 4RX4A 1JN6B 3KNBA 3KYMB 2X4UB 4ODSH 1CGXA 1CCZA 1UKTA 2ICWI 2L0DA 4QGTA 4N90E 5EIIA 1IAIH 3QFDA 2CDEB 4FABH 2XZQL 4CKVX 1RFDL 4BZ1H 2LV4A 1WWBX 3MR9A 2IAMD 3I6GB 3NGBC 4MA8H 1K9TA 4FQXA 1KEGL 2EH8L 3GMNA 4OCXH 4JE4B 2VN7A 3GMQB 4G9FE 1VPOH 1FNHA 2H3NB 4AL8H 4IRSD 5LWYL 1HEZB 5F7LB 1OPGL 2C26A 4OKDA 3P11H 1IVLA 1HIMH 1F3DH 3ZKXC 1UH3A 5FCSH 3KPNA 5DQ9B 4WNQA 3SDAC 4LLYA 5DUBA 4Q9QH 4OQTH 3OKNB 4NO3A 5GJSH 3C60A 4XVUD 1FHGA 4HH9B 4QRPE 3V6OA 5IT2H 2CDEA 1J0YA 4PY7A 1XGTA 2AS5M 3TO2B 4J3VA 4OGXL 4IDLA 5GZOC 1FO0A 2IF7A 4P4KC 3X14B 2W60B 2H32B 1PG7X 3MLVL 5DD5L 4AEFA 2R8SL 3BSZL 4LLMA 3TO4C 4HCRH 2ZJSH 3EW3B 4YLQT 1N64L 4WENB 2HN7B 2HKFL 3ZHLA 4UIMA 2Q6WA 4APQA 5TQ2L 4DUVA 3BXNA 1DEEB 3P40A 5A2JH 4PR5B 3GMOA 1HKLH 2G5RA 3ARTA 1EHLH 3BPCB 3BPOC 2WBJC 4OZHA 1OSPL 2VLRD 4MA1B 2VZSA 1OLLA 2ZG1A 5CBEA 1MFBH 2AKRB 2E9JA 1IC4H 4I2XB 5JR1H 3STZA 1XIWA 1ZVHA 2RBLA 5T1KD 3HUJB 5GGQH 3RX7A 2D7TH 1ZGLM 3FT4A 1GIGH 1KENL 2YD2A 3O9WC 1TVBB 1H9VA 2H26A 4ZFFB 1PEZA 2VDNL 1QEWA 4LLWA 2DM3A 3I3EA 1OF2B 5EC1A 4JRXB 1MCPH 3OR7A 3HMWH 1C7TA 4LQFL 4H20H 4RCAA 1HHHB 1IGTA 4Y19D 1RSFA 4HKZA 4G5ZH 1QKZH 1T22A 4I0PD 5IVXE 4HK3N 3BP6A 3H9SB 4K71B 4PRHB 5E8EA 3JWDL 3CFKB 1NCAL 1XGRA 4RWYH 3G6DH 2QR0A 3BWUC 3BD5A 2HA1A 5F88B 3WJJC 2HJFA 3QNZB 4Q9RL 2OK0L 3DTXB 2UWEF 3RPIB 4RWYL 3D39E 2XN9E 4J3OC 1VACA 4MMZC 4B53A 1EXUB 1VADB 2I25N 3BIAX 5E5MA 5FGSA 4YXLL 3V0WH 3S3JA 1XF2B 5IB5B 2B0SH 2VQUA 1IKNC 1WAAE 2Y23A 5DTFA 1JYXA 1P4LA 4RRPG 5D7JA 2A38A 4XCNB 4NWUH 4L4JA 2F5AL 2H2SD 5EA0L 2C4XA 3I9GL 3N0PB 1PVHA 3TO4B 3ZTNL 4GRLA 5HSFA 1IAII 1P7QD 4KDTC 2X7LB 4JG1L 1I9RH 4X80L 3WFEL 3ZKSD 3S98A 1M05A 3K8KA 1N64H 2NY4D 4GOSA 3WE6B 4YHML 5JZ7D 2F58H 4C55A 3B43A 4AM0B 3VD3A 3KPPB 4P5KB 2C3HA 2DIJA 4GRLC 3QA3A 1L7IL 1EFQA 1EXUA 1MF2L 2GJ6A 3FOLB 3W9DB 3KXFD 4MDIB 1WZKA 5IBUB 5HY9B 1KV3A 2AXHA 4Y5VA 3UTSA 2FBOJ 4Z7VF 1RURL 1KXTB 2J8UE 4HXBH 4OZFB 1DTUA 2XZAL 3BMVA 5IQ7L 2NNAB 1JFQH 5CJ8A 1RQ5A 2VXQL 2W9DH 3P0VH 3L3HB 4L4VE 3T2NL 4G5ZL 5ETUB 4HAGA 4JO1H 3MLZH 3K0WA 4XP9L 3P0VL 2Q8AH 4IOIB 5DMGC 4BH8B 1RUPL 1AQKL 1Z9SA 1NBQA 3LHPH 1E4KC 4QTHB 2E6QA 2VDNH 1DQDH 1DEDA 4LP4A 2J5LB 5JORA 3T77A 3RPKA 5AG8A 1G1CA 5FYJL 5EORH 4BH7B 1HQRA 3DSNA 4NN7C 3F6IA 4FMKA 4PJ7E 4WHYG 1JI1A 4UIKH 4QTIH 3TT1L 1S7UB 3VXUD 4JKLA 4XHJC 4LSDA 1I3VA 5LG1A 3OJDB 1KB5A 2P5WB 5INCA 5D5ME 2YMXL 4ELME 1BX2A 5FM5O 3VWJB 3WKMH 3PL6B 2QQKH 4O2CA 5DSCB 3T2PA 1AKJD 5F9AC 4OLWH 4DVRH 4MNQD 5EU6D 5ALCL 3RWJA 2WP3T 3FFDB 3RIAF 3ULUL 2F8OA 2MNUA 4TUOB 2BHYA 3QQ4B 5GS0C 3NTCL 2HWZH 2BVQA 2DQFB 1DQJA 1JPTH 4N0RA 1P69B 3NVQA 1UVQB 4GLRI 1UWXK 5JMRA 2DYPB 1H15A 2WMPA 1KJMA 2W65B 3TZVD 4K7FB 2WANA 3KJ6H 3MXWH 4U3CA 2WIMA 1UZ8B 4WTZA 1QFPA 3RWHA 5HYJB 3IVKB 5DHVH 4HKJA 5GRZA 5E6IB 3NA4A 4PJ9B 3VFUA 5KW9H 4HMCA 1U93B 3QUZC 3VWJA 2NY0B 4K3EH 5B21A 1PD6A 4Z8FL 2MCG1 2OL3A 2NY5H 2IPKB 3UPCA 2ICWB 3MROA 3CFJB 1CGTA 1E4WL 2V5TA 4K23L 4KK6D 1EEZB 5ITBH 3LHPL 3OAZK 4LAJH 4X6BB 4KJQC 2B39A 3NGBB 2Z91A 5E8NA 2VDQL 3V6OC 3QWRA 4XZUB 3F7VA 1GPOH 1YYLH 3BAEL 1A7NH 1E4XL 1HYRC 3DJ9A 5FGBA 3BZFA 1S7TB 5J3HC 5DT1L 1OT1A 4KVNL 3K7UA 1U8MB 3OF6A 5KG9B 4YDVA 1C08B 1EJOH 1MCWW 3B9KB 2VOTA 3GJEB 4LPTA 1MFBL 1FE8L 4GG8B 3PIQA 5E9DB 4JRYE 2P8LB 2W0LA 3EYQD 4XVTL 5DQJA 2UZIL 3KPMA 3MV7E 3K8LA 2OTPA 1RHFA 2ID5A 5DEGB 3LN5A 3B5GA 1MIEL 5T1KB 1FPTH 5ACZB 1FYTB 4G3YH 1Q1JL 2ARWA 4KRPB 4X6CA 5J57B 3OB0H 1T21A 3C2AL 4OI7A 2A6JB 3TCXA 1F4HA 1S9WB 4NZDA 3SDYH 1JNHA 2DQIL 1FFOA 5I9QB 1CGUA 4LIQL 1G9NC 2FJHA 5DRWA 5D1ZB 4U31A 4QF1A 3BT2H 5FYJU 1CGYA 4GMSH 4LPWA 4QHMB 1P4IH 5CZKA 4HMEA 3ULUH 1KIQA 4L29A 3OJVC 5MEQA 2H2PD 1T0MA 2GSGA 1GZPA 1A0QL 1G7MB 1IKNA 4ODVL 5E70A 4M5YH 4H5SA 4D9LH 4P49A 3D0LA 4UDTA 1PBYA 1UXSB 5FUZH 2LVEA 3AROA 5DMIH 2XY2A 4N5EC 5HXMA 2DN7A 3QEHA 5IVZA 5KSBB 1R3IH 4LCWB 4JO4H 4JN1H 5D2NA 2VDQH 2XT1B 3QAZC 3IKCA 4U1JA 2YPLB 4WTXA 3LS4L 3WJJA 1P2CB 4MAYA 1DBBL 4PYHA 3MLUL 3R4DA 3QQ3B 3ULUF 1KIUA 3FQXB 4PJHE 1UFUA 4KUCD 4LF3A 3MLRL 4U0RB 4EZMA 4JFFA 2WUCL 1F02I 4TVPE 1PLGH 3UTTB 2GUOA 4EUPG 3WFDL 3SY0B 2RAMA 4LSUL 5M95B 4GXVH 3DMMB 4U3XA 3T65B 3TNNA 5AZ2L 5BRZA 3GKZA 3QIWD 4ODHH 4Y19B 4MJ6B 1QHPA 4S1SH 4QGYA 3FT4B 3FQRB 5HJ3B 1WSST 4OAWA 2YD5A 1G9MH 4XI5C 3CXHJ 2JJVA 2YD4A 3LQMA 1BQLH 2FD6L 4WW1A 5HGBB 1KGCE 3TV3L 5JLZA 4E0RB 4OLYL 4QXGH 3JUYA 2PF6A 4OCWH 1ACYH 3MNZB 1XR8A 4X4YA 1PZUB 3V6BR 3SY0A 3MCLL 3KDMB 1CXLA 4D9QD 1HZHL 5EORL 5DVOA 3UJJL 3QG7L 2GEEA 2FATH 4MJ6A 4YHIB 3DUUB 5T1DL 4OCNC 1BZ7A 5FYKH 4HUKB 3GIVA 4JZOA 3LH2H 4MDJA 1T83A 4RFEB 1NMAH 3VWKD 5IT2L 1P6FA 2E9WA 5IR1B 4KMTL 5C0FA 3ARGA 3L9RB 3HCVB 3WHE1 3ZE0E 2BVEA 3RA7L 4I3RL 4N8VG 5DUBB 2MPAL 1IQDA 3HAEH 2CKNA 5JPNB 5JOPD 1NDGA 3PWPD 2JK5B 5F7WC 3RA7H 3QB7C 2VUOA 5DC9B 2XQYK 5KOMC 4OTXL 4K55A 3TVMD 3VXQA 1NC4D 2VQTA 5K93A 5AWNH 1INQB 3V5DB 1I8LC 3QJFA 1LO4H 4NQED 4AM0A 4OTXH 4P2RB 4WY7L 1QLEH 4LSRL 4KJYB 5D2LA 1F5WA 3MRLA 1ORQA 4LSQL 1QBLL 2ZOKB 1YJDH 5IEHB 1J05B 1R5VA 2R1YB 3S96B 5DS8A 2AEQL 2FEDD 3C6LB 3GI8H 5CJQH 5FGBC 5D2NC 5SWQB 1YEJH 1DEEA 4PTTB 1AXIB 5C3TA 3FN0L 4EXPX 4LSTL 3FO2B 5C09D 5GRYA 4YHKH 1I3GL 2RQ8A 3RL2B 1BJMA 1YY9D 1XF3B 1IQDB 5CZVL 5FOBB 3FQTB 4Z7UE 2QADC 3EJZD 5SWSE 1WZMA 4PY7B 1N3NB 3UX9B 1XIWB 1RZ8B 4W70A 4LHUB 2MHAA 1U8LB 4JHWH 2VL4A 4GJTB 1B6UA 4G43B 3HZKA 2VERN 2XNAA 1YECH 3VGHA 4ZFFA 5FM5M 3MRLB 3GMPA 5C3LD 5FO9B 4PJAB 5DJ0A 5CBAB 1S7UA 3ILPA 5LAXB 1LP9B 2FIRT 1T66C 4PRPA 4OGYH 1KB5B 2IWGA 4MA3B 2VDMH 5C0CE 1W72L 1CD9B 1WIOA 5JOFB 5CHNB 1MVUA 3MV8A 5C0AA 3OKDB 3BIBX 4ETYA 4P0DA 1I1AB 2W9LA 4LVEA 4ZAKD 1PSKH 1ZK9A 4YBQD 3ECBA 1H3VA 2OLDA 3W9EB 5CEZL 1FFPA 4L8SB 5HI4C 3ZDZE 3H0TA 1K8IB 3DUSB 2RFXB 3P77A 2MHAB 3JTTB 4U1SB 5HI5C 4E41B 1L6XA 4JRWA 5E2VL 1WFTA 3RL1B 5F7EL 1RVFL 4Y1AE 4CW1B 2FECL 2FYYB 3KWWA 1A6UL 1IEAB 4JM4H 1HHHA 1IGTB 5D5MA 4DEPC 3O3DB 5GSVB 4EEEA 4V1DE 2R0KL 4PJ9A 2YBRA 5FCUL 1YY8B 4L9LC 1J8HD 3DXAE 2VITA 1EGJA 4OIBA 4YDLC 2R4SH 2ARJQ 3LIZL 1ADQH 2NY3C 4S1QH 5JW4Q 3FQWA 3QO1A 3VXNB 5T3ZL 5KVDH 3RNKA 5C08B 2QL1A 5H8DA 1DJSA 3O6FD 1XF4A 1JF5A 1PQZB 3PP3K 3PWJB 2WIIB 2CLZB 4WI3A 3UO1H 3PXJA 4M8QB 2BY0A 4MD4A 2NY0C 1AC6A 2BVUA 5HY9A 5E6ZA 4L3CB 5KG9A 1KCVH 3CGTA 5CJXA 4N8CL 5DGQA 1WVZA 1YN7B 4P2QA 2G60L 2VDML 3DV6A 5TF0A 1FZKB 3BPNB 5HHNB 5IIEB 4GW1B 1RFDH 1NGYA 4I9WD 4Y5XB 3ZHKA 3K3QA 4XPBH 1AO7B 3RY5A 5KTEH 4L8BA 3MV8D 4OCXL 3LEYL 5DWUH 1XGQB 2W0FA 1O0VA 1RIHH 5CILH 5GPRA 5FYJD 4YXHH 2MOVA 3VFPA 5GGSY 1R3LA 2BSTB 4ZDHA 2I9TA 2COQA 1YQVL 4P59H 3IDYC 5IMMA 4JJ5B 4DQOL 3JTSA 3V95A 4OZIA 2Q76B 1S8DB 3JV5A 5DJ8B 5GQBA 3BE1H 1ZLWH 1LEIA 4OZHE 3TT3L 1G7MA 4LLAA 4WDIA 5ALBL 3MODH 4I18B 1KBGL 4LNVA 1QUNA 4H5SB 1VHPA 3DHMA 1A14L 4LCIL 1TTFA 2UZYB 4Y5XA 3UJTH 5HYIA 2FIKA 3ZMRA 2DRUA 1KBGH 25C8H 4ORGA 3QEHB 1U3HC 3CMOL 4YAQA 4J3XA 1N7ML 1QFWL 1RK1B 3DMMD 3BX7C 1LDPH 4PP2A 3QUYC 3S6CA 3EOBB 4F2MB 1MFEL 4X99B 4HZAA 1S9YA 3HZYB 1OLZA 5F93C 3RZCD 2CK2A 1BJ1J 4OLZH 1KC5L 4R90H 5SX4I 5EB9A 3CVIL 1KPRA 1C5CL 3BN3B 1IAKB 4ZFOA 5C9JA 3KNBB 3CDGB 4I0PC 3PWPB 3CDYA 4XNYL 3QRFM 4DCQA 1D5ZB 3A6BL 1QSZA 4G6ML 2WQ8A 3RJDA 2X41A 1CXKA 4DWHA 4HW6A 4GG6E 4QRQA 3GMNB 4HULB 1OW0A 4NQDA 3KPLB 4QT5A 4NO2A 2IBZX 5TDNB 2VLJD 1DLHB 4PLJC 3VRIB 1JTOA 2F58L 1RJZA 5IB3A 1Z6JT 1U8IB 5F8QC 1INDH 5EPMB 4ZSOB 3BZFB 1MI5B 5FO8B 3IDGB 5DQ9A 2SEBA 1NC4A 3V6FA 2NY6C 4ENED 2EDXA 5I8OH 3TEUA 3Q5OA 1ZMYA 4X5LA 2DIAA 1MWAA 4XX1G 4QHKI 2IPKA 2V5RA 3MA9H 3C09B 2DQCH 3A6CL 1QSVA 4FQ1H 3FTGB 4MXVF 3GSUA 3AMKA 4UTBL 2OR9H 1G84A 3QEQA 2GAZB 2EDDA 3MBEC 3FT3A 4MLIA 4JZOB 4GRLD 4CJ0A 1HHGB 5LGHH 2YPVH 5B22A 2I07A 3DVNB 5EBLB 1OTSD 2VKXA 3K4ZA 4FP8L 4KQ3L 2Y5TA 1FFNB 2YA0A 4X5XA 4OLZL 2X4RB 3LMJH 3QDAA 5IHZA 4PJHA 4B7IA 4NQEB 4XCYB 3UJIH 4DTGL 3T4YB 4YC2B 3B83A 2QQKL 1IC7L 3PDOB 1OSZB 4P46D 5GRWA 2EDKA 4UBDC 4BK4A 5I6XC 1UWEL 2CDGA 1NMCC 5FHBH 3TBVB 1K2DB 3F5WB 5F7FA 4EUPH 2NR6D 2LE9A 1D6EA 3BUTA 2Q86A 4U1IA 4UILL 4HSQA 2WUBL 1RJYB 2FX7L 1Z9LA 5H94A 5CKAA 3CZFA 4XP4L 1CF8H 3BPOB 4QRTB 1FP5A 3FB7A 5DHVA 1FFOB 4Y16D 3KJ6L 5IEHA 1A4KB 1MNUH 4YIQA 2VABA 1U8QB 4BYHA 5J12B 3ZKMC 3PV6B 4N0YH 3RFZC 5SWQA 3KPSB 2DICA 3T4YA 3N1FC 2YN5A 4NJAH 1SJEA 1SYSA 5E00B 1JGLH 1RK0A 2LTQC 3UZQA 1QD0A 3MFGB 2HG5B 3T4AB 1E4WH 5F88A 1A3QA 3PV7A 4RQQA 3FHQA 5C6PB 1RZJL 4OM1L 4I1NB 5D2NB 1EUUA 1CT8B 4KQ4H 3VXME 4OI9A 5DC0A 2HRPH 3U0TB 4PB0H 5FO9A 2OZ4L 2ED9A 1NCCL 4ZYKB 1IGFL 4EOWH 5JXAH 1ZHNA 2UZXB 3OV6A 4HZLB 2FLRT 4WO4C 5EO0B 3LKQA 1J1OL 1CLOH 2CKBB 2B4CC 2BRQA 4G6JL 2R29L 4ELKB 1T1YB 3OKDA 4WUUB 2AABL 1X5XA 4XP5L 2DQJL 1GYAA 5ESVA 1SYSB 5E00A 2JCCB 5LXGL 3LQZA 2NY3B 4KVCH 4PG2A 4KK6C 5EZIL 5CUSH 5C09A 3OGOE 3RBGA 4KJQD 3KLHD 1PJ9A 1QRND 2VTFA 2EDEA 5I1AA 4HJGA 3D5OF 1MHCA 3RJQB 2GTZB 4R4ND 1CD1A 3OX8A 3NPSC 4ELMF 1YEDA 4P2QD 4XPHH 3B5TA 3WLWD 3PXHA 2BMKB 3KG5A 5FDWB 4J12A 3D87B 5KW9L 1A14H 2C7UA 1B88A 1JV5B 5AUMA 2K3TA 5EBWA 5IB2B 3I84A 1TTUA 5F8RC 3DHJA 3PP3H 4KHXH 3S37X 1CK0L 2J6EA 3B9DA 4NJAL 5CJBA 3L7FB 4D0BA 4LLUB 1CE1H 3GMRA 5TPWL 4GW5B 5C2BH 4ZUUB 5DD5H 3U0PB 4MHHI 3MUHL 3MJ7A 1R3KB 3HR5B 4MJIA 1MNUL 4I5BA 1FCGA 3OSKA 5JA9A 4HWBA 4LSPL 3ABZA 1LK2B 3SQOL 5F6IB 4HFWA 2AV7A 4XP1L 4WEBH 1BD2E 3T0WA 4KV5E 4ODTL 3OX8B 3IFOA 4IOFD 3HG1A 1KT2A 3MLTA 2Y07L 5KVGH 4LEOA 5J9PB 2EDBA 3P9MB 3KAAA 1JK8B 3KPOA 3IGAA 4DN3H 5JOEA 1J1OH 1OARL 2Y07H 5KVGL 5IIEA 2IQAB 3VFTB 1YJDC 1YEHH 5E2TH 4NN5B 5FYLE 4WUUE 3QXVA 3VFOA 4KI5E 3WIIL 4B41A 4WWKB 3OKKB 4MQTB 2OL3L 3CK0L 4RSVA 5C0JB 1X6NA 2A77L 1BFVL 2QSCH 1RD6A 1RZ8A 5D6CA 1R3LB 2BSTA 1R3KA 1TVBA 1H15B 3F7YA 2OI9B 4BSVA 4RIRA 4ZUSA 5IBUG 3SJVD 2BNRA 3SBWC 3T0EB 1R5VB 1G7HB 2R1YA 3PE9A 3ULVH 3VXSB 4JQIL 2DWDB 5DJ0B 5C2UB 4M62H 2XICA 4AL8L 5IFHL 2XOTA 4PJFA 3A6CH 3GJFK 1U93A 4RRPA 4NPYA 2KZ1B 5IK3A 1NCAH 1AD0A 3F65A 4R2GD 5F7EH 2FO1A 1BVLA 1BLNA 4GAGL 3ULUD 2VN4A 3BD3A 4ORGB 3QUMA 5E8NB 5F7MC 3H0TB 4LIQE 4PJ5B 4WW2B 3TIDB 4H1LH 4LASH 3LS5H 4JR9H 2J1KA 4RIRB 1A21A 4NQCD 4HFUL 3QEUB 1KTLB 3N85L 5MENA 1UZ6F 5CCKL 2AJSL 4M93C 1QA9B 3TN0C 1I3UA 5DTFB 1NBVL 5IJVA 2ZKHH 3SE3A 2CRMA 3L6FA 3RI5K 5A3ID 2EE3A 3FN3A 2H45A 4L9LA 3DGGA 4OGAD 4KDTA 4NT6A 1T3FB 4JFZH 4OLXL 5C7XH 2BOBA 1ZANL 4IRZH 4XXCA 5I1DB 4M03A 1RV6X 3WO4C 1AXSB 4Z7QE 4XH2A 2ED8A 3SJVB 4LKXA 2RFXA 3P77B 1DLHA 1U3HB 2V17L 2LAAA 3KPPA 4P5KA 1XF4B 2QSQA 5F96H 3I2CL 4Y16B 1KN2H 4OKVA 4RAHA 1RZFL 2ARJB 1IEAA 5D5MB 1OAYH 4IM8A 1IKFH 1KIQB 3GSRB 5MEQB 2HFEA 1HI6B 3QXDB 4PV8B 1KCRH 4DVBB 2CPCA 1KTRL 5JHDA 4YGVB 1L7TH 3TLRA 3IAQA 4GAGH 2CKBL 3QJHB 2OMBA 2Q7YB 1CICD 1X5AA 1FIEA 4RMRA 4LCWA 4KU1A 1QTYT 5ESQA 3A67H 3BEWB 4X5WB 3TT1H 3G6JE 4OQTL 3MA7B 1UYWL 2B1AL 4LCYB 1TQBB 2CGRL 2P1YA 1NLBL 4IBLT 5EO9B 1G7QB 1FFNA 1HCVA 4PJCF 3N1MC 4N9OB 1FL5B 4WTZG 1YA5A 4LF3B 1WBZB 3VFMB 2X4RA 3PQYA 1S7SA 1G7IB 5F1SA 3B8YA 3MRIB 5LXGH 2NXZC 3PP4H 2ZKHL 4GBXA 4G3YL 4K3GA 1FZKA 1WFUA 1HI6A 3MLVH 3IJHA 2VXSH 5A16A 4GW1A 2C3VB 3CUPB 1DUYA 1WICA 1MQKL 4OD3L 5HGDA 1YDPA 5J11B 2WQRA 3O9WB 1RAMA 3H7BB 4G8GA 2V17H 1HK6A 4TNVF 1R24A 1JVKA 3L3KA 4MB4A 4RA0C 4YPJA 3S4SA 4OM0L 1OGTB 1A6WH 4OLVL 3MRQB 1T66D 3REVA 5L2JB 5IHUH 5EU7C 4H8WH 3VXSD 1FL5A 4HUUB 1KPRB