3AS8A

Mama msr-1 p41212
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
181
structure length
181
Chain Sequence
DDIRQVYYRDKGISHAKAGRYSEAVVMLEQVYDADAFDVEVALHLGIAYVKTGAVDRGTELLERSIADAPDNIKVATVLGLTYVQVQKYDLAVPLLVKVAEANPVNFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAYSYEQMGSHEEALPHFKKANELDERSAVELALV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Protein binding
molecule keywords Magnetosome protein MamA
total genus 76
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3as8A01
5G05C 2LSVA 1ELWA 2HYZA 3QWWA 4J8EA 3WXXA 4I9CA 3UUXA 2IFUA 3AS5A 3MA5A 3PDNA 3QDNA 4YVQC 3ZGQA 2GW1A 4JHRA 1WAO1 4I9EA 4O6FA 4YVOA 3U3WA 2UWJG 3RO3A 3OXLA 1OUVA 4N3BA 5G04J 3VTYA 1FCHA 5KJKA 3LCAA 1HH8A 1IYGA 2FI7A 1WM5A 2C0MA 5EX0A 1XNFA 3MKRA 5G04C 3URZA 1P5QA 2I6HA 4Y6CA 3TG5A 3ULQA 3ZHEA 3LKUA 4W9RA 1KLXA 2XGOA 3CK9A 4LEUA 3RU0A 3IEGA 3TGOA 4N3CA 3ASGA 4B94A 4KBQA 4I2ZA 3VTXA 3CVNA 1NA0A 3E4BA 2KCKA 4U04A 2J9QA 2XGSA 4NRHB 5KJLA 4HORA 2WQHA 3CEQA 3FFLA 1NA3A 1TJCA 1YA0A 5LCWC 3O48A 4GZ5A 4HOSA 2Q7FA 2FF4A 3QOUA 3ASFA 2PL2A 2KCVA 4HOQA 4RG9A 2C0LA 3RIBA 2C2LA 4J8FA 1A17A 5CCMA 3Q47B 4AY6A 4H7YA 2VYIA 1W3BA 2NC9A 2VSNA 2YQ8A 4J0UA 3QKYA 4I1AA 2XPIA 3U4TA 3UQ3A 5BW8C 3QWVA 4UQYA 4BT8A 3ZPJA 4BT9A 5FZSA 5KJMA 5G05J 4UI9J 3Q49B 4WNGA 3KS2A 3CVQA 2HR2A 3CVLA 3SZ7A 2HO1A 4EQFA 5A6CA 4GZ6A 4YNDA 5FJYA 2MHKA 2QFCA 4GYOA 2FO7A 4U0ZA 1Y8MA 2UY1B 2XEVA 3K9IA 2VQ2A 4GCOA 4GYWA 5FT9A 4BTBA 4UI9K 4AIFA 3ZHEB 1ZU2A 4AY5A 5ARFA 4G23A 4G24A 3LY9A 2FBNA 3CK7A 4F3VA 3MEKA 5C1DA 2LNIA 2Y4UA 5CHEE 5D0QD 3ZFWA 2V5FA 5FTPA 2E2EA 5HQ8A 4J8DA 4H7XA 2KATA 3S7JA 3GZ2A 2YHCA 3LPZA 3LY8A 4BTAA 4G2VA 5LCWJ 3N71A 1PC2A 2AVPA 4Y6WA 5JJ6A 4ME2A 2DBAA 3PE4A 3ASDA 2UY1A 1KT1A 1QZ2A 3AS4A 3CV0A 3FP3A 2VGXA 3MV3B 3Q5MA 1QQEA 4HOUA 4RG6A 2BUGA 3LY7A 3PE3A 5DBKA 2FEZA 2PQNA 1KT0A 3KD7A 1E96B 4I2WA 5AYWD 5CCLA 5JJTA 4N2QA 4A1SA 4GZ3A 4WNFA 5FZRA 2LSUA 4JA9A 5BT1A 4G25A 3AS8A 3ESKA 1IHGA 4N3AA 4WNEA 2VGXB 4XI9A 2PQRA 3Q15A 4N5CA 4IN3B 4UI9C 3S7BA 2IF4A 3ZN3A 2VSYA 1NZNA 2P58C 2ONDA 2L6JA 4GA0A 4WNDA 4GA2A 5EKQD 5D0OD 4ABNA 4AM9A 4CGWA 4I17A 4JL0A 4G26A 5EX3A 1ZBPA 1B89A 4JA7A 5M72A 2KC7A 2XCCA 4G1TA 3UPVA 4KYOB 2WPVA 4APOA 5JJ7A 3QWPA 4GPKA 4U0UA 4GYYA 3CK8A 3GW4A 3MV2B 2XGMA 3GZ1A 4WUYA 3CVPA 2PZIA 4N39A 5DIZA 3CKBA 1HXIA 3BEEA 1ELRA 4KXKB 3EDTB 3OXFA 5ARGA 4U07A 5A7DB 3ASHA 3R9AB 2R5SA 3RO2A 3KAEA 3TAXA 4CDRA 5KJNA 4N2SA 5BNWA 3RJVA 3NF1A 4XI0A 2KCLA 3FWVA 3S7FA 4NQ0A 4U0SA 3LYAA 4GCNA 5HI7A 3JYSA 3TG4A 1HZ4A 3S7DA 4CGVA 2XCBA 4XIFA 2VGYA 2JLBA 2Y4TA 3GYZA 3OXGA 4UQZA 3RKVA 3CKCA 3Q4AB 4UQXA 3HYMB 5FZQA 2OOEA 3SF4A 4GA1A 4HOTA 4BWRA
chains in the Genus database with same CATH superfamily
4L23A 3TWWA 2V8SE 2J07A 2V5QC 4YVQC 1PAQA 4YVOA 3RK6A 1HH8A 3KEZA 3URZA 5EX0A 4EBAA 4A55A 1P5QA 2I6HA 2EINE 1SZ9A 4KBQA 4PH4B 2WXIA 4NRHB 1DCEA 2DZOA 4UWLA 3SBSA 3BUAA 4J8FA 5CCMA 2L0IA 1MZCA 4I1AA 4B8CB 2DYRE 2PNNA 4BT9A 3SHFA 5G05J 4AP2A 2FO7A 4ANXA 1E8XA 4YDYA 3W9GA 2L9BA 3FTYA 2Y4UA 3BG1B 5HQ8A 2LUHA 4DX7D 5T4YA 3SFXA 1OT8A 5AQ9A 3VTYA 2XHEA 5BXUA 1FVHA 4JW1A 4TXRA 4HRLA 3AS8A 2A5UA 5EDSA 2AW6A 3O4ZA 4OVVA 4WNEA 3C3RA 4ABNA 3G2TA 4C0EA 4LERA 2EQXA 4I17A 3DSXA 3LJNA 4UWFA 2I9CA 4LUNU 5BXOA 3SGHA 4HLLA 3OXFA 4Q94A 4LNGA 4F53A 1JUQA 4NQ0A 3L17A 3OXGA 3HXCA 3HYMB 2DCPA 1FT2A 1RW2A 3ML9A 4KZCA 2GRMA 3AAAC 1BU9A 3RSEG 3ZVVA 3V79K 4CCAA 3TG5A 2IJGX 3UINC 3T9KA 3MGBA 4TV3A 2J09A 4H7YA 2VYIA 4DLQA 3PZ4A 3FUEA 4K5BA 2NSZA 5FIOA 3CHPA 2HR2A 4D10C 4EQFA 1TNBA 4U0ZA 1H2VC 2WB2A 4L2LA 4AIFA 3ASNE 2FBNA 3V31A 1N95A 2LNIA 2LAHA 1SVXA 3L22A 1D9SA 4QFVA 4DPRA 4DLOA 4CDMA 3LJ3A 2LXLA 2UY1A 4GTMA 2IOSA 2QYUA 3UTMA 2MYOA 3ZNGA 4RVBA 4GZCA 3L6AA 1UG3A 2VSYA 3VLDA 4TUMA 1SA4A 1ZBPA 3E33A 2WPVA 2F8XK 3PEVB 2P9LG 4DK5A 3V30A 4F7AA 3EDTB 5BNWA 4ANVA 3PZ2A 5HI7A 3BU8A 5ENSD 1S70B 2Y3AA 4UQZA 4FU3A 4KVOA 1MQSA 3FU5A 1OCRE 4O6FA 3J5QB 3APDA 4EZKA 2ZISA 4DX6D 3ZXPA 1KLXA 3CLJA 3JQ1A 2XGSA 4HORA 3PH0C 1YMPA 4L2YA 2NC9A 3TWQA 3ULYA 4UWGA 3AU5A 3RRUA 4UQYA 3L54A 5KJMA 5G2NA 5AQBA 2ILRA 3RRMB 3CVQA 3SZ7A 5AARA 3IHVA 2VSOE 4GCOA 4CT4A 3D9KA 2GRLA 5AAOA 5CRUA 3D9PA 4JXTA 3S7JA 1K1BA 4HRNA 2GRNB 5LCWJ 5H7PA 5AENA 4L1BA 5JA4D 3HIZA 3FP3A 3E30A 3PE3A 1H2TC 1KT0A 3ZKJA 4WNFA 3QB2A 4M3OA 5EYLA 4OVUA 3TWSA 3TWVA 2VTBA 4GA0A 2M63A 4JL0A 4JA7A 4ATGA 2XCCA 4B93B 4GPKA 3SNXA 3I3NA 1E90A 4EZJA 3CVPA 3E37A 1HXIA 5KJKA 1HS6A 2KCLA 4ILGA 2QYJA 5A23A 4XIFA 4F1PA 1YYHA 1QNFA 1N94A 1TYQG 3ULQA 5AJLA 3L9TA 3RU0A 2WXNA 2V4LA 3SFZA 4HQDA 3PZDA 2WQHA 2WVIA 4FJYA 3JXIA 4PUCA 4J7WA 4HOQA 1MX4A 2F37A 1E7UA 4U95D 3R7RA 3B13A 5HRYA 3QWVA 3T8KA 4DI3A 2OCCE 3ESLA 5KBAA 1LD7A 1TNYA 1X81A 4FULA 2QC9A 2XEVA 3I4RB 4GYWA 4UI9K 4MKTA 2KZTA 4G23A 4G24A 3T8MA 3PEUB 2XZTG 2IO2C 2Y69E 2KATA 2RKKA 4LG6A 3EIQC 2ZGGA 3UM3A 1IKND 3IHYA 4N3AA 4GTRA 4UI9C 2IF4A 3Q7FA 1OCOE 1U3DA 3QJZA 2XENA 4FADA 3LVRE 2AXVA 3FTVA 2E0IA 2PZIA 3BEEA 4A1GA 4DUIA 3L13A 2R03A 4GTQA 2RD0A 3FH5A 4HOTA 4GA1A 5G05C 2XEHA 4CYMD 2X3MA 3DSTA 2GW1A 5CERB 1OUVA 3TWRA 2WXMA 4ZFHA 1HO8A 5LP0A 3APCA 2XGOA 3TWXA 3E4BA 3OAWA 5KJLA 3F6QA 5BPPA 2X6IA 1IQRA 3UM0A 2A4ZA 4GTPA 2VSNA 3AG1E 1Q2ZA 1HF8A 4U8YD 1L5JA 3FUFA 1LTXA 5FJYA 2MHKA 4Q96A 5ARFA 2ZGDA 5CEAA 3E32A 2YHCA 4L7TA 2I2OA 2WM9A 2P9IG 3ZYMA 3L82A 3JQ0A 1SQMA 5KCMA 3ASOE 2AXZA 3CQCB 1Z6TA 5D0OD 2XRZA 5G55A 4OYSA 3UPVA 1GW6A 3FUMA 1H6KA 1K8KG 4WUYA 2WMOA 2H6FA 3ASHA 3LYAA 3PZ3A 2OV8A 4G8KA 2OEWA 3AG3E 3FUDA 4EECA 4NURA 4UQXA 3SF4A 3ZYQA 3HDXA 4MBGA 5JJTA 4N2QA 4DX5D 1N0RA 4BX9A 4AVXA 5HS0A 3UM2A 1FCHA 4GZDA 2C0MA 5G04C 3MKRA 5B1AE 5ENQD 4G11A 2KCKA 3CEQA 1TJCA 5B1BE 2Q7FA 2PL2A 2VGEA 1N54A 4AY6A 3QKYA 1OWLA 5JHAA 4GTVA 3LDZA 2BKGA 1MYOA 4EBAG 3FU0A 1EPUA 3CVLA 4GZ6A 4ACKA 4U8VD 3SFYA 3CIAA 3LY9A 4HI9A 2RG8A 3CVVA 2WXHA 5ENTD 3B7UX 1SA5A 5AJDA 3FULA 3N71A 3B95A 5JJ6A 3NAWA 5DBKA 3CHMA 2CHWA 3JCKC 4G25A 3FUHA 3TXNA 1K1AA 4GTOA 1B89A 5M72A 2LO6A 1UJKA 2JABA 2A5EA 3X2QE 4U0UA 2XGMA 3RO2A 4CDRA 1RZ4A 3NF1A 3FWVA 2CG3A 3CR3A 2WXGA 4GU5A 3MKQA 2Y1LE 2VGYA 3PUKA 1E8ZA 3ZGQA 1O5MA 3CKCA 2CHZA 2WXFA 4AOFA 1OY3D 2IFUA 3AS5A 1H6OA 3OXLA 5G04J 1IYGA 1BI7B 4W9RA 2PM7A 2ZIRA 1TN6A 5LX8A 1KZOA 5LCWC 2B6CA 2VTBB 3AG2E 3ASFA 3DPDA 4Z68A 4F6RD 1A17A 2XPIA 4BY6A 5D66A 5BV0A 1HG5A 4UI9J 3Q49B 4CEMA 1N4PA 4BFRA 4NIKA 1QBQA 1WY6A 3ABKE 5T8IA 3ZHEB 3MKQB 1OWOA 4GAAA 5FQ6A 4APFA 2ZU6B 3C3OA 3ZEFA 3UM1A 4R7LA 4Y6WA 4ANUA 1U2VG 2ZXWE 5AQ7A 3BG0B 4K0RA 3MJWA 2LSUA 4UWHA 5ANRA 4NACA 2ONDA 4CGWA 3IKOB 4GA2A 2BEDA 3C98A 5EX3A 4G1TA 1IXVA 2VSXE 2X6JA 3MV2B 2H6HA 2MRIA 3PRZA 3R9AB 4MLPA 4C48B 4RLYA 4M7CA 3J5PA 4J8YA 3EU9A 4RQIA 2OOEA 2OVFA 3BQOA 4JHRA 4I9EA 2V0PA 3LVQE 3U3WA 2UWJG 4YDWA 4LSZE 2XS8A 3CHOA 5CBOA 5E75A 3ZHEA 5KNHD 4N3CA 4B94A 3CVUA 3U66A 3UXGA 2IONA 3UT4A 3V2XA 3HXBA 4AJWA 3O48A 2FF4A 5B3SE 3EUVA 3CHQA 3KSLA 3Q9UC 1Z3YA 4B0ZA 2FULA 2X6FA 5FZSA 4BSXA 3HXFA 1MHQA 2BTDA 2NYJA 1HU3A 1ZU2A 4JZYA 5AQAA 4BX8A 3MEKA 2V5FA 1SZAA 4KMOA 3PS6A 1MX2A 1LF8A 3NBNB 1HX8A 4HXIA 3U64A 4JEHA 5FQ8A 4ILIA 2PQNA 3JUEA 1BD8A 1H2UA 5AYWD 2H6IA 2FO1E 3ESKA 3NZUA 2VGXB 2PQRA 4OAUC 4AM9A 4CGVA 1TEZA 1K3ZD 2J08A 3HG0D 1OWNA 4WWOA 2OVBA 4HLEA 4N39A 1ELRA 3FUNA 3R9MA 5D2MC 4XI0A 1JCRA 3IV0A 4A3VA 4BETA 3Q4AB 1U3CA 3DSVA 3LXUX 1ELWA 2HYZA 3HXEA 1NFIE 4LNBA 1XNFA 3LKUA 2KBXA 3ASGA 5JMND 1O1SA 4U04A 3UKRG 1UN8A 3ABME 1N52A 1YA0A 2RFMA 4RG9A 2P9SG 2XZDG 4DJAA 1HG2A 3ZYKA 3C72A 1TNOA 3Q9NC 4XE0A 3ZUVB 2P9UG 3ZPJA 2F0YA 3PREA 4F1SA 1EDUA 3PNLB 4ILHB 5FTPA 2E2EA 1S0PA 1FPPA 2PM6A 4I1OB 4FHJA 3ABLE 4J0UA 4HOUA 4RG6A 1E96B 4KZ0A 4WWNA 4A1SA 1JCQA 5FZRA 4EZLA 4AXHA 5CECB 2L6JA 2DIWA 1N0QA 3UKUG 2IEJA 1HE8A 4XEIG 4KXKB 2WQ7A 3NZSA 2R5SA 4HNAD 3AU4A 3RJVA 1H0AA 4GCNA 2JLBA 4GMLA 3FU6A 3UI2A 3QWWA 3WXXA 2J4DA 2QY7A 4JEUA 1VDYA 4ANWA 2HM8A 2GRPB 2B0OE 2KM4A 2V4HC 1NA3A 4GZ5A 5EN5D 4V3IA 1TR4A 2C2LA 5LOZA 1S63A 2AXUA 3DEOA 4WWPA 3FH7A 2CHXA 3FEXA 4BT8A 1TN7A 4I6EA 3C3QA 4FJZA 3TXMA 5CMYA 2VQ2A 1PY1A 5CMWA 2P9KG 3ZW3A 4DX1A 2DWZA 5E76A 2XPYA 3UT8A 3LPZA 4I43A 3MZLB 3PE4A 1NP7A 4B89A 5BT1A 2HE0A 1Y6IA 4C9BB 5FINA 3ZN3A 2P58C 1AP7A 5EKQD 3MX3A 1Z5SC 5JJ7A 5FQ4A 3P1UA 5T3RA 3TAXA 3PNTB 3FUIA 4PS7A 2WQ6A 2XCBA 3GZSA 4O1PA 3EHRA 4UUCA 3CVWA 5AIJA 3LS8A 3QK0A 3FTSA 5HKPA 2KZTB 3IEGA 4QQIA 4KVMA 1TN8A 3UX4A 2EIJE 4E85A 3HHMA 2DVWA 3HRAA 2LAIA 4KT6B 3FY4A 3EHQA 1IQUA 2H6GA 3ULEG 3UIOC 4ACLA 1XGWA 1DNPA 4K5CA 2ETBA 3G2SA 3G2UA 4J8DA 4XX5A 4LCTA 2DYSE 3ZU7B 3CV0A 3Q5MA 3TL5A 4GPMA 1QQEA 4PS8A 3VLEA 3B7TA 1NL4A 4FLHA 2AJAA 1E7VA 2Y0BG 2XRYA 3AJIA 4GB9A 3UMVA 3QWPA 4HVBA 2KXPC 3D9MA 5DIZA 2ETAA 3RRNB 5ARGA 1V55E 3S2AA 4ATZD 2QZAA 1G3NB 5KJNA 1Z3XA 5FQ7A 3G2VA 3SD5A 3SO8A 1JWGA 4CT0A 3JYSA 1HZ4A 3S7DA 2GRQB 4UWKA 1WG0A 1BI8B 4BWRA 3EHNA 1DCQA 3UUXA 3Q7AA 4HB5A 5ENNA 3B7RL 4I2ZA 1DVPA 3ISMC 3CVNA 2P2CP 3QOUA 2KCVA 3RIBA 3SBTB 4JHJA 1W3BA 4U8HA 4U7EB 5CBNA 5ITZF 4K03A 5BW8C 3CHSA 1N11A 2WXJA 4WNGA 2YHEA 4YNDA 2IU1A 4K5AB 4CRWA 3AG4E 1Y8MA 3CQGB 2X38A 3PUJA 5C1DA 1ELKA 2AWIA 5CHEE 2WXQA 5BUZA 4J8SA 1ZB1A 2R05A 4XZ4A 4ME2A 1MJ0A 5EIBE 1KT1A 5A6CA 3HVEB 5KWDA 3EHMA 5EILA 4JC8A 2WXPA 4JA9A 1EF1C 2F8YA 4GTTA 3KEAA 5CEDB 1IHGA 5EIDA 4XI9A 3S7BA 4N5CA 4IN3B 1O1TA 1S64A 1NZNA 4IRUA 4DI4A 4FLBA 4MS6A 2J8SD 1A5EA 4KYOB 4A3TA 1OXJA 3GW4A 3GZ1A 2JEKA 4OAVB 4N2SA 5AN8A 1OCCE 4U0SA 1D8DA 3JXJA 5ENPD 3DSSA 3DPYA 2Y4TA 3ML8A 3RKVA 1V54E 3D9NA 4BEPA 2WXRA 3QDNA 2X6HA 1BPOA 3DXMG 2IY0C 3SQVA 2FI7A 2GRRB 3D9IA 5KNGA 4RSYA 2XEEA 2WXOA 1AWCB 3FEYA 4GMRA 3C5RA 2C0LA 3QAQA 4P29A 1BLXB 3U4TA 3EIJA 2EIKE 4BSZB 3KS2A 3NB2A 3EU5A 5ENOD 4BTBA 5FT9A 4TUUA 3K9IA 4AY5A 3T5VA 3CK7A 2WXLA 4X8QA 4H7XA 2XQ0A 2GROB 1PC2A 4XKCA 4C0MA 3AS4A 3MV3B 4PS3A 5FWQA 3LY7A 3CGHA 4YDOA 4JHKA 3DBSA 2R02A 3D9OA 4FP7A 2IO3C 1UN9A 3DSUA 1UOHA 1N9AA 4HS2A 1OWMA 3I4GA 3CVXA 4GYYA 3EJNA 4TRQA 1O1RA 3CKBA 3S7FA 3TG4A 3WG7E 1MX6A 1JWFA 1IHBA 2R17C 3R7QA 3GYZA 3W9FA 3L08A 2I1KA 4O1OA 3RO3A 2NXPA 3T5XA 1WM5A 3CK9A 4GMJA 3DXKG 1NA0A 4FHKA 3LEWA 4EHMA 1FT1A 2XS1A 4E6HA 3MCXA 3APFA 2J4BA 2DZNA 3FUJA 3HVEA 5BV1A 4I1MA 4FA6A 3JUIA 2HO1A 2XPZA 3HXDA 1KZPA 2QFCA 1X5BA 4GYOA 4ZHBA 3ZRHA 2BKKB 3FTXA 4MRUA 5J90A 2AVPA 5C2YA 3TWTA 2DBAA 4BERA 2CG2A 5FZQA 3ENEA 4GTSA 2FEZA 4I2WA 4L9PA 4GZ3A 1E8WA 4DRXE 3Q79A 1DC2A 4U96D 2P9NG 3OTNA 3CVYA 1TNZA 1JCSA 3Q75A 4N5QA 4APOA 5ANLA 3DWLG 2J49A 4JB8P 3QNKA 1INZA 3TJPA 3FUKA 3IXEA 3CSFA 2EILE 5LFAA 4I6JA 3UT7A 2ETCA 4JVSA 4JPSA 3P2BA 3PVLA 3VLFA 1TNUA 4HI8A 2OEVA 3NQPA 4YDEA 5EYPF 2L0TB 3D9HA 2LSVA 4I9CA 3MA5A 3PDNA 3FTZA 1WAO1 1UW4B 3FU3A 3IBEA 4G8LA 4IULA 4J6IA 4Y6CA 2P9PG 3B7SA 5CRVA 4LEUA 3U9WA 1KPSB 4CZ2D 5IY5E 2X6KA 3NOCD 4IYPA 3FFLA 4HOSA 1EYHA 4TXQA 1N4QA 2YINA 3RAUA 2I1JA 3G2WA 4URKA 2YNQA 3Q47B 3CSTA 2YQ8A 3UQ3A 4O60A 4PDXA 1LD8A 4WAFA 2EIME 2UY1B 3FHEA 4U63A 1WDYA 2WMNA 4A63B 3ZIMA 2L6BA 2CFZA 2CFUA 1OWPA 3QC1A 4BTAA 2IQCA 2VGXA 3NOGD 4AEZC 1YCSB 4LRZA 3FH8A 4AV7A 1N4RA 3V2OA 2R59A 4TXPA 4BESA 4Q69A 1SW6A 2BF0X 2MOWA 3E34A 4U07A 3KAEA 5ENRD 3D3MA 1FVFA 4J8EA 3TGOA 3ONLA 4I6GA 4N3BA 3LCAA 3D9JA 3I5PA 3DEPA 3VTXA 1N4SA 2J9QA 3FTUA 1H6PA 3DRAA 4DX2A 2IOLA 2LXMA 1TJFA 3KSQA 1HFAA 1UJJA 3Q78A 1E8YA 2RFAA 3TWUA 2WXKA 2R2LA 3ONKA 4F3VA 5J08A 4XKBA 5D0QD 1D8EA 3GZ2A 3LY8A 3ZXSA 3FTWA 4G2VA 3SI5A 3DSWA 3ASDA 3ZFWA 1QZ2A 4HFGA 2BUGA 3Q73A 3MYVA 3KD7A 5CCLA 4EPZA 3B7BA 4FC8A 4HBDA 3Q15A 4HRMB 3QARA 1QYMA 1H19A 3CHRA 3SY2A 4WNDA 4B8AA 3D9LA 4CDNA 4G26A 2KC7A 4JD2G 2VJ8A 3CK8A 3L16A 3UIPC 1JPLA 5A7DB 3FDHA 3PZ1A 4LNUD 2GGFA 1OCZE 1NI1A 5JHBA 3ZYLA
chains in the Genus database with same CATH topology
3LXUX 5G05C 1ELWA 2HYZA 3D9NA 4L23A 2V8SE 2J07A 2X3MA 2WXRA 1PAQA 2X6HA 3QDNA 4YVQC 1BPOA 2GW1A 4YVOA 1OUVA 3RK6A 1HH8A 3KEZA 2WXMA 2FI7A 3URZA 1HO8A 3D9IA 1XNFA 5EX0A 4EBAA 5LP0A 4A55A 1P5QA 2I6HA 4RSYA 3LKUA 3APCA 2XGOA 1SZ9A 3ASGA 4KBQA 2WXOA 3FEYA 4PH4B 2WXIA 3E4BA 3OAWA 4U04A 5BPPA 5KJLA 4NRHB 1UN8A 2X6IA 4UWLA 1N52A 1YA0A 1IQRA 3SBSA 4RG9A 2C0LA 2A4ZA 3QAQA 4P29A 4J8FA 5CCMA 4DJAA 2L0IA 2VSNA 1HG2A 3ZYKA 4I1AA 4B8CB 3U4TA 3EIJA 4XE0A 3ZPJA 4BT9A 3PREA 3SHFA 5G05J 1HF8A 3KS2A 1L5JA 4F1SA 3FUFA 5FJYA 4AP2A 2MHKA 4BTBA 2FO7A 5FT9A 4TUUA 1EDUA 3K9IA 4ANXA 1E8XA 4Q96A 4AY5A 5ARFA 3T5VA 2L9BA 3PNLB 3CK7A 3FTYA 2WXLA 2Y4UA 4ILHB 3BG1B 5FTPA 2E2EA 5HQ8A 4H7XA 5T4YA 2XQ0A 1S0PA 2YHCA 4L7TA 2PM6A 4I1OB 4FHJA 2I2OA 1PC2A 2WM9A 4XKCA 3ZYMA 4C0MA 4J0UA 3AS4A 3MV3B 4PS3A 5FWQA 3VTYA 2XHEA 4HOUA 4RG6A 3LY7A 1FVHA 3JQ0A 3CGHA 1SQMA 1E96B 4KZ0A 4JW1A 4WWNA 4JHKA 4A1SA 5FZRA 5KCMA 4EZLA 3DBSA 3AS8A 2A5UA 5EDSA 2AW6A 3D9OA 4FP7A 3O4ZA 4OVVA 4WNEA 2AXZA 4AXHA 1UN9A 3CQCB 1Z6TA 2L6JA 2DIWA 4ABNA 5D0OD 3G2TA 4C0EA 2XRZA 4LERA 2EQXA 4I17A 5G55A 4OYSA 3UPVA 1GW6A 3FUMA 4HS2A 2I9CA 4UWFA 1OWMA 1HE8A 1H6KA 4LUNU 3I4GA 3CVXA 4GYYA 3EJNA 4TRQA 4WUYA 3CKBA 2WMOA 4KXKB 3SGHA 2WQ7A 3OXFA 3NZSA 4Q94A 3ASHA 2R5SA 3AU4A 4F53A 3RJVA 1JUQA 3S7FA 4NQ0A 1H0AA 3LYAA 4GCNA 3TG4A 2OV8A 3L17A 1JWFA 2R17C 3R7QA 2JLBA 3FUDA 3GYZA 3OXGA 4GMLA 3FU6A 4EECA 3L08A 4NURA 3HYMB 4UQXA 3SF4A 2I1KA 2DCPA 3ZYQA 3HDXA 5JJTA 4N2QA 3QWWA 3WXXA 3ML9A 4KZCA 2GRMA 3ZVVA 4BX9A 2J4DA 4AVXA 3RO3A 2NXPA 2QY7A 3T5XA 1FCHA 4GZDA 4JEUA 1WM5A 1VDYA 2C0MA 5G04C 3MKRA 4ANWA 4CCAA 3TG5A 2IJGX 3CK9A 4GMJA 2HM8A 4G11A 2KM4A 1NA0A 4FHKA 2KCKA 3LEWA 3CEQA 1NA3A 1TJCA 4GZ5A 2Q7FA 4V3IA 2PL2A 4E6HA 3MCXA 1N54A 2C2LA 2J09A 2J4BA 3APFA 3MGBA 4TV3A 5LOZA 4AY6A 2AXUA 4H7YA 2VYIA 4DLQA 3QKYA 1OWLA 4WWPA 5JHAA 3FH7A 3LDZA 2CHXA 3FEXA 4BT8A 3FUJA 3HVEA 3FUEA 4EBAG 4I1MA 5BV1A 3FU0A 1EPUA 4I6EA 4FA6A 2NSZA 3JUIA 3CHPA 2HR2A 3CVLA 4D10C 2HO1A 2XPZA 4EQFA 4GZ6A 4FJZA 3TXMA 4ACKA 2QFCA 1X5BA 4GYOA 4U0ZA 5CMYA 1H2VC 3CIAA 2VQ2A 1PY1A 2WB2A 4L2LA 4AIFA 5CMWA 3ZRHA 3LY9A 2FBNA 3ZW3A 2LNIA 2RG8A 3FTXA 3CVVA 2LAHA 2WXHA 4MRUA 5E76A 3B7UX 3L22A 2XPYA 5AJDA 4QFVA 3UT8A 3LPZA 4DLOA 3FULA 4DPRA 5J90A 3N71A 2AVPA 5JJ6A 4I43A 5C2YA 4CDMA 3LJ3A 3MZLB 2DBAA 3PE4A 2UY1A 2CG2A 5FZQA 3ENEA 5DBKA 3CHMA 2IOSA 1NP7A 2CHWA 2FEZA 4I2WA 4GZ3A 4B89A 5BT1A 1E8WA 3JCKC 4G25A 4RVBA 4GZCA 1Y6IA 3FUHA 3OTNA 3TXNA 4C9BB 3CVYA 3L6AA 1UG3A 3ZN3A 2VSYA 2P58C 3VLDA 5EKQD 3MX3A 1ZBPA 1B89A 5M72A 1UJKA 2LO6A 2WPVA 4APOA 5JJ7A 5ANLA 4U0UA 2XGMA 3PEVB 5FQ4A 2J49A 4DK5A 3QNKA 4F7AA 3EDTB 1INZA 3RO2A 3P1UA 5T3RA 3TAXA 4CDRA 3TJPA 5BNWA 3FUKA 3NF1A 3FWVA 3PNTB 4ANVA 3CSFA 2CG3A 5LFAA 4I6JA 3FUIA 3CR3A 2WXGA 4GU5A 5HI7A 3UT7A 4PS7A 2WQ6A 3MKQA 4JVSA 4JPSA 2XCBA 2VGYA 2Y3AA 1E8ZA 3GZSA 3P2BA 3PUKA 3PVLA 3CKCA 4FU3A 4UQZA 3VLFA 2CHZA 2WXFA 3ZGQA 3NQPA 4KVOA 4AOFA 2L0TB 1MQSA 2LSVA 3FU5A 4I9CA 2IFUA 3AS5A 3MA5A 3PDNA 4O6FA 3FTZA 1WAO1 5AIJA 3APDA 3LS8A 3CVWA 3QK0A 1UW4B 4EZKA 3FU3A 3IBEA 4GA1A 3OXLA 5G04J 1IYGA 4IULA 3FTSA 4J6IA 4Y6CA 2KZTB 3B7SA 4W9RA 1KLXA 3CLJA 2PM7A 4LEUA 3U9WA 3IEGA 4KVMA 3JQ1A 2X6KA 2XGSA 5LX8A 4HORA 4IYPA 5LCWC 3FFLA 4HOSA 1EYHA 2YINA 3UX4A 2VTBB 3PH0C 3ASFA 3DPDA 2I1JA 3G2WA 4E85A 1A17A 4URKA 3HHMA 2YNQA 3Q47B 4L2YA 2NC9A 3CSTA 2YQ8A 3AU5A 4UWGA 3RRUA 2XPIA 3UQ3A 4BY6A 2LAIA 4UQYA 4KT6B 5BV0A 4PDXA 3FY4A 3L54A 5KJMA 1HG5A 5G2NA 4UI9J 1IQUA 3Q49B 4WAFA 4CEMA 2ILRA 3RRMB 3CVQA 3SZ7A 4BFRA 3IHVA 1WY6A 2UY1B 2VSOE 3FHEA 4GCOA 3D9KA 4CT4A 5T8IA 2GRLA 4ACLA 3ZHEB 1XGWA 3MKQB 1DNPA 1OWOA 4GAAA 4U63A 5FQ6A 4APFA 2WMNA 3G2SA 3G2UA 2ZU6B 3ZIMA 3D9PA 4J8DA 4JXTA 3S7JA 4XX5A 2CFZA 2CFUA 4LCTA 1OWPA 3ZEFA 3QC1A 4BTAA 5LCWJ 4R7LA 5AENA 4Y6WA 4L1BA 4ANUA 2IQCA 3HIZA 3CV0A 3FP3A 3Q5MA 2VGXA 3TL5A 3BG0B 1QQEA 4PS8A 3VLEA 3PE3A 4K0RA 1H2TC 4AEZC 1KT0A 3MJWA 4WNFA 3QB2A 2LSUA 4LRZA 3FH8A 4AV7A 4M3OA 4UWHA 3B7TA 2R59A 4FLHA 5ANRA 4OVUA 1E7VA 4Q69A 2VTBA 4NACA 2ONDA 2XRYA 4GA0A 3IKOB 2BF0X 4GA2A 4CGWA 3C98A 4GB9A 2M63A 4JL0A 5EX3A 2MOWA 4JA7A 4ATGA 2XCCA 4G1TA 3UMVA 3QWPA 4HVBA 4GPKA 2VSXE 3SNXA 2X6JA 3I3NA 3MV2B 1E90A 3CVPA 3D9MA 5DIZA 4EZJA 1HXIA 2MRIA 3PRZA 5ARGA 3R9AB 3RRNB 3S2AA 4U07A 5KJKA 1HS6A 5KJNA 3KAEA 1Z3XA 4MLPA 2KCLA 3G2VA 4ILGA 5FQ7A 3SD5A 1JWGA 4CT0A 3JYSA 1HZ4A 3D3MA 3S7DA 5A23A 4XIFA 4UWKA 2OOEA 1FVFA 2OVFA 4BWRA 1QNFA 3EHNA 4J8EA 3UUXA 3TGOA 4JHRA 3ONLA 2V0PA 4I9EA 3LVQE 5ENNA 4I6GA 2UWJG 3U3WA 4N3BA 3LCAA 3D9JA 3CHOA 3B7RL 3I5PA 3ULQA 5E75A 3ZHEA 5AJLA 3RU0A 2WXNA 2V4LA 4N3CA 4B94A 4I2ZA 3CVUA 1DVPA 3VTXA 3SFZA 3U66A 3CVNA 2IONA 3PZDA 2J9QA 3UT4A 2WQHA 4AJWA 3FTUA 3O48A 2WVIA 4FJYA 4PUCA 2FF4A 3QOUA 4HOQA 2KCVA 3RIBA 3SBTB 3CHQA 4JHJA 1E7UA 1W3BA 3R7RA 3B13A 4U8HA 1Z3YA 2IOLA 4K03A 5BW8C 3QWVA 4B0ZA 2FULA 2X6FA 1TJFA 3CHSA 1HFAA 5FZSA 1UJJA 2WXJA 3ESLA 4BSXA 4DI3A 1E8YA 4WNGA 1MHQA 2YHEA 4FULA 4YNDA 2BTDA 2IU1A 4CRWA 1Y8MA 2XEVA 3CQGB 3I4RB 4GYWA 1HU3A 4UI9K 2WXKA 2KZTA 4MKTA 1ZU2A 4JZYA 4G23A 2X38A 3ONKA 4G24A 3T8MA 4BX8A 4F3VA 3MEKA 3PUJA 5C1DA 1ELKA 5J08A 3PEUB 2AWIA 4XKBA 5CHEE 5D0QD 2WXQA 2V5FA 1SZAA 4J8SA 4KMOA 5BUZA 3PS6A 2KATA 1LF8A 3GZ2A 1HX8A 3LY8A 4HXIA 3FTWA 4G2VA 3ZXSA 3SI5A 3U64A 4XZ4A 4JEHA 3EIQC 4ME2A 5FQ8A 3ASDA 4ILIA 1KT1A 1QZ2A 3ZFWA 5A6CA 3HVEB 4HFGA 2BUGA 3EHMA 3MYVA 2PQNA 3IHYA 3KD7A 1H2UA 4JC8A 5AYWD 5CCLA 4EPZA 2WXPA 4JA9A 1EF1C 3ESKA 3NZUA 4FC8A 1IHGA 4N3AA 4XI9A 2VGXB 2PQRA 3Q15A 4N5CA 3QARA 4IN3B 4UI9C 3S7BA 2IF4A 1H19A 3CHRA 1NZNA 4IRUA 4WNDA 4AM9A 4CGVA 1TEZA 4B8AA 4DI4A 4FLBA 4MS6A 3D9LA 4CDNA 4G26A 1U3DA 3QJZA 2KC7A 4KYOB 2J08A 4A3TA 4FADA 3LVRE 1OWNA 4WWOA 2AXVA 2OVBA 2VJ8A 3CK8A 3FTVA 3GW4A 3L16A 3GZ1A 2JEKA 1JPLA 2E0IA 2PZIA 4N39A 5A7DB 4HLEA 3BEEA 1ELRA 4A1GA 3FDHA 3FUNA 3L13A 2GGFA 4N2SA 4XI0A 3IV0A 4U0SA 5JHBA 2RD0A 3FH5A 4A3VA 2Y4TA 3ML8A 3RKVA 3Q4AB 4HOTA 1U3CA 3ZYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G05 C;  2LSV A;  1ELW A;  2HYZ A;  3QWW A;  4J8E A;  3WXX A;  4I9C A;  3UUX A;  2IFU A;  3AS5 A;  3MA5 A;  3PDN A;  3QDN A;  4YVQ C;  3ZGQ A;  2GW1 A;  4JHR A;  1WAO 1;  4I9E A;  4O6F A;  4YVO A;  3U3W A;  2UWJ G;  3RO3 A;  3OXL A;  1OUV A;  4N3B A;  5G04 J;  3VTY A;  1FCH A;  5KJK A;  3LCA A;  1HH8 A;  1IYG A;  2FI7 A;  1WM5 A;  2C0M A;  5EX0 A;  1XNF A;  3MKR A;  5G04 C;  3URZ A;  1P5Q A;  2I6H A;  4Y6C A;  3TG5 A;  3ULQ A;  3ZHE A;  3LKU A;  4W9R A;  1KLX A;  2XGO A;  3CK9 A;  4LEU A;  3RU0 A;  3IEG A;  3TGO A;  4N3C A;  3ASG A;  4B94 A;  4KBQ A;  4I2Z A;  3VTX A;  3CVN A;  1NA0 A;  3E4B A;  2KCK A;  4U04 A;  2J9Q A;  2XGS A;  4NRH B;  5KJL A;  4HOR A;  2WQH A;  3CEQ A;  3FFL A;  1NA3 A;  1TJC A;  1YA0 A;  5LCW C;  3O48 A;  4GZ5 A;  4HOS A;  2Q7F A;  2FF4 A;  3QOU A;  3ASF A;  2PL2 A;  2KCV A;  4HOQ A;  4RG9 A;  2C0L A;  3RIB A;  2C2L A;  4J8F A;  1A17 A;  5CCM A;  3Q47 B;  4AY6 A;  4H7Y A;  2VYI A;  1W3B A;  2NC9 A;  2VSN A;  2YQ8 A;  4J0U A;  3QKY A;  4I1A A;  2XPI A;  3U4T A;  3UQ3 A;  5BW8 C;  3QWV A;  4UQY A;  4BT8 A;  3ZPJ A;  4BT9 A;  5FZS A;  5KJM A;  5G05 J;  4UI9 J;  3Q49 B;  4WNG A;  3KS2 A;  3CVQ A;  2HR2 A;  3CVL A;  3SZ7 A;  2HO1 A;  4EQF A;  5A6C A;  4GZ6 A;  4YND A;  5FJY A;  2MHK A;  2QFC A;  4GYO A;  2FO7 A;  4U0Z A;  1Y8M A;  2UY1 B;  2XEV A;  3K9I A;  2VQ2 A;  4GCO A;  4GYW A;  5FT9 A;  4BTB A;  4UI9 K;  4AIF A;  3ZHE B;  1ZU2 A;  4AY5 A;  5ARF A;  4G23 A;  4G24 A;  3LY9 A;  2FBN A;  3CK7 A;  4F3V A;  3MEK A;  5C1D A;  2LNI A;  2Y4U A;  5CHE E;  5D0Q D;  3ZFW A;  2V5F A;  5FTP A;  2E2E A;  5HQ8 A;  4J8D A;  4H7X A;  2KAT A;  3S7J A;  3GZ2 A;  2YHC A;  3LPZ A;  3LY8 A;  4BTA A;  4G2V A;  5LCW J;  3N71 A;  1PC2 A;  2AVP A;  4Y6W A;  5JJ6 A;  4ME2 A;  2DBA A;  3PE4 A;  3ASD A;  2UY1 A;  1KT1 A;  1QZ2 A;  3AS4 A;  3CV0 A;  3FP3 A;  2VGX A;  3MV3 B;  3Q5M A;  1QQE A;  4HOU A;  4RG6 A;  2BUG A;  3LY7 A;  3PE3 A;  5DBK A;  2FEZ A;  2PQN A;  1KT0 A;  3KD7 A;  1E96 B;  4I2W A;  5AYW D;  5CCL A;  5JJT A;  4N2Q A;  4A1S A;  4GZ3 A;  4WNF A;  5FZR A;  2LSU A;  4JA9 A;  5BT1 A;  4G25 A;  3AS8 A;  3ESK A;  1IHG A;  4N3A A;  4WNE A;  2VGX B;  4XI9 A;  2PQR A;  3Q15 A;  4N5C A;  4IN3 B;  4UI9 C;  3S7B A;  2IF4 A;  3ZN3 A;  2VSY A;  1NZN A;  2P58 C;  2OND A;  2L6J A;  4GA0 A;  4WND A;  4GA2 A;  5EKQ D;  5D0O D;  4ABN A;  4AM9 A;  4CGW A;  4I17 A;  4JL0 A;  4G26 A;  5EX3 A;  1ZBP A;  1B89 A;  4JA7 A;  5M72 A;  2KC7 A;  2XCC A;  4G1T A;  3UPV A;  4KYO B;  2WPV A;  4APO A;  5JJ7 A;  3QWP A;  4GPK A;  4U0U A;  4GYY A;  3CK8 A;  3GW4 A;  3MV2 B;  2XGM A;  3GZ1 A;  4WUY A;  3CVP A;  2PZI A;  4N39 A;  5DIZ A;  3CKB A;  1HXI A;  3BEE A;  1ELR A;  4KXK B;  3EDT B;  3OXF A;  5ARG A;  4U07 A;  5A7D B;  3ASH A;  3R9A B;  2R5S A;  3RO2 A;  3KAE A;  3TAX A;  4CDR A;  5KJN A;  4N2S A;  5BNW A;  3RJV A;  3NF1 A;  4XI0 A;  2KCL A;  3FWV A;  3S7F A;  4NQ0 A;  4U0S A;  3LYA A;  4GCN A;  5HI7 A;  3JYS A;  3TG4 A;  1HZ4 A;  3S7D A;  4CGV A;  2XCB A;  4XIF A;  2VGY A;  2JLB A;  2Y4T A;  3GYZ A;  3OXG A;  4UQZ A;  3RKV A;  3CKC A;  3Q4A B;  4UQX A;  3HYM B;  5FZQ A;  2OOE A;  3SF4 A;  4GA1 A;  4HOT A;  4BWR A; 
#chains in the Genus database with same CATH topology
 4L23 A;  3TWW A;  2V8S E;  2J07 A;  2V5Q C;  4YVQ C;  1PAQ A;  4YVO A;  3RK6 A;  1HH8 A;  3KEZ A;  3URZ A;  5EX0 A;  4EBA A;  4A55 A;  1P5Q A;  2I6H A;  2EIN E;  1SZ9 A;  4KBQ A;  4PH4 B;  2WXI A;  4NRH B;  1DCE A;  2DZO A;  4UWL A;  3SBS A;  3BUA A;  4J8F A;  5CCM A;  2L0I A;  1MZC A;  4I1A A;  4B8C B;  2DYR E;  2PNN A;  4BT9 A;  3SHF A;  5G05 J;  4AP2 A;  2FO7 A;  4ANX A;  1E8X A;  4YDY A;  3W9G A;  2L9B A;  3FTY A;  2Y4U A;  3BG1 B;  5HQ8 A;  2LUH A;  4DX7 D;  5T4Y A;  3SFX A;  1OT8 A;  5AQ9 A;  3VTY A;  2XHE A;  5BXU A;  1FVH A;  4JW1 A;  4TXR A;  4HRL A;  3AS8 A;  2A5U A;  5EDS A;  2AW6 A;  3O4Z A;  4OVV A;  4WNE A;  3C3R A;  4ABN A;  3G2T A;  4C0E A;  4LER A;  2EQX A;  4I17 A;  3DSX A;  3LJN A;  4UWF A;  2I9C A;  4LUN U;  5BXO A;  3SGH A;  4HLL A;  3OXF A;  4Q94 A;  4LNG A;  4F53 A;  1JUQ A;  4NQ0 A;  3L17 A;  3OXG A;  3HXC A;  3HYM B;  2DCP A;  1FT2 A;  1RW2 A;  3ML9 A;  4KZC A;  2GRM A;  3AAA C;  1BU9 A;  3RSE G;  3ZVV A;  3V79 K;  4CCA A;  3TG5 A;  2IJG X;  3UIN C;  3T9K A;  3MGB A;  4TV3 A;  2J09 A;  4H7Y A;  2VYI A;  4DLQ A;  3PZ4 A;  3FUE A;  4K5B A;  2NSZ A;  5FIO A;  3CHP A;  2HR2 A;  4D10 C;  4EQF A;  1TNB A;  4U0Z A;  1H2V C;  2WB2 A;  4L2L A;  4AIF A;  3ASN E;  2FBN A;  3V31 A;  1N95 A;  2LNI A;  2LAH A;  1SVX A;  3L22 A;  1D9S A;  4QFV A;  4DPR A;  4DLO A;  4CDM A;  3LJ3 A;  2LXL A;  2UY1 A;  4GTM A;  2IOS A;  2QYU A;  3UTM A;  2MYO A;  3ZNG A;  4RVB A;  4GZC A;  3L6A A;  1UG3 A;  2VSY A;  3VLD A;  4TUM A;  1SA4 A;  1ZBP A;  3E33 A;  2WPV A;  2F8X K;  3PEV B;  2P9L G;  4DK5 A;  3V30 A;  4F7A A;  3EDT B;  5BNW A;  4ANV A;  3PZ2 A;  5HI7 A;  3BU8 A;  5ENS D;  1S70 B;  2Y3A A;  4UQZ A;  4FU3 A;  4KVO A;  1MQS A;  3FU5 A;  1OCR E;  4O6F A;  3J5Q B;  3APD A;  4EZK A;  2ZIS A;  4DX6 D;  3ZXP A;  1KLX A;  3CLJ A;  3JQ1 A;  2XGS A;  4HOR A;  3PH0 C;  1YMP A;  4L2Y A;  2NC9 A;  3TWQ A;  3ULY A;  4UWG A;  3AU5 A;  3RRU A;  4UQY A;  3L54 A;  5KJM A;  5G2N A;  5AQB A;  2ILR A;  3RRM B;  3CVQ A;  3SZ7 A;  5AAR A;  3IHV A;  2VSO E;  4GCO A;  4CT4 A;  3D9K A;  2GRL A;  5AAO A;  5CRU A;  3D9P A;  4JXT A;  3S7J A;  1K1B A;  4HRN A;  2GRN B;  5LCW J;  5H7P A;  5AEN A;  4L1B A;  5JA4 D;  3HIZ A;  3FP3 A;  3E30 A;  3PE3 A;  1H2T C;  1KT0 A;  3ZKJ A;  4WNF A;  3QB2 A;  4M3O A;  5EYL A;  4OVU A;  3TWS A;  3TWV A;  2VTB A;  4GA0 A;  2M63 A;  4JL0 A;  4JA7 A;  4ATG A;  2XCC A;  4B93 B;  4GPK A;  3SNX A;  3I3N A;  1E90 A;  4EZJ A;  3CVP A;  3E37 A;  1HXI A;  5KJK A;  1HS6 A;  2KCL A;  4ILG A;  2QYJ A;  5A23 A;  4XIF A;  4F1P A;  1YYH A;  1QNF A;  1N94 A;  1TYQ G;  3ULQ A;  5AJL A;  3L9T A;  3RU0 A;  2WXN A;  2V4L A;  3SFZ A;  4HQD A;  3PZD A;  2WQH A;  2WVI A;  4FJY A;  3JXI A;  4PUC A;  4J7W A;  4HOQ A;  1MX4 A;  2F37 A;  1E7U A;  4U95 D;  3R7R A;  3B13 A;  5HRY A;  3QWV A;  3T8K A;  4DI3 A;  2OCC E;  3ESL A;  5KBA A;  1LD7 A;  1TNY A;  1X81 A;  4FUL A;  2QC9 A;  2XEV A;  3I4R B;  4GYW A;  4UI9 K;  4MKT A;  2KZT A;  4G23 A;  4G24 A;  3T8M A;  3PEU B;  2XZT G;  2IO2 C;  2Y69 E;  2KAT A;  2RKK A;  4LG6 A;  3EIQ C;  2ZGG A;  3UM3 A;  1IKN D;  3IHY A;  4N3A A;  4GTR A;  4UI9 C;  2IF4 A;  3Q7F A;  1OCO E;  1U3D A;  3QJZ A;  2XEN A;  4FAD A;  3LVR E;  2AXV A;  3FTV A;  2E0I A;  2PZI A;  3BEE A;  4A1G A;  4DUI A;  3L13 A;  2R03 A;  4GTQ A;  2RD0 A;  3FH5 A;  4HOT A;  4GA1 A;  5G05 C;  2XEH A;  4CYM D;  2X3M A;  3DST A;  2GW1 A;  5CER B;  1OUV A;  3TWR A;  2WXM A;  4ZFH A;  1HO8 A;  5LP0 A;  3APC A;  2XGO A;  3TWX A;  3E4B A;  3OAW A;  5KJL A;  3F6Q A;  5BPP A;  2X6I A;  1IQR A;  3UM0 A;  2A4Z A;  4GTP A;  2VSN A;  3AG1 E;  1Q2Z A;  1HF8 A;  4U8Y D;  1L5J A;  3FUF A;  1LTX A;  5FJY A;  2MHK A;  4Q96 A;  5ARF A;  2ZGD A;  5CEA A;  3E32 A;  2YHC A;  4L7T A;  2I2O A;  2WM9 A;  2P9I G;  3ZYM A;  3L82 A;  3JQ0 A;  1SQM A;  5KCM A;  3ASO E;  2AXZ A;  3CQC B;  1Z6T A;  5D0O D;  2XRZ A;  5G55 A;  4OYS A;  3UPV A;  1GW6 A;  3FUM A;  1H6K A;  1K8K G;  4WUY A;  2WMO A;  2H6F A;  3ASH A;  3LYA A;  3PZ3 A;  2OV8 A;  4G8K A;  2OEW A;  3AG3 E;  3FUD A;  4EEC A;  4NUR A;  4UQX A;  3SF4 A;  3ZYQ A;  3HDX A;  4MBG A;  5JJT A;  4N2Q A;  4DX5 D;  1N0R A;  4BX9 A;  4AVX A;  5HS0 A;  3UM2 A;  1FCH A;  4GZD A;  2C0M A;  5G04 C;  3MKR A;  5B1A E;  5ENQ D;  4G11 A;  2KCK A;  3CEQ A;  1TJC A;  5B1B E;  2Q7F A;  2PL2 A;  2VGE A;  1N54 A;  4AY6 A;  3QKY A;  1OWL A;  5JHA A;  4GTV A;  3LDZ A;  2BKG A;  1MYO A;  4EBA G;  3FU0 A;  1EPU A;  3CVL A;  4GZ6 A;  4ACK A;  4U8V D;  3SFY A;  3CIA A;  3LY9 A;  4HI9 A;  2RG8 A;  3CVV A;  2WXH A;  5ENT D;  3B7U X;  1SA5 A;  5AJD A;  3FUL A;  3N71 A;  3B95 A;  5JJ6 A;  3NAW A;  5DBK A;  3CHM A;  2CHW A;  3JCK C;  4G25 A;  3FUH A;  3TXN A;  1K1A A;  4GTO A;  1B89 A;  5M72 A;  2LO6 A;  1UJK A;  2JAB A;  2A5E A;  3X2Q E;  4U0U A;  2XGM A;  3RO2 A;  4CDR A;  1RZ4 A;  3NF1 A;  3FWV A;  2CG3 A;  3CR3 A;  2WXG A;  4GU5 A;  3MKQ A;  2Y1L E;  2VGY A;  3PUK A;  1E8Z A;  3ZGQ A;  1O5M A;  3CKC A;  2CHZ A;  2WXF A;  4AOF A;  1OY3 D;  2IFU A;  3AS5 A;  1H6O A;  3OXL A;  5G04 J;  1IYG A;  1BI7 B;  4W9R A;  2PM7 A;  2ZIR A;  1TN6 A;  5LX8 A;  1KZO A;  5LCW C;  2B6C A;  2VTB B;  3AG2 E;  3ASF A;  3DPD A;  4Z68 A;  4F6R D;  1A17 A;  2XPI A;  4BY6 A;  5D66 A;  5BV0 A;  1HG5 A;  4UI9 J;  3Q49 B;  4CEM A;  1N4P A;  4BFR A;  4NIK A;  1QBQ A;  1WY6 A;  3ABK E;  5T8I A;  3ZHE B;  3MKQ B;  1OWO A;  4GAA A;  5FQ6 A;  4APF A;  2ZU6 B;  3C3O A;  3ZEF A;  3UM1 A;  4R7L A;  4Y6W A;  4ANU A;  1U2V G;  2ZXW E;  5AQ7 A;  3BG0 B;  4K0R A;  3MJW A;  2LSU A;  4UWH A;  5ANR A;  4NAC A;  2OND A;  4CGW A;  3IKO B;  4GA2 A;  2BED A;  3C98 A;  5EX3 A;  4G1T A;  1IXV A;  2VSX E;  2X6J A;  3MV2 B;  2H6H A;  2MRI A;  3PRZ A;  3R9A B;  4MLP A;  4C48 B;  4RLY A;  4M7C A;  3J5P A;  4J8Y A;  3EU9 A;  4RQI A;  2OOE A;  2OVF A;  3BQO A;  4JHR A;  4I9E A;  2V0P A;  3LVQ E;  3U3W A;  2UWJ G;  4YDW A;  4LSZ E;  2XS8 A;  3CHO A;  5CBO A;  5E75 A;  3ZHE A;  5KNH D;  4N3C A;  4B94 A;  3CVU A;  3U66 A;  3UXG A;  2ION A;  3UT4 A;  3V2X A;  3HXB A;  4AJW A;  3O48 A;  2FF4 A;  5B3S E;  3EUV A;  3CHQ A;  3KSL A;  3Q9U C;  1Z3Y A;  4B0Z A;  2FUL A;  2X6F A;  5FZS A;  4BSX A;  3HXF A;  1MHQ A;  2BTD A;  2NYJ A;  1HU3 A;  1ZU2 A;  4JZY A;  5AQA A;  4BX8 A;  3MEK A;  2V5F A;  1SZA A;  4KMO A;  3PS6 A;  1MX2 A;  1LF8 A;  3NBN B;  1HX8 A;  4HXI A;  3U64 A;  4JEH A;  5FQ8 A;  4ILI A;  2PQN A;  3JUE A;  1BD8 A;  1H2U A;  5AYW D;  2H6I A;  2FO1 E;  3ESK A;  3NZU A;  2VGX B;  2PQR A;  4OAU C;  4AM9 A;  4CGV A;  1TEZ A;  1K3Z D;  2J08 A;  3HG0 D;  1OWN A;  4WWO A;  2OVB A;  4HLE A;  4N39 A;  1ELR A;  3FUN A;  3R9M A;  5D2M C;  4XI0 A;  1JCR A;  3IV0 A;  4A3V A;  4BET A;  3Q4A B;  1U3C A;  3DSV A;  3LXU X;  1ELW A;  2HYZ A;  3HXE A;  1NFI E;  4LNB A;  1XNF A;  3LKU A;  2KBX A;  3ASG A;  5JMN D;  1O1S A;  4U04 A;  3UKR G;  1UN8 A;  3ABM E;  1N52 A;  1YA0 A;  2RFM A;  4RG9 A;  2P9S G;  2XZD G;  4DJA A;  1HG2 A;  3ZYK A;  3C72 A;  1TNO A;  3Q9N C;  4XE0 A;  3ZUV B;  2P9U G;  3ZPJ A;  2F0Y A;  3PRE A;  4F1S A;  1EDU A;  3PNL B;  4ILH B;  5FTP A;  2E2E A;  1S0P A;  1FPP A;  2PM6 A;  4I1O B;  4FHJ A;  3ABL E;  4J0U A;  4HOU A;  4RG6 A;  1E96 B;  4KZ0 A;  4WWN A;  4A1S A;  1JCQ A;  5FZR A;  4EZL A;  4AXH A;  5CEC B;  2L6J A;  2DIW A;  1N0Q A;  3UKU G;  2IEJ A;  1HE8 A;  4XEI G;  4KXK B;  2WQ7 A;  3NZS A;  2R5S A;  4HNA D;  3AU4 A;  3RJV A;  1H0A A;  4GCN A;  2JLB A;  4GML A;  3FU6 A;  3UI2 A;  3QWW A;  3WXX A;  2J4D A;  2QY7 A;  4JEU A;  1VDY A;  4ANW A;  2HM8 A;  2GRP B;  2B0O E;  2KM4 A;  2V4H C;  1NA3 A;  4GZ5 A;  5EN5 D;  4V3I A;  1TR4 A;  2C2L A;  5LOZ A;  1S63 A;  2AXU A;  3DEO A;  4WWP A;  3FH7 A;  2CHX A;  3FEX A;  4BT8 A;  1TN7 A;  4I6E A;  3C3Q A;  4FJZ A;  3TXM A;  5CMY A;  2VQ2 A;  1PY1 A;  5CMW A;  2P9K G;  3ZW3 A;  4DX1 A;  2DWZ A;  5E76 A;  2XPY A;  3UT8 A;  3LPZ A;  4I43 A;  3MZL B;  3PE4 A;  1NP7 A;  4B89 A;  5BT1 A;  2HE0 A;  1Y6I A;  4C9B B;  5FIN A;  3ZN3 A;  2P58 C;  1AP7 A;  5EKQ D;  3MX3 A;  1Z5S C;  5JJ7 A;  5FQ4 A;  3P1U A;  5T3R A;  3TAX A;  3PNT B;  3FUI A;  4PS7 A;  2WQ6 A;  2XCB A;  3GZS A;  4O1P A;  3EHR A;  4UUC A;  3CVW A;  5AIJ A;  3LS8 A;  3QK0 A;  3FTS A;  5HKP A;  2KZT B;  3IEG A;  4QQI A;  4KVM A;  1TN8 A;  3UX4 A;  2EIJ E;  4E85 A;  3HHM A;  2DVW A;  3HRA A;  2LAI A;  4KT6 B;  3FY4 A;  3EHQ A;  1IQU A;  2H6G A;  3ULE G;  3UIO C;  4ACL A;  1XGW A;  1DNP A;  4K5C A;  2ETB A;  3G2S A;  3G2U A;  4J8D A;  4XX5 A;  4LCT A;  2DYS E;  3ZU7 B;  3CV0 A;  3Q5M A;  3TL5 A;  4GPM A;  1QQE A;  4PS8 A;  3VLE A;  3B7T A;  1NL4 A;  4FLH A;  2AJA A;  1E7V A;  2Y0B G;  2XRY A;  3AJI A;  4GB9 A;  3UMV A;  3QWP A;  4HVB A;  2KXP C;  3D9M A;  5DIZ A;  2ETA A;  3RRN B;  5ARG A;  1V55 E;  3S2A A;  4ATZ D;  2QZA A;  1G3N B;  5KJN A;  1Z3X A;  5FQ7 A;  3G2V A;  3SD5 A;  3SO8 A;  1JWG A;  4CT0 A;  3JYS A;  1HZ4 A;  3S7D A;  2GRQ B;  4UWK A;  1WG0 A;  1BI8 B;  4BWR A;  3EHN A;  1DCQ A;  3UUX A;  3Q7A A;  4HB5 A;  5ENN A;  3B7R L;  4I2Z A;  1DVP A;  3ISM C;  3CVN A;  2P2C P;  3QOU A;  2KCV A;  3RIB A;  3SBT B;  4JHJ A;  1W3B A;  4U8H A;  4U7E B;  5CBN A;  5ITZ F;  4K03 A;  5BW8 C;  3CHS A;  1N11 A;  2WXJ A;  4WNG A;  2YHE A;  4YND A;  2IU1 A;  4K5A B;  4CRW A;  3AG4 E;  1Y8M A;  3CQG B;  2X38 A;  3PUJ A;  5C1D A;  1ELK A;  2AWI A;  5CHE E;  2WXQ A;  5BUZ A;  4J8S A;  1ZB1 A;  2R05 A;  4XZ4 A;  4ME2 A;  1MJ0 A;  5EIB E;  1KT1 A;  5A6C A;  3HVE B;  5KWD A;  3EHM A;  5EIL A;  4JC8 A;  2WXP A;  4JA9 A;  1EF1 C;  2F8Y A;  4GTT A;  3KEA A;  5CED B;  1IHG A;  5EID A;  4XI9 A;  3S7B A;  4N5C A;  4IN3 B;  1O1T A;  1S64 A;  1NZN A;  4IRU A;  4DI4 A;  4FLB A;  4MS6 A;  2J8S D;  1A5E A;  4KYO B;  4A3T A;  1OXJ A;  3GW4 A;  3GZ1 A;  2JEK A;  4OAV B;  4N2S A;  5AN8 A;  1OCC E;  4U0S A;  1D8D A;  3JXJ A;  5ENP D;  3DSS A;  3DPY A;  2Y4T A;  3ML8 A;  3RKV A;  1V54 E;  3D9N A;  4BEP A;  2WXR A;  3QDN A;  2X6H A;  1BPO A;  3DXM G;  2IY0 C;  3SQV A;  2FI7 A;  2GRR B;  3D9I A;  5KNG A;  4RSY A;  2XEE A;  2WXO A;  1AWC B;  3FEY A;  4GMR A;  3C5R A;  2C0L A;  3QAQ A;  4P29 A;  1BLX B;  3U4T A;  3EIJ A;  2EIK E;  4BSZ B;  3KS2 A;  3NB2 A;  3EU5 A;  5ENO D;  4BTB A;  5FT9 A;  4TUU A;  3K9I A;  4AY5 A;  3T5V A;  3CK7 A;  2WXL A;  4X8Q A;  4H7X A;  2XQ0 A;  2GRO B;  1PC2 A;  4XKC A;  4C0M A;  3AS4 A;  3MV3 B;  4PS3 A;  5FWQ A;  3LY7 A;  3CGH A;  4YDO A;  4JHK A;  3DBS A;  2R02 A;  3D9O A;  4FP7 A;  2IO3 C;  1UN9 A;  3DSU A;  1UOH A;  1N9A A;  4HS2 A;  1OWM A;  3I4G A;  3CVX A;  4GYY A;  3EJN A;  4TRQ A;  1O1R A;  3CKB A;  3S7F A;  3TG4 A;  3WG7 E;  1MX6 A;  1JWF A;  1IHB A;  2R17 C;  3R7Q A;  3GYZ A;  3W9F A;  3L08 A;  2I1K A;  4O1O A;  3RO3 A;  2NXP A;  3T5X A;  1WM5 A;  3CK9 A;  4GMJ A;  3DXK G;  1NA0 A;  4FHK A;  3LEW A;  4EHM A;  1FT1 A;  2XS1 A;  4E6H A;  3MCX A;  3APF A;  2J4B A;  2DZN A;  3FUJ A;  3HVE A;  5BV1 A;  4I1M A;  4FA6 A;  3JUI A;  2HO1 A;  2XPZ A;  3HXD A;  1KZP A;  2QFC A;  1X5B A;  4GYO A;  4ZHB A;  3ZRH A;  2BKK B;  3FTX A;  4MRU A;  5J90 A;  2AVP A;  5C2Y A;  3TWT A;  2DBA A;  4BER A;  2CG2 A;  5FZQ A;  3ENE A;  4GTS A;  2FEZ A;  4I2W A;  4L9P A;  4GZ3 A;  1E8W A;  4DRX E;  3Q79 A;  1DC2 A;  4U96 D;  2P9N G;  3OTN A;  3CVY A;  1TNZ A;  1JCS A;  3Q75 A;  4N5Q A;  4APO A;  5ANL A;  3DWL G;  2J49 A;  4JB8 P;  3QNK A;  1INZ A;  3TJP A;  3FUK A;  3IXE A;  3CSF A;  2EIL E;  5LFA A;  4I6J A;  3UT7 A;  2ETC A;  4JVS A;  4JPS A;  3P2B A;  3PVL A;  3VLF A;  1TNU A;  4HI8 A;  2OEV A;  3NQP A;  4YDE A;  5EYP F;  2L0T B;  3D9H A;  2LSV A;  4I9C A;  3MA5 A;  3PDN A;  3FTZ A;  1WAO 1;  1UW4 B;  3FU3 A;  3IBE A;  4G8L A;  4IUL A;  4J6I A;  4Y6C A;  2P9P G;  3B7S A;  5CRV A;  4LEU A;  3U9W A;  1KPS B;  4CZ2 D;  5IY5 E;  2X6K A;  3NOC D;  4IYP A;  3FFL A;  4HOS A;  1EYH A;  4TXQ A;  1N4Q A;  2YIN A;  3RAU A;  2I1J A;  3G2W A;  4URK A;  2YNQ A;  3Q47 B;  3CST A;  2YQ8 A;  3UQ3 A;  4O60 A;  4PDX A;  1LD8 A;  4WAF A;  2EIM E;  2UY1 B;  3FHE A;  4U63 A;  1WDY A;  2WMN A;  4A63 B;  3ZIM A;  2L6B A;  2CFZ A;  2CFU A;  1OWP A;  3QC1 A;  4BTA A;  2IQC A;  2VGX A;  3NOG D;  4AEZ C;  1YCS B;  4LRZ A;  3FH8 A;  4AV7 A;  1N4R A;  3V2O A;  2R59 A;  4TXP A;  4BES A;  4Q69 A;  1SW6 A;  2BF0 X;  2MOW A;  3E34 A;  4U07 A;  3KAE A;  5ENR D;  3D3M A;  1FVF A;  4J8E A;  3TGO A;  3ONL A;  4I6G A;  4N3B A;  3LCA A;  3D9J A;  3I5P A;  3DEP A;  3VTX A;  1N4S A;  2J9Q A;  3FTU A;  1H6P A;  3DRA A;  4DX2 A;  2IOL A;  2LXM A;  1TJF A;  3KSQ A;  1HFA A;  1UJJ A;  3Q78 A;  1E8Y A;  2RFA A;  3TWU A;  2WXK A;  2R2L A;  3ONK A;  4F3V A;  5J08 A;  4XKB A;  5D0Q D;  1D8E A;  3GZ2 A;  3LY8 A;  3ZXS A;  3FTW A;  4G2V A;  3SI5 A;  3DSW A;  3ASD A;  3ZFW A;  1QZ2 A;  4HFG A;  2BUG A;  3Q73 A;  3MYV A;  3KD7 A;  5CCL A;  4EPZ A;  3B7B A;  4FC8 A;  4HBD A;  3Q15 A;  4HRM B;  3QAR A;  1QYM A;  1H19 A;  3CHR A;  3SY2 A;  4WND A;  4B8A A;  3D9L A;  4CDN A;  4G26 A;  2KC7 A;  4JD2 G;  2VJ8 A;  3CK8 A;  3L16 A;  3UIP C;  1JPL A;  5A7D B;  3FDH A;  3PZ1 A;  4LNU D;  2GGF A;  1OCZ E;  1NI1 A;  5JHB A;  3ZYL A; 
#chains in the Genus database with same CATH homology
 3LXU X;  5G05 C;  1ELW A;  2HYZ A;  3D9N A;  4L23 A;  2V8S E;  2J07 A;  2X3M A;  2WXR A;  1PAQ A;  2X6H A;  3QDN A;  4YVQ C;  1BPO A;  2GW1 A;  4YVO A;  1OUV A;  3RK6 A;  1HH8 A;  3KEZ A;  2WXM A;  2FI7 A;  3URZ A;  1HO8 A;  3D9I A;  1XNF A;  5EX0 A;  4EBA A;  5LP0 A;  4A55 A;  1P5Q A;  2I6H A;  4RSY A;  3LKU A;  3APC A;  2XGO A;  1SZ9 A;  3ASG A;  4KBQ A;  2WXO A;  3FEY A;  4PH4 B;  2WXI A;  3E4B A;  3OAW A;  4U04 A;  5BPP A;  5KJL A;  4NRH B;  1UN8 A;  2X6I A;  4UWL A;  1N52 A;  1YA0 A;  1IQR A;  3SBS A;  4RG9 A;  2C0L A;  2A4Z A;  3QAQ A;  4P29 A;  4J8F A;  5CCM A;  4DJA A;  2L0I A;  2VSN A;  1HG2 A;  3ZYK A;  4I1A A;  4B8C B;  3U4T A;  3EIJ A;  4XE0 A;  3ZPJ A;  4BT9 A;  3PRE A;  3SHF A;  5G05 J;  1HF8 A;  3KS2 A;  1L5J A;  4F1S A;  3FUF A;  5FJY A;  4AP2 A;  2MHK A;  4BTB A;  2FO7 A;  5FT9 A;  4TUU A;  1EDU A;  3K9I A;  4ANX A;  1E8X A;  4Q96 A;  4AY5 A;  5ARF A;  3T5V A;  2L9B A;  3PNL B;  3CK7 A;  3FTY A;  2WXL A;  2Y4U A;  4ILH B;  3BG1 B;  5FTP A;  2E2E A;  5HQ8 A;  4H7X A;  5T4Y A;  2XQ0 A;  1S0P A;  2YHC A;  4L7T A;  2PM6 A;  4I1O B;  4FHJ A;  2I2O A;  1PC2 A;  2WM9 A;  4XKC A;  3ZYM A;  4C0M A;  4J0U A;  3AS4 A;  3MV3 B;  4PS3 A;  5FWQ A;  3VTY A;  2XHE A;  4HOU A;  4RG6 A;  3LY7 A;  1FVH A;  3JQ0 A;  3CGH A;  1SQM A;  1E96 B;  4KZ0 A;  4JW1 A;  4WWN A;  4JHK A;  4A1S A;  5FZR A;  5KCM A;  4EZL A;  3DBS A;  3AS8 A;  2A5U A;  5EDS A;  2AW6 A;  3D9O A;  4FP7 A;  3O4Z A;  4OVV A;  4WNE A;  2AXZ A;  4AXH A;  1UN9 A;  3CQC B;  1Z6T A;  2L6J A;  2DIW A;  4ABN A;  5D0O D;  3G2T A;  4C0E A;  2XRZ A;  4LER A;  2EQX A;  4I17 A;  5G55 A;  4OYS A;  3UPV A;  1GW6 A;  3FUM A;  4HS2 A;  2I9C A;  4UWF A;  1OWM A;  1HE8 A;  1H6K A;  4LUN U;  3I4G A;  3CVX A;  4GYY A;  3EJN A;  4TRQ A;  4WUY A;  3CKB A;  2WMO A;  4KXK B;  3SGH A;  2WQ7 A;  3OXF A;  3NZS A;  4Q94 A;  3ASH A;  2R5S A;  3AU4 A;  4F53 A;  3RJV A;  1JUQ A;  3S7F A;  4NQ0 A;  1H0A A;  3LYA A;  4GCN A;  3TG4 A;  2OV8 A;  3L17 A;  1JWF A;  2R17 C;  3R7Q A;  2JLB A;  3FUD A;  3GYZ A;  3OXG A;  4GML A;  3FU6 A;  4EEC A;  3L08 A;  4NUR A;  3HYM B;  4UQX A;  3SF4 A;  2I1K A;  2DCP A;  3ZYQ A;  3HDX A;  5JJT A;  4N2Q A;  3QWW A;  3WXX A;  3ML9 A;  4KZC A;  2GRM A;  3ZVV A;  4BX9 A;  2J4D A;  4AVX A;  3RO3 A;  2NXP A;  2QY7 A;  3T5X A;  1FCH A;  4GZD A;  4JEU A;  1WM5 A;  1VDY A;  2C0M A;  5G04 C;  3MKR A;  4ANW A;  4CCA A;  3TG5 A;  2IJG X;  3CK9 A;  4GMJ A;  2HM8 A;  4G11 A;  2KM4 A;  1NA0 A;  4FHK A;  2KCK A;  3LEW A;  3CEQ A;  1NA3 A;  1TJC A;  4GZ5 A;  2Q7F A;  4V3I A;  2PL2 A;  4E6H A;  3MCX A;  1N54 A;  2C2L A;  2J09 A;  2J4B A;  3APF A;  3MGB A;  4TV3 A;  5LOZ A;  4AY6 A;  2AXU A;  4H7Y A;  2VYI A;  4DLQ A;  3QKY A;  1OWL A;  4WWP A;  5JHA A;  3FH7 A;  3LDZ A;  2CHX A;  3FEX A;  4BT8 A;  3FUJ A;  3HVE A;  3FUE A;  4EBA G;  4I1M A;  5BV1 A;  3FU0 A;  1EPU A;  4I6E A;  4FA6 A;  2NSZ A;  3JUI A;  3CHP A;  2HR2 A;  3CVL A;  4D10 C;  2HO1 A;  2XPZ A;  4EQF A;  4GZ6 A;  4FJZ A;  3TXM A;  4ACK A;  2QFC A;  1X5B A;  4GYO A;  4U0Z A;  5CMY A;  1H2V C;  3CIA A;  2VQ2 A;  1PY1 A;  2WB2 A;  4L2L A;  4AIF A;  5CMW A;  3ZRH A;  3LY9 A;  2FBN A;  3ZW3 A;  2LNI A;  2RG8 A;  3FTX A;  3CVV A;  2LAH A;  2WXH A;  4MRU A;  5E76 A;  3B7U X;  3L22 A;  2XPY A;  5AJD A;  4QFV A;  3UT8 A;  3LPZ A;  4DLO A;  3FUL A;  4DPR A;  5J90 A;  3N71 A;  2AVP A;  5JJ6 A;  4I43 A;  5C2Y A;  4CDM A;  3LJ3 A;  3MZL B;  2DBA A;  3PE4 A;  2UY1 A;  2CG2 A;  5FZQ A;  3ENE A;  5DBK A;  3CHM A;  2IOS A;  1NP7 A;  2CHW A;  2FEZ A;  4I2W A;  4GZ3 A;  4B89 A;  5BT1 A;  1E8W A;  3JCK C;  4G25 A;  4RVB A;  4GZC A;  1Y6I A;  3FUH A;  3OTN A;  3TXN A;  4C9B B;  3CVY A;  3L6A A;  1UG3 A;  3ZN3 A;  2VSY A;  2P58 C;  3VLD A;  5EKQ D;  3MX3 A;  1ZBP A;  1B89 A;  5M72 A;  1UJK A;  2LO6 A;  2WPV A;  4APO A;  5JJ7 A;  5ANL A;  4U0U A;  2XGM A;  3PEV B;  5FQ4 A;  2J49 A;  4DK5 A;  3QNK A;  4F7A A;  3EDT B;  1INZ A;  3RO2 A;  3P1U A;  5T3R A;  3TAX A;  4CDR A;  3TJP A;  5BNW A;  3FUK A;  3NF1 A;  3FWV A;  3PNT B;  4ANV A;  3CSF A;  2CG3 A;  5LFA A;  4I6J A;  3FUI A;  3CR3 A;  2WXG A;  4GU5 A;  5HI7 A;  3UT7 A;  4PS7 A;  2WQ6 A;  3MKQ A;  4JVS A;  4JPS A;  2XCB A;  2VGY A;  2Y3A A;  1E8Z A;  3GZS A;  3P2B A;  3PUK A;  3PVL A;  3CKC A;  4FU3 A;  4UQZ A;  3VLF A;  2CHZ A;  2WXF A;  3ZGQ A;  3NQP A;  4KVO A;  4AOF A;  2L0T B;  1MQS A;  2LSV A;  3FU5 A;  4I9C A;  2IFU A;  3AS5 A;  3MA5 A;  3PDN A;  4O6F A;  3FTZ A;  1WAO 1;  5AIJ A;  3APD A;  3LS8 A;  3CVW A;  3QK0 A;  1UW4 B;  4EZK A;  3FU3 A;  3IBE A;  4GA1 A;  3OXL A;  5G04 J;  1IYG A;  4IUL A;  3FTS A;  4J6I A;  4Y6C A;  2KZT B;  3B7S A;  4W9R A;  1KLX A;  3CLJ A;  2PM7 A;  4LEU A;  3U9W A;  3IEG A;  4KVM A;  3JQ1 A;  2X6K A;  2XGS A;  5LX8 A;  4HOR A;  4IYP A;  5LCW C;  3FFL A;  4HOS A;  1EYH A;  2YIN A;  3UX4 A;  2VTB B;  3PH0 C;  3ASF A;  3DPD A;  2I1J A;  3G2W A;  4E85 A;  1A17 A;  4URK A;  3HHM A;  2YNQ A;  3Q47 B;  4L2Y A;  2NC9 A;  3CST A;  2YQ8 A;  3AU5 A;  4UWG A;  3RRU A;  2XPI A;  3UQ3 A;  4BY6 A;  2LAI A;  4UQY A;  4KT6 B;  5BV0 A;  4PDX A;  3FY4 A;  3L54 A;  5KJM A;  1HG5 A;  5G2N A;  4UI9 J;  1IQU A;  3Q49 B;  4WAF A;  4CEM A;  2ILR A;  3RRM B;  3CVQ A;  3SZ7 A;  4BFR A;  3IHV A;  1WY6 A;  2UY1 B;  2VSO E;  3FHE A;  4GCO A;  3D9K A;  4CT4 A;  5T8I A;  2GRL A;  4ACL A;  3ZHE B;  1XGW A;  3MKQ B;  1DNP A;  1OWO A;  4GAA A;  4U63 A;  5FQ6 A;  4APF A;  2WMN A;  3G2S A;  3G2U A;  2ZU6 B;  3ZIM A;  3D9P A;  4J8D A;  4JXT A;  3S7J A;  4XX5 A;  2CFZ A;  2CFU A;  4LCT A;  1OWP A;  3ZEF A;  3QC1 A;  4BTA A;  5LCW J;  4R7L A;  5AEN A;  4Y6W A;  4L1B A;  4ANU A;  2IQC A;  3HIZ A;  3CV0 A;  3FP3 A;  3Q5M A;  2VGX A;  3TL5 A;  3BG0 B;  1QQE A;  4PS8 A;  3VLE A;  3PE3 A;  4K0R A;  1H2T C;  4AEZ C;  1KT0 A;  3MJW A;  4WNF A;  3QB2 A;  2LSU A;  4LRZ A;  3FH8 A;  4AV7 A;  4M3O A;  4UWH A;  3B7T A;  2R59 A;  4FLH A;  5ANR A;  4OVU A;  1E7V A;  4Q69 A;  2VTB A;  4NAC A;  2OND A;  2XRY A;  4GA0 A;  3IKO B;  2BF0 X;  4GA2 A;  4CGW A;  3C98 A;  4GB9 A;  2M63 A;  4JL0 A;  5EX3 A;  2MOW A;  4JA7 A;  4ATG A;  2XCC A;  4G1T A;  3UMV A;  3QWP A;  4HVB A;  4GPK A;  2VSX E;  3SNX A;  2X6J A;  3I3N A;  3MV2 B;  1E90 A;  3CVP A;  3D9M A;  5DIZ A;  4EZJ A;  1HXI A;  2MRI A;  3PRZ A;  5ARG A;  3R9A B;  3RRN B;  3S2A A;  4U07 A;  5KJK A;  1HS6 A;  5KJN A;  3KAE A;  1Z3X A;  4MLP A;  2KCL A;  3G2V A;  4ILG A;  5FQ7 A;  3SD5 A;  1JWG A;  4CT0 A;  3JYS A;  1HZ4 A;  3D3M A;  3S7D A;  5A23 A;  4XIF A;  4UWK A;  2OOE A;  1FVF A;  2OVF A;  4BWR A;  1QNF A;  3EHN A;  4J8E A;  3UUX A;  3TGO A;  4JHR A;  3ONL A;  2V0P A;  4I9E A;  3LVQ E;  5ENN A;  4I6G A;  2UWJ G;  3U3W A;  4N3B A;  3LCA A;  3D9J A;  3CHO A;  3B7R L;  3I5P A;  3ULQ A;  5E75 A;  3ZHE A;  5AJL A;  3RU0 A;  2WXN A;  2V4L A;  4N3C A;  4B94 A;  4I2Z A;  3CVU A;  1DVP A;  3VTX A;  3SFZ A;  3U66 A;  3CVN A;  2ION A;  3PZD A;  2J9Q A;  3UT4 A;  2WQH A;  4AJW A;  3FTU A;  3O48 A;  2WVI A;  4FJY A;  4PUC A;  2FF4 A;  3QOU A;  4HOQ A;  2KCV A;  3RIB A;  3SBT B;  3CHQ A;  4JHJ A;  1E7U A;  1W3B A;  3R7R A;  3B13 A;  4U8H A;  1Z3Y A;  2IOL A;  4K03 A;  5BW8 C;  3QWV A;  4B0Z A;  2FUL A;  2X6F A;  1TJF A;  3CHS A;  1HFA A;  5FZS A;  1UJJ A;  2WXJ A;  3ESL A;  4BSX A;  4DI3 A;  1E8Y A;  4WNG A;  1MHQ A;  2YHE A;  4FUL A;  4YND A;  2BTD A;  2IU1 A;  4CRW A;  1Y8M A;  2XEV A;  3CQG B;  3I4R B;  4GYW A;  1HU3 A;  4UI9 K;  2WXK A;  2KZT A;  4MKT A;  1ZU2 A;  4JZY A;  4G23 A;  2X38 A;  3ONK A;  4G24 A;  3T8M A;  4BX8 A;  4F3V A;  3MEK A;  3PUJ A;  5C1D A;  1ELK A;  5J08 A;  3PEU B;  2AWI A;  4XKB A;  5CHE E;  5D0Q D;  2WXQ A;  2V5F A;  1SZA A;  4J8S A;  4KMO A;  5BUZ A;  3PS6 A;  2KAT A;  1LF8 A;  3GZ2 A;  1HX8 A;  3LY8 A;  4HXI A;  3FTW A;  4G2V A;  3ZXS A;  3SI5 A;  3U64 A;  4XZ4 A;  4JEH A;  3EIQ C;  4ME2 A;  5FQ8 A;  3ASD A;  4ILI A;  1KT1 A;  1QZ2 A;  3ZFW A;  5A6C A;  3HVE B;  4HFG A;  2BUG A;  3EHM A;  3MYV A;  2PQN A;  3IHY A;  3KD7 A;  1H2U A;  4JC8 A;  5AYW D;  5CCL A;  4EPZ A;  2WXP A;  4JA9 A;  1EF1 C;  3ESK A;  3NZU A;  4FC8 A;  1IHG A;  4N3A A;  4XI9 A;  2VGX B;  2PQR A;  3Q15 A;  4N5C A;  3QAR A;  4IN3 B;  4UI9 C;  3S7B A;  2IF4 A;  1H19 A;  3CHR A;  1NZN A;  4IRU A;  4WND A;  4AM9 A;  4CGV A;  1TEZ A;  4B8A A;  4DI4 A;  4FLB A;  4MS6 A;  3D9L A;  4CDN A;  4G26 A;  1U3D A;  3QJZ A;  2KC7 A;  4KYO B;  2J08 A;  4A3T A;  4FAD A;  3LVR E;  1OWN A;  4WWO A;  2AXV A;  2OVB A;  2VJ8 A;  3CK8 A;  3FTV A;  3GW4 A;  3L16 A;  3GZ1 A;  2JEK A;  1JPL A;  2E0I A;  2PZI A;  4N39 A;  5A7D B;  4HLE A;  3BEE A;  1ELR A;  4A1G A;  3FDH A;  3FUN A;  3L13 A;  2GGF A;  4N2S A;  4XI0 A;  3IV0 A;  4U0S A;  5JHB A;  2RD0 A;  3FH5 A;  4A3V A;  2Y4T A;  3ML8 A;  3RKV A;  3Q4A B;  4HOT A;  1U3C A;  3ZYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...