3ARGA

Ternary crystal structure of the mouse nkt tcr-cd1d-alpha-glucosylceramide(c20:2)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
294
structure length
290
Chain Sequence
NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMPKEDYPIEIQLSAGCEMYNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNDETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWGSLHHILDAQKMVWNHRHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title A molecular basis for the exquisite CD1d-restricted antigen specificity and functional responses of natural killer T cells
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 65
structure length 290
sequence length 294
ec nomenclature
pdb deposition date 2010-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3argA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3argA01
2BRRH 4WVRA 1UXSB 1IT9L 4I3SL 4GKOA 4G6KH 1BVLA 3V6OA 4NUGL 3Q6FB 5JOPE 2P8PA 2GHWB 5LBSL 3HLAB 2C4FU 2YKLH 4AL8H 4KHXH 1SEQH 2YC1A 3RTQB 5IB3A 5I19H 2FX9H 1QHPA 2BNQA 4HCRL 3T2OA 2PXYC 4WI6A 1BECA 4H1LA 1D5IL 3D25B 1FO0H 3WHE1 1PJ9A 3VA2C 5IG7A 3QDMD 1JTPA 3W39A 3PJSA 5JW3L 3WS3B 2K1MA 3LN4A 1BM3L 4U7MA 4HH9B 4LKCB 4Y19A 5I6XC 4DKAA 1J0ZA 3L5XL 2DLHA 2OZ4H 4ZFOA 3SE8H 3VJ6A 4D9QE 2Z8WC 5C0CD 5CSGA 2VDQH 2FYYB 4HUXB 4UT7H 4UUJB 2OS7A 3NIFE 3WE6A 4ETQB 4LCCC 2A1WH 1UKTA 1G7LA 2BY0A 5IFJB 4OCSL 5KANI 1NGYB 4LAQL 1XF3A 3QIBA 1OP3K 4JPKH 1GHFH 1N26A 4NWUL 4J23A 3D3VD 3QUYC 4F7EB 4FTVD 3QWQB 5HI3D 5HVHC 5ICZA 1UM4H 4NKDB 1I7RA 4MNHA 3LKQB 4HMDA 1QSZA 1NGQL 3MA7A 3THML 2NY4D 1MVUA 4RFOH 3HTLX 4WWKA 4G9DA 4BH8B 4PJEA 1I1CA 3L3JB 3LS5L 5KVGL 4TULH 4PJDF 4Z9KB 5IR1B 2HA1A 3LPFA 4QTHA 5EG6C 1I9JL 4OGXH 5JO5B 1Q9KB 3CK0L 3Q5YA 2I27N 4OSUH 2CUHA 3IFPB 1A3RL 1C7TA 3PV6B 4Z78A 4JRXA 4Q0XH 1ONQA 1SMAA 3EAKA 4HBQA 2MWCA 2VTFA 1CE1L 2X4PB 3U0TB 4PRIA 4NBYB 4KZEL 4PBWD 4PJ7A 4XTRD 1LILA 1ZHBA 2R0WH 4QOKE 5A16B 3MRNA 3BEVB 4HIIA 5EC1B 3U0WH 3L7FA 3UBXG 1ZGLA 3TNNA 3NCBB 3K46A 4WHDA 4YHMH 1ADQH 1HQRB 3L95A 5C0CE 3FO2B 4N0UE 3DUUA 1MHHB 1WZKA 3RY4A 1K5NA 1DUYB 2P8LA 3H3PH 4X6CB 3QFJA 5E4EC 5I71B 4BKLA 4Z7NF 2ICWJ 3B2UD 1EGJL 5F1NA 3FQXA 1RULL 1T5XA 1V5JA 5INDA 3RL1A 1GAFL 3WJLA 4FFWD 4X4YA 3CMGA 3CNKA 1YNKL 3D3VE 3MV9E 2DQUH 4FTVE 5DFVC 1J88A 4UAOB 3WHXB 4CRPA 2VC2L 4NQCB 4P2RE 4GT7A 4ORZC 2HJKB 3E6HA 5TDOA 3AS0A 3EYUH 4MS8C 4XNXL 3U79A 1R3JA 1JRHI 2EDEA 3PWVB 1YJDL 1EXUA 1R0AL 4ZMAT 1Y6KR 5CP3H 3REVA 5D7LD 1LO0L 2X1XR 4GQ9H 4HJGA 5F9DC 1KCVL 4OQTA 3W81A 3RGVB 3RHWF 5CSZB 4YHKH 5AWNH 4JFYB 4JFDA 1LDPL 1CFTB 3VD3A 1FFNA 3VXRA 3VFRB 4DZ8A 3IKKA 1G6RA 1NAMA 1Z9LA 5TFSH 1IAIL 3PWUA 1MFAH 2LABA 2PR4H 3ZSTA 3S7GA 1AGFA 5ERWA 3MLPA 2DYPB 2P8MB 5JMRA 1KG0A 3CVHB 4JKPH 1TZIB 4JDZA 2ESVA 2R1WA 1NUFA 2X44D 4JFOB 2X05A 4K71B 5FCSH 4F9LC 5E99L 1C08B 4G6KL 1DDHB 3TN0A 1RU9L 2H2SD 2OBGA 1TMCA 4KUCD 2YKLL 4KHXL 4GUPA 4XPAL 4X6DB 3A67H 4PJDA 1KIQA 3EYVA 5EUOF 1NAKH 1A6VL 2O5XL 4OB5L 4FXKA 4TOYH 3VFMA 3R4DA 3Q0HA 4OF3A 1OWWA 3HAEA 2B2XH 3JTTB 1WWWX 1FO0L 1OGTB 5FO8B 4NO0B 3RWDB 4DN3H 4L8CA 1X5YA 2P7TA 4V1DB 4IMKC 4HJJH 1EV2E 2YD9A 1T5WB 4M6NL 2A38A 3KPQA 4AY0A 4QLRA 3BMWA 4HGWA 2EO9A 4FN0A 1HXMA 4I4WA 1RIHL 1LEKB 1F8TH 2CIKA 2XZAH 2OZ4L 4MA8H 4ZUSA 3SE8L 4M1GH 4AQ1B 3ARQA 2V2WA 5E8OB 1HWGB 2OCFD 5D7LE 3X12B 3ULVD 1LO4H 4XCEB 2A1WL 2XA8L 1PQZA 4Z0XA 1NL0L 4JREC 3QWOB 4F3FA 1GHFL 3I50H 1CDYA 3T0EB 2GTZA 5A40E 3AREA 1XF5B 3FHAA 3AMKA 5EIVA 1CD1A 2CDGB 5ITFB 1UM4L 3MGTA 1U3HA 1GL4B 3GSXB 1IGFL 1ZGLM 4NC1E 4M03A 1TJHH 1I1AD 3MXWL 2OTPA 3TFKA 4RFOL 5GRYA 5E6ID 2OQJB 3FT3B 5JR1L 5DI8B 5F8QC 1HQ4B 4WW2B 3O0RL 4TULL 3MLXH 3OJ2C 4PRPD 2ARJA 5MHSD 4FXLA 4QHLB 4OZGB 1XGPA 4L4VB 4Z18A 5JPNB 3ZHKA 5GRVL 3B9DA 1DCLA 5D1ZC 5MEQA 1LDSA 4NN5C 4Q0XL 3U9UB 2A6DA 1WISA 2DJSA 3EYOB 5HYQB 2R9HD 1T66C 1ZLUK 4N0CC 3QRGH 1O0VA 4GXVH 1JGUH 4NCDA 5D9SA 3WDHA 2AXJA 1XZ0A 1IQDB 1F6LL 5HHPA 4LCWD 2YUXA 4CN6A 1IGJB 3QEQD 5EU6B 4YHML 4ZO6A 5FM5M 1ADQL 1NCCL 1BVKB 2AXGB 3GJFK 4Q7DA 3VE0B 5DD0H 4PB9L 1GSMA 1GXEA 2XTJC 4GG6E 3I2CH 3CDYA 1VFOA 3L3OA 4N0YL 3U30C 4S1QH 4PRHA 4E41A 3DX6B 4R2GC 1EK3A 5DRNA 5EH1A 2GK0B 3TCXA 2BC4A 1X7QB 2BOCA 4IIQB 4EQ3A 2AXHA 3N9GL 3WUZA 3MRCB 1DBBH 1MELA 4RAVB 3MNWB 4XXDB 3VCLA 1RMFH 2ATKB 3MV7E 1URLA 3FFCB 4L1DA 4YDJA 1HYSC 1NCBL 4U1KA 3OG4B 1JFQH 2NY6D 2BVYA 3DIFB 1YEFH 4IRSD 3PHQB 4ZUUB 4P49A 3GSNA 3UTTA 5DRWB 3ARBB 3C60D 2UWEF 4PRPE 3VFVA 5MHSE 4J1UB 3IDUA 2R1YA 2VDMH 4FMFA 4FA8A 1BQUA 3L1OH 2Y9RT 3FB5A 1WC7A 3F6LA 5SWSB 2R0ZH 2F53B 2HFTA 5LQBH 1HH9B 1MPAH 2AI0H 4RMWA 4K7FA 4UQ3B 1KTLB 3LKSA 4LHUG 1OGAB 1MRFH 3RTQC 3KJ6H 4HG4J 3BOVA 2QADD 4K8RH 2D2OA 5E95B 1AP2A 1QKZL 1CDGA 2ZCLH 3BVNA 3GK8H 3AAZB 4XCYA 3QEQE 2ICEA 3QHFL 4XC1H 1T2QL 4G8FB 1VPOH 3QG6B 4OUUA 2FZ3B 4XCNA 4Y0GA 2QQKH 5DK2A 4UIKH 3CAFA 2JCCE 3S3SA 4PIRF 1H0DB 4X80H 5D6DA 5JQHC 3QI9D 1FBIH 5EOCJ 3A67L 1I9RL 2YUZA 1KC5L 1L4IA 1MHEB 3FN0H 2FJHA 5EPMA 1DLHA 2IAMD 1YMMA 3SDXE 2ZG1A 1KN4H 1CFQA 4XB8A 3WS6A 3MRMB 3KNBA 1XIWA 3M17A 4HJJL 3TZVD 2EDWA 3CVHH 1MIMH 1DSFH 1T03H 1C1EL 4U2YA 5ANME 1NC4B 1D5BB 5GJTH 3K8KA 3CXDL 1FZMA 5K9OB 4KROB 2NY5H 4XHQA 2FECI 4MA8L 4OLXL 4W4OC 4M1GL 1ZA6B 3D2UB 5B4MC 1BFVL 1Q9LA 4DCQB 4CN4A 1IC5H 4LLAA 1F00I 2EDTA 2DI9A 2GK2A 1AXSB 4IDLA 2MTPA 5DHXB 3RL2A 3O2VL 4BH7A 4QXGH 2RFXA 1TZGH 2BNRA 1WITA 3MRBB 3UZEA 4GW1B 1QSEB 2A9ML 4MAYA 1Y18A 3M45A 2XY1A 3UZQA 3T8XB 2FDBP 1GGTA 1A6WH 4KJWD 3RX8A 1TJHL 5FGBC 5HPOA 2GSIB 3T4YA 4K3HA 3IU4H 4X7FC 3MBEA 4PJ8B 4DVBB 2OR7A 3K8MA 1M7IB 1S9XA 2EYSA 5JORA 2Z31A 2YBRA 4O5LL 4LF3B 2WBJB 2ZUSA 3VWJB 2XKNA 2UWEA 1D5XA 1U36A 3QDMB 1IJ9A 4RAHA 1MF2H 3SGKC 1AC0A 5CEZE 3QCVH 3LCYA 3SKMA 4I2XA 1FLTX 2NY0D 3HZVA 4PV9A 5I71C 5DJ8A 3TBWB 3ZKND 1JGUL 5MENE 2VSCA 1U8JA 3HB3C 2E7HA 4U3XA 4D3CH 3GBNH 1A7BA 1B3JA 2WMPA 3EOAB 5INCA 1ZTXL 1JL8A 5A1AA 4OCLC 1NBZA 2YPLB 4A6YB 4B50A 4Y2DB 4UAOC 1CG9B 4UQ2A 2HKHH 3TGXA 1HE7A 2YRLA 1QLFA 5BV7L 2FHBA 5C70A 5TDPB 4JO3L 4YK4B 4QRRE 4K8RC 4S1QL 1S9VA 1L0YA 5CJXA 3GSRB 4HIHB 2VWEE 3RNQA 1EHXA 4OAWB 3MUY1 2Z93B 5HI5C 4YAQB 5BW7C 3BH8B 2BSED 3RBSA 3DJ9A 3B8SA 3WIHA 4PJ5D 1OAKH 1RMFL 4D0DB 1FYTE 1F2QA 3LB6C 3RAJH 2BY3A 3RGVC 1JFQL 4ELMF 5JW4R 3TA3D 2VLJD 5IMOB 3BIAX 3OKLB 4ZQKA 1XH3A 1A2YB 5H35A 2HT2C 3W2DL 2XRAH 4ZOAA 4O58H 4L3AA 1QFWI 2VDML 3FT2B 3PWPA 5I8OH 4RSVA 1E27A 1BJ1J 1JPSH 2H32B 4R0LB 4K3DL 3TYFB 1HI6B 3OB0K 4AEEA 2VLKD 4HIEA 4K71C 5LQBL 3P30L 4DAGH 2A9NH 4F57L 1S7UB 2WIIB 1H5BA 3ZTJG 2NY5C 1T2XA 1FL3B 4M6AA 5HD8C 3EOTH 3F7YB 1MRFL 1TJGH 3KJ6L 3VD4A 5C0GB 4EEEA 4K8RL 2J1KA 4BELD 2ZCLL 5IVXA 4OZIE 2PTUA 2ZKHH 3HG1B 2XG5A 4RA3A 2MOVA 1V7NH 3RWCB 3HRZA 5JPMA 5KAQF 4XC1L 3KPRA 4ZFZB 4OLUL 3SKOA 5T1DL 3CGTA 4Y5XA 3MUZ1 3QCTH 5TGBB 4TUOA 5KSAB 3PG2A 4LVHB 2J8OA 2PNDA 2QQKL 4UIKL 4NHUB 1I8IB 4WI9A 2X1OA 4X80L 4L29B 1F90H 1J7VR 1P9MA 2D7QA 2UYLA 1E4KA 1EMTH 5DJCA 1HCFX 3FN0L 3ZSSA 3QISA 4NQDD 1KGCE 2E27L 4HK0A 4QYOA 2HWZL 4M7JH 1A64A 4ZOEA 4PJ5E 5E00A 1MCQA 1NFKA 5HGAA 3FO9B 3DV6A 5IJKA 1H8NA 5D1QB 5D7SL 1EAPA 1XGYL 1T03L 3CXHJ 1XAUA 1ZT4A 2VLJE 3T0EC 2H1PH 1IEBB 4ZUTA 4PJFA 3NIDF 2DQFA 4PP1D 2CMRH 4LPXA 3RDTA 3PWNA 5B39G 3QPXH 5GGRB 5JIKA 5IVOA 4AIZB 5LJYH 2DD8L 3P9MA 3QEHA 4YPGA 2OX5A 1DVFD 4HAFA 4CVZB 4PYGA 4RAUA 4M6OH 5IBLD 4QXGL 2VLKE 4I0PB 4X7SH 4X6BB 1E6OH 4OGYH 2YXFA 4PJCB 4WW2C 1J10A 3G5VB 1I7UA 3BP5A 1FLRH 5F3HA 5BRZE 4IHOB 3TBSA 2XNAA 1HOCB 3WCYA 3ZYZA 2YD8A 5EU4B 1A6WL 1BQLH 2V9QA 4PJIB 5C0BE 4UIMB 3B5HA 1B6DA 5DJYA 3P4MB 3PL6B 1NUNB 3DSNA 5F9WB 4LPWA 2AEWA 4RRPA 4M1DL 3CCHB 3HMXL 1BWMA 2Y1VA 4ELMA 4OLEA 3SOBL 2X4OA 1WT5C 5CMAB 4Y89A 1JHKH 3NA4A 3T1FA 4PY7B 4DEPB 3FHQA 3M1BB 4HWEH 3MMEB 4DTGH 4LP4A 2X4NA 3DARA 3MUGA 3QCVL 5D1XA 4GRLA 3AS1A 1CCZA 1YEDA 4YNYB 1HHHB 3AXLB 3Q6GH 4MAUH 3MV8A 1IM9D 5BXFB 3VXPB 4MDIA 1PY4A 1BBJB 4OCRH 5AD0A 4D3CL 3GBNL 3NOIA 3DHJA 4Y4KA 2IH3A 2VB5A 1AIFA 4MA3A 5DJ0A 5F71A 5ECJE 2R2BB 4IIQC 2X4QB 1Z0NA 3MO1B 5CZVH 5I66A 3FQTA 2FATH 2HT4C 1RHHB 2V5SA 3LRSB 5GZNC 3W11D 1WBYA 4X99B 1WBZA 3W9DB 2FR4B 2G60H 4XP1H 1KBGH 4NPYA 1B4JL 4HHAA 4GKNA 4UBDC 3V7AE 1RHFA 4LLUA 5GSRB 1WWCA 3ULUD 3ARBC 3HE6A 1NMAH 4I1NB 5CJQH 1H3UA 5B8CB 4MWFA 3G5ZB 1IAOA 3O6LL 4HDIB 2RCSH 1FZOA 1G7JB 1EIBA 1U2CA 3CSPA 4NIKB 1OAKL 5E6IB 1E4WL 4LRNL 5DJDA 3RAJL 1OWRM 3BD4A 3GRWL 4LK4A 3BJLA 2CGRH 4BFIA 2PW2B 3DI2B 5FYKU 5L6YH 1XF2B 4A6YH 2H2PD 4Y4HD 4EBQH 1W0YT 2AJ3B 1N2RB 3MRJA 3BPCB 3VDBA 4O58L 5I8OL 1M7DA 4MXQC 4OLYL 1JPSL 3GSQB 4U1JB 3HPLB 1T22B 4P3CH 1NFDB 4JY6A 1KB9J 5KZCD 3GBML 5JDSA 2IH1A 2A9NL 4DAGL 4ZUWA 3RVUC 3SDAD 5EO1B 4WV1A 2VXVL 1KJVA 3EOTL 1EJ6A 2G75A 1TJGL 2OP4L 1JWMB 3MJ8A 4D8PB 4U1NB 3DVIA 2NYYC 3R0MA 1T83C 3BFOA 1A1MA 4XZUA 3O2DA 1E6JH 2YSSB 4UZGA 4QGTA 1YY9D 2AAVA 3RWGB 1U95A 5KJRL 4KRPD 5F7WC 3QXAA 1A5FL 4MJ5A 1OTSD 5A2KH 1TQBB 2KQNA 3I84A 4U3HA 3I02B 2H32H 2XQYG 5GRUH 1ZLWH 5LAXA 3UYPA 4OUOA 1S7QA 5F9AC 4LPVA 1B9ZA 1EMTL 4KROC 4YHOH 3V5DB 5EUKA 4JDVA 2EKSB 5I17A 1P6AB 4U6XA 1CFSB 4M7JL 1CR9L 4J6RH 4JY4B 4NC0B 1X5GA 5CBEB 1M71B 3UJIL 2BNQD 1HYRC 2E9JA 2K7QA 2MFNA 4IRSB 3RNKA 1MUJA 1BEYH 1MFCH 1RIVL 3D1MC 1D7FA 1RD6A 1FGNH 3C60B 1DQQB 5EZIL 3MGOA 4WFFD 3AS2A 4OZFB 3DX9A 1YPZA 2H1PL 1P7KA 4NO5B 4ONHB 2AJYL 3B9EA 4B7LA 3P4NB 2ICWI 4G3YH 4Y19D 2W0LA 2XICA 5FYJU 5DMJB 4GRWF 1CFNB 5KN5B 1LE9A 4P2OA 4ZFFB 3UYRH 4PJ8C 4WFGD 3RVXC 1VACA 2FBJH 2WBJC 3IDYB 4AM0B 1UKQA 3VWJC 1XCTA 4J4PC 3MRHA 3MLUH 1OP5H 4LGRB 1VGKA 3QIBD 4GW5B 1A9EA 4LLVB 1VHPA 3QUKA 2ZPKL 3VFOB 1ZSDA 1DN0B 1BF2A 5KANG 1YYLH 4Y1AA 3LD8B 1MQKH 4MQSB 4UB0H 4BFBD 2R0KH 2R2HB 5K9JH 4I18B 5C0JB 5C2BL 2JJTC 1MH5B 1KFAH 5IHLB 5DEGB 3OR6B 2VL5B 1HSAA 2WK2A 4YHZH 1IZJA 2YPVH 3MOQA 4LSRH 5BS0D 3AY4C 5GRJH 4WWKD 2OLDA 4HWEL 4WY7H 4DTGL 4G7VH 1S7XB 2BVUA 4Y2DC 4WEBH 5I1AA 1N6VA 4YHPB 3HPJB 4NQEA 4AIOA 3B5TA 3C2AL 4D0BB 1HZHH 4YK4C 4OV5A 4LQFH 2CIIA 3Q6GL 1MQ8A 1JP5A 3VXUE 1VCAA 1UB6B 4OCRL 4JRXD 4HIXH 4CL7A 3LOWA 1ED3A 4Z7QE 5IT2L 1UZ6E 3RP1A 2FSEB 4PRID 1UEMA 5ITBH 4FP8L 2VRAA 4Y8DC 4WW1A 3QT2A 4EXKA 3IXTB 5CZVL 4F7CA 2WBWB 3BIKA 2FATL 4LVNB 1PEZA 5I16A 4DW2H 2PTTB 1T7WA 5IVNA 1U93B 1NCNA 4I0KA 4XP1L 1CVRA 2QSCL 1KNOB 1SYSA 3VFTB 2EDNA 2YPKB 1AXTL 1FZJB 4G42B 5IBTL 5MERB 3E3QA 4HV8B 5HGHB 4FFYL 3VXMA 4R0LC 3LN5B 3BEWA 3IAPA 1HK6A 4HG4K 4HCRA 5L6YL 1RJLB 1NLDH 2GT9A 3NCMA 2EXWC 5C86A 1CDBA 4EBQL 2PN5A 4H0HB 4DVRH 1Z5LB 4P0DA 3D0LB 4NO3B 2EKJA 4HUWA 1C16A 4WUKH 1BJMA 5BS0E 5FYLL 1M1SA 4W81A 3IDIA 4FZ8L 5KVMC 3FB6A 2AEPH 3MRKA 2NY0B 3JV4A 4NRXA 5KSAC 2X42A 4LVHC 2BCKB 4QRPA 1NEZB 1LVEA 1HHKB 4JQIL 5TE6H 1G0DA 3C8KB 2NPLX 1L9NA 2EH8H 3GEWB 5T3ZL 4QHMA 3BESR 2QKIA 4JFDD 4P5TA 4A2LA 3WJJA 5ACZB 4W6YB 3EFFB 1KCGC 1EDQA 5D6CA 2BNUB 4RGND 5E70A 2QSVA 1D3CA 3S35H 5HGDA 4NZRL 2EICA 4RMRA 2D31B 4WU5B 5FUZH 3ZL4H 5D1QC 5HYSG 7FABH 3C5JA 1HILB 3P9LA 4NC2B 1S5HA 1WFTA 3LQZA 5FGCE 4UV4H 1ZXQA 4P2YA 2P43B 2VDRH 3JWOH 3TN0D 3AGVA 4K55A 2X1PA 5IW1B 1B0GB 2NX5E 3MX0A 4IMLA 4ZTOH 4UU9B 4J6RL 3T0BA 1DQML 4Y5YB 4Q9RH 1X5FA 3TA3B 3KYKL 4UDTA 2EDKA 4U6YA 4X4XB 1LE5A 3TJEH 5E7BA 5DVMA 4XWOD 4CU8A 4I0PC 4R3SA 5DSCA 3SBWA 1PZ5A 1H3PL 4FFZL 2FIKB 4L4TA 4JHWL 4G3YL 5FCUL 3GNMH 3V95A 1ORQA 1MJUL 3QG7H 4BA8A 5E9DE 4JFHE 2FO4B 3PL6C 4XP6H 3FMGL 5F9WC 3O4LA 1PY9A 1FJ1A 5I1IL 5KSBF 3S36X 2V2TB 1PKQA 3BPLB 2FBJL 3PP3H 1TXKA 3RIFF 5LGJB 3KVQA 2ITDB 2DQTH 4OD3H 4MHHI 4IOFD 2X9WA 1HHGB 4DEPC 2ORBH 1EGJA 2A74A 4TQEH 1YYLL 3ARED 4FXGB 4LLDB 3DRTA 5BCAA 3NFPA 2R0KL 3O11B 3GMPA 2B4CL 5K9JL 5SX4I 5HDBF 1KFAL 1SHMA 2VABB 3R0NA 2GQHA 4OLWH 3O3BA 2KPNA 3TFKD 3O41B 1T7YA 2X70A 4LSRL 1R3KB 43C9A 4WY7L 3I3BA 4Y4FB 1SYVA 4WEBL 3MCKB 1UWXK 5HHME 3MJ7A 2NNAB 4NKMA 2JKXA 3PQYB 1X5IA 1VDGA 3F5WA 4LQFL 4X5WA 2X4SA 2NZ9D 4QRUB 1V3MA 2Y07L 2FX7H 2R56L 5DT1H 3ECBB 5B8CC 4Y16A 3RZWA 5KS9F 4HFWA 1U8MB 2ZOKB 3LKOA 5FKAA 1QG3A 3TWCH 1NGXB 5IOPA 3CC5B 5E6IC 4DW2L 1SY6H 1NJ9B 4X4ME 4PYHA 4TVSa 1NSNH 4U6VH 4E5XA 3V6FB 3BE1L 5DEFB 3RUGB 5I2IA 2OYPA 3MFGB 1AGBA 2OL3L 4FQHB 2YD7A 1TVHB 4DGVL 3T77B 3TCLB 4U1HA 4CDGC 1MHCB 1QFOA 2DL9A 5DRZB 3IS0X 4NBXB 3TM6A 4E41D 3DVNB 4EVNA 2WP3T 4BK4A 3G6AB 2R9HC 4Z7OF 2C3VB 2WBKA 4R7DA 1MIEL 2IFFH 4POYA 2EIZB 3JWOC 5C0AE 4PJHF 1FO0A 2BSTB 5HHOA 2FL5B 2RHEA 3JXAA 4NT6A 4Z7VF 2AQ1A 1RUAH 4LOUC 3OWEA 3BO8B 3UTTD 4B5EA 1FRGH 1HHIB 2AEPL 4XCCH 5I73B 4HKZB 5EBWA 1IM9B 3AVEA 4Q74A 1TQBC 2BRQA 5EZOH 5TE6L 3LEXA 8FABB 5JNYA 2P5EA 3EZ8A 5KSVA 5KSBA 1ZHKB 4DKDC 2ZZUT 3QNYA 5E5MA 3VH8G 3BWUC 1SJEA 4LDLB 3K80A 1RVFH 4MX7A 4XI5D 4LSPH 5HDLA 5IB1B 3CXHK 1FGVL 1R3IL 1KPRA 4IRSC 2PYFA 2J6EH 2IBZY 5HYJA 4QY8A 1BFTA 4MD0B 2GI7A 4G6JH 7FABL 4OIBA 3C60C 3PE9A 4UTBH 3HZKA 3UJJH 3X3GH 1J8KA 1DQTA 1INQB 1NMBL 1ZS8B 3F58H 2VDRL 4OZHE 1XCQB 4L5FH 3RIAF 1KJ2H 2YUVA 5CEXB 4ZXBA 3MNZB 4ZTOL 1S8DA 3MLSH 4APQB 3MJGX 5IF0B 4OTXL 4ZDHB 1C5CH 3I3EA 3MR9A 4LKXA 2DLGA 3MNVB 3RI5F 3TJEL 1J8HE 4HLZH 1MVFA 4MJIB 5EUOE 3EJJX 2DQHH 3DVGA 1YMMD 2Q8AL 2W59A 1ZHNA 3OQ3B 4RX4D 1S9WB 4WUUB 1OY3B 3SDYL 5I1EL 4NHCL 1XIWD 2FJGB 2Z35B 3BUYA 2Y25A 3DX7A 3EBAA 3IDYC 3PHOA 3VRIB 3NA9H 3HCVA 4PG2A 4TNVK 3ZMRA 3QDGE 5CHNA 4HWBL 1LK2A 3VRLE 5KZCB 5KS9A 1RIUH 3QG7L 3ALXA 4P2QA 1EFXD 1T1ZB 2ZG3A 4MCZB 4XP6L 3LD8C 4AH2A 4XBEH 1PG7W 3CUPB 5IMKA 5JOEA 4I18C 2BFVH 3T3MF 1NGWB 4YC2B 1I4FB 2I60H 1T1YB 3FN3A 3NABH 2DQTL 2YZ1A 4OD3L 3OKOA 1OTUC 3WFHB 3F12A 3WN5B 4X9GA 4H1LG 3HS0B 3MRQA 2ORBL 1CLOH 1I85A 1MCFA 1MEXH 5I1HH 2A6IA 1NBYA 4MAYD 4PD4K 3DV4B 5I76B 4OQ1A 3QUML 3RKPA 4ZAKD 2XZZA 3C5ZB 1BVLB 3QZWA 5C1MB 4PJXA 5JMOC 3AFLA 3RGHA 1IAIM 1MY5A 2P8PB 4NNPL 2H3NA 3CX5J 3KPSA 4PJHA 3P40A 4BQBA 2F15A 3X3FL 3SKUD 1T1WA 2IGFH 5IB3B 4OI8A 4MJ4A 3LV3A 2LU4A 4NKIL 3BI9X 2PO6A 4Z7VA 4G8IB 2GJ6A 2Z31D 2XN9D 1P5VA 1OT1A 4DKEH 5HGGS 4H1LB 4LVNC 4QO1A 5FYKH 2QHLA 5B22A 5IG7B 3U1SH 3W39B 3PJSB 1CIDA 5DQ9A 4UDUA 3IDMA 1JNNH 2FX7L 3LN4B 3U7WH 2CO6B 4MNQA 4M7LH 4LDEB 4OCMC 1ZLSH 3T65A 5CZXC 3WIFA 5LWYH 5AZ2H 2X2YA 3O9WD 4KJWC 2JELL 4P23D 3MROA 2A0LD 4ZFOB 3VJ6B 4JRYD 4IOIA 4MQXC 3Q2CA 1JWSA 4U6VL 3WE6B 4OLZH 4YZFF 1PAMA 3IXAA 3ZE2F 1G7LB 3RWHA 4HWNA 4Z6AT 2VQUA 3R1GH 1XF3B 2DQEH 3QIBB 1IKFH 4Z5RA 4E0RA 2J8UA 1KB9K 4JN1H 4IBLT 2C3GA 1U8PA 1LHZA 1DJSA 5ICZB 2NY0C 3KAAA 4LMQE 1QOKA 3D69A 5CGTA 2J12B 3MA7B 5GGRY 1KENL 5CINL 3ZKMC 4OIIH 1MVUB 2Q6WA 4WWKB 4G9DB 3EO1A 3VGBA 4PJEB 1OARH 4BSVA 3F8UB 1NUGA 1RY7B 4FFEX 2VE6A 4PJGE 1G0YR 1KB5L 1XF1A 2YA2A 5GGVL 3L5HA 4QTHB 4C83A 1FRGL 1N59A 4X7DC 1G9MH 4H8WL 4X7TA 2XN9E 3QQ3B 3Q6FA 1A7OL 1ZLVH 3SJVE 3HLAA 4Z78B 3PWPD 1JF6A 3VI3F 5EZOL 1ONQB 1KCSL 4N5ED 3RQ3A 1J8HA 3G6JE 4PRIB 2J4WL 5GRWA 3S4SA 2WSKA 1XGQA 4PJ7B 3MCLH 2CQVA 1ZHBB 1DUZA 4JVWA 4HIIB 1X4XA 3L7FB 2HRPH 3RWIB 1ZGLB 3TNNB 1QBBA 3OXRA 4QRTA 2BVQA 1RVFL 1I7ZA 3L95B 4Y5YC 4N8VG 4JRYE 3TA3C 1FAKT 1ZWIB 3DUUB 3TP4A 4LKCA 1K5NB 2P8LB 3KPRD 3X3GL 1FG2A 1BZ9A 3QFJB 2FRGP 2VLME 4BKLB 1AI1H 1RUMH 5F1NB 3FQXB 1T5XB 1MCWW 1KJ2L 4UV7L 1XF4A 3RL1B 5INDB 5IB5A 1N6UA 4HUXA 1TITA 1OF2A 4UUJA 4X5XA 4X4YB 1F3DJ 5T5NG 1L8JA 5F88A 4LEXH 5DHVB 4K7PH 5IFJA 4KJQD 4J8RB 4M3JA 4KWUA 1UH4A 2BHUA 3E6HB 5C9JA 4P48A 3U9PL 2DQHL 5TDOB 1KCUH 3BPLC 1R3JB 1J5OH 1LP9E 4F7EA 4GS7B 4LNRB 3FONA 1EXUB 5L0QB 1KJMA 3QQNA 5E0QA 4TNWF 4RMQA 1RIUL 4MA7H 4Q97A 4LSTH 4JQXC 2ARWA 1UM6H 2AQ2A 1A14H 4S1DD 2HH0H 5KOVC 4HJGB 3ERYA 4BH8A 3NZ8A 3NCYS 3RY5A 3RDTD 4I0CC 1WJ3A 4AEHH 4X6DF 3KYMA 2VZ3A 2XYCA 5GS3A 2I60L 3NAAH 5JO5A 1FFNB 3VXRB 4ENEC 1CICD 4DZ8B 1KN2L 5FO7B 3TESA 1G6RB 3VGFA 2W91A 1FC1A 1NAMB 3PV6A 3PWUB 4CMMB 5D71L 4Y4FC 3HAEG 4YBLB 1CLOL 2D7MA 3NACL 5I1HL 3P4LA 3NCYP 5DD5H 5ELIA 1NKOA 4JDZB 2ESVB 2R1WB 3UC0H 4Q9QH 5AZEL 4HGKC 3LEVH 2HG5A 1FNSH 4G80A 2CD0A 2CK0H 3O3DA 3TN0B 2R0LH 1TMCB 2QR0A 3MC0A 1JI2A 1YC8A 2IGFL 2IPUG 2WWKO 4GUPB 1JZ5A 2Y06L 4DK3A 4AMKL 4PJDB 1KIQB 4FXKB 1CYGA 4DKEL 1MHHA 3HAEB 5K9QI 2HAZA 2AV7A 3JWDH 5E2WH 3OXSA 1MCOL 1PX4A 4AYFA 3FL7A 3P3YA 3U1SL 4JJ5A 5HVGB 2GKIA 5D1XD 1JNNL 5H2BA 3KPQB 3KWWA 4M7LL 1ZLSL 3K2MC 1G9MC 4HGWB 2BJMH 1HXMB 3UBXA 4I4WB 2CIKB 3MV8D 2OTWB 3UPAA 1R3HA 3NPZB 2PYED 2AK4A 1NBVL 1TCRB 3BKML 4Y4KD 2DQCL 3KYOB 4JKMA 3CVIL 2DB8A 1QNZH 1JF5A 1F42A 4WW2F 1ULVA 3BT2H 3UP1A 4PGZA 3DX8A 4H1LH 1PQZB 3LAFA 4Z0XB 4OZGF 4F58H 3WLBA 4NDMA 2DQEL 2R1XA 3MLYH 2Q8BL 1IKFL 1I8KB 4F3FB 4KK6C 1AKJD 1Y6NR 4LVEA 1N64H 2GTZB 4M8QA 3RZCD 5ACLA 2AXFA 1L7IH 4W68A 3N85L 1CD1B 4BQCA 5CKAA 5C09A 5C8JA 1VESA 1AHWA 3TV3H 2QSTA 3PWJA 2J88L 3HE6D 3MGTB 1EO8H 1U3HB 5I73C 1A47A 4X9BA 3H9HB 3SGEI 1EERB 2R69L 3GKWH 5E94A 4LRIA 3VFRA 1XGRA 5GHWL 4UI2A 5I1JH 2MCPL 3P0YH 3VW3H 4OCWH 2VYRE 3MCG1 4JFFA 1OARL 5D72L 1J0JA 4G9FA 4PY8I 2ARJB 4WGWB 1R5VA 2P8MA 3OL2A 2DLIA 5B21A 3W11C 4JFOA 5DQDL 3STLA 2VH5H 1G7PA 1C08A 3STZB 3U7AA 3KPMA 3PDOA 1NCTA 1MI5E 5MEQB 3MV9B 3KPLA 2A6DB 3ULUC 4P2RB 4XMKL 4X6DA 3S96A 1VA9A 4DKFL 4KMLB 1T6VN 1EEZB 2D0FA 4D94A 2CXKA 5HHPB 4MNGE 1FSKB 5FYJL 4APQC 3NVQA 5EO0A 4V1DA 4AG4L 2OJZH 2PYEE 3S5LG 1T5WA 2FIRT 5TQ2H 2DQIL 4NJ9H 4ODSH 5DHYA 3KPOA 5D7KD 1AO7A 4AEIH 4NO2A 2QSQA 1INDH 1AI1L 1RUML 4J3SA 4PRHB 1MCJA 1TTFA 2GCYA 4DK6A 4YXLH 5F9OH 4B41A 3MJ6A 1WWAX 5DRNB 5C0IA 4TVPD 1WFNA 1A3LH 3HMXA 4NNXB 2BOCB 5MEPA 2FH8A 4K7PL 1JZ8A 1NQBA 3VCLB 2AS5M 4PGCA 3S5LB 4RQQA 4U1MA 4YDJB 3ZKQD 5E8PA 4JM2F 4U1KB 3MRGA 5CAYB 2DDQH 1XF5A 5I18H 4YC2C 5F96H 3RHWK 3TYGL 5D2NE 3GSNB 3UTTB 4M9OA 2VDKH 5ITFA 3JWDC 4HIJA 3WN5C 5EOQH 3SDDA 3VFVB 2YD3A 4F9PA 4MA7L 4OIAA 3ARFA 4LSTL 4P59H 1X5HA 1UM6L 1A14L 2CLRA 1CQKA 2X09A 3FB5B 4JY5H 4J7RA 4MMXC 4WW2A 4AEHL 3NIDE 3HE7A 5DHVH 2HRLA 3C5ZC 4GW4B 4LIQH 3MYZA 4KMTH 3V6OC 4LFHG 1S7VA 3QYCA 4K7FB 2Z8SA 3OKNA 3IS1X 4U7SA 4K2UL 1AP2B 5EOTA 3I6GA 4W4NA 3BVNB 2FCBA 4IRJA 1CGXA 4UOJA 1K4CA 4XCYB 5HYQA 5DD5L 1FVDA 2ICEB 3HC3H 2VZTA 3UC0L 1WVZA 4OUUB 1Z3GH 2WM0A 4XCNB 5ABDE 5DK2B 3ME0A 2AJZA 3C08H 4H0GA 4MB3A 3T0AA 4BZ1H 2HMIC 4MD4A 1U42A 3GRWA 3KGRA 1MREH 2GEEA 1YEHH 1MCPL 3BKYL 4EI5A 4XCFL 2FJHB 5EPMB 2KUTA 1F58L 1G6RH 1YMMB 1NAMH 2V5YA 4MGXA 4TTDC 1CFQB 4U4BA 5GGUA 3KNBB 1XIWB 3M17B 2AJUH 4XP4H 1GRWA 1LGVA 1GOGA 2V5RA 4NQED 3QIBC 2X1WL 4IIQA 3QIUA 5H37G 1FZMB 1X5XA 4XMPH 2FECL 4DOHE 2ADIA 4ODVH 1GPOH 2DBLH 2I5YH 1QNZL 4M48H 5CILL 4KK9C 4ZUUA 3MOAH 5I75B 1RZFL 4MQ7A 3HAEH 4NQXA 4F58L 3RL2B 3IF1A 3ARBA 4BH7B 2E7MA 1GIGL 1ZE3C 3MLYL 4WWKC 2BNRB 3IRPX 5HSFA 2EDOA 1IBGH 2EDHA 1N64L 4HUUB 4IDJH 2Q20A 2QQLH 1YZZA 1A0QL 1L7IL 2VAAA 3G6DH 2L7UA 1Y18B 3LH2H 3WNPA 2IPTH 5SWSA 4MJ6A 4KPHL 4J3VA 1EO8L 1RURH 5JW4N 4KI1A 3GKWL 1OGAA 3T4YB 5I1JL 3MBEB 3VXMD 2P42B 5CP7A 2PKDA 4JM2A 2EYSB 2LE9A 3J8F7 2ERJB 4OCWL 4GG6B 2UY6A 2Z31B 2YBRB 4MXQA 3UXFA 1JV5A 1WEJH 4Z0BH 3D87B 2IPKB 2XKNB 2UWEB 1D5XB 4ZTPH 5DD6B 5F8RC 3SKNA 5J06A 3CFBA 3SKMB 4I2XB 2NW3A 1F4AA 1NGZA 2VR5A 5IROC 3MV7B 4LHUA 2LU7A 3LKRA 3I85A 3HZVB 4PV9B 4LPTA 5DJ8B 1T4KB 3BZFB 3KR3H 4QRPD 1U8JB 4JPWH 1AD0A 1BFOB 1N5AA 1NGPH 3C6LA 2EE6A 1RPQA 1YA5A 3MACL 5INCB 1NBZB 5JIPA 4PP8C 3MV01 4UQ2B 4A2MA 5I1CH 4NJ9L 1QLFB 4ODSL 1MFEL 1XEDA 1MCBA 4AEIL 4OM1H 1D5BA 2MHAB 5DYOA 3DWTA 1INDL 1S9VB 2O5YH 2Z91A 4L3ED 3V4VH 4GS7C 4EOWL 4JVPA 3GSUB 3RNQB 5L0QC 4YXLL 5F9OL 2B20A 3IFOA 3IB4A 2VXSH 3OKEA 2JJWA 4HMEA 1E4XI 5JXEC 4R4BA 3GMQA 3D39E 4HFUH 3WFEL 2OI9A 2VISA 5C08D 2JE8A 5DUBA 4GW1A 4OFPA 1QA9A 3F6IA 4ZQKB 3DYMA 1FNEA 3HMWH 1XH3B 2ZWLT 5H35B 3GI8L 1RUPH 5EOQL 4P59L 3CIQA 4KGLA 4YBLC 3PWPB 3ROOA 4HT1L 1E27B 1J0YA 3TLRA 4PJ8A 2P47B 3ZT5A 4JY5L 3FCTA 4HIEB 4LF3A 3K74B 1FH5H 4GAGH 2WBJA 1H5BB 3TN0C 3VWJA 1JTOA 4J4PA 2XFXA 4ZSOA 1Q9OA 2C4XA 1ZANL 3O4LD 3TPUA 5IVXB 1Q0XH 2EZ0C 3QUYD 2ZCKL 1Q94A 3HRZB 3I75A 4MXWH 5JPMB 1REIA 1YEIL 2IQ9H 3KPRB 4NSKB 3SKOB 2HVJA 4Y5XB 4GMSH 1Z3GL 4TUOB 3V8OA 4L9DA 3F62A 1HHJA 3C08L 5DS8A 1OP9A 1YDPB 3LQAL 4MHHG 2QEJA 4LP5A 3U4BL 2X5PA 2UYLB 4L3EE 4Y2DA 5DJCB 4OZ4B 1WUNT 4HJ0D 1FPTL 1JPFA 3ILPA 1HINL 3CZFA 4LASL 4XP5H 4NNYA 4HK0B 4QYOB 4DUWA 4NZUH 3ARRA 4L8DA 2E8YA 1U8HA 5E00B 1PKOA 5HGAB 4XP4L 3DV6B 4OF5A 5C08E 4OKVA 4MCYA 1B4RA 4IOFC 1EAPB 3BH8A 2L7JA 1ZT4B 4P3DA 5EDXA 3REWB 1ND0A 4EIGB 4PJFB 4P4RA 4NJAH 5FK9A 3PWNB 3CLEH 4ODVL 1GPOL 4M48L 1U3HC 4M62H 3P9MB 3QEHB 4YPGB 5IMOA 4RRPG 3TFKC 4RAUB 3BDYH 3PP4H 3T0XA 3FT2A 2DRUA 1I3GL 2AJSH 4IDJL 1I7UB 1T89A 5F3HB 3LMJH 4UNTA 1UT9A 2H32A 3NIGF 2HLAA 1U58A 4KAQH 3G6DL 5ISZE 1JHTA 1HI6A 2XNAB 4MXVF 4NWTH 3DOSA 4QRQA 4RMTA 4M93B 4XWGH 1QHOA 1XGUA 5FUCC 3ILQD 1U91B 2DM7A 4GKZA 5DJYB 3X13A 5D7IF 2WWMD 1HKFA 1I3UA 5C0GA 4KK5D 4LPYA 2FH6A 3HG1A 4ELMB 3JV6A 2X4OB 3SHSA 1WEJL 1NH6A 5F44A 3U4EA 3UTSA 3WSQH 1CGVA 4CGTA 4ZFZA 1QUNA 2CJUL 4NFCA 3W0WD 1OM3L 1DE4A 1FSKC 1X9QA 1YYMH 3AROA 1A3QA 5KSAA 1JF1A 5ESQA 1WAAF 2OMNA 2X4NB 3MUGB 5H37H 4WWID 5D1XB 4GRLB 4L29A 3P0VH 4F8TA 4PV8B 1YEDB 4DUVA 2WNGA 3KPNA 3KR3L 2Q7NA 4MDIB 5AD0B 1UJ3A 5DWUH 5FGRA 5TE4H 3KG5A 4Y4KB 4G8GD 2IH3B 4MA3B 1AIFB 3DECA 5DJ0B 3ARXA 2D7TH 5C0NC 1Q72H 5I66B 5I1CL 2DQJL 4FQIL 3MLVL 1WBYB 2H9GA 4OM1L 1WBZB 5EN2A 5DTFA 3ARVA 1DQDH 4NBZB 1PEWA 4NPYB 4HHAB 2O5YL 4GKNB 4P46A 4LLUB 3NCJL 1DBJH 5HYJD 2FWOB 3HE6B 1ZA3A 4MWFB 2RB8A 3HNSL 1DEEA 3KPTA 1H3WM 2VL4A 1FZOB 1QFUL 4KRMB 1SVCP 4Z95H 5DZOA 4MB4A 2FB4H 5DJDB 4XRCA 2VZ1A 5F21B 2D7PA 4BFIB 3HR6A 3IJYB 2EDLA 3P11H 4EN3A 2ENYA 4IHOA 3MRLB 3ALWA 4ODWB 1X5AA 1UWGH 3HMWL 1K8DA 3MRJB 4K23L 3B6SA 4RGOH 3GIVA 5B39A 2VLRA 4UIMA 1HEZA 1U2HA 1M7DB 3PL6A 4QXUH 3QDJE 3W0WE 4JKKA 4JY6B 4GJTB 4GMTL 5JDSB 2IH1B 2ZUVA 4ZUWB 4GAGL 2DAVA 5CMAA 5DD3H 4WV1B 5EU7E 1KJVB 3PUCA 3SY0B 4LSVH 1MCDA 2G75B 3MJ8B 5D6DC 1Q0XL 1A1MB 4XZUB 3KXFE 4G8GE 5DZLA 2OL3A 5DUMH 1U95B 4MXWL 5HHXL 3NTCL 1UG9A 3DROA 3QXAB 3WS6C 2BSSA 1XIWC 3E0GA 4JPVL 4PJBF 5D7IA 1TZHB 5LAXB 1S7QB 3QR2A 3EJYC 4NOBA 4TPRL 3FO0L 2X4QA 3MO1A 5EUKB 1PSKH 4JDVB 1RHHA 4ZOCA 5I17B 4U6XB 3QUZA 4NZUL 1F4YL 5D1ZD 1MLBA 4R97B 5J6GB 1WAAA 1KCRL 4XNMA 2M26A 3D18B 5GIRB 3RNKB 4J3XA 5I75C 1MUJB 4RIRA 5FM4A 3E1F1 1U92A 3EFDL 1LO5A 4AT6B 4N0CD 3EYSL 4HDIA 3MGOB 2EE9A 1KEGH 1G7JA 1YPZB 4ERSH 1P7KB 4NJAL 5IIEA 3CLEL 4MNQD 2W9LA 2PW2A 4NM8H 4RFNB 2P5WD 5I0DA 3TNMA 5CUSH 2BHZA 3ARYA 2F74A 5BMFH 2AJ3A 5FA3A 5JTWA 2XTJD 4OFYA 4P2OB 3MBEC 1LE9B 3BPCA 1OAYH 1TVBA 2ERJC 2GUOB 2D9CA 4PGDA 2AJSL 1IFHL 1VACB 2DQGH 3LMJL 2LVEA 3F7VB 4R2GD 4TRPH 3UAJD 1XCTB 5BVPH 2DI7A 3AU1A 3MRHB 1DR9A 3TT3L 4NWTL 1TTUA 1DANT 35C8H 5JHDA 1A9EB 4XWGL 4X9HA 4LSDA 4ONFH 4F2MB 5D7JA 3VMPA 1ZSDB 5SWZE 4Y1AB 1UC6A 3T09A 5EB9A 4CKVX 3BD5A 4I8DA 3ZLQC 4K3JH 2MSPA 2I9LA 1AQKL 1QVOA 3B9AA 4AJ0A 3LIZL 5C2UB 4Z7OE 2NY1B 2YMXH 5D5ME 4KFZC 5T3XH 1YYML 2M1KA 4PRNA 4UILH 4KVCL 4FQLH 3I02A 5I1AB 1DFBH 4NQEB 4R9HA 2D0GA 3QAZB 1T0PB 1CF8H 4MLIA 4HWBA 4KK8C 4KKAC 4OV5B 2GJJA 3O6KH 1U8IB 5CJXC 2X4RA 1X44A 5DWUL 1WBXA 4JB9H 1EHLH 1J1PH 4IEFB 1CFSA 1ED3B 4JY4A 1WGOA 1R5IA 1M71A 5C0RH 2CRZA 1DL7L 3HUJE 1Q72L 1YEGH 4CMHB 4F7CB 2R29L 3BIKB 1LQVA 2P5WE 2CK2A 1DQQA 1C12A 3BH9A 1DQDL 1BIHA 4PJBA 2XTJE 3U82B 1SYSB 3C5SA 4KGJA 4KUZH 1NANH 4FQXB 5GGSA 3QUMA 5E08H 3P77B 2XKSA 2CUMA 2ZG2A 4ZFFA 4Z95L 3LEYL 2YWYA 3BEWB 1YQVL 2LVCA 1NCUA 4I9WE 4PFEA 2R4RH 5GS2H 1TIUA 5SV3A 2GT9B 3KLDA 1H3XA 1H5BC 3QUXA 5DXWA 4DUXA 4G8EA 4ALAH 1UWGL 1KULA 3K4DA 2NZIA 1DN0A 3GO1H 4HUWB 1C16B 3WKMH 3IDIB 5I1DA 3UMTA 2DQDL 2FGWL 5B4MD 3FB6B 3MRKB 4I5BA 1LO3H 4Y5XC 1MH5A 4NRXB 5DEGA 4P4KA 4WEMB 4QRPB 5DRXB 5EU5A 3BISA 4JR9H 5GISH 3BRDA 2EYRA 3IDXH 1K8IA 3JUYA 2UZIH 4FQCH 4KV5E 4QHMB 1E4KC 5EBGA 4R90H 2QKIB 4P5TB 3K3QA 5DUML 1JWUA 3WFBL 5D6CB 4LQ1A 4D0BA 2F58H 5HGDB 3U48A 3CPLA 4N1CA 4RWYH 5C7XL 5IJKC 2DTSA 1QSFE 3D0VB 3C5JB 4M6ML 1S5HB 4S1DC 1FCCA 4YLQT 1EEYA 3INUH 5F89A 3DYOA 5HDQH 4IMLB 4U6HA 3E2HA 5JQ6H 1TNMA 3MJ9H 1KNOA 3IAGC 3K7UA 2BXYA 3O2DH 3VFTA 1I8LA 1KB5A 4R7NA 4U6YB 1LE5B 2YPKA 2MNUA 1AR1C 4G43A 5E6YA 5CD5C 4R3SB 5DSCB 1KEGL 1PZ5B 3GM0A 1Z2KA 5F7UA 3NCCB 4UTAH 3HB3D 3LN5A 4EQ2A 5ENWB 4L4TB 2P1YA 4ZOBA 5J11B 2EE2A 5F7EH 3BDXA 1JZ3A 4M93C 4WEUD 4LLQA 4O2EA 4P5KB 4M61A 4NQCD 3SDCA 3WXVL 4KZDL 2LV4A 2AK4D 1Z5LA 5JXAH 3TEUA 4JHAH 1K6QH 1OAYL 4RBPK 4K8RD 1FJ1B 1BPVA 1S5IL 1PKQB 5FOBA 2DQGL 4TRPL 4QNPF 1G9NH 3WXWL 5FM5O 1CD0A 35C8L 5HI5D 1IEHA 4YZFE 1KTDB 2H41A 5DC9B 5ADPL 1RJZA 2A74B 3HNVL 2DLTA 1KJ2A 2QLVB 3PF2A 2YK1L 5D1XC 1E0OB 3CDFA 3LB6D 4GRLC 4FQ2H 5C09D 3NFPB 3FQRA 3EIFA 1QFHA 4M4RA 1KIUA 3GMPB 3RGVD 4K3JL 1BJ1H 5FDYA 3EFFA 4Z7WE 3CFEA 1VGEH 4ZODA 5CEZL 2HT2D 4JFQB 4Y4KC 3HFMH 2KKQA 43C9B 1FNLA 3MUJA 1SYVB 4FQLL 2DYPD 1BOGA 1V7ML 4OJFH 1CF8L 3MJ7B 1JZ6A 4NKMB 3O4OB 1X5JA 3F5WB 4X5WB 1S7WA 1G9EA 4OF8A 3O6KL 2X4SB 5IW1A 2VSDA 2BOBA 1FIGH 2VDPH 4RNRA 4JB9L 1MLCA 1B0GA 5HD8D 4X6CE 4BK5A 1EHLL 2Q3ZA 4P9MH 2RJMA 1UKSA 4Y16B 5CZKA 5KVEL 4XPGH 2DMCA 4IJ3B 4HFWB 1OAZH 4WTZG 5K59E 3LKOB 4PJ9A 5EOCL 5FKAB 3RX7A 3KPPA 5IOPB 2C3XA 1FNGA 4BYHA 1ZT1A 3FB8A 4NKOA 5HYSA 4NQCE 4YHNA 4BQ9A 4V1DD 4F80A 2B39A 5I2IB 2FIKA 1B88A 4JDTH 4I48A 4JM4L 1AGBB 3DHMA 4U1HB 5JUEH 1KYOJ 4PGEB 4R7DB 3DLQR 3UCRA 4TSCL 3FO1A 4WV1C 1G7QA 4ALAL 3NBNA 1F3RB 1FO0B 1QSFA 2R2CA 3D9AL 1HHGA 5HHOB 3T4AB 3ZDZE 4NT6B 3SGDI 1MY7A 1AGEA 1Z6JT 3WNLA 4LCUA 1LO3L 2NX5B 5EBWB 1SMOA 5LBSH 2F54A 5IJVB 1MHPH 3O41A 1A6AA 1UH3A 5GISL 3LEXB 2ID5A 5JNYB 1R3KA 2P5EB 2UZIL 4FQCL 4Y4FA 2B8OT 2Z9TA 5KSVB 5KSBB 3VXQB 1MNUH 4ACPA 1D5IH 4O2CA 4L4VD 5F1SA 1OQOA 4PJAA 1GH7A 5IQ7H 2G2RA 4G6AC 4R97C 1YNTA 3FQUA 1KPRB 2PYFB 2C5DC 4RWYL 5JW3H 5E9DB 3WBDA 2OSLA 4QY8B 4ODTL 1G9NC 1G1YA 5DC4B 3HZKB 3WDIA 5FO9A 5HY9B 4ZXBB 1S8DB 4JVUA 4RFNC 5EU6D 5CFHA 3MJ9L 3ARUA 4KXZH 3MR9B 3G9VA 4LKXB 5IGXL 1OTTC 4EI5D 4OCSH 4P2OC 2CO7B 4LPUA 3DVGB 1MHCA 1ZHNB 4NWUH 2DTML 4UTAL 4YE4L 5LGKA 1NC2A 3BUYB 4Z7UE 1S7TA 4Z7WA 3HCVB 2C3VA 3T0EE 3K8LA 5CHNB 1LK2B 1MJ7H 2D9QB 3QIUD 4P2QB 4M5ZL 5DFTA 5KG9A 4HUMB 2HT4D 4AH2B 3FFCD 5GZND 1R5WA 1N7ML 3TBVA 1UH2A 2J2ZA 5HHMB 5IMKB 3LS5H 1KF9B 4WTWA 4UBDD 3BP7A 1CXHA 4HF5H 3VXSA 4YDIH 4RMVA 2LTQC 2NY1C 3OKOB 1JNHA 3CK0H 1JGLH 3ARBD 3F12B 4ODXA 4JGUA 1TQCB 4HUVA 1S3KH 4Y8AA 1A3RH 4HQQL 3TH3T 4OZGE 3MRQB 1FZKA 3HR5A 2CRIA 5L2KA 4L4VE 2AK1H 4QKXB 1BZ7A 2A6IB 3H6JA 1NBYB 4FQ2L 3QAZC 5E2JA 5C07A 5SWSD 5E5RB 4KZEH 2F53D 5B3JE 4JFEA 2B7DT 1P7HL 4PJXB 4OD1L 3TPKA 2H3NB 4PJHB 1EH9A 3KPSB 1VGEL 5D2LE 1OGAD 3SQOL 1T1WB 3LV3B 2CRYA 4JM2D 4U2ZA 2EH7L 2PO6B 3ARGA 3L7EA 4Z7VB 2GJ6B 4JN2A 4KDVA 3V6ZA 4MXQD 4CMHC 2DM3A 4LSSH 5EU6E 5IEHB 25C8H 1WIPA 4ZFGL 1I7TB 2C1OA 2X4UB 3GSWA 4L3CA 2IANE 3SE3A 1EGJH 1CL7I 5DQ9B 2VDPL 4UDUB 1GAFH 4C56A 5IV2A 3IDMB 2Q3AA 5HVWA 2BSRA 4MNQB 5C0AB 3T65B 3DXAA 3VH8A 4P9ML 4LHUD 4FQXC 4WFEE 2NYYD 4QHNA 2VC2H 3MROB 4KDWA 5I8CA 3OAZH 4IOIB 2RIKA 1KXVC 4XNXH 3C6LD 1JWSB 3WNNA 3FFCE 3VRIA 1CIUA 3OR7A 1YJDH 4JDTL 3S34H 3Q5OA 1R0AH 4Z76A 4Z5RB 4KKBC 4E0RB 1QPXA 1NC4D 5JUEL 2J8UB 1QO3B 1WCBA 4KROD 2N7BA 3R8QA 2L4OA 3N06B 1U8PB 3I6KB 1T7VA 3CUPA 1U0QA 5I15L 4C55A 4JCLA 5F7NC 3OKMA 2XXCB 3D69B 3ARWA 1LDPH 3EGSA 3RFZC 2F53E 2Q6WB 2XI9A 3UTPD 5DMGC 4XVTL 3EO1B 3WN5A 1IAIH 4ZD3H 5IFAL 4NFBA 1QSED 2ADFH 2KH2B 4P5TC 2VE6B 2XZQL 3WJJC 4DQOH 4C83B 3DV4A 1N59B 1QRNA 5I76A 4X7TB 5E99H 3VD9A 3C5ZA 1AR2A 4YBQD 3RBGA 1OPGL 1RU9H 1YECL 3L6FA 1MHPL 4XPAH 4PJ8D 1J8HB 1I1FA 4OKDA 3RVXD 4G8IA 1T04A 1A6VH 2O5XH 4OB5H 3S4SB 1XGQB 1H3VA 1BIIA 1DUZB 2WBJD 1MNUL 4B53A 3VWJD 3TT1H 4J4PD 1ZEAL 4HXAL 2XIDA 2SEBA 5IQ7L 1KLGA 3OXRB 4QRTB 3DRQA 2BVQB 3RIAK 1I7ZB 1N8ZA 3QDGB 3V7MA 1WZMA 5SWQB 3FZUD 2Y36L 3GJFA 4M6NH 4H88L 1RIHH 4NQTA 3TJHC 1FG2B 1BZ9B 5C6TL 2BMKB 4CW1A 3SBWC 1S7SA 4UOW1 5T5NF 3QXTA 1BD2A 4RZCA 1XF4B 5DLML 1RZ8A 5IB5B 5J11C 5DA0B 1OF2B 4X5XB 4C59B 4GAFB 4OV6F 5F88B 2YPLD 2XA8H 4Y2DD 3HC4L 4UNUA 1NL0H 3VGDA 5C9JB 2OXGA 3W5NA 3WUWG 2WQ8A 1OVZA 2ADGA 1OAXL 5ACMA 3UTPE 3WO4B 3PABA 2YS4A 3FONB 1KJMB 4R8WL 5D2LA 1QSEE 4E9LA 2APVA 1IGFH 5HHVH 4DFHA 1MJ7L 1AC6A 3BX7C 4G5ZL 3NIFF 3MXWH 1J05A 1U3JA 3H9SA 3NZ8B 2ZUUA 1OD7A 2Y4SA 5JR1H 3O0RH 1ZVYA 3BGMA 4GG8B 3EHBC 3KYMB 4HJ0C 3WUWB 1IC4H 1OOAA 4HF5L 4YDIL 5BV7B 4KKNA 1JGLL 4I3GA 4GRMA 3QQ3A 3D48R 1S3KL 3WFZA 4B7IA 3DUHA 5E6ZA 1SM3H 2AK1L 1YJDC 2JIXA 2GSGA 1CDHA 1A7NL 3QDME 4N5UA 3O4OC 1S78C 2HG5B 4G80B 3O3DB 2EXWD 1I8MA 4KRNA 4X8JA 2QR0B 2DM4A 5DF0A 1QBML 3RWIA 5JZ7C 4PREA 4YH6A 1NCCH 1F02I 4Y16C 3HG1D 4PB9H 4IJ3C 1ZWIA 4XPFL 2Z4QA 2EIDA 4OT1L 4LSSL 2E7LA 5IROA 1XR9A 2CPCA 3UTSD 3U0PA 25C8L 2AV7B 2YPLE 3OXSB 3ES6B 3GJEA 3LHPL 4N0YH 5KSAD 3T2QA 3HC0A 5BJTA 4JJ5B 4LCYA 5I1KH 2KBGA 3M8OL 3BN9C 5H2BB 4CJ1A 2FLBT 3KWWB 3UBXB 1OB1A 5DHVA 5GRZA 3ILQC 3N9GH 2EIEA 4O51A 4J8RA 4N8VA 1R3HB 2WWMC 2AK4B 3BAEH 4PJGB 2E7BA 4KK5C 1P53A 1II4E 4I77L 3MRRA 3UEZA 1NCBH 1OAUL 3ROLA 2V17H 5B3NA 3DX8B 4LNRA 5D1QD 1KPUA 3S34L 1MAJA 2OTUA 4NDMB 3WLBB 2R1XB 1MRDH 5F1KC 3QNXA 5DJAB 1JK8A 5T33L 5JXEA 4MVBA 4M8QB 2AXFB 4JAMA 4P46D 5C09B 5C8JB 1AHWB 1MSPA 3PWJB 3OX8A 4Z8FH 1TVDA 2XA3A 1SJVA 3RVVC 3V5KA 1H9VA 1CDIA 5E94B 1XGRB 5FO7A 2AJXH 1RUQL 4I0PD 3KHQA 1T2JA 5F9JA 3WHE0 4EI6A 1EO5A 1QKZH 4M1CC 4CMMA 4ZD3L 4JFFB 2VDNL 5IESH 1KPVA 2ADFL 4G9FB 2E9WA 1QR1A 1R5VB 3QHZL 5E2TH 1BGXL 4HK3N 4DQOL 3QHFH 1A7PL 1T2QH 3ZDXF 1A9BA 2AEQH 3STLB 4X0KB 1G7PB 3KPMB 3PDOB 3AMLA 2DKMA 3VG0L 3IU3A 3KLHD 4UOW0 3PL6D 3KPLB 4X83A 1FQ9C 4PGBA 5GXBB 3S96B 4NHUE 1I9RH 1KC5H 3TIDA 5HHNA 3TT1L 2CUIA 4TSAL 3JUZA 4P5MA 4ZXBC 4M00A 1ROWA 1JE6A 5EO0B 4RFEA 5E2UL 1FL6A 1PVHA 5DHYB 3KPOB 5TH2A 1C1EH 1CVSC 2J7LA 2X1QA 3RPIA 1AO7B 5C6WH 4NO2B 1RUKH 4DJMA 3CXDH 4KTEL 4S1RH 2OTWA 4OLXH 2JB5L 5CJBA 2GCYB 1BFVH 1TCRA 3RJQB 1HNFA 5DDHA 3KYOA 4EZMA 4PG2C 1PW3A 5C0IB 1DEDA 5K33A 4YO0A 5A43C 1BX2A 5JIIA 5MEPB 3X17A 4TNWK 3O2VH 4XB7A 3ZE0E 3MGAA 4PGCB 1I8KA 4RQQB 3QUZD 4GLRH 4U1MB 5J6HA 5C0EB 2Q87A 1P84J 5E8PB 2WLYA 2NR6C 3MRGB 4RMSA 5DEZA 1AFVH 2A9MH 1W72L 4QOKA 3O8XA 3PXJA 4XC3L 4JO1H 1FDLL 4ORGA 4PJCE 4Q58C 1T80A 3O81A 5C3TA 3WL9A 1GYAA 4HIJB 4XX1G 1TQCC 3H9HA 3SDDB 5HHVL 5EULV 3ARFB 1I85C 3GSVA 5C0CA 2CLRB 4N0UA 3PNWB 4PJIE 4M4PA 4O5LH 3HE7B 5FF6A 4RWHA 1IC4L 1S7VB 4PTTA 5FV2A 1QFWM 3OKNB 3QWRA 1OSPL 4NM4H 3STZA 2E5EA 3D3VA 1RK1A 2PO6C 5EOTB 3I6GB 3MV9A 4FTVA 1SM3L 4IRJB 4P2RA 4ZO7A 1K4CB 2F19L 3GFUA 5HTSA 3HN3A 5DMIH 4S0SD 1FVDB 1K3ZA 5JHDD 2KZ1B 5SX5H 3C8DA 3ZYJA 3QO0A 4O02L 4YEEA 2AJZB 4O9HL 1EEZA 4HAGA 4MD4B 1IGML 1ZTXH 5T5FH 1SJHA 4LOUD 4EI5B 5BV7H 1NPUA 3ULVE 4JO3H 4DFIA 1CZ8L 4HKXA 5MEOB 5GGUB 5I1KL 3UAJC 4JANA 3V5HA 4KI5C 1KYOK 3IETA 5GS0L 3UBXI 1UJTA 3QIWA 4NNXA 5KVFH 2VR4A 3QIUB 3U7YH 1FVEA 4R96A 3S5LA 3BAEL 5K9KA 1G0XA 2ADIB 3G04A 3KYNA 4GG6F 4JGMA 2V17L 4MQ7B 1MI5B 4HW6A 4NQXB 3IF1B 3TH4T 3W2DH 4FRWA 2OR9L 4XPBL 1JUFA 3CMOH 1PG7X 1MRDL 1JNLH 2XPGA 3QJHA 3NZHH 3X11A 5T1KA 1CLCA 4K3DH 2VXQL 2VAAB 4MJ6B 4QHKJ 1P2CA 4MNGB 1UQSA 3P30H 4Z8FL 4GW4A 4F57H 1W8OA 1HIML 1NFDE 4KJPC 2AJXL 3MLRH 5CP7B 4JM2B 5AG9A 5IESL 2D0HA 4LCWE 5LCVL 3LKPA 3GHBL 2ITCB 3QUXD 1JV5B 5E2TL 1ZVSA 1JYWA 2IEPA 4XNQA 4OLUH 5T1DH 2AEQL 5D7LA 2UY7A 5ESAA 3QQ9D 3IYLW 1P5UA 3SKNB 4WHCA 5I9QB 3CFBB 4GQPH 2ICWA 1S9KC 2NW3B 5KSUB 1NGZB 1P1ZA 4LHUB 4ZYKB 4XAKD 3LKRB 4W6WB 4P4KD 5T1LA 2HJFA 4R26H 3CZJA 1OTUD 5CCKL 1AD0B 2E27H 1A8JH 2HWZH 3GMMB 1N5AB 4YDKL 3C6LB 4NP4L 4BUHA 2APTA 1GZQA 2VQ1A 5D7SH 1PG7L 1XGYH 3U83A 3QCUH 4WI7A 1RUKL 1CBVH 4S1RL 5DYOB 3G5XA 2O5ZH 2Z91B 3DURA 3WO4C 5TF0A 3IFOB 3SDXF 2DD8H 1D6EA 1D5ZA 1W0VA 5I8KL 2A77L 3OKEB 4YDLB 3IRZA 4R4BB 3GMQB 2EDJA 2OI9B 2VISB 1YNLH 2B0SH 5DUBB 3HNTL 4TYUA 5IVXF 4HUUA 5D70H 1AFVL 1QA9B 1TPXB 1JGDA 4AQOA 1FNEB 4JO1L 5BV7C 2KDGA 2DLFH 5CZXD 2HKFL 5EORL 3S88L 5J56B 1NCDL 2HFFA 2X6MA 3ROOB 3OJDA 4XP9L 1VKXB 4WTXA 1UXWA 2WINA 4M1DH 3VDCA 4MQXD 4GG6A 4NRYA 3HMXH 5C0DB 4KC3B 1KOAA 3FCTB 3SOBH 1MJ8H 2IPKA 3SDCD 2XFXB 4ZSOB 1TFHA 1Q9OB 3RA7L 4NM4L 3TPUB 5DD6A 1MWAH 3E6FA 3FQWB 4FOMA 3QDHA 2DICA 4QHUA 5BZWA 2BK8A 3MV7A 2BXZA 1Q94B 3I75B 5DMIL 2HVJB 1T4KA 1I1AA 3BZFA 3IT8D 1KSRA 4PJFF 3ZKMD 1HHJB 5DS8B 3DMMA 2P45B 4JHZA 1BFOA 1BLNA 2APXA 1IRAY 2J3SA 4PRPA 2IADA 4JO4L 5T5FL 1JPFB 3VG9B 3ILPB 3CZFB 5E1AA 5ADOL 3UJTH 1B2WH 4NNYB 1GGUA 5FEBA 1AY1L 2MQCA 2MHAA 5FKPA 5E2VH 4L8DB 1B4JH 1U8HB 5IHUH 3GSUA 2BVOA 4OKVB 4JPIA 4MCYB 4L8SA 5TE7H 5KVFL 3BPNB 1WLHA 1KELL 3O6LH 4KH2A 1G1CA 4P3DB 3PGDA 4HPOL 5H94B 5ID1B 2W38A 1ND0B 1MAML 3U7YL 4PG9B 2G5BA 4HXBL 1AD9A 1E4WH 1LD9A 4P4RB 4LRNH 3QEQA 5FK9B 3GRWH 1AHWC 4IOSD 3L3HA 3DI3B 4PJ9D 2F8XC 4LRIC 1VADB 2JCCA 3UZVB 4PPTA 1VERA 2G9HA 1T1XB 4XPHL 3CMOL 1JNLL 3NZHL 1P6FA 1FFOA 4OLYH 3ZKSD 3PIQA 4NZTH 3V6BR 2DMKA 2HLAB 1U58B 1IC1A 1Q0YH 5GGTH 1JHTB 4QRQB 4KMQA 4ZUVA 3SDXA 3GBMH 4XVSL 3GMLA 1QSVA 1XGUB 2X10A 1DQJA 3C6SA 3V0AC 2VXVH 4GKZB 3X13B 2OP4H 5IKCA 1T3FA 5ILTH 1DBAH 3MLRL 1TCMA 5ANMA 3CFKB 2MJWA 3JV6B 4FS0A 3MODH 3U4EB 3UTSB 5HYFA 4NSKA 2XACC 5FYKD 5KJRH 2BZDA 4N90D 1DE4B 4DWHA 1A5FH 3BHBB 1JF1B 2AGJL 4OCYH 4R4FH 5ESQB 1YDPA 3BP6B 1JCKA 1CGSL 2BDNL 5F1IA 2N56A 3A6CH 3B9KA 4OZ4A 3KPNB 2F54D 3NFSL 4R26L 1UJ3B 4ENED 1JGVH 1EUUA 2ZUWA 1CR9H 3RPKA 5MP6L 1TDQA 3UJIH 4Y4FD 1ZLWK 4XVUC 2R8SL 3Q48A 1RIVH 3FQNA 2FX8L 4CADA 1WSST 1M6OB 4Q9BA 5EZIH 2H9GB 4POZC 3PQYD 3QCUL 4WJ5A 5EN2B 5DTFB 3REWA 1CBVL 3DPBA 4JEGB 2O5ZL 1TLKA 2AJYH 4M02A 4P46B 3UTQB 3T0VA 4AENA 5H8DA 2NTFA 2CKNA 1N6QL 1MCKA 1ZA3B 2VDOL 3SDDC 5ICYA 1Q1JL 4F9PC 1DEEB 3LRGA 3ARFC 4HKBB 2IAMA 2BX5A 3MA9L 3FFDB 4XAWL 1LEGA 1YNLL 3A6BL 2B0SL 3VFGL 4XRCB 5ALCH 1WTGT 3TZVA 5D70L 3HE7C 4EN3B 5MENA 4PRBA 4YXKH 1K8DB 2EEDA 2DLFL 3B6SB 1WZLA 2UZXB 3DNKA 2ZPKH 3GIVB 5B39B 5IB4A 4KY1H 4WI3A 2VLRB 1HEZB 1U91A 4IRJC 1RZKL 5FYKE 12E8L 1NC2D 4Q6IA 1M7XA 5CJ5A 5C2BH 5KTEL 5HDOA 3GGWA 4QRRA 7CGTA 1FORL 2HFGH 1MJ8L 2ZCHH 4JJHA 3DETC 4CAGA 4CN1A 1KXTB 3B4NA 3VFPB 4KK6D 2ED9A 5I30L 4NQDE 2ZSWA 1MWAL 5FUOH 1CT8A 4EI5C 5HBBA 4LL9A 2XWTA 2OL3B 3VXSD 1FYTA 2V7HA 3C2AH 4PV8A 2E6JA 3S37X 5DA4A 3DROB 4QNPE 1YPZF 2BSSB 4PD4J 1ITCA 3I6LD 5AYUL 5D7IB 2HN7B 3PQYE 5IT2H 5EWIH 4JLRA 32C2B 5C07D 1V8HA 4FP8H 4ZNEE 4R6UA 1GOFA 3QIUC 4JFED 1A22B 1ZGLP 1K2DA 3HHRB 2Q86A 3UJTL 1B2WL 1ZK9A 3QUZB 2R15A 2DS4A 5E2VL 1MLBB 2QSCH 1UYWL 3ARGD 4XNMB 5DO2D 5IHUL 1KV3A 4IRZH 4RIRB 2DMBA 5DUPH 1U8QA 1T0NA 1U92B 2FWOA 4CU7A 1LO5B 3ARDA 5TE7L 3RUGE 1AXTH 5IBTH 3LVEA 4OZIA 4OFVA 4X5LA 3ORJA 4FFYH 5MI0B 3LZFH 2HLFC 5EBLA 4C56D 3R8BB 5IIEB 1L6XA 2EC8A 3IJYA 3ZYIA 4APQD 1P4BL 3EZJB 4QXWA 3TNMB 3MRLA 4ODWA 1W0WA 1X5KA 2F74B 4ISVA 1J12A 5FA3B 4MJID 3VXOA 4NUJA 4JM2C 4WU7B 1TVBB 4WUUD 4PGDB 1JTTA 1I9IL 5FYLH 4NZTL 2HTKD 4BFGA 5IK3A 4FZ8H 5GGTL 1Q0YL 3UROR 3AU1B 1AGDB 1BJ8A 5JHDB 1XGTA 4PJ5A 5D7JB 4JQIH 3O45A 1MCLA 1YUHA 3SY0A 3BKJL 5I9QC 5GSVB 4LLYB 5ILTL 1DBAL 5T3ZH 1KACB 3I6LE 3MJ9A 2VLJA 3MFFA 4TSBL 4R4NC 3BSZH 2ZUQB 2I9LB 2NCMA 1QVOB 1QPPA 2ZUXA 3MODL 3LDBC 1NBQA 5F6HJ 4S2SA 1RK0A 4PRNB 3C6LC 4NZRH 5HXMA 4LLMA 3S8WA 2EC9U 4OCYL 4R4FL 1IC7H 1TZHA 4DGYL 2VLKA 3CLFL 2H6PA 1QRND 1DQLH 3A6CL 5CKGA 4UMGA 4ODHL 3C5ZD 3EDFA 3ESVF 3RRQA 2NQCA 3VFNB 2B1AH 3ULUE 3P2TA 4HULB 1Z0MA 5BRZA 2X4RB 3F65A 4K9EL 1WBXB 1JGVL 2XXMB 1DQMH 5J6GA 1KT2A 1R5IB 3E8UL 3B8YA 4TNVF 1P84K 3D18A 5GIRA 5LG1A 5L88L 3KYKH 4YDLC 3A6OA 4HWUA 5C0BA 3LQMA 5FGSA 2OI9C 4CDHA 4AT6A 1C12B 3BH9B 4EXPX 4KQ4H 5E8DL 4WHTA 5IMLA 1H3PH 1A6PA 4MLSA 1GGIL 1TPXC 4FFZH 4MJIE 4PJBB 3JBG7 3C5SB 3SEPA 3ZTJH 2HMID 2XT1B 4JHWH 3QPQC 1NCWL 4WUUE 1DBML 5FCUH 1HKLL 1WFOA 5CD3A 1X6LA 4YBQC 1MJUH 5GGSB 3QUMB 4B0MM 2W9DH 3OAUL 5DJXA 3FMGH 1JJUA 1BD2D 4NQUA 3C9NA 2GFBA 5FECA 2EYTA 4PY8J 1FE8L 2GUOA 4NRZA 5I1IH 3BGAA 5ALCL 3OMZA 4TTDD 1EZVY 4TUKH 5EFIA 3QUXB 3F7VA 4G8EB 4YXKL 2Y7QA 3CH1B 1DBKL 4HZLA 4YQXL 3S97C 5DD1L 1J1OH 4F2MA 4KY1L 3VD5A 1U8OA 3FZUC 5I1DB 3ZYOA 1FN4A 2B4CH 3PP3K 4I5BB 2OR8A 4KK9D 1VB9A 1DVFA 4P4KB 1F3JA 2HFGL 2Y5TA 2BVTA 1NDMA 2ZCHL 5EU5B 2FO1A 3GMOA 3H42L 1NLBH 3H9SD 1F11A 2EYRB 1K8IB 1MFDL 4LAJH 4N1EA 3U36A 3V6OE 1C5DB 5HYEA 4F33B 5M94B 3HZMB 4KJYB 5FUOL 5JA9A 3VG9C 5CBAB 1G7MA 1JWUB 2BNQE 4I13B 1U8IA 5BO1L 3NGBB 4HS6A 3CPLB 2W0FA 2Y07H 1KIPA 2R56H 4WFFE 2JIXD 5CLWA 5EWIL 3BPNC 3HZYA 3ZTNL 5JDJA 3QNZA 4Y19E 3MRDB 1EEYB 4QT5A 5F89B 3S36H 1BQHG 3MLTA 4U6HB 3ZT7A 3E2HB 3BE1H 2DIAA 3ZT6A 4IRZL 1KB5B 2OL3H 3FOLA 4R7NB 4WFGE 5SWZB 5DUPL 4NQSA 3SE4C 4Z77A 4DGVH 4FQXA 3OJMB 3PGFL 5DK0A 4G43B 4Z7QF 5TF1H 3QFJD 1UZ6F 3P77A 3ZO0A 2VKXA 1T89C 5FB8A 1VEPA 1D6VL 3LZFL 2DIBA 5D8JH 5D5MB 4NZJA 1MIEH 4LLQB 4O2EB 1BQHB 3S98A 4M61B 3SDCB 1A6TA 3STBA 5LGHL 2YA1A 5FDWA 3MQIA 5DURB 6FABH 5FOBB 2WIMA 4PJEE 3MXVH 1EUTA 5DRXA 1RJZB 5JXED 4JG1H 3O2WH 3VFSA 2ICES 1KJ2B 3AS3A 4HD9A 2D3VA 3FQRB 1EEUA 4JRXE 1CU4H 4Y4HA 4G6FD 5D4QA 4QEGA 4CVXA 1QBAA 3BSZL 3BXNA 4PRIE 1UJ3C 3CFEB 3VXRD 4YEFA 4JHBA 4CBPA 4PJ7E 4Q2ZB 1FGVH 1R3IH 4CNIA 3OF6A 1IC7L 5BZDA 3UO1L 3EJZC 3CH8A 3D0VA 1BOGB 2V5TA 4D9QD 4MSWA 3CFJB 2ESVD 3IJHA 3T3PF 1DQLL 5EBMA 3ZKXB 5EU3A 1NMBH 1S7WB 3SDAA 2B1AL 5DMYA 1JN6A 2P48B 2BOBB 4RNRB 4P46C 1MLCB 1T21A 3O6FA 3QFJE 4OCNC 5GZOC 2B4CC 4OTXH 4U1LA 5JLZA 3C8HA 2EZ0D 2XG4A 3RY6A 4PJ9B 4FQ1H 4P57A 5E1HB 3KPPB 1FNGB 4K3GA 1ZT1B 3FB8B 2Q8AH 3TJHA 4C54A 4LIQE 4NKOB 5HYSB 4KQ4L 1HSBA 3SDYH 4YHNB 5I1EH 4NHCH 4J3OC 2P44B 4EN3C 5ENWA 2XZCL 4I48B 2ZJSL 1R24A 4GFTB 4ONGL 4HWBH 4EDXA 3VWKB 4P5KA 1J86A 3QH3A 2W9DL 3KLHC 1RZGA 1UCBH 4M5YH 4YHLL 1EA9C 5I8EB 1GGCL 5KW9H 1QACA 2Z92A 4HPYL 4TUKL 5IEKA 2LFGA 3FO1B 1GGBL 3VXUA 2YA0A 3T1WA 2FD6L 1G7QB 3IKCA 2IALA 2K7PA 2XY2A 1KTDA 3DVFA 1QSFB 4JFDE 1J1OL 3NCFB 4KTDH 4V3EB 4H5SB 1X4YA 3VXRE 4PLNC 4RGNE 4QOKD 3HI6H 3O8XD 5IFHH 3IDJB 1AGEB 5CWSB 4LCUB 3TF7C 2CDFA 1U3HD 3QUMH 4V3DB 4XHJC 4LBEA 4NNPH 2F54B 4QHKI 3K1DA 2IG2L 2ESVE 3EYFA 3X3FH 1A6AB 3MRPA 4JFQA 5E56A 1NMCB 1NLBL 2CXGA 2D7OA 2DI8A 4NKIH 1CLZH 4Q9CA 1HWHB 4YFEA 4O2CB 4JRWA 1WFUA 4PJDE 3L5WA 3QUZC 4PJAB 3QWRD 2ZP0T 2BY1A 2G2RB 5DR5L 4XVJL 1PLGH 2GITB 1YNTB 3FQUB 3MV9D 3DGGA 1U8KA 2OSLB 3DTXA 4P2RD 1X3DA 3QDAA 1CXKA 1H15B 2JELH 1H3GA 2YUWA 3GKZA 4RDQG 5BS0A 5FO9B 5MI0C 3S36L 1A4KA 1LWRA 2V6HA 3WMSA 1JVKA 3H3KA 1AJ7H 5TF1L 2PCPA 2RAMA 3SCMA 5L9DH 1GCFA 3TVMA 4YDVB 4PRHD 2QHRH 1NC2B 4WTZA 3WV0A 4Z7NE 1S7TB 1A7RL 4Z7WB 4U0RB 5D8JL 4PGEA 3K2UL 3QIWD 2RQ8A 1TJIL 3MOBL 5D7JC 4OGZA 4PJXF 5C0ND 1KENH 5CINH 1VFMA 2DKSA 5KG9B 3FN9A 3NFNA 1R5WB 3TBVB 3T4AA 1KTKE 6FABL 1C5BH 2ZUQC 1K4DA 1KB5H 4I3RL 3BP7B 5GGVH 3VXSB 3MXVL 4H8WH 1JNHB 2NX5A 4ODXB 1SVZA 2C7UA 3TO2A 3WD5L 4HUVB 1A7OH 1ORSA 2H26A 4JKWA 1FZKB 3HR5B 5IJVA 5L2KB 4JG1L 5T1KD 3O2WL 1BZ7B 1KCSH 4U33A 5DGQA 5FUCE 4ELKA 5C07B 2UUDH 2J4WH 1CU4L 4JFEB 3VXQA 1P4IH 2I25N 4M9PA 3FAXA 5ID0A 2VO5A 1ZLVK 3OAYH 1IM3A 2XWBA 2CKBL 5EA0H 3LSOA 3ARGB 2X89A 3L7EB 4JN2B 1IARB 1W72A 5E9DA 3V6ZB 1CK0H 4FQJH 4KI5F 3L5JA 2V2XA 2EDYA 2C1OB 2J8UF 3GSWB 4L3CB 3J7HA 2PUQT 3I9GH 1DANU 4NFDA 1CL7L 3ZDXE 4UV7H 3D85B 4C56B 5IV2B 5HY9A 4LFHD 2BSRB 5EU7C 3DXAB 3VH8B 3TBTA 4PRHE 1A4JA 4E41E 4QHNB 3EDKA 3IFNL 5J13B 3ULVC 5T1LD 2CLVA 4FQ1L 5I8CB 3U9PH 3HKFA 1JMXA 5DVLA 5B38G 2ZOLB 2VXTL 3KS0H 2FJFA 1JRHH 3QUXC 3QJFA 4M8VA 3OR7B 1MOEA 4YXHH 4OZHF 2BRRL 2I9TA 4F7TB 3EJYD 4W6XB 4Z76B 2EDFA 3QQ9C 1I1YA 3HRPA 4RCAA 1WCBB 3UTTE 4L9LB 4JZNA 3RWFA 4AL8L 5I1LA 1SEQL 3K4ZA 1UCBL 5I19L 4M5YL 2FX9L 5HHMA 4TTGA 4BFEA 1CS6A 5KW9L 3OKMB 2AJVH 4P4KC 5B38B 5IHZA 4XGZA 3EGSB 3N1PC 1KN2H 2VOTA 1FFQA 2ATPA 4YHYB 2BNRD 4KTDL 5D71H 3VRLF 2O61B 4PGJA 3NACH 4LEOB 3HI6L 5IFHL 1LNUA 4ZS7H 1T0MB 1ES0A 1QBLH 1QLRA 1QRNB 5AZEH 4X4MA 1OP3H 3P73A 3NGBC 1KLFA 1BWWA 3L6FB 3MBED 2VDQL 4UT7L 1I1FB 2Y06H 2JJVA 4AMKH 1CLZL 1T04B 1RZIA 4PUBH 4G59A 3SGJC 1BIIB 5IEHA 4XXCA 1Z9MA 2YR3A 1ZAGA 4JPKL 4Z7UB 1I7TA 2SEBB 1MCOH 2JJSA 2X4UA 1KLGB 3DRQB 1XT5A 1N8ZB 1PLGL 2CR3A 2NY3B 3E2HC 5EO9A 1AQDA 1I8LC 1YMME 2C26A 3GJFB 4CUCA 5C0AA 3MV7D 4H8WC 1FV1A 1TTGA 4CW1B 1S7SB 1BD2B 4RZCB 1NBVH 3DMMD 5F93C 3BKMH 2DQCH 3CVIH 1RZ8B 2BHYA 1KLUA 5HPMA 4FQPA 2EO1A 1JZ4A 1YN6A 1OW0A 1AJ7L 3SDCC 4OGXL 4OSUL 5A2LH 2PW1A 1TENA 3GM8A 2Q8BH 4KK8D 4KKAD 5FM8A 1QO3A 2JK5A 5L9DL 2ADGB 2QHRL 3I6KA 2VZSA 3N85H 3PABB 2BNRE 2J88H 5D2LB 5E8EA 2R0WL 3EO0B 1QQDA 2R69H 1J05B 3U0WL 5GHWH 2MCPH 3BKCH 3H9SB 1IKNA 1X4ZA 1E4JA 4N68A 2VZUA 5D72H 1CWVA 2KL6A 1C5BL 3BGMB 4KKCC 5J1AA 5FFLA 4U7KA 2NW2A 2IANB 4MZ2A 4OZHA 3S9DB 4S0UC 5DQDH 3H3PL 4GRMB 4KDTA 1BREA 4JKLA 3W9EA 4LDOB 3KLAA 5DJ6A 4M3KB 3I3DA 5DZNA 3ZE1F 1GOHA 1R3LA 2UWEE 1YQ2A 2JIXB 2GSGB 4XMKH 1F6AA 3DGCR 3B5GA 1N3NA 2I07B 5EUOA 4DKFH 3ZKXC 4NQVA 5F70A 2DQUL 4TN9A 5E8NA 2Q76A 3CJJA 5FHBH 4I2XE 1I8MB 3Q3GA 1P4IL 3BW9A 4X8JB 4PJGF 5FYJH 3EYUL 4PREB 4HX1A 5F6IB 3QDGA 5EA0L 5AUMA 5SWQA 2DF3A 2R23A 4AG4H 2V5MA 5BQ7A 4G7YH 2Z4QB 1CK0L 2DQIH 4PJ9C 3T2PA 4FQJL 5C0FA 4MDJA 1XR9B 3U0PB 1O7SA 2EDQA 1QTYT 1QEWA 3GJEB 2BMKA 5F7KC 1RJYA 3G6JF 3BP4A 4LLWA 4LPCA 3P4OA 3I9GL 4GQ9L 3HC0B 5BJTB 4LCYB 3GDBA 4BQ6A 4YFLF 3VWKC 4YHKL 1OB1B 5AWNL 3B9KD 2YWZA 1D9KA 4O51B 4N8VB 3IDGA 4HEPG 5TFSL 3MRRB 1IQWH 1MFAL 2WP3O 3EYQD 2PR4L 3ROLB 1JRHL 1WZ1H 1OLZA 1JMZA 3ALPA 3TYGH 4JKPL 4YXHL 1KPUB 4OF6A 4U1SA 5CJ8A 4PBVC 1CDCA 2OTUB 2HT3D 3FRUA 5J3HD 2HFEA 3QNXB 1JK8B 2YRPA 4HGMA 4F15B 4JAMB 2JB6A 1IAKA 1GGYA 5J1TC 4ODBD 3RVTC 3PWPE 4GG8A 3OX8B 1NAKL 1XFPA 4G6FB 4TOYL 2AJVL 3WUWA 3MRFA 5C71A 2B2XL 3OPZH 3V5KB 1LP9F 3H8NA 3HI1B 1AR1D 5CEZD 4K2UH 1NMCC 4EI6B 4RX4A 5F9JB 5T3XD 4DN3L 5CD5D 3OKDA 1A21A 3V2AR 1KPVB 3VGGA 1A1OA 4PR5A 2E9BA 5MEND 1QR1B 1B0RA 4EKXA 3MSPA 4ZS7L 5IVXE 5LXGH 1QBLL