3AS8A

Mama msr-1 p41212
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
181
structure length
181
Chain Sequence
DDIRQVYYRDKGISHAKAGRYSEAVVMLEQVYDADAFDVEVALHLGIAYVKTGAVDRGTELLERSIADAPDNIKVATVLGLTYVQVQKYDLAVPLLVKVAEANPVNFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAYSYEQMGSHEEALPHFKKANELDERSAVELALV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Protein binding
molecule keywords Magnetosome protein MamA
total genus 76
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3as8A01
2FBNA 4J8EA 5G05C 3RIBA 3U4TA 5EX0A 2C0LA 5FZQA 4BTBA 4GYWA 4HOQA 2PL2A 3ASGA 3CVNA 2KCLA 5FJYA 2VSNA 3QWPA 4GZ6A 4JA7A 4NQ0A 3OXLA 1P5QA 3RKVA 2FEZA 3RO3A 2PZIA 2XEVA 4GA2A 4A1SA 3KAEA 5HQ8A 5KJKA 3KS2A 4YVOA 4WNDA 4BT9A 2R5SA 2AVPA 3Q5MA 5C1DA 1IHGA 2FF4A 2HR2A 3ZHEB 2NC9A 5KJNA 3U3WA 1KLXA 2HYZA 1WM5A 3LCAA 1ZU2A 1QZ2A 1W3BA 4U0SA 2UWJG 4H7YA 3LPZA 3RO2A 4N3CA 3LY7A 4LEUA 4CDRA 3CVQA 4KBQA 4I2ZA 3CK9A 4F3VA 4AY6A 1B89A 3Q49B 3LYAA 3QWVA 3O48A 3ZFWA 3FP3A 2XCBA 3R9AB 1NA0A 3GW4A 3FWVA 3AS4A 3Q47B 3Q4AB 5A6CA 2KATA 2Y4UA 2VSYA 5DBKA 4IN3B 3GYZA 3CV0A 4AIFA 4GCNA 3TG4A 3ULQA 2XPIA 2P58C 5KJMA 1OUVA 3QOUA 4Y6CA 5EX3A 1A17A 4G24A 3OXGA 4GYOA 1YA0A 4GYYA 3E4BA 4I9EA 2PQNA 3ZHEA 2HO1A 4U0ZA 4Y6WA 4YNDA 4YVQC 4XI0A 4U0UA 2PQRA 2KCVA 3CVPA 4UI9C 3S7DA 4WNGA 2ONDA 3ASHA 4I17A 2FI7A 3GZ1A 1PC2A 2Q7FA 4ABNA 4BWRA 4HOSA 2XGSA 2OOEA 3CEQA 3S7FA 2UY1A 5FZSA 3LY8A 4UQYA 5FT9A 5A7DB 5BNWA 2QFCA 5FZRA 2XGMA 3AS8A 4N2QA 4G26A 2GW1A 3LKUA 5CHEE 4BT8A 5ARGA 2DBAA 4GA0A 2KC7A 1KT1A 4XI9A 1NA3A 4B94A 2JLBA 4EQFA 1ZBPA 3QDNA 2VYIA 4GA1A 4GZ5A 3MV3B 4I1AA 2YHCA 4UQZA 4G25A 3ZPJA 4U07A 2XCCA 4G1TA 3AS5A 1HH8A 3UQ3A 3ASDA 3UUXA 5KJLA 4HOTA 2LSUA 3MEKA 3BEEA 1HXIA 1E96B 4RG9A 1WAO1 3EDTB 3PE4A 3CK7A 3GZ2A 3QKYA 4JL0A 2VGYA 2BUGA 4UI9K 3JYSA 4XIFA 3S7BA 3URZA 5JJ7A 4WUYA 2WPVA 5HI7A 4G2VA 3FFLA 1TJCA 4H7XA 5G04J 4GCOA 4WNEA 3ZGQA 5EKQD 2MHKA 4HOUA 5D0QD 4WNFA 3MKRA 5FTPA 5BT1A 3UPVA 3WXXA 5DIZA 2J9QA 5LCWC 2L6JA 3VTYA 4N2SA 1KT0A 5BW8C 5JJTA 4GPKA 1ELRA 2YQ8A 1XNFA 3Q15A 2LSVA 4I9CA 4UQXA 1Y8MA 3RU0A 4GZ3A 3MA5A 5M72A 2WQHA 2V5FA 3PDNA 4U04A 5D0OD 5ARFA 3ASFA 5G04C 3TG5A 3MV2B 1ELWA 4KXKB 4NRHB 4AM9A 2C2LA 2E2EA 2VGXB 3HYMB 4N3BA 5JJ6A 3NF1A 3VTXA 5CCLA 2VQ2A 4J8DA 4JA9A 3SF4A 3CKCA 4N3AA 2IF4A 4N5CA 1NZNA 2C0MA 2IFUA 2I6HA 3K9IA 4APOA 3KD7A 3QWWA 2Y4TA 2UY1B 3CKBA 1FCHA 4W9RA 3SZ7A 4AY5A 5CCMA 4UI9J 3IEGA 4JHRA 4J8FA 4J0UA 3N71A 4N39A 1HZ4A 2KCKA 5G05J 4CGWA 3CVLA 4BTAA 4RG6A 2VGXA 3ESKA 3RJVA 2FO7A 4ME2A 1IYGA 5AYWD 3TAXA 4HORA 1QQEA 4CGVA 3S7JA 5LCWJ 3LY9A 4I2WA 2XGOA 3PE3A 3CK8A 3ZN3A 4G23A 3TGOA 3OXFA 2LNIA 4O6FA 4KYOB
chains in the Genus database with same CATH superfamily
3ABME 4GZDA 3NQPA 5B3SE 5FZQA 4JZYA 5LP0A 3SFXA 4GA2A 1TNZA 3ENEA 3DPYA 3U9WA 5ANRA 3UKUG 3PS6A 1MZCA 5CRUA 3Q49B 3QWVA 2I1KA 3NZUA 3CHRA 3GW4A 4UUCA 5DBKA 4AIFA 4K03A 4Y6CA 4G24A 3ZHEA 3I4RB 4WWOA 4ANWA 2F8YA 5FINA 1H6OA 3CVPA 3DWLG 4K5AB 2L0IA 5CMYA 2KC7A 3L9TA 2YHCA 4A55A 2J4BA 1UJJA 3QKYA 4GMRA 1HG5A 3TWWA 4RSYA 3TJPA 4F7AA 3CVVA 3IHYA 4EZLA 4GPKA 4I43A 1HG2A 4DI3A 1K3ZD 4BSZB 3ZYLA 5ARFA 4ANUA 2C2LA 1FCHA 3SBSA 3D9MA 5J90A 2XEHA 1HZ4A 3DRAA 4BTAA 3FUJA 3OXFA 3Q7AA 3L82A 3UT7A 3Q78A 3RSEG 4DJAA 1L5JA 4GMJA 3KAEA 3HHMA 4DLQA 2HYZA 2F8XK 1N0QA 3ESLA 1N0RA 1TR4A 4N3CA 5ENTD 2V5QC 3O48A 4QFVA 3FWVA 3CV0A 2EIKE 4GCNA 1A5EA 2WXGA 5BXOA 4HFGA 3E4BA 3FEYA 3EUVA 3GZSA 2F0YA 5FZSA 2WQ6A 3ZW3A 3SBTB 2GRRB 1OY3D 3WG7E 1KT1A 2L0TB 2VYIA 3E37A 2WXFA 3D9NA 2J8SD 3MGBA 3D9IA 4KZCA 3UKRG 1KPSB 5KJLA 1VDYA 3V2OA 1N4QA 3GZ2A 2EINE 3P1UA 4G2VA 3MZLB 5EKQD 2XEEA 1H2TC 4HQDA 3UPVA 3RK6A 3VTYA 1IHBA 4AVXA 4AJWA 5M72A 3PDNA 3D9PA 5FWQA 1NL4A 3J5PA 3Q9NC 2VQ2A 4A1GA 3FH5A 2ETBA 1N54A 1O1TA 5T4YA 5AAOA 1N11A 2RG8A 4RG6A 3APCA 2LAIA 4CGVA 3PREA 4B89A 4ANVA 1O1RA 4TUMA 1YYHA 4EECA 4XKBA 2GRPB 5FJYA 4JA7A 4WWPA 4GTTA 3Q79A 4NACA 4CEMA 5KJKA 1IHGA 2YHEA 1E7VA 1Q2ZA 1V55E 3UM2A 2P9LG 2R17C 3ZNGA 4A3VA 5ENPD 2P2CP 4HLEA 4GYYA 1SVXA 4XI0A 4WNGA 2Q7FA 3FUIA 2VTBA 2UY1A 3UIPC 4YDYA 2BF0X 1FVFA 2RFAA 2XGMA 3BG1B 4TUUA 3PRZA 5CEAA 4GPMA 2KBXA 3TWVA 3EIQC 3EDTB 4OAUC 2BUGA 2V4HC 3JYSA 4XIFA 2AXVA 2QYJA 4J6IA 4AXHA 4GCOA 3DSVA 2MHKA 5D66A 2BKGA 3QNKA 1U3CA 2YQ8A 3Q15A 4I9CA 4XZ4A 4GZ3A 4AM9A 3FY4A 1ELWA 2E0IA 4N3BA 3EJNA 2MRIA 4F1PA 4FU3A 3ZVVA 3B7UX 2P9SG 5AQ7A 2VGXA 1HU3A 1E8ZA 2LNIA 2WXKA 4B93B 2WXMA 4GAAA 3ZU7B 4B0ZA 4I6JA 2IU1A 3FTYA 2IO2C 3G2TA 2AVPA 3QAQA 5CEDB 4FADA 3U66A 1KZPA 3LY7A 3T5XA 4ACLA 1SZAA 3ZFWA 2YNQA 3ONLA 1N52A 4L2YA 4M7CA 1N4RA 2Y4UA 2XPIA 4F53A 3QOUA 3E34A 4CDNA 4NIKA 2XHEA 4I9EA 3P2BA 4JC8A 4LRZA 2XGSA 2QY7A 2QFCA 3FH8A 5CBOA 5E76A 4XI9A 4X8QA 3T9KA 4UQZA 1FT1A 3UUXA 2LSUA 3MYVA 1U2VG 3DEOA 1BI7B 1JCQA 4WNEA 4DLOA 2OVBA 1TEZA 3FTZA 4XEIG 3BUAA 5CECB 3G2WA 4GMLA 3EHMA 4J8DA 4JA9A 4C0EA 3K9IA 1AWCB 3DBSA 4JHJA 3ZXPA 4JW1A 3N71A 1TNOA 2EIME 5LCWJ 3PE3A 3HIZA 4LG6A 2IY0C 5CBNA 5JA4D 3AG1E 2LO6A 2FBNA 3HXBA 4HOQA 2KCLA 4HLLA 3QWPA 2XEVA 3D9JA 1OCZE 2IOLA 3W9GA 5FQ8A 3DSUA 3CGHA 2XZDG 2JABA 2OEWA 2KATA 2KZTA 5B1AE 3ULQA 1JCSA 4I1MA 5FQ7A 3OXGA 4AV7A 2AWIA 2F37A 3FEXA 4HI8A 3IXEA 1H6PA 5FQ4A 2J09A 1X5BA 4O1PA 5G2NA 1HX8A 2X38A 3LVQE 3CSFA 3PNLB 2OEVA 4RG9A 4JL0A 4ATGA 3PZ1A 2VGYA 1TYQG 2R05A 3T8KA 4QQIA 3Q9UC 5AN8A 4D10C 1ELRA 3ASFA 3FU3A 1FVHA 4G11A 4IYPA 3VTXA 2GRLA 4XKCA 4DX5D 2P9PG 2GRMA 4O1OA 4Q94A 2XPYA 3ABKE 3EHQA 1K8KG 3TAXA 4KT6B 2ILRA 2VTBB 4NQ0A 2DYRE 4GB9A 2FEZA 3UIOC 2L6BA 3MCXA 3U3WA 4K5BA 1JCRA 2CHWA 4TXRA 3APDA 2XCBA 5A6CA 5CERB 1QBQA 3VLEA 3HG0D 4DX1A 3HVEB 5ENNA 1MJ0A 3CEQA 3QARA 4Q69A 1BI8B 2DBAA 1H2UA 5LFAA 3QDNA 3NOCD 3FU0A 3LDZA 3PEVB 3HXDA 3EIJA 3LEWA 3AJIA 1WAO1 3CK7A 1UJKA 4RVBA 2ZGGA 4H7XA 1JWGA 4FULA 2VGEA 4BFRA 1H0AA 1MX6A 3CSTA 1DVPA 2I9CA 2P9IG 5A23A 2Y4TA 4GTVA 1OWNA 2UY1B 4L1BA 4AY5A 5T3RA 2WB2A 1GW6A 3IHVA 5H7PA 4CGWA 4ILHB 1U3DA 2RKKA 2A5UA 1BU9A 3LY9A 2J49A 3ZGQA 2AJAA 1Z6TA 2ZIRA 2CFZA 1S64A 4GYWA 4E6HA 4LNUD 5ENSD 3CHSA 4UWKA 3I5PA 2R5SA 5KCMA 4ATZD 2NC9A 4FHKA 5BV1A 3FTUA 4U0SA 3D9LA 4LEUA 3CK9A 4KZ0A 1DCEA 4G8KA 2V8SE 4P29A 5AQBA 1RW2A 4UWGA 3V79K 4XX5A 2I1JA 2OV8A 1YA0A 2WMNA 3UTMA 3NAWA 2XS1A 4I17A 5BPPA 3FUEA 5ANLA 5FT9A 5BNWA 1H19A 5FZRA 2ETCA 4FLHA 2GW1A 3LKUA 4BT8A 3V30A 2J4DA 3FDHA 3HDXA 4I1AA 3MV3B 4DRXE 2XCCA 4GZCA 3AS5A 2CHXA 3DXMG 4WUYA 3FFLA 1HFAA 2PM7A 3E30A 5ITZF 2LSVA 1Y8MA 3SGHA 4OAVB 5JJ6A 3ULEG 3ZYKA 2IONA 5FQ6A 1WDYA 2C0MA 2IFUA 5EIBE 2WVIA 3MKQB 3X2QE 3QK0A 3NOGD 1JUQA 4JHRA 4ILIA 3CLJA 2BTDA 4AEZC 2WXNA 5AJDA 3PEUB 3SQVA 4KYOB 4J8EA 5EX0A 2C0LA 2M63A 3AG3E 3OXLA 4BETA 3ZHEB 1ZU2A 4M3OA 2CFUA 3ML8A 4EHMA 3LYAA 2I2OA 3FP3A 4BEPA 3FTVA 2VSYA 1SA5A 3GYZA 3D9OA 5HKPA 2ZU6B 4YDOA 1TNUA 4U0UA 2ONDA 4J8YA 4MKTA 1N9AA 2WM9A 3R7RA 4C9BB 4HI9A 3ISMC 4MS6A 3IV0A 4EQFA 3CVWA 3HXFA 4KVOA 2WXPA 3L22A 3SFYA 2WPVA 2BKKB 3Q73A 3C72A 4JXTA 1NP7A 1MX4A 3L08A 3V2XA 3NB2A 2E2EA 1Z5SC 3AU5A 4F1SA 5HS0A 3KSQA 3KD7A 1KZOA 4HRNA 4UI9J 3TL5A 3D3MA 4U63A 3UINC 3TGOA 5G05C 5CMWA 1G3NB 2WXJA 1UW4B 3R7QA 4GZ6A 5KNGA 4BX9A 3FUHA 3TWSA 4A1SA 4L23A 1EDUA 3PNTB 2B0OE 4CDRA 3CVQA 3RRNB 4JB8P 4C48B 2PM6A 3LJ3A 3FUNA 3AS4A 3Q47B 5ENRD 2P58C 5KJMA 5BXUA 1Z3XA 2CG2A 3FULA 4JD2G 4YDEA 1E7UA 3SFZA 3S7FA 3UXGA 1BD8A 3AG2E 5CHEE 3T5VA 2WQ7A 4B8CB 3KSLA 4G1TA 4PUCA 2B6CA 4JPSA 2R03A 4YDWA 2KZTB 4TXPA 3LVRE 4ACKA 3TWTA 5HI7A 3B7TA 1D9SA 1HS6A 3T8MA 1MX2A 3C3QA 2BEDA 1K1BA 5G04C 4BTBA 1MQSA 3IKOB 2GRNB 4F6RD 2VSOE 4K5CA 4PH4B 3CHQA 4U7EB 5FIOA 4PS8A 1OXJA 2H6GA 3QB2A 4L9PA 2V0PA 1SQMA 3FUFA 1S70B 3FUKA 2EQXA 2XPZA 4HORA 3E32A 4DX2A 5KWDA 1N94A 1AP7A 1EPUA 5AQ9A 2PL2A 3VLFA 2DWZA 3RKVA 1P5QA 3CVYA 3B95A 3IBEA 4DPRA 1N95A 5EIDA 4V3IA 3V31A 4MBGA 1V54E 1DCQA 4I2ZA 1IQUA 2VJ8A 4BERA 5B1BE 2KXPC 4CYMD 1H2VC 3DSXA 2DCPA 5JMND 5T8IA 4WAFA 3UM1A 2XS8A 1WG0A 4YNDA 4YVQC 4K0RA 3DSWA 1MHQA 4ABNA 4Q96A 4KMOA 1Z3YA 3FUDA 3TWRA 4B8AA 4GTMA 1ZBPA 4HBDA 3PZ4A 3ASDA 3MEKA 5HRYA 4UI9K 3CQGB 5LOZA 4OVUA 4U8YD 1LD8A 2ZGDA 2WXIA 5D0QD 5FTPA 4JEUA 4N2SA 4EZKA 2HE0A 3BU8A 5J08A 3MA5A 3UQ3A 2YINA 3MV2B 4KXKB 3HYMB 4L2LA 2A4ZA 4FA6A 1NZNA 3O4ZA 1IXVA 4A3TA 1N4SA 4OVVA 3BG0B 3ZEFA 3CR3A 4ME2A 2L9BA 4MRUA 2RFMA 3UX4A 1ELKA 1E8WA 4G23A 3B13A 1Y6IA 3TXNA 4BX8A 4HB5A 3B7BA 3I3NA 1EYHA 3CVNA 4AOFA 3RO3A 1UN8A 4LSZE 4BT9A 3Q5MA 2FF4A 3ZXSA 3UI2A 3SD5A 3ZUVB 2XZTG 4F3VA 4FLBA 2V4LA 1RZ4A 1ZB1A 2IEJA 3MX3A 1NA0A 3E33A 1LD7A 4IN3B 1N4PA 2R02A 2R59A 1OWPA 1PC2A 3UT8A 1TNBA 3PUKA 3EU5A 2DVWA 5ENQD 3AS8A 4G26A 5AQAA 3FHEA 3TWUA 4CDMA 3F6QA 3SNXA 4PS3A 4UWHA 1H6KA 3PE4A 4GTRA 3S7BA 3CQCB 3OTNA 4HVBA 1O5MA 4FHJA 3WXXA 1KT0A 1PY1A 2DYSE 2AW6A 1UN9A 4FJZA 2LXLA 4U04A 4NRHB 3RAUA 3I4GA 1HE8A 3CKCA 4N3AA 2I6HA 4APOA 3QWWA 1LF8A 2WXRA 4N5QA 4N39A 2LUHA 4LUNU 2FO1E 4LNBA 4O6FA 3DPDA 3U4TA 2XENA 3ASGA 3FU6A 2VSNA 2PZIA 2X6JA 3CVXA 4ANXA 4XE0A 1BLXB 2FULA 1QZ2A 4H7YA 4TV3A 3MKQA 2XRYA 2XRZA 3R9AB 3JCKC 2AXUA 3S7JA 4GYOA 2EILE 4KVMA 4PDXA 2Y69E 3TWXA 3U64A 2OOEA 3AG4E 4ZFHA 5ENOD 5A7DB 3ASOE 4GA0A 3RRUA 1E8XA 3QJZA 3ZKJA 3FH7A 4HXIA 1HH8A 1HF8A 2NYJA 2H6HA 3MKRA 5DIZA 1FPPA 2J9QA 3D9KA 3NBNB 2WXLA 1XNFA 1BPOA 4HNAD 5D0OD 1MYOA 5CCLA 3LS8A 3SF4A 2X6HA 4N5CA 1D8EA 4U96D 5CCMA 2H6FA 4NURA 4J0UA 3PVLA 5BUZA 3RJVA 4JEHA 4LERA 4ZHBA 3C3OA 5JHAA 1INZA 5AIJA 3UM0A 4J8SA 4GU5A 4YVOA 2HR2A 1LTXA 1SZ9A 1W3BA 3LPZA 1EF1C 1TJFA 3ZRHA 2J08A 1TNYA 3EU9A 2IOSA 3ZYQA 4FP7A 3Q75A 2HO1A 4Y6WA 5G55A 1OWLA 4G8LA 2PQRA 3ASHA 3L13A 1SA4A 3AAAC 4E85A 1DC2A 2QC9A 3L54A 2ZISA 4I6GA 3ABLE 5ARGA 1NFIE 3UM3A 4TRQA 2WXHA 2H6IA 4HOUA 1SW6A 4GTQA 4L7TA 2KM4A 2WQHA 3QC1A 2P9UG 4DX7D 3C98A 2QZAA 5BV0A 4ILGA 3CHOA 1OWOA 3CKBA 4W9RA 1XGWA 1IQRA 5EN5D 4RQIA 2ETAA 2FO7A 1IYGA 5AYWD 3SI5A 4C0MA 4EPZA 4U95D 3PZ2A 3CK8A 4OYSA 4R7LA 1OCOE 1E8YA 2XQ0A 5HQ8A 5C1DA 3L17A 3CIAA 3OAWA 2CG3A 1TN8A 1B89A 5AARA 3Q4AB 1OT8A 4HRMB 3D9HA 3JQ1A 3MJWA 2WXQA 5EX3A 1A17A 4GTSA 4EBAG 4UI9C 3S7DA 2RD0A 4Z68A 4HOSA 2JEKA 3R9MA 2J07A 3FTXA 3S2AA 2P9NG 3DXKG 4N2QA 3G2SA 2QYUA 4B94A 2JLBA 4GA1A 1K1AA 2WMOA 4UWFA 4U07A 4LCTA 3EHNA 4IRUA 1E96B 3UT4A 4AP2A 2Y3AA 3LJNA 3ULYA 4CT4A 4DX6D 5EYPF 1TJCA 4HS2A 4I1OB 2X3MA 5BW8C 3L6AA 3G2UA 4UQXA 5KBAA 4CT0A 2VGXB 4GTOA 3SY2A 3NF1A 1X81A 2LXMA 4O60A 3B7SA 4EZJA 5EILA 4DI4A 4CZ2D 3SZ7A 4JHKA 4PS7A 3PUJA 5AENA 3CHPA 3PZDA 1NI1A 1YMPA 3PH0C 4J8FA 3FUMA 3PZ3A 5KNHD 2VSXE 4I2WA 2XGOA 1PAQA 1S63A 4BY6A 5EYLA 3DEPA 2R2LA 4FJYA 3CHMA 2IQCA 4RLYA 4EBAA 5CRVA 3AU4A 3ONKA 4WNDA 5KJNA 3C3RA 5D2MC 4CRWA 4BSXA 1WM5A 3ML9A 3RO2A 2P9KG 3ZYMA 3HRAA 3HXCA 5E75A 1OUVA 4URKA 3SHFA 2PQNA 4LNGA 2KCVA 3FTWA 1IKND 3B7RL 3GZ1A 4BWRA 2DIWA 4UQYA 3TXMA 1TN7A 1OCCE 2GGFA 3DSTA 4A63B 2OVFA 5IY5E 1OCRE 1HO8A 4J7WA 2DZNA 3C5RA 2IJGX 3BEEA 1HXIA 1O1SA 1TN6A 3TWQA 3LXUX 3KEZA 2Y0BG 3APFA 4WNFA 3Q7FA 2WXOA 5JJTA 3JXIA 2DZOA 2V5FA 3ASNE 1JPLA 4U8VD 3FTSA 4MLPA 2Y1LE 3BQOA 4GTPA 3HXEA 3IEGA 1OWMA 5G05J 3CVLA 1FT2A 1QQEA 2MOWA 3NZSA 2IO3C 3J5QB 3RIBA 4DUIA 1UG3A 2GROB 2ZXWE 1D8DA 2EIJE 5JHBA 3KS2A 2NXPA 3W9FA 1KLXA 4U8HA 3LCAA 5EDSA 2UWJG 3SO8A 2X6KA 4AY6A 4KBQA 4CCAA 4HRLA 3CVUA 3HVEA 3TG4A 1JWFA 4UWLA 5BT1A 2GRQB 4U0ZA 1S0PA 2FI7A 3RRMB 2MYOA 3LY8A 1YCSB 4TXQA 2PNNA 3DSSA 3L16A 5LX8A 4FC8A 3JUIA 1NA3A 1QNFA 2OCCE 3FU5A 4GZ5A 4G25A 2CHZA 3ZPJA 4IULA 4APFA 1DNPA 1QYMA 4HOTA 3JQ0A 2X6FA 5C2YA 4WWNA 3UMVA 3URZA 3JUEA 5JJ7A 3JXJA 4DK5A 3VLDA 5G04J 1UOHA 5LCWC 2L6JA 3RU0A 3TG5A 2AXZA 2X6IA 3EHRA 3KEAA 1WY6A 3ZIMA 2NSZA 2IF4A 4BESA 4I6EA 2A5EA 2LAHA 3G2VA 2KCKA 2HM8A 3ESKA 5AJLA 1E90A 3ZN3A 4JVSA
chains in the Genus database with same CATH topology
2LO6A 2FBNA 4GZDA 3NQPA 5G05C 5CMWA 5FZQA 4JZYA 4HOQA 5AIJA 5LP0A 2WXJA 1UW4B 2KCLA 3R7QA 3QWPA 4GZ6A 4BX9A 3FUHA 2XEVA 4GA2A 3D9JA 4A1SA 4J8SA 4GU5A 4YVOA 3ENEA 2HR2A 2IOLA 3U9WA 5ANRA 1SZ9A 4L23A 1W3BA 1EDUA 3PS6A 5FQ8A 3PNTB 3LPZA 1EF1C 1TJFA 3ZRHA 2J08A 4CDRA 3CVQA 3CGHA 3Q49B 3RRNB 3QWVA 2PM6A 3LJ3A 2IOSA 3ZYQA 2I1KA 3NZUA 3CHRA 3FUNA 3GW4A 3AS4A 3Q47B 4FP7A 2KATA 5DBKA 2KZTA 4AIFA 3ULQA 2P58C 4K03A 5KJMA 4Y6CA 4I1MA 4G24A 5FQ7A 3OXGA 3ZHEA 3I4RB 1Z3XA 2CG2A 4WWOA 2HO1A 4Y6WA 5G55A 4ANWA 1OWLA 3FULA 2PQRA 3CVPA 4AV7A 3ASHA 3L13A 2AWIA 1E7UA 3SFZA 3S7FA 4E85A 2L0IA 3L54A 3FEXA 4I6GA 5FQ4A 5CHEE 2J09A 5CMYA 5ARGA 1X5BA 3T5VA 2KC7A 4B8CB 2WQ7A 5G2NA 1HX8A 2X38A 2YHCA 3LVQE 3CSFA 3PNLB 4G1TA 4PUCA 4A55A 2J4BA 4JPSA 1UJJA 4RG9A 3QKYA 4JL0A 4ATGA 2KZTB 2VGYA 1HG5A 3LVRE 4ACKA 5HI7A 3B7TA 4TRQA 2WXHA 4RSYA 3TJPA 4F7AA 4HOUA 1HS6A 3CVVA 3T8MA 3IHYA 4EZLA 4D10C 4GPKA 4L7TA 1ELRA 4I43A 1HG2A 4DI3A 2KM4A 2WQHA 3QC1A 5ARFA 5G04C 3ZYLA 1MQSA 3ASFA 4BTBA 3IKOB 4ANUA 2C2LA 1FVHA 3C98A 3FU3A 4G11A 4IYPA 3VTXA 2GRLA 4XKCA 2VSOE 5BV0A 4ILGA 3CHOA 1OWOA 4PH4B 3CKBA 1FCHA 3CHQA 4W9RA 3SBSA 1XGWA 1IQRA 3D9MA 2GRMA 4Q94A 4PS8A 5J90A 3QB2A 1HZ4A 2V0PA 1SQMA 2XPYA 4BTAA 3FUFA 2FO7A 1IYGA 5AYWD 3FUKA 2EQXA 2XPZA 3SI5A 3TAXA 4HORA 4KT6B 4C0MA 4EPZA 2ILRA 3CK8A 3FUJA 4OYSA 3OXFA 4R7LA 1EPUA 3UT7A 2PL2A 3VLFA 2VTBB 1E8YA 4NQ0A 4DJAA 3RKVA 1L5JA 1P5QA 4GMJA 2FEZA 2XQ0A 4GB9A 3KAEA 3CVYA 3IBEA 4DPRA 3HHMA 5HQ8A 3MCXA 5C1DA 3U3WA 3L17A 4DLQA 3CIAA 3OAWA 4V3IA 2HYZA 2CG3A 3ESLA 4N3CA 4I2ZA 1B89A 2CHWA 3O48A 4QFVA 1IQUA 3APDA 2XCBA 5A6CA 3Q4AB 3FWVA 2VJ8A 3JQ1A 3CV0A 3MJWA 4GCNA 1H2VC 2WXGA 2DCPA 5T8IA 2WXQA 5EX3A 4WAFA 1A17A 4HFGA 3VLEA 3E4BA 3FEYA 4YNDA 3HVEB 4YVQC 4EBAG 5ENNA 4K0RA 3GZSA 4UI9C 3S7DA 2RD0A 1MHQA 4ABNA 4HOSA 3CEQA 4Q96A 4KMOA 3QARA 5FZSA 4Q69A 1Z3YA 3FUDA 2JEKA 2WQ6A 3ZW3A 2J07A 3FTXA 3S2AA 3SBTB 4N2QA 3G2SA 2DBAA 4B8AA 1H2UA 1KT1A 4B94A 2JLBA 1ZBPA 2L0TB 2VYIA 3QDNA 4GA1A 5LFAA 2WMOA 3FU0A 3LDZA 3PEVB 2WXFA 4UWFA 3D9NA 4U07A 4LCTA 3MGBA 3D9IA 3EIJA 4KZCA 3EHNA 3ASDA 3LEWA 5KJLA 3MEKA 1VDYA 4IRUA 1E96B 1WAO1 3CK7A 3GZ2A 3UT4A 4UI9K 4AP2A 2Y3AA 3CQGB 1UJKA 3P1UA 5LOZA 4RVBA 4OVUA 4G2VA 4CT4A 3MZLB 1TJCA 4H7XA 1JWGA 5EKQD 2WXIA 5D0QD 1H2TC 4FULA 4HS2A 5FTPA 3UPVA 4I1OB 4JEUA 2X3MA 3RK6A 4N2SA 3VTYA 4EZKA 5BW8C 4BFRA 3L6AA 3G2UA 4UQXA 4AVXA 5J08A 4AJWA 3MA5A 5M72A 3PDNA 3D9PA 2YINA 3UQ3A 1H0AA 4CT0A 3MV2B 4KXKB 5FWQA 3HYMB 2VGXB 4L2LA 3CSTA 2A4ZA 3NF1A 2VQ2A 4A1GA 4FA6A 1DVPA 2I9CA 5A23A 3B7SA 4EZJA 4DI4A 1NZNA 3FH5A 3O4ZA 2Y4TA 1OWNA 2UY1B 1N54A 4JHKA 4L1BA 3SZ7A 5T3RA 4A3TA 1GW6A 4PS7A 5T4YA 4AY5A 3IHVA 3PUJA 2WB2A 5AENA 3CHPA 3PZDA 4J8FA 3PH0C 4OVVA 4CGWA 3FUMA 4ILHB 2RG8A 1U3DA 2VSXE 3BG0B 4RG6A 2A5UA 3ZEFA 3APCA 3CR3A 4ME2A 2L9BA 2LAIA 4MRUA 3PREA 4CGVA 3LY9A 4B89A 2J49A 4I2WA 2XGOA 1PAQA 3UX4A 1ELKA 4ANVA 1E8WA 4G23A 3ZGQA 3B13A 1Y6IA 1Z6TA 3TXNA 4BY6A 4BX8A 4EECA 2CFZA 4GYWA 4E6HA 4FJYA 3I3NA 4XKBA 1EYHA 3CVNA 5FJYA 3CHMA 4JA7A 3RO3A 4AOFA 2IQCA 4WWPA 3CHSA 4EBAA 1UN8A 4UWKA 3AU4A 4NACA 4CEMA 3I5PA 3ONKA 5KJKA 4WNDA 4BT9A 2R5SA 3Q5MA 5KCMA 1IHGA 2FF4A 5KJNA 2NC9A 4CRWA 4BSXA 4FHKA 1WM5A 2YHEA 3FTUA 3ZXSA 5BV1A 1E7VA 4U0SA 3ML9A 3RO2A 3D9LA 3SD5A 4LEUA 4F3VA 3CK9A 2V4LA 4FLBA 4KZ0A 3ZYMA 2R17C 3MX3A 1NA0A 2V8SE 4P29A 4IN3B 4UWGA 4A3VA 5E75A 4XX5A 1OUVA 2I1JA 2OV8A 4HLEA 4GYYA 4URKA 1YA0A 3SHFA 2PQNA 2R59A 2WMNA 4XI0A 2KCVA 3FTWA 1OWPA 4WNGA 3B7RL 4I17A 3GZ1A 1PC2A 2Q7FA 3UT8A 3FUIA 4BWRA 5BPPA 2DIWA 2UY1A 3PUKA 2VTBA 3FUEA 5ANLA 4UQYA 5FT9A 3TXMA 5BNWA 1H19A 5FZRA 4FLHA 2BF0X 1FVFA 2XGMA 3AS8A 3BG1B 2GGFA 2GW1A 3LKUA 4G26A 4BT8A 2OVFA 4TUUA 3PRZA 3FHEA 2J4DA 4CDMA 3FDHA 3HDXA 4I1AA 3MV3B 1HO8A 3EIQC 3SNXA 2XCCA 4GZCA 3AS5A 4PS3A 4UWHA 2IJGX 3BEEA 1HXIA 1H6KA 3EDTB 3PE4A 3S7BA 3CQCB 2CHXA 2BUGA 3JYSA 4XIFA 2AXVA 3OTNA 4WUYA 3LXUX 4HVBA 3KEZA 3FFLA 4J6IA 4AXHA 4GCOA 4FHJA 2MHKA 1HFAA 3APFA 4WNFA 2PM7A 3WXXA 2WXOA 1KT0A 1PY1A 3QNKA 5JJTA 1U3CA 2YQ8A 3Q15A 2LSVA 4I9CA 1Y8MA 2AW6A 4XZ4A 4GZ3A 3SGHA 1UN9A 2V5FA 4FJZA 4U04A 4AM9A 3FY4A 1ELWA 2E0IA 4NRHB 5JJ6A 1JPLA 3EJNA 4N3BA 3ZYKA 2IONA 3FTSA 3I4GA 4MLPA 5FQ6A 1HE8A 3CKCA 4N3AA 2C0MA 2IFUA 2MRIA 2I6HA 4APOA 3QWWA 4FU3A 2WVIA 1LF8A 2WXRA 3MKQB 3ZVVA 3B7UX 3QK0A 3IEGA 1JUQA 1OWMA 4JHRA 4N39A 5G05J 4LUNU 4ILIA 3CVLA 2VGXA 1HU3A 1QQEA 3CLJA 2MOWA 1E8ZA 2BTDA 4AEZC 2WXNA 5AJDA 3NZSA 3PEUB 2LNIA 4O6FA 4KYOB 2WXKA 3DPDA 4J8EA 3RIBA 3U4TA 5EX0A 1UG3A 2C0LA 2M63A 3ASGA 3FU6A 2VSNA 2WXMA 3OXLA 4GAAA 4B0ZA 2PZIA 4I6JA 2IU1A 3FTYA 5JHBA 2X6JA 3KS2A 2NXPA 3G2TA 2AVPA 3QAQA 3ZHEB 3CVXA 4ANXA 4XE0A 1KLXA 4U8HA 3LCAA 1ZU2A 2FULA 1QZ2A 4FADA 5EDSA 2UWJG 4H7YA 3U66A 4M3OA 2CFUA 3LY7A 2X6KA 3ML8A 4TV3A 3T5XA 4KBQA 4AY6A 3MKQA 2XRYA 3LYAA 4ACLA 1SZAA 2I2OA 3ZFWA 2YNQA 3FP3A 3ONLA 2XRZA 1N52A 4L2YA 3R9AB 4CCAA 2Y4UA 3FTVA 2VSYA 3CVUA 3JCKC 3GYZA 3D9OA 3HVEA 2AXUA 3TG4A 2XPIA 2ZU6B 4F53A 3QOUA 3S7JA 1JWFA 4GYOA 4CDNA 2XHEA 4I9EA 4UWLA 5BT1A 4U0ZA 1S0PA 3P2BA 4JC8A 4LRZA 4KVMA 4PDXA 4U0UA 2ONDA 2FI7A 4MKTA 3RRMB 3U64A 2XGSA 2OOEA 2QY7A 2WM9A 3R7RA 3LY8A 5A7DB 4C9BB 2QFCA 3FH8A 3L16A 5LX8A 4FC8A 3JUIA 4GA0A 4XI9A 5E76A 1NA3A 3RRUA 4MS6A 1QNFA 3FU5A 3IV0A 4EQFA 4GZ5A 3CVWA 1E8XA 3QJZA 4KVOA 4UQZA 3FH7A 2CHZA 4G25A 4IULA 3ZPJA 2WXPA 3L22A 4HXIA 4APFA 1DNPA 1HH8A 3UUXA 4HOTA 3JQ0A 1HF8A 2LSUA 2X6FA 5C2YA 4WWNA 3UMVA 3MYVA 3URZA 5JJ7A 4DK5A 3VLDA 2WPVA 5G04J 4WNEA 4DLOA 3MKRA 2OVBA 1TEZA 3FTZA 4JXTA 5DIZA 2J9QA 3D9KA 2L6JA 5LCWC 2WXLA 1NP7A 1XNFA 1BPOA 3RU0A 3G2WA 3L08A 4GMLA 5D0OD 3EHMA 3TG5A 2AXZA 2X6IA 5CCLA 2E2EA 3LS8A 1WY6A 4J8DA 4JA9A 3AU5A 3SF4A 3ZIMA 2NSZA 2X6HA 2IF4A 4N5CA 4C0EA 4F1SA 3K9IA 3KD7A 4I6EA 3DBSA 3G2VA 2LAHA 4JHJA 5CCMA 4JW1A 4NURA 4UI9J 4J0UA 3TL5A 3N71A 2KCKA 3PVLA 2HM8A 5BUZA 3RJVA 3ESKA 3D3MA 4JEHA 5AJLA 4LERA 4U63A 1E90A 5LCWJ 5JHAA 3PE3A 3HIZA 1INZA 3ZN3A 3TGOA 4JVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FBN A;  4J8E A;  5G05 C;  3RIB A;  3U4T A;  5EX0 A;  2C0L A;  5FZQ A;  4BTB A;  4GYW A;  4HOQ A;  2PL2 A;  3ASG A;  3CVN A;  2KCL A;  5FJY A;  2VSN A;  3QWP A;  4GZ6 A;  4JA7 A;  4NQ0 A;  3OXL A;  1P5Q A;  3RKV A;  2FEZ A;  3RO3 A;  2PZI A;  2XEV A;  4GA2 A;  4A1S A;  3KAE A;  5HQ8 A;  5KJK A;  3KS2 A;  4YVO A;  4WND A;  4BT9 A;  2R5S A;  2AVP A;  3Q5M A;  5C1D A;  1IHG A;  2FF4 A;  2HR2 A;  3ZHE B;  2NC9 A;  5KJN A;  3U3W A;  1KLX A;  2HYZ A;  1WM5 A;  3LCA A;  1ZU2 A;  1QZ2 A;  1W3B A;  4U0S A;  2UWJ G;  4H7Y A;  3LPZ A;  3RO2 A;  4N3C A;  3LY7 A;  4LEU A;  4CDR A;  3CVQ A;  4KBQ A;  4I2Z A;  3CK9 A;  4F3V A;  4AY6 A;  1B89 A;  3Q49 B;  3LYA A;  3QWV A;  3O48 A;  3ZFW A;  3FP3 A;  2XCB A;  3R9A B;  1NA0 A;  3GW4 A;  3FWV A;  3AS4 A;  3Q47 B;  3Q4A B;  5A6C A;  2KAT A;  2Y4U A;  2VSY A;  5DBK A;  4IN3 B;  3GYZ A;  3CV0 A;  4AIF A;  4GCN A;  3TG4 A;  3ULQ A;  2XPI A;  2P58 C;  5KJM A;  1OUV A;  3QOU A;  4Y6C A;  5EX3 A;  1A17 A;  4G24 A;  3OXG A;  4GYO A;  1YA0 A;  4GYY A;  3E4B A;  4I9E A;  2PQN A;  3ZHE A;  2HO1 A;  4U0Z A;  4Y6W A;  4YND A;  4YVQ C;  4XI0 A;  4U0U A;  2PQR A;  2KCV A;  3CVP A;  4UI9 C;  3S7D A;  4WNG A;  2OND A;  3ASH A;  4I17 A;  2FI7 A;  3GZ1 A;  1PC2 A;  2Q7F A;  4ABN A;  4BWR A;  4HOS A;  2XGS A;  2OOE A;  3CEQ A;  3S7F A;  2UY1 A;  5FZS A;  3LY8 A;  4UQY A;  5FT9 A;  5A7D B;  5BNW A;  2QFC A;  5FZR A;  2XGM A;  3AS8 A;  4N2Q A;  4G26 A;  2GW1 A;  3LKU A;  5CHE E;  4BT8 A;  5ARG A;  2DBA A;  4GA0 A;  2KC7 A;  1KT1 A;  4XI9 A;  1NA3 A;  4B94 A;  2JLB A;  4EQF A;  1ZBP A;  3QDN A;  2VYI A;  4GA1 A;  4GZ5 A;  3MV3 B;  4I1A A;  2YHC A;  4UQZ A;  4G25 A;  3ZPJ A;  4U07 A;  2XCC A;  4G1T A;  3AS5 A;  1HH8 A;  3UQ3 A;  3ASD A;  3UUX A;  5KJL A;  4HOT A;  2LSU A;  3MEK A;  3BEE A;  1HXI A;  1E96 B;  4RG9 A;  1WAO 1;  3EDT B;  3PE4 A;  3CK7 A;  3GZ2 A;  3QKY A;  4JL0 A;  2VGY A;  2BUG A;  4UI9 K;  3JYS A;  4XIF A;  3S7B A;  3URZ A;  5JJ7 A;  4WUY A;  2WPV A;  5HI7 A;  4G2V A;  3FFL A;  1TJC A;  4H7X A;  5G04 J;  4GCO A;  4WNE A;  3ZGQ A;  5EKQ D;  2MHK A;  4HOU A;  5D0Q D;  4WNF A;  3MKR A;  5FTP A;  5BT1 A;  3UPV A;  3WXX A;  5DIZ A;  2J9Q A;  5LCW C;  2L6J A;  3VTY A;  4N2S A;  1KT0 A;  5BW8 C;  5JJT A;  4GPK A;  1ELR A;  2YQ8 A;  1XNF A;  3Q15 A;  2LSV A;  4I9C A;  4UQX A;  1Y8M A;  3RU0 A;  4GZ3 A;  3MA5 A;  5M72 A;  2WQH A;  2V5F A;  3PDN A;  4U04 A;  5D0O D;  5ARF A;  3ASF A;  5G04 C;  3TG5 A;  3MV2 B;  1ELW A;  4KXK B;  4NRH B;  4AM9 A;  2C2L A;  2E2E A;  2VGX B;  3HYM B;  4N3B A;  5JJ6 A;  3NF1 A;  3VTX A;  5CCL A;  2VQ2 A;  4J8D A;  4JA9 A;  3SF4 A;  3CKC A;  4N3A A;  2IF4 A;  4N5C A;  1NZN A;  2C0M A;  2IFU A;  2I6H A;  3K9I A;  4APO A;  3KD7 A;  3QWW A;  2Y4T A;  2UY1 B;  3CKB A;  1FCH A;  4W9R A;  3SZ7 A;  4AY5 A;  5CCM A;  4UI9 J;  3IEG A;  4JHR A;  4J8F A;  4J0U A;  3N71 A;  4N39 A;  1HZ4 A;  2KCK A;  5G05 J;  4CGW A;  3CVL A;  4BTA A;  4RG6 A;  2VGX A;  3ESK A;  3RJV A;  2FO7 A;  4ME2 A;  1IYG A;  5AYW D;  3TAX A;  4HOR A;  1QQE A;  4CGV A;  3S7J A;  5LCW J;  3LY9 A;  4I2W A;  2XGO A;  3PE3 A;  3CK8 A;  3ZN3 A;  4G23 A;  3TGO A;  3OXF A;  2LNI A;  4O6F A;  4KYO B; 
#chains in the Genus database with same CATH topology
 3ABM E;  4GZD A;  3NQP A;  5B3S E;  5FZQ A;  4JZY A;  5LP0 A;  3SFX A;  4GA2 A;  1TNZ A;  3ENE A;  3DPY A;  3U9W A;  5ANR A;  3UKU G;  3PS6 A;  1MZC A;  5CRU A;  3Q49 B;  3QWV A;  2I1K A;  3NZU A;  3CHR A;  3GW4 A;  4UUC A;  5DBK A;  4AIF A;  4K03 A;  4Y6C A;  4G24 A;  3ZHE A;  3I4R B;  4WWO A;  4ANW A;  2F8Y A;  5FIN A;  1H6O A;  3CVP A;  3DWL G;  4K5A B;  2L0I A;  5CMY A;  2KC7 A;  3L9T A;  2YHC A;  4A55 A;  2J4B A;  1UJJ A;  3QKY A;  4GMR A;  1HG5 A;  3TWW A;  4RSY A;  3TJP A;  4F7A A;  3CVV A;  3IHY A;  4EZL A;  4GPK A;  4I43 A;  1HG2 A;  4DI3 A;  1K3Z D;  4BSZ B;  3ZYL A;  5ARF A;  4ANU A;  2C2L A;  1FCH A;  3SBS A;  3D9M A;  5J90 A;  2XEH A;  1HZ4 A;  3DRA A;  4BTA A;  3FUJ A;  3OXF A;  3Q7A A;  3L82 A;  3UT7 A;  3Q78 A;  3RSE G;  4DJA A;  1L5J A;  4GMJ A;  3KAE A;  3HHM A;  4DLQ A;  2HYZ A;  2F8X K;  1N0Q A;  3ESL A;  1N0R A;  1TR4 A;  4N3C A;  5ENT D;  2V5Q C;  3O48 A;  4QFV A;  3FWV A;  3CV0 A;  2EIK E;  4GCN A;  1A5E A;  2WXG A;  5BXO A;  4HFG A;  3E4B A;  3FEY A;  3EUV A;  3GZS A;  2F0Y A;  5FZS A;  2WQ6 A;  3ZW3 A;  3SBT B;  2GRR B;  1OY3 D;  3WG7 E;  1KT1 A;  2L0T B;  2VYI A;  3E37 A;  2WXF A;  3D9N A;  2J8S D;  3MGB A;  3D9I A;  4KZC A;  3UKR G;  1KPS B;  5KJL A;  1VDY A;  3V2O A;  1N4Q A;  3GZ2 A;  2EIN E;  3P1U A;  4G2V A;  3MZL B;  5EKQ D;  2XEE A;  1H2T C;  4HQD A;  3UPV A;  3RK6 A;  3VTY A;  1IHB A;  4AVX A;  4AJW A;  5M72 A;  3PDN A;  3D9P A;  5FWQ A;  1NL4 A;  3J5P A;  3Q9N C;  2VQ2 A;  4A1G A;  3FH5 A;  2ETB A;  1N54 A;  1O1T A;  5T4Y A;  5AAO A;  1N11 A;  2RG8 A;  4RG6 A;  3APC A;  2LAI A;  4CGV A;  3PRE A;  4B89 A;  4ANV A;  1O1R A;  4TUM A;  1YYH A;  4EEC A;  4XKB A;  2GRP B;  5FJY A;  4JA7 A;  4WWP A;  4GTT A;  3Q79 A;  4NAC A;  4CEM A;  5KJK A;  1IHG A;  2YHE A;  1E7V A;  1Q2Z A;  1V55 E;  3UM2 A;  2P9L G;  2R17 C;  3ZNG A;  4A3V A;  5ENP D;  2P2C P;  4HLE A;  4GYY A;  1SVX A;  4XI0 A;  4WNG A;  2Q7F A;  3FUI A;  2VTB A;  2UY1 A;  3UIP C;  4YDY A;  2BF0 X;  1FVF A;  2RFA A;  2XGM A;  3BG1 B;  4TUU A;  3PRZ A;  5CEA A;  4GPM A;  2KBX A;  3TWV A;  3EIQ C;  3EDT B;  4OAU C;  2BUG A;  2V4H C;  3JYS A;  4XIF A;  2AXV A;  2QYJ A;  4J6I A;  4AXH A;  4GCO A;  3DSV A;  2MHK A;  5D66 A;  2BKG A;  3QNK A;  1U3C A;  2YQ8 A;  3Q15 A;  4I9C A;  4XZ4 A;  4GZ3 A;  4AM9 A;  3FY4 A;  1ELW A;  2E0I A;  4N3B A;  3EJN A;  2MRI A;  4F1P A;  4FU3 A;  3ZVV A;  3B7U X;  2P9S G;  5AQ7 A;  2VGX A;  1HU3 A;  1E8Z A;  2LNI A;  2WXK A;  4B93 B;  2WXM A;  4GAA A;  3ZU7 B;  4B0Z A;  4I6J A;  2IU1 A;  3FTY A;  2IO2 C;  3G2T A;  2AVP A;  3QAQ A;  5CED B;  4FAD A;  3U66 A;  1KZP A;  3LY7 A;  3T5X A;  4ACL A;  1SZA A;  3ZFW A;  2YNQ A;  3ONL A;  1N52 A;  4L2Y A;  4M7C A;  1N4R A;  2Y4U A;  2XPI A;  4F53 A;  3QOU A;  3E34 A;  4CDN A;  4NIK A;  2XHE A;  4I9E A;  3P2B A;  4JC8 A;  4LRZ A;  2XGS A;  2QY7 A;  2QFC A;  3FH8 A;  5CBO A;  5E76 A;  4XI9 A;  4X8Q A;  3T9K A;  4UQZ A;  1FT1 A;  3UUX A;  2LSU A;  3MYV A;  1U2V G;  3DEO A;  1BI7 B;  1JCQ A;  4WNE A;  4DLO A;  2OVB A;  1TEZ A;  3FTZ A;  4XEI G;  3BUA A;  5CEC B;  3G2W A;  4GML A;  3EHM A;  4J8D A;  4JA9 A;  4C0E A;  3K9I A;  1AWC B;  3DBS A;  4JHJ A;  3ZXP A;  4JW1 A;  3N71 A;  1TNO A;  2EIM E;  5LCW J;  3PE3 A;  3HIZ A;  4LG6 A;  2IY0 C;  5CBN A;  5JA4 D;  3AG1 E;  2LO6 A;  2FBN A;  3HXB A;  4HOQ A;  2KCL A;  4HLL A;  3QWP A;  2XEV A;  3D9J A;  1OCZ E;  2IOL A;  3W9G A;  5FQ8 A;  3DSU A;  3CGH A;  2XZD G;  2JAB A;  2OEW A;  2KAT A;  2KZT A;  5B1A E;  3ULQ A;  1JCS A;  4I1M A;  5FQ7 A;  3OXG A;  4AV7 A;  2AWI A;  2F37 A;  3FEX A;  4HI8 A;  3IXE A;  1H6P A;  5FQ4 A;  2J09 A;  1X5B A;  4O1P A;  5G2N A;  1HX8 A;  2X38 A;  3LVQ E;  3CSF A;  3PNL B;  2OEV A;  4RG9 A;  4JL0 A;  4ATG A;  3PZ1 A;  2VGY A;  1TYQ G;  2R05 A;  3T8K A;  4QQI A;  3Q9U C;  5AN8 A;  4D10 C;  1ELR A;  3ASF A;  3FU3 A;  1FVH A;  4G11 A;  4IYP A;  3VTX A;  2GRL A;  4XKC A;  4DX5 D;  2P9P G;  2GRM A;  4O1O A;  4Q94 A;  2XPY A;  3ABK E;  3EHQ A;  1K8K G;  3TAX A;  4KT6 B;  2ILR A;  2VTB B;  4NQ0 A;  2DYR E;  4GB9 A;  2FEZ A;  3UIO C;  2L6B A;  3MCX A;  3U3W A;  4K5B A;  1JCR A;  2CHW A;  4TXR A;  3APD A;  2XCB A;  5A6C A;  5CER B;  1QBQ A;  3VLE A;  3HG0 D;  4DX1 A;  3HVE B;  5ENN A;  1MJ0 A;  3CEQ A;  3QAR A;  4Q69 A;  1BI8 B;  2DBA A;  1H2U A;  5LFA A;  3QDN A;  3NOC D;  3FU0 A;  3LDZ A;  3PEV B;  3HXD A;  3EIJ A;  3LEW A;  3AJI A;  1WAO 1;  3CK7 A;  1UJK A;  4RVB A;  2ZGG A;  4H7X A;  1JWG A;  4FUL A;  2VGE A;  4BFR A;  1H0A A;  1MX6 A;  3CST A;  1DVP A;  2I9C A;  2P9I G;  5A23 A;  2Y4T A;  4GTV A;  1OWN A;  2UY1 B;  4L1B A;  4AY5 A;  5T3R A;  2WB2 A;  1GW6 A;  3IHV A;  5H7P A;  4CGW A;  4ILH B;  1U3D A;  2RKK A;  2A5U A;  1BU9 A;  3LY9 A;  2J49 A;  3ZGQ A;  2AJA A;  1Z6T A;  2ZIR A;  2CFZ A;  1S64 A;  4GYW A;  4E6H A;  4LNU D;  5ENS D;  3CHS A;  4UWK A;  3I5P A;  2R5S A;  5KCM A;  4ATZ D;  2NC9 A;  4FHK A;  5BV1 A;  3FTU A;  4U0S A;  3D9L A;  4LEU A;  3CK9 A;  4KZ0 A;  1DCE A;  4G8K A;  2V8S E;  4P29 A;  5AQB A;  1RW2 A;  4UWG A;  3V79 K;  4XX5 A;  2I1J A;  2OV8 A;  1YA0 A;  2WMN A;  3UTM A;  3NAW A;  2XS1 A;  4I17 A;  5BPP A;  3FUE A;  5ANL A;  5FT9 A;  5BNW A;  1H19 A;  5FZR A;  2ETC A;  4FLH A;  2GW1 A;  3LKU A;  4BT8 A;  3V30 A;  2J4D A;  3FDH A;  3HDX A;  4I1A A;  3MV3 B;  4DRX E;  2XCC A;  4GZC A;  3AS5 A;  2CHX A;  3DXM G;  4WUY A;  3FFL A;  1HFA A;  2PM7 A;  3E30 A;  5ITZ F;  2LSV A;  1Y8M A;  3SGH A;  4OAV B;  5JJ6 A;  3ULE G;  3ZYK A;  2ION A;  5FQ6 A;  1WDY A;  2C0M A;  2IFU A;  5EIB E;  2WVI A;  3MKQ B;  3X2Q E;  3QK0 A;  3NOG D;  1JUQ A;  4JHR A;  4ILI A;  3CLJ A;  2BTD A;  4AEZ C;  2WXN A;  5AJD A;  3PEU B;  3SQV A;  4KYO B;  4J8E A;  5EX0 A;  2C0L A;  2M63 A;  3AG3 E;  3OXL A;  4BET A;  3ZHE B;  1ZU2 A;  4M3O A;  2CFU A;  3ML8 A;  4EHM A;  3LYA A;  2I2O A;  3FP3 A;  4BEP A;  3FTV A;  2VSY A;  1SA5 A;  3GYZ A;  3D9O A;  5HKP A;  2ZU6 B;  4YDO A;  1TNU A;  4U0U A;  2OND A;  4J8Y A;  4MKT A;  1N9A A;  2WM9 A;  3R7R A;  4C9B B;  4HI9 A;  3ISM C;  4MS6 A;  3IV0 A;  4EQF A;  3CVW A;  3HXF A;  4KVO A;  2WXP A;  3L22 A;  3SFY A;  2WPV A;  2BKK B;  3Q73 A;  3C72 A;  4JXT A;  1NP7 A;  1MX4 A;  3L08 A;  3V2X A;  3NB2 A;  2E2E A;  1Z5S C;  3AU5 A;  4F1S A;  5HS0 A;  3KSQ A;  3KD7 A;  1KZO A;  4HRN A;  4UI9 J;  3TL5 A;  3D3M A;  4U63 A;  3UIN C;  3TGO A;  5G05 C;  5CMW A;  1G3N B;  2WXJ A;  1UW4 B;  3R7Q A;  4GZ6 A;  5KNG A;  4BX9 A;  3FUH A;  3TWS A;  4A1S A;  4L23 A;  1EDU A;  3PNT B;  2B0O E;  4CDR A;  3CVQ A;  3RRN B;  4JB8 P;  4C48 B;  2PM6 A;  3LJ3 A;  3FUN A;  3AS4 A;  3Q47 B;  5ENR D;  2P58 C;  5KJM A;  5BXU A;  1Z3X A;  2CG2 A;  3FUL A;  4JD2 G;  4YDE A;  1E7U A;  3SFZ A;  3S7F A;  3UXG A;  1BD8 A;  3AG2 E;  5CHE E;  3T5V A;  2WQ7 A;  4B8C B;  3KSL A;  4G1T A;  4PUC A;  2B6C A;  4JPS A;  2R03 A;  4YDW A;  2KZT B;  4TXP A;  3LVR E;  4ACK A;  3TWT A;  5HI7 A;  3B7T A;  1D9S A;  1HS6 A;  3T8M A;  1MX2 A;  3C3Q A;  2BED A;  1K1B A;  5G04 C;  4BTB A;  1MQS A;  3IKO B;  2GRN B;  4F6R D;  2VSO E;  4K5C A;  4PH4 B;  3CHQ A;  4U7E B;  5FIO A;  4PS8 A;  1OXJ A;  2H6G A;  3QB2 A;  4L9P A;  2V0P A;  1SQM A;  3FUF A;  1S70 B;  3FUK A;  2EQX A;  2XPZ A;  4HOR A;  3E32 A;  4DX2 A;  5KWD A;  1N94 A;  1AP7 A;  1EPU A;  5AQ9 A;  2PL2 A;  3VLF A;  2DWZ A;  3RKV A;  1P5Q A;  3CVY A;  3B95 A;  3IBE A;  4DPR A;  1N95 A;  5EID A;  4V3I A;  3V31 A;  4MBG A;  1V54 E;  1DCQ A;  4I2Z A;  1IQU A;  2VJ8 A;  4BER A;  5B1B E;  2KXP C;  4CYM D;  1H2V C;  3DSX A;  2DCP A;  5JMN D;  5T8I A;  4WAF A;  3UM1 A;  2XS8 A;  1WG0 A;  4YND A;  4YVQ C;  4K0R A;  3DSW A;  1MHQ A;  4ABN A;  4Q96 A;  4KMO A;  1Z3Y A;  3FUD A;  3TWR A;  4B8A A;  4GTM A;  1ZBP A;  4HBD A;  3PZ4 A;  3ASD A;  3MEK A;  5HRY A;  4UI9 K;  3CQG B;  5LOZ A;  4OVU A;  4U8Y D;  1LD8 A;  2ZGD A;  2WXI A;  5D0Q D;  5FTP A;  4JEU A;  4N2S A;  4EZK A;  2HE0 A;  3BU8 A;  5J08 A;  3MA5 A;  3UQ3 A;  2YIN A;  3MV2 B;  4KXK B;  3HYM B;  4L2L A;  2A4Z A;  4FA6 A;  1NZN A;  3O4Z A;  1IXV A;  4A3T A;  1N4S A;  4OVV A;  3BG0 B;  3ZEF A;  3CR3 A;  4ME2 A;  2L9B A;  4MRU A;  2RFM A;  3UX4 A;  1ELK A;  1E8W A;  4G23 A;  3B13 A;  1Y6I A;  3TXN A;  4BX8 A;  4HB5 A;  3B7B A;  3I3N A;  1EYH A;  3CVN A;  4AOF A;  3RO3 A;  1UN8 A;  4LSZ E;  4BT9 A;  3Q5M A;  2FF4 A;  3ZXS A;  3UI2 A;  3SD5 A;  3ZUV B;  2XZT G;  4F3V A;  4FLB A;  2V4L A;  1RZ4 A;  1ZB1 A;  2IEJ A;  3MX3 A;  1NA0 A;  3E33 A;  1LD7 A;  4IN3 B;  1N4P A;  2R02 A;  2R59 A;  1OWP A;  1PC2 A;  3UT8 A;  1TNB A;  3PUK A;  3EU5 A;  2DVW A;  5ENQ D;  3AS8 A;  4G26 A;  5AQA A;  3FHE A;  3TWU A;  4CDM A;  3F6Q A;  3SNX A;  4PS3 A;  4UWH A;  1H6K A;  3PE4 A;  4GTR A;  3S7B A;  3CQC B;  3OTN A;  4HVB A;  1O5M A;  4FHJ A;  3WXX A;  1KT0 A;  1PY1 A;  2DYS E;  2AW6 A;  1UN9 A;  4FJZ A;  2LXL A;  4U04 A;  4NRH B;  3RAU A;  3I4G A;  1HE8 A;  3CKC A;  4N3A A;  2I6H A;  4APO A;  3QWW A;  1LF8 A;  2WXR A;  4N5Q A;  4N39 A;  2LUH A;  4LUN U;  2FO1 E;  4LNB A;  4O6F A;  3DPD A;  3U4T A;  2XEN A;  3ASG A;  3FU6 A;  2VSN A;  2PZI A;  2X6J A;  3CVX A;  4ANX A;  4XE0 A;  1BLX B;  2FUL A;  1QZ2 A;  4H7Y A;  4TV3 A;  3MKQ A;  2XRY A;  2XRZ A;  3R9A B;  3JCK C;  2AXU A;  3S7J A;  4GYO A;  2EIL E;  4KVM A;  4PDX A;  2Y69 E;  3TWX A;  3U64 A;  2OOE A;  3AG4 E;  4ZFH A;  5ENO D;  5A7D B;  3ASO E;  4GA0 A;  3RRU A;  1E8X A;  3QJZ A;  3ZKJ A;  3FH7 A;  4HXI A;  1HH8 A;  1HF8 A;  2NYJ A;  2H6H A;  3MKR A;  5DIZ A;  1FPP A;  2J9Q A;  3D9K A;  3NBN B;  2WXL A;  1XNF A;  1BPO A;  4HNA D;  5D0O D;  1MYO A;  5CCL A;  3LS8 A;  3SF4 A;  2X6H A;  4N5C A;  1D8E A;  4U96 D;  5CCM A;  2H6F A;  4NUR A;  4J0U A;  3PVL A;  5BUZ A;  3RJV A;  4JEH A;  4LER A;  4ZHB A;  3C3O A;  5JHA A;  1INZ A;  5AIJ A;  3UM0 A;  4J8S A;  4GU5 A;  4YVO A;  2HR2 A;  1LTX A;  1SZ9 A;  1W3B A;  3LPZ A;  1EF1 C;  1TJF A;  3ZRH A;  2J08 A;  1TNY A;  3EU9 A;  2IOS A;  3ZYQ A;  4FP7 A;  3Q75 A;  2HO1 A;  4Y6W A;  5G55 A;  1OWL A;  4G8L A;  2PQR A;  3ASH A;  3L13 A;  1SA4 A;  3AAA C;  4E85 A;  1DC2 A;  2QC9 A;  3L54 A;  2ZIS A;  4I6G A;  3ABL E;  5ARG A;  1NFI E;  3UM3 A;  4TRQ A;  2WXH A;  2H6I A;  4HOU A;  1SW6 A;  4GTQ A;  4L7T A;  2KM4 A;  2WQH A;  3QC1 A;  2P9U G;  4DX7 D;  3C98 A;  2QZA A;  5BV0 A;  4ILG A;  3CHO A;  1OWO A;  3CKB A;  4W9R A;  1XGW A;  1IQR A;  5EN5 D;  4RQI A;  2ETA A;  2FO7 A;  1IYG A;  5AYW D;  3SI5 A;  4C0M A;  4EPZ A;  4U95 D;  3PZ2 A;  3CK8 A;  4OYS A;  4R7L A;  1OCO E;  1E8Y A;  2XQ0 A;  5HQ8 A;  5C1D A;  3L17 A;  3CIA A;  3OAW A;  2CG3 A;  1TN8 A;  1B89 A;  5AAR A;  3Q4A B;  1OT8 A;  4HRM B;  3D9H A;  3JQ1 A;  3MJW A;  2WXQ A;  5EX3 A;  1A17 A;  4GTS A;  4EBA G;  4UI9 C;  3S7D A;  2RD0 A;  4Z68 A;  4HOS A;  2JEK A;  3R9M A;  2J07 A;  3FTX A;  3S2A A;  2P9N G;  3DXK G;  4N2Q A;  3G2S A;  2QYU A;  4B94 A;  2JLB A;  4GA1 A;  1K1A A;  2WMO A;  4UWF A;  4U07 A;  4LCT A;  3EHN A;  4IRU A;  1E96 B;  3UT4 A;  4AP2 A;  2Y3A A;  3LJN A;  3ULY A;  4CT4 A;  4DX6 D;  5EYP F;  1TJC A;  4HS2 A;  4I1O B;  2X3M A;  5BW8 C;  3L6A A;  3G2U A;  4UQX A;  5KBA A;  4CT0 A;  2VGX B;  4GTO A;  3SY2 A;  3NF1 A;  1X81 A;  2LXM A;  4O60 A;  3B7S A;  4EZJ A;  5EIL A;  4DI4 A;  4CZ2 D;  3SZ7 A;  4JHK A;  4PS7 A;  3PUJ A;  5AEN A;  3CHP A;  3PZD A;  1NI1 A;  1YMP A;  3PH0 C;  4J8F A;  3FUM A;  3PZ3 A;  5KNH D;  2VSX E;  4I2W A;  2XGO A;  1PAQ A;  1S63 A;  4BY6 A;  5EYL A;  3DEP A;  2R2L A;  4FJY A;  3CHM A;  2IQC A;  4RLY A;  4EBA A;  5CRV A;  3AU4 A;  3ONK A;  4WND A;  5KJN A;  3C3R A;  5D2M C;  4CRW A;  4BSX A;  1WM5 A;  3ML9 A;  3RO2 A;  2P9K G;  3ZYM A;  3HRA A;  3HXC A;  5E75 A;  1OUV A;  4URK A;  3SHF A;  2PQN A;  4LNG A;  2KCV A;  3FTW A;  1IKN D;  3B7R L;  3GZ1 A;  4BWR A;  2DIW A;  4UQY A;  3TXM A;  1TN7 A;  1OCC E;  2GGF A;  3DST A;  4A63 B;  2OVF A;  5IY5 E;  1OCR E;  1HO8 A;  4J7W A;  2DZN A;  3C5R A;  2IJG X;  3BEE A;  1HXI A;  1O1S A;  1TN6 A;  3TWQ A;  3LXU X;  3KEZ A;  2Y0B G;  3APF A;  4WNF A;  3Q7F A;  2WXO A;  5JJT A;  3JXI A;  2DZO A;  2V5F A;  3ASN E;  1JPL A;  4U8V D;  3FTS A;  4MLP A;  2Y1L E;  3BQO A;  4GTP A;  3HXE A;  3IEG A;  1OWM A;  5G05 J;  3CVL A;  1FT2 A;  1QQE A;  2MOW A;  3NZS A;  2IO3 C;  3J5Q B;  3RIB A;  4DUI A;  1UG3 A;  2GRO B;  2ZXW E;  1D8D A;  2EIJ E;  5JHB A;  3KS2 A;  2NXP A;  3W9F A;  1KLX A;  4U8H A;  3LCA A;  5EDS A;  2UWJ G;  3SO8 A;  2X6K A;  4AY6 A;  4KBQ A;  4CCA A;  4HRL A;  3CVU A;  3HVE A;  3TG4 A;  1JWF A;  4UWL A;  5BT1 A;  2GRQ B;  4U0Z A;  1S0P A;  2FI7 A;  3RRM B;  2MYO A;  3LY8 A;  1YCS B;  4TXQ A;  2PNN A;  3DSS A;  3L16 A;  5LX8 A;  4FC8 A;  3JUI A;  1NA3 A;  1QNF A;  2OCC E;  3FU5 A;  4GZ5 A;  4G25 A;  2CHZ A;  3ZPJ A;  4IUL A;  4APF A;  1DNP A;  1QYM A;  4HOT A;  3JQ0 A;  2X6F A;  5C2Y A;  4WWN A;  3UMV A;  3URZ A;  3JUE A;  5JJ7 A;  3JXJ A;  4DK5 A;  3VLD A;  5G04 J;  1UOH A;  5LCW C;  2L6J A;  3RU0 A;  3TG5 A;  2AXZ A;  2X6I A;  3EHR A;  3KEA A;  1WY6 A;  3ZIM A;  2NSZ A;  2IF4 A;  4BES A;  4I6E A;  2A5E A;  2LAH A;  3G2V A;  2KCK A;  2HM8 A;  3ESK A;  5AJL A;  1E90 A;  3ZN3 A;  4JVS A; 
#chains in the Genus database with same CATH homology
 2LO6 A;  2FBN A;  4GZD A;  3NQP A;  5G05 C;  5CMW A;  5FZQ A;  4JZY A;  4HOQ A;  5AIJ A;  5LP0 A;  2WXJ A;  1UW4 B;  2KCL A;  3R7Q A;  3QWP A;  4GZ6 A;  4BX9 A;  3FUH A;  2XEV A;  4GA2 A;  3D9J A;  4A1S A;  4J8S A;  4GU5 A;  4YVO A;  3ENE A;  2HR2 A;  2IOL A;  3U9W A;  5ANR A;  1SZ9 A;  4L23 A;  1W3B A;  1EDU A;  3PS6 A;  5FQ8 A;  3PNT B;  3LPZ A;  1EF1 C;  1TJF A;  3ZRH A;  2J08 A;  4CDR A;  3CVQ A;  3CGH A;  3Q49 B;  3RRN B;  3QWV A;  2PM6 A;  3LJ3 A;  2IOS A;  3ZYQ A;  2I1K A;  3NZU A;  3CHR A;  3FUN A;  3GW4 A;  3AS4 A;  3Q47 B;  4FP7 A;  2KAT A;  5DBK A;  2KZT A;  4AIF A;  3ULQ A;  2P58 C;  4K03 A;  5KJM A;  4Y6C A;  4I1M A;  4G24 A;  5FQ7 A;  3OXG A;  3ZHE A;  3I4R B;  1Z3X A;  2CG2 A;  4WWO A;  2HO1 A;  4Y6W A;  5G55 A;  4ANW A;  1OWL A;  3FUL A;  2PQR A;  3CVP A;  4AV7 A;  3ASH A;  3L13 A;  2AWI A;  1E7U A;  3SFZ A;  3S7F A;  4E85 A;  2L0I A;  3L54 A;  3FEX A;  4I6G A;  5FQ4 A;  5CHE E;  2J09 A;  5CMY A;  5ARG A;  1X5B A;  3T5V A;  2KC7 A;  4B8C B;  2WQ7 A;  5G2N A;  1HX8 A;  2X38 A;  2YHC A;  3LVQ E;  3CSF A;  3PNL B;  4G1T A;  4PUC A;  4A55 A;  2J4B A;  4JPS A;  1UJJ A;  4RG9 A;  3QKY A;  4JL0 A;  4ATG A;  2KZT B;  2VGY A;  1HG5 A;  3LVR E;  4ACK A;  5HI7 A;  3B7T A;  4TRQ A;  2WXH A;  4RSY A;  3TJP A;  4F7A A;  4HOU A;  1HS6 A;  3CVV A;  3T8M A;  3IHY A;  4EZL A;  4D10 C;  4GPK A;  4L7T A;  1ELR A;  4I43 A;  1HG2 A;  4DI3 A;  2KM4 A;  2WQH A;  3QC1 A;  5ARF A;  5G04 C;  3ZYL A;  1MQS A;  3ASF A;  4BTB A;  3IKO B;  4ANU A;  2C2L A;  1FVH A;  3C98 A;  3FU3 A;  4G11 A;  4IYP A;  3VTX A;  2GRL A;  4XKC A;  2VSO E;  5BV0 A;  4ILG A;  3CHO A;  1OWO A;  4PH4 B;  3CKB A;  1FCH A;  3CHQ A;  4W9R A;  3SBS A;  1XGW A;  1IQR A;  3D9M A;  2GRM A;  4Q94 A;  4PS8 A;  5J90 A;  3QB2 A;  1HZ4 A;  2V0P A;  1SQM A;  2XPY A;  4BTA A;  3FUF A;  2FO7 A;  1IYG A;  5AYW D;  3FUK A;  2EQX A;  2XPZ A;  3SI5 A;  3TAX A;  4HOR A;  4KT6 B;  4C0M A;  4EPZ A;  2ILR A;  3CK8 A;  3FUJ A;  4OYS A;  3OXF A;  4R7L A;  1EPU A;  3UT7 A;  2PL2 A;  3VLF A;  2VTB B;  1E8Y A;  4NQ0 A;  4DJA A;  3RKV A;  1L5J A;  1P5Q A;  4GMJ A;  2FEZ A;  2XQ0 A;  4GB9 A;  3KAE A;  3CVY A;  3IBE A;  4DPR A;  3HHM A;  5HQ8 A;  3MCX A;  5C1D A;  3U3W A;  3L17 A;  4DLQ A;  3CIA A;  3OAW A;  4V3I A;  2HYZ A;  2CG3 A;  3ESL A;  4N3C A;  4I2Z A;  1B89 A;  2CHW A;  3O48 A;  4QFV A;  1IQU A;  3APD A;  2XCB A;  5A6C A;  3Q4A B;  3FWV A;  2VJ8 A;  3JQ1 A;  3CV0 A;  3MJW A;  4GCN A;  1H2V C;  2WXG A;  2DCP A;  5T8I A;  2WXQ A;  5EX3 A;  4WAF A;  1A17 A;  4HFG A;  3VLE A;  3E4B A;  3FEY A;  4YND A;  3HVE B;  4YVQ C;  4EBA G;  5ENN A;  4K0R A;  3GZS A;  4UI9 C;  3S7D A;  2RD0 A;  1MHQ A;  4ABN A;  4HOS A;  3CEQ A;  4Q96 A;  4KMO A;  3QAR A;  5FZS A;  4Q69 A;  1Z3Y A;  3FUD A;  2JEK A;  2WQ6 A;  3ZW3 A;  2J07 A;  3FTX A;  3S2A A;  3SBT B;  4N2Q A;  3G2S A;  2DBA A;  4B8A A;  1H2U A;  1KT1 A;  4B94 A;  2JLB A;  1ZBP A;  2L0T B;  2VYI A;  3QDN A;  4GA1 A;  5LFA A;  2WMO A;  3FU0 A;  3LDZ A;  3PEV B;  2WXF A;  4UWF A;  3D9N A;  4U07 A;  4LCT A;  3MGB A;  3D9I A;  3EIJ A;  4KZC A;  3EHN A;  3ASD A;  3LEW A;  5KJL A;  3MEK A;  1VDY A;  4IRU A;  1E96 B;  1WAO 1;  3CK7 A;  3GZ2 A;  3UT4 A;  4UI9 K;  4AP2 A;  2Y3A A;  3CQG B;  1UJK A;  3P1U A;  5LOZ A;  4RVB A;  4OVU A;  4G2V A;  4CT4 A;  3MZL B;  1TJC A;  4H7X A;  1JWG A;  5EKQ D;  2WXI A;  5D0Q D;  1H2T C;  4FUL A;  4HS2 A;  5FTP A;  3UPV A;  4I1O B;  4JEU A;  2X3M A;  3RK6 A;  4N2S A;  3VTY A;  4EZK A;  5BW8 C;  4BFR A;  3L6A A;  3G2U A;  4UQX A;  4AVX A;  5J08 A;  4AJW A;  3MA5 A;  5M72 A;  3PDN A;  3D9P A;  2YIN A;  3UQ3 A;  1H0A A;  4CT0 A;  3MV2 B;  4KXK B;  5FWQ A;  3HYM B;  2VGX B;  4L2L A;  3CST A;  2A4Z A;  3NF1 A;  2VQ2 A;  4A1G A;  4FA6 A;  1DVP A;  2I9C A;  5A23 A;  3B7S A;  4EZJ A;  4DI4 A;  1NZN A;  3FH5 A;  3O4Z A;  2Y4T A;  1OWN A;  2UY1 B;  1N54 A;  4JHK A;  4L1B A;  3SZ7 A;  5T3R A;  4A3T A;  1GW6 A;  4PS7 A;  5T4Y A;  4AY5 A;  3IHV A;  3PUJ A;  2WB2 A;  5AEN A;  3CHP A;  3PZD A;  4J8F A;  3PH0 C;  4OVV A;  4CGW A;  3FUM A;  4ILH B;  2RG8 A;  1U3D A;  2VSX E;  3BG0 B;  4RG6 A;  2A5U A;  3ZEF A;  3APC A;  3CR3 A;  4ME2 A;  2L9B A;  2LAI A;  4MRU A;  3PRE A;  4CGV A;  3LY9 A;  4B89 A;  2J49 A;  4I2W A;  2XGO A;  1PAQ A;  3UX4 A;  1ELK A;  4ANV A;  1E8W A;  4G23 A;  3ZGQ A;  3B13 A;  1Y6I A;  1Z6T A;  3TXN A;  4BY6 A;  4BX8 A;  4EEC A;  2CFZ A;  4GYW A;  4E6H A;  4FJY A;  3I3N A;  4XKB A;  1EYH A;  3CVN A;  5FJY A;  3CHM A;  4JA7 A;  3RO3 A;  4AOF A;  2IQC A;  4WWP A;  3CHS A;  4EBA A;  1UN8 A;  4UWK A;  3AU4 A;  4NAC A;  4CEM A;  3I5P A;  3ONK A;  5KJK A;  4WND A;  4BT9 A;  2R5S A;  3Q5M A;  5KCM A;  1IHG A;  2FF4 A;  5KJN A;  2NC9 A;  4CRW A;  4BSX A;  4FHK A;  1WM5 A;  2YHE A;  3FTU A;  3ZXS A;  5BV1 A;  1E7V A;  4U0S A;  3ML9 A;  3RO2 A;  3D9L A;  3SD5 A;  4LEU A;  4F3V A;  3CK9 A;  2V4L A;  4FLB A;  4KZ0 A;  3ZYM A;  2R17 C;  3MX3 A;  1NA0 A;  2V8S E;  4P29 A;  4IN3 B;  4UWG A;  4A3V A;  5E75 A;  4XX5 A;  1OUV A;  2I1J A;  2OV8 A;  4HLE A;  4GYY A;  4URK A;  1YA0 A;  3SHF A;  2PQN A;  2R59 A;  2WMN A;  4XI0 A;  2KCV A;  3FTW A;  1OWP A;  4WNG A;  3B7R L;  4I17 A;  3GZ1 A;  1PC2 A;  2Q7F A;  3UT8 A;  3FUI A;  4BWR A;  5BPP A;  2DIW A;  2UY1 A;  3PUK A;  2VTB A;  3FUE A;  5ANL A;  4UQY A;  5FT9 A;  3TXM A;  5BNW A;  1H19 A;  5FZR A;  4FLH A;  2BF0 X;  1FVF A;  2XGM A;  3AS8 A;  3BG1 B;  2GGF A;  2GW1 A;  3LKU A;  4G26 A;  4BT8 A;  2OVF A;  4TUU A;  3PRZ A;  3FHE A;  2J4D A;  4CDM A;  3FDH A;  3HDX A;  4I1A A;  3MV3 B;  1HO8 A;  3EIQ C;  3SNX A;  2XCC A;  4GZC A;  3AS5 A;  4PS3 A;  4UWH A;  2IJG X;  3BEE A;  1HXI A;  1H6K A;  3EDT B;  3PE4 A;  3S7B A;  3CQC B;  2CHX A;  2BUG A;  3JYS A;  4XIF A;  2AXV A;  3OTN A;  4WUY A;  3LXU X;  4HVB A;  3KEZ A;  3FFL A;  4J6I A;  4AXH A;  4GCO A;  4FHJ A;  2MHK A;  1HFA A;  3APF A;  4WNF A;  2PM7 A;  3WXX A;  2WXO A;  1KT0 A;  1PY1 A;  3QNK A;  5JJT A;  1U3C A;  2YQ8 A;  3Q15 A;  2LSV A;  4I9C A;  1Y8M A;  2AW6 A;  4XZ4 A;  4GZ3 A;  3SGH A;  1UN9 A;  2V5F A;  4FJZ A;  4U04 A;  4AM9 A;  3FY4 A;  1ELW A;  2E0I A;  4NRH B;  5JJ6 A;  1JPL A;  3EJN A;  4N3B A;  3ZYK A;  2ION A;  3FTS A;  3I4G A;  4MLP A;  5FQ6 A;  1HE8 A;  3CKC A;  4N3A A;  2C0M A;  2IFU A;  2MRI A;  2I6H A;  4APO A;  3QWW A;  4FU3 A;  2WVI A;  1LF8 A;  2WXR A;  3MKQ B;  3ZVV A;  3B7U X;  3QK0 A;  3IEG A;  1JUQ A;  1OWM A;  4JHR A;  4N39 A;  5G05 J;  4LUN U;  4ILI A;  3CVL A;  2VGX A;  1HU3 A;  1QQE A;  3CLJ A;  2MOW A;  1E8Z A;  2BTD A;  4AEZ C;  2WXN A;  5AJD A;  3NZS A;  3PEU B;  2LNI A;  4O6F A;  4KYO B;  2WXK A;  3DPD A;  4J8E A;  3RIB A;  3U4T A;  5EX0 A;  1UG3 A;  2C0L A;  2M63 A;  3ASG A;  3FU6 A;  2VSN A;  2WXM A;  3OXL A;  4GAA A;  4B0Z A;  2PZI A;  4I6J A;  2IU1 A;  3FTY A;  5JHB A;  2X6J A;  3KS2 A;  2NXP A;  3G2T A;  2AVP A;  3QAQ A;  3ZHE B;  3CVX A;  4ANX A;  4XE0 A;  1KLX A;  4U8H A;  3LCA A;  1ZU2 A;  2FUL A;  1QZ2 A;  4FAD A;  5EDS A;  2UWJ G;  4H7Y A;  3U66 A;  4M3O A;  2CFU A;  3LY7 A;  2X6K A;  3ML8 A;  4TV3 A;  3T5X A;  4KBQ A;  4AY6 A;  3MKQ A;  2XRY A;  3LYA A;  4ACL A;  1SZA A;  2I2O A;  3ZFW A;  2YNQ A;  3FP3 A;  3ONL A;  2XRZ A;  1N52 A;  4L2Y A;  3R9A B;  4CCA A;  2Y4U A;  3FTV A;  2VSY A;  3CVU A;  3JCK C;  3GYZ A;  3D9O A;  3HVE A;  2AXU A;  3TG4 A;  2XPI A;  2ZU6 B;  4F53 A;  3QOU A;  3S7J A;  1JWF A;  4GYO A;  4CDN A;  2XHE A;  4I9E A;  4UWL A;  5BT1 A;  4U0Z A;  1S0P A;  3P2B A;  4JC8 A;  4LRZ A;  4KVM A;  4PDX A;  4U0U A;  2OND A;  2FI7 A;  4MKT A;  3RRM B;  3U64 A;  2XGS A;  2OOE A;  2QY7 A;  2WM9 A;  3R7R A;  3LY8 A;  5A7D B;  4C9B B;  2QFC A;  3FH8 A;  3L16 A;  5LX8 A;  4FC8 A;  3JUI A;  4GA0 A;  4XI9 A;  5E76 A;  1NA3 A;  3RRU A;  4MS6 A;  1QNF A;  3FU5 A;  3IV0 A;  4EQF A;  4GZ5 A;  3CVW A;  1E8X A;  3QJZ A;  4KVO A;  4UQZ A;  3FH7 A;  2CHZ A;  4G25 A;  4IUL A;  3ZPJ A;  2WXP A;  3L22 A;  4HXI A;  4APF A;  1DNP A;  1HH8 A;  3UUX A;  4HOT A;  3JQ0 A;  1HF8 A;  2LSU A;  2X6F A;  5C2Y A;  4WWN A;  3UMV A;  3MYV A;  3URZ A;  5JJ7 A;  4DK5 A;  3VLD A;  2WPV A;  5G04 J;  4WNE A;  4DLO A;  3MKR A;  2OVB A;  1TEZ A;  3FTZ A;  4JXT A;  5DIZ A;  2J9Q A;  3D9K A;  2L6J A;  5LCW C;  2WXL A;  1NP7 A;  1XNF A;  1BPO A;  3RU0 A;  3G2W A;  3L08 A;  4GML A;  5D0O D;  3EHM A;  3TG5 A;  2AXZ A;  2X6I A;  5CCL A;  2E2E A;  3LS8 A;  1WY6 A;  4J8D A;  4JA9 A;  3AU5 A;  3SF4 A;  3ZIM A;  2NSZ A;  2X6H A;  2IF4 A;  4N5C A;  4C0E A;  4F1S A;  3K9I A;  3KD7 A;  4I6E A;  3DBS A;  3G2V A;  2LAH A;  4JHJ A;  5CCM A;  4JW1 A;  4NUR A;  4UI9 J;  4J0U A;  3TL5 A;  3N71 A;  2KCK A;  3PVL A;  2HM8 A;  5BUZ A;  3RJV A;  3ESK A;  3D3M A;  4JEH A;  5AJL A;  4LER A;  4U63 A;  1E90 A;  5LCW J;  5JHA A;  3PE3 A;  3HIZ A;  1INZ A;  3ZN3 A;  3TGO A;  4JVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...