3ARGA

Ternary crystal structure of the mouse nkt tcr-cd1d-alpha-glucosylceramide(c20:2)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
294
structure length
290
Chain Sequence
NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMPKEDYPIEIQLSAGCEMYNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNDETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWGSLHHILDAQKMVWNHRHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A molecular basis for the exquisite CD1d-restricted antigen specificity and functional responses of natural killer T cells
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
total genus 65
structure length 290
sequence length 294
ec nomenclature
pdb deposition date 2010-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3argA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3argA01
3VXSA 4LARL 3PV7A 4XNUL 2NCMA 1JN6B 3SDXB 3BEVA 5FAAA 5J0BA 3SPVA 1YMME 1AH1A 4N1CA 3WSQL 3GSNB 2YPVH 2IF7A 1AHWB 2NY5C 4TUKH 5L2JA 4U2YA 1XIWD 5ALCH 4O2EB 1FP5A 2WBJA 2EIZB 4DAGL 2D31A 2XNAA 4KJPC 3VXOA 4NQDE 4Q97A 3O6LL 4WTZG 4CVXB 1ACYL 3EBAA 2FBOJ 1AD0B 3BHBB 3VFRA 4OD3H 4UIKH 4AQOA 5IKCA 4PRPD 2XXMB 2ARWA 5BCAA 5FYLD 4CNIA 3I6GB 2KL6A 4JZOA 4JZJB 4LHUD 4MZ3A 3W11D 3H6JA 4HD9A 3IS0X 1G9EA 2R0WH 5H37H 1YPZF 4NDMB 3UO1L 4UTAL 4YFLF 3X11B 1IL1B 2ZP0T 5E8DL 4F9PC 1NUDA 4ZFFB 1G7JA 1MFDH 2BSRA 3ARDD 1UADC 5E8EA 2W9DH 4DKFH 3WYRA 3BWUC 3MRKB 5DJDB 5DC4B 4J8RB 4Y5VA 3JTTA 1RZKH 3VFPA 1LEGA 4N5EA 1SEQH 3CC5B 2RGSA 3LKSA 3UZVB 4OF5A 3AM8A 3O2VH 4XPBH 4Y19B 3BPNB 3V6ZB 1NFDA 3O2DL 3SOBL 3QPQC 5I6XC 1QEWB 3MRGB 4JY4B 4JKKA 5DHYB 3D2UA 5TDNA 4HUUB 2J4WH 4CMMB 4D9LL 3KPLA 4BH8A 1ZSDB 4IIQB 3N1MC 4PJIA 3SQOL 1IM9B 3GMLA 1X5GA 4JRXD 4Z0BH 4Y1AB 5FUZL 3QDGE 1IAKA 3V4UL 2XICA 2K3TA 3ZSSA 5FGRA 1NGZA 4PJIE 5DHXB 5JZ7D 4GRWH 3UTSE 3CFBB 3HR5B 5HJ3A 3I02A 1A1NA 5I1DB 3WNNA 3RUGB 4NO2A 5JDSB 3DTXA 2FIKB 4LQ1A 2CGRL 3H7BA 4KGJA 1CL7L 4ZTPL 5H35A 4K9EL 4DCQB 4OZFH 4RWYL 2EDJA 3OGCA 3L3DB 4YIQB 3FFCA 1KC5H 5BOPA 1VFOA 1B0GB 4NKOA 2VLRD 5TH2B 3TVMC 2GIYA 4XPHL 3VXRB 5JA8B 4JFPB 5JIKA 1NGPH 2QR0A 1MPAL 4JQXC 3C08L 4P9MH 2EH7H 3HE6D 4MD4B 1JGEA 4U1JB 3QNXB 4LARH 4F9LA 1XGPA 4Z18A 1FG2A 1FG2B 4DJMA 5GJSH 3B5TA 3ES6B 4A2MA 1I1AC 32C2A 3W0WE 4PB0H 2ZG2A 4XAKD 1F11B 4LLQA 4FZ8L 4UI2A 5F7HA 1OCWL 3E1F1 1NAML 2IBBA 2XWJA 4ODHH 4KTDL 5DD5L 2F74A 5TE4L 5BVJA 2OR8A 4MXQD 1QVOA 5LVEA 4GAJL 3WJLA 1U8NB 4PY8J 4OIIL 4IJ3B 1RZGA 5IESL 3SDCA 3VG0H 5K59E 3NCJL 3VE0B 3VE0A 2VB5A 4B41A 1U95B 2DI7A 1T1WA 2DLFL 1I9JL 2VH5H 4WEBL 5DRNB 5E8DH 4NT6A 3IU3A 4TULL 3FN9A 2YSSA 1Z3GL 3JBG7 1TQCC 2P45B 4OI7A 3TIEA 2YPLA 5CEZL 4NQEE 1S7RB 2GK2A 1N5AA 2QADC 1ZT7A 1MCOL 1Q72H 4Y5VB 2QQKH 1XGYH 2Q7NA 2E6PA 4MQXD 1HCFX 3B2UC 2EC9T 3H0TA 3GSOA 5I18H 3MRHA 2JB6B 4QYOB 4XMKL 5KVEH 4WUUB 3W39A 4M5ZH 3ARTA 3QFJA 2EH8H 5FB8A 2LTQB 4LMQI 3ZKSD 5FKAB 4ODBD 43C9B 2Y4SA 4KK5C 2A9NL 5LWYL 3TVMB 4I0CC 4MA3B 4RAVA 1UB6A 1R3KA 3LKQB 1LP9B 4MQSB 3F62A 3I3DA 1CFBA 2BRQA 4Z7UF 8FABA 15C8H 1OSZB 2D0GA 1TCRB 4HWUA 2P8LB 5D96B 3TO4A 3IT8D 5KANI 2WW8A 4FQ2L 4JN1H 3HRZB 2CKBL 1L4IA 5D1ZA 1ZKAA 4I3GA 4UTBH 1A3LH 1QFUH 4JJ5A 4N8CH 4U4BA 4DZBA 5CGYD 1FVCB 1YN6B 3WHE1 5I1IL 3WN5C 1GPOH 2YK1H 3QEHB 1F00I 5DYOB 3MJ7A 4HIJA 5JIHA 5GRJH 3QCUH 4KPHH 4KK5D 2BSSA 3C08H 1NMCB 4ENED 1Y6KR 1OLLA 4MQXC 1KENL 4S2SA 2NQCA 1A1OA 5C08A 2IALB 3UJTL 4X7DC 5SWSB 3RFZC 3ARRA 2WWKO 4HMEA 2KKQA 5C2UB 4NZDA 4YWGL 5DGRA 5EU3A 1PG7W 3P30L 2GAZB 2ADFH 4G8GE 1H0DA 4N0CC 4EI6B 5DFVD 1RJZB 3DVNB 4XPAH 5AWNL 4LDEB 4XBGB 5D7LE 2YEZA 4WHYH 5IB1B 2BCKA 4B50A 3BJ91 3WDHA 2BVPA 5E7BA 3LEXA 4PP2A 1KN4H 2J88H 1DBBH 7FABH 5A2FA 1PSKL 4FXGA 4WCYL 3MJ6A 5K9OB 25C8H 3I50H 3RY4A 4FQXB 2APTA 4KKCD 4HH9A 4G6FD 2OR9L 4KJPD 1M6OA 1G7MA 4RWYH 4Y16D 3QXWA 1I8LA 3HI6H 2AXJA 1MFEL 5ACLA 3FOMB 3WS6A 1OL0A 3MRIA 2DBJA 4X6EB 4IM8A 1BQHB 5AD0A 3O3AA 2K1MA 4F58H 5F7DA 3O2DH 3FTGA 2BNUA 4MNGB 4MNGA 5C0CE 3DRQA 1FNEB 1OAQL 2APWA 4M61A 3MLSL 4FQLH 3QDJA 4NQVB 3MBXL 4QRPA 5DJXB 4QNPE 5IVXA 3E6HB 2F54A 2EDWA 2PTVA 3SKOB 3U0PA 5FHAH 4D9LH 3RWGA 2AJZA 4WWKA 3TNMB 1I1FB 3IF1A 3QCVL 4QOKD 4CAGA 1MWAH 4DGYH 4ZO6A 4WO4C 1GYAA 2YBRA 2PYFA 3GMNA 3WS3B 1SYVA 4PGBB 4I77H 5IB2B 3QO0B 4BUGA 4GW5B 4XXDA 5CGYC 1QA9A 3B2VL 4NZUH 4XVSL 5I76B 3IAQA 4U1IB 4Q0XL 5KAQG 5IFAH 4KZEL 5TE6H 2YD1A 3MNVA 2W9LA 3PDOA 4PJXA 5I19H 4KI5F 1KN2L 5F9WC 5MERA 4APQB 1HHGA 4LPUA 4KK8D 4NUJA 4C57C 1RY7B 4MNQB 5DRWA 2BOCA 5A1AA 5JPNB 1NBZA 3T65A 2VDRL 5DHVH 4EN3B 2WWKT 1WC7A 2YA1A 5E5MA 4V1DE 1N7ML 4LRNH 1KELL 2BVQB 5DO2C 1S9KC 1VGKA 2NY0C 3MUHL 4PRIA 1CDUA 3OAUL 4QXUH 1MY7A 1K2DB 1L0QA 3ULUL 2EDFA 1IKFL 2FIRT 1NGXA 5IK3A 4GW1A 1BGXH 1R5IB 3TF7A 4P2OD 4Z76A 3OAYK 2B4CC 4N0YH 5SWSE 1V7MH 3ULSB 3QUZD 3PWLB 1RIHH 3IJYA 43CAA 3CVHL 1MELA 3NPZB 4DK3A 3BVNB 3ET9F 5FO7A 3V5KB 1ZE3C 2ERJB 3RJQB 1YZZA 4FFYH 4K7FA 4ODTH 4PLNC 2IBGA 3O9WB 1KYOK 3HMWL 3FQWA 1CICD 5IB2A 3DXAB 35C8H 5EBGA 2ARJB 3OKDA 4WJ5B 5GGVH 4LCUB 4ZXBD 4JB9L 5KW9L 3NABL 5IEKB 4X6FA 1NGWA 5EBWB 1NCWL 1BP3B 3NTCH 3DMMB 3MRBA 3T0EE 3PIQA 3TNNB 2XKNA 1RJLA 3CFDA 3MLRL 4XVTH 2IQAB 1MJJB 1FAIH 3G6JE 4X5XB 2VIRB 2LAGB 3F7YB 5HYEA 3FT2B 4H5SB 1UJTA 5HGDA 4ONOA 3MBED 1MWAA 1JBJA 4YBLC 1ETZA 1ZHKA 1TZIA 3QB7C 5EOCL 4Z78B 3L3OB 3HAEB 1BWWA 4YHIB 1HQRB 3S97C 4YDKL 4MQ7A 4PDCE 1V7NL 2JF1A 3AM8C 3JUYA 3PGFL 1YJDC 4YEFA 1KACB 4Y4KC 3GM8A 2NLJB 3QXVA 2KDGA 5ITBH 2UWEA 3UDWA 3AS3A 4DKEL 2KZWA 3IF1B 3KR3L 4DKAA 1CGSH 4IRSB 4PJCB 4ZYKA 1JHLL 1V3LA 4JRXE 4I0KA 4PRHB 4OQTL 4U6HA 1JZ6A 4HWBL 4QLRA 4FZ8H 3DXAE 3QBTB 1VEPA 5AZEH 2ARJQ 4OFYD 3RBGA 3ZYZA 5FIEA 3QWOB 1L6ZA 4OM0H 3CFJB 3LQZB 1XAUA 4MDIA 3OG6B 1JCKA 2VNCA 1QD0A 2YA0A 3OJDA 3ZDYE 3QR2A 5A2LH 1IL1A 4W6WB 2B1HL 2COQA 4HUWA 2AAVA 3K1KC 3U30C 1MUJB 1S7VA 4S10A 2HFEA 1HILB 5HI5C 5H2BA 2QQLH 2I60H 5D96C 3D1MC 3MRBB 2LABA 3B6SA 5TQ2L 3FO0H 2I07B 4JFFD 4JRXB 4U1LB 3V6FA 2XFXB 4WTWA 5EWIL 2VUOA 4Y19A 3WXVH 4EDWH 1LK2A 4R2GC 4LP4A 3OX8B 3GKWH 4KVNH 5DJ2B 4LKXA 4PJAB 3UBXG 1A1MA 3L3OA 5F9JB 4P2OC 4R26L 4HXBL 3T08A 1F3DJ 4PGEB 5AWNH 2X89A 5J8OA 1KLGB 1VSCA 4W4OC 2IEPA 2I25N 3GSXB 1C08B 3ULSA 4BQBA 3O6FC 3M07A 2BRRL 1MH5B 1AIFB 3DV6A 1A64A 5ECJE 3RUGF 3F12A 3P4MB 5EZOL 2P4AB 4JFYB 1U8HA 2FYYA 3W11C 2XN9E 4U7MA 3CVIH 3LDBB 1SYSB 1UCBH 5J12B 2F74B 5GS3A 5HDLA 5F3BB 3I85A 3FZUD 1W0VA 4R4FH 4JAMA 5C0RL 3OXSB 5IR1B 4XRCB 3FQXB 5B3JE 4JHWH 1A2YB 1DLFH 2DKMA 3KS0J 4TVSa 4TTGA 2NYYD 5J13B 3L3DA 4JM2C 1CT8A 5E7FA 3HZYA 2O5YL 1ROWA 4URTB 2MJWA 5IUSA 4X5XA 3GIVA 2IADA 4B7LA 2EYSA 4MS8A 3LB6C 1QNZH 5GRWA 3SN6N 4NQDD 4P3DA 5I66A 1MCHA 1RHHB 3HRPA 4G9FA 2YPKB 5K9QG 4HFWA 1U3HC 1UYWH 4WWID 2NY4B 1X5HA 4JFPA 3WHE0 2P8MB 1A3RL 5FF6A 2CMRL 3RKPA 4XVUC 2V17L 1U8IB 3LQAC 4LAJH 3L95B 4O2FA 2VDMH 3VXPA 4H8WL 4DGIL 5BXFB 4NWTL 3TPUA 5C3TA 4HZAA 5TPWL 4DUWA 1QVOB 3KPTA 4O2CA 4DOHE 1WISA 3IRZA 3S34H 3Q6FB 4KHXL 2B0SH 4JFFE 2Q6WA 4OCXL 4FG6C 3AAZA 3LQZA 3QPXH 4HX1B 4X9BA 4FFYL 4LDLB 3PP4H 3LN4B 4KKBC 2UZIH 4N0CD 1YJDH 2FIKA 4Y5YB 5JXAH 3ARSA 2DI9A 1ITCA 1G9MH 4J7RA 1ZT4B 5F1KC 2EKSA 1QRND 3O3BB 3ZE2E 4QEGA 3S4SB 3ALXA 4D0DA 1G7JB 4AMKL 4DUXA 4PLKD 4ZOBA 3KPRD 4HK0B 2Z9TA 2AV1B 3UJIL 4YHNB 4X98A 1YN7A 4X7SH 3HE6C 1JRHH 4FTVD 5BZWB 1LP9F 1BGXL 3KHOA 3C5JB 5JW4N 4YPGB 1N0LA 4LASL 4ISVB 1H0DB 4MJIE 4BQ8A 4WFHE 5BOZG 5C6PB 5J57B 5CHNA 3SGEH 3RP1A 4GMSH 1P6AB 1HXYB 3CU7A 1KCGC 2HLAB 2MCPL 3EYQC 1HWGB 3NABH 1JK8A 1H3GA 1FPTH 4LAQL 5DVOA 1MRDL 4XI5D 2VXVL 3EYOA 4Q2ZA 1GOFA 3IDGB 5MEQA 3EO1A 1BQUA 1CXEA 2V2TB 1UQSA 2N56A 1BLNB 1QO3B 4HUVB 3OF6D 4U1KA 4YXKH 5LXGL 1S9YB 3MRJB 4M00A 5JOPD 1VERA 2B2XL 2BNQE 1FVCA 2GITB 3NZ8A 5KVMC 2ICEA 1EK3A 4OLWH 5DDHA 5DDHB 4RGMC 2OM5A 1T5XB 5FCSH 2KZ1B 4ODWA 4HFUH 4OI9A 6FABL 2H3NA 2EDQA 4WGVB 1A7NH 4NM4L 5EU6E 1UXSB 3LV3B 3WE6A 3QXDB 4TVPD 2DDQL 3QWRD 1FQ9C 1B6UA 3CSPA 3ARBA 3D87B 5SX5H 1G9NC 4EBQL 3TA3D 1F02I 1I1FA 3UROR 1ED3A 3B9KC 4OLZL 3IDXH 2BXYA 3MACL 3OB8A 3C6LD 3SJVD 2JJUA 4F2MB 1NCNA 5IMLB 4QRQB 5DK0B 3OKOB 3KPPA 1DQJB 1XGUB 1Q1JL 4PJFF 3VGGA 5I0DA 2D9QB 5CFHA 1JV5A 4M9PA 3G9AB 5FGBA 4MYWB 2QSTA 3P0GB 1WGOA 3ARQA 5CEXA 5ENWB 4V1DD 5K9OA 1FL3A 4PJHA 4DVBB 2HT4C 3QIBA 4NJ9H 3DRTB 3E0GA 2R0WL 4TNVK 4IJ3C 3BKMH 4XWGL 1BLNA 4LIQL 4JM4H 1XF5B 1Q8MA 1QNZL 3MRNA 1D5MA 1DQLL 3EOBB 2UUDH 1P4LB 4LLVB 4XNZB 4XPGL 3SKUD 3QDJB 3FOMA 3UTPD 1JPGA 1K6QL 4K7PY 1P84J 3BN9C 4X98B 2IMNA 3AY4A 4JFQA 3TT3H 2BNUB 3S37L 2PO6D 5C0BD 5C08B 4MNQD 4JO4L 1BF8A 3EYFA 4U0RC 5EO1B 1FVEA 1BD2B 2JE8A 5DHVB 1NCUA 2GAZA 2XQYK 4P2OB 3HR6A 1BIIB 3X3FH 1KFAH 1NBVL 2NY7H 4BSVA 4Z7WB 3GGWB 5T3XL 5D2LA 4HIXL 2ZUXA 5DQDH 4YHOH 5MERB 4MNHB 3MV7E 4IMKA 2BNRB 1NDMB 4MGXA 2XA3A 5HHVL 1BFTA 4L3CA 3GB7B 2Y6SC 3EYOB 1FSKC 4XCFH 5JHDA 3WDJA 2BP3A 3VMOA 1A9EA 1G7MB 3FO2A 1NLDL 3FZUC 3DGGB 2OTWA 3RDTB 3U36B 2YOCA 1A3QA 5BVPH 4OIBA 5DUMH 1OAKL 1VPOL 4GAGL 4I0PD 3FRUA 1KC5L 1WAAA 5D71L 5GRJL 3RNQB 4QHMA 5C0JB 3DIFB 1O0VA 2YUWA 5F7KC 5IVZB 4LSTH 3PWPE 3RHWF 3I75A 1OGTA 3X3GL 3HZMA 4GG8B 5GSRA 5ID0A 1XIWB 5DMGC 3H2WA 1MCRA 4ZNCD 5FOBB 5L8JB 5E4EC 1FJ1A 4KGLA 2Z31B 3VDBA 1D9KA 4LEXL 4JVPA 3HZVB 5DK2A 2MPAL 1A6UL 2ZNXA 4UOW1 2B4CL 4X4YA 4NNXA 3U9PL 4L8DB 1U58A 4AIZA 3NCYP 2GK0B 4YHPB 2Q7YB 4K3EH 3SO5A 3OHXA 3P9LB 3MV9A 2ZSVA 3ILQC 3DVFA 4AEIH 3OPZL 5FO8A 1XZ0B 1BVZA 3VRIB 4QXTA 2VWEE 3PUCA 4MSWA 4ETQB 2HJKB 2ICES 4N0UB 1LGVA 5D8JL 2E7MA 1UVQB 3LKRB 5F44A 4I2XE 4I5BA 2BVUA 3FMGL 3JV0A 4IMLB 4MJ6B 4EEEA 3HI1B 1AO7A 1SQ2N 1VFAA 3QAZC 2MTPA 5DTFB 4DVRL 3P11L 3ZLQC 1JZ7A 2W9DL 5T5FL 1N5YH 4H88L 3MJ8B 1Q72L 4TN9A 3ELAT 1FRGL 1UB5A 1FFNA 1LK2B 3EIFA 3QUML 1FO0H 1OW0C 5T1LB 1I7TA 4OB5H 4PRBB 4C83B 4NHUB 2R1XA 4N8VA 1ZHLA 1P2CB 4FFZL 4JY6B 5ID0B 5KS9E 1E4KC 4HF5L 1YEIL 4S0SD 2XT1B 1C08A 4GKZA 3QDGD 1KYOJ 4ZXBC 1I9RL 4ZTOL 4FQHB 5IG7A 3KJ4B 5IG7B 2AP2A 1QSEA 5MP6L 4P5TC 5DA0B 1SBBA 4LLMB 3TFKA 1OCWH 3F6LA 1EVTC 4NBXB 3UC0H 3D6GA 5E03A 2NY1C 1CE6A 5DJCA 3AVEA 3QWOA 5D72H 4QXTB 4YGVB 3E3QA 1PG7L 2CK0L 2XQBH 4M6NH 4NHUE 2GCYA 4WI5A 3B9VA 4PJBB 1RJLB 4IOSD 1FL5A 4I18A 1EFQA 3RWCB 4AH2A 3TJHC 6CGTA 5JMRA 4QHMB 3RWDA 2HJFA 2J8HA 4JR9L 3MRRB 5F9JA 3OKNA 4QY8A 1UWEL 3LKSB 4OGAC 5DD3H 4Z5RA 2HRLA 5LWYH 1IAIM 3FHAA 2JJTC 1YEHL 3PWNB 4ZOAA 2HYMA 3DSFH 5D1XD 5IMOB 3MXVH 3GFUA 2PTTB 3AS2A 2OBGA 5IT2L 4YHZL 2J8OA 4RX4D 5T1KD 4PRHD 1PY9A 3IFOB 1KT2B 2DWDA 4HUMB 2ZNWA 5JW3L 2H1PH 1REIA 2Y06H 3BOVA 3VGFA 4TNWK 3PWVA 4XC3H 3RTQB 4W81A 2XG5A 3LKOB 4KMTH 4KXZH 3U9UB 5I8OL 1ZVSB 4TPRH 4XAWH 3LSOA 5EUKA 4JPIA 2ZSVB 2EE6A 4HS8H 4JY5H 4HV8B 4Y4FC 3RY6A 4JZOB 2EIZA 5GHWH 5B38A 2MHAB 2PTUA 2C7UB 2P5WD 3HFML 1WZ1L 2ZSWA 2I9TB 1YNLL 3PNWA 1NCBL 4GRLA 4UBDC 2LU7A 1G7IB 4FQXC 5M94B 1MFEH 2HG5A 3O4OC 5F72S 4HG4J 4HWEL 4GT7A 5FFLA 1G7LA 1AE6H 1Z9OA 3CAFA 1K85A 2BERA 3MJ8A 5FYKE 1KJMA 3HE7C 5EOCH 1KPUA 3S37H 1Y18A 3L5WA 1KPVA 2G5RA 2H2PC 5CSGA 1MOEA 3X14A 2MSPA 4RDQF 5DMYA 2FB4L 2LAAA 4ZUTA 5FOJA 2YD5A 3KYMA 3VFPB 3O4LA 3CDFA 5HYIA 5FDWA 4KKNA 4RQQB 4PGDA 1LVEA 4ZD3H 1D5XA 1S7TB 3KR3H 4Q9QH 1G0YR 4HKXA 4P23D 5HGGS 3C5ZC 5INDB 4I0PA 1QEWA 3IJHB 1H15A 4L1DA 1ORQA 1H8OA 1NSNL 2Z91B 2XI9A 1IKNC 1T5WB 3VXRD 2W1NA 2GHWB 4YX2L 1J8KA 4Y2OA 4LPXA 2FZ3B 2X4RA 5BZDB 2ZUUA 5D5MB 4ZAKD 3VFUB 2PXYC 4DEPB 3B9KD 3CK0H 3V0VB 1M7IB 3NAAH 3TP4A 1YDPB 3KXFA 4YIQA 1JYVA 3OR7A 2DBLH 1II4E 3VGAB 1R3LA 4G8EA 3IDYB 4RMVA 3O2DA 1ZLWK 1QR4A 4HC1H 1G7QA 4XBEL 5I1HL 4BK5A 3EOAB 3ZL4L 1UM6H 3CXDH 1T1XA 1T1XB 3HUJA 3VWKB 4QXUL 1JPSH 4NM8H 1I3RA 4BFIB 1C16A 5T3XE 5C07B 4IRJA 2CKNA 1P7QD 2MPAH 4UV7L 4HH8A 4OGYL 4OLVH 4PJAE 5CJOH 4Z7WE 4MJID 3DVNA 2W60A 1OTUD 4PJ7A 5CBEA 4JANB 3D0LA 2JJTA 3QWQB 4IRJC 4UBDD 1OHQA 1D7FA 3H42H 3LKOA 4Y8AA 5ADOH 2A6IB 5ILTH 1JNNL 4RFOH 1HXYA 4ZPVB 2GTWA 1T22A 1ZOXA 3O4OB 4MXVE 4UQ2B 5GHWL 4CMHC 5F1OB 4NZTL 5DK3A 3QH3B 2F53A 5J9PA 1JK8B 4I18C 1ZAGA 4UUJA 1IGFH 1NCWH 5CEYA 3AXLB 1UWXK 3V9FA 5BZDA 4YO0A 3WHXB 1NKOA 3BZ4B 3FO9A 1Q0XH 4XCFL 3W5MA 2DD8H 5IQ7H 2ICEB 5I8KL 1LO2L 3C2AL 4Y8DC 2IH1B 2MMXA 2XRAH 3JZ7A 2X1QA 4BQ6A 4K9EC 4HUVA 5KVGL 1TMCA 3WL9B 3WL9A 2FB4H 3AFLA 4QGYA 5CP3A 3WLBB 3ARDC 1JHTB 1TITA 2QADD 2XTJB 5ESAB 2AV1A 1U3ZA 4HPYH 4JFQB 3QULA 1UEYA 5CJ8A 5BQ7B 4PRNB 4I0PC 2Y5TA 1I1AB 2CQVA 5CKAA 1KPRA 4XAKE 1MCWW 1E4KA 4HFWB 1DLHA 1PAMA 3ARWA 2HWZH 2BJMH 4PB9L 3LEVL 3D25B 2ADIB 4EI6A 4JGMA 5BMFH 4NKIL 1A6ZA 3NPSB 4M1GH 4L4VB 3RBSA 1QSED 4HS6A 3WEXA 5C0FB 3TVMA 3U7WH 3L6FA 5EZJB 5IFJA 1X3DA 2CDGA 1DSFH 5E8OA 4DQOH 1KEGH 2YKLH 4H1LH 4KMTL 4Z7VB 5HHOA 4KJYB 4WFGE 4QTHB 3DVGA 4M8QB 3SDCB 2ITDB 1HK6A 4XP1L 3OKMB 5JPMA 1L0YA 4FQXA 2Y07H 4X99A 1KULA 3WLWD 5DURB 3PABA 3QQ4A 1XF4B 3TM6A 3TJEH 2YRPA 2FATH 4MA7L 3BPLB 3EZ8A 1S9YA 4UB0L 1YEDA 4OQTA 1VKXA 2QQLL 2BMKA 5D7KD 3MNZB 2DQDL 2AXGA 3CSBA 4FFVC 4XB7A 1VFUA 1MREH 4HC1A 1HI6A 2H32A 5DMKA 5ESVA 1OSPL 1QFWL 3QZWG 3DRQB 1MCWM 5HYJA 4OZIB 1AO7E 1UWEH 3WE6B 2EZ0C 1YPZB 1ODAA 2HMID 4LSDA 1Y6NR 4I2XA 2Y06L 3U46B 3IKCA 4S2SB 1DZBA 1A7RH 2GJ6A 2NY5L 4ORZC 1MFAL 2XZCL 3KLSA 3QA3B 3TYGL 3RGVC 3LB6D 4HIEA 4A6YH 1T04A 4RMWA 2DTSA 4WUUD 5D1ZD 4PGCA 1P7KA 3FAXA 1MFBL 4Q6YA 1A7QH 4LCIL 5SWZB 3HZKB 2CLVA 1NC2B 4M1DL 3FB7B 3KPQA 3QRGL 4HHAB 4Q6IA 4N9OB 3KLDA 3VGEA 5KJRH 4W70A 4S1SH 1G6RL 3SKNB 4L4VD 1RD6A 3ROOB 5CZKA 3I2CL 5EO0B 5AZ2H 4NO5B 1SMAA 4ZO8A 3B9EA 3FT2A 1IC1A 1FLTX 1S7SA 2J2ZA 3GK8H 4L8SC 3PGCA 3RIAF 4O00A 3ZYIA 5IVZA 4KRPC 1RMFL 1UGNA 1TVBA 2AQ1A 4K71C 4XMPL 4Z7UB 1OT2A 5MEPB 1NFKA 4PGJA 3L3JA 3PQYB 4WNQB 1PVHA 4U7SA 3U48A 5DSCA 2V17H 4H26A 5I1AA 4JO1L 4C83A 4XHQA 1CDYA 2X4NB 1VGEL 1T20B 2AGJL 3QEQE 5CJXC 1TQBC 4S1RL 4BZ1L 1JPFA 2WINA 4D8PB 2WINB 5C2BL 3ULUF 4P3CL 3KXFD 1A6TB 1RJZA 4QWWC 3MXWL 4D9QE 3BVNA 1GOHA 3BFOA 3QEUB 1T83A 4GAJH 5AZEL 4HS6B 1Q94A 4LLYA 4MAUH 1NAMH 1HNGA 5BO1H 4PJ8C 4UOW0 1F8TH 4Y2DB 2YRLA 5ETUB 4I5BB 3TPKA 3VFRB 5FO8B 1MJ7H 1FSKB 4KVCH 3KPRA 1F45A 5IHLB 4MSWB 2VOTA 2E27L 4L9LC 5E1AB 5KN5B 3EJJX 1DLFL 4HHAA 4WFGD 2F19L 1FORL 1NC4D 2DLFH 5HHOD 3ZE0F 1BJ8A 1BEYH 1EO8H 3L7FB 2XFXA 3GM0A 4AL8H 1OGAE 2AXGB 2G2RB 5CP7B 5HGDB 4UV4H 1PBYA 2HMIC 2MOVA 3TT3L 4V2BA 4L8BA 4GG8A 1Z5LB 2RHEA 3GI8H 1CLOL 4JKWA 2NXYC 3T0EC 1I7TB 2NLJA 3GSNA 1AIFA 4QHLB 2R1XB 1HIMH 1L7IH 1MHHA 4N8VB 1OW0A 2X4SA 1QKZH 1FIGH 3KPLB 3VRLF 4OCSL 4OCYH 1CE1H 2FYYB 5E6YA 1XGYL 1IM9A 3GMLB 9CGTA 4LSSH 1I1CA 1RQ5A 1OP5K 3VFMA 3MV8B 3FJTA 1BQLL 3GBML 4FQHA 4LCUA 4O58H 3IAGC 1CD0A 3T4YA 5DD0H 3UTTD 1OGAD 3BQUD 5JLZA 3FCTB 1NGWB 3GZKA 4PJCE 2IANB 1A7BA 2VXSH 1I9JH 4M6OH 3WIHH 3VWJD 4UAOC 4K3JH 1RUPL 1UVQA 2DRUA 5DJAB 1Q9KA 1IGYB 4NBYB 1NGQL 4XP6H 2XN9A 2NW3A 5C09B 3ARFC 2QSCH 5EORH 5B39G 3QIWA 1MQKH 4ENEC 3AGVA 2PF6A 3FFCB 3TA3C 3TNNA 4YE4L 1WUNT 4YZFE 3BD4A 3R1GL 5MEPA 2R4SL 4M3KB 3BAEH 2CIIB 3MRCB 3T1WA 4JCLA 5F89B 2DN7A 5F3HA 2RB8A 3AREC 2HWZL 3SKJH 1B2WL 5GRVK 4OCRL 2P5WB 1U93B 1HQRA 4PJDA 1ONQB 5DJ6B 5DS8A 2P47B 1Y0LA 3RWHB 4YDIL 4KDVA 4OZHE 2DM7A 4DTGH 2CKBH 4QF1B 2E6JA 3LEVH 4I1NB 2DQJH 3AB0C 3JTCA 4MA8L 1T03L 4TNVF 5DT1H 1OGAB 3BQUB 1T5WA 3I50L 5JZ7C 1V3JA 3LZFL 5BRZE 2J8UE 3FQWB 1ZMYA 2GKIA 1A4JA 1WWWX 2X41A 1QLRB 4XHJC 2NY4D 3TFKD 1ZA3B 5I2IA 2VLKE 1RZIB 3S96B 4DEPC 4D3CL 5EBWA 3WUWB 4U49A 4V1DA 1M7IA 3RVXD 4OZ4A 5I73B 2J3SA 2BC4B 1XFPA 2X2YA 4FS0A 2Z8WC 1X7QA 1ZHBB 3KPOA 2XOTA 1MIMH 1QBML 3STLA 5AZ2L 3WLWC 5CEZH 3MV8E 4G8FB 4J4PD 1YY9D 3LN9A 3WXWL 3P73A 4HZLB 5D4QA 3B2UD 4AZ8A 1O7SA 5H94B 2M26A 5GQBA 4MQ7B 3ZE2F 1KSRA 4OLVL 5INDA 4PJHE 4KI5C 1MAML 1S9VA 1JF6A 2UV3A 4TUJB 4OZGE 5F7MC 2ZCLH 5I17B 5DS8B 3REVA 1AGFB 1LK3L 4P2RE 1S8DB 1J10A 2O93L 5LGKA 2ZG1A 3LPFA 3VXUD 4DN3H 1FPTL 3PXHA 5CZVH 3BDYH 3B3IB 3B3IA 2VZTA 5D7KE 3Q2CA 1L8JA 1R5WB 1KCKA 1LO4L 4L4VE 3FO1B 4Y5YC 5KANG 1AP2B 1AP2A 4D0BB 3T3ME 4J1UB 2NR6D 4JM2A 2NZ9D 3MRJA 2BNQD 5FGBC 1K3IA 2ATPB 5FHBH 2ATPA 3MC0A 4D94A 3GSNL 4R9HA 5INCB 4MJ2A 4X4ZA 1OAKH 1V3MA 4Y4KD 3O3EA 5CINH 3A6BH 5E2VH 2BC4A 4JJHA 5TE6L 2CO6B 4F15B 5IVNA 4HBQA 4GG6E 5ICXA 2KBGA 5DYOA 1F4AA 1G7QB 4L8CA 4D0DB 2VITA 3RWCA 4AH2B 1J7VR 3VGBA 5C71A 4S1DD 3KGRA 5HDBE 4C56D 3S98A 1IAIH 2NTFB 4O5LL 3MBEC 1U91B 4Z7QF 4J4PC 1ZANL 4OFKA 5KSBE 5EDXA 1GHFL 1VCAA 4I77L 1VHPA 1Y0LB 4JO2H 3K8LA 4F2MA 3IJHA 1DFBL 1DBJH 1YMHA 3GMQB 5BMFL 2B4CH 4LQFH 4R90L 3PHOA 2A73B 2C3VA 4LPWA 4HWNA 1TPXB 2M2DA 2HFGL 2VN7A 4EIGB 2OI9C 3WEXB 2XYCA 1CU4H 3SCMA 2G9HB 4AJ0A 2R56L 1X5XA 2ICCA 3V95A 1ZVSA 5CEXB 3HNVH 4PRAB 3DUSA 1EUUA 3BE1L 5E9DE 4CU8A 2EZ0D 4Q2ZB 2WMPA 2LVEA 4XXCA 4M93C 5F6HI 1MCSA 4PRDA 4LLWB 2GJ6E 4D0BA 3HI6L 1G0XA 5BV7B 1RUPH 1N8ZA 4ONGH 1JI1A 3K4AA 3NGBB 3GIVB 4P59H 2A74B 3WLBA 3GBNH 2ED9A 3RI5F 3MRIB 3GMMA 3DX9B 3HPJB 2XQYG 4JVWA 2E7LC 1CXKA 4EI5C 2DM2A 5DQ9A 4G8FA 4EZMA 1KB5B 4JQIL 2Z4QA 1ZVYA 3G5YB 1P6FA 3NN8A 5SWSA 3O3DB 4IRZL 1CQYA 3SGJC 2VLJB 2P8MA 3H9SB 3VRJB 5D1QD 4JLRB 1MCLA 1CICB 2AVGA 4FQ1L 3UDWC 4UOJA 5D7SL 3C9NB 5AYQA 1WFOA 3T8XA 4PJGB 2W0FA 3MO1B 3PHSA 3NH7L 1IC5L 2EYRA 4L3EB 2ESVD 2DQEL 5EIQA 1MEXL 2WWMD 4KK6C 3K1DA 2PYFB 1KFAL 1NBVH 5DT1L 5IMLA 3WFHA 4O2CB 2A6IA 1SEBA 4PY8I 1MCPL 2DAVA 1T04B 5ANMB 5ANMA 5BRZB 3MOAH 1A7QL 4LCIH 3U30B 5HBBA 2FCBA 5JQHC 4RAUB 2B5IC 3BIKB 4NFBA 2K9UA 2PO6B 4JJ5B 3LN5B 1BM3H 4Y5YA 3E3QE 4G7VH 1FC2D 4HKJA 4HKJB 3UZQA 3RVVD 5JOFA 1ZGLA 1MFDL 1OWRM 5B39B 1N0XL 1MIEL 5C0GA 3IU3B 3QEHA 5FUCC 4JO3L 1YYML 1HH9B 2NMSA 2YSSB 4YUEH 1IM3B 1IM3A 2HKHH 3NIFE 5C0BB 4KVNL 5LGHH 3HPJA 3I6KA 3O6KH 4EOWH 1R3IL 4WI8A 3Q5TA 5DD3L 3TBTB 5K9KA 3T0EA 3OAYH 4Y4HC 2A6KA 1DVFD 1S78D 4E0RA 2VQ1A 5I9QC 3MR9A 4GMTH 2XG4A 1DQQA 4XT1C 5D2NA 4HLZH 1BJ1H 3MGOB 1A6TA 4P2QE 5IJVB 1L7IL 1VADB 2A1WH 4M5YH 2VYRE 4MS8C 3V5KA 2OJZH 3EAKA 1NUFA 2CK0H 3PP3K 3LIZL 4MA3A 1FBIH 5D1XC 1FNGB 5GPRA 3TA3B 3U4EA 1CF8L 4OGAD 1MJ7L 1NCAL 4P46A 1YNKL 4ALAL 1EFXB 4ZFOL 3HZKA 3FB8A 5E1AA 5KN5A 4H25A 1MHEA 4H25B 3LMJL 1N8ZB 4Z7OF 4Q6IC 5KSUB 3K7UA 3N1PC 1OAXL 5IHUL 4HWEH 1SVZA 1PJ9A 1NKRA 2ERJC 4QRUA 5D7LA 2RQ8A 4J2XA 4GBXC 4MJIB 2BK8A 1RIVL 1IM9D 2PYEB 4E41E 5I75B 4FQJL 4J3TA 2RJMA 3WIIL 2NX5B 3IRPX 5FOBA 4FQ1H 1TZGL 2DQTL 4P2OA 2BNRE 4D8PA 5E95B 3A0OA 1ZHNA 5GJSL 3VXMA 4K23L 4GKZB 1P1ZA 3TBYB 5B38G 3TBTA 2ILLA 3C6LA 4Y4KA 3FT3B 3SJVA 4ERSL 4RA0C 4OGXL 1T20A 2QV2A 3V5DA 3U79A 1SYVB 5CIPH 3VFWB 3UXFA 1RIUL 2Q7YA 4YHPA 4WUKH 4WI7A 4YQXH 2RR3A 4J3WA 3CFJA 3CFEA 2CDGB 4POZD 3RVVC 3KPQB 2FGWL 3QNYB 3EDKA 1WQVT 3TWCL 3H7LA 3RIAK 5KOVC 2LFGA 5I0ZA 3QDJE 3HI1A 5JHDE 2VLKB 1LDSA 3KJ6L 1J5OL 2NY6C 5BRZD 4N0RA 3FO2B 1HEZB 3VFTA 3EOTL 5IVOA 1E28A 4KQ3H 2W07A 4I3RL 2I9LA 4WGWB 2J8UA 3K4DA 1NBQA 2CLRA 1INDL 4X7CC 4WO4B 4UV7H 5MENA 4WU5B 1XH3B 5E56A 2UZIL 1P4IH 3IU4L 4O9HH 5D5MF 4QRUB 4JO2L 4IS6B 3UJJH 2G60H 4PJAA 5HPMB 1WZMA 2VQTA 3S35L 1R5IA 1RZFH 5HYJB 4OZIA 4ZFOB 2V5SA 2QSQA 5KSBF 5TE4H 1J18A 2IFGA 3LKPA 5TPWH 4M48L 1OB1B 1YA5A 1Q9WA 5HVFB 2VABA 4A6YL 1OPGH 1AXTL 1EEZB 3MRDB 2BCKB 2VO5A 1QBLH 2DQUH 5TDOB 4WI2A 4H8WC 3BD5A 5C7XH 3D85B 4ZUSA 5IBTH 3LQAL 4PGBA 1U58B 2Q86A 5CCKH 4WRLA 2WBWB 3DVIA 4M62H 4QHNA 4JHAH 1YEEL 3SDDD 3RWIB 5IEKA 5DUBA 3PGDB 4GMSL 5BS0E 2YD7A 1IT9L 2ICWA 5DQJB 2DQHL 3LEYH 4A2LA 5HVHB 5IIEA 3MPCA 3WMSA 3K2UL 1S9WA 4RMTA 3O81A 3QI9B 3TO4C 3NIFF 5GRVL 3O3AB 2LU4A 5LGHL 5LAXA 5EIVA 3P4LA 4WO4A 3ECBB 3FQRB 5EBMA 4YUEL 4JM2F 4XZUA 2R0LL 3H3PH 4KMLB 3B5GA 2LQRA 3TIDA 3IDXL 1IC7H 5I1CL 4ORGA 2UYLB 2P7TA 1QUNA 2X70B 3O45B 4PJHF 1I85C 1C7TA 2ED8A 3BGAA 5I30H 3FFDA 4RX4A 5KVDL 2AK1L 3KYKH 4P3WA 4G8GB 2D4DA 1H3VA 1DVFC 5D6CA 4LLUA 1MF2L 1OGAA 3BQUA 1JF1B 1J05A 4WW2C 4PJXB 3BUTA 1VACB 2YXMA 4JEGB 4O51A 5F1NA 5H8DA 4TQEL 3REWB 2HJLB 3C87A 3DUHA 3R4DA 4Z0XA 4Z7NF 3VGDA 3BP5A 4YZFF 1J0YA 3FQUA 2PXYA 3OL2A 3KDMA 3WUWA 3A6BL 5E2VL 1I3GL 3KYNB 3T0AA 4JCMA 1B3JA 1CR9H 2J5LB 4MNGE 1EEUA 1BX2A 2AK4D 5GRYA 2ZG3A 1C16B 4F8TA 1GC1H 1BQSA 1MJJA 1YYMH 2E9WA 2XA8L 4U6VH 5CS7A 5MEOB 4Z7VF 1A6VH 5DJZA 4WHCA 5DMIL 2CSPA 1IQDB 1ORSB 3ZO0A 4AG4L 1EXUA 1F4XL 1UKSA 4RISH 1R6VA 2GEEA 3JUZA 3IB4A 2DLEA 1CD1B 3TN0A 4JDZA 4C56E 1IAOA 3ILQD 1P7QA 4YHLL 1A21A 3EJZD 4XZUB 4EVNB 1AGBA 1S9VB 4Y16A 1LP9E 4F58L 1C5DA 3MA7B 4H1LA 3MRDA 4ORGB 1FNSL 3S6CA 1W72B 3QJFB 3ZT7A 1VFBA 3CZJA 1NCDL 4LRIC 2X4QA 3DBXB 4JN1L 3T4YB 1L6XA 4LHUG 2BFVH 3TO2A 3KYOA 2P5WE 4RFEA 5MEQB 5B38B 3ULUD 2EE2A 2XTLA 2DQIH 4LRIA 5KBNC 2GCYB 2O5XL 2QHLA 4M6AA 1R3LB 4Z0XB 1QHPA 3LDBC 2V5YA 1NPUA 3H9SD 5IQ7L 3UTQB 3LY6A 4HWZA 1WVZA 3C8DA 5GGSA 3OAZH 3F7QA 3CLEH 1ZTXL 1TVDA 5J56B 1J5OH 2P1YA 4P2QD 2GJZB 5FK9B 5BZWA 3OKNB 4QY8B 3WUZA 4OZFA 2CO7B 2ZOLB 1IE5A 5IHBA 4RQQA 1XGQB 3GSOB 4F7MA 1N7MH 4YR6A 4YJZL 1OAZL 3TN0D 1KCUL 2A9NH 5GJTL 3QFJD 2P5ED 5A2IH 3MV8D 4TUJA 4GMTL 4MD4A 1N26A 1IEAB 5J6HA 1U8IA 4BZ2L 3MCKB 4IRJD 5L2KE 1LILA 2OZ4L 3UZEA 4M1DH 2FX9L 5C9JB 1UB6B 3ULUE 3BO8B 4JFDB 4M7LT 3TPUB 3INUH 3VXTB 5D9SA 1KBGL 3ZZ1A 5AG9A 3VWKC 3KPPB 2FWOA 2FZ3A 2N7BA 4WDIA 5D8JH 3G5ZA 3RWFA 3P4NA 1J05B 3ZE1F 1U8HB 4F33B 1JNLL 3IDJB 3IDJA 3IETA 2YKLL 1MRFH 2C7UA 2J1KA 3EYSL 4JKPH 1FZOA 2VLME 5IBUG 5JDSA 2JK5B 5KSAD 2BVEA 4JAMB 2BHUA 4ZS6D 5IWLA 4GKSB 3BH8B 4K7PX 2EDRA 2HG5B 3QHTC 3NFSL 3ULUC 3ZYOA 4S0TD 5HDQL 4PRIE 4XNQB 2Q87A 3IGAA 5HYQB 5KSBA 3OZ9L 1OTTD 1WCBA 3MV7B 4CU6A 1I3RB 1U8KB 4KV5E 3QHZH 2JB5L 3MJ7B 4HIJB 4HQQL 4LU5L 1VGEH 1T66D 3MRHB 3JVGC 4ZFZA 3MNWA 3C6SB 1IMHC 3UYPA 4MXQC 4E42B 5A40E 4L9DA 1OD9A 2HTLC 5IFHL 2KH2B 5TFSL 3BEWB 4DWHA 1HXMB 4IEFB 1HXMA 1OQXA 4B7IA 5EU6B 5F6IB 5L9DL 2DLTA 3LH2L 2ADJB 4KROC 1BMGA 3X13B 4NKDB 5CEZE 2EXYC 3LQAH 1MWAL 4PJGA 4DGYL 1TDQA 3TO4B 4GFTB 1S3KL 3FOLB 1J0JA 1YPZE 3FOLA 3ZTNH 1EX0A 2GFBA 3VD4A 5ERWA 3FONA 2VLLA 4XVJH 2GTZB 1FNGA 5LBSL 2YZ8A 4UT9L 3T0ED 4YBHA 2F54E 3UTZB 4APQD 2L7UA 1E4JA 4LP5A 1MY5A 4XWOD 5ISZE 1EBAA 4G3YH 5KVFH 3VFGH 1EFXA 2AS5M 5F7WC 1WZLA 3BPOC 2VR9A 5DD6A 1RVFL 4NCDA 3DTXB 1HH9A 4PJFE 3Q1SH 4HWZB 5ALBH 5E94A 2IADB 1EO8L 4HUXA 1ZT7B 4HEME 1AHWC 2VISA 4DZ8A 4HUKB 4WNQA 3SDAD 2FH8A 1CFNA 3I75B 1YQVH 4PYHA 3D0VB 3BAEL 4P2RB 1U8OA 1Z0NA 3MCG1 1XT5A 1XMWA 3HNSH 4P2CG 1P4IL 3UMTA 1Q0YL 3OQ3B 2BDNL 4NC1E 2CKBA 2VZUA 4ZTOH 1VADA 3VFOB 4RDQG 4JPWL 2NY4C 3ARYA 5EIIB 3M45A 5TF1L 4YAQA 5BS0D 2J6EH 2X9XA 5KSVA 5F7LB 5CKGA 4Z6AT 2H26A 5D9SB 2CJUH 5E6IC 4NKDA 1ZT1A 1XGUA 2NXZD 2R0ZH 2IQ9L 3QP3A 2GTWB 1UH2A 5BRZA 3PWJB 1JZ2A 1YEJH 4R4NC 4O58L 5TDPA 1SBSL 4N0FB 4NC1C 1M05B 2IPTH 1FFOB 1OTTC 3KPSE 1FGVL 4YK4B 2CXGA 5E6ZA 3ZMRA 3IFNH 2WZPD 3ROOA 3MLRH 1QSFB 1IC4H 1CDJA 1S7SB 3IJSB 4LLWA 4IMKC 2BVOA 5F7DB 4XCYA 2YZ1A 2EO9A 3CLEL 4PV9B 2WP3O 5I1GH 1D5MB 2FBJL 3EOBA 4HCRL 4G6ML 3THML 3T1FB 2BNRD 1CS6A 1V7NH 1A6WH 1OARH 1B4JH 2QQNL 1ZGLP 1WFNA 5BW7A 4R4ND 3E6HA 5HYJD 4FQCH 1KXQE 3C5SB 3D3VB 4K3EL 3FRPA 4Z7WA 4GW5A 4S1QH 4U31A 1OAUL 1FVDB 1MNUH 5AG8A 1IBGL 1JGUH 1BF2A 4ACPA 5C08D 3ZT5A 4GOSA 3RHWK 5SWZA 4QRTB 3QPXL 3BRFA 3UCRA 4UTAH 3BJLA 5GXBB 4X6DB 1U8QA 2YWYA 3ME0A 4WJ5A 5DJYA 5I8CA 5DJYB 1OM3H 5I8CB 3RVUD 1EAPB 2VZ3A 3QIBC 4C56A 5FHBL 2XWTA 2DQIL 1JVKA 5DRWB 3FT4A 3PIQB 2GSIB 4X5WB 3RDTA 3CCHA 2RCSH 1EJOH 3T2NL 5MEND 2Z92A 2HLFD 1L9MA 3UX9B 2ZUQB 1IZJA 5HI3D 4JM2D 1T7WA 4PLJD 5HPMA 4OCMC 3LV3A 1CLZH 1P4LA 3HC3L 1L7TH 2C3GA 3RAJL 1KTLB 1AO7D 1WEJH 3V4UH 4B53A 5ITFA 3KNBA 5IB4A 5DD1H 2IPUK 3IAPA 3V7AG 2WIMA 4Z76B 5D7JB 3KPMA 3ZHDA 3KPMB 5KVDH 2DYPA 3S88L 4MD0B 4UINH 2FO1A 5DR5H 3ILPA 3KLHC 4G6KH 5F7NC 3C09C 4PGCB 5EUKB 4KZDH 1K4DA 1KNOB 1RULL 1UCBL 4NYLB 1RUML 2FHFA 4FXGB 2W0KA 3EO9H 4NRYB 4U2ZA 3WCYA 3M1BA 3DRTA 5T1KA 1WV7T 2XRAL 5IOPA 1E28B 2GSGB 1U8JB 2GSGA 5DFTA 4JQIH 2ICWB 3RVTC 1FZMB 3RWJA 3ALWA 3P40A 1D5BA 3MFFB 4R4BB 1AJ7L 4OM1H 4AM0A 3UTTB 3ECBA 1KB9K 5EBMB 4JQVC 2IG2L 2DOCA 4X6EA 5F9DC 1FNLA 4HBCH 4UDTB 1RZ7H 1YMMA 1ZA6B 5E6ID 1NJ9B 5I1JH 1Q0XL 1SHMA 1T89C 4XPFL 4L29B 3WFCH 1EGJL 1T2QH 3ROLB 5L6YL 2JIXB 3U0PB 5ITFB 3VD9A 3KPSB 4R7DB 5ICZA 1NFIB 2JJSC 2Z91A 2KPNA 3ULVE 4G7YL 1AFVH 3AS0A 5ISZD 1CL7I 1VACA 4QXGL 2HTKC 5CZXD 2DDQH 4JN2B 2C26A 2Q86B 5DJAA 3VFMB 3CFCL 4ODHL 4YBQD 2JCCB 1VFMA 3U0TB 3MLVH 1AGEB 4IRSD 5JLZB 5F1NB 2RFXA 3G5XB 1I4FB 3VFGL 1BBJB 3LD8B 1YJDL 2X1XR 5HHNB 4KDTC 1A7NL 5HI4D 1Q9KB 3DYOA 3O2WH 4P23B 4ZAKC 2JIXD 4XBEH 3SDXF 3MLXH 2NW3B 1PD6A 3SE9L 2NX5D 4BH7A 5EN2B 1U6AH 3KHQA 2Z92B 5F3HB 4G6JL 5E6IB 1L7TL 3RAJH 3OXRA 1X5YA 1CG9B 5F21B 1AKJD 4O5LH 3RWHA 4X7SL 2GW5A 1M71A 3K81A 3QRFM 1ORQB 1H3PH 4XTRC 5IMMB 4LSUL 1N59B 4FQCL 4EJ1C 4P2YA 3VH8A 4BZYA 2ICWJ 2X4SB 1RUKL 3V8OA 5GRZA 2BHZA 1U3HA 1ADQA 3GUTB 3WJJC 1V8HA 4QF1A 3F58H 5HHOE 2ATKB 1RJCA 1NMAL 2X40A 1IZKA 2Q20A 3GSUB 3OTTA 4L5FL 5A16B 4X6CA 2XZAH 3QUMA 4WVRA 1T22B 5I2IB 4X0KA 4FQPA 1MRFL 2YD6A 3QIUD 4Z7UE 3QUKA 1TTGA 1T1WB 3NCEB 4E5XB 5CUSH 3CDGA 1DQDL 2OLDA 3BPOB 1NEUA 4HLJA 1QFUL 3PHQB 1CDIA 1OAXH 5IHUH 3C60B 3HLAA 1QFHA 1P9MC 1DVFB 3CSYA 4N1EA 1I1AD 4MVBD 1MHCB 1KJ2B 3QG6B 1U8MA 3PJSB 4EI5D 4NQDB 4PY7A 1DE4B 1I8KA 2I07A 4PY7B 4U1LA 2Q76A 3WUWG 5I1GL 3SDDB 4M7LH 4L3ED 2HT3D 1U3HD 4I13B 4N9GA 1G6RB 4WY7H 4MCYA 3C6SA 3TZVB 2HJFB 4XNYL 4UNUA 5F6IC 3VI4E 4MCZA 1CQKA 4RGND 1UZ6F 2WLZA 2YPKA 4N90E 3OJMB 3C5JA 3BESR 2VDLH 1AD9B 3QCTH 1TJIH 4PBXA 1GZPB 2W65B 3EO0B 5C8JA 1D6VH 1NH6A 1OTUC 3IFOA 1HN1A 5EC2B 4U6YB 2XZQL 1JGLL 2VC2L 4JFYA 2YUVA 4IIQA 2GFBB 3EFFB 4LCCB 2AABH 2W38A 5D70L 2FJFB 1IFHL 5T3ZE 3EYVB 1A4JB 2D7PA 1WFTA 5I1LB 4PRAA 4UNVA 1DQTA 4DZBB 3SDYH 4NZJA 2UVEA 4F57H 3P4NB 2ZJSL 2Y25A 2HKFH 4EXPX 4BKLB 1T1YB 1WAAE 2IGFL 4DW2H 4NFCA 4MHHG 4UT7H 1A1NB 5I1DA 3EDEA 5T5NG 3DX7B 3BRGC 1WCBB 1CFSA 2F53D 1A9BA 4PJEB 5DURD 5FXCH 1G9NH 1RHFA 1PX4A 3ZE0E 1QSEE 4KDWA 3JV4A 5L88L 4R3SA 5LJYH 3QULB 1INDH 1LEGB 1RHHA 2H32B 3MV7A 5AUMB 5D7IF 5B4MD 5KG9A 2GT9B 1JWMA 2Q76B 2Y1VA 5FO9B 2ZKHL 5FO9A 4P5MA 1NFDB 2Y9RT 4ZFZB 2VR4A 1IQDA 1ORSA 3BUYB 5KOMC 4QHUB 3NCMA 2QEJA 4TOYL 4XGZA 2DKUA 1NMBL 2DJ4A 3RVWD 1U3HB 4GH7B 3T0XA 2EDBA 3WFCL 5IW6B 1ZLUH 5MP6H 2DM4A 3WFHB 2V2XA 4Y16B 1INEL 2QADB 5E4IA 4X6CB 1HHHA 1PSKH 4JPIB 2F54D 4U6YA 3NFPA 4XVTL 3CFBA 3HR5A 5HJ3B 3SCMB 2VLLB 4KU1A 4RAUA 2VDPH 3FHQA 4P23C 1W72A 4DUVA 4OBRA 4JHAL 4UAOB 2VZSA 1HOCB 3VWJA 4KV5F 1UXWA 4GKSA 2R1YA 4PJ5A 5TQ0H 1I7UA 4O4YL 3C60A 4F3FB 4AENA 4FXKA 4F7EA 4YLQT 3IGAB 5HYQA 1QG3A 2HH0H 4M9OA 4NQDA 4BM7A 4PJEA 5J12C 1U8KA 5AYUH 5ID1B 1TJGL 5A43C 3O3DA 3R1GH 1BWMA 4JO4H 1YPZA 4G8IA 4ZG1A 3H9SA 4ODWB 3VRJA 3TZVA 3SDAB 2AXFA 1YC8A 4LVNB 3T04D 3CFIC 3T0EB 3K8MA 1OAYH 2AJSH 3QNXA 3OPZH 4DGVL 1U8OB 1FFQA 3MO1A 2Z31D 2V2WB 3S35H 1EGJH 2WWMC 4KAQL 4KK6D 4BZ2H 3TYGH 1SJEB 1JUFA 5DHVA 2R8SL 3TF7C 2R0KH 4JLRA 2Y72A 3O0RL 2DL9A 4WCYH 3O6FD 4LVNC 1SEBB 1RK0A 1JGDA 3Q6GH 2W0FB 4RFNB 4U05A 4JQVA 3MREA 4TPRL 3UTSB 3U9PH 5EPMB 4MNHA 1JNLH 1VEMA 3SDCD 4QRQA 2N7AA 4Q6IB 5EU5A 4PFEA 2PO6A 1NLBL 3CU1A 1ERNA 1AHWA 4J6RH 4L9LA 4OF7A 4FA8A 1E4WL 2CRYA 3LS4L 4FHBD 3TWCH 1FO0L 4LEXH 1CWVA 2FRGP 4QRSB 5FGCB 3V6OA 2PYEE 4E41B 4YDKH 4P4RA 5HHMB 5TQ2H 3MUZ1 5B39A 5DUPH 5GZND 4R97B 3JWOL 2A6JA 2VXUH 3BZ4A 4Y19E 1T83C 1OVZA 3U6RA 3R0MA 3RX8A 3HMXL 1TNMA 1U0QA 4PG9A 4PG9B 3GJFA 4JO1H 3EFDH 1GVIA 2A6KB 3KLHD 1KIRB 3V5HB 4PJ9D 4U3CA 4NQXB 1JHTA 2ID5A 3IDIB 5C09E 4ZSOA 2N4IA 3MGTA 3MLYL 3SEPA 4BSVB 1SY6H 4EN3D 2K7PA 5BQ7A 3CVHH 4PJ7B 2EYRB 1J0IA 3EYFB 4ODTL 1S9XB 3IDUA 5TDOA 4XP5H 5C6TL 3GBLA 2GY5A 1PGRB 4X6CE 5ESQA 1FV1B 2LVCA 2DL2A 1CD9B 1IAMA 2J6EA 3OKDB 5T3ZD 2XZAL 2ZUQC 3QWRA 4KRPB 5E2UH 1UM4L 3SOBH 1ZSDA 2OL3A 3MYZA 1NBYA 2P46B 2IBZX 4NNYB 3WFBL 1J1PL 2OTWB 5EZOH 4G42B 2ICWI 4HK3N 4PB0L 1MIML 1SJVA 3QIBB 5IWLC 4LPYA 1H3XA 5HYJE 2B0SL 1KF9B 1X5IA 3ZL4H 4X5WA 3ZKNC 1TZHA 3MRPA 3HAEA 1T6VN 3HZMB 4P9ML 4HLZG 1T0MA 1U8LA 4FQXD 2V5RA 4OLEA 2R2HA 2FX8H 4TSCL 1GIGH 1SMOA 5DJ8B 3E2HC 1BQHA 2DQGH 5AD0B 4KI1A 4DK6A 4U1SA 1EMTL 3VG9B 2VH5L 4V2CB 4CVWA 1IGIL 4M7ZC 4OCWH 4FFWC 5CZVL 1FVEB 3O0RH 4X80L 5GISH 4YXHL 4W6YB 2UVFA 5ALCL 4ZSOB 2F54B 3FFDB 5JUEH 4QGTA 4P0DA 2AQ3A 3D85D 2ORBL 3MREB 2BVPB 4RAHA 2DQCH 4YAQB 5ESQB 4QRTA 3SGKC 1I8LC 3QNYA 4NKMA 1JIBA 4Y1AD 3IDNB 4NQSB 1F11A 1WZ1H 2DICA 3ARXA 3CVHB 1JFQL 1DP0A 3IFNL 1J12A 1YNLH 5TQ0L 4EUPA 4H0GA 3MRFB 2PW2A 5GGUA 1A0QH 2J8UB 2OL3H 1N6QL 4N68A 4GRMA 1C5CL 4YDVA 4XC3L 1TETH 4MHHI 1S5HB 1EBPA 4QT5A 5GGTA 4G8GD 2ZOKB 4WTZA 3IJSA 3WXVL 1WTLA 2Z35A 3S36H 4MAYA 1P4BL 5DMJB 1T6WA 2MNUA 2XY2A 4N0CA 3KLAA 1CFTB 1J86A 3WFEH 1NCTA 2OZ4H 5HHPB 1NEZA 3MXVL 4X5LA 3Q3GA 1XH3A 5I8EA 4FQQA 4HW6A 3HG1B 4Z7VE 3VXUA 2MCPH 5HY9A 3QUXB 5JORB 4ZOEA 1RI8A 3VI3E 4KRNA 1F4HA 1MRDH 4G6AC 3TT1L 2JB6A 4QYOA 2P7TB 3S3PA 4LAQH 4JPKH 1KXTB 2O26U 1FV1A 1KCLA 5T1LD 1XCTB 1EERB 1IEBA 5E8PA 3QI9D 1IGFL 3TCLA 3Q6GL 5CMAB 1EHLH 3UTTE 3L5JA 4ZO9A 4F7TA 3PGDA 4PYGA 2WQ8A 4Z95L 3I9GL 1LP9A 4FZEL 2V9TA 4NJAL 2VJXA 3VDCA 2JB5H 2X4UB 3O11A 4NN5C 2XN9B 3NMEA 4CMHB 3BN3B 5KS9A 3UJIH 1O5DT 5IM7B 4LPTA 1JHKL 5JIPA 4HGWA 5EZIH 2W59A 3CC5A 4KY1L 1EHXA 1BBDL 4IOIA 5D7SH 1MCQA 2XKUA 4LOUC 1UM6L 4WW2A 1FFNB 1X5LA 4NUGH 2EIBA 4NQUA 3KYMB 4N8CL 3CX5K 1EIBA 4N8PA 3TZVD 2OJEB 2VR5A 5I1AB 4UU9A 3BT2L 3KPRE 1KTLA 3OV6A 2D0HA 1GOGA 3KG5A 5IMOA 4LDOB 2OJZL 2AJUL 4LMQE 4QO1A 3G6JF 3PV6A 2VDNL 4CL7A 5KTEL 4GKNB 3HZVA 4XX1G 4UT6L 1AC0A 1MVUB 4LBEB 5J6GB 5E9DD 4HX1A 5HSFA 1ZXQA 5CILH 4OUUB 1JTPA 1SBSH 1XR8A 1C12B 1C12A 1QLRA 4ELMF 3VG0L 5DVLA 1NLBH 4J6RL 4RGOL 3CNKA 3EGSB 3WV0A 5MHSE 5JXEC 3BH8A 1E27B 3LRSB 4IDJH 3FCTA 4XP4H 4RWHA 4DCQA 3HLAB 3RY5A 3FFCD 4OJFL 4KTYA 3VXUE 3QUYC 2B5IB 3G5VA 1X6NA 3H9ZA 5GGQL 1MRCH 3L3KA 2N1KA 3VXRA 5IQ9A 2HFEB 2Q8BH 1CF8H 3IYLW 3QYCA 1JPSL 1WSST 2KQMA 5CWSB 3FB5B 3QRGH 1RZJH 2QHRH 3VJ6B 1MFNA 3O41B 4CN4A 2YD2A 3X14B 3BEWA 1TTFA 4IDLA 2NNAB 4FQQB 3Q5YA 1UKQA 1IGML 4PRBA 5LCVL 5JUEL 4YHML 2H41A 1UZ8B 1JF5A 3MXWH 4PRHA 4U6HB 3HE7A 4P99A 3BO8A 5ACMA 1U8NA 2GUOB 3P4OA 3VXMD 2A0LD 1DR9A 5IBLC 4X0KB 1QSEB 4Z95H 4HV8A 4LNRA 3VMPA 1VPOH 1ZVHA 4PRDB 3G6DL 1IGCL 5BV7C 1VFBB 3TV3L 1F4YL 3V52L 4HJ0D 3O2WL 5D1QA 2NW2A 1CXLA 4JPVH 5ISZB 1NFDE 2X44D 5ANME 4XB8A 5FYJE 1SJHA 1I9IL 3OB0K 12E8L 4GXUN 2BOBA 4M1CC 2IH1A 4XCCL 3UBXI 1MREL 1KB5A 3BKYL 4JRYB 3S5LG 3S36L 3SGKA 4JRXA 1MCJA 1NGYA 1OTSD 2WBJC 2DQDH 1XF3A 2VKXA 4JO3H 3QXDA 5E8EB 5T3XH 2VLJA 1KENH 3PP3H 3NIDF 2WM0A 1VGKB 3BH9A 2M8XA 4PJXF 2P5EB 1I3VA 4PRNA 3RPKA 3NA9L 3P73B 4HZLA 2D0FA 4Z7NE 3VI3F 5CLTA 1FZKB 3SGEI 4NKIH 3IXTB 2FD6H 5EUOA 3KPNA 2R69H 3N9GH 4KQ4H 3C2SA 3SPVB 4JPKL 4JM4L 3E2HA 1S78C 3RWFB 4L5FH 5CBEB 5CSZB 4DKDC 1AGFA 1CDBA 2FO4A 1DBBL 4PJIB 2X4TB 1PEWA 3RQ3A 1DEDA 2O61A 5DRZA 2B2XH 2VKWA 3DUSB 3LN5A 1E4XH 3DVGB 4M8QA 4DKEH 1CIUA 1TXKA 4NCC2 5EFIA 1M7DB 1CFVL 1N4XL 1KIQA 3PABB 3QQ4B 1WF5A 4KI5E 2ARJA 3EO9L 4GW4A 4NDMA 2C3HA 4YO0B 3WHXA 1CBVH 4LLVA 3RZCB 2HKHL 3QUMH 2EC8A 4PGZA 4FQIH 1BD2D 1I3UA 3MNZA 5E00B 5CD5D 5GRUL 5JNYA 4P57A 3ISWA 4L4JA 1NL0L 1A47A 5ESVB 5DMKB 3KWWA 4HJJL 3KWWB 3G5YA 1I1AA 3MR9B 3GRWA 5H94A 1YUHA 4IHOA 2DWEB 1HSBA 2DB8A 4ZUTB 2C3XA 2OSLB 5C0CB 4NGHH 4FTVE 3VG9C 1MLCA 1K8IB 2P49B 2FDBP 4NHCL 2AJZB 4WWKB 3TNMA 4CN1A 4N1HB 5DVNA 4LSQL 5D2NC 3ORJA 2WY3A 5C0FA 2R23B 5F1IB 4OZHF 1JE6A 5C9JA 2CIKB 1MFBH 3GMQA 5E2UL 4QXGH 5HHOB 1AFVL 2PW1A 3STBA 4KUCD 4L8SB 1RZJC 1CI5A 2A83B 2FHBA 1KCVL 4G6KL 2OL3B 4YH6A 2G9HA 1KB9J 4CGTA 3BIKA 3LMJH 4HDIB 2WUCL 1NBZB 4Z7VA 4XPGH 1C5BL 2VSDA 4H20L 1OQOA 3CCHB 4TNWF 5DC0A 1UFUA 2I5YH 1X5JA 1F3RB 5ISZA 2D9CA 1RZ7L 3V0VA 1WITA 1MI5E 3G04A 1LDPH 1PZUB 4LSTL 2ADGB 4PP1D 1A6VL 1T0MB 1U8LB 4KKLC 1XIWA 1U92A 2EECA 4OD3L 4WHDA 1CLZL 3HC3H 5HXMA 4PJFB 3GI9L 1GGIL 5GGRY 2Z8SA 1I1YB 5GGVL 3IVKA 4Y5XC 4GXVH 2X4PB 4LVOC 1ZS8B 3AMLA 1X5FA 5E4EB 4X7EC 1IGMH 3B2VH 4NZUL 5HD8C 2AQ2A 3IDIA 2OSLA 5C0CA 2YWZA 2ADIA 1DUZB 5I19L 2AJUH 1OB1A 4Q0XH 4OD1H 1U8PA 4HJGB 3WD5H 1EEZA 4KTEH 5DRXB 1KB5L 1KNOA 1HSAB 3VFVA 5F1IA 2XWBA 2FR4A 4NUJB 2GYSA 3D85A 4KVCL 1BREA 2R29H 5DK0A 1KJ3H 2R2CA 1J0KA 3MLXL 1G6VK 1JFQH 3E6FA 4PUBL 1QBMH 4QHKI 3DHMA 1EAPA 3T77B 4TSAH 1N6VA 3ULVH 4QRSA 3ARGB 1NDGA 5TGBB 4ONFH 3RNKA 4GW4B 5JW4M 1QRNA 3MRMA 5E2WH 1T4KB 3M8OL 1D5BB 3MFFA 4P5KA 2GITA 1RZ8A 3QIBD 3DI3B 2APVA 1P84K 4PBVC 2WUBL 2X9YA 3GO1H 5EC1B 3F5WA 2VISB 3SQBA 4H0HB 1RURL 1HWHB 3I3EA 1KIRA 5GS1C 1A3RH 4M6MH 2H8PB 5C1MB 5I1JL 4JFEB 4L4TE 5DC9B 3WIHL 5IJKA 1AQKL 4KKCC 1K3ZA 1HHJB 2R9HC 3BZFB 3EW3B 2PR4H 4NN7C 4P3DB 5I66B 3AY4C 1G1YA 1Q9WB 2YA2A 5SV4A 1FYTD 1Q94B 5L8KB 1MI5A 1WJ3A 3P9MB 4GBXA 3MV8A 1G1CA 1FVDA 3U7YH 2EDEA 3LRHA 3PL6D 1ITBB 3CLFH 4GAYA 1BFVL 5A2KH 1E4XL 2IANA 5EPMA 3HNTH 4WW1A 3W9DA 1R0AL 4K8RC 4L9LB 1FL5B 4HPOH 4I18B 2W0PA 1P9MA 2D2OA 4LFHD 3V6OC 2BY2A 4ZPTA 5C09A 1GZQB 2UZXB 1U9KA 4E41A 1X44A 1GRWA 3B8YA 5H2BB 1YEFH 1TVBB 3ARZA 5F96L 2YMXH 4LSVL 5GGVY 3SKJL 4HJ0C 5C0BE 5A2JH 1MJUH 5I15H 2BZDA 3PP4L 3NA9H 3B9KA 1Z5LA 2FX7H 1MCEA 3UP1A 4HKZB 3NOIA 4RISL 5CZXC 3L3JB 3PQYA 5CGMA 1T3FA 5DJ2A 2A38A 3ARBC 1QR1A 5IB4B 5JW3H 2DWDB 4ZFOA 1MCIA 2BHYA 3MX0A 3U1SH 3AC0A 4BA8A 3RL2B 3LPGA 3RL2A 1DBAH 3V8CA 1DBKL 4KK8C 3K74B 5IB5B 3WD5L 1T1ZA 1S7XA 1S7XB 5FM5O 1ACYH 3GRWH 3DROA 3MLUL 1EZVY 3C60D 4G5ZH 3LAFA 2X89D 4GUPA 2IJ0C 3VD3A 3DXAA 2G75A 3O8XB 2I9TA 1DN0B 1RUAL 2W9EH 1FDLL 1JTOA 1YYLH 3QIUB 4KC3B 3GSRA 3G6DH 4J3SA 2RFXB 3G5XA 3QO1A 1A6AA 1CFQA 3FB7A 2WAHA 2PO6C 2C4FT 3HG1E 4OLUH 2XKSA 3SQOH 1QPPA 3V6FB 4MLIA 1G9NL 3VMNA 4WEBH 3K80A 1YNTA 4RA3A 1YNTB 4PJEE 5ABDE 3OX8A 2I26N 1A7PH 3BP6B 4R4FL 3BDBA 3VXNB 1ZHKB 5B3JF 3RU8L 1OGTB 1CDGA 4GXUM 2OXGA 3C5ZB 2P5WA 4JFEA 3O41A 4LCCC 1OP5H 3U0WL 5FA3B 1GHFH 1A14H 1P7QB 5DXWA 1RVFH 1KLGA 1FJ1B 4JRYD 4FQ2H 2JIXA 1KEML 4NN6C 3CX5J 3N1GC 1ZHNB 3VXMB 4PJBE 3HE6A 3HE6B 1CICC 2AI0H 2UWEB 3PV6B 5KAQF 5FKPB 1MH5A 3TZVC 5IESH 1FNSH 4UU9B 3T3PF 1ZHLB 4JY6A 4HMDA 3IFPA 1G9MC 4LBEA 1WT5C 2VLRB 1CGTA 2FJHA 1QYGH 4KHXH 2VLMD 3VXTA 1XR8B 4UQ3B 3ULVD 4JDTL 4MXWL 3TCLB 5IVXF 4GJTB 3C60C 1MCKA 1EA9C 1MVUA 3MCLH 3C2AH 5ACZB 4RFEB 1B90A 1TCMA 4OZIF 1K5NA 4WFED 1BOGB 1CFSB 4M43H 5ETUA 5E1HB 3QIWC 5GGSY 3QZWA 2VXUL 4RMSA 3I6GA 3KS0H 3OBAA 5GGSB 5SWSD 5DTFA 4KHTL 1BBJA 3MJ9A 4RNRA 2H2SC 1MHCA 3GI9H 3N85L 2JELL 4D9RD 1FZJB 5ICXB 4PR5A 3RL1B 3NCJH 4N9GB 4Q9RH 2L0DA 1MWAB 1CLYH 2FL5A 1T3FB 1N59A 1H9VA 1DBJL 3KLAB 1S7QA 2D7QA 2HT3C 1UZ8A 4W4NA 4M3JA 1Z3GH 3ESUF 1T7XA 1IVLA 5I16B 3NIGF 5J4MA 2FBJH 4HCRH 1HDMA 3EUUA 5GS0L 2R0KL 1LD9A 1EAJA 4WDIB 4CMMA 1JPTH 4ELME 1F13A 4PV8B 1AXSB 1H3UA 4JVUA 1KB5H 5GGTH 2WBJB 2FEDC 4GUPB 4K2UH 5DWUH 4XPTH 1B88A 3X17A 5F9AC 3GSUA 5A16A 5J13C 3B83A 3VFSA 5IHZB 4G9DA 4UT9H 2AGJH 1JL8A 4DN4L 5IKCB 5L2KD 1UH4A 5DUBB 3QUKB 2DTML 5BV7H 3A67L 3NVQA 1J0ZA 4JG1L 4J1UA 2XKNB 3CFDB 3L9RB 5CSBA 3L9RA 4X7TA 1KN2H 2NY1D 4EDXA 4LEOB 4NPYA 5HHVH 4BH7B 3MOQA 1TVHB 3JWOH 4BSWA 1FFPA 2DQGL 1A9EB 3MRKA 3CMGA 3BKCH 3EJZC 3MUGA 5I1EL 1GIGL 3RJDA 1LHZA 2A1WL 4ZOCA 4DQOL 1H5BC 1UXSA 5EU7E 5DF0A 4LASH 4NQEA 3TLRA 2HFFA 1E6OH 4OD2B 3SY0B 5MI0C 4NIKB 1VA9A 2R9HD 1JNNH 3MZTA 3FL7A 2AEPL 3MBXH 4MJ5A 5B8CB 3VXSB 5HHQA 5IJKC 3E8UH 4M7KL 3REVB 1I8MA 2X70A 2NY3D 1KEGL 4JZNA 4JZNB 1D9KB 5CBAB 1JWSA 4D2NA 2NXYD 1OY3B 1X6LA 4UMGA 2X5PA 4R8WH 2A83A 5IW1B 1WLHA 4BQCA 3EO1B 4G7VL 3RKDC 2MHAA 2K7QA 1PKOA 4PLJC 4PJCF 2D7TH 2AJXH 3D3VE 1HQ4A 2JK5A 3FQTA 4V3EB 2ZCHH 1PKQB 3VCLA 5D7LD 4TSAL 5JW4R 3ULVL 3D39D 3ARGC 1QFWI 4X83A 4KK9C 4CDGC 4I8DA 1FDLH 1M7DA 5E00A 1JYNA 1QP1A 3GSWA 1F8TL 2B7DT 2NY6D 4OFYA 4OI8A 1YY8B 1OSPH 4EXKA 3GJFB 5TF0A 7FABL 1XF5A 3J7HA 4HBCL 3QDMD 2P8PA 1WBYA 4GRWB 3WJJA 4BUHA 4X7TB 4WHTA 3LQMA 4X6BA 1CZ8H 5IV2B 3EOAA 1YEEH 4G8IB 1CLOH 2CLZB 4I2XB 5GS2H 3MACH 1CICA 3RGVA 4YQXL 1ED3B 5C0ND 1B9ZA 1GGYA 1SJXA 4YHMH 2J6EL 1T89A 3VXSE 1L9NA 2CIKA 1QBLL 2DQUL 1U2HA 5KW9H 4NZRL 5I16A 5CHNB 1OD7A 3SBWA 4YBLB 4GG6F 2EDNA 2SEBA 4LCYB 4JANA 1EH9A 3KYKL 1BEYL 3GJEA 3NACL 5EB9A 5IGXH 1FN4A 2F19H 5CBAA 4KDTA 2BNRA 3DMMC 5FYKL 5BS0A 1BOYA 4ZPVA 2C4XA 3EYUL 3CH1A 4PJ9C 3R8BB 5L2JB 5DO2D 4GRLD 2R1YB 4PJ5B 4TUKL 3X3FL 4WI4A 3KYOB 1CK0H 1FLRL 4P4RB 5HHMA 4PJDF 3OR7B 4OUOA 4DFHA 1H8NA 3M8OH 1WFUA 3K4ZA 3PGFH 1PKQA 3ARVA 1LE5B 4D9RE 4LEOA 2VXSL 4M6OL 4OZGF 3S8WA 3PL6C 2HRPH 2CK2A 5HVWA 3DETD 3H8NA 4HT1H 4O9HL 3ZE1E 4M7JL 4JRYA 4BFIA 2QL1A 1F4XH 4JE4B 5GGRB 1MCCA 5EOQH 4FP8H 4I9WE 5D2NB 3TBWA 1KELH 1GAFL 1ZEAH 4TSBH 2E7HA 3GNML 3BH9B 3D3VA 1MLCB 1H8SA 3IFLH 3F7VA 3C6LB 2NY2D 3SJVB 4M62L 4Z5RB 2F58L 1FZKA 4RRPA 4JDTH 3P11H 1HIML 3OR6B 1CN4A 5EU3B 3ZDYF 1QYGL 3LKQA 5KSVB 3S37X 1F3JB 1RPQA 2V2XB 1FO0A 4Y1AE 4TTDD 2F8OA 1U8QB 3IXAA 4D0CB 2F15A 3AAZB 1AR1D 4OTXL 5TDPB 2YD8A 4KK9D 3RZCC 2XWTB 4ETQA 3DO3A 1QLEH 4UIMA 1PX3A 3B5HA 3HI5L 2AW2A 4Y1AA 3MV7D 1NFDF 5KSUA 5LKNA 3ZKXB 1HOCA 3VWJB 3HMXA 4XMLH 5F9WB 1I7UB 2NPLX 1AXIB 2YR3A 3V79C 1TETL 1F6AB 1ZT4A 3ZKXC 1U95A 1UQSB 2VL5B 3BDYL 3BPCB 2ZSWB 2NZ9C 4CW1A 2OL3L 4YDIH 1WZKA 3HFMH 5F7EH 3GMOB 4X4ME 1AR2A 3HTLX 2XPGB 1TENA 5EOTB 4GRLB 4KY1H 5C0EA 5MENB 3U6RB 2R4RH 2B20A 3SE3C 2WQRA 5AAWA 1P1ZB 3Q0HA 1BZQK 1A6UH 2X7LB 2X7LA 1RUKH 1P2CA 2V2WA 4JFDD 5BW7C 1DBML 1SY6A 3F58L 3V5DB 3QJHA 4D3CH 3CH8A 3PWUA 5B4MC 3MBEB 1VESA 4J3UA 3L5IA 2Z8RA 1D5XB 2AJ3A 1QOKA 5FYJL 2CMRH 1KJVA 4OCLC 4K71B 4K9EH 4PTTB 5DEFA 4B0MM 4AYFA 4N0UA 2CDEB 4F15C 3V52H 1A7OL 1IARB 1VENA 2C3WA 5KS9F 5EO9A 1B0RA 5CJ5A 1D5ZB 3PL6B 5C0IA 4HMCA 2YUXA 4N0FA 1MLBA 3QEQD 3TV3H 3WO4C 5DD6B 5HHNA 5FV1L 3MRFA 2I60L 2V7HA 3BKJL 4POYA 3O9WD 3JXAA 4QTIH 5J11B 4NO5A 4WY7L 5JOFB 1ZGLB 3KAAA 4GKOA 1HEZA 1YEHH 4HKZA 3VFTB 3CVIL 1NAMB 4NOFA 1NAKH 2BVOB 2RAMA 1U3JA 3RTQD 1W72L 1UC6A 1ZLSH 5TH2A 2WBKA 4H1LG 1I75A 1T80A 2OYPA 1RK1A 5HGAB 5T1MA 2AKRA 4NFDA 5K9KB 4HS3B 5DSCB 2EXWD 3K0WA 1TFHA 3MZGB 2VQ1B 3MRLB 5EBLA 1VEOA 3MRLA 5EBLB 3T0BA 2A9ML 1XIWC 2R69L 3STZB 3DYPA 3MGOA 4JFED 5IB5A 1F90L 4HK3J 1F3JA 4XAWL 2R29L 1IEBB 5E8PB 3PF2A 5CD5C 1Q9LB 1QLEL 5F7FA 2QKIB 2QKIA 4HC1L 3GSRB 4OFVA 4HIIA 1NC2A 3JWDL 4XPHH 4X7FC 1HYRC 5BVJB 1WICA 5IP4A 1BFSA 1IAIL 3U4EB 1CDCA 4N5ED 4F8QA 3P77B 1CLCA 1EVUA 2CUMA 3GB7A 4XP4L 2EO1A 3QIUC 1W0YT 3QHZL 4LU5H 5TGBA 3RKDD 1YMMD 5E6IA 3W9EA 4PJIF 3UYRH 3WKNA 4LNVA 1HE7A 4Z7UA 2VIRA 5FA3A 1R3JB 4XNUH 2UWEF 4LOUD 1GGCH 5F88A 2QSVA 3NPSC 3BQUC 4YFEA 3F5WB 4MCYB 3HG1A 4MAYB 5TJWK 3VXUB 1ETZB 2EC9U 4CVZB 3OAZK 4XTRD 2J7LA 3D2UB 5TDNB 3TIDB 2JJWA 2O5YH 3GBNL 2EDXA 5B8CC 3GSQA 1S5IL 4K94L 2W65A 1BIIA 4EKXA 2D03L 1LK3H 2FLRT 43CAB 2AK4B 4JFDE 5JORA 3BP4B 3MOAL 3QEGL 4XCEB 4WV1A 3TVMD 3H3KA 3EFFA 1HKLL 4F7TB 4GO6B 2Q3AA 4K94C 5J1AB 1MI5B 3IDNA 3HB3D 2DQFB 3SDYL 2R56H 3EYUH 1RAMA 1NDMA 1ZANH 3HI5H 1CE6B 5DJCB 2BVYA 3A6CL 3VFUA 3ZHLA 1DANT 5FYJU 3ARFB 1QSVA 3TO2B 1HHGB 5E8OB 3FT4B 5LQBL 3FN3A 2VXVH 4KJYA 4PG2C 5EZLA 3NCFB 3FRUB 3ZT6A 3MV01 3RPIB 3RNQA 2ZOKA 3MV9E 3SE4A 2IPKB 1I7RB 1MCDA 4RFOL 3BGFC 4BFEA 3CD4A 2EDOA 2CR3A 2EDHA 4M7JH 4MAYD 4Q9BA 3RWJB 3DV4A 4Z78A 4ZQKA 5FK9A 3RIFK 1IILE 4IOIB 3TFKC 1VKXB 1BZ7B 1K2DA 4ODVH 3TBVA 4RZCA 2BSSB 5C6WH 5DEZA 1DBAL 1Q1JH 3ARBD 4JQXA 1LO5A 4R96B 5FUOH 1IEAA 3K8KA 4U1NA 2HVKA 2PNDA 1D5IL 1F58H 1YECH 4KXZI 5B8CA 1OAUH 1A6PA 4XP5L 3EYQD 4YC2B 3QJFA 4JRWA 1JMXA 4MAYC 4R7DA 5ICZB 2X4QB 5GZOD 2VQUA 3VI4F 3CPLB 5IW1A 3WFDH 2YD4A 5L2KB 5L2KA 4MDIB 1S7UB 5JO5B 3MQIA 3V4PL 1KTDA 3BP7A 1XGTB 2I24N 5FYKH 1IGYA 1HINL 2WUCH 3DBXA 3MV11 3EFDL 4O4YH 3BDXA 5ICYA 1TNNA 1TVHA 2CDFA 3M1BB 2UY7A 1OAQH 1URLA 1M6OB 4JZJA 4Z9KB 1MEXH 5JNYB 3LVEA 4X9FA 1E0OB 3P9WB 1WC7B 2F5AL 5E5MB 5L7XL 4Q58C 4KUCF 1AKJB 5MENE 4NQEB 1G0DA 1T21A 1IKNA 1HSBB 1C1EH 1P5UA 3RGHA 4OD2A 3SY0A 4UDTA 4OKDA 4LSPL 4ZDHA 4J3VA 3RRQA 3MOBL 5BVPL 2E5EA 2LU3A 3VW3H 1K8IA 4CJ0A 3NH7H 1FNEA 1SM3H 1RIUH 5DEGB 1KPRB 2AERT 2YHGA 2R23A 1DDHB 4PBWD 4M7ZB 5EUOB 3IFLL 4OZFG 1JZ8A 2AK4A 1OM3L 3MLSH 5DVMA 5E99L 3E2HB 2LE9A 1X5ZA 5B21A 3IFPB 4PV8A 2UYLA 1DSFL 2VLKD 4LCWB 5JW5A 5EU5B 2OQJA 5FYKU 1F90H 4G8GA 3TJEL 3VFSB 5IHZA 2MKLC 5D5MA 1KCVH 4RMRA 4OLWL 2Q6WB 3FO9B 4ZMAT 1RZIA 3S96A 5JPMB 2ZUTA 1R5WA 1J8HE 1YEFL 4K7FB 5ACZA 4F3FA 3EKCA 1Y6MR 4V1DB 1EZVX 4WWKD 3SJVE 4NP4H 5HVHC 2F5BL 5ADPH 2B8OT 3HAEG 1XGTA 3D18A 1CGVA 4MNQE 4GQPH 1OP3H 5EZLB 3UEZA 4Y4FB 2DMCA 3QZWB 4NM4H 5E2WL 5H37G 1G7IA 3G6JB 3G6JA 3ARUA 1Q9OB 1XCQB 3DUUA 1KN4L 3PWPA 2OZ4A 3SDAA 5F7EL 5SV3A 3MLZH 1CFNB 3V5HA 3RTQC 1KJMB 1NGYB 3KJ6H 4XPAL 2BJML 4PB9H 5DD1L 2HFFB 4X8JB 5HD8D 4NJ9L 3TN0C 1HHKA 4ELMB 15C8L 1YN7B 2VAAA 4ETYA 5JQ6H 4B5EA 1OF2A 5IB1A 3DSNA 4MJ5B 2VDRH 4LCYA 3L3HA 1FNFA 1S9XA 4S11A 4XC1H 5HHXL 1DUYB 1F3DH 1HDMB 4FFZH 2F9BT 3Q6FA 4QHLA 3ULVF 3LSOB 4OB5L 2E7CA 2QLVB 4HXAH 4HIHA 5E8NA 1F4WH 4L1HA 5ERWB 1JYXA 1KTDB 3TC9A 4AQ1B 5CEYB 4JM2B 1VB9A 5LQBH 1EEYA 2NY6B 3E3QC 3OG4B 4G9DB 4JHBA 4OCYL 5E94B 1UM5H 3N0PB 5DZLA 3C8HA 1RMFH 3EOYG 1MFCL 2BOBB 4KJWD 2ZPKL 5DRNA 2KQNA 5FUCE 3DJ9A 3UC0L 4ZNEA 3D0VA 4P2RA 4EDXB 5ITBL 3AU1A 5F96H 4LCWE 3VU2A 5BO1L 4YDLB 2QQNH 1B4JL 1KEMH 2NX5E 5D7JD 1E6JL 4RFNC 1OARL 1A14L 4NKQB 2OCFD 3EHBD 1JGEB 3NA4A 4CVUA 4PGDB 1XEDA 4FFWD 1AD9A 2E9BA 1UWGL 3ES6A 4M8VA 3W39B 3VFNA 4ODXB 4Y4HA 5FF6B 1ZT1B 4JDVA 2H32H 2VDOL 3QIWD 5FKAA 3UBXB 3K2MC 1P7KB 3OAUH 3DHJA 1EHLL 1YEKH 3ARDB 5EIIA 1FRGH 1DUYA 2HFTA 1NLDH 5BXFA 2GTZA 4LVHC 2MFNA 1S7WB 3HCVB 5JA9A 2O61B 3Q5OA 5C0DB 2E7LA 1U41A 3WNKA 3WIFA 3AS1A 1QBBA 5L0QB 4TTDC 3PL6A 4G43A 5E24E 1KCSH 2ZUVA 2MWCA 5D71H 1M05A 3BXNA 3WKMH 3DX7A 5F3BA 2DYPD 4NUGL 1UA6H 4KH2A 2NY2C 2DF3A 4MMXC 4P5KB 3DO7A 1AXTH 2MKWA 3FQXA 4F37K 5CLWA 1HILA 2BSTA