3AS8A

Mama msr-1 p41212
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
181
structure length
181
Chain Sequence
DDIRQVYYRDKGISHAKAGRYSEAVVMLEQVYDADAFDVEVALHLGIAYVKTGAVDRGTELLERSIADAPDNIKVATVLGLTYVQVQKYDLAVPLLVKVAEANPVNFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAYSYEQMGSHEEALPHFKKANELDERSAVELALV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Magnetosome protein MamA
publication title Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Protein binding
total genus 76
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3as8A01
1ELWA 2YHCA 3ASFA 3QDNA 2JLBA 4I17A 1A17A 3ESKA 2C0MA 5EX3A 3SZ7A 3CVPA 4JA9A 4GZ5A 3OXGA 4J8DA 2WQHA 3AS4A 3RKVA 1HZ4A 4UQYA 2FF4A 3U4TA 4N5CA 2VYIA 4LEUA 5JJTA 5JJ7A 4Y6WA 5KJMA 3RIBA 3LKUA 4UQXA 2GW1A 2V5FA 4AY6A 3GZ2A 3LY9A 5KJLA 3VTYA 3VTXA 3ZGQA 2VQ2A 2FI7A 3CEQA 2XGMA 3CK9A 4NQ0A 4J0UA 4BT9A 2KCVA 4N3CA 3S7FA 3NF1A 2VGYA 5BT1A 3EDTB 5G05J 2Q7FA 3UUXA 2C0LA 4U0ZA 5HQ8A 3UQ3A 5ARFA 4NRHB 1ZBPA 3FP3A 3QWPA 5ARGA 4O6FA 5G05C 4XIFA 4GPKA 4WNEA 2QFCA 3SF4A 1B89A 3OXFA 5DBKA 3JYSA 3K9IA 4HOTA 3Q15A 3FWVA 4N3AA 2FEZA 4WNFA 1WAO1 2VGXB 5FZSA 2WPVA 1FCHA 2LSVA 2OOEA 1QQEA 4GCNA 4WUYA 4AIFA 3LYAA 4IN3B 4BWRA 2XCBA 3Q5MA 2KCLA 4G24A 3ZN3A 5CCLA 2ONDA 3Q49B 4RG6A 4J8EA 4GA1A 5FT9A 3S7BA 1IYGA 4JL0A 4YNDA 4F3VA 3PE3A 3LY8A 4A1SA 5FJYA 2XPIA 3LPZA 1ELRA 4J8FA 1HXIA 3PE4A 5KJKA 3ULQA 4GYOA 5C1DA 3Q47B 1OUVA 2I6HA 4WNDA 4G1TA 1XNFA 4U0SA 5DIZA 2VSNA 2UY1B 4AM9A 3S7JA 3LY7A 3CK7A 1TJCA 4U0UA 4GCOA 2VGXA 4G23A 2PQRA 1YA0A 5EKQD 2IF4A 4I9EA 3TGOA 4GYYA 4APOA 4BTBA 2LNIA 5G04C 3CKCA 2FBNA 4GZ6A 2VSYA 2XGOA 4UI9K 3UPVA 3TAXA 3HYMB 5HI7A 4HORA 2R5SA 3QWWA 1W3BA 4U07A 3S7DA 2Y4UA 2L6JA 1QZ2A 2KCKA 2XGSA 2HYZA 5A6CA 4H7XA 3MKRA 3ASDA 2AVPA 2KATA 3PDNA 4I2ZA 1P5QA 5BNWA 1HH8A 4CGVA 4I9CA 4JHRA 3URZA 2HR2A 4XI0A 1NA3A 5JJ6A 3R9AB 3KD7A 5LCWJ 3MV2B 3RO2A 3CKBA 1NA0A 3GZ1A 4GA2A 3OXLA 2P58C 3KAEA 3QWVA 2UY1A 2UWJG 5LCWC 5CHEE 1Y8MA 3TG4A 2PL2A 1KLXA 4JA7A 2PZIA 2J9QA 4KXKB 3RO3A 3E4BA 3FFLA 2KC7A 4B94A 5AYWD 4YVOA 3CV0A 4UQZA 2HO1A 4W9RA 2PQNA 4I2WA 5A7DB 4N2QA 1NZNA 3CVLA 3RJVA 5FZRA 3RU0A 4XI9A 4G26A 5D0QD 2LSUA 4GZ3A 5M72A 5BW8C 2FO7A 4EQFA 4KYOB 3QOUA 3ZFWA 4UI9J 3ZHEA 3LCAA 3MEKA 4ABNA 4ME2A 4RG9A 3ASGA 1KT1A 5G04J 2MHKA 3AS8A 4GA0A 4N3BA 4GYWA 4KBQA 4UI9C 3IEGA 2IFUA 3MV3B 2E2EA 3N71A 3Q4AB 4HOUA 3ASHA 2DBAA 3CK8A 1IHGA 2BUGA 3GW4A 4AY5A 5FTPA 4WNGA 5KJNA 1KT0A 3BEEA 2C2LA 3MA5A 2YQ8A 2NC9A 4CDRA 2XCCA 3GYZA 3TG5A 4HOSA 1WM5A 3O48A 4H7YA 3QKYA 4U04A 5CCMA 4N39A 5D0OD 1PC2A 2Y4TA 4I1AA 3ZHEB 3CVQA 4Y6CA 5EX0A 3WXXA 3AS5A 4HOQA 4BT8A 4G25A 3U3WA 4YVQC 5FZQA 4N2SA 4BTAA 3KS2A 4G2VA 3CVNA 1ZU2A 4CGWA 1E96B 3ZPJA 2XEVA
chains in the Genus database with same CATH superfamily
2YHCA 2HE0A 1OWPA 2L0TB 4ACLA 2OVBA 5ANLA 2P9KG 1A17A 5EX3A 4GZ5A 2WQHA 1E90A 2WQ7A 3J5PA 2R05A 2OEWA 4Y6WA 2P9NG 3AU5A 3CSFA 2EILE 4LNUD 4K5BA 3Q9UC 3LKUA 2P9SG 3LY9A 5EIDA 3VTYA 3VTXA 5CBOA 4PH4B 3ZGQA 4NIKA 3SY2A 2FI7A 3D9MA 3CK9A 4GZDA 4J0UA 2BEDA 3L16A 2AXVA 3HXFA 4IULA 4BSZB 2V4HC 4LCTA 4ANXA 4U0ZA 5FQ4A 4FJZA 4B93B 1UN8A 3CVUA 4GPKA 5AARA 5BV1A 3SFXA 2DYRE 1JUQA 4L23A 3Q75A 3MJWA 2DYSE 3JYSA 3P1UA 1BI7B 1MQSA 1KZOA 4BETA 4O60A 4RSYA 3TWXA 2B0OE 1N4QA 3FUEA 3T8MA 2I9CA 3E34A 1WAO1 2E0IA 4O1OA 4LNGA 3TJPA 4C0EA 1XGWA 3PZDA 4HXIA 2VGEA 1TN6A 2XCBA 1K1AA 4G24A 1OCOE 3ZN3A 2GRNB 4D10C 3AJIA 1U2VG 3MGBA 3DXKG 4RG6A 4CRWA 3UXGA 2WM9A 4BESA 3F6QA 3TXNA 3QNKA 3UKUG 1LD8A 2X6HA 3FUDA 4F3VA 3G2WA 1SA5A 1MZCA 3LY8A 1U3DA 4CT4A 3HDXA 2JEKA 2MOWA 1ELRA 4J8FA 3QAQA 1MX4A 2XZDG 4GTOA 3P2BA 5KJKA 4GYOA 1OUVA 4J8YA 2FO1E 4U0SA 3SI5A 3UT4A 1MJ0A 1SQMA 2VSNA 1OY3D 5CEDB 1JCRA 1E7VA 3C72A 3CQCB 4GCOA 4U96D 4YDEA 1YA0A 3AG1E 2J09A 3TGOA 4FULA 4GZ6A 1E8WA 3SBTB 3DPDA 4K5AB 5HI7A 5HRYA 5CBNA 3L22A 3Q7FA 4DUIA 1W3BA 2L6JA 4DI3A 1FT2A 2XGSA 2XZTG 4ANWA 5A6CA 4MRUA 5ITZF 4NACA 3ULYA 2KATA 3Q7AA 4FU3A 4I1MA 4JHRA 2ZGDA 3APDA 4XI0A 5AQ9A 1HF8A 3I5PA 4ILIA 4PS3A 2H6GA 2B6CA 1IQUA 3RO2A 2LUHA 3CHMA 3CKBA 3GZ1A 3NZUA 1HG5A 3QWVA 2WXKA 1N4RA 2UWJG 2X6KA 1TR4A 2GRMA 2I2OA 1X81A 3NAWA 2PL2A 4CYMD 1O1RA 2J9QA 3TXMA 4KXKB 3RO3A 3E4BA 3SHFA 4B94A 1OXJA 4UQZA 2HO1A 4W9RA 3TWWA 4A63B 1HE8A 5A7DB 1UJJA 2AJAA 4N2QA 3CVLA 1JPLA 1K8KG 5D66A 4XI9A 4WWOA 1BPOA 5AQ7A 4EHMA 4UWFA 4FADA 3RRMB 1JWGA 1YMPA 3C3OA 4KZ0A 4KYOB 3QOUA 4UI9J 4CEMA 4MLPA 4DPRA 4ABNA 4L2YA 3T5XA 5B1AE 1EDUA 2MHKA 3QK0A 5E75A 3ZRHA 4XKBA 1IHGA 4HI8A 4AY5A 2M63A 4JW1A 2DZNA 1SW6A 4WNGA 1KT0A 2MRIA 3BEEA 2C2LA 4ANVA 2YQ8A 3LVRE 2PM6A 2WMOA 3DSTA 2KBXA 3FEXA 4L7TA 3ZVVA 4I43A 2H6HA 3EUVA 3EHRA 3RSEG 4HFGA 4U04A 5KNHD 5D0OD 2DCPA 4I1AA 3ZHEB 4Q69A 3UM1A 2X38A 3V79K 3HHMA 4K5CA 3JXJA 4AJWA 2WXJA 3C3QA 3ZIMA 3PUJA 4EZJA 4WAFA 3ASOE 5CMWA 3UT7A 4BT8A 3V30A 1TEZA 1SZAA 3I3NA 3IV0A 1UN9A 3L9TA 4QQIA 3KS2A 4G2VA 3CVNA 1ZU2A 4CGWA 1IKND 4JEHA 4I1OB 1E96B 2XEVA 1TNYA 4OAUC 3ZYLA 1ELWA 3Q79A 3QDNA 4U7EB 2BTDA 3E32A 2ETBA 1YYHA 2WXIA 1G3NB 4J8DA 2XRYA 4FC8A 1N95A 2WXQA 3RKVA 1O5MA 3FH8A 1YCSB 3L6AA 4LEUA 5JJ7A 2V0PA 4FP7A 1LF8A 3CIAA 2BKGA 5ENQD 2NXPA 3ONLA 5JA4D 1OWLA 4GMLA 4AY6A 2L6BA 5T8IA 5KJLA 4J8SA 3Q9NC 2WXHA 2VQ2A 3FUHA 2XEHA 4ZFHA 3FUFA 4BT9A 5AQAA 2KCVA 3U66A 3JCKC 2WXOA 2XENA 3S7FA 3NF1A 2VGYA 3NOCD 2ILRA 1WY6A 5BT1A 2YNQA 3FUJA 4NRHB 1Z5SC 2KXPC 3QWPA 4CT0A 3ABKE 3EU9A 5G05C 5T4YA 3O4ZA 3R7QA 1ZB1A 2QFCA 3FUKA 3QB2A 3SF4A 4BFRA 3B7RL 4ILGA 3C98A 1PY1A 1IHBA 4ACKA 3DSSA 3K9IA 4FLBA 4HOTA 4ZHBA 4IYPA 1MYOA 4G8KA 3SFYA 3LEWA 3CHRA 2L9BA 3PZ2A 1OT8A 2FEZA 4P29A 4PDXA 3FY4A 3SNXA 3VLEA 1PAQA 2WPVA 4YDYA 1U3CA 1FCHA 3KSQA 2Y0BG 3ZEFA 2OOEA 4GCNA 4FLHA 4AIFA 3PEVB 2R17C 2OVFA 2KCLA 3L17A 4HLLA 2QYJA 1AWCB 3B13A 4G8LA 4WWPA 2RKKA 3S7BA 3G2SA 2IJGX 5ENTD 1SA4A 3D9NA 3ZW3A 3ML8A 3UI2A 3JUEA 3TWTA 3C3RA 4A1GA 1OCZE 1OWOA 3ULQA 1OCRE 2XPZA 2OCCE 3RRNB 2UY1B 2WVIA 3UTMA 3CK7A 1TJCA 4U0UA 4DJAA 2VGXA 2PQRA 1DCEA 2X6IA 4I9EA 4APOA 3CHSA 4BTBA 2LNIA 2PNNA 3ISMC 2CHXA 5FIOA 5JMND 3U64A 4HORA 4GTSA 3QWWA 3DRAA 4U07A 4YDOA 5IY5E 3S7DA 3NZSA 4HNAD 1QZ2A 2KCKA 3ZUVB 1FVFA 3MKRA 2AVPA 3CQGB 2WXFA 3PDNA 5BNWA 1HH8A 2ZU6B 2LXMA 3AU4A 3URZA 1N9AA 1N0QA 3D9KA 4I6GA 3KEZA 1H2TC 2F37A 3MV2B 5FINA 1H6OA 2A5UA 3OXLA 2P58C 4N5QA 4E6HA 3IXEA 3CVVA 4BEPA 2Y3AA 4JEUA 5LCWC 4V3IA 3TG4A 3LS8A 3DPYA 2LXLA 1HS6A 2CFUA 4NURA 3OTNA 3HIZA 4ANUA 2LAIA 5B3SE 1LD7A 2KC7A 4AVXA 5AYWD 3LXUX 4HB5A 2LO6A 5CERB 2ZGGA 4I2WA 1HU3A 3E30A 3L54A 2OEVA 5AJDA 4DX7D 1EPUA 1JCSA 5JHBA 3HVEB 4CDMA 1E8ZA 4AOFA 3UKRG 2L0IA 1N4PA 4EQFA 2FO7A 3RAUA 4G11A 3ZHEA 3LCAA 5EYLA 4ME2A 2H6FA 4PS7A 4RG9A 3QARA 3FU5A 3CVWA 3HXDA 1KT1A 2NSZA 1EF1C 1N52A 5G04J 3AS8A 2VTBB 2IONA 2XHEA 2KZTB 2AWIA 2IFUA 3D9IA 3ZXSA 2E2EA 3N71A 3Q4AB 5D2MC 2DBAA 5BXUA 3CK8A 3PNTB 4HBDA 5FTPA 2FULA 2IU1A 1AP7A 3MA5A 2YINA 1H2UA 3ENEA 4LRZA 2XCCA 3GYZA 3KEAA 3AG4E 3V2OA 3W9GA 4H7YA 4TUMA 3DXMG 1H0AA 3BQOA 3QKYA 4ILHB 3DWLG 2F8YA 1PC2A 1LTXA 5CRVA 3AS5A 1S64A 4DLOA 2R02A 4TXQA 4G25A 3CLJA 3U3WA 2JABA 3DEPA 5EILA 2J08A 1BU9A 4Z68A 3B7BA 3HXEA 1QYMA 2WXMA 2CFZA 5EYPF 1KZPA 4ATGA 2DIWA 3ZPJA 3QC1A 3ASFA 1V54E 4L2LA 4GZCA 3SZ7A 1Z3YA 3CVPA 4GB9A 3AS4A 3VLFA 1HZ4A 1E7UA 3U4TA 4DX6D 4N5CA 4I6JA 3D9HA 5LX8A 3CR3A 3LJ3A 5KJMA 4CDNA 4U8HA 2MYOA 3CSTA 4RLYA 3RIBA 4UQXA 3BU8A 3PNLB 2GW1A 5HKPA 4JZYA 3GZ2A 2QC9A 2WXRA 3D9OA 4O1PA 5HS0A 3AG2E 4BX9A 5CRUA 1H6KA 4NQ0A 1HO8A 1BD8A 1Q2ZA 4IRUA 4C9BB 3IBEA 4APFA 3JQ1A 4BERA 2HM8A 4MBGA 3NQPA 3UUXA 4K0RA 3UINC 3UQ3A 4GTPA 4JD2G 5ARFA 2CHZA 5ENSD 3FP3A 1TN8A 5KBAA 4O6FA 2I1KA 5EDSA 1JCQA 2EIJE 1JWFA 1EYHA 4WNEA 4DX5D 3HG0D 1B89A 3W9FA 3BUAA 3S2AA 1DCQA 4JHKA 2WXGA 3APCA 3Q15A 4HVBA 5CECB 2EIKE 3FU0A 3G2VA 4WNFA 4GMRA 2DZOA 2Y1LE 3DSXA 3Q78A 2V8SE 5FZSA 2ETCA 2XS8A 4TV3A 2ETAA 2RFMA 4C0MA 3TWQA 2J8SD 4BWRA 1RZ4A 5CCLA 3UMVA 3Q49B 3FULA 3B7TA 5BPPA 1H2VC 3SD5A 4J8EA 4GA1A 1IYGA 3PH0C 4YNDA 3PE3A 4EBAG 3PZ3A 5E76A 1UJKA 2XPIA 3SO8A 2DVWA 2XPYA 3LPZA 1QBQA 3V2XA 4B8AA 3SGHA 1HXIA 3PE4A 2J07A 1D8EA 4F1PA 1XNFA 1BLXB 4F7AA 5DIZA 4XZ4A 4HI9A 3S7JA 3LY7A 5BUZA 1A5EA 3AG3E 2GRRB 5EKQD 3EIQC 3ZNGA 1VDYA 2PM7A 3BG1B 4KVOA 1K3ZD 5G04C 1MHQA 4FJYA 2VSYA 2XGOA 1NL4A 3J5QB 4UI9K 3TL5A 3TAXA 3HYMB 2VSXE 4B8CB 2R5SA 4M3OA 1KPSB 3D9JA 4GU5A 4FHJA 3UM2A 4JHJA 1S0PA 2Y4UA 5J90A 2IO2C 2ZISA 3PVLA 1IXVA 3ML9A 4BY6A 3KSLA 2BKKB 1NP7A 3PEUB 3EIJA 4HQDA 4H7XA 3UIOC 2BF0X 4I2ZA 1P5QA 1SZ9A 4EBAA 1Y6IA 3FU3A 2HR2A 1INZA 3E37A 3FTXA 5JJ6A 4UWHA 3EU5A 3B95A 4DRXE 3D9LA 4OVVA 1N0RA 5EIBE 2WXLA 3MKQB 3TWRA 1TNBA 2WMNA 3MYVA 2VTBA 1KLXA 2PZIA 3PZ4A 5ENOD 4DK5A 3FEYA 3FFLA 5C2YA 4JB8P 3CV0A 2AXUA 2GRLA 2IO3C 1FPPA 3ASNE 3TWVA 4BX8A 2J4BA 1NZNA 3MX3A 3ZKJA 3RU0A 5LP0A 3ZYQA 5AJLA 5D0QD 5LOZA 5M72A 5BW8C 4GTQA 4DX1A 3ZFWA 3ESLA 2F0YA 4CZ2D 2X6FA 2P2CP 1FT1A 3ASGA 3PREA 1O1SA 3G2TA 1DC2A 2ZIRA 3LJNA 4U8VD 1TNUA 4GA0A 3BG0B 3PUKA 2P9IG 4UI9C 3IEGA 3MV3B 4HOUA 2OV8A 3FUNA 3TWUA 3GW4A 1N4SA 4EPZA 3JQ0A 2NC9A 2CHWA 1E8XA 4E85A 4A3TA 4TRQA 4HOSA 3UIPC 1WM5A 5A23A 3GZSA 3L08A 4M7CA 2J4DA 1Z3XA 1D8DA 4JXTA 3ZU7B 5AN8A 5FQ8A 2Y4TA 3G2UA 3CVQA 4Y6CA 1V55E 3WXXA 1UG3A 4YDWA 3EJNA 2V5QC 3DSUA 4HOQA 2CG2A 3E33A 1TNZA 4YVQC 2X6JA 4FA6A 4C48B 2GRPB 4GMJA 4N2SA 1MX6A 2WXNA 4BTAA 1S70B 2F8XK 4LNBA 3UM0A 1O1TA 1DVPA 1N11A 2JLBA 5BXOA 4KVMA 4GTMA 4I17A 3ESKA 2C0MA 2QZAA 3ONKA 4JA9A 3MCXA 3OXGA 4UQYA 2FF4A 4FHKA 2VYIA 1NFIE 2WQ6A 5JJTA 4F1SA 3JXIA 3ZYKA 3APFA 5B1BE 3FU6A 2ZXWE 3FUMA 1N54A 1Z6TA 2V5FA 1TJFA 2A4ZA 2R03A 4HLEA 2XQ0A 4A55A 2P9UG 4U63A 1H19A 5G2NA 3VLDA 4HRNA 3CEQA 4AV7A 4HRLA 2XGMA 2R2LA 4UUCA 1GW6A 4HRMB 4N3CA 3JUIA 2XEEA 2NYJA 3EDTB 3FH7A 1TN7A 2R59A 4XKCA 5G05J 3V31A 3FH5A 2Q7FA 4JPSA 5EN5D 2C0LA 4TUUA 5HQ8A 1UOHA 3PRZA 2V4LA 1ZBPA 4OYSA 5ENPD 5ARGA 4XIFA 3UT8A 4GTTA 3D9PA 3OXFA 3SQVA 5DBKA 4DX2A 3CVXA 4PUCA 3FDHA 4MKTA 3FTZA 4K03A 3U9WA 5ENRD 3FWVA 4N3AA 1L5JA 4F53A 2P9PG 4ATZD 1FVHA 1ELKA 2VGXB 5T3RA 2LSVA 3X2QE 3T5VA 4UWGA 3NBNB 1QQEA 4XEIG 5J08A 4WUYA 3LYAA 4IN3B 1OWMA 2WB2A 5ANRA 3Q5MA 1H6PA 2ONDA 4AP2A 3CHOA 1UW4B 1BI8B 4BSXA 3R9MA 1WG0A 3NB2A 5FT9A 3DBSA 3DSVA 2RFAA 3B7UX 1D9SA 4JL0A 1MX2A 2J49A 4A1SA 1TYQG 2RD0A 5FJYA 1HG2A 2GGFA 3UM3A 3IHYA 4L9PA 2I1JA 5AENA 3IHVA 1X5BA 3DEOA 5AAOA 4KMOA 4GAAA 5C1DA 3Q47B 2LAHA 2I6HA 4DI4A 4LUNU 4WNDA 4G1TA 2QYUA 4Q96A 5G55A 4JVSA 4U95D 4B0ZA 3QJZA 4AM9A 5FWQA 4G23A 3EHMA 1K1BA 3B7SA 2XS1A 4KT6B 2IF4A 4GYYA 1WDYA 1HFAA 4OVUA 4PS8A 3MKQA 3UX4A 2AW6A 3CKCA 2FBNA 3SBSA 3FHEA 4RQIA 3HXCA 3UPVA 5ENNA 4QFVA 4OAVB 4J7WA 3EHQA 2VJ8A 2P9LG 4F6RD 4XE0A 4TXRA 2IY0C 4GPMA 2HYZA 3FTYA 4AEZC 3NOGD 3I4GA 3ASDA 3MZLB 4CGVA 1N94A 4I9CA 1NA3A 1OCCE 3R9AB 3KD7A 5LCWJ 3SFZA 1QNFA 2EQXA 1NA0A 4GA2A 3FTWA 3D3MA 3KAEA 4L1BA 2UY1A 3ABME 5CHEE 1Y8MA 2RG8A 4B89A 4EZKA 4JA7A 2X3MA 2IEJA 3C5RA 3ABLE 4EZLA 2Y69E 3CHPA 4Q94A 4YVOA 3HRAA 1SVXA 1S63A 5H7PA 2A5EA 3Q73A 5FQ6A 2PQNA 2EINE 3ULEG 3FTSA 2QY7A 4X8QA 3HXBA 3RJVA 5FZRA 2GRQB 4UWLA 5CMYA 4TXPA 3R7RA 4KZCA 4G26A 3CVYA 3L13A 2LSUA 3FTUA 4GZ3A 3FUIA 4GTRA 3IKOB 4URKA 5BV0A 3MEKA 2AXZA 3DSWA 2YHEA 4N3BA 4GYWA 4KBQA 3ASHA 2WXPA 1E8YA 4UWKA 3WG7E 2BUGA 3ZXPA 3OAWA 5AIJA 4LERA 1TNOA 5KNGA 4U8YD 5KJNA 1DNPA 2IQCA 4I6EA 3RRUA 2IOSA 4CDRA 1IQRA 3PS6A 5CEAA 3TG5A 5JHAA 3FTVA 5KCMA 4GTVA 3ZYMA 4EECA 2IOLA 3O48A 3I4RB 3EHNA 4CCAA 1OWNA 4MS6A 4WWNA 2GROB 5CCMA 4N39A 2XRZA 3LDZA 3HVEA 3AAAC 4JC8A 5EX0A 2EIME 4HS2A 2DWZA 5AQBA 3RK6A 2H6IA 3LVQE 2VSOE 2KM4A 4DLQA 1RW2A 1HX8A 3L82A 4J6IA 5LFAA 5KWDA 4A3VA 1NI1A 4RVBA 2CG3A 4XX5A 3CHQA 5FZQA 3CGHA 5FQ7A 4LSZE 2KZTA 3PZ1A 3T9KA 4LG6A 4AXHA 4R7LA 3T8KA 3TWSA
chains in the Genus database with same CATH topology
3ZYLA 3QC1A 1ELWA 2YHCA 3ASFA 3QDNA 1OWPA 2L0TB 2JLBA 4ACLA 2OVBA 5ANLA 2BTDA 4L2LA 4KVMA 4GZCA 4I17A 1A17A 3ESKA 2C0MA 2WXIA 5EX3A 3ONKA 3SZ7A 1Z3YA 3CVPA 4JA9A 4GZ5A 3MCXA 2XRYA 3OXGA 4FC8A 4GB9A 2WQHA 4J8DA 2WXQA 3AS4A 3VLFA 1E90A 1HZ4A 4UQYA 3RKVA 2WQ7A 2FF4A 1E7UA 3U4TA 4N5CA 4I6JA 4FHKA 2VYIA 3FH8A 2WQ6A 4LEUA 3L6AA 5JJTA 5JJ7A 4F1SA 5LX8A 2V0PA 3CR3A 4FP7A 3LJ3A 4Y6WA 5KJMA 1LF8A 3CIAA 4CDNA 3AU5A 2NXPA 3CSFA 4U8HA 3ZYKA 3APFA 3ONLA 3FU6A 3CSTA 3FUMA 3RIBA 1OWLA 1N54A 3LKUA 4UQXA 3PNLB 1Z6TA 4GMLA 2GW1A 2V5FA 1TJFA 4AY6A 4JZYA 2A4ZA 3GZ2A 4HLEA 2XQ0A 2WXRA 3LY9A 3D9OA 5T8IA 4A55A 5KJLA 4J8SA 4U63A 1H19A 5G2NA 3VTYA 3VTXA 2WXHA 4PH4B 4BX9A 3ZGQA 2VQ2A 3FUHA 3VLDA 2FI7A 3CEQA 4AV7A 3D9MA 2XGMA 3CK9A 1H6KA 3FUFA 1GW6A 1HO8A 4GZDA 4J0UA 4NQ0A 3L16A 4BT9A 2KCVA 2AXVA 3U66A 4IRUA 4N3CA 3JCKC 2WXOA 3JUIA 4C9BB 3S7FA 3IBEA 3NF1A 2VGYA 2ILRA 1WY6A 4APFA 5BT1A 3EDTB 3FH7A 3JQ1A 4IULA 2HM8A 2R59A 4XKCA 5G05J 3NQPA 2YNQA 3FH5A 4LCTA 2Q7FA 3UUXA 3FUJA 4JPSA 2C0LA 4K0RA 4U0ZA 4TUUA 3UQ3A 4ANXA 5HQ8A 3PRZA 5ARFA 5FQ4A 4NRHB 2CHZA 4FJZA 2V4LA 1ZBPA 3FP3A 3QWPA 4OYSA 4CT0A 5ARGA 4O6FA 2I1KA 1UN8A 5EDSA 3CVUA 5G05C 5T4YA 4XIFA 3O4ZA 1JWFA 3R7QA 4GPKA 1EYHA 3UT8A 4WNEA 5BV1A 3FUKA 2QFCA 3SF4A 3QB2A 3D9PA 4BFRA 1B89A 3B7RL 3OXFA 4ILGA 1JUQA 4L23A 5DBKA 3C98A 3CVXA 1PY1A 3MJWA 3S2AA 4PUCA 3FDHA 4MKTA 3FTZA 4ACKA 3JYSA 4JHKA 3P1UA 2WXGA 3K9IA 4K03A 3U9WA 1MQSA 4FLBA 4HOTA 4IYPA 3APCA 3LEWA 3CHRA 3FWVA 3Q15A 4N3AA 4RSYA 2L9BA 4HVBA 1L5JA 3FU0A 3FUEA 3G2VA 2FEZA 4WNFA 4F53A 4P29A 4PDXA 3T8MA 2I9CA 3FY4A 3SNXA 3VLEA 1PAQA 1WAO1 1FVHA 2E0IA 1ELKA 2VGXB 2V8SE 5FZSA 3TJPA 2WPVA 4TV3A 4C0EA 5T3RA 1U3CA 1FCHA 2LSVA 3ZEFA 2OOEA 3T5VA 4UWGA 1XGWA 1QQEA 4GCNA 3PZDA 4HXIA 4FLHA 4C0MA 5J08A 4WUYA 4AIFA 3LYAA 4IN3B 1OWMA 3PEVB 2WB2A 5ANRA 4BWRA 2R17C 2OVFA 2XCBA 3Q5MA 2KCLA 3L17A 4G24A 3ZN3A 2ONDA 3UMVA 5CCLA 4AP2A 3CHOA 4D10C 1UW4B 3FULA 3MGBA 3B7TA 3Q49B 4RG6A 4CRWA 3B13A 5BPPA 1H2VC 3SD5A 4J8EA 2WM9A 4WWPA 4BSXA 4GA1A 3TXNA 3QNKA 5FT9A 3DBSA 3S7BA 3B7UX 3G2SA 2IJGX 2X6HA 1IYGA 3PH0C 4JL0A 3FUDA 4YNDA 4F3VA 3PE3A 2J49A 3G2WA 4EBAG 3LY8A 1U3DA 3D9NA 3HDXA 5E76A 3ZW3A 2JEKA 3ML8A 4CT4A 1UJKA 4A1SA 2RD0A 5FJYA 2XPIA 1HG2A 2GGFA 2MOWA 2XPYA 3IHYA 3LPZA 2I1JA 1ELRA 4J8FA 4A1GA 3QAQA 5AENA 4B8AA 3IHVA 1X5BA 3SGHA 1HXIA 4KMOA 1OWOA 3PE4A 3P2BA 2J07A 3ULQA 5KJKA 4GAAA 4GYOA 5C1DA 3Q47B 1OUVA 2LAHA 2I6HA 4DI4A 4LUNU 4WNDA 4G1TA 1XNFA 2XPZA 4F7AA 4U0SA 3SI5A 4Q96A 5G55A 4JVSA 5DIZA 3UT4A 4XZ4A 3RRNB 4B0ZA 1SQMA 3QJZA 2VSNA 2UY1B 2WVIA 4AM9A 3S7JA 1E7VA 3LY7A 5BUZA 3CK7A 1TJCA 4U0UA 3CQCB 4DJAA 5FWQA 4GCOA 2VGXA 4G23A 3EHMA 2PQRA 1YA0A 3B7SA 4KT6B 5EKQD 4EZLA 2X6IA 2J09A 2IF4A 3EIQC 4I9EA 3TGOA 1VDYA 4GYYA 2PM7A 4APOA 3CHSA 4BTBA 2LNIA 1HFAA 3BG1B 4KVOA 4OVUA 4FULA 4PS8A 3MKQA 3UX4A 2AW6A 3CKCA 1MHQA 2FBNA 5G04C 2CHXA 3FHEA 3SBSA 4FJYA 4GZ6A 1E8WA 2VSYA 3SBTB 2XGOA 3TL5A 4UI9K 3U64A 3UPVA 3DPDA 3TAXA 3HYMB 2VSXE 5HI7A 5ENNA 2R5SA 3L22A 3QWWA 4QFVA 4B8CB 4HORA 1W3BA 4M3OA 2VJ8A 3D9JA 4GU5A 4U07A 4FHJA 3S7DA 4JHJA 2Y4UA 1S0PA 2L6JA 5J90A 3NZSA 4XE0A 4DI3A 3PVLA 1QZ2A 2KCKA 2XGSA 3ML9A 4BY6A 4ANWA 2HYZA 1NP7A 3PEUB 3EIJA 3FTYA 5A6CA 4AEZC 1FVFA 4MRUA 4H7XA 3I4GA 4NACA 3MKRA 3ASDA 2AVPA 2BF0X 2KATA 3CQGB 2WXFA 3PDNA 4I2ZA 1P5QA 5BNWA 3MZLB 1HH8A 2ZU6B 4CGVA 1SZ9A 4EBAA 4FU3A 4I1MA 1Y6IA 3FU3A 4I9CA 4JHRA 3AU4A 3APDA 3URZA 2HR2A 1INZA 3D9KA 4XI0A 1NA3A 3FTXA 4I6GA 3KEZA 1HF8A 3I5PA 5JJ6A 3R9AB 3KD7A 1H2TC 4ILIA 4PS3A 5LCWJ 3SFZA 1QNFA 2EQXA 4UWHA 1IQUA 3MV2B 3RO2A 3CHMA 3CKBA 1NA0A 2A5UA 3GZ1A 3NZUA 4GA2A 1HG5A 3D9LA 3FTWA 2P58C 3D3MA 3OXLA 3KAEA 4L1BA 4OVVA 4E6HA 3CVVA 3QWVA 2WXKA 2UY1A 2Y3AA 2UWJG 2X6KA 2WXLA 3MKQB 4JEUA 1Y8MA 4V3IA 5CHEE 3TG4A 5LCWC 2RG8A 4B89A 2GRMA 3LS8A 2WMNA 2I2OA 2PL2A 3MYVA 2VTBA 1HS6A 1KLXA 4EZKA 2CFUA 4NURA 4JA7A 3OTNA 3HIZA 2PZIA 2J9QA 2X3MA 4ANUA 3TXMA 2LAIA 4KXKB 3RO3A 3E4BA 4DK5A 3FEYA 3FFLA 3SHFA 2KC7A 4AVXA 4B94A 5AYWD 4Q94A 3CHPA 4YVOA 5C2YA 3LXUX 2LO6A 3CV0A 4UQZA 2HO1A 2AXUA 4W9RA 2GRLA 5FQ6A 2PQNA 4I2WA 1HU3A 3L54A 1HE8A 5AJDA 5A7DB 3FTSA 4BX8A 1EPUA 1UJJA 2J4BA 4N2QA 2QY7A 5JHBA 1NZNA 3MX3A 3HVEB 3CVLA 4CDMA 1JPLA 3RJVA 5FZRA 4UWLA 5CMYA 1E8ZA 3RU0A 4XI9A 4WWOA 5LP0A 3R7RA 3ZYQA 4KZCA 1BPOA 4AOFA 5AJLA 4G26A 5D0QD 3CVYA 2L0IA 3L13A 2LSUA 3FTUA 4GZ3A 5LOZA 4UWFA 3FUIA 4FADA 3RRMB 5BW8C 2FO7A 4EQFA 5M72A 1JWGA 3IKOB 4URKA 5BV0A 4KZ0A 4KYOB 3QOUA 4G11A 3ZFWA 3ESLA 4UI9J 3ZHEA 3LCAA 3MEKA 4MLPA 2X6FA 4CEMA 4ABNA 4ME2A 4PS7A 4RG9A 4DPRA 2AXZA 4L2YA 3QARA 3FU5A 3ASGA 3PREA 3CVWA 1KT1A 3T5XA 3G2TA 2NSZA 1EF1C 1N52A 1EDUA 2MHKA 5G04J 3AS8A 4GA0A 3QK0A 2VTBB 3BG0B 2YHEA 2IONA 2XHEA 4N3BA 4GYWA 3PUKA 4KBQA 2KZTB 4UI9C 2AWIA 2IFUA 3IEGA 3MV3B 3D9IA 3ZXSA 2E2EA 3N71A 3Q4AB 4HOUA 5E75A 2OV8A 2DBAA 2WXPA 3ASHA 3ZRHA 1E8YA 3FUNA 4UWKA 4XKBA 3CK8A 3PNTB 1IHGA 2BUGA 3OAWA 5AIJA 3GW4A 4LERA 4AY5A 2M63A 4JW1A 5FTPA 4WNGA 5KJNA 2FULA 2IU1A 1KT0A 2MRIA 3BEEA 1DNPA 2IQCA 4I6EA 2C2LA 4EPZA 4ANVA 3MA5A 2YINA 3JQ0A 3RRUA 2IOSA 2YQ8A 2NC9A 3LVRE 1H2UA 2CHWA 3ENEA 4LRZA 1IQRA 2PM6A 2XCCA 3GYZA 3PS6A 1E8XA 4CDRA 4E85A 4A3TA 3TG5A 2WMOA 5JHAA 3FTVA 5KCMA 4TRQA 4HOSA 3FEXA 3ZYMA 1WM5A 4EECA 5A23A 2IOLA 3O48A 4L7TA 3ZVVA 4H7YA 4I43A 3GZSA 3I4RB 3EHNA 4CCAA 1OWNA 1H0AA 3L08A 4MS6A 2J4DA 3QKYA 4WWNA 1Z3XA 4ILHB 4HFGA 4U04A 5CCMA 4JXTA 4N39A 5D0OD 2XRZA 3LDZA 1PC2A 2DCPA 3HVEA 2Y4TA 4I1AA 5FQ8A 3ZHEB 3G2UA 4Q69A 2X38A 4JC8A 3CVQA 3HHMA 4Y6CA 5EX0A 4AJWA 4HS2A 3WXXA 1UG3A 2WXJA 3EJNA 3RK6A 3ZIMA 3PUJA 4EZJA 3LVQE 3AS5A 2VSOE 2KM4A 4WAFA 4DLQA 4HOQA 1HX8A 4DLOA 3UT7A 5CMWA 2CG2A 4BT8A 4J6IA 5LFAA 4A3VA 1TEZA 1SZAA 4G25A 3CLJA 3U3WA 4YVQC 2X6JA 3I3NA 4FA6A 3IV0A 4RVBA 2CG3A 2J08A 1UN9A 4GMJA 4XX5A 3CHQA 5FZQA 3CGHA 4N2SA 2WXNA 5FQ7A 3KS2A 4BTAA 2KZTA 4G2VA 3CVNA 2WXMA 2CFZA 1ZU2A 4CGWA 4AXHA 4JEHA 4ATGA 4I1OB 1E96B 4R7LA 2DIWA 3ZPJA 2XEVA 1DVPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ELW A;  2YHC A;  3ASF A;  3QDN A;  2JLB A;  4I17 A;  1A17 A;  3ESK A;  2C0M A;  5EX3 A;  3SZ7 A;  3CVP A;  4JA9 A;  4GZ5 A;  3OXG A;  4J8D A;  2WQH A;  3AS4 A;  3RKV A;  1HZ4 A;  4UQY A;  2FF4 A;  3U4T A;  4N5C A;  2VYI A;  4LEU A;  5JJT A;  5JJ7 A;  4Y6W A;  5KJM A;  3RIB A;  3LKU A;  4UQX A;  2GW1 A;  2V5F A;  4AY6 A;  3GZ2 A;  3LY9 A;  5KJL A;  3VTY A;  3VTX A;  3ZGQ A;  2VQ2 A;  2FI7 A;  3CEQ A;  2XGM A;  3CK9 A;  4NQ0 A;  4J0U A;  4BT9 A;  2KCV A;  4N3C A;  3S7F A;  3NF1 A;  2VGY A;  5BT1 A;  3EDT B;  5G05 J;  2Q7F A;  3UUX A;  2C0L A;  4U0Z A;  5HQ8 A;  3UQ3 A;  5ARF A;  4NRH B;  1ZBP A;  3FP3 A;  3QWP A;  5ARG A;  4O6F A;  5G05 C;  4XIF A;  4GPK A;  4WNE A;  2QFC A;  3SF4 A;  1B89 A;  3OXF A;  5DBK A;  3JYS A;  3K9I A;  4HOT A;  3Q15 A;  3FWV A;  4N3A A;  2FEZ A;  4WNF A;  1WAO 1;  2VGX B;  5FZS A;  2WPV A;  1FCH A;  2LSV A;  2OOE A;  1QQE A;  4GCN A;  4WUY A;  4AIF A;  3LYA A;  4IN3 B;  4BWR A;  2XCB A;  3Q5M A;  2KCL A;  4G24 A;  3ZN3 A;  5CCL A;  2OND A;  3Q49 B;  4RG6 A;  4J8E A;  4GA1 A;  5FT9 A;  3S7B A;  1IYG A;  4JL0 A;  4YND A;  4F3V A;  3PE3 A;  3LY8 A;  4A1S A;  5FJY A;  2XPI A;  3LPZ A;  1ELR A;  4J8F A;  1HXI A;  3PE4 A;  5KJK A;  3ULQ A;  4GYO A;  5C1D A;  3Q47 B;  1OUV A;  2I6H A;  4WND A;  4G1T A;  1XNF A;  4U0S A;  5DIZ A;  2VSN A;  2UY1 B;  4AM9 A;  3S7J A;  3LY7 A;  3CK7 A;  1TJC A;  4U0U A;  4GCO A;  2VGX A;  4G23 A;  2PQR A;  1YA0 A;  5EKQ D;  2IF4 A;  4I9E A;  3TGO A;  4GYY A;  4APO A;  4BTB A;  2LNI A;  5G04 C;  3CKC A;  2FBN A;  4GZ6 A;  2VSY A;  2XGO A;  4UI9 K;  3UPV A;  3TAX A;  3HYM B;  5HI7 A;  4HOR A;  2R5S A;  3QWW A;  1W3B A;  4U07 A;  3S7D A;  2Y4U A;  2L6J A;  1QZ2 A;  2KCK A;  2XGS A;  2HYZ A;  5A6C A;  4H7X A;  3MKR A;  3ASD A;  2AVP A;  2KAT A;  3PDN A;  4I2Z A;  1P5Q A;  5BNW A;  1HH8 A;  4CGV A;  4I9C A;  4JHR A;  3URZ A;  2HR2 A;  4XI0 A;  1NA3 A;  5JJ6 A;  3R9A B;  3KD7 A;  5LCW J;  3MV2 B;  3RO2 A;  3CKB A;  1NA0 A;  3GZ1 A;  4GA2 A;  3OXL A;  2P58 C;  3KAE A;  3QWV A;  2UY1 A;  2UWJ G;  5LCW C;  5CHE E;  1Y8M A;  3TG4 A;  2PL2 A;  1KLX A;  4JA7 A;  2PZI A;  2J9Q A;  4KXK B;  3RO3 A;  3E4B A;  3FFL A;  2KC7 A;  4B94 A;  5AYW D;  4YVO A;  3CV0 A;  4UQZ A;  2HO1 A;  4W9R A;  2PQN A;  4I2W A;  5A7D B;  4N2Q A;  1NZN A;  3CVL A;  3RJV A;  5FZR A;  3RU0 A;  4XI9 A;  4G26 A;  5D0Q D;  2LSU A;  4GZ3 A;  5M72 A;  5BW8 C;  2FO7 A;  4EQF A;  4KYO B;  3QOU A;  3ZFW A;  4UI9 J;  3ZHE A;  3LCA A;  3MEK A;  4ABN A;  4ME2 A;  4RG9 A;  3ASG A;  1KT1 A;  5G04 J;  2MHK A;  3AS8 A;  4GA0 A;  4N3B A;  4GYW A;  4KBQ A;  4UI9 C;  3IEG A;  2IFU A;  3MV3 B;  2E2E A;  3N71 A;  3Q4A B;  4HOU A;  3ASH A;  2DBA A;  3CK8 A;  1IHG A;  2BUG A;  3GW4 A;  4AY5 A;  5FTP A;  4WNG A;  5KJN A;  1KT0 A;  3BEE A;  2C2L A;  3MA5 A;  2YQ8 A;  2NC9 A;  4CDR A;  2XCC A;  3GYZ A;  3TG5 A;  4HOS A;  1WM5 A;  3O48 A;  4H7Y A;  3QKY A;  4U04 A;  5CCM A;  4N39 A;  5D0O D;  1PC2 A;  2Y4T A;  4I1A A;  3ZHE B;  3CVQ A;  4Y6C A;  5EX0 A;  3WXX A;  3AS5 A;  4HOQ A;  4BT8 A;  4G25 A;  3U3W A;  4YVQ C;  5FZQ A;  4N2S A;  4BTA A;  3KS2 A;  4G2V A;  3CVN A;  1ZU2 A;  4CGW A;  1E96 B;  3ZPJ A;  2XEV A; 
#chains in the Genus database with same CATH topology
 2YHC A;  2HE0 A;  1OWP A;  2L0T B;  4ACL A;  2OVB A;  5ANL A;  2P9K G;  1A17 A;  5EX3 A;  4GZ5 A;  2WQH A;  1E90 A;  2WQ7 A;  3J5P A;  2R05 A;  2OEW A;  4Y6W A;  2P9N G;  3AU5 A;  3CSF A;  2EIL E;  4LNU D;  4K5B A;  3Q9U C;  3LKU A;  2P9S G;  3LY9 A;  5EID A;  3VTY A;  3VTX A;  5CBO A;  4PH4 B;  3ZGQ A;  4NIK A;  3SY2 A;  2FI7 A;  3D9M A;  3CK9 A;  4GZD A;  4J0U A;  2BED A;  3L16 A;  2AXV A;  3HXF A;  4IUL A;  4BSZ B;  2V4H C;  4LCT A;  4ANX A;  4U0Z A;  5FQ4 A;  4FJZ A;  4B93 B;  1UN8 A;  3CVU A;  4GPK A;  5AAR A;  5BV1 A;  3SFX A;  2DYR E;  1JUQ A;  4L23 A;  3Q75 A;  3MJW A;  2DYS E;  3JYS A;  3P1U A;  1BI7 B;  1MQS A;  1KZO A;  4BET A;  4O60 A;  4RSY A;  3TWX A;  2B0O E;  1N4Q A;  3FUE A;  3T8M A;  2I9C A;  3E34 A;  1WAO 1;  2E0I A;  4O1O A;  4LNG A;  3TJP A;  4C0E A;  1XGW A;  3PZD A;  4HXI A;  2VGE A;  1TN6 A;  2XCB A;  1K1A A;  4G24 A;  1OCO E;  3ZN3 A;  2GRN B;  4D10 C;  3AJI A;  1U2V G;  3MGB A;  3DXK G;  4RG6 A;  4CRW A;  3UXG A;  2WM9 A;  4BES A;  3F6Q A;  3TXN A;  3QNK A;  3UKU G;  1LD8 A;  2X6H A;  3FUD A;  4F3V A;  3G2W A;  1SA5 A;  1MZC A;  3LY8 A;  1U3D A;  4CT4 A;  3HDX A;  2JEK A;  2MOW A;  1ELR A;  4J8F A;  3QAQ A;  1MX4 A;  2XZD G;  4GTO A;  3P2B A;  5KJK A;  4GYO A;  1OUV A;  4J8Y A;  2FO1 E;  4U0S A;  3SI5 A;  3UT4 A;  1MJ0 A;  1SQM A;  2VSN A;  1OY3 D;  5CED B;  1JCR A;  1E7V A;  3C72 A;  3CQC B;  4GCO A;  4U96 D;  4YDE A;  1YA0 A;  3AG1 E;  2J09 A;  3TGO A;  4FUL A;  4GZ6 A;  1E8W A;  3SBT B;  3DPD A;  4K5A B;  5HI7 A;  5HRY A;  5CBN A;  3L22 A;  3Q7F A;  4DUI A;  1W3B A;  2L6J A;  4DI3 A;  1FT2 A;  2XGS A;  2XZT G;  4ANW A;  5A6C A;  4MRU A;  5ITZ F;  4NAC A;  3ULY A;  2KAT A;  3Q7A A;  4FU3 A;  4I1M A;  4JHR A;  2ZGD A;  3APD A;  4XI0 A;  5AQ9 A;  1HF8 A;  3I5P A;  4ILI A;  4PS3 A;  2H6G A;  2B6C A;  1IQU A;  3RO2 A;  2LUH A;  3CHM A;  3CKB A;  3GZ1 A;  3NZU A;  1HG5 A;  3QWV A;  2WXK A;  1N4R A;  2UWJ G;  2X6K A;  1TR4 A;  2GRM A;  2I2O A;  1X81 A;  3NAW A;  2PL2 A;  4CYM D;  1O1R A;  2J9Q A;  3TXM A;  4KXK B;  3RO3 A;  3E4B A;  3SHF A;  4B94 A;  1OXJ A;  4UQZ A;  2HO1 A;  4W9R A;  3TWW A;  4A63 B;  1HE8 A;  5A7D B;  1UJJ A;  2AJA A;  4N2Q A;  3CVL A;  1JPL A;  1K8K G;  5D66 A;  4XI9 A;  4WWO A;  1BPO A;  5AQ7 A;  4EHM A;  4UWF A;  4FAD A;  3RRM B;  1JWG A;  1YMP A;  3C3O A;  4KZ0 A;  4KYO B;  3QOU A;  4UI9 J;  4CEM A;  4MLP A;  4DPR A;  4ABN A;  4L2Y A;  3T5X A;  5B1A E;  1EDU A;  2MHK A;  3QK0 A;  5E75 A;  3ZRH A;  4XKB A;  1IHG A;  4HI8 A;  4AY5 A;  2M63 A;  4JW1 A;  2DZN A;  1SW6 A;  4WNG A;  1KT0 A;  2MRI A;  3BEE A;  2C2L A;  4ANV A;  2YQ8 A;  3LVR E;  2PM6 A;  2WMO A;  3DST A;  2KBX A;  3FEX A;  4L7T A;  3ZVV A;  4I43 A;  2H6H A;  3EUV A;  3EHR A;  3RSE G;  4HFG A;  4U04 A;  5KNH D;  5D0O D;  2DCP A;  4I1A A;  3ZHE B;  4Q69 A;  3UM1 A;  2X38 A;  3V79 K;  3HHM A;  4K5C A;  3JXJ A;  4AJW A;  2WXJ A;  3C3Q A;  3ZIM A;  3PUJ A;  4EZJ A;  4WAF A;  3ASO E;  5CMW A;  3UT7 A;  4BT8 A;  3V30 A;  1TEZ A;  1SZA A;  3I3N A;  3IV0 A;  1UN9 A;  3L9T A;  4QQI A;  3KS2 A;  4G2V A;  3CVN A;  1ZU2 A;  4CGW A;  1IKN D;  4JEH A;  4I1O B;  1E96 B;  2XEV A;  1TNY A;  4OAU C;  3ZYL A;  1ELW A;  3Q79 A;  3QDN A;  4U7E B;  2BTD A;  3E32 A;  2ETB A;  1YYH A;  2WXI A;  1G3N B;  4J8D A;  2XRY A;  4FC8 A;  1N95 A;  2WXQ A;  3RKV A;  1O5M A;  3FH8 A;  1YCS B;  3L6A A;  4LEU A;  5JJ7 A;  2V0P A;  4FP7 A;  1LF8 A;  3CIA A;  2BKG A;  5ENQ D;  2NXP A;  3ONL A;  5JA4 D;  1OWL A;  4GML A;  4AY6 A;  2L6B A;  5T8I A;  5KJL A;  4J8S A;  3Q9N C;  2WXH A;  2VQ2 A;  3FUH A;  2XEH A;  4ZFH A;  3FUF A;  4BT9 A;  5AQA A;  2KCV A;  3U66 A;  3JCK C;  2WXO A;  2XEN A;  3S7F A;  3NF1 A;  2VGY A;  3NOC D;  2ILR A;  1WY6 A;  5BT1 A;  2YNQ A;  3FUJ A;  4NRH B;  1Z5S C;  2KXP C;  3QWP A;  4CT0 A;  3ABK E;  3EU9 A;  5G05 C;  5T4Y A;  3O4Z A;  3R7Q A;  1ZB1 A;  2QFC A;  3FUK A;  3QB2 A;  3SF4 A;  4BFR A;  3B7R L;  4ILG A;  3C98 A;  1PY1 A;  1IHB A;  4ACK A;  3DSS A;  3K9I A;  4FLB A;  4HOT A;  4ZHB A;  4IYP A;  1MYO A;  4G8K A;  3SFY A;  3LEW A;  3CHR A;  2L9B A;  3PZ2 A;  1OT8 A;  2FEZ A;  4P29 A;  4PDX A;  3FY4 A;  3SNX A;  3VLE A;  1PAQ A;  2WPV A;  4YDY A;  1U3C A;  1FCH A;  3KSQ A;  2Y0B G;  3ZEF A;  2OOE A;  4GCN A;  4FLH A;  4AIF A;  3PEV B;  2R17 C;  2OVF A;  2KCL A;  3L17 A;  4HLL A;  2QYJ A;  1AWC B;  3B13 A;  4G8L A;  4WWP A;  2RKK A;  3S7B A;  3G2S A;  2IJG X;  5ENT D;  1SA4 A;  3D9N A;  3ZW3 A;  3ML8 A;  3UI2 A;  3JUE A;  3TWT A;  3C3R A;  4A1G A;  1OCZ E;  1OWO A;  3ULQ A;  1OCR E;  2XPZ A;  2OCC E;  3RRN B;  2UY1 B;  2WVI A;  3UTM A;  3CK7 A;  1TJC A;  4U0U A;  4DJA A;  2VGX A;  2PQR A;  1DCE A;  2X6I A;  4I9E A;  4APO A;  3CHS A;  4BTB A;  2LNI A;  2PNN A;  3ISM C;  2CHX A;  5FIO A;  5JMN D;  3U64 A;  4HOR A;  4GTS A;  3QWW A;  3DRA A;  4U07 A;  4YDO A;  5IY5 E;  3S7D A;  3NZS A;  4HNA D;  1QZ2 A;  2KCK A;  3ZUV B;  1FVF A;  3MKR A;  2AVP A;  3CQG B;  2WXF A;  3PDN A;  5BNW A;  1HH8 A;  2ZU6 B;  2LXM A;  3AU4 A;  3URZ A;  1N9A A;  1N0Q A;  3D9K A;  4I6G A;  3KEZ A;  1H2T C;  2F37 A;  3MV2 B;  5FIN A;  1H6O A;  2A5U A;  3OXL A;  2P58 C;  4N5Q A;  4E6H A;  3IXE A;  3CVV A;  4BEP A;  2Y3A A;  4JEU A;  5LCW C;  4V3I A;  3TG4 A;  3LS8 A;  3DPY A;  2LXL A;  1HS6 A;  2CFU A;  4NUR A;  3OTN A;  3HIZ A;  4ANU A;  2LAI A;  5B3S E;  1LD7 A;  2KC7 A;  4AVX A;  5AYW D;  3LXU X;  4HB5 A;  2LO6 A;  5CER B;  2ZGG A;  4I2W A;  1HU3 A;  3E30 A;  3L54 A;  2OEV A;  5AJD A;  4DX7 D;  1EPU A;  1JCS A;  5JHB A;  3HVE B;  4CDM A;  1E8Z A;  4AOF A;  3UKR G;  2L0I A;  1N4P A;  4EQF A;  2FO7 A;  3RAU A;  4G11 A;  3ZHE A;  3LCA A;  5EYL A;  4ME2 A;  2H6F A;  4PS7 A;  4RG9 A;  3QAR A;  3FU5 A;  3CVW A;  3HXD A;  1KT1 A;  2NSZ A;  1EF1 C;  1N52 A;  5G04 J;  3AS8 A;  2VTB B;  2ION A;  2XHE A;  2KZT B;  2AWI A;  2IFU A;  3D9I A;  3ZXS A;  2E2E A;  3N71 A;  3Q4A B;  5D2M C;  2DBA A;  5BXU A;  3CK8 A;  3PNT B;  4HBD A;  5FTP A;  2FUL A;  2IU1 A;  1AP7 A;  3MA5 A;  2YIN A;  1H2U A;  3ENE A;  4LRZ A;  2XCC A;  3GYZ A;  3KEA A;  3AG4 E;  3V2O A;  3W9G A;  4H7Y A;  4TUM A;  3DXM G;  1H0A A;  3BQO A;  3QKY A;  4ILH B;  3DWL G;  2F8Y A;  1PC2 A;  1LTX A;  5CRV A;  3AS5 A;  1S64 A;  4DLO A;  2R02 A;  4TXQ A;  4G25 A;  3CLJ A;  3U3W A;  2JAB A;  3DEP A;  5EIL A;  2J08 A;  1BU9 A;  4Z68 A;  3B7B A;  3HXE A;  1QYM A;  2WXM A;  2CFZ A;  5EYP F;  1KZP A;  4ATG A;  2DIW A;  3ZPJ A;  3QC1 A;  3ASF A;  1V54 E;  4L2L A;  4GZC A;  3SZ7 A;  1Z3Y A;  3CVP A;  4GB9 A;  3AS4 A;  3VLF A;  1HZ4 A;  1E7U A;  3U4T A;  4DX6 D;  4N5C A;  4I6J A;  3D9H A;  5LX8 A;  3CR3 A;  3LJ3 A;  5KJM A;  4CDN A;  4U8H A;  2MYO A;  3CST A;  4RLY A;  3RIB A;  4UQX A;  3BU8 A;  3PNL B;  2GW1 A;  5HKP A;  4JZY A;  3GZ2 A;  2QC9 A;  2WXR A;  3D9O A;  4O1P A;  5HS0 A;  3AG2 E;  4BX9 A;  5CRU A;  1H6K A;  4NQ0 A;  1HO8 A;  1BD8 A;  1Q2Z A;  4IRU A;  4C9B B;  3IBE A;  4APF A;  3JQ1 A;  4BER A;  2HM8 A;  4MBG A;  3NQP A;  3UUX A;  4K0R A;  3UIN C;  3UQ3 A;  4GTP A;  4JD2 G;  5ARF A;  2CHZ A;  5ENS D;  3FP3 A;  1TN8 A;  5KBA A;  4O6F A;  2I1K A;  5EDS A;  1JCQ A;  2EIJ E;  1JWF A;  1EYH A;  4WNE A;  4DX5 D;  3HG0 D;  1B89 A;  3W9F A;  3BUA A;  3S2A A;  1DCQ A;  4JHK A;  2WXG A;  3APC A;  3Q15 A;  4HVB A;  5CEC B;  2EIK E;  3FU0 A;  3G2V A;  4WNF A;  4GMR A;  2DZO A;  2Y1L E;  3DSX A;  3Q78 A;  2V8S E;  5FZS A;  2ETC A;  2XS8 A;  4TV3 A;  2ETA A;  2RFM A;  4C0M A;  3TWQ A;  2J8S D;  4BWR A;  1RZ4 A;  5CCL A;  3UMV A;  3Q49 B;  3FUL A;  3B7T A;  5BPP A;  1H2V C;  3SD5 A;  4J8E A;  4GA1 A;  1IYG A;  3PH0 C;  4YND A;  3PE3 A;  4EBA G;  3PZ3 A;  5E76 A;  1UJK A;  2XPI A;  3SO8 A;  2DVW A;  2XPY A;  3LPZ A;  1QBQ A;  3V2X A;  4B8A A;  3SGH A;  1HXI A;  3PE4 A;  2J07 A;  1D8E A;  4F1P A;  1XNF A;  1BLX B;  4F7A A;  5DIZ A;  4XZ4 A;  4HI9 A;  3S7J A;  3LY7 A;  5BUZ A;  1A5E A;  3AG3 E;  2GRR B;  5EKQ D;  3EIQ C;  3ZNG A;  1VDY A;  2PM7 A;  3BG1 B;  4KVO A;  1K3Z D;  5G04 C;  1MHQ A;  4FJY A;  2VSY A;  2XGO A;  1NL4 A;  3J5Q B;  4UI9 K;  3TL5 A;  3TAX A;  3HYM B;  2VSX E;  4B8C B;  2R5S A;  4M3O A;  1KPS B;  3D9J A;  4GU5 A;  4FHJ A;  3UM2 A;  4JHJ A;  1S0P A;  2Y4U A;  5J90 A;  2IO2 C;  2ZIS A;  3PVL A;  1IXV A;  3ML9 A;  4BY6 A;  3KSL A;  2BKK B;  1NP7 A;  3PEU B;  3EIJ A;  4HQD A;  4H7X A;  3UIO C;  2BF0 X;  4I2Z A;  1P5Q A;  1SZ9 A;  4EBA A;  1Y6I A;  3FU3 A;  2HR2 A;  1INZ A;  3E37 A;  3FTX A;  5JJ6 A;  4UWH A;  3EU5 A;  3B95 A;  4DRX E;  3D9L A;  4OVV A;  1N0R A;  5EIB E;  2WXL A;  3MKQ B;  3TWR A;  1TNB A;  2WMN A;  3MYV A;  2VTB A;  1KLX A;  2PZI A;  3PZ4 A;  5ENO D;  4DK5 A;  3FEY A;  3FFL A;  5C2Y A;  4JB8 P;  3CV0 A;  2AXU A;  2GRL A;  2IO3 C;  1FPP A;  3ASN E;  3TWV A;  4BX8 A;  2J4B A;  1NZN A;  3MX3 A;  3ZKJ A;  3RU0 A;  5LP0 A;  3ZYQ A;  5AJL A;  5D0Q D;  5LOZ A;  5M72 A;  5BW8 C;  4GTQ A;  4DX1 A;  3ZFW A;  3ESL A;  2F0Y A;  4CZ2 D;  2X6F A;  2P2C P;  1FT1 A;  3ASG A;  3PRE A;  1O1S A;  3G2T A;  1DC2 A;  2ZIR A;  3LJN A;  4U8V D;  1TNU A;  4GA0 A;  3BG0 B;  3PUK A;  2P9I G;  4UI9 C;  3IEG A;  3MV3 B;  4HOU A;  2OV8 A;  3FUN A;  3TWU A;  3GW4 A;  1N4S A;  4EPZ A;  3JQ0 A;  2NC9 A;  2CHW A;  1E8X A;  4E85 A;  4A3T A;  4TRQ A;  4HOS A;  3UIP C;  1WM5 A;  5A23 A;  3GZS A;  3L08 A;  4M7C A;  2J4D A;  1Z3X A;  1D8D A;  4JXT A;  3ZU7 B;  5AN8 A;  5FQ8 A;  2Y4T A;  3G2U A;  3CVQ A;  4Y6C A;  1V55 E;  3WXX A;  1UG3 A;  4YDW A;  3EJN A;  2V5Q C;  3DSU A;  4HOQ A;  2CG2 A;  3E33 A;  1TNZ A;  4YVQ C;  2X6J A;  4FA6 A;  4C48 B;  2GRP B;  4GMJ A;  4N2S A;  1MX6 A;  2WXN A;  4BTA A;  1S70 B;  2F8X K;  4LNB A;  3UM0 A;  1O1T A;  1DVP A;  1N11 A;  2JLB A;  5BXO A;  4KVM A;  4GTM A;  4I17 A;  3ESK A;  2C0M A;  2QZA A;  3ONK A;  4JA9 A;  3MCX A;  3OXG A;  4UQY A;  2FF4 A;  4FHK A;  2VYI A;  1NFI E;  2WQ6 A;  5JJT A;  4F1S A;  3JXI A;  3ZYK A;  3APF A;  5B1B E;  3FU6 A;  2ZXW E;  3FUM A;  1N54 A;  1Z6T A;  2V5F A;  1TJF A;  2A4Z A;  2R03 A;  4HLE A;  2XQ0 A;  4A55 A;  2P9U G;  4U63 A;  1H19 A;  5G2N A;  3VLD A;  4HRN A;  3CEQ A;  4AV7 A;  4HRL A;  2XGM A;  2R2L A;  4UUC A;  1GW6 A;  4HRM B;  4N3C A;  3JUI A;  2XEE A;  2NYJ A;  3EDT B;  3FH7 A;  1TN7 A;  2R59 A;  4XKC A;  5G05 J;  3V31 A;  3FH5 A;  2Q7F A;  4JPS A;  5EN5 D;  2C0L A;  4TUU A;  5HQ8 A;  1UOH A;  3PRZ A;  2V4L A;  1ZBP A;  4OYS A;  5ENP D;  5ARG A;  4XIF A;  3UT8 A;  4GTT A;  3D9P A;  3OXF A;  3SQV A;  5DBK A;  4DX2 A;  3CVX A;  4PUC A;  3FDH A;  4MKT A;  3FTZ A;  4K03 A;  3U9W A;  5ENR D;  3FWV A;  4N3A A;  1L5J A;  4F53 A;  2P9P G;  4ATZ D;  1FVH A;  1ELK A;  2VGX B;  5T3R A;  2LSV A;  3X2Q E;  3T5V A;  4UWG A;  3NBN B;  1QQE A;  4XEI G;  5J08 A;  4WUY A;  3LYA A;  4IN3 B;  1OWM A;  2WB2 A;  5ANR A;  3Q5M A;  1H6P A;  2OND A;  4AP2 A;  3CHO A;  1UW4 B;  1BI8 B;  4BSX A;  3R9M A;  1WG0 A;  3NB2 A;  5FT9 A;  3DBS A;  3DSV A;  2RFA A;  3B7U X;  1D9S A;  4JL0 A;  1MX2 A;  2J49 A;  4A1S A;  1TYQ G;  2RD0 A;  5FJY A;  1HG2 A;  2GGF A;  3UM3 A;  3IHY A;  4L9P A;  2I1J A;  5AEN A;  3IHV A;  1X5B A;  3DEO A;  5AAO A;  4KMO A;  4GAA A;  5C1D A;  3Q47 B;  2LAH A;  2I6H A;  4DI4 A;  4LUN U;  4WND A;  4G1T A;  2QYU A;  4Q96 A;  5G55 A;  4JVS A;  4U95 D;  4B0Z A;  3QJZ A;  4AM9 A;  5FWQ A;  4G23 A;  3EHM A;  1K1B A;  3B7S A;  2XS1 A;  4KT6 B;  2IF4 A;  4GYY A;  1WDY A;  1HFA A;  4OVU A;  4PS8 A;  3MKQ A;  3UX4 A;  2AW6 A;  3CKC A;  2FBN A;  3SBS A;  3FHE A;  4RQI A;  3HXC A;  3UPV A;  5ENN A;  4QFV A;  4OAV B;  4J7W A;  3EHQ A;  2VJ8 A;  2P9L G;  4F6R D;  4XE0 A;  4TXR A;  2IY0 C;  4GPM A;  2HYZ A;  3FTY A;  4AEZ C;  3NOG D;  3I4G A;  3ASD A;  3MZL B;  4CGV A;  1N94 A;  4I9C A;  1NA3 A;  1OCC E;  3R9A B;  3KD7 A;  5LCW J;  3SFZ A;  1QNF A;  2EQX A;  1NA0 A;  4GA2 A;  3FTW A;  3D3M A;  3KAE A;  4L1B A;  2UY1 A;  3ABM E;  5CHE E;  1Y8M A;  2RG8 A;  4B89 A;  4EZK A;  4JA7 A;  2X3M A;  2IEJ A;  3C5R A;  3ABL E;  4EZL A;  2Y69 E;  3CHP A;  4Q94 A;  4YVO A;  3HRA A;  1SVX A;  1S63 A;  5H7P A;  2A5E A;  3Q73 A;  5FQ6 A;  2PQN A;  2EIN E;  3ULE G;  3FTS A;  2QY7 A;  4X8Q A;  3HXB A;  3RJV A;  5FZR A;  2GRQ B;  4UWL A;  5CMY A;  4TXP A;  3R7R A;  4KZC A;  4G26 A;  3CVY A;  3L13 A;  2LSU A;  3FTU A;  4GZ3 A;  3FUI A;  4GTR A;  3IKO B;  4URK A;  5BV0 A;  3MEK A;  2AXZ A;  3DSW A;  2YHE A;  4N3B A;  4GYW A;  4KBQ A;  3ASH A;  2WXP A;  1E8Y A;  4UWK A;  3WG7 E;  2BUG A;  3ZXP A;  3OAW A;  5AIJ A;  4LER A;  1TNO A;  5KNG A;  4U8Y D;  5KJN A;  1DNP A;  2IQC A;  4I6E A;  3RRU A;  2IOS A;  4CDR A;  1IQR A;  3PS6 A;  5CEA A;  3TG5 A;  5JHA A;  3FTV A;  5KCM A;  4GTV A;  3ZYM A;  4EEC A;  2IOL A;  3O48 A;  3I4R B;  3EHN A;  4CCA A;  1OWN A;  4MS6 A;  4WWN A;  2GRO B;  5CCM A;  4N39 A;  2XRZ A;  3LDZ A;  3HVE A;  3AAA C;  4JC8 A;  5EX0 A;  2EIM E;  4HS2 A;  2DWZ A;  5AQB A;  3RK6 A;  2H6I A;  3LVQ E;  2VSO E;  2KM4 A;  4DLQ A;  1RW2 A;  1HX8 A;  3L82 A;  4J6I A;  5LFA A;  5KWD A;  4A3V A;  1NI1 A;  4RVB A;  2CG3 A;  4XX5 A;  3CHQ A;  5FZQ A;  3CGH A;  5FQ7 A;  4LSZ E;  2KZT A;  3PZ1 A;  3T9K A;  4LG6 A;  4AXH A;  4R7L A;  3T8K A;  3TWS A; 
#chains in the Genus database with same CATH homology
 3ZYL A;  3QC1 A;  1ELW A;  2YHC A;  3ASF A;  3QDN A;  1OWP A;  2L0T B;  2JLB A;  4ACL A;  2OVB A;  5ANL A;  2BTD A;  4L2L A;  4KVM A;  4GZC A;  4I17 A;  1A17 A;  3ESK A;  2C0M A;  2WXI A;  5EX3 A;  3ONK A;  3SZ7 A;  1Z3Y A;  3CVP A;  4JA9 A;  4GZ5 A;  3MCX A;  2XRY A;  3OXG A;  4FC8 A;  4GB9 A;  2WQH A;  4J8D A;  2WXQ A;  3AS4 A;  3VLF A;  1E90 A;  1HZ4 A;  4UQY A;  3RKV A;  2WQ7 A;  2FF4 A;  1E7U A;  3U4T A;  4N5C A;  4I6J A;  4FHK A;  2VYI A;  3FH8 A;  2WQ6 A;  4LEU A;  3L6A A;  5JJT A;  5JJ7 A;  4F1S A;  5LX8 A;  2V0P A;  3CR3 A;  4FP7 A;  3LJ3 A;  4Y6W A;  5KJM A;  1LF8 A;  3CIA A;  4CDN A;  3AU5 A;  2NXP A;  3CSF A;  4U8H A;  3ZYK A;  3APF A;  3ONL A;  3FU6 A;  3CST A;  3FUM A;  3RIB A;  1OWL A;  1N54 A;  3LKU A;  4UQX A;  3PNL B;  1Z6T A;  4GML A;  2GW1 A;  2V5F A;  1TJF A;  4AY6 A;  4JZY A;  2A4Z A;  3GZ2 A;  4HLE A;  2XQ0 A;  2WXR A;  3LY9 A;  3D9O A;  5T8I A;  4A55 A;  5KJL A;  4J8S A;  4U63 A;  1H19 A;  5G2N A;  3VTY A;  3VTX A;  2WXH A;  4PH4 B;  4BX9 A;  3ZGQ A;  2VQ2 A;  3FUH A;  3VLD A;  2FI7 A;  3CEQ A;  4AV7 A;  3D9M A;  2XGM A;  3CK9 A;  1H6K A;  3FUF A;  1GW6 A;  1HO8 A;  4GZD A;  4J0U A;  4NQ0 A;  3L16 A;  4BT9 A;  2KCV A;  2AXV A;  3U66 A;  4IRU A;  4N3C A;  3JCK C;  2WXO A;  3JUI A;  4C9B B;  3S7F A;  3IBE A;  3NF1 A;  2VGY A;  2ILR A;  1WY6 A;  4APF A;  5BT1 A;  3EDT B;  3FH7 A;  3JQ1 A;  4IUL A;  2HM8 A;  2R59 A;  4XKC A;  5G05 J;  3NQP A;  2YNQ A;  3FH5 A;  4LCT A;  2Q7F A;  3UUX A;  3FUJ A;  4JPS A;  2C0L A;  4K0R A;  4U0Z A;  4TUU A;  3UQ3 A;  4ANX A;  5HQ8 A;  3PRZ A;  5ARF A;  5FQ4 A;  4NRH B;  2CHZ A;  4FJZ A;  2V4L A;  1ZBP A;  3FP3 A;  3QWP A;  4OYS A;  4CT0 A;  5ARG A;  4O6F A;  2I1K A;  1UN8 A;  5EDS A;  3CVU A;  5G05 C;  5T4Y A;  4XIF A;  3O4Z A;  1JWF A;  3R7Q A;  4GPK A;  1EYH A;  3UT8 A;  4WNE A;  5BV1 A;  3FUK A;  2QFC A;  3SF4 A;  3QB2 A;  3D9P A;  4BFR A;  1B89 A;  3B7R L;  3OXF A;  4ILG A;  1JUQ A;  4L23 A;  5DBK A;  3C98 A;  3CVX A;  1PY1 A;  3MJW A;  3S2A A;  4PUC A;  3FDH A;  4MKT A;  3FTZ A;  4ACK A;  3JYS A;  4JHK A;  3P1U A;  2WXG A;  3K9I A;  4K03 A;  3U9W A;  1MQS A;  4FLB A;  4HOT A;  4IYP A;  3APC A;  3LEW A;  3CHR A;  3FWV A;  3Q15 A;  4N3A A;  4RSY A;  2L9B A;  4HVB A;  1L5J A;  3FU0 A;  3FUE A;  3G2V A;  2FEZ A;  4WNF A;  4F53 A;  4P29 A;  4PDX A;  3T8M A;  2I9C A;  3FY4 A;  3SNX A;  3VLE A;  1PAQ A;  1WAO 1;  1FVH A;  2E0I A;  1ELK A;  2VGX B;  2V8S E;  5FZS A;  3TJP A;  2WPV A;  4TV3 A;  4C0E A;  5T3R A;  1U3C A;  1FCH A;  2LSV A;  3ZEF A;  2OOE A;  3T5V A;  4UWG A;  1XGW A;  1QQE A;  4GCN A;  3PZD A;  4HXI A;  4FLH A;  4C0M A;  5J08 A;  4WUY A;  4AIF A;  3LYA A;  4IN3 B;  1OWM A;  3PEV B;  2WB2 A;  5ANR A;  4BWR A;  2R17 C;  2OVF A;  2XCB A;  3Q5M A;  2KCL A;  3L17 A;  4G24 A;  3ZN3 A;  2OND A;  3UMV A;  5CCL A;  4AP2 A;  3CHO A;  4D10 C;  1UW4 B;  3FUL A;  3MGB A;  3B7T A;  3Q49 B;  4RG6 A;  4CRW A;  3B13 A;  5BPP A;  1H2V C;  3SD5 A;  4J8E A;  2WM9 A;  4WWP A;  4BSX A;  4GA1 A;  3TXN A;  3QNK A;  5FT9 A;  3DBS A;  3S7B A;  3B7U X;  3G2S A;  2IJG X;  2X6H A;  1IYG A;  3PH0 C;  4JL0 A;  3FUD A;  4YND A;  4F3V A;  3PE3 A;  2J49 A;  3G2W A;  4EBA G;  3LY8 A;  1U3D A;  3D9N A;  3HDX A;  5E76 A;  3ZW3 A;  2JEK A;  3ML8 A;  4CT4 A;  1UJK A;  4A1S A;  2RD0 A;  5FJY A;  2XPI A;  1HG2 A;  2GGF A;  2MOW A;  2XPY A;  3IHY A;  3LPZ A;  2I1J A;  1ELR A;  4J8F A;  4A1G A;  3QAQ A;  5AEN A;  4B8A A;  3IHV A;  1X5B A;  3SGH A;  1HXI A;  4KMO A;  1OWO A;  3PE4 A;  3P2B A;  2J07 A;  3ULQ A;  5KJK A;  4GAA A;  4GYO A;  5C1D A;  3Q47 B;  1OUV A;  2LAH A;  2I6H A;  4DI4 A;  4LUN U;  4WND A;  4G1T A;  1XNF A;  2XPZ A;  4F7A A;  4U0S A;  3SI5 A;  4Q96 A;  5G55 A;  4JVS A;  5DIZ A;  3UT4 A;  4XZ4 A;  3RRN B;  4B0Z A;  1SQM A;  3QJZ A;  2VSN A;  2UY1 B;  2WVI A;  4AM9 A;  3S7J A;  1E7V A;  3LY7 A;  5BUZ A;  3CK7 A;  1TJC A;  4U0U A;  3CQC B;  4DJA A;  5FWQ A;  4GCO A;  2VGX A;  4G23 A;  3EHM A;  2PQR A;  1YA0 A;  3B7S A;  4KT6 B;  5EKQ D;  4EZL A;  2X6I A;  2J09 A;  2IF4 A;  3EIQ C;  4I9E A;  3TGO A;  1VDY A;  4GYY A;  2PM7 A;  4APO A;  3CHS A;  4BTB A;  2LNI A;  1HFA A;  3BG1 B;  4KVO A;  4OVU A;  4FUL A;  4PS8 A;  3MKQ A;  3UX4 A;  2AW6 A;  3CKC A;  1MHQ A;  2FBN A;  5G04 C;  2CHX A;  3FHE A;  3SBS A;  4FJY A;  4GZ6 A;  1E8W A;  2VSY A;  3SBT B;  2XGO A;  3TL5 A;  4UI9 K;  3U64 A;  3UPV A;  3DPD A;  3TAX A;  3HYM B;  2VSX E;  5HI7 A;  5ENN A;  2R5S A;  3L22 A;  3QWW A;  4QFV A;  4B8C B;  4HOR A;  1W3B A;  4M3O A;  2VJ8 A;  3D9J A;  4GU5 A;  4U07 A;  4FHJ A;  3S7D A;  4JHJ A;  2Y4U A;  1S0P A;  2L6J A;  5J90 A;  3NZS A;  4XE0 A;  4DI3 A;  3PVL A;  1QZ2 A;  2KCK A;  2XGS A;  3ML9 A;  4BY6 A;  4ANW A;  2HYZ A;  1NP7 A;  3PEU B;  3EIJ A;  3FTY A;  5A6C A;  4AEZ C;  1FVF A;  4MRU A;  4H7X A;  3I4G A;  4NAC A;  3MKR A;  3ASD A;  2AVP A;  2BF0 X;  2KAT A;  3CQG B;  2WXF A;  3PDN A;  4I2Z A;  1P5Q A;  5BNW A;  3MZL B;  1HH8 A;  2ZU6 B;  4CGV A;  1SZ9 A;  4EBA A;  4FU3 A;  4I1M A;  1Y6I A;  3FU3 A;  4I9C A;  4JHR A;  3AU4 A;  3APD A;  3URZ A;  2HR2 A;  1INZ A;  3D9K A;  4XI0 A;  1NA3 A;  3FTX A;  4I6G A;  3KEZ A;  1HF8 A;  3I5P A;  5JJ6 A;  3R9A B;  3KD7 A;  1H2T C;  4ILI A;  4PS3 A;  5LCW J;  3SFZ A;  1QNF A;  2EQX A;  4UWH A;  1IQU A;  3MV2 B;  3RO2 A;  3CHM A;  3CKB A;  1NA0 A;  2A5U A;  3GZ1 A;  3NZU A;  4GA2 A;  1HG5 A;  3D9L A;  3FTW A;  2P58 C;  3D3M A;  3OXL A;  3KAE A;  4L1B A;  4OVV A;  4E6H A;  3CVV A;  3QWV A;  2WXK A;  2UY1 A;  2Y3A A;  2UWJ G;  2X6K A;  2WXL A;  3MKQ B;  4JEU A;  1Y8M A;  4V3I A;  5CHE E;  3TG4 A;  5LCW C;  2RG8 A;  4B89 A;  2GRM A;  3LS8 A;  2WMN A;  2I2O A;  2PL2 A;  3MYV A;  2VTB A;  1HS6 A;  1KLX A;  4EZK A;  2CFU A;  4NUR A;  4JA7 A;  3OTN A;  3HIZ A;  2PZI A;  2J9Q A;  2X3M A;  4ANU A;  3TXM A;  2LAI A;  4KXK B;  3RO3 A;  3E4B A;  4DK5 A;  3FEY A;  3FFL A;  3SHF A;  2KC7 A;  4AVX A;  4B94 A;  5AYW D;  4Q94 A;  3CHP A;  4YVO A;  5C2Y A;  3LXU X;  2LO6 A;  3CV0 A;  4UQZ A;  2HO1 A;  2AXU A;  4W9R A;  2GRL A;  5FQ6 A;  2PQN A;  4I2W A;  1HU3 A;  3L54 A;  1HE8 A;  5AJD A;  5A7D B;  3FTS A;  4BX8 A;  1EPU A;  1UJJ A;  2J4B A;  4N2Q A;  2QY7 A;  5JHB A;  1NZN A;  3MX3 A;  3HVE B;  3CVL A;  4CDM A;  1JPL A;  3RJV A;  5FZR A;  4UWL A;  5CMY A;  1E8Z A;  3RU0 A;  4XI9 A;  4WWO A;  5LP0 A;  3R7R A;  3ZYQ A;  4KZC A;  1BPO A;  4AOF A;  5AJL A;  4G26 A;  5D0Q D;  3CVY A;  2L0I A;  3L13 A;  2LSU A;  3FTU A;  4GZ3 A;  5LOZ A;  4UWF A;  3FUI A;  4FAD A;  3RRM B;  5BW8 C;  2FO7 A;  4EQF A;  5M72 A;  1JWG A;  3IKO B;  4URK A;  5BV0 A;  4KZ0 A;  4KYO B;  3QOU A;  4G11 A;  3ZFW A;  3ESL A;  4UI9 J;  3ZHE A;  3LCA A;  3MEK A;  4MLP A;  2X6F A;  4CEM A;  4ABN A;  4ME2 A;  4PS7 A;  4RG9 A;  4DPR A;  2AXZ A;  4L2Y A;  3QAR A;  3FU5 A;  3ASG A;  3PRE A;  3CVW A;  1KT1 A;  3T5X A;  3G2T A;  2NSZ A;  1EF1 C;  1N52 A;  1EDU A;  2MHK A;  5G04 J;  3AS8 A;  4GA0 A;  3QK0 A;  2VTB B;  3BG0 B;  2YHE A;  2ION A;  2XHE A;  4N3B A;  4GYW A;  3PUK A;  4KBQ A;  2KZT B;  4UI9 C;  2AWI A;  2IFU A;  3IEG A;  3MV3 B;  3D9I A;  3ZXS A;  2E2E A;  3N71 A;  3Q4A B;  4HOU A;  5E75 A;  2OV8 A;  2DBA A;  2WXP A;  3ASH A;  3ZRH A;  1E8Y A;  3FUN A;  4UWK A;  4XKB A;  3CK8 A;  3PNT B;  1IHG A;  2BUG A;  3OAW A;  5AIJ A;  3GW4 A;  4LER A;  4AY5 A;  2M63 A;  4JW1 A;  5FTP A;  4WNG A;  5KJN A;  2FUL A;  2IU1 A;  1KT0 A;  2MRI A;  3BEE A;  1DNP A;  2IQC A;  4I6E A;  2C2L A;  4EPZ A;  4ANV A;  3MA5 A;  2YIN A;  3JQ0 A;  3RRU A;  2IOS A;  2YQ8 A;  2NC9 A;  3LVR E;  1H2U A;  2CHW A;  3ENE A;  4LRZ A;  1IQR A;  2PM6 A;  2XCC A;  3GYZ A;  3PS6 A;  1E8X A;  4CDR A;  4E85 A;  4A3T A;  3TG5 A;  2WMO A;  5JHA A;  3FTV A;  5KCM A;  4TRQ A;  4HOS A;  3FEX A;  3ZYM A;  1WM5 A;  4EEC A;  5A23 A;  2IOL A;  3O48 A;  4L7T A;  3ZVV A;  4H7Y A;  4I43 A;  3GZS A;  3I4R B;  3EHN A;  4CCA A;  1OWN A;  1H0A A;  3L08 A;  4MS6 A;  2J4D A;  3QKY A;  4WWN A;  1Z3X A;  4ILH B;  4HFG A;  4U04 A;  5CCM A;  4JXT A;  4N39 A;  5D0O D;  2XRZ A;  3LDZ A;  1PC2 A;  2DCP A;  3HVE A;  2Y4T A;  4I1A A;  5FQ8 A;  3ZHE B;  3G2U A;  4Q69 A;  2X38 A;  4JC8 A;  3CVQ A;  3HHM A;  4Y6C A;  5EX0 A;  4AJW A;  4HS2 A;  3WXX A;  1UG3 A;  2WXJ A;  3EJN A;  3RK6 A;  3ZIM A;  3PUJ A;  4EZJ A;  3LVQ E;  3AS5 A;  2VSO E;  2KM4 A;  4WAF A;  4DLQ A;  4HOQ A;  1HX8 A;  4DLO A;  3UT7 A;  5CMW A;  2CG2 A;  4BT8 A;  4J6I A;  5LFA A;  4A3V A;  1TEZ A;  1SZA A;  4G25 A;  3CLJ A;  3U3W A;  4YVQ C;  2X6J A;  3I3N A;  4FA6 A;  3IV0 A;  4RVB A;  2CG3 A;  2J08 A;  1UN9 A;  4GMJ A;  4XX5 A;  3CHQ A;  5FZQ A;  3CGH A;  4N2S A;  2WXN A;  5FQ7 A;  3KS2 A;  4BTA A;  2KZT A;  4G2V A;  3CVN A;  2WXM A;  2CFZ A;  1ZU2 A;  4CGW A;  4AXH A;  4JEH A;  4ATG A;  4I1O B;  1E96 B;  4R7L A;  2DIW A;  3ZPJ A;  2XEV A;  1DVP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...