3ARGA

Ternary crystal structure of the mouse nkt tcr-cd1d-alpha-glucosylceramide(c20:2)
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
294
structure length
290
Chain Sequence
b'NYTFRCLQMSSFANRSWSRTDSVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVKMMPKEDYPIEIQLSAGCEMYNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDLPIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNDETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWGSLHHILDAQKMVWNHRHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
molecule tags Immune system
source organism Mus musculus
publication title A molecular basis for the exquisite CD1d-restricted antigen specificity and functional responses of natural killer T cells
pubmed doi rcsb
total genus 65
structure length 290
sequence length 294
ec nomenclature
pdb deposition date 2010-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3argA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3argA01
1XF5A 2A6IA 4N5ED 4OZGA 1KPVB 3GSRA 3QUKB 1LDPL 3UZQA 5EU6A 3IXAA 4NQDE 3GRWL 5HD8D 5J1AB 3MLUL 1KOAA 1D3CA 4OAWA 1UH2A 5IMLB 4XPGH 1SVCP 3VFWA 1EEUA 2XPGA 2PTVA 3BRGC 1MRDL 2FB4H 1JL8A 3ILPB 1KTDB 3MFFB 3K2UH 5HVWA 2QSTA 3O0RH 5MEQA 1XCTA 5KS9F 5DJYA 2AK4E 5BV7L 1ADQH 5C7XL 3IFNL 3PV6B 1HH6B 4PJ5E 1M71B 3B2VH 3NA4A 2VJXA 1AD9B 4ETQA 1H3XA 4KRPB 2G60H 1OM3L 5KANI 1ORSA 4RBPH 2FL5B 4MJ6B 3LKQA 4YIQA 4J4PD 4D8PA 4X80L 2J88H 3GJEA 4RMQA 1I85C 5JQHC 4LLWA 4PJIB 4R7NB 3B3IB 1IJ9A 4UTBL 3D9AH 3HG1B 4ZUUB 3PWVB 4Z5RB 2I26N 5GGTH 1SYVB 4PJGF 4LVNC 1DDHA 5CD5D 1EJ6A 4MD4A 1A7OH 4WW2B 4Y8AA 1NPUA 3TWCL 3OGCB 2YA0A 4V1DA 3MO1B 4YR6B 3MV7A 3D1MC 3AUVA 2FCBA 5F96H 3HCVB 2NY3D 5FO8A 2FJFB 2VDNH 2XWBA 1KEGH 4JVWA 3P11H 1EEQA 1JRHH 1BF8A 4IIQB 4XAWH 4GT7A 4S1DC 5E5MA 4OAWB 5DEZA 2YD5A 3OSKA 1AO7A 3OG4B 5DJ2A 4RMUA 5HHMB 4I5BB 4PPTA 2VDKH 3ARDC 4QGYA 1TNMA 4R4FH 2ADFH 3NFNB 3TJHD 3I50L 4WHYH 3DXAE 4V3DB 2QQLH 3PDGA 2JB6A 3FONB 4JG1H 1IGYB 4X7SH 4PRHD 1FQ9C 1KB5H 1FVEB 4LU5H 1N6UA 3ARQA 4WHYG 2X4SA 4Z0XB 3S4SA 4DOHB 4I3RL 1WK0A 2AXGB 5E95B 5FYJU 3V6FA 4OT1H 4X5XA 2EDLA 1JHLH 3LEVH 5DLMH 3S96B 2A6JA 4AIZB 2ATPB 1DVFB 4M7LT 2APXA 2IANA 1ODAA 1I7RB 5EPMA 2DN7A 3MBXH 5TE7L 4UMGA 2VQ1A 4JN1H 4LNRA 4XTRC 5HHQB 4W4OA 2VLME 3NCYP 4XNZC 3QFJD 2BY1A 1GGBL 2YPLB 3L3OA 1FVCB 1AY1H 2IFFL 5F7YC 1UXSA 3ZDXE 1FYTB 2W91A 3CFCH 4U1IB 2Q8BH 1NCCH 1DBAH 4XPHH 4UIKH 3ZE0F 1HOCA 3GBLA 4KTDL 2FWOB 4JM2C 5TGBA 2V2TB 1QR1A 2YHGA 4G6MH 3WFZA 4UQ2A 4DCQB 5CAYB 4JVPA 4MNQD 4DQOL 3VFNA 4K2UH 4LLMA 3IDXL 4DK6A 5HYIA 1XR8B 3SGKC 2CK2A 2MPAH 1KUMA 3RJDA 5TFSL 5HI3D 4DVBB 4PB9H 3W81A 1KIUA 2BDNH 1DR9A 1D6VL 3MXWH 3QPXL 5J3HC 5ADOL 4R96A 4YX2H 3GSQA 2GY7B 4PLKC 3DETD 5F6IC 1JJUA 4P23C 3VXMB 4UDUA 5I16B 2CRMA 2ESVD 2XQYK 2XN9D 3PJSB 1WBYB 1I9JH 4IRSC 5ERWA 4Y0GA 4ODVH 4YUEH 2CDGB 1P2CA 1WC7B 4JFDB 2Q3AA 3QIUB 4MA1C 3MV8B 2JJSC 3NCYS 4U1HA 4PJAF 5I0ZA 2X4TB 3U2SB 1UA6L 2I60H 1IC1A 4JRYE 3LIZL 4PLJD 5D5ME 1EMTH 3NABH 5DI8A 3QIBD 2ICEB 4IRSB 3D0VB 3QYCA 3C09B 5DVNA 3AVEA 4ZUWA 1NDGA 3R06A 3SBWA 2B1HH 5C3LD 1EX0A 2NXZC 3IS0X 3BXNA 3G6AA 4HJJH 4NKOA 1DBKL 3KR3H 4MCZA 2BSSB 3SCMA 1KN4H 1AI1H 5I8KL 4L8SC 3H42H 3CSBA 4M3KB 3BZEB 1U3HA 3DTXA 2M8XA 5MI0C 4FNLL 4LGRB 3HLAB 1T21A 3IRPX 5DUML 2VNCA 1MHCB 1OSPH 4NN5B 1AQDA 4RX4A 4X4MA 4FZ8H 4KK9D 3Q6FB 4F8QA 4PRPA 1G7IB 3EOYG 2P8LB 2E8YA 3QUXA 1S7XA 2E8ZA 4X7TA 1HE7A 4U0RC 3IJYB 4JRWA 1RMFH 4ZFZA 5F21B 4XMLL 3D0LA 3TYGL 1SJHB 2YMXL 1FH5H 3OXRB 3FAXA 4RAVA 3C5SA 2YBRB 3CZFB 3VXNA 1X4ZA 3HE7D 4BSVB 1WWCA 2ZUVA 1IAII 2FEDC 4OF5A 1G6VK 2I9LB 2HT3D 3MJ8A 5DK3A 1UZ6E 4LLVA 5DVLA 5CINL 3FFDA 2V7HA 4PJ9D 2EC9T 3E8UH 3RU8H 3T4AA 1ZHNA 1FE8H 1VACA 1BVKB 5J8OA 3ULSA 1BOGA 4M02A 3NZHL 3RX5A 3KPRD 3U9PH 5D6CA 3S88H 1H3VA 2EIBA 4J3TA 1TZGH 1M7IB 1IE5A 4LL9A 4HBCL 4Y2DC 1NBYA 1IAIM 3QHZL 3PDOB 4Z7WB 2E9BA 4RGMB 2Q6WA 5IBUG 5F7DB 2NY5C 2A74A 2E7LC 4YHLH 4NFDA 3J8F7 1OTTD 5FV2A 4HG4J 2BMKB 3O3BB 3ALXA 3LQAC 1KT2A 1S9VB 1U58A 4XI5D 2GJ6D 3G5YA 1YPZF 4PRAA 3RUGA 2XRAH 1S5IH 3IDMB 2PO6D 5GZNC 4ODSL 4I3GA 1P84J 3TT3H 2D9CA 3G04A 1W72L 1A8JH 1KIQA 3U6RB 1J1XL 4H20H 3TEUA 4LVNB 5EC1B 3WN5B 4J12A 1WSST 5KS9A 1RJLA 4XBGA 3O6KH 1DQQA 3L3KB 3MLWH 4QRSA 3EZJB 5FHAL 1T4KB 3H9SE 4RWYH 1HCFX 1GGIL 3QUZB 4LSSH 5EA0H 3DUSB 5IK3A 1KG0A 5D71L 5I6XB 1MY5A 3N1FC 5AZEH 2FH6A 1BZ9A 4LCWE 3SQOH 4TQEH 3ZTJH 2VRAA 4RFNC 2CMRL 1FGVH 1JWUA 1S7UA 5FKAB 2VO5A 2D7MA 5DD3H 4XPBH 5FYLH 4LP5A 2XNAB 1NFIA 1WQVT 2WK2A 5IIEB 5FEBA 3CFEA 4LQFL 1GZQB 1KTRL 3CFIC 4KK5D 2OP4L 1JHTA 5K59F 2P24A 4QHNA 5DD6B 1T83C 4OIAA 3ZKMC 5BRZA 4WGVB 1DQTA 4PRDB 3BW9B 5FF6A 2X89D 4L3CB 4NFCA 3P0GB 4MCZB 3SDCA 4WI4A 1KLUB 4MXQA 4UNVA 1CGSL 2R69H 1OQOA 1JUFB 2YKLH 2Z4QA 4WV1A 4XNQA 5T3ZH 3O4LA 1S78C 4KV5F 8CGTA 3N1GC 4RMTA 3RTQD 2FIKB 3E6HB 1FRGH 4WTWA 4XWGH 3HRZB 2AK4A 2X4TA 3P4OB 3SGEH 3LN4B 5L2JA 2G60L 1I1FA 3S3SA 3F8UB 1BFVH 3BKML 5BV7C 4NQXA 1NFDF 2N1KA 2QQKL 5ICXA 5I15H 2C26A 3PJSA 4JB9L 5HSFA 3KPNB 2MCPH 5JOFA 3KYAA 5T3ZE 3I50H 4LLYA 1YYMH 2BNQE 3CX5K 4ZTPL 8FABB 4S1SL 1WBXA 4NRZB 4BM7A 2C3VB 1FSKC 1GC1H 1OAXH 1KJVA 4DGYH 4J2XA 2FIRT 4YDKH 1GRWA 3UCRA 4PGCB 3TA3A 5INCB 1NGXA 5FK9A 5EBMB 2HT4C 3K4DA 3VFNB 4IHOB 4GAFB 2LFGA 3SCMB 3TT1L 1RUQL 4LASH 4LPVA 3DV4B 2J8UB 2XA8H 4TTDD 3IJSA 4YXHL 5HI5D 3ZSSA 4HKZB 4WO4B 3BP6A 3BRDA 4NBZB 4ZQKB 1FFOB 4AEIH 4K7FB 1F2XK 4AH2A 4U1HB 1IEHA 2PTTA 3CUPA 1P2CB 1WC7A 4JFDA 2QSCH 3EYQC 2CKBH 1QPXA 5ALCH 3GI8L 4JZJC 5CEXA 3HZYA 3V4PL 4F37F 4Z95H 3I2CH 3CDFA 1KIRB 2A6KA 1N7MH 1FZKB 3SKNB 1I3UA 4JKPH 1DLHA 1KB5B 1WEJL 3HHRB 3ZT5A 3WIHL 4D0BA 3DRTB 2HKFH 1Q94A 2UVEA 4XHJC 1FNEA 1BFOA 3FB5A 3QCUH 1OSPL 1HXMB 1U8MA 3FRUA 3QEQA 3EO9L 3ROLB 1SBBA 1XGUB 4KJQD 2ZOLB 1U8NB 3R1GL 1NCCL 4K94L 4LKCB 2DRUA 4A2MA 4FABL 5LWYL 4IRJC 1UWGL 1A7PH 2NTFA 4ZXBB 3MUJA 2BNRA 2XTLA 5L8KB 4KI5C 2EE6A 3VXRB 2R4RH 1KN2H 4LHUB 5TE7H 2AJVL 4PRBA 3BWUC 1RAMA 3WLBA 2DQTH 2VXUL 3FB6A 3SJVB 3M1BA 4X6FB 3U0TA 4BQ8A 1PDKA 1B2WH 4H25A 3IETB 1J7VR 1S7SA 1QA9B 1CE6B 2OSLB 1N0LA 4XGZB 4WFHD 3ARGC 1CE1H 5LWYH 2EE2A 3OPZH 3PL6B 2BVOB 3N9GH 1FFRA 2F5AL 4X6DF 4DVRL 2NYYD 4HH9A 5C09E 3GSVB 4QOKE 1YJDH 4CMHB 5IQ7H 1U8PA 3VFRA 3CXHK 4HFUH 4OF8A 3GFUA 2WV3A 4ZFFB 2ZCLH 5BO1H 3FO2A 1MRFL 4HIIB 5CP7B 4XAWL 2RFXA 1CK0L 3NACH 1HSAA 4ONOA 1QSEA 3NCCB 4WHTA 1SY6H 3PWNB 3QJFA 1OCWH 3RZWA 5ILTL 1MHHA 5F96L 5TQ0H 3KLSA 2EKJA 4UIKL 2RCSH 4QTIH 5EZLA 1D9KD 4YE4H 5I76A 2MSPA 5EUOF 2D0HA 2VXQL 1CTOA 1NGXB 4NP4H 4LEXL 4JY4B 1P4IH 2V17H 4ZD3L 3T3PE 3RUGF 3PHQA 1ZA3A 4PRNA 3GKZA 3G6JF 3OJMB 1MH5B 4PY7A 5IMKB 2CLRB 4FFEX 1T0PB 2Y6SC 3FOMA 1MIEL 3B5HA 4NGHH 3NAAL 1UT9A 1KENH 1TZHA 2YPVH 4RISH 1GZPA 1UJTA 3X11A 2KQMA 3KPNA 4P2OC 3AM8C 3SBWC 1H3PL 5J1TC 1VFBA 3NVQA 5C08E 4DZ8B 3T0EB 3ARFC 1A2YA 4ZS7L 1I3GH 4Z77A 4S1SH 4HF5L 1Z9OA 4U1GC 3PWPB 5HYJA 3U30B 4WW2F 3UTTB 4F58L 5E8PB 3U1SH 3H0TA 1FSKB 3GMNB 4YK4B 1RFDH 1HHJA 4YNYA 2LAGB 2OZ4L 2XWJA 3GJFH 3H9HA 4LPUA 5HHXH 1SVZA 4HPOL 4RISL 5EU6D 4JEGB 2FLRT 3FQUA 4MLSA 3P73A 1S9YA 2OCFD 3HI5H 1S7RB 5J6HB 1BJMA 3D2UD 1U8HB 3ESVF 4YGVA 1QFUH 1C8PA 5CJQL 1J1PH 3C5ZB 2QSCL 5CD5C 1G7MB 4GKSB 5E8OA 1HHHB 3DVFA 1XF4B 2CRZA 4GRLC 4F15B 2YC1B 1YEKH 2DQIH 1I9IH 2YWYA 4PJEF 2Q7YA 1UEMA 2A1WL 2PN5A 2IGFH 3EO0A 3ZKSD 1RIHL 4EN3A 5GHWH 1TPXB 1KEML 3C87A 4P46D 5T1LA 4YXLH 1MLCB 3OKYA 2IAND 5JHDD 1F2QA 1GIGH 1MQKH 3D39A 1RK0B 4S1DD 4PJCE 3P4LA 3HPJA 4Y4FC 2FX9L 4TVPL 5HDLA 4NPYA 4JFXA 5EBGA 2WP3T 5D7JB 1TJIH 4Y5YA 1IKNC 4NJ9L 5EOTA 4ZTPH 3QCVH 2V2XA 3VXTA 2PW1A 1UFUA 3EW3B 4I1NB 2DQGL 2VSCA 5FK9B 4XCCH 2Y06L 2KL6A 1QNZL 5FDYA 3LB6D 3C6LA 5TDOA 8FABA 3QQ9C 4O2FB 4LQ1A 1FYTE 4PP1C 1ONQB 3L95A 3RVVC 2XN9E 4LCUA 1MREL 3DO3A 3MRCA 1YMHA 3FJTA 2Q86B 2VZVA 1H0DB 1AHWA 3MLRL 1A0QH 2VIRA 4MGXA 4J3XA 3O3DB 3HAEH 2WUBL 3TZVB 5GGQH 3TN0A 1GPOL 3MUGB 3HRZA 5A2FA 5CSZB 4XVTL 4D0DA 2AERT 4DN3L 3GSXA 5J12C 5EO1B 3BESR 3MRJB 1OP9A 1RUML 1SMAA 2BSTA 2RQ8A 1JTPA 3V0VA 3QSKB 4Y16B 4B41A 5TFSH 5BVPL 1S3KL 2X5PA 1VDGA 4R6UA 1MCKA 3ALWA 4L3ED 3OR6B 2OJEA 1OD9A 2YEZA 5BRZB 1M7XA 1EVTC 5T3XD 3RY4A 4YXKH 5SWZB 4UT7L 4PGEB 4TSCH 2EDKA 5DFVD 1TTUA 3AS2A 12E8H 1JMXA 5FA4B 1P6FA 3D0LB 1VEOA 1U3JA 4NJAH 2YSSA 5TDPA 2EDYA 4D9RD 2WZPD 3BZDA 3CNKA 1J9CT 1MJJA 2EKSB 2VUYA 4KKBC 3TIEA 3WXVL 2DS4A 4DKDC 3RDTB 3LZFH 4ZO7A 5T3XE 3O2VH 2HVJB 1BZ9B 2PCPA 2DTML 3LPGA 1P5VA 2V9RA 1B0GB 1A4KB 4CMMB 3OKDB 3C8KB 1XMWA 3GIZL 4YHML 2OTUA 3U83A 3VI4E 1JZ6A 4R9HA 4HLZH 5EOCJ 2ICWB 1ZAGA 5GRYA 2DWDA 3ULUH 4X7DC 4L3EA 4F33A 3F5WB 3RKPA 2YD6A 3UTQA 3KPMA 4W6WB 1X7QB 3BDBA 1UENA 3MXVL 4GW1A 5JW5A 5IB4B 3H3BC 3WHE1 4ODXA 3SGJA 3QIWB 1EFXD 5D2NA 5IMOB 1EHLH 4MSWA 2ID5A 4JR9H 5C0FB 5I8KH 4X7CC 1RK0A 4F7PB 2VXSL 4XT1C 4AK1A 4HS6A 2ITCB 5IWLC 3L7EB 4O4YL 2GSGA 3RGVB 3BKMH 4RNRB 4EN3B 1U3HD 1ZS8A 4JHWL 3VFGH 2ICCA 5KSBF 5JQ6L 4Z7WF 2HYMA 4UT6L 5MENB 4K7PH 3OGOE 3T1FA 4OFYD 2DL2A 4MNQE 2PYED 1NANI 1D5MA 3DGGA 3IKCB 5GQBA 3O2WH 4M9OA 5B3JF 2HFFB 3BP4A 4M7LL 4H8WC 2IPKB 3GSWA 4FQCH 5DFVC 1MRCL 4K9EH 1H5BC 4MB3A 5I73B 2X1OA 1I7TA 5F88B 4N1EA 2PW1B 4R7DB 1EAJA 1XH3B 3OJVC 5C2BH 5IB1B 2V2XB 4YX2L 3JWNC 4U6HB 2DKMA 2FWOA 3C60C 3GMOA 2PUQT 1TETH 4HPYL 5JLZA 1QRND 2FEEI 5F6HJ 5T5NG 1HHJB 2IQAA 1L4IA 5I17B 3BSZL 5DURD 4I0PD 2AK1L 2FBJH 4FQXD 1ZWIA 1CYGA 5HHPB 1IBGH 2YA2A 5D1ZB 2F8OA 4AIZA 5E9DA 4X9FA 3IVKA 3IAGC 1OQXA 4X83A 1MI5D 1QP1A 1AC6A 2HJKA 4WTZG 1LK3H 2OTWA 3DXAA 3WNPA 4ESKA 1IFHL 1LO0H 2R9HD 3GSUA 1ZHBB 3MZGB 4NO0D 1AGEA 3QIUC 2B1HL 1J8HB 2A73A 2ITDB 3VRLF 4YBLC 2AEQH 4WUUE 4H88H 5I8OL 3TH2T 4P0DA 6FABL 3G9VA 4I18B 4MNHB 4JM4L 4W70A 5DA4A 2X4OB 4ODSH 1NBQA 1DVFC 2W9LA 4DKFL 2D3VA 3JWOH 3N1PC 1BQLL 2MTPA 1A7PL 1AO7B 3IGAA 2QQLL 3OZ9L 3H9HB 1IAIH 4K94H 5GGRA 1S8DA 3QHFL 3CVIH 4JG0L 4PGZA 4Y4KD 3MC0A 1MVFA 5FO8B 2JCCB 4MJID 1RZFH 4UT9H 3HRPA 5JORB 5TE6L 3AREC 2AQ3A 3ZSTA 5SWQA 1N64H 2YPLE 3BI9X 4RQQA 3RVTD 5KZCB 3UPRA 3AXLA 5E7BA 1CWVA 5E99H 4ZS6C 5EN2A 2OL3B 4BFIA 2VDMH 1CBVH 5GS1C 4AM0A 5FOBA 3VXMA 1X5FA 1NC2A 3DGCR 1U3YA 1A9EB 4JRYB 1P9MC 4X4XB 1BWMA 1RPQA 4M3JA 1RZKC 1N4XL 1LEGB 4M1CC 4OCSH 4NQEB 2A83B 1ZA3B 2ZUYA 1I7TB 3CX5J 4X98B 4NC1C 1OVZA 4U3XA 2Q8AH 4YWGH 4YHPB 3RY6A 2VDRL 3PWJB 4DUVA 3RUGE 1FFNB 3D85A 4BZ1H 2W0FB 4Z18A 4XP6L 4Q6IB 2Z93A 2GJZB 4KRLB 3EYFB 3VE0B 1Y6NR 3MLSL 1U6AH 1YYLL 1ZS8B 4ZUSA 5GGSA 1IM9D 4CW1B 3X17A 3GO1H 3V5HB 4X7SL 1X5HA 3VRLE 4WDIA 1Q0YH 4G8GD 5A3ID 4FZ8L 5EBLA 4M43H 3O0RL 1VGKA 2WAHA 5F1IA 1MAML 2A9NH 5D7SL 5F97E 1MJUL 4NC2B 4P46C 1B0WA 1JZ3A 3FHQA 3RIFK 1JF1A 3MJ6A 5BZWA 2DBJA 2X42A 4R26H 1OWRM 3EYVA 3FCTA 1IGML 1AC0A 2DMKA 5DVKA 1NBVH 1KENL 1MCSA 5I74C 4OGYH 4I9WE 4PJFF 1QRKA 1PSKL 2QQQA 3MNWA 2AV7B 2DQUL 5IB2B 2IG2L 5AD0B 5T3ZL 5D72L 1R3LB 2P48B 5ALCL 1NMCC 2J8OA 2NY7L 4F2MA 3QQNA 2CJUL 5EZIH 4YE4L 2G75A 2V7NA 5IV2A 3WE6A 3WHE0 1S7TA 2VR4A 4GAYB 4Q6IA 4OCXL 3VG9C 2W9DH 4LARH 4D94A 4NZRH 3VFTB 1NUDA 1BQHG 2E7LE 4H1LH 4LLAA 3FQXA 2UWEF 5GRVK 3MJ9H 2WINA 1CL7I 3CFBA 3UTPD 4FP8L 4AQ1B 1UWEL 3ARFD 4ORGB 4AG4H 4GW4B 3NZ8B 5DQJB 1WWAX 5C2UB 4L4JA 4G9DA 1JGDB 3ZTNL 3U7WH 1T0NB 4WNQB 1MCPH 5ID1A 2HAZA 3GNMH 4NBXB 3QDJD 3W11C 3QXVA 1F6AB 3MFGB 2ILLA 4Y4FB 1KIRA 1HI6A 4NKIH 1IQWL 5IF0B 5D8JL 1U8OA 3RX7A 5FGBC 1RZ7L 4LEOA 4RGNB 5MENE 3D85B 3B9VA 4OZ4A 3OQ3B 2CIKA 1AI1L 1TMCB 1I1FB 1B0RB 1J0HA 1C08A 1FFPB 3MJ7B 5DRZB 5HJ3B 1KTDA 3ILPA 5CEYA 4Q74A 5EOCH 1YPZA 4GQ9L 3B4NA 3UBXB 1MI5E 2EYTB 4ENEC 5L2KB 4M9PA 4GXVH 3QWQB 2EDDA 4LKXB 5HVFB 4GRLA 4ALAH 2AEPH 4N0RA 1IT9H 4LU5L 1JIBA 1F58L 2EE9A 4IHOA 1JTTA 3WD5L 1TQBC 5D7LA 2OL3A 5HYJE 4R4BA 3RPIA 3UTSB 4EN3C 2YUZA 3CD4A 1C5BL 4XMKL 4KC3B 2AKRA 4U7KA 1CFBA 4JJHA 3VH8A 2Z8VC 5IFJA 2XN9A 5T1MB 5LBSH 1GGYA 1CGWA 2Y07L 2JK5A 3S5LB 2VC2H 5F3BB 5DMIH 1S7UB 3NMEA 2IJ0C 1NQBA 1YQVH 4FP8H 5C9JA 1A3LL 2FGZA 4XVSH 5D2LB 5D1QC 5B39A 5GZOC 2X1XR 3IDXH 43C9A 1EGJL 3KHQA 1KG0B 5T5NF 4XXDB 3VMOA 3IAPA 3GMPB 4PD4K 1GVIA 3P4OA 3VXQA 4K9EL 1MFNA 2R1YA 2CKBL 2VXTH 2FIKA 4JFHE 4WEBL 1HH9A 4OBRA 2XG4A 4HG4K 1AGEB 1FAKT 5C0JA 4NZJA 4EVNB 2WIIB 4NUGH 3C9NA 3EDJA 4UTBH 5KS9B 2APBA 1TLKA 1MCRA 2D2OA 1DEEB 1IQDB 1EA9C 3D48R 1G7LA 1YNTA 3W39B 3AY4C 3G5XA 3HZKB 3HI5L 1QR4A 4L8DA 3SGKA 1XR9A 4OGYL 4ONHB 3RHWK 1EZVX 1VGEH 2HFFA 3BP4B 4V3EB 1JNLH 4M7KL 1G0XA 2BOBA 4MQ7B 1D5MB 3DGGB 3BGAA 3CDGB 2HTLC 3MGOA 3UEZA 5BJTB 1F00I 4OD2B 2HRPL 1EFXA 1UADC 3U1SL 5E2WL 2Y25A 5JXAL 4Y16C 2W1NA 1NAMH 4U6HA 1U8QB 2NY0C 2Y5EA 4AEHL 5AZ2H 3P0VH 2ERJC 4GG6A 1ZVYA 2EYRA 2YPKB 2DLTA 4GKNB 5CEZL 1IEBB 2EH8L 1RIVL 4L9LB 4M7KH 4ZOBA 3KS0J 1F90L 3KYNB 4IRJD 3PL6C 1B90A 4JPVH 4PJHA 1S9WB 1T0MB 4LSRH 1RQ5A 1TJHL 2P5EB 1P4IL 1MIML 3GI8H 1WCBA 1NGPH 4X0KB 5C08D 5GZOD 1KJ2A 1UC6A 1YEKL 1U0QA 3SKUD 2CJUH 1I3RA 3RGVA 5DRXA 5DD0L 1TIUA 2CD0A 1GSMA 1N6QL 4FG6D 4MDIB 3C6LD 3BMVA 4OSUL 1YC7A 4L4TB 3MRKA 3PV7A 4EXKA 1OCWL 4E41A 3AAZA 1F11B 3T0AA 4GG8A 1KTLA 1MHHB 1D5XB 1OB1B 3MJGX 1F4YL 3SGDI 3UTQB 4AZ8A 1NGZB 5B38B 2WBJA 3WL9B 3IFNH 4NZDA 3REWB 3SDAA 2P5EE 4DQOH 5FUOH 3T65B 3EIFA 5LGJA 1OAQH 2VERN 5AEAA 4Y88A 4EZMA 1XGPB 2EIZA 2F5BH 3I3BA 4CKVX 3O3UN 1PG7W 2H32B 3UJJH 4NRXA 4WWID 3K81A 1LO4H 4XPTH 3HMXL 4HUWA 3S36X 3O9WC 1A6VH 3T2PA 1S9KC 5FECB 3VWJC 4MJ5A 4OGXH 3S35L 3MYJB 3ARRA 4IRJA 1SJVA 3UYPA 1MNUL 4HJJL 2B39A 1MCWW 1OLLA 1RZGB 1Y6MR 3MA9L 4KTYA 3O6KL 2DYPA 5CD3B 1UKTA 3UDWA 4Y5XB 1INQA 3IETA 3ELAT 3ZYIA 5DGRA 4ZFOL 1V7NH 4ACPA 1UM4L 2CKBB 3QO0B 1UZ6F 3HN3A 4KJYB 3DO7A 3JTSB 3IJYA 4X7TB 3F6LA 4PJ5B 1WBZB 4IOFD 5T3ZD 2APTA 4TULH 4QXTB 1YMHB 3MRCB 1P4LB 3QJHB 4WEBH 4JAMA 1OPGL 4AMKH 2ATKB 4NRYB 3T3PF 4WUUB 4HH8A 5GRUH 5GGVH 4DFIA 1F4HA 4R4FL 3FB8B 1UQSA 3MRJA 2PF6A 3WFHB 2DMBA 2ZOLA 2KDGA 2HWZH 3ARDD 4CGTA 3AS1A 1E4XL 1I3VA 3QUML 2VLMD 1M1SA 2ED8A 4HIJB 3MUGA 5EBWA 2Z92B 4NQDB 2YXMA 3G9AB 4LLMB 1RUPH 3VXUE 1UM6L 3EOAA 2DF3A 3MUHL 1KELL 4LRIC 3MV9D 4GRWB 4LSDA 3D3VE 5I30H 5MEOB 1N5YH 1QSFE 3I6GA 3R06B 3SKNA 4ODHH 4XB8A 2F5AH 5FUCE 3OJ2C 4LLDB 2AJZB 4LNRB 2IMMA 3VXUD 4XCYA 5TDOB 5SWQB 5T1LB 2Y7QB 4K3EH 2ADIA 4N5EC 1JGLH 5C0DA 1Q0XL 4AEFA 3L5WB 2F53A 2WWMC 4GLRI 4UT6H 4YHNB 3V9FA 1HIMH 3T2OA 2M26A 1V8HA 3O9WB 1MWAL 4MNGE 3GSNA 2K3TA 1MCOH 1YEFL 5EORH 2OXHA 2R2BB 1T04B 3I9GH 2R0WL 1CT8B 4HS8L 2D31B 5MEOA 3W9DA 2UY7A 2XZAL 4Y5YB 4KK6C 1PLGH 5DRNA 3TCLB 4YGVB 2IF7A 5GIRB 2Z35B 4HK3N 1T83A 3LD8B 3B6SA 4UBDD 1O0VA 2ZPKL 5C07B 1YEIL 5I1AB 1NH6A 2C1PB 2IAMC 3OB0K 4M48H 1QFWH 5KVFH 4U2YA 5FM5M 4XPGL 5FUCC 5IVZA 5IKCB 2V5TA 4LLUA 4U6XA 2ERJB 2XWJB 2MCPL 3FQWA 2VLJE 3CFJA 4XVUC 4OB5H 4J3WA 3VXMD 4TVSa 1GH7A 3AU1A 1FYTA 4XNYL 2AAVA 2ESVB 3H0TB 2DLEA 3RP1A 1I9RL 3AC0A 2XN9B 5T1MA 3MLSH 3MRMB 4LSTH 3HCVA 1MCOL 1YEFH 3C5ZA 1UB6A 4HUXA 2OQJA 5IHZA 5J11B 1H3GA 1HHGA 3WNNA 3QIUD 2ATPA 4H26B 2I60L 1DJSA 2OBGA 4X99B 5J6HA 4J3OC 5DFTA 1MRCH 1INDH 4YO0A 4OUOA 4CU8A 3LEYH 2H6PB 3WIFB 4NZTL 3UYRH 3HG1A 4U4BA 4KVCH 1LNUB 3A6BH 2R8SL 3EFFB 1SBSH 1NGWB 2APFA 1PY4A 5DEGB 5IB1A 5DGQA 1MHEA 1YPZB 1A7RL 4GG6F 2X89A 4KK9C 1L8JA 3BW9A 4D9QE 4KI5F 1JYXA 5FGCE 5CP3A 3UTTA 4XC1H 5F7EL 5HI3C 3MV01 1UB5B 2A38A 4JO4H 5JA8B 3PV6A 4OLYL 5K9KB 4N0CC 5T1DH 5LXGL 5FO9A 3BH8A 3M17B 2F54A 5IVOA 2WIMA 3E0GA 1QBLL 4RMSA 2VAJA 5DD5L 4PRID 4C4KT 3GI9H 3MACH 3ECBB 2DQEH 1YEGL 1JWUB 3BO8B 4AEEA 4U1MB 2GQHA 1W72A 2A9NL 5D7SH 3QULB 1U42A 5F7WC 3L7EA 3U0PA 3AS3A 3QEQE 1R5VB 5EFIB 3H42L 1SEBB 1KPUB 3LS4L 4GRMB 2R9HC 5D2NE 4P57A 3NPSC 4PP8C 1YECH 3SOBH 3RQ3A 4JQXC 5I8OH 5TDNB 3BISA 1ACYH 3VWKD 4QRTA 4HK3J 4FA8A 2DQCH 3KPMB 5DJZA 1I7ZB 4HKJB 5FYKH 3T2NL 4Z7OE 5EC1A 3WN5A 1T7VA 4PJHB 1F4XL 3MNVA 3QA3B 1NLBL 1RI8A 1S5IL 3KLAB 2LVEA 3FMGL 2RFXB 3DX7A 5DEFA 2NY6B 3FN9A 5E6ID 3DWTA 4X4ME 2R23A 4PUBH 2MMXA 1QUNA 5DRWA 3IDJB 5BXFB 2QLVB 1XGYL 2OLDA 4JPKH 1UJ3B 4Y5VA 5EIQA 1J0JA 2XPGB 3KS0H 4PLJC 4D9QD 3L3DB 4OKVA 5K9JH 5DEGA 1G9ML 1UM6H 2LU7A 5E99L 2R1XB 2FO4B 1R6VA 3T8XA 1ZA6B 2EEDA 2GSIB 4KJQC 3R8BB 5IQ7L 1T1WB 4TPRL 3IXTB 1NFDB 5IB5A 3QUMA 4JRXA 5GSVA 5C0BA 4TTDC 4U3CA 3ULVF 5HHOD 4NC1E 3DRTA 4HUNB 3TM6A 1N59A 1NEZG 1T22A 2IWGA 3I6LE 3VRIA 1T2QH 4NZTH 3SN6N 3FB7B 4I9WD 2RJMA 4J1UA 2VISA 1QBAA 3DLQR 3LN5A 1WZKA 3FFCE 2AGJL 2WLZA 3RZCC 4M6NL 3TPUE 2VKWA 5EG6C 3DHJA 2ZNXA 3QNZB 1URLA 5KVMC 4GSDH 1LEIB 4BSVA 5GS3A 4G3YL 4YHPA 1AP2B 2HH0L 5CCKL 2A2QT 1TTGA 2J8UF 3HZMA 1NJ9B 4R3SA 4PJFB 5GIRA 35C8L 3K74B 1E27B 3SPVB 3IFPA 1EHLL 4WO4A 2QEJA 1OGTB 5DK0B 3QDMB 3UJJL 4CU7A 2W0LA 5F7NC 1FZKA 2Q20A 5FOBB 1JFQL 5JO5B 4UBDC 3TF7A 4YHNA 2HLAA 1YPZE 4BFIB 1V7MH 3ZYZA 1QKZH 3JV4A 3RWCA 1KIPB 2XV6B 3ULUL 2FATL 3VGFA 4TVPH 1JYNA 3U4EB 1F4WH 4MAYA 5IBTH 5JORA 1ZVHA 4P2RE 5C0CA 2FR4B 3PWPE 4JGUA 3WNKA 3MRDA 4K7FA 2NZ9D 4IDJH 3V6ZB 2YD7A 4XNUL 2VN7A 1DQJA 1ZLVK 3MROB 5GGRB 4HLJA 4WVRA 2EXYC 3HE6C 4QRPE 1KULA 3PWLB 4WHCA 1BOYA 2R8SH 1K3ZA 2EYSB 4L1DA 5DJAA 5ESAB 1FNFA 2BVQA 5FOJA 3S37H 4HWBL 2X4OA 2B8OT 1B0RA 1D6EB 2IBZY 1SJXA 4MAYD 4P46A 5INCA 1CDCA 1B6DA 2IPUG 3WFEL 2A73B 2ITDA 2H32H 3BRFA 5J56B 4MVBA 5DDHB 3IRZA 2ED7A 4J1UB 1ZHBA 1FP5A 5CBAB 3SDCB 2H2PD 1NEUA 3BZ4B 1JI1A 1A1OB 5GJTH 3I02B 1G9NL 1IGTB 1M4KA 4KDTC 1A14L 4PRDA 1CLZH 2P7TB 1T20A 5CZXC 1LO5A 5F6HI 1FL3B 3C5JB 5CLTA 4HWNA 5F3HB 2V9QA 3K3QA 4Z78B 4JFPA 4KMTL 1YEDB 4JDVA 3UAJD 3QI9B 1CICC 3QNYB 4LSSL 4N8CL 1SEQL 3SE8L 5KBNC 4MWFB 3VCLB 3SE3A 5I15L 1NGYB 3HPLA 5E03A 1NUFA 1HK6A 1F6FB 1P69B 3QCTH 1T1ZA 5FB8A 3IDJA 4R7DA 5B4MC 4GMSL 2WP3O 4M6NH 5DMGD 2Z8SA 3SO3B 3I75B 4CVXA 4DZ8A 3JZ7A 3W5NA 1ZGLM 3QZWA 2FH8A 4JRXB 4R2GD 5FGCB 4OV5A 2BNQA 3TT3L 3LZFL 1DANT 3BPOB 3SDXB 3EUUA 4R4NC 3UMTA 3CFEB 5FYLD 4YBLB 2C9AA 5I1IH 4WHDA 1XCQB 3VXPB 4OFKA 5DO2C 3O2DA 4WTZA 2YN5A 4W6XB 1EEZA 1F42A 1N8ZA 1BD2D 1TVHB 2G9HA 4IJ3C 4PR5B 3QCUL 1J88A 4OZFG 3S4SG 4M8QA 5ESVA 3GZKA 3AREB 4P2CG 4F9LC 1A3LH 5E94B 3RUGB 3T0XA 5HHOE 3SDAC 4F7EA 3AREA 2VTFA 5TF1L 5C08A 4ODXB 1RUMH 4GKOA 4MA7H 4EDWH 4IIQA 2DD8H 4OCNC 4JFEA 4DVRH 2W9DL 4X6EB 5DJZB 2UV3A 2NXZB 1QSEB 4HUMB 3ZHKA 5FO9B 5GRVL 5D1XD 4I18C 4LVEA 3G08B 2GK0A 5ENWA 5IW1B 3KLHD 1F3RB 2ICWA 5C07E 5DTFA 3ARGD 3IDNB 3RU8L 4JLRB 4Y2DD 3V79C 3W9EA 1Z0MA 5CZVH 1TQCB 4H5SA 3BDXA 1RHFA 3F12A 5JQ6H 3U0PB 3BEWB 5IP4A 2O61A 5E8DH 1A9EA 4JRYA 3BO8A 3EOBA 2O5XL 4G80B 4LDLB 4Z0BH 2HLFC 4LIQH 4I0CC 3OKEA 2OZ4H 1YEJH 1KV3A 5EN2B 2IBGA 4H1LB 1QPPA 2FEDD 1DFBL 2X4QB 1YEDA 5DSCA 1A7NH 1M71A 2G5BA 4I48B 5DJXB 3SDDB 4G8FB 3QXDA 2YBRA 1OGAE 1H15B 1QEWB 1UVQA 4NKDA 1GL4B 2BNRE 1VADB 3ZHDA 4JB9H 2AK1H 4N0UA 4KKBD 3MTRA 3Q6FA 4JM2B 5CBAA 1A14H 4N1HB 1D5BA 4K94C 2R2HA 1KPVA 1T7WA 2OTPA 1EUTA 4PB0L 2NY6C 4GSDL 2VITA 3MLYL 3IAQA 4P2RA 4XWGL 3REVB 1CFNB 4NO2A 3RWDA 3SQBA 3U7AA 1BF2A 1MUJA 2IPUK 2YD2A 3MV7E 5C0AD 3TZVA 2A77L 4FFYL 2BVQB 3SO3C 4Z7VF 4OCWH 1S7VB 3WSQH 4CJ0A 4EUPA 3S37L 1AGCB 1XIWC 4XCNA 5ESQA 5FKPA 3RWFA 2DQHH 2Q86A 1UKSA 3O9WA 2ESVA 3WXWH 1TJHH 2ICWI 3O8XD 4S1RL 5C0CB 2F54E 5CEXB 2VE6B 3LRHA 4OTXH 3OXSB 2CDGA 3SDXE 2Y9RT 1CD1A 4KUCF 4OD3H 4PLNC 5DMKA 4FQXA 3JV4B 4NM8H 5EU3B 4P4KA 3KYOA 1BREA 3UTTD 3DVGA 2UZYB 2E27H 4NCDA 2XTJD 2IAMA 1CD9B 3T77B 3UBXG 5KG9A 4PJHE 4PYGA 4Q9RH 5CSBA 3ZKND 5I1CH 3G6AB 1WIUA 1JI2A 4KGJA 5F9DC 3MSPA 5C3TA 1NC4A 5CS7A 1HXYB 4OFVA 1IGFL 2IFFH 2XKSA 5EBWB 5KS9E 1CR9H 5FIEA 2AVGA 1AKJA 3JV6B 1C08B 1IARB 5LGHL 1X5ZA 5FHAH 2OR9L 3O3EA 1RZ8A 3MA7A 1A0QL 3QDGB 4NQVB 2X9XA 5GXBB 3IJHB 3K1KC 1AXIB 2IC2A 4LHQB 3O8XA 3DV6B 1T66C 3EO0B 3BPCA 5GS0L 4Q0XH 2QL1A 1S9XA 1NCNA 1HI6B 5IVXE 1UXSB 3V7AG 5I18L 3HE6B 4I3RH 3BPCB 1PD6A 5DVOA 1KN2L 4QT5B 5I2IB 4TRPH 3PUCA 1LHZA 1MCFA 1JZ4A 3GBML 2D0GA 2IANB 4GW5A 4KV5E 1MUJB 4KRPC 2H26B 5LQBH 3BKJL 4NHCL 3S6CA 4JZNB 1D5IL 3EJZD 3U4BH 4X6CE 3V6FB 5DD1L 4UT7H 4XVJH 1TJIL 5FM8A 3MYJA 3QH3B 1MHPH 3E2HC 4OZHF 4K3JH 4KDVA 4MA3B 5A2LH 4UILH 3EJYD 3QJHA 4HJ0C 2EIZB 3C2SA 4PJ5A 3LD8C 4PJBB 1YDPB 4KJYA 5EB9A 3DO7B 1ZOXA 4GKZB 4X8XA 4YHOL 1LD9A 5H2BB 3CSYA 1A4KA 4CMMA 1DVFA 1RIUL 1B88A 3TNMB 5I9QC 4PUBL 3Q0HA 1MELA 2HVJA 2DIBA 1ERNA 3BE1L 1PZ5A 1RZGA 2SEBA 4GG8B 3HNVL 2VLJB 1MIMH 4TUJB 2YSSB 2JB6B 3VI3F 4LLQB 5BS0A 5JW4M 4F15C 4QRRA 2DM7A 4PRNB 2FNBA 1CF8H 4EJ1C 1J0ZA 2BNQD 1VGKB 1RZIA 5J13B 1WFTA 4LCCC 3LS4H 4GMTH 3R4DA 3MLZL 2HG5A 1W72B 1V7ML 5KVEL 5IT2H 4Y16A 1ZLSH 3P0VL 3HUJA 3KPPB 1NGZA 3B9AA 4Y16D 1XZ0A 3K2UL 4KMTH 4M48L 4F7MA 4PRIA 5CBEB 5AG8A 2FDBP 4G59A 3AAZB 1IZJA 4YFDB 1JPST 1KC5H 1CDIA 1VFAB 3HAEB 1NCWH 3I84A 3CMGA 5ADPH 4GG6B 2P5WE 4KI1A 1MFCL 4M8QB 5ESVB 2WUCL 4O58H 2IEPA 4DN4L 4YXLL 1H8NA 3V0WH 1EDQA 3RL2A 5ISZB 4MNGA 5ITFB 1CQYA 4HCRA 3UJTH 3V4PH 5I1JL 2X4NA 3T3MF 3L95B 4ZD3H 1ONQA 1JGLL 1CN4A 5F7DA 1XF3A 4TNWK 1U93B 4ZPVA 3ULVC 4MZ2A 2E9JA 3ZT7A 1VKXA 5GGTL 4X4YA 3BKCL 4L9LA 3ZDZF 1LP9F 1Z9LA 2E3VA 3HZKA 4L8DB 4MA8L 4QRRE 5ENWB 7CGTA 2CLVB 1AKJD 4QGTA 1TENA 4WU5B 5I8EA 3MFFA 1QSFA 2QKIB 4JFEB 4PTTA 3HI6H 4NC0B 2BNRB 2UVFA 5CILL 1JPSL 4U1GB 1R3KB 4MAUH 3QIWD 1EFXB 4QNPE 3IXAB 1H8OA 4HFUL 4L4VD 4R26L 1FPTH 4OF6A 4PJHF 5D7IF 2X9WA 4P3CL 4RAUB 4RIRB 4FFVC 5C0GB 3G5XB 4HWBA 5GJSH 2P45B 2DTSA 1IAMA 1WTLA 5E2VH 3GSNB 3IU3B 4ENED 4JFFB 4JHAH 3CK0H 1FO0B 1QO3A 3TVMB 5E8DL 5EO9A 3U7YL 3C60D 3N0PB 2R2EB 4H1LG 1LO2L 4PJCB 4PJ8B 4BZ1L 4KXZI 5ID0B 5HHPA 3TIDA 2B1AL 1D6EA 4L8CB 2KQNA 4ELMF 5C6PB 1JCKA 4CNIA 5I1EH 3MPCA 4PFEA 3THMH 3HC0A 3HMXH 4PJAE 4EI5D 1I1CA 2EDOA 4LMQE 3VCLA 3BP6B 3PDDA 2JK5B 3S5LA 2CUMA 4DEPC 2LABA 4QLRA 1ADQA 2XQBL 4GQPH 2Y5TB 3ZL4H 3K4ZA 2VLRE 2BRRH 2E27L 1U8JA 5D5MB 2IPKA 5EU5A 4BA8A 3UXFA 1XIWD 5FYLL 3SDAD 3HI6L 3O4LD 4HBCH 3WUWG 3DURB 4Y19B 4PV9A 3FO9A 4HS3A 3QFJA 4ODTL 4PJ7E 4LAJH 4BUGA 4FQIH 3H9SD 5DQJA 5E6IC 4UV4H 3O6FD 3KDMB 1JZ2A 2D7TH 2W0PA 3MJ7A 3SKOA 3WJJC 4Z7WE 3TYFB 3TVMC 2DLIA 1HSBA 1INQB 2VLRB 2LV4A 3QNZA 4ALAL 1P7QA 3BPLB 4Y2DA 1D5ZA 1AR2A 1S7TB 4XZUB 3AB0B 3CLEL 2BRQA 2F53E 1LK2A 1QVOB 2Z91B 1J1XH 1YN6B 3W11D 3DNKA 4MS8C 4IM8A 3CVHB 3QPQC 1FLRH 2JIXD 4L3CA 4OB5L 4X7FC 2PXYB 5I71C 1A6VL 4HIEA 2W9EH 3UJIH 1G9EA 1IGFH 4NQSB 5D1QB 1RU9H 3W5MA 4PREB 5ACZB 3ARGA 2ADFL 2NY5L 3CFBB 3DUUB 5BCAA 3P4MA 2GHWB 5AG9A 5E2TL 5IVXB 5DD5H 5HY9A 3RVWD 2PR4L 1CVRA 2BVOA 3PHOB 2R4SH 4BQCA 4BZ2L 3G5VA 1N26A 3PQYB 3GMMA 4UQ3B 4M7ZB 3AY4A 2DM2A 4OD3L 4PRPD 1KEGL 2DKSA 5D1XC 1L9NA 3BN9D 4C55A 4XMPL 4TOYH 4RFOL 3KJ6L 4CVWA 5D93B 1FVDB 5IB3B 1OAUL 4U31A 3SJVA 5JIHA 3WXWL 1BLNA 1FLTX 4O51B 1YDPA 4NHUE 5JHLL 3LRSA 5DJDB 3LN5B 4ZAKD 1WVZA 4UV4L 3U36B 4OCRL 3OAZH 5EDXA 5FCUL 3QDAA 3MBEC 1JGUL 4K7PL 5TQ0L 2AQ2A 4V1DE 1DUZB 2G5RA 25C8L 4KTEL 1PSKH 3UO1H 3ROLA 2C1OB 4X80H 1FFQA 3QPXH 4V2BA 3QUMB 5EUKB 5IB5B 3JWDC 4GKNA 2EIDA 4I8DA 3HE7A 2EICA 1SM3L 3PABB 3EYOB 1A02N 3LVEA 3MRHA 5A40E 2HWZL 5FYKE 1SJEB 1NDMA 3SKMA 4NNYA 3HE6A 2NTSP 1MRDH 2NY5H 3U46B 5LGKA 4Y5VB 3LEXA 5E1HB 4HX1B 1ORQA 3O4OB 5BJTA 5BV7B 2HTKC 5E5RB 1X5GA 4TNWF 5EU7E 1CE1L 5J1SC 2CXGA 5DRWB 3ZKXB 5JMOC 3B2UC 1NGQH 1NBYB 4JQXA 4NQCE 2PTTB 1XCTB 2NY3B 1C16A 5F1SA 4WFHE 3GMRB 4L5FH 1V7NL 4M61B 1FC2D 1AGFA 1KJ3H 5D6CB 2DQTL 3GK8H 4X7EC 4KROC 2CSPA 4QRTB 3DBXA 4OLZL 3IJSB 1OTTC 5HHMD 3VU2A 3T77A 5KG9B 3GMQA 4AM0B 3O45B 4HC1A 1CR9L 4NPYB 4R8WL 4ZOEA 3OWEA 4FFZL 3VW3L 1XGTB 4G8EA 5F72S 2DM3A 5DQ9A 5HHVL 1TZIA 3TN0D 3MRBB 4OFPA 2CRYA 3NBNA 2W0KA 3D69A 1MF2H 4R0LA 1E4KA 1SYSB 1K85A 3QULA 4P4KC 2QHLA 3O3AB 4FG6C 5H94A 3E2HB 1RZJC 3IDGA 2VZUA 4HGWB 1GOHA 1KELH 3VRJB 1K8IA 2Q87A 4PDCE 3DYOA 3HZVB 4HGWA 5EULV 3C6SA 3KPRE 1TETL 4HPYH 2JELL 3TNMA 2DLHA 2B4CL 2FJGB 3BD3A 1TCMA 1E4XH 4OGZA 4X6CB 4PJEE 5GHWL 5TE6H 4LOUD 5L2JB 4YEFA 4NHUA 4PJDF 1XGYH 4JPKL 2I9TB 3BVNB 4AYFA 3F7YB 2YPLD 2W65B 2X2YA 3EO1A 3NZHH 3CFKB 1LE9B 5HHVH 3BKCH 3RKDC 3GM8A 4MA3A 3ARUA 3NOIA 3O2WL 4PJFE 4CN1A 1KJMA 4X8JB 4N0FB 1ED3B 4RGNE 1NDGB 2GK2A 2ICEA 3GMNA 4XPAH 1RJYA 3QG6A 4OF0A 4M61A 3ISWA 5E8PA 3X12B 3IVKB 1YEHL 3C6LC 1ZT4B 1KCUL 2OXGA 4H0GA 4FMFA 1NBVL 3C08H 5IMMA 2ADGB 2HTLD 2VLKD 1ES0B 5I75B 1ZT7B 3JV0A 1MCIA 4LSUH 4P23A 5I17A 5GS1B 5HPMA 5HDQL 4X5WB 3E2HA 5ETUA 2Z0BA 4YZFE 4XWOD 1OAQL 2CLRA 1ZGLP 4GXUN 1OAYH 4JFDD 3GGWB 1NUNB 3MV8D 1TZIB 4ORGA 3DIFB 3H8NA 3U0WL 1VENA 5FUZH 4QYOB 2Q76A 4GJTB 1BJ1H 3LKSB 3QHZH 3QIBB 4OBSA 1IL1B 1AE6H 3L3HB 5EZLB 1CGVA 1K5NB 1RUKL 3I2CL 3T1FB 5KSVB 2VDLH 4OSUH 4U1IA 5MHSD 1P4LA 4O02L 3CVHL 4NKMB 3FT2B 5DJDA 5DF0A 5FM4A 2YA1A 4Z7OF 4FQLL 3BH9B 1A7OL 3TWCH 1JYVA 5GRWA 1BLNB 1AD0B 1K2DB 4U7SA 4WGWB 1BVLA 4OF7A 4LGPB 4V1DD 1HQRA 1X9QA 2IG2H 5F8RC 2PCPB 1RURL 4HX1A 4XNUH 4YHOH 3MNZB 2R0KL 2ZOKB 4LSRL 5GISH 3AMLA 5I30L 3EDEA 1IC5H 1OTSD 5DJ6B 3MCLH 3QAZB 4MJ5B 5BOPA 3PHOA 2BY2A 4BELD 2OMNA 1K3IA 1L6ZA 3F5WA 5CEZH 3HE7B 4XGZA 1WAAE 4KDTA 5J06A 5HVHB 5D2NC 3FQRA 3RVXC 5E2TH 5ACZA 3UX9B 1A4JB 2OTUB 1E6OL 2OJEB 2YEZB 3OR6A 4NN6C 3REWA 3SE3C 1W8OA 4MZ3A 1UQSB 2YN3A 5FB8B 3GB7A 3KPRB 3PWUB 2YRZA 4JAMB 2EIEA 1LGVA 4KI5E 2P5ED 3ME0A 2X6MA 4CJ1A 4MWFA 5CEZE 1VADA 2VQUA 1KXTB 5D7KE 5CWSA 2O5XH 1M05A 3U4AA 3GK8L 4AIXA 2E6QA 4OZHB 4HAGA 3MLVH 1PKQE 4BFEA 2VXUH 3VXNB 1A9BB 4S1QH 3BPOC 3Q1SL 1HXMA 3TFKC 3SKOB 4GRWF 4L4TD 1VERA 5CD3A 4M1DH 5F6IB 1XGQA 1AHWB 1W0VB 4G80A 2HT2C 3NCJH 4XCEB 2YR3A 1TCRB 2P5EA 3VJ6A 3G5VB 4XH2B 1ZLVH 5ICYA 3OKMB 3V52H 3BQUD 4LCWD 1Q9LA 3VFVA 4H5SB 1FNGA 4XPFH 1PVHA 3P9LA 2PO6B 3C8HA 3FO1A 5IQ9B 3OKKA 1XGPA 2J4WL 3UPRB 1L6XA 4L3EE 4KK6D 1Y0LA 2PXYA 2ZCLL 3P4NB 3QEQD 5IEKB 4UV7H 4OZFH 3ZKMD 1N7ML 4G7YH 3BXNB 1WUNT 1D7FA 5IOPA 5C9KA 1Q1JH 3WKML 4UINL 4BYHA 4EI5A 4LCUB 4IIQC 4G7VH 1TTFA 3DV4A 5L9DH 2EDHA 4YDVA 3OZ9H 1IRAY 3VW3H 1FNAA 1MCDA 3PG2A 2Y4SA 2AJSL 2HFEB 3UTTE 2NMSA 2XG5A 3M45A 2ORBL 1FG2B 4PJ5D 5FYKL 3LOWA 3UJTL 2C3VA 1KXQE 1EH9A 5DO2D 3V0WL 3EYSH 2JIXA 5KSVA 2XFXA 2IH1B 3BPNC 2OTWB 1ETZB 1I75A 5T1KD 4WI8A 1OGTA 5DK0A 2JF1A 2X70B 4P9HL 1J86A 2H2SD 2VZSA 4XNYH 3WO4B 3ARDB 4JVUA 2XZCH 2NXYD 4NQDD 2GTZA 4XXDA 3FN0H 3WFDH 2GFBB 3UYOD 1K4CA 2V2TA 3SDCC 1LP9B 2BXZA 3GJFK 3TBWB 4NSKA 1NL0L 2D03H 1F13A 4WV1B 1YEJL 5DXWA 4HSQA 5KJRL 2QQKH 5C6TL 4PYHA 1WEJH 5CHNA 3STZB 1CQKA 4QXUL 1WZLA 2FRGP 3Q5TA 1C5CL 4N90E 1FGNH 1RVFL 5IFHH 3IS1X 3GHEL 3LV3B 4QF1B 4M6ML 1IGTA 1BAFL 3BGFB 2ZSVB 1G7PB 4LF3A 3RZCB 1FVEA 2QTEA 4N0FA 1N4XH 1QOKA 4LBEA 3ZT6A 2NY3C 1XIWA 2OK0L 2OJZH 4XX1G 4HK0B 2I9TA 1KACB 1NAKL 2FZ3A 5C07D 1A6WH 3OAUL 1JPFB 5DK2A 1HHKB 5GSRA 4OZ4B 5EWIL 4HPOH 1AGBA 4JFZH 2B0SH 5AUMB 2OR7A 2VUOA 3QIWA 5D2NB 1T7ZA 3F7VA 2BK8A 3PP4H 3HE7C 4XAKE 2HJLA 1Z6JT 3MGTA 5AYUL 3X14A 3NIFF 4EUPG 5I8EB 3MXVH 3QAZC 3FQTB 1OAKL 1ZHLA 4U1NB 3U4EA 3LDBC 4B5EA 4FQJL 2NXYC 4NT6A 1QHOA 1GGCL 2X41A 1FLRL 1F8TL 4WW2A 3IF1B 2MQCA 1F4XH 2PO6A 4RZCA 2WINB 2QV2A 2EC9U 5IROA 1YMMB 5I1HH 3C08L 3UC0L 4PJAB 2ESVE 4Q58C 3BAEH 2F9BT 3B3IA 5SWSA 1YY9D 3MLVL 2AV1A 5JW3H 4LLWB 3E3QE 3VJ6B 1XGRB 5ITFA 4DW2L 3KHOA 3RIAF 3SPVA 3UBXA 2C3GA 1FZMA 3W0WB 4K3EL 5FHBH 1SMOA 3S36H 15C8L 1RUAH 1AIFA 5L9DL 4MNQA 4FXGA 4F57H 2NY4C 3QNXA 3HAEA 5H35B 1LEIA 3WJJA 2WY3A 1KB9J 5MP6L 4JREB 3QCVL 4HBQA 4OFYA 5CWSB 2MCG1 3QR2A 1U8OB 1F5WA 3WFCL 1FBIL 1CLOH 1BEYL 4PRIB 2X4UA 4JO1L 3VFUA 3VXRD 1FNGB 5ALBH 4KZDH 3EYVB 3GB7B 5HGHB 5HYSA 4EKXA 5ID1B 1ZVSB 4RGOH 3P30L 3SJVD 2CRIA 1A6WL 5HGDA 4Z76B 3QQ4A 5T33H 3UZEA 1XGQB 3FRUB 2A9MH 4LAQH 5AYQA 2I9LA 2MJWA 4QOKB 5KSAD 3DX9A 5I75C 2BHZA 2IANE 4H26A 1A9BA 2GSIA 1CS6A 2QJDA 3O41B 3O2DL 1C12A 1WFNA 3VWKB 4M7LH 4OM0L 1JPTL 4C56A 5GGSB 1LEKB 3DYMA 4JANB 4M6MH 3K8LA 2A6KB 1NGPL 5B8CA 2UZXB 5BW7C 1AXTH 3PIQA 4K07A 3O6MH 5E0QA 3B9EA 1HN1A 5E6IB 3K1DA 3ARXA 4JGJA 1PQZB 1K4DB 2Z31D 1U8MB 5B39G 5T3XL 1IM9A 5IW6B 4OJFH 5LCVH 5D96B 5ISZE 1NANH 1OGAA 5HHNA 5KANG 4R97C 1EAPB 4ZYKB 2ARJQ 4HCRL 4FHBD 5J89A 1P4BL 3BP7A 1CFSA 1KC5L 3MOBH 2DQGH 4LCCA 3OJDB 2VR5A 3ES6A 2OS7A 4G42B 4OIIH 1FNLA 1X44A 4KQ3H 1D9KB 5A2JH 2EDRA 2EC8A 3TBTB 4P23D 1T80A 2JB5H 4QYOA 2O93L 3ARVA 2ZSWB 1RD6A 4PREA 3D39D 5C8JB 2HKFL 2H1PL 1KJVB 2BVUA 4JFZL 4DEPB 4K71B 5I2IA 1NLDL 2FHBA 1U36A 5HPMB 3IDUA 1A1NA 5DZOA 5I8CA 3F7RA 3GSOA 4UIMA 4FTVA 4XCNB 1UXWB 2Z93B 3ERYA 3F7VB 3NH7L 1A6ZB 4MA8H 3BH8B 1OTUC 4G6JL 1A7BA 1HHKA 2YWZA 5GSRB 1JPTH 3QUYC 3LKSA 3QIBA 1N5AA 1FG9C 3LHPH 1U8HA 3PP3K 4NO5B 1FJ1B 3ULUD 5DJ8B 2AK4B 1HHIB 5L8LB 2A77H 4FFYH 5L88H 2QSVA 4HUUB 4JCLA 1JZ7A 3GGWA 2IADB 3RRQA 2J6EL 1QD0A 5EZJB 4CBPA 1L7TH 1ROWA 2XA8L 4YXHH 4Y4HC 5KW9H 1W0WB 4EQ3A 4P3DB 3TPUA 4NN7C 4N0UB 3RNQA 1IKFH 4U2ZA 5BO1L 1TJGH 3Q3GB 3FFCA 4ZO6A 3RAJH 4PJ7B 1BFSA 3QUMH 1DLFL 3CJJA 3D2UB 1HZHL 5EU5B 2P1YA 3VGAB 5C0NC 1GC1L 2CLZA 5EPMB 1KBGH 5JZ7C 3SEPA 2MWCA 1MJUH 1UM5H 1BJ1J 1VFBB 4F7TB 4M43L 2JCCA 4D2NA 4OQ1A 3CH8A 3U48A 4AY0A 4G43B 1EHAA 3RTQC 4JO2H 5JDSA 5E6YA 1FAIH 4P5TB 5DHYB 4ZOAA 4EI6B 1SY6A 1LP9A 1MSPA 4FRWA 4JZJB 1N0XH 2D7NA 4PY7B 1YNKL 5IMKA 3F62A 5ANMB 4ZDHB 4KKLD 4YHIA 4I0PA 4WU7A 3QUZA 3S34H 3S3JA 2P24B 3O45A 2BSED 5GZND 2AJ3A 2OM5A 5I76B 3G08A 5D93C 5IW1A 3IKCA 4X6CF 2R2HB 1U8KA 3FOLB 1SEQH 3SE8H 4ODVL 1DQQB 1CT8A 1JWSA 1G7QA 3OKOA 4FTVD 3FTGB 5GS0D 1U9KA 1RZJH 1X5KA 2FX8L 3U6RA 4C56D 4WY7H 1HSAB 1NCDH 4E0RA 2OP4H 1OSZB 1TNNA 3CIQA 5CUSL 4IS6B 1X5YA 2RAMA 5EH1A 2B4CH 3IT8D 4IMKC 2AJXH 4PRAB 5E2UH 5C70A 1EGJA 1IGIH 1U8PB 3VFRB 3HFML 3WJLC 4H1LA 1XGTA 2VC2L 4JO4L 4AIOA 2RB8A 3GMQB 4DZBB 5BS0D 2PXYC 1CGTA 5I71B 4GW1B 1NDMB 2V5SA 4F3FB 4G42A 4PTTB 4XVJL 4A2LA 4LCCB 4MXQD 2ZCHL 3RWHA 1RZJL 1T0MA 4FQCL 2DKUA 4Y4HB 3PABA 4XP9L 3S5LG 5EZIL 3BPLC 4NQUA 4G6JH 1VPOH 1GAFL 4OLZH 5E8EA 2KZ1B 2YOCA 4MHHI 5DQDL 4QRPB 4HGKC 1FHGA 3TIEB 1S9VA 4DAGL 2CXKA 4XCEA 1RIVH 4P9ML 4QHKI 4UNTA 5SWZD 5KAQF 4MS8D 5IB3A 1WTGT 2CKBA 4GG6E 3CZFA 4UTAH 1YJDC 2LQRA 3R1GH 4K71C 3DX9B 4N8VG 1BM3L 4GBXD 1MAMH 3NPZB 4NN7B 1NFDE 4APQD 2C1OA 4U3HA 3MV8E 4IEFB 3QUXB 4JQIH 1RULL 1CXLA 3GI9L 3MACL 2IALB 3RDTD 4BZYA 4YHLL 1A1OA 5HGHA 1UEYA 3V0VB 5I1GH 3W0WE 1NC2D 1CXHA 4OI9A 5HY9B 3B9KC 1QSZA 5KVDH 1CIDA 1QSED 4HKXA 3ZE1F 1MHCA 4LSQH 5EO1A 1G7HA 2DWDB 3BWAA 1JZ5A 1X5XA 4LLVB 3ARGB 4L4VE 4XC1L 4OLUH 1NMAL 3OHXB 3BZEA 1T3FB 5D96C 4OQTA 5A2KH 3H9ZA 1AQKH 3MQIA 4JKWA 4LK4A 4RMVA 1JHKL 5JXEC 2DWEA 1KNOA 4ZNEA 4BH7A 4PBXA 4Y8DC 4ONGH 1NGYA 1I1AA 4PJDE 1NCAL 2VL5A 4P99A 5T1KA 2VDLL 3K4AA 4OGAD 3BHBA 3KJ6H 4X6DB 1Q1JL 3MLYH 2UYLA 3VFGL 5JHDA 3HS0B 1BVLB 2FSEA 4FQQB 1RUPL 3RWCB 3O6FC 3C8DA 3RIAK 1ZT1A 1U3HB 1S3KH 4ZFOA 4X0KA 1I7UA 3RY5A 4BSJA 1IC4H 1BFTA 3P9WB 3TBVB 2Z9TA 4M93B 3HC4H 1J0YA 1ZLUK 4P49A 3L3HA 4KTDH 5DDHA 4NOFA 3GSXB 2ZUWA 4KVNL 3N9GL 3MRRB 3VG0L 5E9DD 4PG9A 5C0EB 4HT1L 4KI5D 1AGBB 3GRWH 3LN9A 3CC5B 3DIFA 5MHSE 4YH6A 4RFEB 3FT4A 1BIIA 4UOW1 3CC5A 3CAFA 4U6TA 4Y1AA 4APQC 2L7UA 4Z7NE 5I66A 3QEHA 1Q38A 1ZEAL 5DS8A 3DVIA 1WBYA 4CADA 3G6JB 4G5ZH 1BZ7B 1QRNB 5IROC 1HNFA 4PJ9A 4OZGE 4K8RH 1FVCA 2AGJH 1K8DA 5BVJB 4NZUH 1T5WA 4HIHA 3O8XB 4JY6B 2YKLL 2XY2A 3NIFE 4QHMB 4JFDE 4HFWA 4RRPG 5IMMB 4JFFE 2O26U 5D1ZD 4K7PY 5DD6A 1KYOK 1BBJB 5INDB 1X4XA 1XR8A 5JXED 2BOCA 1MAKA 1GGUA 1MI5B 4UI2A 4M00A 2XA3A 2XTJB 4OD1H 4LOUC 2LTQB 4K8RC 4PJIE 3V7AE 2HMIC 5F9JB 1CFSB 1JWMA 5J4MA 3FL7A 4JPIB 5FYJD 4K55A 3MRFA 3WIHH 1IGIL 3CZJA 1UJ3A 3KLHC 3TESA 3ARBC 1FL5A 3MJ9L 4BH7B 1U41A 3BVNA 1G6RH 1R3LA 1N3NA 1TQBB 4L8SB 5FGBA 4KTEH 4S1RH 2AV7A 1ZANH 1ZGLB 3LKPB 4PJIF 5EA0L 2DQIL 2X1PA 3LQZB 5E00A 5GGQL 1HQ4B 4S0SD 4Y4KB 2AXGA 2XWBB 4PJGB 1J5OL 4MJIB 1I4FA 4HUKB 4PJEB 1OAUH 4MA1B 3D69B 1JF1B 4M1GH 1NMAH 3MV7B 3MO1A 1QBMH 1OP3H 1OGAD 2WANA 4EBQH 4P57B 1P1ZA 4PLOB 1JE6A 2MOVA 4GRMA 3CPLB 3BYYA 3JWDH 1T1WA 1I9RH 4Z5RA 1F4WL 4ZPVB 3LB6C 5EBLB 3ULVD 5CGMA 3TLRA 1GGCH 2FO4A 2H2SC 1RFDL 3CFDA 4JRYD 1OAXL 1OAYL 1T5XB 5E5MB 3Q48A 3GJEB 1YZZA 1QFHA 1WT5C 4D8PB 1UM5L 4NQED 4FTVE 1IQWH 1WICA 1KGCE 3BKYH 4C54A 3UTPE 1JP5A 2P4AB 1OT1A 2VQTA 4IBLT 1RY7B 1UVQB 2W0FA 4NKDB 3P4NA 5CP7A 1A7NL 4HIIA 2R23B 1KN4L 5MERA 4O5LH 5E2JA 3NFPB 1J8HE 4QRUB 3TO4C 4WI9A 4ZSOB 2COQA 3L5HA 3OGCA 4UOJA 4HHAA 1ITBB 2FGWL 1W8NA 1RHHB 3B5GA 1MVUA 3U46A 1ULVA 4F7MB 1U93A 1ZSDA 3VFWB 1PX4A 2BXYA 2EXYD 2XTJE 1J11A 3S88L 3MRLA 2O61B 1EK3A 5CZVL 5TDNA 4MNGB 3TO2B 4N8VB 4WFGE 4G9DB 3EJYC 3BPNB 5DD0H 5HDOA 3GMLB 4YAQA 5JOPE 3ARSA 3MOAL 4H25B 5I74B 4ZTOL 4OCWL 3FQXB 4X6FA 3U0TB 3KVQA 1KJ2L 1R3JB 1L0XA 2OL3L 3LQAH 3M8OH 2RHEA 5K93A 2E7CA 2QR0A 5MEQB 4U1MA 5I1KL 3R0NA 4LQFH 5IJVA 5HI4C 3WE6B 4XBPA 1RUQH 4LASL 1PZ5B 4KH2A 4DJMA 3QJFB 3CFJB 3MRIA 4LSQL 3PWUA 5DHVB 1T5XA 3N50A 1JWSB 2GTWB 1FYHB 4D3CL 1ZGLA 2R29H 3T0BA 1T03L 1YUHB 1U8NA 3VXSB 4K2UL 3QZWG 3PP3H 5K9KA 2EDJA 4JQIL 4G6ML 1FN4A 3V4UH 3H6JA 4DTGH 1B4RA 3FQRB 1FL5B 4N0YL 3TA3D 3BKYL 4HC1H 1EEYB 2DI8A 2HN7A 1FNEB 4QRQB 1DN2A 1IM3A 4QY8B 4NNPH 4QRRB 7FABH 1J8HA 2CDFB 2AJUL 3PQYA 5ISZD 5C71A 1MQ8A 5IT2L 5KVEH 4Q6IC 3PL6A 1LDPH 4M5YH 1LNUA 1DE4B 4ZUWB 4P9HH 4YO0B 1QFWI 1CE6A 1KCKA 5JW3L 4H88L 4JCMA 4GMSH 3DX8B 3QZWB 1QLRB 1HYSC 3TP4A 1DQMH 5IR1A 4M1GL 2PNDA 4WDIB 5DJ0A 2O5YH 3D39E 5E24E 1CZ8L 3JBG7 1AD0A 3H3PH 2ARWA 5ERWB 4I0PC 1T1ZB 4U05A 1R3HB 3V7MA 2Y06H 3FZUD 5GRZA 3V6OE 1L9MA 1YN6A 4Y4FD 1JNHB 2C3WA 4E5XB 5IEHA 1NSNL 4NSKB 2PW2B 5B22A 1MFDL 4RGND 3D85D 3QEHB 5JPMB 1MFBL 1OAZH 4GLRH 3MR9B 4L4VB 2YZ8A 3KPQB 4KFZC 3RWGA 4N90D 3HG1E 3ILQD 4Q9RL 1MI5A 3TYFA 4LCIH 2W60B 3NACL 5F89B 3WS3A 4HLZG 1CDGA 5F1NA 1FZOA 3ARDA 4GW5B 3K7UA 4NRZA 3DJ9A 1S7QA 3SDDC 1JNNL 3DOSA 2FD6L 1CLCA 1EO8H 1FBIH 3KG5A 4MXWH 2BERA 2R2BA 3ZDZE 1IAKB 2X10A 3PE9A 2FX8H 4MQTB 3RWJB 1QFOA 4TUOB 4MDJA 3KYOB 3C60B 4ISVA 2L0DA 3C09C 3H7BA 1IAIL 4Q9BA 5HHQA 3NGBC 4EI5C 2XY1A 4Q2ZB 3U9UB 3V6OA 2APWA 3KNBA 2HFEA 2ZUTA 4PJ8D 1Q9WA 4PD4J 1TQCC 3LH2H 1LDSA 4OZFA 5DFWH 3Q2CA 4OLEA 4PGDA 2A6JB 1QLRA 3MBXL 3S96A 3T0EE 1CGYA 5I1JH 2YD4A 2KUTA 2GIYA 2FYYA 1NC4B 3NGBB 4EI5B 4GAGH 2BVPB 1T1XB 5GPRA 1JUFA 2ZG1A 5IM7A 5FECA 2J2ZA 3IGAB 4R90H 3MRDB 3BEVB 4DKAA 3BP7B 2FR4A 4CUCA 3T1WA 2C5DC 2PR4H 1EEYA 2HN7B 3PQYE 4FQJH 4JG1L 5FO7A 5JOEA 3F58L 2OX5A 4FABH 1T3FA 2G2RB 4AT6A 2R2EA 3ZDYE 3FO1B 5IQ9A 2BJMH 2ZKHH 4FQ2L 5FGSA 3SDAB 5HHMA 1YEIH 2ED9A 3FT3B 1YEGH 4Y19D 2NY1B 4IOIA 5TJWK 3GSUB 3O6LH 2CR6A 4JM2A 3MYZA 5FYJH 4E42B 2XNAA 4X9GA 3TGXA 3ULVH 5EIVA 3OKMA 2A6DA 2VL5B 3L9RB 2EKSA 1AGCA 4KZEL 4R90L 1F45A 2N7BA 3NN8B 2OMBA 2Z31C 1MWAH 2VB5A 2D7QA 3BZFB 3VXUA 5IK3B 4CAGA 3LIZH 5DSCB 5DRXB 4G8EB 1CXKA 1INEL 2H3NA 5A43C 3Q6GL 2IQAB 5HGDB 4Z76A 4PJXB 1U8LB 5EO0A 3VDCA 5HYSB 4P2QE 2FJHB 1U8IA 3P77B 3AFLA 1ZHKA 4FQIL 2GY5A 4J6RL 5CGYD 1RHHA 2JCCF 2N4IA 5FGRA 4TNVK 3GEWB 4OGAC 5D1QD 2VN4A 1NKOA 3IDNA 4BK5A 1CBVL 3WHXA 2HT4D 3QIWC 4LSTL 3RNKB 3B2VL 1MJ7L 3EDFA 5DMIL 1NCBH 4G8FA 4I48A 5DJXA 2MPAL 4JFHD 1AIFB 3T8XB 2LU4A 5DT1L 1FDLH 2X4QA 3X3FH 5I19L 4PRHE 1AGDA 3K46A 3BMWA 2I25N 3K2MC 3DHMA 4F58H 3PQYD 5ISZA 2GEEA 4HQQH 3EOBB 5C08B 2CPCA 4HWUA 2BMKA 4NQTA 2BJML 2ZKHL 4FQ2H 5M94B 1I8MA 4KJWC 4Y2OA 4XRCB 4P3WA 2ITCA 3GBMH 4J4PA 5E8NA 3C6LB 3PDOA 5J12B 1GJIA 2JTDA 1K2DA 3LPFA 3H2WA 1DBKH 2AXFA 3KR3L 4X9HA 5EUOA 2YPVL 2X4RB 3GIVB 1TVHA 4GAJH 2R0WH 3K80A 4GXVL 1A6TA 1J0KA 2XICA 4S1QL 3TV3L 1MREH 1DEEA 3ARZA 2MQ0A 5J57B 5AAMA 4Q7DA 3VXTB 3NABL 3WIHA 4JDTH 5HGAA 1CCZA 2R0LL 1JVKA 1U8LA 1ZHNB 4KKNA 3B9DA 1HQ4A 1MY7A 1KB5L 3T09A 2R39A 2Z8WC 1PZUB 3KXFB 3VD3A 5J11C 1GOFA 4PG2C 5D8JH 1B0GA 4AENB 2YUWA 2AW2A 3QDHA 1HCVA 4N0CA 3MRFB 1N8ZB 2G9HB 5E56A 1MJJB 2DICA 1BZQK 3D18A 2P8LA 3QG7H 3RAJL 5J3HD 4UU9A 2YUXA 1MJ7H 3UAJC 1DBBH 4JFPB 5IHUL 5FA4A 4P4RA 5E8OB 1PEZA 1U8KB 1Z0NA 3FOLA 4TYUA 5F7EH 2IQ9L 2BOCB 3ZL4L 2CQVA 3HNTL 4PJBA 2GYSA 1ZT4A 1T20B 5GRUL 4OCXH 3LS5H 1C5BH 4XMKH 2DJSA 2ZUQC 3MOAH 5B8CC 3KPSD 3TO4D 1AY1L 3BEVA 1TPXC 4WIQA 4JZJA 5CINH 4TRPL 4L4TE 3V0AC 3RA7H 2M2DA 3FZUC 2MNUA 4CU6A 3T4AB 2QSQA 1AJ7H 1VFUA 1MOEA 2EDXA 3EAKA 3ZYJA 4Y4KC 5DJ8A 3R0MA 1LMKA 4G5ZL 2ICWJ 3TN0B 2FGWH 3O4OC 1OM3H 5HPOA 5IGXH 2DQDL 1IGJB 1TFHA 3MV9B 1JK8A 3NN8A 4JN2A 1V5JA 1CU4L 3MODL 3U0WH 4H8WL 1B6UA 1UXWA 5IF0A 1VEPA 4FQHB 5CIPH 3FFCB 2JB5L 3ARBB 3Q3GA 1RULH 2H8PA 1I1RA 3VXOA 1CICD 3DRQA 2X40A 5IFJB 4U6XB 4EQ2A 5C92A 1CICA 5IKCA 2F5BL 2B5IC 5KVGH 3Q5OA 4NQVA 2KH2B 5T1LD 2ADJB 1CDBA 3AGVA 2W9EL 3UJIL 4DGIL 5CEZD 3UTZA 5DJCB 2K7QA 3BSZH 2DMCA 1WGOA 3O9WD 4JY5H 4YHMH 3A67L 4FFWC 4FXLA 3P11L 1QR1B 1CF8L 3N1MC 1BGXL 3FRPG 1YEEL 1TZGL 4ZUTA 4BKLA 1T04A 5BQ7B 1B4JH 4X9BA 2BVPA 1I1AB 3JVGA 4YFLF 1AGFB 4I2XE 4WJ5B 4ODUA 2X44D 3QXAA 4O9HH 1A6PA 2MQ3A 5EU3A 3AB0C 1R0AL 3D6GA 4PGDB 3TJEL 1F3DH 2WLYA 4L8CA 1I8IA 4PP2B 1MCNA 2HFGH 4OZFB 1NCTA 4P5KA 1I7RA 5CJXC 1EXUB 3L5XH 2DB8A 1ND0B 2VLKB 1ORQB 3BIAX 3VWJB 1G7HB 3WV0A 2OZ4A 5JIKA 1IAKA 1QSEE 3KXFE 1YY8B 4KZEH 3FONA 1T0NA 3O41A 4TUKH 3RGHA 3EOAB 5H37H 5C7XH 1RJZA 3PGDA 4UAOB 4PTUA 1L0YA 4G9FD 4WTXA 1NFDA 4P2OB 1KF9B 1ZA6A 3D87B 4F9PA 4DUWA 1JZ8A 1ZVSA 2CK0H 2VZ3A 5EZOH 4WUUA 3MLZH 2HMID 4LPCA 4P2YA 4K3GA 1PYWA 3L3OB 4G9FE 4Z7QF 1CZ8H 4ZXBA 4OLVH 3KPRA 3LCYA 5CCKH 1FORL 5HYJB 3JTSA 3UTSE 2UY6A 3DSFH 1JF5A 3HR6A 1A2YB 1LE5A 4A6YL 4V1DB 1DBJH 5BMFH 2ORBH 3KYKL 4HZAA 3VGEA 4PJ8C 4LEXH 3LKNB 3LKOA 4XCCL 1TZHB 2X4NB 2DDQL 3AM8A 5SX4H 4Z7UF 1E4WH 1S7WA 4Z8FL 4L9LC 3FQNB 1MH5A 4XP1L 5C0IB 3LKQB 2N56A 3NFNA 4KMQA 1RK1B 4LHJB 1G1YA 1IVLA 3QUXC 5DT1H 5T33L 1IC4L 2VDML 5IHUH 2FX9H 1J12A 5IFAL 3VMNA 4YPGA 2YK1H 4WCYL 2BNUB 1D9KC 3DX7B 4OLYH 5DEFB 2WBJB 1G9MH 3BH9A 3MGTB 4UAOC 4JO1H 4EXPX 1FGVL 1KEMH 3MNVB 3WJLA 1BX2A 3ECBA 3EYFA 4TNVF 3I3DA 4DN3H 3FTGA 2FJFA 3PWNA 1EJOL 4U6VH 1XGRA 2F54B 5TH2B 3M17A 3CVIL 4KHTH 2NY6D 3GSRB 3QUKA 4PBWD 1R3JA 4ZUVA 4ZMAT 1K9TA 1CVSC 3MMEB 4NCC1 1YQ2A 4XVUD 3WSQL 1FIEA 4I18A 3KDMA 4JN1L 1X6NA 5CLWA 1SYVA 1TXKA 3DUHA 1NCUA 3PXHA 1U95A 1R5VA 1KPRA 4K8RL 1J05A 4JO3H 2DQCL 2JJUA 4PJIA 4R7NA 4GRWE 3W2DH 5DHYA 4LCWB 4URTB 5E70A 3WS6C 3SDXA 1HEZB 1OP3K 3LQZA 4YDKL 4M62H 4X99A 5FYJL 5IJKC 1LE5B 2P8PA 2DOCA 3EYUH 3OAYK 3TNNB 4PS4L 5A16B 5HTSA 4GKZA 2ZZUT 4XWOC 4JHBA 2Y5TA 5F8QC 2YD9A 2A0LD 3CH1A 4GRWH 4ZG1A 3B9KD 2NTFB 4BFGA 3TBSA 4LLUB 4KK8D 5LJYH 4S11A 2H2PC 1R24B 3RZCA 5GJTL 4JDVB 2AABH 3MGOB 2QADD 1X4YA 3CLEH 2HVKB 3TCXA 4K3DH 4N68A 3GBNL 4DUXA 1JMZA 4P4KD 4XC3L 1N5AB 4WW1B 1N6VA 1XR9B 1RJZB 5KSBA 4HMCA 4CN4A 1A1MB 1P9MA 4YWGL 3RA7L 5J7CC 3KJ4C 1QQDB 2X70A 4WO4C 3QDMD 2W92A 1ETZA 3C9NB 2V2WA 3WCYA 3TJEH 1T5WB 3I6LD 1M7DA 4QHLB 1IGCL 2AEIT 2RGSA 4UU9B 43CAA 5FYJE 3NIDF 5CJQH 4MQXC 1PJ9A 4OV6F 4I2XA 2GT9A 1A6UL 5E00B 4CADB 1UWXH 2R1YB 2AP2A 4XXCC 4KROD 3RL1A 4RAUA 1G6RL 4RIRA 1PGRB 1K4CB 2NXYB 3UROR 4NQEE 4YGAB 1HNGA 4TSBL 2GFBA 1ZWIB 2GTZB 3ZZ1A 4G6FB 3HA0A 4MSWB 2EO9A 2I07B 1CFTA 3QFDB 3IKKA 4OLWH 1BEYH 4NQCD 5IB4A 4XTRD 5JLZB 1P7KB 4HKZA 5HGAB 1BECA 5I1LA 2QADC 5EUOE 2PYFB 1FL6B 4AMKL 5HHNB 4MAYB 1YN7A 2QHRL 1KIQB 3MLUH 4RFNB 1WITA 3TH4T 3UTZB 15C8H 1RUAL 4DKFH 4HXBL 4A6YA 3C8KA 2AEPL 4S10A 5AWNH 1VSCA 4NO0A 3CMOH 4GFTB 3O11A 4QHMA 4U1KA 5F9WB 2WBWB 3BHBB 3SDCD 5F7UA 4Z7UA 2ZJSL 2HP4A 2DJ4A 5BS0E 3QCTL 1A3QA 3IFPB 3NTCL 4XPAL 3NFSL 5HHOA 4X6BB 3O2VL 1WBZA 2WNGA 2WWMD 4OQTH 4TSAL 3RJQB 5HYEA 1VPOL 4HD9A 4M5ZH 1JN6B 4P5MB 4HT1H 1FV1B 4F7PA 1RZ7H 3P0YL 3SGJC 2Z92A 4C83B 4POUB 4OZHA 4B50A 3QI9D 1IAOA 5HI4D 5KOMC 4FQXC 4LFHG 3CLFL 5JW5B 4J7RA 3HKFA 3BN9C 5GS2D 2J1KA 1CXFA 2XXMB 3MX0A 1YQVL 4HUWB 4TUKL 3ULSB 3QEGH 5I6XC 3TBVA 2X4UB 3VFUB 1MFAH 4I4WB 5IBLC 4XPBL 1JRHL 1OLZA 3NA9H 2V7HB 4OLXL 5FA3B 3QUZC 4LDOB 2AS5M 2XIDA 4ODWA 1CLYH 4JRXD 5LGJB 1A6AB 4Z95L 1H15A 4FQQA 2OK0H 4FXGB 1FVDA 2CUHA 1GZQA 1CTNA 2IGFL 1YMMD 3PF2A 4WUKH 3CXDL 3C5SB 1PKQB 5IIEA 3OXRA 2BX5A 1IKNA 2Q8BL 4QHUA 4NOBA 2DYPD 2ARJB 1H5BA 2CO7B 1D5XA 3B8SA 1ZLUH 4FQLH 4OKVB 1BD2B 4AEIL 4E41B 3W0WD 3MLRH 1PFCA 4J8RA 4XNXL 5EIIA 3ARED 1J1OL 3O11B 4QKXB 4U1KB 5IVXA 1E6JL 4JKLA 6FABH 4IMKA 2ZJSH 1JV5A 3P4MB 1P5UA 5SWZA 3DSNA 3CMOL 3A67H 3KLAA 3RVUC 4XX1E 1I9EA 1IFHH 1EBPA 1LO0L 5DTFB 1OTUD 2H1PH 3S3PA 1X5JA 1WZMA 1ZHLB 1LK3L 1WT5A 2DIJA 5DYOB 3WL9A 1MPAH 4NWUH 4M7JL 5D70L 3WLWC 9CGTA 4JGMA 4RWHA 5EZOL 3D25A 3VGDA 2A0LC 5L6YH 3D0VA 3PHSA 4NJ9H 3IDIA 4Y2DB 2AXFB 3WO3B 3HPJB 4HDIB 4QOKD 1HZHH 5KSAB 5D4QA 4J23A 4NN5C 3GO1L 2PKDA 2JE8A 3MV8A 4MDIA 3RI5F 5K9QG 4NM8L 5IGXL 4G3YH 4H0IA 2Y6SD 3VGBA 2KZWA 4TUOA 4J3VA 2O5ZH 2BSRB 1XCQA 1JBJA 1I8KB 1S9WA 3SDDD 3LH2L 5JHDE 3O3EB 3RDTC 4OV5B 2Z31B 4MCYB 3HUJE 1OP5K 4ONHA 3QUYD 5F89A 4U0RB 1RIUH 3X12A 2YUVA 1QTYT 3L3IB 2DQUH 4U49A 2H45A 4DCQA 1EIBA 1YEEH 1ED3A 1W0YT 4TPRH 1Z9MA 3GKWH 4Z7VE 4EI6A 2VLLB 4UILL 1MFCH 1CFTB 3QP3A 4P23B 4NFBA 3N1QC 3S7GA 1QSFD 4MB4A 4R4ND 3AXLB 1WZ1L 4I13B 4OCYL 5CUSH 3D39B 3UPCA 2ADGA 5ID0A 2GJJA 4FZEH 4FFVD 4IS6A 1LILA 5IR1B 5B38G 3GM0A 4NHCH 4E0RB 3QDME 4QCIA 2DDQH 1RU9L 3CFCL 1LO3L 1E28B 1ZLSL 2BCKB 1P4BH 1RJYB 3MLTB 3AU1B 3N85L 1OT2A 3VDBA 3BZ4A 3PGCA 2YC1A 5C0CD 5BMFL 5I73C 2O5YL 4R0LB 1ZTXL 1U95B 1T6WA 3OL2A 2P5WA 3W2DL 5KSBB 2VXVH 3MCKA 3CFKA 4YC2B 3RY6C 5E4IA 3U7YH 4XNZB 4AT6B 4P2RB 3REVA 3VXQB 5IESH 1FRGL 5D7LB 4NO5A 5FO7B 4QTHA 3HI1B 4JFYA 4ZUVB 4X6CA 3MRGB 2DAVA 3CSPA 3DX6B 4KJPD 1J5OH 2FJGA 3DBXB 2XZQH 3L5IA 1LO4L 3BDYL 2GI7A 4KHTL 1CG9A 2RCSL 2P46B 5HGBA 5I8CB 3RGVC 4P3CH 4KUZL 5IJVB 4RAHA 3CH1B 4UINH 4YXKL 4O2EA 5FUOL 1EGJH 2FEEL 2BNUA 3ROOA 3T4YA 5C09A 1DUYA 3OB0H 5C8JA 4Q2ZA 3U9UA 3D5OF 3LAFA 3QEGL 3CCHA 2EDTA 3LEXB 3OAUH 4YAQB 2AQ1A 3H7LA 3G6DL 3PWVA 4S2SA 4UDUB 3HE6D 3RNQB 1Z3GH 1S7WB 1CLOL 5GISL 2VLLA 4OD1L 2NX5D 2F15A 4NZRL 3KPTA 5DUBB 4XP1H 4YDLB 1D5IH 1TCRA 5HXMA 3RL2B 2HKHL 3MLXL 3EFDH 4DVBA 2IADA 5E08H 2WM0A 3NZ8A 3WNOA 3L3IA 4IOFC 2NY4D 2EDBA 2IBZX 2WUBH 1KLGB 2MHAB 5DRZA 5JHLH 3S36L 2AI0L