3AS8A

Mama msr-1 p41212
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
181
structure length
181
Chain Sequence
b'DDIRQVYYRDKGISHAKAGRYSEAVVMLEQVYDADAFDVEVALHLGIAYVKTGAVDRGTELLERSIADAPDNIKVATVLGLTYVQVQKYDLAVPLLVKVAEANPVNFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAYSYEQMGSHEEALPHFKKANELDERSAVELALV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly
pubmed doi rcsb
molecule keywords Magnetosome protein MamA
source organism Magnetospirillum gryphiswaldense
molecule tags Protein binding
total genus 76
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3as8A01
3GZ1A 2YHCA 1NA3A 5FZQA 5FJYA 4JHRA 4AIFA 1ZU2A 3KD7A 3GW4A 3GZ2A 4G26A 5CHEE 2Y4TA 3AS8A 3LPZA 2LSVA 5CCLA 2BUGA 3OXFA 3CVNA 3ZHEB 3URZA 4H7YA 2VGXA 4YVOA 4WNDA 1HZ4A 2FF4A 3CKBA 3HYMB 3S7FA 4J0UA 4CGWA 3CVQA 3ESKA 2FI7A 5KJKA 3LY8A 3CK9A 1IYGA 4BWRA 2VQ2A 2XGSA 4I9CA 3ASFA 5HI7A 4F3VA 4UQZA 4CDRA 1NZNA 3MKRA 5KJLA 4BT9A 4HOTA 3IEGA 4GZ5A 4KXKB 4U0SA 2L6JA 5EKQD 4KYOB 4AY6A 4G2VA 3MV2B 4H7XA 2KCLA 2R5SA 2HR2A 3FFLA 2I6HA 4NQ0A 5M72A 2XCBA 3TGOA 1QZ2A 5KJMA 3LY7A 3CK7A 4I9EA 5FT9A 2DBAA 4WNFA 3KS2A 3QKYA 2FBNA 4GZ6A 2PZIA 2XPIA 5D0QD 4UQXA 4JL0A 2XCCA 2UWJG 3FP3A 5G05J 3CVLA 3Q5MA 5LCWC 2V5FA 3Q4AB 3QDNA 5JJ7A 5AYWD 2NC9A 4JA9A 3CVPA 3RIBA 4NRHB 2VSYA 3LYAA 1A17A 1TJCA 3ZGQA 4RG9A 3ULQA 2VGYA 3AS5A 5EX0A 4WNEA 5BNWA 4W9RA 4BTBA 5D0OD 3VTXA 4YNDA 2PQNA 4XIFA 1KT1A 1P5QA 2OOEA 3GYZA 3ZN3A 4JA7A 1OUVA 5C1DA 2VSNA 2PQRA 5G04C 1ZBPA 3Q49B 3QWPA 2Q7FA 3CEQA 1B89A 5FZSA 1HH8A 3WXXA 2C2LA 3TG4A 4WNGA 2J9QA 2FEZA 2YQ8A 2KATA 3QOUA 4N5CA 3ASGA 4AM9A 2IFUA 4GA1A 3AS4A 4UQYA 1XNFA 3LCAA 4IN3B 5FTPA 5BW8C 2WQHA 4XI9A 3S7JA 4LEUA 3ASDA 3K9IA 4GYOA 3CK8A 4UI9C 1E96B 4EQFA 3ASHA 3PE4A 3ZFWA 4AY5A 3OXLA 4GYWA 2ONDA 4N3BA 2IF4A 2JLBA 5G05C 3Q47B 4GYYA 4J8FA 5BT1A 4G24A 3RU0A 3RJVA 2MHKA 4I2ZA 2XGMA 4KBQA 1YA0A 3ZPJA 3O48A 4HOUA 3U3WA 2WPVA 1ELRA 2PL2A 3S7BA 4WUYA 3R9AB 4U07A 4UI9K 4XI0A 3TG5A 3RKVA 3RO2A 1W3BA 1Y8MA 4ME2A 4B94A 5DBKA 1QQEA 3MA5A 5JJTA 5LCWJ 4HOSA 4A1SA 5EX3A 4BT8A 2Y4UA 4GZ3A 2KC7A 3FWVA 4YVQC 3VTYA 4HOQA 2FO7A 2AVPA 5CCMA 3CV0A 3SZ7A 2HO1A 4I2WA 2LSUA 4U0UA 4Y6WA 3EDTB 5KJNA 4G23A 5A6CA 3TAXA 3SF4A 4GA0A 1FCHA 3MEKA 1PC2A 4J8DA 3KAEA 3QWVA 4O6FA 5ARFA 3UPVA 5ARGA 3JYSA 2C0LA 2KCVA 3NF1A 4U0ZA 5G04J 4GA2A 4BTAA 4N2QA 3U4TA 3CKCA 5JJ6A 3UUXA 2XGOA 2UY1A 4CGVA 4I17A 2QFCA 2C0MA 2GW1A 3MV3B 4J8EA 1KLXA 4APOA 4I1AA 3PDNA 1KT0A 4GCOA 2VGXB 3OXGA 3LY9A 3N71A 1HXIA 1WM5A 3S7DA 3RO3A 2KCKA 4HORA 2LNIA 5FZRA 3E4BA 3UQ3A 4G1TA 3LKUA 2VYIA 4UI9J 1ELWA 4GPKA 5HQ8A 4Y6CA 4N2SA 3Q15A 4N3AA 5DIZA 3ZHEA 4GCNA 1NA0A 2HYZA 3PE3A 4N3CA 4ABNA 1IHGA 2UY1B 4G25A 4N39A 4RG6A 4U04A 3QWWA 2P58C 3BEEA 2XEVA 5A7DB 2E2EA 1WAO1
chains in the Genus database with same CATH superfamily
3SY2A 4A1GA 4DX1A 5BUZA 1OCOE 4AIFA 3TWUA 4IYPA 4BEPA 1BI7B 3GZ2A 4HRNA 4G26A 5CHEE 1KPSB 3LPZA 4OAVB 3T8KA 2LSVA 2WXKA 3ONLA 2BUGA 3ABKE 3C98A 3FHEA 4H7YA 4YVOA 4KZCA 1HZ4A 1TNBA 5EIDA 4AOFA 4CGWA 3UT4A 4AEZC 2FI7A 2IO3C 4BWRA 3UX4A 3PZ1A 2XRYA 3ASOE 3UXGA 4AV7A 3UIPC 3J5QB 2OV8A 5HI7A 2J07A 3L6AA 3Q7AA 4UQZA 1NZNA 1O5MA 2YNQA 4TXPA 4KXKB 5EKQD 1OWPA 5ENPD 3FUDA 1ZB1A 5M72A 3ABME 3TGOA 1QZ2A 3LY7A 5CMYA 4ATGA 3CK7A 3D9NA 1NL4A 2CFUA 3ABLE 4FC8A 1QNFA 5D0QD 3FUEA 4MBGA 4UQXA 3FTVA 3MGBA 2UWJG 4XX5A 2V5QC 3FP3A 2NXPA 3D9LA 4WWNA 3X2QE 3CIAA 2R59A 2WXQA 5T3RA 3QDNA 2IY0C 3MKQB 3AU4A 4DK5A 2ETCA 3RIBA 4B0ZA 4PUCA 1A17A 4K03A 4MKTA 3EU9A 3HXFA 3ZGQA 2F8YA 3C5RA 2VGYA 3AS5A 2ZGDA 1BLXB 2IQCA 5KWDA 5ENTD 2QZAA 4BERA 5D0OD 3HVEA 1P5QA 1WDYA 1INZA 1IQUA 2OOEA 2V8SE 3ZN3A 4JA7A 5C1DA 2VSNA 3U66A 3LDZA 1Q2ZA 5CEAA 1SQMA 4V3IA 1B89A 2J8SD 3L17A 4R7LA 2XHEA 3BG1B 3EHMA 1BI8B 3HXDA 3OTNA 2YQ8A 4D10C 3F6QA 4XZ4A 4ATZD 2IFUA 2P9PG 2LO6A 3LCAA 3EHNA 2OEVA 2R2LA 4BY6A 4I6JA 3QK0A 3ASDA 2VTBA 4IULA 3DSTA 2VGEA 4JVSA 1IXVA 4GMRA 1TN6A 4GTSA 2AWIA 3FULA 1GW6A 1E96B 1LD7A 4AY5A 1Z3YA 3ZU7B 2PNNA 4HNAD 2ONDA 3CQCB 3Q9NC 3B7UX 3V79K 2CHWA 2DCPA 4GYYA 3NQPA 4J8FA 1N4SA 4BX9A 4BETA 3RU0A 3J5PA 3UT8A 3ZIMA 3CR3A 1YA0A 1ELRA 2WB2A 4ILIA 4L9PA 4WUYA 3R9AB 3CHOA 3FH7A 2X6JA 3JCKC 3PZDA 1TNYA 3E30A 3ZYLA 3CGHA 5J90A 3MA5A 4GTVA 5JJTA 4U96D 2EQXA 4HOSA 3APCA 4HLLA 1N4PA 3B7SA 4NIKA 3MZLB 3VLDA 4YVQC 3I3NA 4RVBA 3VTYA 3HRAA 3SFZA 3SBTB 2E0IA 3LEWA 4DLOA 3NOGD 4G23A 3SF4A 3Q75A 2P9LG 1PC2A 4J8YA 4K5BA 2XEEA 3KAEA 5HKPA 2B0OE 4C9BB 2EILE 2X38A 4CZ2D 5ARGA 3JYSA 3B13A 4U0ZA 5G04J 3KEZA 4HI8A 3TJPA 4N2QA 3U4TA 4FA6A 3LVRE 3TWXA 4JC8A 3UUXA 5ENOD 2C0MA 3MV3B 4C0MA 3PZ4A 3B7BA 5AENA 5BV1A 1KT0A 2VGXB 3N71A 1JUQA 3FUNA 4E85A 3S7DA 2IEJA 3DPDA 3RO3A 1IHBA 1N52A 2DZNA 3E4BA 4G1TA 5FQ8A 3LKUA 2AJAA 3QC1A 2GGFA 5AN8A 2ZU6B 4N2SA 3B7RL 2NSZA 2HYZA 5HRYA 4ABNA 2UY1B 5EILA 4G25A 3Q7FA 5EYPF 4RSYA 4Z68A 3QWWA 2PM7A 5A7DB 2LAHA 3RRNB 5ENRD 1AWCB 4ACLA 1WAO1 1OCRE 2QC9A 3FDHA 4LG6A 3GZ1A 1MX2A 2YHCA 4HBDA 5C2YA 1V54E 3W9GA 1ZU2A 3KD7A 2V4LA 2RG8A 3E37A 3FUFA 5ENQD 2IOLA 3AS8A 1V55E 3PUKA 5CBNA 3AG2E 2XRZA 4XKCA 4NURA 2J49A 3HXBA 4BX8A 1N0RA 2EIKE 3Q78A 3SBSA 1DVPA 5JMND 3S7FA 4PS7A 4JPSA 4LSZE 4TRQA 2J4BA 3ESKA 5JHAA 4HRLA 3CK9A 3FEYA 2VQ2A 1JCRA 4X8QA 1UW4B 3L13A 2GRMA 3ASFA 4LERA 4KMOA 1EDUA 3IHVA 1FVHA 3T5XA 4BSXA 5CRVA 5KJLA 3B95A 4U0SA 4GPMA 5D2MC 5E75A 5CBOA 4AY6A 4B8AA 4G2VA 4H7XA 3FUMA 2X6KA 2X6IA 2R5SA 2F0YA 1JCQA 2HR2A 4HI9A 1E90A 4NQ0A 1E8ZA 2VSXE 5KJMA 4CT0A 4JXTA 3MX3A 3RRUA 2WM9A 1BU9A 1BPOA 2KBXA 2P9NG 4BFRA 2DBAA 3E34A 3DSSA 3QJZA 2FBNA 1NI1A 3V2XA 2X6FA 3ZKJA 5BXUA 5T4YA 3EHRA 3BU8A 4RQIA 4BSZB 5BV0A 1DCQA 3IHYA 2I2OA 3FTYA 4ANXA 1OCZE 5LCWC 4ANWA 2B6CA 1LF8A 3E32A 2V5FA 4OVUA 5AYWD 1O1TA 4WWOA 2DYRE 3DSWA 1UN8A 3CVPA 5D66A 4AXHA 3LYAA 1OWMA 2CHZA 4O1OA 4APFA 2XPYA 3L9TA 4KZ0A 3IKOB 4J7WA 2Y3AA 2HE0A 4I6EA 3DSUA 2PQNA 3FY4A 1H2VC 2IU1A 3CQGB 2BF0X 4A55A 3LJ3A 3I5PA 3QWPA 3CEQA 1DNPA 2BKGA 4GZCA 1HH8A 3WXXA 2C2LA 1OCCE 4WNGA 2J9QA 3NBNB 1TYQG 3QOUA 1UJJA 1U2VG 4N5CA 1MZCA 5FQ4A 3ASGA 4EZJA 4GA1A 5FTPA 4IN3B 5BW8C 4DLQA 1SA4A 3I4RB 3PEVB 4HRMB 1HFAA 4LEUA 2R03A 3C3RA 3K9IA 3TXMA 3NZUA 2XS8A 3ASNE 3EIQC 3UKUG 3KSQA 4HFGA 1UJKA 3ASHA 3W9FA 1E8XA 1N95A 3OXLA 4UWGA 2H6FA 4AJWA 3MJWA 3PZ2A 5AIJA 1EF1C 1DCEA 3DSVA 4ILHB 4U8VD 2WQ6A 1D9SA 1AP7A 2IO2C 5JHBA 3RSEG 1DC2A 3ENEA 4G24A 1VDYA 3PNTB 3FU5A 2R05A 2LUHA 4A3VA 4UWHA 3ZPJA 3UM0A 4LNUD 2WPVA 2JEKA 3G2VA 4UI9K 4DRXE 4EPZA 3TG5A 4AP2A 3RKVA 3RO2A 1W3BA 1Y8MA 4GTTA 1OWOA 4TUMA 5DBKA 5AQBA 2J08A 1N0QA 4I43A 1E7UA 2P9KG 3AJIA 3G2TA 3CVYA 4DX6D 5KCMA 4BT8A 2KC7A 3JUEA 2LXLA 3FU6A 2EIJE 4HOQA 4URKA 3PZ3A 3CVXA 3NZSA 5CCMA 2Y0BG 4Q96A 3CVVA 4N5QA 4U0UA 5G55A 1EYHA 2GROB 3EDTB 5KJNA 2X3MA 4M3OA 3MEKA 3GZSA 2GRNB 2Y1LE 3L16A 2M63A 4FLBA 2QY7A 5ARFA 5ANLA 4OAUC 1H0AA 3UM3A 1S64A 2KCVA 3ZW3A 3RK6A 2I1JA 3UI2A 4GA2A 2GRRB 3DWLG 5G2NA 4F6RD 3L08A 2WXPA 3CKCA 2OVFA 2XGOA 3FU0A 2UY1A 2IONA 3PEUB 2AXVA 3JUIA 4J8EA 1MX6A 3D9IA 2WQ7A 1OWLA 2AW6A 1EPUA 3PDNA 3FTWA 4GB9A 3Q73A 4GMJA 1HXIA 1WM5A 2KZTB 1X5BA 4FULA 4CCAA 1NFIE 3UQ3A 5HS0A 4DPRA 4B8CB 4UI9J 1ELWA 5AJDA 3QB2A 1X81A 5HQ8A 4Y6CA 4A63B 5DIZA 3R7QA 3PE3A 4N3CA 3FEXA 2WXLA 4HXIA 1N11A 4U04A 1HX8A 1Z5SC 3V2OA 1IKND 2DYSE 4Q94A 3ZYQA 4CDMA 1NA3A 3UMVA 5FJYA 4JHRA 4UUCA 4F53A 5CMWA 3DEOA 1H6PA 4YDYA 2R02A 2V0PA 2WVIA 4CT4A 2A5UA 3Q79A 4RLYA 5CCLA 4UWLA 3CVNA 3ZHEB 3URZA 1HO8A 4WNDA 2FF4A 3CKBA 4L23A 3HYMB 4J0UA 3V30A 5KJKA 3L22A 3LY8A 4EECA 1IYGA 1H6KA 1YMPA 1UG3A 3G2SA 1K1BA 4PS3A 1E8WA 1TN7A 4CDRA 2ETAA 1TJFA 3IEGA 4GZ5A 4GAAA 3ULYA 2FO1E 4KYOB 1S0PA 1HE8A 3MV2B 3HVEB 1N9AA 2KXPC 3ESLA 1K1AA 4EBAG 3G2WA 4ILGA 2WXFA 4FHKA 4WNFA 2BEDA 3KS2A 2R17C 3D9HA 4OVVA 1D8DA 2YINA 3D3MA 2XPIA 4WAFA 4JL0A 1QBQA 1TNUA 3SFXA 3DSXA 4I1OB 4OYSA 5EIBE 3ONKA 2H6GA 2XZTG 3D9PA 3FTZA 5LFAA 3R9MA 2VTBB 2WMNA 4JA9A 3JQ1A 4E6HA 4UWKA 4L7TA 3RAUA 3HHMA 2VSYA 3EUVA 1TJCA 4JD2G 4CEMA 5CRUA 3ULQA 4JZYA 5EX0A 4W9RA 3JXJA 3VTXA 3I4GA 2A5EA 4XIFA 1KT1A 5LOZA 4GTQA 1MX4A 3CHPA 3HIZA 4JHJA 3DEPA 4DX7D 2PQRA 2MYOA 5G04C 3RRMB 3JQ0A 2XEHA 4GTPA 3AG1E 2BTDA 3BUAA 5FZSA 1PY1A 3APDA 2AXUA 4Q69A 2KATA 1OY3D 1UOHA 3TWVA 1E8YA 4AM9A 4FP7A 2RFMA 4CRWA 4UQYA 3AS4A 1XNFA 2DWZA 4XEIG 2MOWA 2JABA 3UINC 1WY6A 3S7JA 3UIOC 2RD0A 3MKQA 3HXEA 4CYMD 1KZPA 2J4DA 3CK8A 3PE4A 2WXRA 4QQIA 2QYJA 1YCSB 5FIOA 3KSLA 2JLBA 3LJNA 3FUHA 3T9KA 2VSOE 2OEWA 4J8SA 4F1SA 1H19A 3RJVA 2MHKA 2LAIA 4I2ZA 4KBQA 1HG5A 4U8HA 2DZOA 3O48A 4HOUA 3ZXPA 2PL2A 4GTMA 4B93B 3LVQE 4U07A 1FT1A 4PDXA 4XI0A 3ULEG 4LNBA 3ZVVA 4O60A 1HS6A 4ME2A 3EIJA 3C3OA 3ML8A 2KM4A 1Y6IA 2P9UG 1JCSA 5ENNA 4ZFHA 1SZ9A 4LNGA 4HB5A 4A1SA 4GTOA 1O1SA 1ELKA 3CVUA 4J6IA 3SHFA 3AAAC 4KVMA 3VLEA 4C48B 4F7AA 1N54A 5AQ7A 2AVPA 3SZ7A 2HO1A 2LSUA 3PRZA 2V4HC 4Y6WA 1Z6TA 4U8YD 3TAXA 2KZTA 5LP0A 5EYLA 3R7RA 3E33A 4J8DA 2CG2A 3L82A 4CDNA 4UWFA 4XE0A 3SNXA 4TV3A 2XENA 2XZDG 3UPVA 3CLJA 4U63A 1MQSA 3DXKG 4GTRA 3NF1A 2EINE 3SQVA 3DBSA 5EN5D 3LS8A 2ILRA 1MYOA 3CHQA 3PVLA 4FADA 4LUNU 4I17A 4LCTA 5FWQA 3IXEA 2X6HA 2GW1A 4JHKA 1KLXA 4APOA 3P2BA 3OXGA 1JWFA 3LY9A 2P2CP 3C72A 3PH0C 4DX5D 5AJLA 1H6OA 1MJ0A 2L6BA 3ML9A 2KCKA 4HORA 5KNHD 5FZRA 3D9KA 3TWQA 1SVXA 3MCXA 4QFVA 3HXCA 5CEDB 2VYIA 1YYHA 1K3ZD 4XKBA 3FTUA 2P9IG 5KBAA 4GPKA 3Q15A 4U7EB 4N3AA 4MLPA 3ZHEA 4GCNA 4YDEA 5ITZF 5EDSA 4N39A 4RG6A 3NB2A 4L2LA 2XQ0A 1TN8A 3BEEA 3C3QA 3SD5A 1JWGA 5JA4D 1OT8A 2YHEA 4MS6A 5AARA 3S2AA 2L0IA 3DXMG 5FZQA 2XS1A 3B7TA 1FVFA 4DX2A 3CSFA 3GW4A 4IRUA 3UM1A 4KT6B 2Y4TA 5AQ9A 1FT2A 3PNLB 2L9BA 4F1PA 3SGHA 1S70B 4FHJA 2MRIA 3OXFA 2CHXA 4U95D 1G3NB 4C0EA 2VGXA 1OWNA 5B1BE 3T5VA 3CSTA 2IJGX 5H7PA 3CVQA 4G11A 2Y69E 4FJYA 2HM8A 3FH8A 1H2UA 2FULA 2WMOA 3UT7A 2GRPB 2XGSA 2RFAA 4I9CA 4GU5A 3CHSA 4F3VA 4K5AB 4L1BA 5AAOA 4M7CA 3P1UA 3MKRA 5ENSD 4BT9A 4HOTA 4NACA 2ZGGA 2WXGA 2L6JA 3FH5A 1E7VA 1HF8A 1LTXA 3SFYA 3EHQA 3MYVA 3L54A 2KCLA 2LXMA 3ISMC 3FFLA 2I6HA 2ZISA 1K8KG 2XCBA 5A23A 1NP7A 4JEUA 5LX8A 1TNOA 1Z3XA 4K5CA 4I9EA 4TUUA 5FT9A 1N4RA 1QYMA 3O4ZA 3QKYA 4GZ6A 4ANUA 3KEAA 2IOSA 2QYUA 2PZIA 4ZHBA 4PH4B 2XCCA 5G05J 4YDOA 1SZAA 3CVLA 2RKKA 3Q5MA 4DJAA 5BPPA 4JW1A 3PREA 3Q4AB 1TR4A 5CECB 5JJ7A 3FTXA 2NC9A 3TL5A 4I1MA 3ZNGA 3IBEA 4NRHB 2I9CA 1XGWA 1N4QA 2OVBA 4RG9A 3D9MA 4WNEA 5BNWA 3APFA 4DUIA 1OXJA 4BTBA 1L5JA 4G8KA 4YNDA 2H6HA 1S63A 2CG3A 3GYZA 3G2UA 1OUVA 3OAWA 2H6IA 1ZBPA 3Q49B 3D9JA 3EJNA 3UM2A 3VLFA 2Q7FA 2WXOA 1JPLA 4MRUA 3DRAA 3AG4E 2WXIA 3TWWA 3TG4A 2F8XK 3SI5A 2EIME 3U64A 2FEZA 3U9WA 1HG2A 2DIWA 5KNGA 4GZDA 2J09A 3FU3A 2WQHA 3ZRHA 4XI9A 4HS2A 3AU5A 3NOCD 3BQOA 2L0TB 4I6GA 2NYJA 4GYOA 4L2YA 1PAQA 4UI9C 1TEZA 3FUIA 2XPZA 4EQFA 3ZFWA 3FTSA 5IY5E 2ZXWE 4FLHA 4GYWA 3TXNA 1D8EA 4N3BA 4ACKA 2GRQB 2VJ8A 2IF4A 3DPYA 5G05C 4JEHA 1FPPA 3Q47B 3HDXA 1H2TC 5BT1A 4PS8A 5J08A 1IQRA 1RZ4A 1KZOA 2XGMA 3UKRG 4EBAA 5FINA 4DI3A 3HG0D 3WG7E 3TWSA 3U3WA 3Q9UC 3S7BA 4YDWA 3T8MA 2P9SG 2ETBA 3ZUVB 3CHMA 3D9OA 5B3SE 1RW2A 4EZLA 1MHQA 5E76A 3QARA 1LD8A 1SA5A 5AQAA 3V31A 4B94A 4O1PA 3FUJA 1QQEA 3JXIA 5LCWJ 2DVWA 4BESA 3QAQA 4P29A 5EX3A 4WWPA 2Y4UA 3ZYMA 2I1KA 1BD8A 4GZ3A 3AG3E 3FWVA 2F37A 2ZIRA 4FJZA 2FO7A 4HVBA 3CV0A 4I2WA 4A3TA 4TXQA 5T8IA 3TWRA 4HQDA 4TXRA 4EHMA 2PM6A 5A6CA 4AVXA 4GA0A 2WXHA 1FCHA 5BXOA 3CVWA 2WXMA 4ANVA 1A5EA 3QWVA 4O6FA 5ANRA 4DI4A 3FUKA 1U3DA 4EZKA 3ZEFA 3LXUX 5B1AE 2C0LA 3EU5A 2CFZA 4BTAA 2GRLA 4K0RA 5CERB 5JJ6A 3PS6A 1N94A 2WXNA 1UN9A 3IV0A 4B89A 4CGVA 2QFCA 2WXJA 1U3CA 3TWTA 3SO8A 4I1AA 3QNKA 4GCOA 2AXZA 2A4ZA 4LRZA 3PUJA 4FU3A 2LNIA 4KVOA 1HU3A 4GMLA 3ZXSA 3CHRA 1SW6A 1O1RA 1TNZA 2OCCE 4G8LA 1NA0A 1IHGA 3BG0B 4HLEA 1WG0A 2BKKB 3ZYKA 3NAWA 4JB8P 5FQ6A 2P58C 3UTMA 2XEVA 2E2EA 5FQ7A
chains in the Genus database with same CATH topology
3FDHA 4MS6A 4Q94A 3GZ1A 4A1GA 3ZYQA 2YHCA 3S2AA 1NA3A 2L0IA 4CDMA 3UMVA 5BUZA 5FZQA 5FJYA 5C2YA 4JHRA 4AIFA 3B7TA 4IYPA 1FVFA 1ZU2A 2V4LA 2RG8A 3KD7A 4F53A 3CSFA 3FUFA 3GW4A 2IOLA 3GZ2A 4IRUA 5CMWA 4KT6B 4G26A 5CHEE 2Y4TA 3AS8A 3PUKA 3LPZA 3PNLB 2L9BA 2V0PA 2WVIA 4CT4A 2LSVA 2WXKA 3ONLA 2A5UA 5CCLA 2XRZA 4XKCA 3SGHA 4UWLA 4FHJA 2BUGA 4NURA 2J49A 2MRIA 4BX8A 3OXFA 2CHXA 3C98A 3CVNA 3SBSA 3ZHEB 1DVPA 3URZA 3FHEA 4H7YA 4C0EA 2VGXA 4YVOA 1HO8A 4KZCA 1HZ4A 1OWNA 2FF4A 3CKBA 4L23A 3HYMB 4WNDA 3T5VA 3S7FA 4J0UA 4PS7A 4JPSA 4AOFA 4TRQA 3CSTA 2J4BA 2IJGX 4CGWA 3UT4A 3CVQA 3ESKA 4AEZC 4G11A 2FI7A 5JHAA 5KJKA 3L22A 3LY8A 3CK9A 4FJYA 4EECA 1IYGA 2HM8A 3FEYA 4BWRA 1H6KA 2VQ2A 3FH8A 1H2UA 2FULA 1UG3A 3UX4A 2WMOA 2XRYA 3UT7A 3G2SA 1UW4B 2XGSA 3L13A 4I9CA 4AV7A 2GRMA 4GU5A 2OV8A 3ASFA 3CHSA 4PS3A 5HI7A 4F3VA 2J07A 4LERA 1E8WA 4KMOA 3L6AA 1EDUA 3IHVA 1FVHA 4L1BA 4UQZA 3T5XA 4CDRA 4BSXA 3P1UA 1NZNA 3MKRA 5KJLA 4BT9A 2YNQA 1TJFA 4HOTA 3IEGA 4GZ5A 4GAAA 4KXKB 4NACA 4U0SA 2WXGA 2L6JA 5EKQD 3FH5A 1OWPA 4KYOB 1E7VA 5E75A 1S0PA 1HF8A 4B8AA 4AY6A 3FUDA 1HE8A 3MYVA 4G2VA 3L54A 3MV2B 3HVEB 3FUMA 4H7XA 2KCLA 2X6KA 2X6IA 2R5SA 2HR2A 3FFLA 2I6HA 1E90A 4NQ0A 5M72A 1E8ZA 2XCBA 5A23A 1NP7A 3TGOA 1QZ2A 2VSXE 4JEUA 3LY7A 3ESLA 5KJMA 5CMYA 4ATGA 5LX8A 4CT0A 4JXTA 4EBAG 1Z3XA 3CK7A 3MX3A 3G2WA 2WM9A 3RRUA 4ILGA 1BPOA 2WXFA 4I9EA 4TUUA 5FT9A 2DBAA 4FHKA 3D9NA 4BFRA 4WNFA 3KS2A 3O4ZA 3QKYA 2R17C 2FBNA 3QJZA 4OVVA 4GZ6A 4ANUA 2YINA 2IOSA 3D3MA 2CFUA 2PZIA 2X6FA 2XPIA 4FC8A 1QNFA 5D0QD 5T4YA 3FUEA 4UQXA 3FTVA 3MGBA 4WAFA 4JL0A 4PH4B 5BV0A 2XCCA 2UWJG 3IHYA 2I2OA 4XX5A 3FP3A 5G05J 4I1OB 1SZAA 3CVLA 3FTYA 4OYSA 2NXPA 3Q5MA 4ANXA 4DJAA 3D9LA 4WWNA 5BPPA 4JW1A 4ANWA 5LCWC 3CIAA 2R59A 2WXQA 3ONKA 1LF8A 2V5FA 3PREA 4OVUA 3Q4AB 3D9PA 3FTZA 5T3RA 5LFAA 3QDNA 5JJ7A 5AYWD 3MKQB 2VTBB 3FTXA 2NC9A 3TL5A 4I1MA 2WMNA 3AU4A 4JA9A 3JQ1A 4WWOA 4E6HA 4DK5A 4UWKA 3IBEA 1UN8A 4L7TA 3CVPA 3RIBA 4B0ZA 4PUCA 4NRHB 3HHMA 4AXHA 2VSYA 2I9CA 3LYAA 1A17A 1TJCA 1XGWA 1OWMA 4K03A 4MKTA 2CHZA 4CEMA 4APFA 3ZGQA 2OVBA 4RG9A 4CRWA 2XPYA 3ULQA 2VGYA 3AS5A 4JZYA 3IKOB 4KZ0A 5EX0A 2Y3AA 3D9MA 4WNEA 5BNWA 2IQCA 3APFA 4W9RA 4I6EA 4BTBA 5D0OD 1L5JA 4YNDA 2PQNA 3VTXA 3FY4A 3I4GA 4XIFA 1KT1A 3HVEA 5LOZA 1H2VC 2IU1A 1P5QA 3CHPA 1INZA 1IQUA 2CG3A 3CQGB 3HIZA 2BF0X 2OOEA 2V8SE 3G2UA 3GYZA 4JA7A 3ZN3A 4JHJA 1OUVA 5C1DA 2VSNA 4A55A 2PQRA 3OAWA 3U66A 3LJ3A 3I5PA 5G04C 3RRMB 1ZBPA 3JQ0A 3D9JA 3EJNA 3Q49B 3QWPA 3VLFA 2Q7FA 3LDZA 2WXOA 1DNPA 1JPLA 1SQMA 3CEQA 4MRUA 4V3IA 1B89A 4GZCA 2BTDA 5FZSA 1HH8A 3L17A 4R7LA 2XHEA 3BG1B 3WXXA 2C2LA 2WXIA 3TG4A 3SI5A 4WNGA 1PY1A 3EHMA 2J9QA 3U64A 3APDA 2AXUA 2FEZA 3OTNA 4Q69A 2YQ8A 3U9WA 2KATA 3QOUA 1UJJA 1HG2A 2DIWA 4N5CA 4D10C 4XZ4A 1E8YA 5FQ4A 3ASGA 4EZJA 4AM9A 4FP7A 2IFUA 4GA1A 2LO6A 4GZDA 3AS4A 4UQYA 1XNFA 2J09A 3EHNA 3LCAA 2MOWA 3FU3A 4IN3B 5FTPA 4I6JA 2WQHA 5BW8C 4BY6A 4DLQA 3ZRHA 4XI9A 1WY6A 3S7JA 4HS2A 3AU5A 3I4RB 3PEVB 1HFAA 3QK0A 4LEUA 3ASDA 3K9IA 2RD0A 2L0TB 3MKQA 4I6GA 3TXMA 2VTBA 3NZUA 4IULA 4JVSA 4GYOA 4L2YA 3EIQC 1PAQA 2J4DA 3CK8A 4UI9C 1TEZA 2AWIA 3FULA 4HFGA 1GW6A 1E96B 1UJKA 3FUIA 2XPZA 4EQFA 3ASHA 3PE4A 2WXRA 1E8XA 3FTSA 1Z3YA 3ZFWA 4AY5A 3OXLA 4UWGA 4FLHA 4AJWA 4GYWA 3MJWA 3TXNA 2ONDA 3CQCB 4N3BA 5AIJA 1EF1C 4ACKA 2VJ8A 2IF4A 2JLBA 5G05C 4ILHB 3B7UX 3FUHA 4JEHA 2WQ6A 2CHWA 2VSOE 3Q47B 2DCPA 3HDXA 4GYYA 1H2TC 5JHBA 3NQPA 4J8FA 3ENEA 4BX9A 5BT1A 4J8SA 4G24A 4PS8A 4F1SA 1VDYA 3PNTB 3FU5A 3RU0A 5J08A 1IQRA 1H19A 3RJVA 2MHKA 2LAIA 4I2ZA 3UT8A 3ZIMA 3CR3A 2XGMA 4A3VA 4KBQA 4EBAA 4DI3A 1YA0A 1HG5A 4UWHA 3ZPJA 4U8HA 3O48A 4HOUA 3U3WA 2WPVA 1ELRA 2PL2A 3S7BA 2WB2A 2JEKA 3T8MA 4ILIA 4WUYA 3CHMA 3D9OA 3R9AB 3LVQE 3G2VA 4U07A 4PDXA 4UI9K 4XI0A 4EPZA 3TG5A 4AP2A 3CHOA 4EZLA 3FH7A 1MHQA 5E76A 3RKVA 3QARA 3ZVVA 2X6JA 1HS6A 1W3BA 3JCKC 1Y8MA 4ME2A 3PZDA 3EIJA 3RO2A 1OWOA 4B94A 3ZYLA 3FUJA 3CGHA 5J90A 3ML8A 5DBKA 1QQEA 2KM4A 1Y6IA 2J08A 3MA5A 4I43A 5JJTA 1E7UA 5LCWJ 5ENNA 1SZ9A 2EQXA 4HOSA 4A1SA 3APCA 3G2TA 3QAQA 3CVYA 4P29A 5EX3A 4WWPA 5KCMA 4BT8A 3B7SA 2Y4UA 3ZYMA 1ELKA 2I1KA 4GZ3A 3CVUA 2KC7A 4J6IA 3FWVA 3MZLB 3SHFA 4KVMA 3VLDA 3FU6A 3I3NA 4YVQC 4RVBA 3VTYA 4HOQA 3VLEA 4URKA 4F7AA 4FJZA 3CVXA 2FO7A 1N54A 3NZSA 4HVBA 2AVPA 5CCMA 3CV0A 4Q96A 3SZ7A 3CVVA 3SFZA 2HO1A 4I2WA 2LSUA 4A3TA 3PRZA 4U0UA 5G55A 2E0IA 3SBTB 5T8IA 3LEWA 4Y6WA 1EYHA 3EDTB 4DLOA 5KJNA 4G23A 1Z6TA 2X3MA 2PM6A 5A6CA 3TAXA 2KZTA 3SF4A 4M3OA 4AVXA 5LP0A 4GA0A 2WXHA 1FCHA 3R7RA 3MEKA 3CVWA 1PC2A 2WXMA 4J8DA 3GZSA 2CG2A 4ANVA 3KAEA 3QWVA 4O6FA 3L16A 5ANRA 2M63A 4CDNA 4DI4A 4UWFA 3FUKA 4FLBA 4XE0A 2QY7A 4TV3A 1U3DA 5ARFA 3SNXA 4EZKA 4C9BB 3UPVA 3ZEFA 2X38A 5ANLA 5ARGA 1H0AA 3CLJA 1MQSA 2C0LA 3B13A 3JYSA 3LXUX 4U63A 2KCVA 3NF1A 4U0ZA 5G04J 3ZW3A 2CFZA 3RK6A 2I1JA 3DBSA 3KEZA 4GA2A 5G2NA 3LS8A 3TJPA 4BTAA 2ILRA 4N2QA 3L08A 2GRLA 3U4TA 2WXPA 4K0RA 3LVRE 3CKCA 3CHQA 4JC8A 3PS6A 5JJ6A 3UUXA 4FA6A 2OVFA 2XGOA 3FU0A 3PVLA 2WXNA 4FADA 1UN9A 2UY1A 3IV0A 4B89A 4LUNU 4CGVA 2IONA 4I17A 4LCTA 2QFCA 3PEUB 2AXVA 3JUIA 5FWQA 2WXJA 1U3CA 2C0MA 2X6HA 2GW1A 3MV3B 4JHKA 4C0MA 4J8EA 1KLXA 4APOA 3D9IA 2WQ7A 1OWLA 2AW6A 5AENA 1EPUA 4I1AA 3PDNA 3FTWA 5BV1A 3QNKA 4GB9A 1KT0A 4GCOA 2VGXB 3P2BA 3OXGA 1JWFA 2AXZA 3LY9A 3N71A 4GMJA 1HXIA 1WM5A 1JUQA 2KZTB 2A4ZA 3PH0C 1X5BA 5AJLA 4LRZA 4FULA 3PUJA 3FUNA 4E85A 3ML9A 3S7DA 3DPDA 2KCKA 4FU3A 3RO3A 4CCAA 4HORA 2LNIA 4KVOA 1HU3A 5FZRA 3D9KA 1N52A 3MCXA 3E4BA 4QFVA 3UQ3A 4G1TA 5FQ8A 3LKUA 2VYIA 4DPRA 4GMLA 3ZXSA 4B8CB 3CHRA 4UI9J 1ELWA 3QC1A 3FTUA 4XKBA 5AJDA 3QB2A 2GGFA 4GPKA 5HQ8A 4Y6CA 2ZU6B 4N2SA 3Q15A 4N3AA 4MLPA 3B7RL 5DIZA 3ZHEA 4GCNA 1NA0A 2NSZA 3R7QA 2HYZA 3PE3A 4N3CA 4ABNA 1IHGA 3BG0B 4HLEA 3FEXA 2WXLA 3ZYKA 2UY1B 4HXIA 4G25A 5EDSA 4N39A 4RG6A 4RSYA 4U04A 5FQ6A 3QWWA 2P58C 4L2LA 2XQ0A 1HX8A 3BEEA 2XEVA 2PM7A 5A7DB 2E2EA 2LAHA 5FQ7A 3RRNB 3SD5A 1JWGA 2YHEA 4ACLA 1WAO1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZ1 A;  2YHC A;  1NA3 A;  5FZQ A;  5FJY A;  4JHR A;  4AIF A;  1ZU2 A;  3KD7 A;  3GW4 A;  3GZ2 A;  4G26 A;  5CHE E;  2Y4T A;  3AS8 A;  3LPZ A;  2LSV A;  5CCL A;  2BUG A;  3OXF A;  3CVN A;  3ZHE B;  3URZ A;  4H7Y A;  2VGX A;  4YVO A;  4WND A;  1HZ4 A;  2FF4 A;  3CKB A;  3HYM B;  3S7F A;  4J0U A;  4CGW A;  3CVQ A;  3ESK A;  2FI7 A;  5KJK A;  3LY8 A;  3CK9 A;  1IYG A;  4BWR A;  2VQ2 A;  2XGS A;  4I9C A;  3ASF A;  5HI7 A;  4F3V A;  4UQZ A;  4CDR A;  1NZN A;  3MKR A;  5KJL A;  4BT9 A;  4HOT A;  3IEG A;  4GZ5 A;  4KXK B;  4U0S A;  2L6J A;  5EKQ D;  4KYO B;  4AY6 A;  4G2V A;  3MV2 B;  4H7X A;  2KCL A;  2R5S A;  2HR2 A;  3FFL A;  2I6H A;  4NQ0 A;  5M72 A;  2XCB A;  3TGO A;  1QZ2 A;  5KJM A;  3LY7 A;  3CK7 A;  4I9E A;  5FT9 A;  2DBA A;  4WNF A;  3KS2 A;  3QKY A;  2FBN A;  4GZ6 A;  2PZI A;  2XPI A;  5D0Q D;  4UQX A;  4JL0 A;  2XCC A;  2UWJ G;  3FP3 A;  5G05 J;  3CVL A;  3Q5M A;  5LCW C;  2V5F A;  3Q4A B;  3QDN A;  5JJ7 A;  5AYW D;  2NC9 A;  4JA9 A;  3CVP A;  3RIB A;  4NRH B;  2VSY A;  3LYA A;  1A17 A;  1TJC A;  3ZGQ A;  4RG9 A;  3ULQ A;  2VGY A;  3AS5 A;  5EX0 A;  4WNE A;  5BNW A;  4W9R A;  4BTB A;  5D0O D;  3VTX A;  4YND A;  2PQN A;  4XIF A;  1KT1 A;  1P5Q A;  2OOE A;  3GYZ A;  3ZN3 A;  4JA7 A;  1OUV A;  5C1D A;  2VSN A;  2PQR A;  5G04 C;  1ZBP A;  3Q49 B;  3QWP A;  2Q7F A;  3CEQ A;  1B89 A;  5FZS A;  1HH8 A;  3WXX A;  2C2L A;  3TG4 A;  4WNG A;  2J9Q A;  2FEZ A;  2YQ8 A;  2KAT A;  3QOU A;  4N5C A;  3ASG A;  4AM9 A;  2IFU A;  4GA1 A;  3AS4 A;  4UQY A;  1XNF A;  3LCA A;  4IN3 B;  5FTP A;  5BW8 C;  2WQH A;  4XI9 A;  3S7J A;  4LEU A;  3ASD A;  3K9I A;  4GYO A;  3CK8 A;  4UI9 C;  1E96 B;  4EQF A;  3ASH A;  3PE4 A;  3ZFW A;  4AY5 A;  3OXL A;  4GYW A;  2OND A;  4N3B A;  2IF4 A;  2JLB A;  5G05 C;  3Q47 B;  4GYY A;  4J8F A;  5BT1 A;  4G24 A;  3RU0 A;  3RJV A;  2MHK A;  4I2Z A;  2XGM A;  4KBQ A;  1YA0 A;  3ZPJ A;  3O48 A;  4HOU A;  3U3W A;  2WPV A;  1ELR A;  2PL2 A;  3S7B A;  4WUY A;  3R9A B;  4U07 A;  4UI9 K;  4XI0 A;  3TG5 A;  3RKV A;  3RO2 A;  1W3B A;  1Y8M A;  4ME2 A;  4B94 A;  5DBK A;  1QQE A;  3MA5 A;  5JJT A;  5LCW J;  4HOS A;  4A1S A;  5EX3 A;  4BT8 A;  2Y4U A;  4GZ3 A;  2KC7 A;  3FWV A;  4YVQ C;  3VTY A;  4HOQ A;  2FO7 A;  2AVP A;  5CCM A;  3CV0 A;  3SZ7 A;  2HO1 A;  4I2W A;  2LSU A;  4U0U A;  4Y6W A;  3EDT B;  5KJN A;  4G23 A;  5A6C A;  3TAX A;  3SF4 A;  4GA0 A;  1FCH A;  3MEK A;  1PC2 A;  4J8D A;  3KAE A;  3QWV A;  4O6F A;  5ARF A;  3UPV A;  5ARG A;  3JYS A;  2C0L A;  2KCV A;  3NF1 A;  4U0Z A;  5G04 J;  4GA2 A;  4BTA A;  4N2Q A;  3U4T A;  3CKC A;  5JJ6 A;  3UUX A;  2XGO A;  2UY1 A;  4CGV A;  4I17 A;  2QFC A;  2C0M A;  2GW1 A;  3MV3 B;  4J8E A;  1KLX A;  4APO A;  4I1A A;  3PDN A;  1KT0 A;  4GCO A;  2VGX B;  3OXG A;  3LY9 A;  3N71 A;  1HXI A;  1WM5 A;  3S7D A;  3RO3 A;  2KCK A;  4HOR A;  2LNI A;  5FZR A;  3E4B A;  3UQ3 A;  4G1T A;  3LKU A;  2VYI A;  4UI9 J;  1ELW A;  4GPK A;  5HQ8 A;  4Y6C A;  4N2S A;  3Q15 A;  4N3A A;  5DIZ A;  3ZHE A;  4GCN A;  1NA0 A;  2HYZ A;  3PE3 A;  4N3C A;  4ABN A;  1IHG A;  2UY1 B;  4G25 A;  4N39 A;  4RG6 A;  4U04 A;  3QWW A;  2P58 C;  3BEE A;  2XEV A;  5A7D B;  2E2E A;  1WAO 1; 
#chains in the Genus database with same CATH topology
 3SY2 A;  4A1G A;  4DX1 A;  5BUZ A;  1OCO E;  4AIF A;  3TWU A;  4IYP A;  4BEP A;  1BI7 B;  3GZ2 A;  4HRN A;  4G26 A;  5CHE E;  1KPS B;  3LPZ A;  4OAV B;  3T8K A;  2LSV A;  2WXK A;  3ONL A;  2BUG A;  3ABK E;  3C98 A;  3FHE A;  4H7Y A;  4YVO A;  4KZC A;  1HZ4 A;  1TNB A;  5EID A;  4AOF A;  4CGW A;  3UT4 A;  4AEZ C;  2FI7 A;  2IO3 C;  4BWR A;  3UX4 A;  3PZ1 A;  2XRY A;  3ASO E;  3UXG A;  4AV7 A;  3UIP C;  3J5Q B;  2OV8 A;  5HI7 A;  2J07 A;  3L6A A;  3Q7A A;  4UQZ A;  1NZN A;  1O5M A;  2YNQ A;  4TXP A;  4KXK B;  5EKQ D;  1OWP A;  5ENP D;  3FUD A;  1ZB1 A;  5M72 A;  3ABM E;  3TGO A;  1QZ2 A;  3LY7 A;  5CMY A;  4ATG A;  3CK7 A;  3D9N A;  1NL4 A;  2CFU A;  3ABL E;  4FC8 A;  1QNF A;  5D0Q D;  3FUE A;  4MBG A;  4UQX A;  3FTV A;  3MGB A;  2UWJ G;  4XX5 A;  2V5Q C;  3FP3 A;  2NXP A;  3D9L A;  4WWN A;  3X2Q E;  3CIA A;  2R59 A;  2WXQ A;  5T3R A;  3QDN A;  2IY0 C;  3MKQ B;  3AU4 A;  4DK5 A;  2ETC A;  3RIB A;  4B0Z A;  4PUC A;  1A17 A;  4K03 A;  4MKT A;  3EU9 A;  3HXF A;  3ZGQ A;  2F8Y A;  3C5R A;  2VGY A;  3AS5 A;  2ZGD A;  1BLX B;  2IQC A;  5KWD A;  5ENT D;  2QZA A;  4BER A;  5D0O D;  3HVE A;  1P5Q A;  1WDY A;  1INZ A;  1IQU A;  2OOE A;  2V8S E;  3ZN3 A;  4JA7 A;  5C1D A;  2VSN A;  3U66 A;  3LDZ A;  1Q2Z A;  5CEA A;  1SQM A;  4V3I A;  1B89 A;  2J8S D;  3L17 A;  4R7L A;  2XHE A;  3BG1 B;  3EHM A;  1BI8 B;  3HXD A;  3OTN A;  2YQ8 A;  4D10 C;  3F6Q A;  4XZ4 A;  4ATZ D;  2IFU A;  2P9P G;  2LO6 A;  3LCA A;  3EHN A;  2OEV A;  2R2L A;  4BY6 A;  4I6J A;  3QK0 A;  3ASD A;  2VTB A;  4IUL A;  3DST A;  2VGE A;  4JVS A;  1IXV A;  4GMR A;  1TN6 A;  4GTS A;  2AWI A;  3FUL A;  1GW6 A;  1E96 B;  1LD7 A;  4AY5 A;  1Z3Y A;  3ZU7 B;  2PNN A;  4HNA D;  2OND A;  3CQC B;  3Q9N C;  3B7U X;  3V79 K;  2CHW A;  2DCP A;  4GYY A;  3NQP A;  4J8F A;  1N4S A;  4BX9 A;  4BET A;  3RU0 A;  3J5P A;  3UT8 A;  3ZIM A;  3CR3 A;  1YA0 A;  1ELR A;  2WB2 A;  4ILI A;  4L9P A;  4WUY A;  3R9A B;  3CHO A;  3FH7 A;  2X6J A;  3JCK C;  3PZD A;  1TNY A;  3E30 A;  3ZYL A;  3CGH A;  5J90 A;  3MA5 A;  4GTV A;  5JJT A;  4U96 D;  2EQX A;  4HOS A;  3APC A;  4HLL A;  1N4P A;  3B7S A;  4NIK A;  3MZL B;  3VLD A;  4YVQ C;  3I3N A;  4RVB A;  3VTY A;  3HRA A;  3SFZ A;  3SBT B;  2E0I A;  3LEW A;  4DLO A;  3NOG D;  4G23 A;  3SF4 A;  3Q75 A;  2P9L G;  1PC2 A;  4J8Y A;  4K5B A;  2XEE A;  3KAE A;  5HKP A;  2B0O E;  4C9B B;  2EIL E;  2X38 A;  4CZ2 D;  5ARG A;  3JYS A;  3B13 A;  4U0Z A;  5G04 J;  3KEZ A;  4HI8 A;  3TJP A;  4N2Q A;  3U4T A;  4FA6 A;  3LVR E;  3TWX A;  4JC8 A;  3UUX A;  5ENO D;  2C0M A;  3MV3 B;  4C0M A;  3PZ4 A;  3B7B A;  5AEN A;  5BV1 A;  1KT0 A;  2VGX B;  3N71 A;  1JUQ A;  3FUN A;  4E85 A;  3S7D A;  2IEJ A;  3DPD A;  3RO3 A;  1IHB A;  1N52 A;  2DZN A;  3E4B A;  4G1T A;  5FQ8 A;  3LKU A;  2AJA A;  3QC1 A;  2GGF A;  5AN8 A;  2ZU6 B;  4N2S A;  3B7R L;  2NSZ A;  2HYZ A;  5HRY A;  4ABN A;  2UY1 B;  5EIL A;  4G25 A;  3Q7F A;  5EYP F;  4RSY A;  4Z68 A;  3QWW A;  2PM7 A;  5A7D B;  2LAH A;  3RRN B;  5ENR D;  1AWC B;  4ACL A;  1WAO 1;  1OCR E;  2QC9 A;  3FDH A;  4LG6 A;  3GZ1 A;  1MX2 A;  2YHC A;  4HBD A;  5C2Y A;  1V54 E;  3W9G A;  1ZU2 A;  3KD7 A;  2V4L A;  2RG8 A;  3E37 A;  3FUF A;  5ENQ D;  2IOL A;  3AS8 A;  1V55 E;  3PUK A;  5CBN A;  3AG2 E;  2XRZ A;  4XKC A;  4NUR A;  2J49 A;  3HXB A;  4BX8 A;  1N0R A;  2EIK E;  3Q78 A;  3SBS A;  1DVP A;  5JMN D;  3S7F A;  4PS7 A;  4JPS A;  4LSZ E;  4TRQ A;  2J4B A;  3ESK A;  5JHA A;  4HRL A;  3CK9 A;  3FEY A;  2VQ2 A;  1JCR A;  4X8Q A;  1UW4 B;  3L13 A;  2GRM A;  3ASF A;  4LER A;  4KMO A;  1EDU A;  3IHV A;  1FVH A;  3T5X A;  4BSX A;  5CRV A;  5KJL A;  3B95 A;  4U0S A;  4GPM A;  5D2M C;  5E75 A;  5CBO A;  4AY6 A;  4B8A A;  4G2V A;  4H7X A;  3FUM A;  2X6K A;  2X6I A;  2R5S A;  2F0Y A;  1JCQ A;  2HR2 A;  4HI9 A;  1E90 A;  4NQ0 A;  1E8Z A;  2VSX E;  5KJM A;  4CT0 A;  4JXT A;  3MX3 A;  3RRU A;  2WM9 A;  1BU9 A;  1BPO A;  2KBX A;  2P9N G;  4BFR A;  2DBA A;  3E34 A;  3DSS A;  3QJZ A;  2FBN A;  1NI1 A;  3V2X A;  2X6F A;  3ZKJ A;  5BXU A;  5T4Y A;  3EHR A;  3BU8 A;  4RQI A;  4BSZ B;  5BV0 A;  1DCQ A;  3IHY A;  2I2O A;  3FTY A;  4ANX A;  1OCZ E;  5LCW C;  4ANW A;  2B6C A;  1LF8 A;  3E32 A;  2V5F A;  4OVU A;  5AYW D;  1O1T A;  4WWO A;  2DYR E;  3DSW A;  1UN8 A;  3CVP A;  5D66 A;  4AXH A;  3LYA A;  1OWM A;  2CHZ A;  4O1O A;  4APF A;  2XPY A;  3L9T A;  4KZ0 A;  3IKO B;  4J7W A;  2Y3A A;  2HE0 A;  4I6E A;  3DSU A;  2PQN A;  3FY4 A;  1H2V C;  2IU1 A;  3CQG B;  2BF0 X;  4A55 A;  3LJ3 A;  3I5P A;  3QWP A;  3CEQ A;  1DNP A;  2BKG A;  4GZC A;  1HH8 A;  3WXX A;  2C2L A;  1OCC E;  4WNG A;  2J9Q A;  3NBN B;  1TYQ G;  3QOU A;  1UJJ A;  1U2V G;  4N5C A;  1MZC A;  5FQ4 A;  3ASG A;  4EZJ A;  4GA1 A;  5FTP A;  4IN3 B;  5BW8 C;  4DLQ A;  1SA4 A;  3I4R B;  3PEV B;  4HRM B;  1HFA A;  4LEU A;  2R03 A;  3C3R A;  3K9I A;  3TXM A;  3NZU A;  2XS8 A;  3ASN E;  3EIQ C;  3UKU G;  3KSQ A;  4HFG A;  1UJK A;  3ASH A;  3W9F A;  1E8X A;  1N95 A;  3OXL A;  4UWG A;  2H6F A;  4AJW A;  3MJW A;  3PZ2 A;  5AIJ A;  1EF1 C;  1DCE A;  3DSV A;  4ILH B;  4U8V D;  2WQ6 A;  1D9S A;  1AP7 A;  2IO2 C;  5JHB A;  3RSE G;  1DC2 A;  3ENE A;  4G24 A;  1VDY A;  3PNT B;  3FU5 A;  2R05 A;  2LUH A;  4A3V A;  4UWH A;  3ZPJ A;  3UM0 A;  4LNU D;  2WPV A;  2JEK A;  3G2V A;  4UI9 K;  4DRX E;  4EPZ A;  3TG5 A;  4AP2 A;  3RKV A;  3RO2 A;  1W3B A;  1Y8M A;  4GTT A;  1OWO A;  4TUM A;  5DBK A;  5AQB A;  2J08 A;  1N0Q A;  4I43 A;  1E7U A;  2P9K G;  3AJI A;  3G2T A;  3CVY A;  4DX6 D;  5KCM A;  4BT8 A;  2KC7 A;  3JUE A;  2LXL A;  3FU6 A;  2EIJ E;  4HOQ A;  4URK A;  3PZ3 A;  3CVX A;  3NZS A;  5CCM A;  2Y0B G;  4Q96 A;  3CVV A;  4N5Q A;  4U0U A;  5G55 A;  1EYH A;  2GRO B;  3EDT B;  5KJN A;  2X3M A;  4M3O A;  3MEK A;  3GZS A;  2GRN B;  2Y1L E;  3L16 A;  2M63 A;  4FLB A;  2QY7 A;  5ARF A;  5ANL A;  4OAU C;  1H0A A;  3UM3 A;  1S64 A;  2KCV A;  3ZW3 A;  3RK6 A;  2I1J A;  3UI2 A;  4GA2 A;  2GRR B;  3DWL G;  5G2N A;  4F6R D;  3L08 A;  2WXP A;  3CKC A;  2OVF A;  2XGO A;  3FU0 A;  2UY1 A;  2ION A;  3PEU B;  2AXV A;  3JUI A;  4J8E A;  1MX6 A;  3D9I A;  2WQ7 A;  1OWL A;  2AW6 A;  1EPU A;  3PDN A;  3FTW A;  4GB9 A;  3Q73 A;  4GMJ A;  1HXI A;  1WM5 A;  2KZT B;  1X5B A;  4FUL A;  4CCA A;  1NFI E;  3UQ3 A;  5HS0 A;  4DPR A;  4B8C B;  4UI9 J;  1ELW A;  5AJD A;  3QB2 A;  1X81 A;  5HQ8 A;  4Y6C A;  4A63 B;  5DIZ A;  3R7Q A;  3PE3 A;  4N3C A;  3FEX A;  2WXL A;  4HXI A;  1N11 A;  4U04 A;  1HX8 A;  1Z5S C;  3V2O A;  1IKN D;  2DYS E;  4Q94 A;  3ZYQ A;  4CDM A;  1NA3 A;  3UMV A;  5FJY A;  4JHR A;  4UUC A;  4F53 A;  5CMW A;  3DEO A;  1H6P A;  4YDY A;  2R02 A;  2V0P A;  2WVI A;  4CT4 A;  2A5U A;  3Q79 A;  4RLY A;  5CCL A;  4UWL A;  3CVN A;  3ZHE B;  3URZ A;  1HO8 A;  4WND A;  2FF4 A;  3CKB A;  4L23 A;  3HYM B;  4J0U A;  3V30 A;  5KJK A;  3L22 A;  3LY8 A;  4EEC A;  1IYG A;  1H6K A;  1YMP A;  1UG3 A;  3G2S A;  1K1B A;  4PS3 A;  1E8W A;  1TN7 A;  4CDR A;  2ETA A;  1TJF A;  3IEG A;  4GZ5 A;  4GAA A;  3ULY A;  2FO1 E;  4KYO B;  1S0P A;  1HE8 A;  3MV2 B;  3HVE B;  1N9A A;  2KXP C;  3ESL A;  1K1A A;  4EBA G;  3G2W A;  4ILG A;  2WXF A;  4FHK A;  4WNF A;  2BED A;  3KS2 A;  2R17 C;  3D9H A;  4OVV A;  1D8D A;  2YIN A;  3D3M A;  2XPI A;  4WAF A;  4JL0 A;  1QBQ A;  1TNU A;  3SFX A;  3DSX A;  4I1O B;  4OYS A;  5EIB E;  3ONK A;  2H6G A;  2XZT G;  3D9P A;  3FTZ A;  5LFA A;  3R9M A;  2VTB B;  2WMN A;  4JA9 A;  3JQ1 A;  4E6H A;  4UWK A;  4L7T A;  3RAU A;  3HHM A;  2VSY A;  3EUV A;  1TJC A;  4JD2 G;  4CEM A;  5CRU A;  3ULQ A;  4JZY A;  5EX0 A;  4W9R A;  3JXJ A;  3VTX A;  3I4G A;  2A5E A;  4XIF A;  1KT1 A;  5LOZ A;  4GTQ A;  1MX4 A;  3CHP A;  3HIZ A;  4JHJ A;  3DEP A;  4DX7 D;  2PQR A;  2MYO A;  5G04 C;  3RRM B;  3JQ0 A;  2XEH A;  4GTP A;  3AG1 E;  2BTD A;  3BUA A;  5FZS A;  1PY1 A;  3APD A;  2AXU A;  4Q69 A;  2KAT A;  1OY3 D;  1UOH A;  3TWV A;  1E8Y A;  4AM9 A;  4FP7 A;  2RFM A;  4CRW A;  4UQY A;  3AS4 A;  1XNF A;  2DWZ A;  4XEI G;  2MOW A;  2JAB A;  3UIN C;  1WY6 A;  3S7J A;  3UIO C;  2RD0 A;  3MKQ A;  3HXE A;  4CYM D;  1KZP A;  2J4D A;  3CK8 A;  3PE4 A;  2WXR A;  4QQI A;  2QYJ A;  1YCS B;  5FIO A;  3KSL A;  2JLB A;  3LJN A;  3FUH A;  3T9K A;  2VSO E;  2OEW A;  4J8S A;  4F1S A;  1H19 A;  3RJV A;  2MHK A;  2LAI A;  4I2Z A;  4KBQ A;  1HG5 A;  4U8H A;  2DZO A;  3O48 A;  4HOU A;  3ZXP A;  2PL2 A;  4GTM A;  4B93 B;  3LVQ E;  4U07 A;  1FT1 A;  4PDX A;  4XI0 A;  3ULE G;  4LNB A;  3ZVV A;  4O60 A;  1HS6 A;  4ME2 A;  3EIJ A;  3C3O A;  3ML8 A;  2KM4 A;  1Y6I A;  2P9U G;  1JCS A;  5ENN A;  4ZFH A;  1SZ9 A;  4LNG A;  4HB5 A;  4A1S A;  4GTO A;  1O1S A;  1ELK A;  3CVU A;  4J6I A;  3SHF A;  3AAA C;  4KVM A;  3VLE A;  4C48 B;  4F7A A;  1N54 A;  5AQ7 A;  2AVP A;  3SZ7 A;  2HO1 A;  2LSU A;  3PRZ A;  2V4H C;  4Y6W A;  1Z6T A;  4U8Y D;  3TAX A;  2KZT A;  5LP0 A;  5EYL A;  3R7R A;  3E33 A;  4J8D A;  2CG2 A;  3L82 A;  4CDN A;  4UWF A;  4XE0 A;  3SNX A;  4TV3 A;  2XEN A;  2XZD G;  3UPV A;  3CLJ A;  4U63 A;  1MQS A;  3DXK G;  4GTR A;  3NF1 A;  2EIN E;  3SQV A;  3DBS A;  5EN5 D;  3LS8 A;  2ILR A;  1MYO A;  3CHQ A;  3PVL A;  4FAD A;  4LUN U;  4I17 A;  4LCT A;  5FWQ A;  3IXE A;  2X6H A;  2GW1 A;  4JHK A;  1KLX A;  4APO A;  3P2B A;  3OXG A;  1JWF A;  3LY9 A;  2P2C P;  3C72 A;  3PH0 C;  4DX5 D;  5AJL A;  1H6O A;  1MJ0 A;  2L6B A;  3ML9 A;  2KCK A;  4HOR A;  5KNH D;  5FZR A;  3D9K A;  3TWQ A;  1SVX A;  3MCX A;  4QFV A;  3HXC A;  5CED B;  2VYI A;  1YYH A;  1K3Z D;  4XKB A;  3FTU A;  2P9I G;  5KBA A;  4GPK A;  3Q15 A;  4U7E B;  4N3A A;  4MLP A;  3ZHE A;  4GCN A;  4YDE A;  5ITZ F;  5EDS A;  4N39 A;  4RG6 A;  3NB2 A;  4L2L A;  2XQ0 A;  1TN8 A;  3BEE A;  3C3Q A;  3SD5 A;  1JWG A;  5JA4 D;  1OT8 A;  2YHE A;  4MS6 A;  5AAR A;  3S2A A;  2L0I A;  3DXM G;  5FZQ A;  2XS1 A;  3B7T A;  1FVF A;  4DX2 A;  3CSF A;  3GW4 A;  4IRU A;  3UM1 A;  4KT6 B;  2Y4T A;  5AQ9 A;  1FT2 A;  3PNL B;  2L9B A;  4F1P A;  3SGH A;  1S70 B;  4FHJ A;  2MRI A;  3OXF A;  2CHX A;  4U95 D;  1G3N B;  4C0E A;  2VGX A;  1OWN A;  5B1B E;  3T5V A;  3CST A;  2IJG X;  5H7P A;  3CVQ A;  4G11 A;  2Y69 E;  4FJY A;  2HM8 A;  3FH8 A;  1H2U A;  2FUL A;  2WMO A;  3UT7 A;  2GRP B;  2XGS A;  2RFA A;  4I9C A;  4GU5 A;  3CHS A;  4F3V A;  4K5A B;  4L1B A;  5AAO A;  4M7C A;  3P1U A;  3MKR A;  5ENS D;  4BT9 A;  4HOT A;  4NAC A;  2ZGG A;  2WXG A;  2L6J A;  3FH5 A;  1E7V A;  1HF8 A;  1LTX A;  3SFY A;  3EHQ A;  3MYV A;  3L54 A;  2KCL A;  2LXM A;  3ISM C;  3FFL A;  2I6H A;  2ZIS A;  1K8K G;  2XCB A;  5A23 A;  1NP7 A;  4JEU A;  5LX8 A;  1TNO A;  1Z3X A;  4K5C A;  4I9E A;  4TUU A;  5FT9 A;  1N4R A;  1QYM A;  3O4Z A;  3QKY A;  4GZ6 A;  4ANU A;  3KEA A;  2IOS A;  2QYU A;  2PZI A;  4ZHB A;  4PH4 B;  2XCC A;  5G05 J;  4YDO A;  1SZA A;  3CVL A;  2RKK A;  3Q5M A;  4DJA A;  5BPP A;  4JW1 A;  3PRE A;  3Q4A B;  1TR4 A;  5CEC B;  5JJ7 A;  3FTX A;  2NC9 A;  3TL5 A;  4I1M A;  3ZNG A;  3IBE A;  4NRH B;  2I9C A;  1XGW A;  1N4Q A;  2OVB A;  4RG9 A;  3D9M A;  4WNE A;  5BNW A;  3APF A;  4DUI A;  1OXJ A;  4BTB A;  1L5J A;  4G8K A;  4YND A;  2H6H A;  1S63 A;  2CG3 A;  3GYZ A;  3G2U A;  1OUV A;  3OAW A;  2H6I A;  1ZBP A;  3Q49 B;  3D9J A;  3EJN A;  3UM2 A;  3VLF A;  2Q7F A;  2WXO A;  1JPL A;  4MRU A;  3DRA A;  3AG4 E;  2WXI A;  3TWW A;  3TG4 A;  2F8X K;  3SI5 A;  2EIM E;  3U64 A;  2FEZ A;  3U9W A;  1HG2 A;  2DIW A;  5KNG A;  4GZD A;  2J09 A;  3FU3 A;  2WQH A;  3ZRH A;  4XI9 A;  4HS2 A;  3AU5 A;  3NOC D;  3BQO A;  2L0T B;  4I6G A;  2NYJ A;  4GYO A;  4L2Y A;  1PAQ A;  4UI9 C;  1TEZ A;  3FUI A;  2XPZ A;  4EQF A;  3ZFW A;  3FTS A;  5IY5 E;  2ZXW E;  4FLH A;  4GYW A;  3TXN A;  1D8E A;  4N3B A;  4ACK A;  2GRQ B;  2VJ8 A;  2IF4 A;  3DPY A;  5G05 C;  4JEH A;  1FPP A;  3Q47 B;  3HDX A;  1H2T C;  5BT1 A;  4PS8 A;  5J08 A;  1IQR A;  1RZ4 A;  1KZO A;  2XGM A;  3UKR G;  4EBA A;  5FIN A;  4DI3 A;  3HG0 D;  3WG7 E;  3TWS A;  3U3W A;  3Q9U C;  3S7B A;  4YDW A;  3T8M A;  2P9S G;  2ETB A;  3ZUV B;  3CHM A;  3D9O A;  5B3S E;  1RW2 A;  4EZL A;  1MHQ A;  5E76 A;  3QAR A;  1LD8 A;  1SA5 A;  5AQA A;  3V31 A;  4B94 A;  4O1P A;  3FUJ A;  1QQE A;  3JXI A;  5LCW J;  2DVW A;  4BES A;  3QAQ A;  4P29 A;  5EX3 A;  4WWP A;  2Y4U A;  3ZYM A;  2I1K A;  1BD8 A;  4GZ3 A;  3AG3 E;  3FWV A;  2F37 A;  2ZIR A;  4FJZ A;  2FO7 A;  4HVB A;  3CV0 A;  4I2W A;  4A3T A;  4TXQ A;  5T8I A;  3TWR A;  4HQD A;  4TXR A;  4EHM A;  2PM6 A;  5A6C A;  4AVX A;  4GA0 A;  2WXH A;  1FCH A;  5BXO A;  3CVW A;  2WXM A;  4ANV A;  1A5E A;  3QWV A;  4O6F A;  5ANR A;  4DI4 A;  3FUK A;  1U3D A;  4EZK A;  3ZEF A;  3LXU X;  5B1A E;  2C0L A;  3EU5 A;  2CFZ A;  4BTA A;  2GRL A;  4K0R A;  5CER B;  5JJ6 A;  3PS6 A;  1N94 A;  2WXN A;  1UN9 A;  3IV0 A;  4B89 A;  4CGV A;  2QFC A;  2WXJ A;  1U3C A;  3TWT A;  3SO8 A;  4I1A A;  3QNK A;  4GCO A;  2AXZ A;  2A4Z A;  4LRZ A;  3PUJ A;  4FU3 A;  2LNI A;  4KVO A;  1HU3 A;  4GML A;  3ZXS A;  3CHR A;  1SW6 A;  1O1R A;  1TNZ A;  2OCC E;  4G8L A;  1NA0 A;  1IHG A;  3BG0 B;  4HLE A;  1WG0 A;  2BKK B;  3ZYK A;  3NAW A;  4JB8 P;  5FQ6 A;  2P58 C;  3UTM A;  2XEV A;  2E2E A;  5FQ7 A; 
#chains in the Genus database with same CATH homology
 3FDH A;  4MS6 A;  4Q94 A;  3GZ1 A;  4A1G A;  3ZYQ A;  2YHC A;  3S2A A;  1NA3 A;  2L0I A;  4CDM A;  3UMV A;  5BUZ A;  5FZQ A;  5FJY A;  5C2Y A;  4JHR A;  4AIF A;  3B7T A;  4IYP A;  1FVF A;  1ZU2 A;  2V4L A;  2RG8 A;  3KD7 A;  4F53 A;  3CSF A;  3FUF A;  3GW4 A;  2IOL A;  3GZ2 A;  4IRU A;  5CMW A;  4KT6 B;  4G26 A;  5CHE E;  2Y4T A;  3AS8 A;  3PUK A;  3LPZ A;  3PNL B;  2L9B A;  2V0P A;  2WVI A;  4CT4 A;  2LSV A;  2WXK A;  3ONL A;  2A5U A;  5CCL A;  2XRZ A;  4XKC A;  3SGH A;  4UWL A;  4FHJ A;  2BUG A;  4NUR A;  2J49 A;  2MRI A;  4BX8 A;  3OXF A;  2CHX A;  3C98 A;  3CVN A;  3SBS A;  3ZHE B;  1DVP A;  3URZ A;  3FHE A;  4H7Y A;  4C0E A;  2VGX A;  4YVO A;  1HO8 A;  4KZC A;  1HZ4 A;  1OWN A;  2FF4 A;  3CKB A;  4L23 A;  3HYM B;  4WND A;  3T5V A;  3S7F A;  4J0U A;  4PS7 A;  4JPS A;  4AOF A;  4TRQ A;  3CST A;  2J4B A;  2IJG X;  4CGW A;  3UT4 A;  3CVQ A;  3ESK A;  4AEZ C;  4G11 A;  2FI7 A;  5JHA A;  5KJK A;  3L22 A;  3LY8 A;  3CK9 A;  4FJY A;  4EEC A;  1IYG A;  2HM8 A;  3FEY A;  4BWR A;  1H6K A;  2VQ2 A;  3FH8 A;  1H2U A;  2FUL A;  1UG3 A;  3UX4 A;  2WMO A;  2XRY A;  3UT7 A;  3G2S A;  1UW4 B;  2XGS A;  3L13 A;  4I9C A;  4AV7 A;  2GRM A;  4GU5 A;  2OV8 A;  3ASF A;  3CHS A;  4PS3 A;  5HI7 A;  4F3V A;  2J07 A;  4LER A;  1E8W A;  4KMO A;  3L6A A;  1EDU A;  3IHV A;  1FVH A;  4L1B A;  4UQZ A;  3T5X A;  4CDR A;  4BSX A;  3P1U A;  1NZN A;  3MKR A;  5KJL A;  4BT9 A;  2YNQ A;  1TJF A;  4HOT A;  3IEG A;  4GZ5 A;  4GAA A;  4KXK B;  4NAC A;  4U0S A;  2WXG A;  2L6J A;  5EKQ D;  3FH5 A;  1OWP A;  4KYO B;  1E7V A;  5E75 A;  1S0P A;  1HF8 A;  4B8A A;  4AY6 A;  3FUD A;  1HE8 A;  3MYV A;  4G2V A;  3L54 A;  3MV2 B;  3HVE B;  3FUM A;  4H7X A;  2KCL A;  2X6K A;  2X6I A;  2R5S A;  2HR2 A;  3FFL A;  2I6H A;  1E90 A;  4NQ0 A;  5M72 A;  1E8Z A;  2XCB A;  5A23 A;  1NP7 A;  3TGO A;  1QZ2 A;  2VSX E;  4JEU A;  3LY7 A;  3ESL A;  5KJM A;  5CMY A;  4ATG A;  5LX8 A;  4CT0 A;  4JXT A;  4EBA G;  1Z3X A;  3CK7 A;  3MX3 A;  3G2W A;  2WM9 A;  3RRU A;  4ILG A;  1BPO A;  2WXF A;  4I9E A;  4TUU A;  5FT9 A;  2DBA A;  4FHK A;  3D9N A;  4BFR A;  4WNF A;  3KS2 A;  3O4Z A;  3QKY A;  2R17 C;  2FBN A;  3QJZ A;  4OVV A;  4GZ6 A;  4ANU A;  2YIN A;  2IOS A;  3D3M A;  2CFU A;  2PZI A;  2X6F A;  2XPI A;  4FC8 A;  1QNF A;  5D0Q D;  5T4Y A;  3FUE A;  4UQX A;  3FTV A;  3MGB A;  4WAF A;  4JL0 A;  4PH4 B;  5BV0 A;  2XCC A;  2UWJ G;  3IHY A;  2I2O A;  4XX5 A;  3FP3 A;  5G05 J;  4I1O B;  1SZA A;  3CVL A;  3FTY A;  4OYS A;  2NXP A;  3Q5M A;  4ANX A;  4DJA A;  3D9L A;  4WWN A;  5BPP A;  4JW1 A;  4ANW A;  5LCW C;  3CIA A;  2R59 A;  2WXQ A;  3ONK A;  1LF8 A;  2V5F A;  3PRE A;  4OVU A;  3Q4A B;  3D9P A;  3FTZ A;  5T3R A;  5LFA A;  3QDN A;  5JJ7 A;  5AYW D;  3MKQ B;  2VTB B;  3FTX A;  2NC9 A;  3TL5 A;  4I1M A;  2WMN A;  3AU4 A;  4JA9 A;  3JQ1 A;  4WWO A;  4E6H A;  4DK5 A;  4UWK A;  3IBE A;  1UN8 A;  4L7T A;  3CVP A;  3RIB A;  4B0Z A;  4PUC A;  4NRH B;  3HHM A;  4AXH A;  2VSY A;  2I9C A;  3LYA A;  1A17 A;  1TJC A;  1XGW A;  1OWM A;  4K03 A;  4MKT A;  2CHZ A;  4CEM A;  4APF A;  3ZGQ A;  2OVB A;  4RG9 A;  4CRW A;  2XPY A;  3ULQ A;  2VGY A;  3AS5 A;  4JZY A;  3IKO B;  4KZ0 A;  5EX0 A;  2Y3A A;  3D9M A;  4WNE A;  5BNW A;  2IQC A;  3APF A;  4W9R A;  4I6E A;  4BTB A;  5D0O D;  1L5J A;  4YND A;  2PQN A;  3VTX A;  3FY4 A;  3I4G A;  4XIF A;  1KT1 A;  3HVE A;  5LOZ A;  1H2V C;  2IU1 A;  1P5Q A;  3CHP A;  1INZ A;  1IQU A;  2CG3 A;  3CQG B;  3HIZ A;  2BF0 X;  2OOE A;  2V8S E;  3G2U A;  3GYZ A;  4JA7 A;  3ZN3 A;  4JHJ A;  1OUV A;  5C1D A;  2VSN A;  4A55 A;  2PQR A;  3OAW A;  3U66 A;  3LJ3 A;  3I5P A;  5G04 C;  3RRM B;  1ZBP A;  3JQ0 A;  3D9J A;  3EJN A;  3Q49 B;  3QWP A;  3VLF A;  2Q7F A;  3LDZ A;  2WXO A;  1DNP A;  1JPL A;  1SQM A;  3CEQ A;  4MRU A;  4V3I A;  1B89 A;  4GZC A;  2BTD A;  5FZS A;  1HH8 A;  3L17 A;  4R7L A;  2XHE A;  3BG1 B;  3WXX A;  2C2L A;  2WXI A;  3TG4 A;  3SI5 A;  4WNG A;  1PY1 A;  3EHM A;  2J9Q A;  3U64 A;  3APD A;  2AXU A;  2FEZ A;  3OTN A;  4Q69 A;  2YQ8 A;  3U9W A;  2KAT A;  3QOU A;  1UJJ A;  1HG2 A;  2DIW A;  4N5C A;  4D10 C;  4XZ4 A;  1E8Y A;  5FQ4 A;  3ASG A;  4EZJ A;  4AM9 A;  4FP7 A;  2IFU A;  4GA1 A;  2LO6 A;  4GZD A;  3AS4 A;  4UQY A;  1XNF A;  2J09 A;  3EHN A;  3LCA A;  2MOW A;  3FU3 A;  4IN3 B;  5FTP A;  4I6J A;  2WQH A;  5BW8 C;  4BY6 A;  4DLQ A;  3ZRH A;  4XI9 A;  1WY6 A;  3S7J A;  4HS2 A;  3AU5 A;  3I4R B;  3PEV B;  1HFA A;  3QK0 A;  4LEU A;  3ASD A;  3K9I A;  2RD0 A;  2L0T B;  3MKQ A;  4I6G A;  3TXM A;  2VTB A;  3NZU A;  4IUL A;  4JVS A;  4GYO A;  4L2Y A;  3EIQ C;  1PAQ A;  2J4D A;  3CK8 A;  4UI9 C;  1TEZ A;  2AWI A;  3FUL A;  4HFG A;  1GW6 A;  1E96 B;  1UJK A;  3FUI A;  2XPZ A;  4EQF A;  3ASH A;  3PE4 A;  2WXR A;  1E8X A;  3FTS A;  1Z3Y A;  3ZFW A;  4AY5 A;  3OXL A;  4UWG A;  4FLH A;  4AJW A;  4GYW A;  3MJW A;  3TXN A;  2OND A;  3CQC B;  4N3B A;  5AIJ A;  1EF1 C;  4ACK A;  2VJ8 A;  2IF4 A;  2JLB A;  5G05 C;  4ILH B;  3B7U X;  3FUH A;  4JEH A;  2WQ6 A;  2CHW A;  2VSO E;  3Q47 B;  2DCP A;  3HDX A;  4GYY A;  1H2T C;  5JHB A;  3NQP A;  4J8F A;  3ENE A;  4BX9 A;  5BT1 A;  4J8S A;  4G24 A;  4PS8 A;  4F1S A;  1VDY A;  3PNT B;  3FU5 A;  3RU0 A;  5J08 A;  1IQR A;  1H19 A;  3RJV A;  2MHK A;  2LAI A;  4I2Z A;  3UT8 A;  3ZIM A;  3CR3 A;  2XGM A;  4A3V A;  4KBQ A;  4EBA A;  4DI3 A;  1YA0 A;  1HG5 A;  4UWH A;  3ZPJ A;  4U8H A;  3O48 A;  4HOU A;  3U3W A;  2WPV A;  1ELR A;  2PL2 A;  3S7B A;  2WB2 A;  2JEK A;  3T8M A;  4ILI A;  4WUY A;  3CHM A;  3D9O A;  3R9A B;  3LVQ E;  3G2V A;  4U07 A;  4PDX A;  4UI9 K;  4XI0 A;  4EPZ A;  3TG5 A;  4AP2 A;  3CHO A;  4EZL A;  3FH7 A;  1MHQ A;  5E76 A;  3RKV A;  3QAR A;  3ZVV A;  2X6J A;  1HS6 A;  1W3B A;  3JCK C;  1Y8M A;  4ME2 A;  3PZD A;  3EIJ A;  3RO2 A;  1OWO A;  4B94 A;  3ZYL A;  3FUJ A;  3CGH A;  5J90 A;  3ML8 A;  5DBK A;  1QQE A;  2KM4 A;  1Y6I A;  2J08 A;  3MA5 A;  4I43 A;  5JJT A;  1E7U A;  5LCW J;  5ENN A;  1SZ9 A;  2EQX A;  4HOS A;  4A1S A;  3APC A;  3G2T A;  3QAQ A;  3CVY A;  4P29 A;  5EX3 A;  4WWP A;  5KCM A;  4BT8 A;  3B7S A;  2Y4U A;  3ZYM A;  1ELK A;  2I1K A;  4GZ3 A;  3CVU A;  2KC7 A;  4J6I A;  3FWV A;  3MZL B;  3SHF A;  4KVM A;  3VLD A;  3FU6 A;  3I3N A;  4YVQ C;  4RVB A;  3VTY A;  4HOQ A;  3VLE A;  4URK A;  4F7A A;  4FJZ A;  3CVX A;  2FO7 A;  1N54 A;  3NZS A;  4HVB A;  2AVP A;  5CCM A;  3CV0 A;  4Q96 A;  3SZ7 A;  3CVV A;  3SFZ A;  2HO1 A;  4I2W A;  2LSU A;  4A3T A;  3PRZ A;  4U0U A;  5G55 A;  2E0I A;  3SBT B;  5T8I A;  3LEW A;  4Y6W A;  1EYH A;  3EDT B;  4DLO A;  5KJN A;  4G23 A;  1Z6T A;  2X3M A;  2PM6 A;  5A6C A;  3TAX A;  2KZT A;  3SF4 A;  4M3O A;  4AVX A;  5LP0 A;  4GA0 A;  2WXH A;  1FCH A;  3R7R A;  3MEK A;  3CVW A;  1PC2 A;  2WXM A;  4J8D A;  3GZS A;  2CG2 A;  4ANV A;  3KAE A;  3QWV A;  4O6F A;  3L16 A;  5ANR A;  2M63 A;  4CDN A;  4DI4 A;  4UWF A;  3FUK A;  4FLB A;  4XE0 A;  2QY7 A;  4TV3 A;  1U3D A;  5ARF A;  3SNX A;  4EZK A;  4C9B B;  3UPV A;  3ZEF A;  2X38 A;  5ANL A;  5ARG A;  1H0A A;  3CLJ A;  1MQS A;  2C0L A;  3B13 A;  3JYS A;  3LXU X;  4U63 A;  2KCV A;  3NF1 A;  4U0Z A;  5G04 J;  3ZW3 A;  2CFZ A;  3RK6 A;  2I1J A;  3DBS A;  3KEZ A;  4GA2 A;  5G2N A;  3LS8 A;  3TJP A;  4BTA A;  2ILR A;  4N2Q A;  3L08 A;  2GRL A;  3U4T A;  2WXP A;  4K0R A;  3LVR E;  3CKC A;  3CHQ A;  4JC8 A;  3PS6 A;  5JJ6 A;  3UUX A;  4FA6 A;  2OVF A;  2XGO A;  3FU0 A;  3PVL A;  2WXN A;  4FAD A;  1UN9 A;  2UY1 A;  3IV0 A;  4B89 A;  4LUN U;  4CGV A;  2ION A;  4I17 A;  4LCT A;  2QFC A;  3PEU B;  2AXV A;  3JUI A;  5FWQ A;  2WXJ A;  1U3C A;  2C0M A;  2X6H A;  2GW1 A;  3MV3 B;  4JHK A;  4C0M A;  4J8E A;  1KLX A;  4APO A;  3D9I A;  2WQ7 A;  1OWL A;  2AW6 A;  5AEN A;  1EPU A;  4I1A A;  3PDN A;  3FTW A;  5BV1 A;  3QNK A;  4GB9 A;  1KT0 A;  4GCO A;  2VGX B;  3P2B A;  3OXG A;  1JWF A;  2AXZ A;  3LY9 A;  3N71 A;  4GMJ A;  1HXI A;  1WM5 A;  1JUQ A;  2KZT B;  2A4Z A;  3PH0 C;  1X5B A;  5AJL A;  4LRZ A;  4FUL A;  3PUJ A;  3FUN A;  4E85 A;  3ML9 A;  3S7D A;  3DPD A;  2KCK A;  4FU3 A;  3RO3 A;  4CCA A;  4HOR A;  2LNI A;  4KVO A;  1HU3 A;  5FZR A;  3D9K A;  1N52 A;  3MCX A;  3E4B A;  4QFV A;  3UQ3 A;  4G1T A;  5FQ8 A;  3LKU A;  2VYI A;  4DPR A;  4GML A;  3ZXS A;  4B8C B;  3CHR A;  4UI9 J;  1ELW A;  3QC1 A;  3FTU A;  4XKB A;  5AJD A;  3QB2 A;  2GGF A;  4GPK A;  5HQ8 A;  4Y6C A;  2ZU6 B;  4N2S A;  3Q15 A;  4N3A A;  4MLP A;  3B7R L;  5DIZ A;  3ZHE A;  4GCN A;  1NA0 A;  2NSZ A;  3R7Q A;  2HYZ A;  3PE3 A;  4N3C A;  4ABN A;  1IHG A;  3BG0 B;  4HLE A;  3FEX A;  2WXL A;  3ZYK A;  2UY1 B;  4HXI A;  4G25 A;  5EDS A;  4N39 A;  4RG6 A;  4RSY A;  4U04 A;  5FQ6 A;  3QWW A;  2P58 C;  4L2L A;  2XQ0 A;  1HX8 A;  3BEE A;  2XEV A;  2PM7 A;  5A7D B;  2E2E A;  2LAH A;  5FQ7 A;  3RRN B;  3SD5 A;  1JWG A;  2YHE A;  4ACL A;  1WAO 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...