3AS8A

Mama msr-1 p41212
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
181
structure length
181
Chain Sequence
b'DDIRQVYYRDKGISHAKAGRYSEAVVMLEQVYDADAFDVEVALHLGIAYVKTGAVDRGTELLERSIADAPDNIKVATVLGLTYVQVQKYDLAVPLLVKVAEANPVNFNVRFRLGVALDNLGRFDEAIDSFKIALGLRPNEGKVHRAIAYSYEQMGSHEEALPHFKKANELDERSAVELALV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Magnetosome protein MamA
publication title Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly
pubmed doi rcsb
source organism Magnetospirillum gryphiswaldense
molecule tags Protein binding
total genus 76
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3as8A01
4U0UA 3WXXA 3GYZA 3OXLA 4AY5A 3SF4A 3UPVA 5FZRA 2BUGA 2AVPA 4GYOA 4I2ZA 4AIFA 1KT0A 4BTAA 4G2VA 2PQNA 3K9IA 3QDNA 1ZBPA 5BW8C 4KYOB 4J8FA 4G26A 3CVLA 2YHCA 4N3BA 4XIFA 2VGXA 4YNDA 4GPKA 3FFLA 3SZ7A 5G05J 5HI7A 3QWWA 3LPZA 2L6JA 3CK9A 3RJVA 1A17A 2UWJG 2KCLA 5G04C 5JJ7A 5ARFA 5FZSA 1W3BA 5G04J 2VYIA 4Y6CA 3E4BA 5D0OD 4ABNA 3KAEA 3MKRA 3TG4A 4AY6A 4I17A 1ELWA 5CCLA 2C0LA 3VTXA 5KJLA 4N2QA 3PE4A 2UY1B 2Y4UA 5EX3A 2GW1A 3JYSA 4NRHB 2C0MA 3O48A 4XI9A 2E2EA 5ARGA 2HO1A 2OOEA 3R9AB 4A1SA 5C1DA 3RO2A 4RG6A 2WPVA 1HXIA 2V5FA 4G25A 3ASDA 3CK8A 4EQFA 3Q5MA 3CV0A 4XI0A 4KBQA 2PL2A 2IFUA 4CGVA 2Y4TA 3MEKA 3MV3B 3ZHEB 2R5SA 3LKUA 4BT8A 4Y6WA 2XPIA 1QZ2A 2PQRA 2VSYA 3QKYA 3NF1A 4APOA 1HH8A 2HR2A 3AS4A 2KCKA 3LCAA 4GYWA 4UQZA 3RO3A 2P58C 3Q49B 4J0UA 4I2WA 2DBAA 4H7YA 3CEQA 1HZ4A 3U3WA 3OXGA 3Q47B 3TGOA 4BTBA 4GZ6A 2J9QA 3OXFA 4WNFA 4F3VA 1E96B 4ME2A 3ZPJA 4HOSA 4JHRA 3RIBA 3S7DA 4N3CA 5LCWC 1NA3A 4KXKB 5DBKA 3Q4AB 2XGSA 5LCWJ 4WNEA 3LYAA 4BWRA 1KLXA 4HORA 3PE3A 4U04A 2KCVA 3CKBA 2PZIA 2Q7FA 4I9EA 3LY7A 4UQYA 2VGXB 3GZ1A 1WM5A 3EDTB 3URZA 5JJ6A 2FI7A 2XGMA 4U07A 5BT1A 2FEZA 3S7JA 1TJCA 3LY9A 4GZ5A 1NA0A 3GZ2A 2IF4A 4G24A 1FCHA 3ZGQA 2ONDA 2VSNA 4WNGA 4UQXA 3BEEA 4J8EA 2XCBA 2YQ8A 5FZQA 3GW4A 2XEVA 3S7BA 1B89A 5FJYA 3N71A 3CK7A 3CVPA 2FBNA 5HQ8A 2LNIA 3KD7A 4U0ZA 1WAO1 5FT9A 3PDNA 1QQEA 4N5CA 2KC7A 1NZNA 1PC2A 4LEUA 5CHEE 3QOUA 4YVQC 5DIZA 1XNFA 3ASGA 4UI9K 4NQ0A 3TAXA 3RU0A 3AS8A 5M72A 4N39A 3LY8A 4HOQA 4U0SA 3ASFA 5A7DB 4I1AA 4CGWA 1IYGA 5AYWD 1ELRA 2C2LA 2FO7A 5CCMA 4AM9A 4GCNA 4JA9A 4I9CA 3ASHA 2LSVA 5A6CA 3MV2B 3RKVA 4RG9A 4CDRA 4JA7A 1OUVA 1Y8MA 5JJTA 3S7FA 2FF4A 1ZU2A 3TG5A 2XCCA 4N3AA 5EX0A 5BNWA 1IHGA 4JL0A 5FTPA 3ZFWA 4O6FA 4GZ3A 5G05C 4HOTA 4UI9C 2JLBA 3QWPA 4UI9J 3KS2A 3FP3A 3ZN3A 3CVQA 3VTYA 4G23A 2LSUA 1KT1A 2MHKA 3UQ3A 3HYMB 5KJKA 3MA5A 2HYZA 2UY1A 5EKQD 2VGYA 3QWVA 4GCOA 4J8DA 2VQ2A 3IEGA 2NC9A 4B94A 3ULQA 4WUYA 1P5QA 4H7XA 3CKCA 4GA2A 4N2SA 4WNDA 4GA1A 3Q15A 1YA0A 4BT9A 3U4TA 2KATA 3CVNA 4GA0A 4IN3B 5KJMA 3ZHEA 3UUXA 4G1TA 2QFCA 5KJNA 5D0QD 3ESKA 2XGOA 4HOUA 3FWVA 3AS5A 4GYYA 2I6HA 4YVOA 2WQHA 4W9RA
chains in the Genus database with same CATH superfamily
3R7QA 5AENA 4FJZA 2DYSE 3D9KA 3GYZA 4AY5A 2LUHA 4U7EB 5HKPA 3NBNB 1TEZA 1YYHA 1MYOA 2I1JA 2BUGA 2AVPA 2QC9A 3AG4E 2XZDG 4WWPA 5ANRA 1BI7B 5B3SE 4B8CB 3PRZA 2EIJE 1SA5A 3CHOA 4B93B 3ZEFA 2XEHA 3K9IA 4DPRA 1Z3XA 2L0TB 3AG3E 2ZISA 4G26A 4JVSA 4XZ4A 4G11A 2YHCA 3ZIMA 4I6GA 2J4BA 3UT7A 1E7UA 4JB8P 1MX4A 3DSWA 4GMJA 2KCLA 5JJ7A 5ARFA 1TNYA 2DIWA 3VLEA 2A4ZA 3CHRA 5BXUA 3PZ4A 3QK0A 4QQIA 4ABNA 1JPLA 1IXVA 3KAEA 3MKRA 4EBAA 2EINE 4I17A 1ELWA 3VTXA 4A3TA 4N2QA 2LXLA 2Y4UA 5EX3A 3JYSA 3DXKG 5AARA 3TWVA 2P9NG 3B7BA 1TNOA 4LERA 2HO1A 2OOEA 4YDOA 3R9MA 4A1SA 1N4RA 3RO2A 2V5QC 3TXNA 4ZFHA 3QNKA 4RG6A 3G2TA 3FUDA 4A55A 3G2UA 3ASDA 4GTVA 4RQIA 1N4SA 5KNHD 4BY6A 3EIQC 4FA6A 1NFIE 2X6KA 1VDYA 2IFUA 2XRYA 2GRNB 5LOZA 3UIPC 5JHAA 1X5BA 2XPIA 4PS7A 3QKYA 3DSSA 1HH8A 1QBQA 3AS4A 1TYQG 4UUCA 3LCAA 4UQZA 4U63A 2NXPA 3CEQA 4XKBA 2J07A 3TGOA 2J9QA 4ME2A 4WWNA 2CG2A 1NP7A 1E8YA 5DBKA 1MZCA 2CFUA 5D66A 4BWRA 4BEPA 3PE3A 1LF8A 3Q78A 3V30A 3UX4A 4X8QA 2KM4A 5AJDA 1N54A 3PZ1A 1Z5SC 4L2YA 3TXMA 3QB2A 2VGXB 4UQYA 5B1BE 4K03A 4FJYA 4ATGA 4HLEA 4XKCA 4NIKA 3EDTB 2F8XK 2IOLA 4EECA 5AQ9A 2XGMA 4U07A 4K5AB 1NL4A 2FEZA 4IULA 2XRZA 2R59A 1NA0A 1S70B 2IF4A 4AP2A 4EHMA 3ZYKA 5LX8A 4MS6A 4L7TA 3NB2A 4WAFA 3PEUB 3FUIA 1BI8B 4HRMB 3EHRA 2A5UA 3FUMA 5FIOA 4J8SA 2YHEA 2LAHA 2XS8A 4K5BA 5FZQA 2WQ6A 3GW4A 4K0RA 3UI2A 1B89A 5FJYA 2Y1LE 2GRMA 2WXPA 3N71A 3Q7FA 1OXJA 4U95D 5B1AE 3EHNA 5HQ8A 2FO1E 3V79K 4U0ZA 3ZRHA 1QNFA 3TWQA 1ELKA 3SNXA 3T8KA 5BV1A 2QZAA 3FHEA 5FQ4A 1HU3A 4HNAD 5CHEE 5E76A 3CHPA 3BG0B 4TXQA 4UI9K 4NQ0A 5CBOA 3AS8A 4HB5A 3LY8A 5EYPF 4ACKA 3TWSA 3T9KA 3ASFA 1Q2ZA 1E8WA 1N4PA 4F6RD 1DCEA 1TN8A 4I1AA 4KT6B 3W9FA 1Z3YA 3E34A 3RAUA 5CCMA 3ULYA 2P9PG 4CRWA 5G55A 3CIAA 2WXNA 4GCNA 4E85A 4FU3A 4I9CA 1HS6A 2WXKA 2YINA 2OV8A 2AXUA 3ABKE 4CCAA 2P9IG 4KZCA 3Q9UC 5A6CA 3TWUA 2M63A 4JHKA 4CDRA 3DXMG 2XCCA 2KBXA 4JPSA 1H6PA 5AJLA 2GRPB 5EX0A 4CYMD 3SO8A 4LSZE 3ZFWA 3UM2A 4HOTA 1JWFA 2BKGA 4LCTA 3FU3A 4DLOA 2J49A 1N4QA 3L82A 3VTYA 4DLQA 3UQ3A 5EN5D 2VGEA 3PZ2A 3J5PA 4J7WA 5KJKA 4APFA 2HYZA 3T8MA 5CMWA 2DWZA 2WXIA 3QWVA 3HVEA 3L16A 2VQ2A 1YCSB 3EJNA 3AU4A 4YDEA 5IY5E 4TUMA 4WUYA 4H7XA 1BPOA 4C0MA 4GA2A 4BFRA 4IYPA 3W9GA 3DSXA 4FULA 3B95A 3PREA 2ETCA 1OCZE 2J08A 4OAVB 1MX6A 1UW4B 5AQ7A 4DX1A 5JHBA 4LNUD 4G8KA 5KJMA 1WDYA 4TRQA 3HDXA 4DRXE 2QYJA 2XEEA 3UUXA 3FTWA 2Y0BG 2QFCA 4HBDA 4GTMA 1QYMA 3AG1E 3CQGB 5D0QD 3C72A 2OVBA 3AS5A 1HFAA 2I6HA 4U0UA 4OVVA 3OXLA 3JCKC 4OYSA 1N94A 4ILGA 3LS8A 4O1OA 4QFVA 3T5VA 3BG1B 3SFZA 4U8YD 1TNUA 4DJAA 2XPYA 5JA4D 4AOFA 5AN8A 1PAQA 3QARA 3UIOC 2XPZA 1JCRA 5FQ8A 3CVLA 1UOHA 2X6HA 1DNPA 4IRUA 1UN8A 4N3BA 4XIFA 3FFLA 3HXEA 3U9WA 4GMRA 5FQ7A 5G05J 5HI7A 5EIDA 2RFAA 3FTZA 2UWJG 4JXTA 2WXRA 3FTUA 4MKTA 4B89A 5D0OD 2LO6A 3UINC 2I1KA 3FUFA 1LD7A 3D9JA 5KJLA 2UY1B 4PUCA 2GW1A 3BQOA 3O48A 4DX7D 2E2EA 2ZU6B 2A5EA 1O1TA 3R9AB 1OWNA 4I6JA 3L17A 4KZ0A 2MYOA 2WPVA 2V5FA 4WWOA 3L22A 3D9MA 3PH0C 2RFMA 3ENEA 3Q5MA 4I1MA 4XI0A 4KBQA 2PL2A 3Q79A 3IHYA 3ZYQA 1JCQA 3CVVA 1INZA 5AAOA 3DSTA 4BT8A 2VTBB 1E8ZA 2DVWA 2VSYA 1FT1A 5CECB 3IKOB 1V54E 2IY0C 2DBAA 4H7YA 1HZ4A 3IHVA 2IO3C 2RD0A 4AXHA 4HVBA 4DUIA 4HOSA 3RIBA 3CVWA 3L9TA 1KZPA 2CFZA 1D8DA 3G2WA 3Q4AB 4JD2G 2KZTA 3LYAA 1KLXA 3T5XA 4HORA 3CHSA 1O1SA 1S63A 2R05A 2RG8A 2KCVA 3RRMB 4BSXA 2X3MA 5LFAA 3ZUVB 1V55E 3E32A 3SGHA 4NURA 3URZA 3I4GA 4L23A 2FI7A 3F6QA 5BT1A 3LY9A 3DWLG 4G24A 2ETAA 1FCHA 4M3OA 1TJFA 3TWRA 4EZJA 5KNGA 3HIZA 3JUEA 1G3NB 2IJGX 3Q73A 4XX5A 4D10C 1TNBA 3CVPA 3PNLB 4URKA 1BD8A 5KWDA 4HQDA 5ENRD 4PDXA 2IONA 3APDA 2WMOA 4CZ2D 1NZNA 1PC2A 3QOUA 4ANXA 3UXGA 4UWGA 2Y69E 2DCPA 2IQCA 1MJ0A 3UM1A 1GW6A 1OCCE 3JQ1A 4ILIA 4HOQA 5BUZA 2WVIA 3C3OA 2LAIA 5A7DB 4RSYA 1IYGA 2I9CA 2DZOA 1TN6A 3TL5A 2R17C 1HO8A 3D9HA 4O60A 4AV7A 3ASHA 2PNNA 2CHZA 1MX2A 3UT4A 3MV2B 4CDNA 4KVOA 5HRYA 4RG9A 1HF8A 1H2UA 1Y8MA 2IU1A 3S7FA 3TG5A 4BSZB 3HHMA 2VJ8A 4U8VD 4U96D 3FTYA 2H6IA 2J8SD 3ISMC 5C2YA 4ATZD 4HS2A 4JL0A 2P2CP 3NOGD 4F1PA 3MGBA 1OWLA 2QYUA 4UI9C 4FP7A 4UI9J 2P9KG 3E30A 4HI8A 3FP3A 5CERB 4G23A 2LSUA 3U64A 1KT1A 1U3DA 2MHKA 1N9AA 4YDYA 4A3VA 1S0PA 4GCOA 5D2MC 4HLLA 3I5PA 3IEGA 2OVFA 2NC9A 3ULQA 3FY4A 3V31A 2R2LA 3CKCA 3D9OA 2XHEA 4N2SA 3SD5A 4GTTA 1XGWA 1JWGA 4J8YA 1TN7A 1YA0A 3P1UA 4BT9A 1JUQA 5EDSA 1S64A 4YDWA 4GU5A 3ML8A 1UN9A 4GTQA 4IN3B 4CDMA 3ZVVA 3ZHEA 3ZYLA 2PM6A 4U8HA 4GZCA 4HOUA 1OWMA 3FWVA 4HRNA 5BPPA 2ETBA 4GYYA 3QC1A 4YVOA 3FUKA 4W9RA 4L1BA 4FLHA 3FUEA 3GZSA 4HXIA 3D9IA 3SF4A 3UPVA 3OAWA 1IKND 3FH7A 4AVXA 3TWWA 3AG2E 3PZDA 1TNZA 4GYOA 4AIFA 3J5QB 3MJWA 3C3RA 4BTAA 4G2VA 3PUJA 2PQNA 2R02A 1DC2A 4XEIG 4JHJA 4O1PA 4UWFA 5HS0A 5BW8C 1K1BA 1YMPA 4KYOB 5E75A 4R7LA 3FH5A 2JEKA 1D9SA 4YNDA 1EDUA 5T4YA 4EPZA 4GPKA 3BU8A 2F37A 3LPZA 3TJPA 1N0QA 4CT0A 3AU5A 4ANUA 3SBSA 3RJVA 1A17A 2BF0X 5J90A 5G04C 1OCRE 5FZSA 5G04J 2VYIA 3E4BA 3PUKA 4TXPA 3P2BA 3ABME 1RW2A 4AY6A 1NI1A 5CCLA 2C0LA 3HXBA 3FEXA 4HFGA 4GTRA 3HVEB 4XI9A 4BX9A 3EHMA 5ARGA 4FHJA 5C1DA 4N5QA 1HXIA 3R7RA 4G25A 5BXOA 3Q75A 2AWIA 3CK8A 2YNQA 3VLDA 4EQFA 3KSLA 1N52A 3RRNB 4FLBA 4UWLA 5ANLA 2Y4TA 2QY7A 3MV3B 2BEDA 4F1SA 3ULEG 2R5SA 3AAAC 4I1OB 4Y6WA 1QZ2A 2GRLA 3PVLA 4APOA 3NAWA 2WXMA 2HR2A 2KCKA 3DBSA 3RO3A 2P58C 3Q49B 4I2WA 3CVXA 3B7SA 1SZ9A 2H6FA 4GMLA 1UJJA 3FTSA 3OXGA 3Q47B 4K5CA 3MX3A 1Z6TA 3HG0D 4PS3A 4ILHB 1E96B 4P29A 3FEYA 2WMNA 2X6FA 3S7DA 4N3CA 4KXKB 1EYHA 5CMYA 3LEWA 3ZYMA 4DX6D 1DVPA 4V3IA 1K3ZD 2PZIA 3BUAA 2Q7FA 3LDZA 2EIKE 3LY7A 2R03A 3ESLA 1K1AA 4KMOA 3GZ1A 5CRUA 3JXJA 1WM5A 3DEPA 3FTVA 3RRUA 2MRIA 4PH4B 3FUJA 5JJ6A 1BU9A 2V8SE 4FADA 3FULA 1TJCA 4GZ5A 2WXFA 4GPMA 1N11A 4M7CA 3CSFA 2WQ7A 3ZGQA 2NSZA 2ONDA 4Q96A 4WNGA 4TUUA 2P9SG 4HI9A 5T3RA 5EIBE 5ENPD 1AP7A 2XEVA 3NZUA 3S7BA 3LJ3A 2DZNA 3NZSA 3LVRE 2LNIA 1HX8A 5AQBA 1WAO1 2XS1A 3B13A 3UMVA 4A63B 3PDNA 2OEVA 1QQEA 1AWCB 4N5CA 2KC7A 4I43A 4LEUA 3FU0A 1KPSB 3MZLB 5ENTD 3SFYA 3ASGA 5G2NA 3EU9A 3KEAA 3UTMA 4CEMA 1H0AA 1ZB1A 1HG2A 3E37A 3PZ3A 4KVMA 2C2LA 2AW6A 3FUNA 4AM9A 2IEJA 4HRLA 1WY6A 2LSVA 3C5RA 4EZLA 3D9LA 3JQ0A 4B0ZA 3B7TA 4JA7A 1OUVA 1UG3A 2H6GA 1N95A 5JJTA 1ZU2A 3TWXA 2KZTB 3D9PA 4GTPA 2NYJA 3FDHA 5ENSD 2BKKB 3MYVA 4AEZC 4FC8A 4NACA 3I3NA 5BNWA 2GGFA 5FTPA 4O6FA 4GZ3A 2ILRA 3ONKA 2JLBA 3UM0A 5FQ6A 2ZXWE 2HM8A 3ZN3A 3CVQA 3DPDA 4L9PA 4JC8A 4BESA 1H19A 3JUIA 1X81A 3DSUA 2FULA 5EKQD 4J8DA 3B7RL 1N0RA 1MHQA 3UT8A 4B94A 2P9UG 3CR3A 3ML9A 2VSOE 1P5QA 3HXFA 4DI4A 3AJIA 4GA1A 3Q15A 3U4TA 2KATA 4MLPA 3B7UX 3V2XA 4GA0A 1IQRA 3ZW3A 3SQVA 4G1TA 2F8YA 5KJNA 1OWOA 1EPUA 1OCOE 3ESKA 2EIME 3G2VA 3D3MA 4JEUA 3O4ZA 3CVUA 2WQHA 3L54A 2WXOA 3CGHA 5KBAA 2GROB 3WXXA 5T8IA 5JMND 5FZRA 2L9BA 2CHXA 2CHWA 1H2TC 2XQ0A 2Y3AA 4ZHBA 4I2ZA 3E33A 5AQAA 1KT0A 5CRVA 4RVBA 3EIJA 1PY1A 3QDNA 1ZBPA 5J08A 4J8FA 1OWPA 3Q7AA 3S2AA 3SFXA 3TWTA 2XZTG 4G8LA 3PNTB 2VGXA 4EBAG 5ENOD 4RLYA 3SZ7A 4C9BB 3QWWA 4Z68A 2L6JA 5CBNA 3CK9A 3PS6A 4GZDA 1FPPA 1UJKA 4JZYA 4CT4A 1W3BA 2V4HC 4Y6CA 4LUNU 5ENQD 1KZOA 4EZKA 3RK6A 3LJNA 3NOCD 3U66A 3TG4A 4BERA 1SA4A 3PE4A 4GAAA 5FWQA 4NRHB 2C0MA 2ZGDA 3CSTA 2B6CA 4J6IA 1FVHA 3KSQA 1IHBA 4F7AA 4LNGA 2X6IA 3C98A 3CV0A 3RSEG 1A5EA 1MQSA 1WG0A 4LNBA 4CGVA 4DX5D 1H6KA 4GB9A 2B0OE 3UKUG 4JW1A 3MEKA 3CHMA 3IV0A 2WXJA 3ZHEB 2WM9A 5EILA 4E6HA 2BTDA 5FINA 3ZXSA 3LKUA 1SW6A 3DPYA 4BETA 2PQRA 3DSVA 5CEDB 4DX2A 1FVFA 3NF1A 3I4RB 2CG3A 1SVXA 4GYWA 2OEWA 1SQMA 4A1GA 4ANWA 4GTSA 4Q94A 4J0UA 3CLJA 2X38A 3U3WA 1OY3D 1U2VG 4BTBA 3NQPA 3HXDA 4TXRA 4GZ6A 3OXFA 3FTXA 4WNFA 4F3VA 5KCMA 3ZPJA 3L13A 3ZNGA 4ANVA 5BV0A 4JHRA 3LVQE 5LCWC 1NA3A 2XGSA 3WG7E 5LCWJ 4WNEA 1IQUA 2J09A 2EILE 4AJWA 3IXEA 3OTNA 4U04A 1BLXB 2PM7A 3DEOA 3CKBA 2GRRB 1JCSA 4I9EA 3VLFA 1H2VC 1DCQA 5CEAA 2V4LA 3C3QA 1TR4A 2WXLA 2GRQB 4XE0A 3MKQA 3S7JA 4UWHA 1FT2A 2ZIRA 3GZ2A 3G2SA 1RZ4A 3SBTB 2MOWA 2F0YA 3EUVA 3MKQB 2VSNA 3EHQA 4OVUA 4UQXA 2AXZA 2WXGA 3BEEA 4J8EA 2V0PA 1E8XA 2XCBA 3ZXPA 4ACLA 1SZAA 2YQ8A 4LRZA 2VSXE 3CK7A 2FBNA 3KD7A 4C48B 3DRAA 3SY2A 5FT9A 2RKKA 4UWKA 3HXCA 3KEZA 2AXVA 3CHQA 4FHKA 1OT8A 1LTXA 4L2LA 4YVQC 2OCCE 1HE8A 5DIZA 1XNFA 3Q9NC 4I6EA 4TV3A 5H7PA 3TAXA 3ZU7B 3RU0A 3UM3A 4N39A 5M72A 4U0SA 3ASOE 2IO2C 1HG5A 5A23A 3EU5A 2XENA 4BX8A 4OAUC 5LP0A 3QAQA 4CGWA 3X2QE 3L08A 5AYWD 1ELRA 2FO7A 1O1RA 3ONLA 1E7VA 3L6AA 4JA9A 3FUHA 1D8EA 3APFA 2ZGGA 3RKVA 3FU6A 2FF4A 2KXPC 5EYLA 4DK5A 4N3AA 1U3CA 2E0IA 1Y6IA 2IOSA 5ENNA 1IHGA 3IBEA 5G05C 1E90A 3JXIA 3QWPA 4F53A 3KS2A 4MBGA 2EQXA 3HYMB 3MA5A 2UY1A 2J4DA 5AIJA 3FH8A 3QJZA 2VGYA 2X6JA 4PS8A 3CQCB 5ITZF 3MCXA 2H6HA 3ABLE 1K8KG 3ASNE 4DI3A 4C0EA 1L5JA 4WNDA 2DYRE 1EF1C 2LXMA 3UKRG 2JABA 3CVNA 1LD8A 3SHFA 4B8AA 2WXHA 3D9NA 1O5MA 2AJAA 2L0IA 2L6BA 4Q69A 3FU5A 3CVYA 2P9LG 2HE0A 3V2OA 4GTOA 2WB2A 1H6OA 2I2OA 2VTBA 3APCA 3SI5A 3HRAA 2XGOA 4LG6A 3PEVB 3LXUX 4JEHA 4MRUA 2WXQA 3ZKJA
chains in the Genus database with same CATH topology
3FUEA 3GZSA 2WXOA 3L54A 4OVVA 4U0UA 3CGHA 4HXIA 3R7QA 5AENA 4FJZA 3D9KA 3WXXA 5T8IA 3GYZA 3D9IA 3OXLA 3JCKC 4OYSA 4AY5A 3SF4A 3UPVA 5FZRA 1TEZA 3OAWA 4ILGA 2L9BA 2I1JA 2CHXA 3LS8A 2CHWA 1H2TC 3FH7A 4QFVA 4AVXA 2BUGA 2XQ0A 2Y3AA 2AVPA 3PZDA 3T5VA 4GYOA 4WWPA 3BG1B 4I2ZA 5ANRA 3SFZA 4AIFA 4B8CB 1KT0A 3MJWA 3PRZA 4BTAA 4G2VA 4DJAA 3PUJA 3CHOA 4RVBA 2XPYA 3ZEFA 2PQNA 3EIJA 3K9IA 4AOFA 1PY1A 1PAQA 1ZBPA 3QDNA 3QARA 4JHJA 4DPRA 4UWFA 1Z3XA 5BW8C 2L0TB 2XPZA 5J08A 4KYOB 4J8FA 5E75A 1OWPA 4G26A 3CVLA 4R7LA 2X6HA 5FQ8A 3S2AA 4JVSA 3FH5A 1DNPA 2JEKA 4IRUA 4XZ4A 4G11A 2YHCA 1UN8A 3PNTB 3ZIMA 4N3BA 4XIFA 2VGXA 4EBAG 4YNDA 1EDUA 5T4YA 4EPZA 4GPKA 3FFLA 4I6GA 2J4BA 3U9WA 3SZ7A 5FQ7A 5G05J 5HI7A 4C9BB 3QWWA 3UT7A 3LPZA 3TJPA 4CT0A 2L6JA 3AU5A 1E7UA 4ANUA 3SBSA 3CK9A 3PS6A 3RJVA 1A17A 4GZDA 2BF0X 3FTZA 5J90A 2UWJG 2KCLA 4GMJA 1UJKA 4JZYA 4JXTA 5G04C 5JJ7A 4CT4A 2WXRA 5ARFA 2DIWA 5FZSA 1W3BA 5G04J 3VLEA 2VYIA 2A4ZA 3FTUA 4Y6CA 3CHRA 4LUNU 3E4BA 3QK0A 4MKTA 4B89A 5D0OD 2LO6A 3PUKA 3RK6A 1JPLA 3P2BA 4ABNA 4EZKA 2I1KA 3KAEA 3MKRA 3FUFA 4EBAA 3U66A 3TG4A 4AY6A 4I17A 1ELWA 3D9JA 5CCLA 2C0LA 3VTXA 4A3TA 5KJLA 4N2QA 3PE4A 2UY1B 2Y4UA 4PUCA 3FEXA 4GAAA 5EX3A 5FWQA 2GW1A 3JYSA 4HFGA 4NRHB 3HVEB 2C0MA 3O48A 4XI9A 2E2EA 2ZU6B 4BX9A 3EHMA 4LERA 2HO1A 3CSTA 5ARGA 2OOEA 4FHJA 3R9AB 4A1SA 1OWNA 5C1DA 4I6JA 4J6IA 3RO2A 3L17A 4KZ0A 3TXNA 3QNKA 4RG6A 2WPVA 3G2TA 1HXIA 2V5FA 4WWOA 1FVHA 3L22A 3R7RA 3FUDA 4A55A 3G2UA 4G25A 3D9MA 3ASDA 2AWIA 3CK8A 3PH0C 2YNQA 4F7AA 3VLDA 4EQFA 3ENEA 3Q5MA 4BY6A 2X6IA 3EIQC 3C98A 3CV0A 4I1MA 4FA6A 4XI0A 1N52A 4KBQA 2X6KA 2PL2A 1VDYA 3IHYA 3RRNB 1MQSA 2IFUA 4CGVA 4FLBA 4UWLA 5ANLA 1H6KA 4GB9A 3ZYQA 2Y4TA 4JW1A 2QY7A 3MEKA 3CHMA 3IV0A 2WXJA 3MV3B 3ZHEB 3CVVA 1INZA 2XRYA 4F1SA 5LOZA 2WM9A 2R5SA 2BTDA 4E6HA 4I1OB 3ZXSA 5JHAA 3LKUA 4BT8A 1X5BA 2VTBB 4Y6WA 1E8ZA 2XPIA 4PS7A 1QZ2A 2GRLA 2PQRA 2VSYA 3PVLA 1FVFA 3QKYA 3NF1A 4APOA 1HH8A 2WXMA 3I4RB 2HR2A 3AS4A 2CG3A 2KCKA 3LCAA 4GYWA 3DBSA 4UQZA 1SQMA 3IKOB 4A1GA 4ANWA 4U63A 3RO3A 4Q94A 2P58C 3Q49B 4J0UA 4I2WA 3CVXA 2DBAA 2NXPA 3B7SA 1SZ9A 3CLJA 4H7YA 3CEQA 1HZ4A 2X38A 1UJJA 3FTSA 3IHVA 3OXGA 4GMLA 3U3WA 3Q47B 4XKBA 2J07A 3TGOA 4BTBA 3NQPA 2RD0A 3MX3A 1Z6TA 4AXHA 4PS3A 4GZ6A 2J9QA 3FTXA 3OXFA 4ILHB 4WNFA 4F3VA 1E96B 4ME2A 2CG2A 4WWNA 5KCMA 3ZPJA 4P29A 1NP7A 4HOSA 3L13A 4ANVA 3FEYA 2WMNA 4JHRA 5BV0A 1E8YA 2X6FA 3RIBA 4N3CA 3S7DA 3LVQE 5LCWC 3CVWA 1NA3A 4KXKB 2CFZA 3G2WA 1EYHA 3Q4AB 2CFUA 2XGSA 5CMYA 5DBKA 5LCWJ 3LEWA 3ZYMA 4WNEA 1IQUA 2KZTA 1DVPA 2J09A 3LYAA 4AJWA 3OTNA 4BWRA 1KLXA 3T5XA 4HORA 3PE3A 1LF8A 4V3IA 3CHSA 4U04A 3UX4A 2PM7A 2RG8A 2KCVA 3CKBA 3RRMB 2PZIA 2KM4A 5AJDA 1N54A 2Q7FA 4L2YA 3TXMA 3LDZA 4I9EA 3LY7A 3QB2A 2VGXB 2X3MA 1H2VC 3ESLA 4UQYA 3VLFA 4BSXA 5LFAA 4K03A 2V4LA 4KMOA 3GZ1A 3SGHA 4FJYA 4ATGA 4HLEA 4XKCA 1WM5A 4NURA 3EDTB 3URZA 3FTVA 3RRUA 2WXLA 2MRIA 3I4GA 2IOLA 4PH4B 4XE0A 4EECA 3FUJA 4L23A 5JJ6A 2FI7A 2XGMA 4U07A 2V8SE 4FADA 3MKQA 3FULA 5BT1A 2FEZA 4IULA 2XRZA 2R59A 3S7JA 4UWHA 1TJCA 3LY9A 4GZ5A 1NA0A 3GZ2A 2IF4A 3G2SA 4AP2A 2WXFA 4G24A 3SBTB 3ZYKA 5LX8A 4MS6A 2MOWA 3CSFA 1FCHA 4L7TA 4M3OA 2WQ7A 1TJFA 3ZGQA 3MKQB 2NSZA 2ONDA 2VSNA 4WAFA 4OVUA 3PEUB 4Q96A 4WNGA 4UQXA 2AXZA 2WXGA 3FUIA 4TUUA 4EZJA 3BEEA 4J8EA 2V0PA 1E8XA 2XCBA 5T3RA 4ACLA 1SZAA 2A5UA 3FUMA 4J8SA 2YHEA 2LAHA 2YQ8A 5FZQA 2WQ6A 3GW4A 3HIZA 4K0RA 4LRZA 2IJGX 2XEVA 3NZUA 3S7BA 3LJ3A 2VSXE 1B89A 4XX5A 5FJYA 4D10C 3NZSA 2GRMA 2WXPA 3LVRE 3N71A 3CK7A 3CVPA 2FBNA 3PNLB 3EHNA 5HQ8A 2LNIA 3KD7A 4URKA 4U0ZA 1HX8A 3ZRHA 1QNFA 1WAO1 3B13A 5FT9A 3UMVA 1ELKA 3SNXA 4PDXA 4UWKA 5BV1A 3PDNA 2IONA 3FHEA 3KEZA 1QQEA 3APDA 5FQ4A 4N5CA 1HU3A 2WMOA 2AXVA 2KC7A 4I43A 3CHQA 1NZNA 1PC2A 4FHKA 4LEUA 5CHEE 3FU0A 3QOUA 3MZLB 4L2LA 5E76A 4YVQC 4UWGA 4ANXA 1HE8A 5DIZA 3CHPA 1XNFA 3ASGA 3BG0B 2DCPA 4I6EA 4TV3A 4UI9K 4NQ0A 3TAXA 5G2NA 2IQCA 3RU0A 1GW6A 3JQ1A 3AS8A 4ILIA 4N39A 5M72A 3LY8A 4HOQA 4ACKA 4U0SA 5BUZA 5A23A 1HG5A 2WVIA 3ASFA 4CEMA 1E8WA 2LAIA 1H0AA 4BX8A 5LP0A 3QAQA 5A7DB 4I1AA 4RSYA 1HG2A 4CGWA 4KT6B 1Z3YA 4L1BA 4KVMA 1IYGA 3L08A 2I9CA 5AYWD 1ELRA 2C2LA 2FO7A 3ONLA 5CCMA 2AW6A 3TL5A 3FUNA 2R17C 4CRWA 4AM9A 5G55A 1E7VA 3CIAA 1HO8A 2WXNA 3L6AA 4GCNA 4E85A 4JA9A 4FU3A 4I9CA 1HS6A 2WXKA 4AV7A 1WY6A 3ASHA 2YINA 3FUHA 2OV8A 2AXUA 2LSVA 4CCAA 3APFA 4KZCA 2CHZA 3UT4A 5A6CA 3MV2B 2M63A 4CDNA 4EZLA 4KVOA 4JHKA 3RKVA 4RG9A 3D9LA 3JQ0A 3FU6A 4B0ZA 4CDRA 3B7TA 1HF8A 1H2UA 1OUVA 1UG3A 4JA7A 1Y8MA 2IU1A 5JJTA 2FF4A 1ZU2A 3S7FA 3TG5A 2XCCA 2KZTB 3D9PA 3HHMA 2VJ8A 3FDHA 4JPSA 4DK5A 4N3AA 1U3CA 2E0IA 1Y6IA 2IOSA 3MYVA 5AJLA 5EX0A 4AEZC 3FTYA 5ENNA 4FC8A 4NACA 3I3NA 5C2YA 5BNWA 4HS2A 1IHGA 2GGFA 4JL0A 5FTPA 3ZFWA 4O6FA 3IBEA 3MGBA 4GZ3A 2ILRA 5G05C 1OWLA 1E90A 4HOTA 3ONKA 4UI9C 2JLBA 1JWFA 3QWPA 5FQ6A 4FP7A 4LCTA 3FU3A 4UI9J 4DLOA 2J49A 4F53A 3KS2A 3FP3A 2HM8A 3ZN3A 3CVQA 3DPDA 3VTYA 4G23A 2LSUA 3U64A 4DLQA 4JC8A 1H19A 1KT1A 1U3DA 2MHKA 5EKQD 3UQ3A 3JUIA 4A3VA 2EQXA 3HYMB 5KJKA 4APFA 3MA5A 2HYZA 3T8MA 2UY1A 2FULA 2J4DA 1S0PA 5CMWA 5AIJA 3FH8A 3QJZA 2VGYA 2WXIA 3QWVA 2X6JA 4GCOA 3CQCB 4J8DA 4PS8A 3B7RL 3HVEA 3L16A 2VQ2A 1MHQA 3I5PA 3IEGA 3MCXA 2OVFA 3UT8A 2NC9A 4B94A 4DI3A 3EJNA 3AU4A 3ULQA 3CR3A 4WUYA 3ML9A 4C0EA 3FY4A 2VSOE 1P5QA 4H7XA 1BPOA 1L5JA 3CKCA 3D9OA 4C0MA 2XHEA 4GA2A 4BFRA 4IYPA 4N2SA 3SD5A 4WNDA 1XGWA 1EF1C 1JWGA 4DI4A 4GA1A 4FULA 3Q15A 3PREA 1YA0A 3P1UA 4BT9A 4HVBA 3U4TA 2KATA 3CVNA 1JUQA 2J08A 4MLPA 5EDSA 3B7UX 1UW4B 4GA0A 3SHFA 4B8AA 4GU5A 3ML8A 1UN9A 2WXHA 5JHBA 3D9NA 1IQRA 4IN3B 5KJMA 4CDMA 3ZW3A 2L0IA 4TRQA 3HDXA 3FU5A 3ZVVA 4Q69A 3CVYA 3ZHEA 3ZYLA 3UUXA 3FTWA 2WB2A 4G1TA 2QFCA 2PM6A 2I2OA 5KJNA 2VTBA 1OWOA 3CQGB 3APCA 4U8HA 5D0QD 4GZCA 1EPUA 3ESKA 2XGOA 3SI5A 3G2VA 4HOUA 1OWMA 3FWVA 3PEVB 5BPPA 2OVBA 3D3MA 3AS5A 3LXUX 4JEHA 4GYYA 3QC1A 1HFAA 2I6HA 4JEUA 4MRUA 3O4ZA 3CVUA 4YVOA 3FUKA 2WQHA 2WXQA 4W9RA 4FLHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0U A;  3WXX A;  3GYZ A;  3OXL A;  4AY5 A;  3SF4 A;  3UPV A;  5FZR A;  2BUG A;  2AVP A;  4GYO A;  4I2Z A;  4AIF A;  1KT0 A;  4BTA A;  4G2V A;  2PQN A;  3K9I A;  3QDN A;  1ZBP A;  5BW8 C;  4KYO B;  4J8F A;  4G26 A;  3CVL A;  2YHC A;  4N3B A;  4XIF A;  2VGX A;  4YND A;  4GPK A;  3FFL A;  3SZ7 A;  5G05 J;  5HI7 A;  3QWW A;  3LPZ A;  2L6J A;  3CK9 A;  3RJV A;  1A17 A;  2UWJ G;  2KCL A;  5G04 C;  5JJ7 A;  5ARF A;  5FZS A;  1W3B A;  5G04 J;  2VYI A;  4Y6C A;  3E4B A;  5D0O D;  4ABN A;  3KAE A;  3MKR A;  3TG4 A;  4AY6 A;  4I17 A;  1ELW A;  5CCL A;  2C0L A;  3VTX A;  5KJL A;  4N2Q A;  3PE4 A;  2UY1 B;  2Y4U A;  5EX3 A;  2GW1 A;  3JYS A;  4NRH B;  2C0M A;  3O48 A;  4XI9 A;  2E2E A;  5ARG A;  2HO1 A;  2OOE A;  3R9A B;  4A1S A;  5C1D A;  3RO2 A;  4RG6 A;  2WPV A;  1HXI A;  2V5F A;  4G25 A;  3ASD A;  3CK8 A;  4EQF A;  3Q5M A;  3CV0 A;  4XI0 A;  4KBQ A;  2PL2 A;  2IFU A;  4CGV A;  2Y4T A;  3MEK A;  3MV3 B;  3ZHE B;  2R5S A;  3LKU A;  4BT8 A;  4Y6W A;  2XPI A;  1QZ2 A;  2PQR A;  2VSY A;  3QKY A;  3NF1 A;  4APO A;  1HH8 A;  2HR2 A;  3AS4 A;  2KCK A;  3LCA A;  4GYW A;  4UQZ A;  3RO3 A;  2P58 C;  3Q49 B;  4J0U A;  4I2W A;  2DBA A;  4H7Y A;  3CEQ A;  1HZ4 A;  3U3W A;  3OXG A;  3Q47 B;  3TGO A;  4BTB A;  4GZ6 A;  2J9Q A;  3OXF A;  4WNF A;  4F3V A;  1E96 B;  4ME2 A;  3ZPJ A;  4HOS A;  4JHR A;  3RIB A;  3S7D A;  4N3C A;  5LCW C;  1NA3 A;  4KXK B;  5DBK A;  3Q4A B;  2XGS A;  5LCW J;  4WNE A;  3LYA A;  4BWR A;  1KLX A;  4HOR A;  3PE3 A;  4U04 A;  2KCV A;  3CKB A;  2PZI A;  2Q7F A;  4I9E A;  3LY7 A;  4UQY A;  2VGX B;  3GZ1 A;  1WM5 A;  3EDT B;  3URZ A;  5JJ6 A;  2FI7 A;  2XGM A;  4U07 A;  5BT1 A;  2FEZ A;  3S7J A;  1TJC A;  3LY9 A;  4GZ5 A;  1NA0 A;  3GZ2 A;  2IF4 A;  4G24 A;  1FCH A;  3ZGQ A;  2OND A;  2VSN A;  4WNG A;  4UQX A;  3BEE A;  4J8E A;  2XCB A;  2YQ8 A;  5FZQ A;  3GW4 A;  2XEV A;  3S7B A;  1B89 A;  5FJY A;  3N71 A;  3CK7 A;  3CVP A;  2FBN A;  5HQ8 A;  2LNI A;  3KD7 A;  4U0Z A;  1WAO 1;  5FT9 A;  3PDN A;  1QQE A;  4N5C A;  2KC7 A;  1NZN A;  1PC2 A;  4LEU A;  5CHE E;  3QOU A;  4YVQ C;  5DIZ A;  1XNF A;  3ASG A;  4UI9 K;  4NQ0 A;  3TAX A;  3RU0 A;  3AS8 A;  5M72 A;  4N39 A;  3LY8 A;  4HOQ A;  4U0S A;  3ASF A;  5A7D B;  4I1A A;  4CGW A;  1IYG A;  5AYW D;  1ELR A;  2C2L A;  2FO7 A;  5CCM A;  4AM9 A;  4GCN A;  4JA9 A;  4I9C A;  3ASH A;  2LSV A;  5A6C A;  3MV2 B;  3RKV A;  4RG9 A;  4CDR A;  4JA7 A;  1OUV A;  1Y8M A;  5JJT A;  3S7F A;  2FF4 A;  1ZU2 A;  3TG5 A;  2XCC A;  4N3A A;  5EX0 A;  5BNW A;  1IHG A;  4JL0 A;  5FTP A;  3ZFW A;  4O6F A;  4GZ3 A;  5G05 C;  4HOT A;  4UI9 C;  2JLB A;  3QWP A;  4UI9 J;  3KS2 A;  3FP3 A;  3ZN3 A;  3CVQ A;  3VTY A;  4G23 A;  2LSU A;  1KT1 A;  2MHK A;  3UQ3 A;  3HYM B;  5KJK A;  3MA5 A;  2HYZ A;  2UY1 A;  5EKQ D;  2VGY A;  3QWV A;  4GCO A;  4J8D A;  2VQ2 A;  3IEG A;  2NC9 A;  4B94 A;  3ULQ A;  4WUY A;  1P5Q A;  4H7X A;  3CKC A;  4GA2 A;  4N2S A;  4WND A;  4GA1 A;  3Q15 A;  1YA0 A;  4BT9 A;  3U4T A;  2KAT A;  3CVN A;  4GA0 A;  4IN3 B;  5KJM A;  3ZHE A;  3UUX A;  4G1T A;  2QFC A;  5KJN A;  5D0Q D;  3ESK A;  2XGO A;  4HOU A;  3FWV A;  3AS5 A;  4GYY A;  2I6H A;  4YVO A;  2WQH A;  4W9R A; 
#chains in the Genus database with same CATH topology
 3R7Q A;  5AEN A;  4FJZ A;  2DYS E;  3D9K A;  3GYZ A;  4AY5 A;  2LUH A;  4U7E B;  5HKP A;  3NBN B;  1TEZ A;  1YYH A;  1MYO A;  2I1J A;  2BUG A;  2AVP A;  2QC9 A;  3AG4 E;  2XZD G;  4WWP A;  5ANR A;  1BI7 B;  5B3S E;  4B8C B;  3PRZ A;  2EIJ E;  1SA5 A;  3CHO A;  4B93 B;  3ZEF A;  2XEH A;  3K9I A;  4DPR A;  1Z3X A;  2L0T B;  3AG3 E;  2ZIS A;  4G26 A;  4JVS A;  4XZ4 A;  4G11 A;  2YHC A;  3ZIM A;  4I6G A;  2J4B A;  3UT7 A;  1E7U A;  4JB8 P;  1MX4 A;  3DSW A;  4GMJ A;  2KCL A;  5JJ7 A;  5ARF A;  1TNY A;  2DIW A;  3VLE A;  2A4Z A;  3CHR A;  5BXU A;  3PZ4 A;  3QK0 A;  4QQI A;  4ABN A;  1JPL A;  1IXV A;  3KAE A;  3MKR A;  4EBA A;  2EIN E;  4I17 A;  1ELW A;  3VTX A;  4A3T A;  4N2Q A;  2LXL A;  2Y4U A;  5EX3 A;  3JYS A;  3DXK G;  5AAR A;  3TWV A;  2P9N G;  3B7B A;  1TNO A;  4LER A;  2HO1 A;  2OOE A;  4YDO A;  3R9M A;  4A1S A;  1N4R A;  3RO2 A;  2V5Q C;  3TXN A;  4ZFH A;  3QNK A;  4RG6 A;  3G2T A;  3FUD A;  4A55 A;  3G2U A;  3ASD A;  4GTV A;  4RQI A;  1N4S A;  5KNH D;  4BY6 A;  3EIQ C;  4FA6 A;  1NFI E;  2X6K A;  1VDY A;  2IFU A;  2XRY A;  2GRN B;  5LOZ A;  3UIP C;  5JHA A;  1X5B A;  2XPI A;  4PS7 A;  3QKY A;  3DSS A;  1HH8 A;  1QBQ A;  3AS4 A;  1TYQ G;  4UUC A;  3LCA A;  4UQZ A;  4U63 A;  2NXP A;  3CEQ A;  4XKB A;  2J07 A;  3TGO A;  2J9Q A;  4ME2 A;  4WWN A;  2CG2 A;  1NP7 A;  1E8Y A;  5DBK A;  1MZC A;  2CFU A;  5D66 A;  4BWR A;  4BEP A;  3PE3 A;  1LF8 A;  3Q78 A;  3V30 A;  3UX4 A;  4X8Q A;  2KM4 A;  5AJD A;  1N54 A;  3PZ1 A;  1Z5S C;  4L2Y A;  3TXM A;  3QB2 A;  2VGX B;  4UQY A;  5B1B E;  4K03 A;  4FJY A;  4ATG A;  4HLE A;  4XKC A;  4NIK A;  3EDT B;  2F8X K;  2IOL A;  4EEC A;  5AQ9 A;  2XGM A;  4U07 A;  4K5A B;  1NL4 A;  2FEZ A;  4IUL A;  2XRZ A;  2R59 A;  1NA0 A;  1S70 B;  2IF4 A;  4AP2 A;  4EHM A;  3ZYK A;  5LX8 A;  4MS6 A;  4L7T A;  3NB2 A;  4WAF A;  3PEU B;  3FUI A;  1BI8 B;  4HRM B;  3EHR A;  2A5U A;  3FUM A;  5FIO A;  4J8S A;  2YHE A;  2LAH A;  2XS8 A;  4K5B A;  5FZQ A;  2WQ6 A;  3GW4 A;  4K0R A;  3UI2 A;  1B89 A;  5FJY A;  2Y1L E;  2GRM A;  2WXP A;  3N71 A;  3Q7F A;  1OXJ A;  4U95 D;  5B1A E;  3EHN A;  5HQ8 A;  2FO1 E;  3V79 K;  4U0Z A;  3ZRH A;  1QNF A;  3TWQ A;  1ELK A;  3SNX A;  3T8K A;  5BV1 A;  2QZA A;  3FHE A;  5FQ4 A;  1HU3 A;  4HNA D;  5CHE E;  5E76 A;  3CHP A;  3BG0 B;  4TXQ A;  4UI9 K;  4NQ0 A;  5CBO A;  3AS8 A;  4HB5 A;  3LY8 A;  5EYP F;  4ACK A;  3TWS A;  3T9K A;  3ASF A;  1Q2Z A;  1E8W A;  1N4P A;  4F6R D;  1DCE A;  1TN8 A;  4I1A A;  4KT6 B;  3W9F A;  1Z3Y A;  3E34 A;  3RAU A;  5CCM A;  3ULY A;  2P9P G;  4CRW A;  5G55 A;  3CIA A;  2WXN A;  4GCN A;  4E85 A;  4FU3 A;  4I9C A;  1HS6 A;  2WXK A;  2YIN A;  2OV8 A;  2AXU A;  3ABK E;  4CCA A;  2P9I G;  4KZC A;  3Q9U C;  5A6C A;  3TWU A;  2M63 A;  4JHK A;  4CDR A;  3DXM G;  2XCC A;  2KBX A;  4JPS A;  1H6P A;  5AJL A;  2GRP B;  5EX0 A;  4CYM D;  3SO8 A;  4LSZ E;  3ZFW A;  3UM2 A;  4HOT A;  1JWF A;  2BKG A;  4LCT A;  3FU3 A;  4DLO A;  2J49 A;  1N4Q A;  3L82 A;  3VTY A;  4DLQ A;  3UQ3 A;  5EN5 D;  2VGE A;  3PZ2 A;  3J5P A;  4J7W A;  5KJK A;  4APF A;  2HYZ A;  3T8M A;  5CMW A;  2DWZ A;  2WXI A;  3QWV A;  3HVE A;  3L16 A;  2VQ2 A;  1YCS B;  3EJN A;  3AU4 A;  4YDE A;  5IY5 E;  4TUM A;  4WUY A;  4H7X A;  1BPO A;  4C0M A;  4GA2 A;  4BFR A;  4IYP A;  3W9G A;  3DSX A;  4FUL A;  3B95 A;  3PRE A;  2ETC A;  1OCZ E;  2J08 A;  4OAV B;  1MX6 A;  1UW4 B;  5AQ7 A;  4DX1 A;  5JHB A;  4LNU D;  4G8K A;  5KJM A;  1WDY A;  4TRQ A;  3HDX A;  4DRX E;  2QYJ A;  2XEE A;  3UUX A;  3FTW A;  2Y0B G;  2QFC A;  4HBD A;  4GTM A;  1QYM A;  3AG1 E;  3CQG B;  5D0Q D;  3C72 A;  2OVB A;  3AS5 A;  1HFA A;  2I6H A;  4U0U A;  4OVV A;  3OXL A;  3JCK C;  4OYS A;  1N94 A;  4ILG A;  3LS8 A;  4O1O A;  4QFV A;  3T5V A;  3BG1 B;  3SFZ A;  4U8Y D;  1TNU A;  4DJA A;  2XPY A;  5JA4 D;  4AOF A;  5AN8 A;  1PAQ A;  3QAR A;  3UIO C;  2XPZ A;  1JCR A;  5FQ8 A;  3CVL A;  1UOH A;  2X6H A;  1DNP A;  4IRU A;  1UN8 A;  4N3B A;  4XIF A;  3FFL A;  3HXE A;  3U9W A;  4GMR A;  5FQ7 A;  5G05 J;  5HI7 A;  5EID A;  2RFA A;  3FTZ A;  2UWJ G;  4JXT A;  2WXR A;  3FTU A;  4MKT A;  4B89 A;  5D0O D;  2LO6 A;  3UIN C;  2I1K A;  3FUF A;  1LD7 A;  3D9J A;  5KJL A;  2UY1 B;  4PUC A;  2GW1 A;  3BQO A;  3O48 A;  4DX7 D;  2E2E A;  2ZU6 B;  2A5E A;  1O1T A;  3R9A B;  1OWN A;  4I6J A;  3L17 A;  4KZ0 A;  2MYO A;  2WPV A;  2V5F A;  4WWO A;  3L22 A;  3D9M A;  3PH0 C;  2RFM A;  3ENE A;  3Q5M A;  4I1M A;  4XI0 A;  4KBQ A;  2PL2 A;  3Q79 A;  3IHY A;  3ZYQ A;  1JCQ A;  3CVV A;  1INZ A;  5AAO A;  3DST A;  4BT8 A;  2VTB B;  1E8Z A;  2DVW A;  2VSY A;  1FT1 A;  5CEC B;  3IKO B;  1V54 E;  2IY0 C;  2DBA A;  4H7Y A;  1HZ4 A;  3IHV A;  2IO3 C;  2RD0 A;  4AXH A;  4HVB A;  4DUI A;  4HOS A;  3RIB A;  3CVW A;  3L9T A;  1KZP A;  2CFZ A;  1D8D A;  3G2W A;  3Q4A B;  4JD2 G;  2KZT A;  3LYA A;  1KLX A;  3T5X A;  4HOR A;  3CHS A;  1O1S A;  1S63 A;  2R05 A;  2RG8 A;  2KCV A;  3RRM B;  4BSX A;  2X3M A;  5LFA A;  3ZUV B;  1V55 E;  3E32 A;  3SGH A;  4NUR A;  3URZ A;  3I4G A;  4L23 A;  2FI7 A;  3F6Q A;  5BT1 A;  3LY9 A;  3DWL G;  4G24 A;  2ETA A;  1FCH A;  4M3O A;  1TJF A;  3TWR A;  4EZJ A;  5KNG A;  3HIZ A;  3JUE A;  1G3N B;  2IJG X;  3Q73 A;  4XX5 A;  4D10 C;  1TNB A;  3CVP A;  3PNL B;  4URK A;  1BD8 A;  5KWD A;  4HQD A;  5ENR D;  4PDX A;  2ION A;  3APD A;  2WMO A;  4CZ2 D;  1NZN A;  1PC2 A;  3QOU A;  4ANX A;  3UXG A;  4UWG A;  2Y69 E;  2DCP A;  2IQC A;  1MJ0 A;  3UM1 A;  1GW6 A;  1OCC E;  3JQ1 A;  4ILI A;  4HOQ A;  5BUZ A;  2WVI A;  3C3O A;  2LAI A;  5A7D B;  4RSY A;  1IYG A;  2I9C A;  2DZO A;  1TN6 A;  3TL5 A;  2R17 C;  1HO8 A;  3D9H A;  4O60 A;  4AV7 A;  3ASH A;  2PNN A;  2CHZ A;  1MX2 A;  3UT4 A;  3MV2 B;  4CDN A;  4KVO A;  5HRY A;  4RG9 A;  1HF8 A;  1H2U A;  1Y8M A;  2IU1 A;  3S7F A;  3TG5 A;  4BSZ B;  3HHM A;  2VJ8 A;  4U8V D;  4U96 D;  3FTY A;  2H6I A;  2J8S D;  3ISM C;  5C2Y A;  4ATZ D;  4HS2 A;  4JL0 A;  2P2C P;  3NOG D;  4F1P A;  3MGB A;  1OWL A;  2QYU A;  4UI9 C;  4FP7 A;  4UI9 J;  2P9K G;  3E30 A;  4HI8 A;  3FP3 A;  5CER B;  4G23 A;  2LSU A;  3U64 A;  1KT1 A;  1U3D A;  2MHK A;  1N9A A;  4YDY A;  4A3V A;  1S0P A;  4GCO A;  5D2M C;  4HLL A;  3I5P A;  3IEG A;  2OVF A;  2NC9 A;  3ULQ A;  3FY4 A;  3V31 A;  2R2L A;  3CKC A;  3D9O A;  2XHE A;  4N2S A;  3SD5 A;  4GTT A;  1XGW A;  1JWG A;  4J8Y A;  1TN7 A;  1YA0 A;  3P1U A;  4BT9 A;  1JUQ A;  5EDS A;  1S64 A;  4YDW A;  4GU5 A;  3ML8 A;  1UN9 A;  4GTQ A;  4IN3 B;  4CDM A;  3ZVV A;  3ZHE A;  3ZYL A;  2PM6 A;  4U8H A;  4GZC A;  4HOU A;  1OWM A;  3FWV A;  4HRN A;  5BPP A;  2ETB A;  4GYY A;  3QC1 A;  4YVO A;  3FUK A;  4W9R A;  4L1B A;  4FLH A;  3FUE A;  3GZS A;  4HXI A;  3D9I A;  3SF4 A;  3UPV A;  3OAW A;  1IKN D;  3FH7 A;  4AVX A;  3TWW A;  3AG2 E;  3PZD A;  1TNZ A;  4GYO A;  4AIF A;  3J5Q B;  3MJW A;  3C3R A;  4BTA A;  4G2V A;  3PUJ A;  2PQN A;  2R02 A;  1DC2 A;  4XEI G;  4JHJ A;  4O1P A;  4UWF A;  5HS0 A;  5BW8 C;  1K1B A;  1YMP A;  4KYO B;  5E75 A;  4R7L A;  3FH5 A;  2JEK A;  1D9S A;  4YND A;  1EDU A;  5T4Y A;  4EPZ A;  4GPK A;  3BU8 A;  2F37 A;  3LPZ A;  3TJP A;  1N0Q A;  4CT0 A;  3AU5 A;  4ANU A;  3SBS A;  3RJV A;  1A17 A;  2BF0 X;  5J90 A;  5G04 C;  1OCR E;  5FZS A;  5G04 J;  2VYI A;  3E4B A;  3PUK A;  4TXP A;  3P2B A;  3ABM E;  1RW2 A;  4AY6 A;  1NI1 A;  5CCL A;  2C0L A;  3HXB A;  3FEX A;  4HFG A;  4GTR A;  3HVE B;  4XI9 A;  4BX9 A;  3EHM A;  5ARG A;  4FHJ A;  5C1D A;  4N5Q A;  1HXI A;  3R7R A;  4G25 A;  5BXO A;  3Q75 A;  2AWI A;  3CK8 A;  2YNQ A;  3VLD A;  4EQF A;  3KSL A;  1N52 A;  3RRN B;  4FLB A;  4UWL A;  5ANL A;  2Y4T A;  2QY7 A;  3MV3 B;  2BED A;  4F1S A;  3ULE G;  2R5S A;  3AAA C;  4I1O B;  4Y6W A;  1QZ2 A;  2GRL A;  3PVL A;  4APO A;  3NAW A;  2WXM A;  2HR2 A;  2KCK A;  3DBS A;  3RO3 A;  2P58 C;  3Q49 B;  4I2W A;  3CVX A;  3B7S A;  1SZ9 A;  2H6F A;  4GML A;  1UJJ A;  3FTS A;  3OXG A;  3Q47 B;  4K5C A;  3MX3 A;  1Z6T A;  3HG0 D;  4PS3 A;  4ILH B;  1E96 B;  4P29 A;  3FEY A;  2WMN A;  2X6F A;  3S7D A;  4N3C A;  4KXK B;  1EYH A;  5CMY A;  3LEW A;  3ZYM A;  4DX6 D;  1DVP A;  4V3I A;  1K3Z D;  2PZI A;  3BUA A;  2Q7F A;  3LDZ A;  2EIK E;  3LY7 A;  2R03 A;  3ESL A;  1K1A A;  4KMO A;  3GZ1 A;  5CRU A;  3JXJ A;  1WM5 A;  3DEP A;  3FTV A;  3RRU A;  2MRI A;  4PH4 B;  3FUJ A;  5JJ6 A;  1BU9 A;  2V8S E;  4FAD A;  3FUL A;  1TJC A;  4GZ5 A;  2WXF A;  4GPM A;  1N11 A;  4M7C A;  3CSF A;  2WQ7 A;  3ZGQ A;  2NSZ A;  2OND A;  4Q96 A;  4WNG A;  4TUU A;  2P9S G;  4HI9 A;  5T3R A;  5EIB E;  5ENP D;  1AP7 A;  2XEV A;  3NZU A;  3S7B A;  3LJ3 A;  2DZN A;  3NZS A;  3LVR E;  2LNI A;  1HX8 A;  5AQB A;  1WAO 1;  2XS1 A;  3B13 A;  3UMV A;  4A63 B;  3PDN A;  2OEV A;  1QQE A;  1AWC B;  4N5C A;  2KC7 A;  4I43 A;  4LEU A;  3FU0 A;  1KPS B;  3MZL B;  5ENT D;  3SFY A;  3ASG A;  5G2N A;  3EU9 A;  3KEA A;  3UTM A;  4CEM A;  1H0A A;  1ZB1 A;  1HG2 A;  3E37 A;  3PZ3 A;  4KVM A;  2C2L A;  2AW6 A;  3FUN A;  4AM9 A;  2IEJ A;  4HRL A;  1WY6 A;  2LSV A;  3C5R A;  4EZL A;  3D9L A;  3JQ0 A;  4B0Z A;  3B7T A;  4JA7 A;  1OUV A;  1UG3 A;  2H6G A;  1N95 A;  5JJT A;  1ZU2 A;  3TWX A;  2KZT B;  3D9P A;  4GTP A;  2NYJ A;  3FDH A;  5ENS D;  2BKK B;  3MYV A;  4AEZ C;  4FC8 A;  4NAC A;  3I3N A;  5BNW A;  2GGF A;  5FTP A;  4O6F A;  4GZ3 A;  2ILR A;  3ONK A;  2JLB A;  3UM0 A;  5FQ6 A;  2ZXW E;  2HM8 A;  3ZN3 A;  3CVQ A;  3DPD A;  4L9P A;  4JC8 A;  4BES A;  1H19 A;  3JUI A;  1X81 A;  3DSU A;  2FUL A;  5EKQ D;  4J8D A;  3B7R L;  1N0R A;  1MHQ A;  3UT8 A;  4B94 A;  2P9U G;  3CR3 A;  3ML9 A;  2VSO E;  1P5Q A;  3HXF A;  4DI4 A;  3AJI A;  4GA1 A;  3Q15 A;  3U4T A;  2KAT A;  4MLP A;  3B7U X;  3V2X A;  4GA0 A;  1IQR A;  3ZW3 A;  3SQV A;  4G1T A;  2F8Y A;  5KJN A;  1OWO A;  1EPU A;  1OCO E;  3ESK A;  2EIM E;  3G2V A;  3D3M A;  4JEU A;  3O4Z A;  3CVU A;  2WQH A;  3L54 A;  2WXO A;  3CGH A;  5KBA A;  2GRO B;  3WXX A;  5T8I A;  5JMN D;  5FZR A;  2L9B A;  2CHX A;  2CHW A;  1H2T C;  2XQ0 A;  2Y3A A;  4ZHB A;  4I2Z A;  3E33 A;  5AQA A;  1KT0 A;  5CRV A;  4RVB A;  3EIJ A;  1PY1 A;  3QDN A;  1ZBP A;  5J08 A;  4J8F A;  1OWP A;  3Q7A A;  3S2A A;  3SFX A;  3TWT A;  2XZT G;  4G8L A;  3PNT B;  2VGX A;  4EBA G;  5ENO D;  4RLY A;  3SZ7 A;  4C9B B;  3QWW A;  4Z68 A;  2L6J A;  5CBN A;  3CK9 A;  3PS6 A;  4GZD A;  1FPP A;  1UJK A;  4JZY A;  4CT4 A;  1W3B A;  2V4H C;  4Y6C A;  4LUN U;  5ENQ D;  1KZO A;  4EZK A;  3RK6 A;  3LJN A;  3NOC D;  3U66 A;  3TG4 A;  4BER A;  1SA4 A;  3PE4 A;  4GAA A;  5FWQ A;  4NRH B;  2C0M A;  2ZGD A;  3CST A;  2B6C A;  4J6I A;  1FVH A;  3KSQ A;  1IHB A;  4F7A A;  4LNG A;  2X6I A;  3C98 A;  3CV0 A;  3RSE G;  1A5E A;  1MQS A;  1WG0 A;  4LNB A;  4CGV A;  4DX5 D;  1H6K A;  4GB9 A;  2B0O E;  3UKU G;  4JW1 A;  3MEK A;  3CHM A;  3IV0 A;  2WXJ A;  3ZHE B;  2WM9 A;  5EIL A;  4E6H A;  2BTD A;  5FIN A;  3ZXS A;  3LKU A;  1SW6 A;  3DPY A;  4BET A;  2PQR A;  3DSV A;  5CED B;  4DX2 A;  1FVF A;  3NF1 A;  3I4R B;  2CG3 A;  1SVX A;  4GYW A;  2OEW A;  1SQM A;  4A1G A;  4ANW A;  4GTS A;  4Q94 A;  4J0U A;  3CLJ A;  2X38 A;  3U3W A;  1OY3 D;  1U2V G;  4BTB A;  3NQP A;  3HXD A;  4TXR A;  4GZ6 A;  3OXF A;  3FTX A;  4WNF A;  4F3V A;  5KCM A;  3ZPJ A;  3L13 A;  3ZNG A;  4ANV A;  5BV0 A;  4JHR A;  3LVQ E;  5LCW C;  1NA3 A;  2XGS A;  3WG7 E;  5LCW J;  4WNE A;  1IQU A;  2J09 A;  2EIL E;  4AJW A;  3IXE A;  3OTN A;  4U04 A;  1BLX B;  2PM7 A;  3DEO A;  3CKB A;  2GRR B;  1JCS A;  4I9E A;  3VLF A;  1H2V C;  1DCQ A;  5CEA A;  2V4L A;  3C3Q A;  1TR4 A;  2WXL A;  2GRQ B;  4XE0 A;  3MKQ A;  3S7J A;  4UWH A;  1FT2 A;  2ZIR A;  3GZ2 A;  3G2S A;  1RZ4 A;  3SBT B;  2MOW A;  2F0Y A;  3EUV A;  3MKQ B;  2VSN A;  3EHQ A;  4OVU A;  4UQX A;  2AXZ A;  2WXG A;  3BEE A;  4J8E A;  2V0P A;  1E8X A;  2XCB A;  3ZXP A;  4ACL A;  1SZA A;  2YQ8 A;  4LRZ A;  2VSX E;  3CK7 A;  2FBN A;  3KD7 A;  4C48 B;  3DRA A;  3SY2 A;  5FT9 A;  2RKK A;  4UWK A;  3HXC A;  3KEZ A;  2AXV A;  3CHQ A;  4FHK A;  1OT8 A;  1LTX A;  4L2L A;  4YVQ C;  2OCC E;  1HE8 A;  5DIZ A;  1XNF A;  3Q9N C;  4I6E A;  4TV3 A;  5H7P A;  3TAX A;  3ZU7 B;  3RU0 A;  3UM3 A;  4N39 A;  5M72 A;  4U0S A;  3ASO E;  2IO2 C;  1HG5 A;  5A23 A;  3EU5 A;  2XEN A;  4BX8 A;  4OAU C;  5LP0 A;  3QAQ A;  4CGW A;  3X2Q E;  3L08 A;  5AYW D;  1ELR A;  2FO7 A;  1O1R A;  3ONL A;  1E7V A;  3L6A A;  4JA9 A;  3FUH A;  1D8E A;  3APF A;  2ZGG A;  3RKV A;  3FU6 A;  2FF4 A;  2KXP C;  5EYL A;  4DK5 A;  4N3A A;  1U3C A;  2E0I A;  1Y6I A;  2IOS A;  5ENN A;  1IHG A;  3IBE A;  5G05 C;  1E90 A;  3JXI A;  3QWP A;  4F53 A;  3KS2 A;  4MBG A;  2EQX A;  3HYM B;  3MA5 A;  2UY1 A;  2J4D A;  5AIJ A;  3FH8 A;  3QJZ A;  2VGY A;  2X6J A;  4PS8 A;  3CQC B;  5ITZ F;  3MCX A;  2H6H A;  3ABL E;  1K8K G;  3ASN E;  4DI3 A;  4C0E A;  1L5J A;  4WND A;  2DYR E;  1EF1 C;  2LXM A;  3UKR G;  2JAB A;  3CVN A;  1LD8 A;  3SHF A;  4B8A A;  2WXH A;  3D9N A;  1O5M A;  2AJA A;  2L0I A;  2L6B A;  4Q69 A;  3FU5 A;  3CVY A;  2P9L G;  2HE0 A;  3V2O A;  4GTO A;  2WB2 A;  1H6O A;  2I2O A;  2VTB A;  3APC A;  3SI5 A;  3HRA A;  2XGO A;  4LG6 A;  3PEV B;  3LXU X;  4JEH A;  4MRU A;  2WXQ A;  3ZKJ A; 
#chains in the Genus database with same CATH homology
 3FUE A;  3GZS A;  2WXO A;  3L54 A;  4OVV A;  4U0U A;  3CGH A;  4HXI A;  3R7Q A;  5AEN A;  4FJZ A;  3D9K A;  3WXX A;  5T8I A;  3GYZ A;  3D9I A;  3OXL A;  3JCK C;  4OYS A;  4AY5 A;  3SF4 A;  3UPV A;  5FZR A;  1TEZ A;  3OAW A;  4ILG A;  2L9B A;  2I1J A;  2CHX A;  3LS8 A;  2CHW A;  1H2T C;  3FH7 A;  4QFV A;  4AVX A;  2BUG A;  2XQ0 A;  2Y3A A;  2AVP A;  3PZD A;  3T5V A;  4GYO A;  4WWP A;  3BG1 B;  4I2Z A;  5ANR A;  3SFZ A;  4AIF A;  4B8C B;  1KT0 A;  3MJW A;  3PRZ A;  4BTA A;  4G2V A;  4DJA A;  3PUJ A;  3CHO A;  4RVB A;  2XPY A;  3ZEF A;  2PQN A;  3EIJ A;  3K9I A;  4AOF A;  1PY1 A;  1PAQ A;  1ZBP A;  3QDN A;  3QAR A;  4JHJ A;  4DPR A;  4UWF A;  1Z3X A;  5BW8 C;  2L0T B;  2XPZ A;  5J08 A;  4KYO B;  4J8F A;  5E75 A;  1OWP A;  4G26 A;  3CVL A;  4R7L A;  2X6H A;  5FQ8 A;  3S2A A;  4JVS A;  3FH5 A;  1DNP A;  2JEK A;  4IRU A;  4XZ4 A;  4G11 A;  2YHC A;  1UN8 A;  3PNT B;  3ZIM A;  4N3B A;  4XIF A;  2VGX A;  4EBA G;  4YND A;  1EDU A;  5T4Y A;  4EPZ A;  4GPK A;  3FFL A;  4I6G A;  2J4B A;  3U9W A;  3SZ7 A;  5FQ7 A;  5G05 J;  5HI7 A;  4C9B B;  3QWW A;  3UT7 A;  3LPZ A;  3TJP A;  4CT0 A;  2L6J A;  3AU5 A;  1E7U A;  4ANU A;  3SBS A;  3CK9 A;  3PS6 A;  3RJV A;  1A17 A;  4GZD A;  2BF0 X;  3FTZ A;  5J90 A;  2UWJ G;  2KCL A;  4GMJ A;  1UJK A;  4JZY A;  4JXT A;  5G04 C;  5JJ7 A;  4CT4 A;  2WXR A;  5ARF A;  2DIW A;  5FZS A;  1W3B A;  5G04 J;  3VLE A;  2VYI A;  2A4Z A;  3FTU A;  4Y6C A;  3CHR A;  4LUN U;  3E4B A;  3QK0 A;  4MKT A;  4B89 A;  5D0O D;  2LO6 A;  3PUK A;  3RK6 A;  1JPL A;  3P2B A;  4ABN A;  4EZK A;  2I1K A;  3KAE A;  3MKR A;  3FUF A;  4EBA A;  3U66 A;  3TG4 A;  4AY6 A;  4I17 A;  1ELW A;  3D9J A;  5CCL A;  2C0L A;  3VTX A;  4A3T A;  5KJL A;  4N2Q A;  3PE4 A;  2UY1 B;  2Y4U A;  4PUC A;  3FEX A;  4GAA A;  5EX3 A;  5FWQ A;  2GW1 A;  3JYS A;  4HFG A;  4NRH B;  3HVE B;  2C0M A;  3O48 A;  4XI9 A;  2E2E A;  2ZU6 B;  4BX9 A;  3EHM A;  4LER A;  2HO1 A;  3CST A;  5ARG A;  2OOE A;  4FHJ A;  3R9A B;  4A1S A;  1OWN A;  5C1D A;  4I6J A;  4J6I A;  3RO2 A;  3L17 A;  4KZ0 A;  3TXN A;  3QNK A;  4RG6 A;  2WPV A;  3G2T A;  1HXI A;  2V5F A;  4WWO A;  1FVH A;  3L22 A;  3R7R A;  3FUD A;  4A55 A;  3G2U A;  4G25 A;  3D9M A;  3ASD A;  2AWI A;  3CK8 A;  3PH0 C;  2YNQ A;  4F7A A;  3VLD A;  4EQF A;  3ENE A;  3Q5M A;  4BY6 A;  2X6I A;  3EIQ C;  3C98 A;  3CV0 A;  4I1M A;  4FA6 A;  4XI0 A;  1N52 A;  4KBQ A;  2X6K A;  2PL2 A;  1VDY A;  3IHY A;  3RRN B;  1MQS A;  2IFU A;  4CGV A;  4FLB A;  4UWL A;  5ANL A;  1H6K A;  4GB9 A;  3ZYQ A;  2Y4T A;  4JW1 A;  2QY7 A;  3MEK A;  3CHM A;  3IV0 A;  2WXJ A;  3MV3 B;  3ZHE B;  3CVV A;  1INZ A;  2XRY A;  4F1S A;  5LOZ A;  2WM9 A;  2R5S A;  2BTD A;  4E6H A;  4I1O B;  3ZXS A;  5JHA A;  3LKU A;  4BT8 A;  1X5B A;  2VTB B;  4Y6W A;  1E8Z A;  2XPI A;  4PS7 A;  1QZ2 A;  2GRL A;  2PQR A;  2VSY A;  3PVL A;  1FVF A;  3QKY A;  3NF1 A;  4APO A;  1HH8 A;  2WXM A;  3I4R B;  2HR2 A;  3AS4 A;  2CG3 A;  2KCK A;  3LCA A;  4GYW A;  3DBS A;  4UQZ A;  1SQM A;  3IKO B;  4A1G A;  4ANW A;  4U63 A;  3RO3 A;  4Q94 A;  2P58 C;  3Q49 B;  4J0U A;  4I2W A;  3CVX A;  2DBA A;  2NXP A;  3B7S A;  1SZ9 A;  3CLJ A;  4H7Y A;  3CEQ A;  1HZ4 A;  2X38 A;  1UJJ A;  3FTS A;  3IHV A;  3OXG A;  4GML A;  3U3W A;  3Q47 B;  4XKB A;  2J07 A;  3TGO A;  4BTB A;  3NQP A;  2RD0 A;  3MX3 A;  1Z6T A;  4AXH A;  4PS3 A;  4GZ6 A;  2J9Q A;  3FTX A;  3OXF A;  4ILH B;  4WNF A;  4F3V A;  1E96 B;  4ME2 A;  2CG2 A;  4WWN A;  5KCM A;  3ZPJ A;  4P29 A;  1NP7 A;  4HOS A;  3L13 A;  4ANV A;  3FEY A;  2WMN A;  4JHR A;  5BV0 A;  1E8Y A;  2X6F A;  3RIB A;  4N3C A;  3S7D A;  3LVQ E;  5LCW C;  3CVW A;  1NA3 A;  4KXK B;  2CFZ A;  3G2W A;  1EYH A;  3Q4A B;  2CFU A;  2XGS A;  5CMY A;  5DBK A;  5LCW J;  3LEW A;  3ZYM A;  4WNE A;  1IQU A;  2KZT A;  1DVP A;  2J09 A;  3LYA A;  4AJW A;  3OTN A;  4BWR A;  1KLX A;  3T5X A;  4HOR A;  3PE3 A;  1LF8 A;  4V3I A;  3CHS A;  4U04 A;  3UX4 A;  2PM7 A;  2RG8 A;  2KCV A;  3CKB A;  3RRM B;  2PZI A;  2KM4 A;  5AJD A;  1N54 A;  2Q7F A;  4L2Y A;  3TXM A;  3LDZ A;  4I9E A;  3LY7 A;  3QB2 A;  2VGX B;  2X3M A;  1H2V C;  3ESL A;  4UQY A;  3VLF A;  4BSX A;  5LFA A;  4K03 A;  2V4L A;  4KMO A;  3GZ1 A;  3SGH A;  4FJY A;  4ATG A;  4HLE A;  4XKC A;  1WM5 A;  4NUR A;  3EDT B;  3URZ A;  3FTV A;  3RRU A;  2WXL A;  2MRI A;  3I4G A;  2IOL A;  4PH4 B;  4XE0 A;  4EEC A;  3FUJ A;  4L23 A;  5JJ6 A;  2FI7 A;  2XGM A;  4U07 A;  2V8S E;  4FAD A;  3MKQ A;  3FUL A;  5BT1 A;  2FEZ A;  4IUL A;  2XRZ A;  2R59 A;  3S7J A;  4UWH A;  1TJC A;  3LY9 A;  4GZ5 A;  1NA0 A;  3GZ2 A;  2IF4 A;  3G2S A;  4AP2 A;  2WXF A;  4G24 A;  3SBT B;  3ZYK A;  5LX8 A;  4MS6 A;  2MOW A;  3CSF A;  1FCH A;  4L7T A;  4M3O A;  2WQ7 A;  1TJF A;  3ZGQ A;  3MKQ B;  2NSZ A;  2OND A;  2VSN A;  4WAF A;  4OVU A;  3PEU B;  4Q96 A;  4WNG A;  4UQX A;  2AXZ A;  2WXG A;  3FUI A;  4TUU A;  4EZJ A;  3BEE A;  4J8E A;  2V0P A;  1E8X A;  2XCB A;  5T3R A;  4ACL A;  1SZA A;  2A5U A;  3FUM A;  4J8S A;  2YHE A;  2LAH A;  2YQ8 A;  5FZQ A;  2WQ6 A;  3GW4 A;  3HIZ A;  4K0R A;  4LRZ A;  2IJG X;  2XEV A;  3NZU A;  3S7B A;  3LJ3 A;  2VSX E;  1B89 A;  4XX5 A;  5FJY A;  4D10 C;  3NZS A;  2GRM A;  2WXP A;  3LVR E;  3N71 A;  3CK7 A;  3CVP A;  2FBN A;  3PNL B;  3EHN A;  5HQ8 A;  2LNI A;  3KD7 A;  4URK A;  4U0Z A;  1HX8 A;  3ZRH A;  1QNF A;  1WAO 1;  3B13 A;  5FT9 A;  3UMV A;  1ELK A;  3SNX A;  4PDX A;  4UWK A;  5BV1 A;  3PDN A;  2ION A;  3FHE A;  3KEZ A;  1QQE A;  3APD A;  5FQ4 A;  4N5C A;  1HU3 A;  2WMO A;  2AXV A;  2KC7 A;  4I43 A;  3CHQ A;  1NZN A;  1PC2 A;  4FHK A;  4LEU A;  5CHE E;  3FU0 A;  3QOU A;  3MZL B;  4L2L A;  5E76 A;  4YVQ C;  4UWG A;  4ANX A;  1HE8 A;  5DIZ A;  3CHP A;  1XNF A;  3ASG A;  3BG0 B;  2DCP A;  4I6E A;  4TV3 A;  4UI9 K;  4NQ0 A;  3TAX A;  5G2N A;  2IQC A;  3RU0 A;  1GW6 A;  3JQ1 A;  3AS8 A;  4ILI A;  4N39 A;  5M72 A;  3LY8 A;  4HOQ A;  4ACK A;  4U0S A;  5BUZ A;  5A23 A;  1HG5 A;  2WVI A;  3ASF A;  4CEM A;  1E8W A;  2LAI A;  1H0A A;  4BX8 A;  5LP0 A;  3QAQ A;  5A7D B;  4I1A A;  4RSY A;  1HG2 A;  4CGW A;  4KT6 B;  1Z3Y A;  4L1B A;  4KVM A;  1IYG A;  3L08 A;  2I9C A;  5AYW D;  1ELR A;  2C2L A;  2FO7 A;  3ONL A;  5CCM A;  2AW6 A;  3TL5 A;  3FUN A;  2R17 C;  4CRW A;  4AM9 A;  5G55 A;  1E7V A;  3CIA A;  1HO8 A;  2WXN A;  3L6A A;  4GCN A;  4E85 A;  4JA9 A;  4FU3 A;  4I9C A;  1HS6 A;  2WXK A;  4AV7 A;  1WY6 A;  3ASH A;  2YIN A;  3FUH A;  2OV8 A;  2AXU A;  2LSV A;  4CCA A;  3APF A;  4KZC A;  2CHZ A;  3UT4 A;  5A6C A;  3MV2 B;  2M63 A;  4CDN A;  4EZL A;  4KVO A;  4JHK A;  3RKV A;  4RG9 A;  3D9L A;  3JQ0 A;  3FU6 A;  4B0Z A;  4CDR A;  3B7T A;  1HF8 A;  1H2U A;  1OUV A;  1UG3 A;  4JA7 A;  1Y8M A;  2IU1 A;  5JJT A;  2FF4 A;  1ZU2 A;  3S7F A;  3TG5 A;  2XCC A;  2KZT B;  3D9P A;  3HHM A;  2VJ8 A;  3FDH A;  4JPS A;  4DK5 A;  4N3A A;  1U3C A;  2E0I A;  1Y6I A;  2IOS A;  3MYV A;  5AJL A;  5EX0 A;  4AEZ C;  3FTY A;  5ENN A;  4FC8 A;  4NAC A;  3I3N A;  5C2Y A;  5BNW A;  4HS2 A;  1IHG A;  2GGF A;  4JL0 A;  5FTP A;  3ZFW A;  4O6F A;  3IBE A;  3MGB A;  4GZ3 A;  2ILR A;  5G05 C;  1OWL A;  1E90 A;  4HOT A;  3ONK A;  4UI9 C;  2JLB A;  1JWF A;  3QWP A;  5FQ6 A;  4FP7 A;  4LCT A;  3FU3 A;  4UI9 J;  4DLO A;  2J49 A;  4F53 A;  3KS2 A;  3FP3 A;  2HM8 A;  3ZN3 A;  3CVQ A;  3DPD A;  3VTY A;  4G23 A;  2LSU A;  3U64 A;  4DLQ A;  4JC8 A;  1H19 A;  1KT1 A;  1U3D A;  2MHK A;  5EKQ D;  3UQ3 A;  3JUI A;  4A3V A;  2EQX A;  3HYM B;  5KJK A;  4APF A;  3MA5 A;  2HYZ A;  3T8M A;  2UY1 A;  2FUL A;  2J4D A;  1S0P A;  5CMW A;  5AIJ A;  3FH8 A;  3QJZ A;  2VGY A;  2WXI A;  3QWV A;  2X6J A;  4GCO A;  3CQC B;  4J8D A;  4PS8 A;  3B7R L;  3HVE A;  3L16 A;  2VQ2 A;  1MHQ A;  3I5P A;  3IEG A;  3MCX A;  2OVF A;  3UT8 A;  2NC9 A;  4B94 A;  4DI3 A;  3EJN A;  3AU4 A;  3ULQ A;  3CR3 A;  4WUY A;  3ML9 A;  4C0E A;  3FY4 A;  2VSO E;  1P5Q A;  4H7X A;  1BPO A;  1L5J A;  3CKC A;  3D9O A;  4C0M A;  2XHE A;  4GA2 A;  4BFR A;  4IYP A;  4N2S A;  3SD5 A;  4WND A;  1XGW A;  1EF1 C;  1JWG A;  4DI4 A;  4GA1 A;  4FUL A;  3Q15 A;  3PRE A;  1YA0 A;  3P1U A;  4BT9 A;  4HVB A;  3U4T A;  2KAT A;  3CVN A;  1JUQ A;  2J08 A;  4MLP A;  5EDS A;  3B7U X;  1UW4 B;  4GA0 A;  3SHF A;  4B8A A;  4GU5 A;  3ML8 A;  1UN9 A;  2WXH A;  5JHB A;  3D9N A;  1IQR A;  4IN3 B;  5KJM A;  4CDM A;  3ZW3 A;  2L0I A;  4TRQ A;  3HDX A;  3FU5 A;  3ZVV A;  4Q69 A;  3CVY A;  3ZHE A;  3ZYL A;  3UUX A;  3FTW A;  2WB2 A;  4G1T A;  2QFC A;  2PM6 A;  2I2O A;  5KJN A;  2VTB A;  1OWO A;  3CQG B;  3APC A;  4U8H A;  5D0Q D;  4GZC A;  1EPU A;  3ESK A;  2XGO A;  3SI5 A;  3G2V A;  4HOU A;  1OWM A;  3FWV A;  3PEV B;  5BPP A;  2OVB A;  3D3M A;  3AS5 A;  3LXU X;  4JEH A;  4GYY A;  3QC1 A;  1HFA A;  2I6H A;  4JEU A;  4MRU A;  3O4Z A;  3CVU A;  4YVO A;  3FUK A;  2WQH A;  2WXQ A;  4W9R A;  4FLH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...