3ASGA

Mama d159k mutant 2
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
182
structure length
182
Chain Sequence
DIRQVYYRDKGISHAKAGRYSQAVMLLEQVYDADAFDVDVALHLGIAYVKTGAVDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALKNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPHFKKANELDEGASVELALVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly
pubmed doi rcsb
source organism Magnetospirillum magnetotacticum
molecule tags Protein binding
molecule keywords MamA
total genus 69
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07719 TPR_2 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
A PF14559 TPR_19 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3asgA01
3OXGA 4GZ3A 3LY7A 5JJ6A 1IYGA 3Q47B 1HH8A 2QFCA 5HI7A 4XI0A 3ASHA 3U4TA 3GW4A 4JHRA 5FZSA 4F3VA 2LSVA 5CCMA 2UY1B 2MHKA 4Y6WA 3Q15A 3O48A 4J8EA 1NA0A 2KCKA 2XPIA 3KAEA 3LPZA 3UPVA 2ONDA 4I9EA 5LCWC 1NA3A 1WM5A 3LY9A 5CHEE 4YNDA 4RG9A 3ZGQA 2Y4UA 2Y4TA 1ELRA 4GYOA 3AS5A 4GZ5A 4U07A 5ARGA 4CDRA 4YVQC 3FP3A 3ZFWA 3CVQA 4J8DA 4I2WA 3LY8A 3RKVA 3S7DA 5M72A 3FFLA 5ARFA 2JLBA 2KCVA 3S7FA 2WQHA 3CV0A 5A7DB 4HOTA 2XEVA 2KATA 3Q4AB 4G25A 3KS2A 4UI9J 4I9CA 4AM9A 4HOUA 2VSNA 2C2LA 3ASDA 3AS8A 1IHGA 3LYAA 3LCAA 1KT0A 3MA5A 3CK9A 4G1TA 4UQZA 2P58C 2R5SA 4UI9K 3URZA 3WXXA 4AY5A 1ZBPA 3VTYA 4GYYA 4ME2A 5C1DA 5KJMA 1ELWA 1WAO1 4Y6CA 3E4BA 4GZ6A 3ZHEA 3BEEA 3OXLA 4I17A 1OUVA 3TGOA 3SZ7A 3GZ2A 4N3BA 2FBNA 2YHCA 4N2QA 2UWJG 3MEKA 2XGSA 3Q49B 4I1AA 5G04J 4BTAA 2NC9A 2VYIA 3K9IA 4I2ZA 5CCLA 3MV3B 3PDNA 3QDNA 3QWPA 3ZN3A 2XGOA 4XIFA 3CK8A 3CVPA 3ASFA 5FZQA 4XI9A 5EKQD 5KJLA 5JJTA 2I6HA 4G26A 5BW8C 3R9AB 3AS4A 3CVLA 5FT9A 4U0UA 2VGYA 4WNEA 4A1SA 4GCOA 3IEGA 1P5QA 4HOQA 3SF4A 4WNFA 3LKUA 2IF4A 3CK7A 5A6CA 3CEQA 4LEUA 5G05J 4G2VA 4KYOB 4NQ0A 3RU0A 4H7YA 4JL0A 1Y8MA 4G23A 1QZ2A 4RG6A 4BT8A 3U3WA 2LSUA 3JYSA 1HZ4A 2HR2A 2XCBA 2HYZA 2UY1A 3ASGA 3OXFA 5FZRA 3RJVA 3VTXA 4BWRA 2HO1A 2KC7A 4BTBA 4EQFA 4J0UA 3CVNA 3RIBA 2LNIA 3MKRA 2AVPA 2BUGA 1ZU2A 3MV2B 4U0SA 3TG5A 4GA2A 4KBQA 1A17A 4B94A 1HXIA 2IFUA 2VQ2A 5D0OD 4IN3B 4APOA 5HQ8A 4N2SA 3Q5MA 4JA7A 2PQNA 3ESKA 2VSYA 2J9QA 4U04A 5JJ7A 3RO2A 4UI9C 2KCLA 1PC2A 4JA9A 2L6JA 4UQXA 4WUYA 2XGMA 3QWVA 3UQ3A 5KJKA 2E2EA 4N39A 5D0QD 2XCCA 3ULQA 2YQ8A 3KD7A 4CGWA 4HOSA 5EX0A 5AYWD 4UQYA 1B89A 1YA0A 2PL2A 1TJCA 5DIZA 2VGXB 3GYZA 1QQEA 3FWVA 2PQRA 4AY6A 2FF4A 4O6FA 5LCWJ 1KLXA 4W9RA 5EX3A 5BNWA 4HORA 3N71A 4N3CA 5DBKA 3ZHEB 4WNGA 3EDTB 3PE3A 4U0ZA 1FCHA 4GA0A 2Q7FA 4GYWA 4YVOA 1XNFA 2OOEA 3QKYA 4CGVA 2C0MA 2PZIA 4G24A 4KXKB 3HYMB 2VGXA 3TG4A 5BT1A 3QOUA 3CKBA 1KT1A 4NRHB 4N3AA 2FEZA 3CKCA 4J8FA 2V5FA 5FTPA 3UUXA 4GPKA 5G04C 1NZNA 4H7XA 2GW1A 3PE4A 4N5CA 4WNDA 4AIFA 5KJNA 3S7BA 1E96B 3NF1A 3GZ1A 3QWWA 2FO7A 2WPVA 2DBAA 2FI7A 3S7JA 4BT9A 4GCNA 3ZPJA 4GA1A 5FJYA 1W3BA 5G05C 2C0LA 3RO3A 3TAXA 4ABNA
chains in the Genus database with same CATH superfamily
1K1AA 3PEVB 5FZSA 3FTSA 2LSVA 4Y6WA 3Q15A 3UPVA 4ANUA 4LERA 3CVQA 4I2WA 4UWKA 4FA6A 4DRXE 2CHWA 2I1KA 2J08A 1S64A 3HXDA 3BEEA 1E8WA 3ZNGA 2VYIA 3BG1B 3X2QE 5HKPA 3CVPA 4OVUA 3C3RA 5CECB 5CBOA 3SFZA 5G05J 3DEPA 4XE0A 4BFRA 2ETAA 4JXTA 4ACKA 1A17A 3CVXA 4I1MA 4K5CA 3T5XA 4FHJA 2V0PA 4UQXA 2A4ZA 4HOSA 1MX2A 4I6JA 3Q78A 3HXEA 5ENPD 2YINA 2VGXB 3FH5A 3CVYA 3UMVA 1TJFA 2J8SD 1TR4A 4F1PA 3CVWA 4AV7A 2I2OA 3J5PA 4MRUA 5J90A 2EIJE 2R02A 3KEZA 1MQSA 3SHFA 4GZ3A 2EILE 3LJNA 4J8EA 3ZKJA 2AXVA 5M72A 2ZISA 3QJZA 5A7DB 2A5EA 3B7BA 4G25A 2GGFA 4GAAA 1K1BA 4O1OA 4G8LA 3D9OA 3CHQA 3LDZA 1E90A 2L0IA 3HVEB 1DNPA 3CSFA 3HXFA 3O4ZA 3PZ3A 3PNLB 2KBXA 4PS8A 4XI9A 3FU3A 3AS4A 3NZSA 2WMOA 3ZXPA 3CLJA 4JL0A 1TNBA 1HO8A 1BPOA 3UT4A 4LG6A 4KZ0A 3Q75A 4KBQA 4N2SA 4MBGA 1UN8A 5J08A 3DSVA 3E30A 3IKOB 4B8CB 4N39A 4LUNU 4DI3A 3GYZA 1HU3A 4Q94A 5D66A 2EINE 4N3CA 3CQCB 3HVEA 1OCOE 1BU9A 5ANRA 4A63B 3TWSA 4MLPA 4B8AA 4WNDA 4XKBA 2WMNA 2B6CA 3FY4A 4JHJA 2C0LA 3HIZA 3F6QA 2MHKA 1JWGA 1O5MA 3LY9A 1KPSB 2Y4UA 4GYOA 1ELRA 4U63A 3FP3A 3S7DA 2KCVA 1YYHA 2XEVA 4LRZA 2X6JA 3G2SA 2Y69E 3AS8A 4FLHA 3MA5A 3UT8A 1EYHA 4Y6CA 2F0YA 2J07A 2DZNA 1XGWA 2DZOA 1OWMA 2F37A 4BTAA 4IULA 4I2ZA 4CZ2D 2X6HA 3B7UX 1UG3A 1JUQA 2GRPB 4RSYA 3VLEA 3TWXA 3BU8A 4H7YA 3L6AA 4EPZA 4B93B 4AOFA 3FUFA 4F53A 4EQFA 4K5BA 3Q5MA 4JA7A 5ENSD 3D9HA 4RVBA 3E37A 3KSQA 3G2UA 3Q9UC 3PS6A 5FWQA 3HHMA 4UQYA 3ZU7B 3W9GA 3FWVA 3SY2A 1OY3D 2M63A 2WXJA 3EHNA 3CHMA 4G24A 5BT1A 1IXVA 2PM6A 3C98A 2RFMA 3C5RA 3ZYKA 3PE4A 4AIFA 3S7BA 2FO7A 4TXPA 3S7JA 1W3BA 5G05C 5AQAA 1H6PA 1TYQG 4O1PA 5JMND 3KSLA 2YHEA 1Z3YA 2QYUA 1NA0A 1N54A 2XZDG 1IKND 4AVXA 1JPLA 2Y4TA 5ARGA 3UM0A 4J8DA 3FTXA 3AG2E 1Z6TA 3ML9A 5ARFA 4QFVA 3EUVA 3V79K 4AY5A 2IEJA 1ELWA 3ULEG 4UUCA 3E4BA 1Q2ZA 2PM7A 1ZB1A 2UWJG 2XZTG 4JVSA 4QQIA 2RFAA 2WXNA 3ASFA 5KJLA 3IBEA 1E8XA 2KXPC 4L9PA 3T8KA 2WVIA 5BXUA 3DSUA 3DPYA 3CK7A 3FTZA 4ATGA 1SZ9A 2IQCA 4G23A 3UKRG 4HS2A 2EIME 2FULA 3RJVA 1PY1A 2KC7A 1EDUA 2IFUA 2GRNB 3PVLA 3DPDA 5AENA 3ZEFA 1NI1A 3FDHA 3SI5A 2LAIA 2L6JA 3IHYA 2VTBB 3FUDA 4XKCA 2XCCA 3CR3A 4PS3A 1B89A 1OWPA 3TWTA 1BI7B 5LP0A 3SQVA 2IO3C 2OOEA 2PZIA 3QOUA 4JPSA 3E33A 3UUXA 3V30A 4GPKA 2B0OE 3DXMG 3ASNE 3ZPJA 4ILIA 4WWNA 3ASOE 5FJYA 2J4DA 3B7SA 2IY0C 2ETCA 2QFCA 3DXKG 4DLOA 3PNTB 3SBTB 3UIPC 3FH7A 3CQGB 3HXCA 4YVQC 1TEZA 2WQHA 3Q4AB 4R7LA 5A23A 3SFYA 3ZIMA 1HG2A 3G2WA 2I9CA 4DX2A 1N9AA 5JHAA 1D8DA 4U8YD 3ZXSA 3FUEA 2NC9A 2H6HA 2GRLA 2X6FA 3CHRA 4OAUC 2RG8A 5EKQD 4TV3A 4U0UA 2J09A 3C3OA 4Z68A 2IU1A 4HOQA 4LEUA 2LO6A 1S0PA 3T9KA 4BT8A 4UWFA 4BWRA 4I1OB 1BLXB 4A55A 2DYSE 3EU5A 1HXIA 2VQ2A 2MYOA 5CRUA 2J9QA 1HS6A 3OTNA 4MKTA 1H6KA 1AWCB 2WXMA 1N0QA 1YA0A 4HRMB 2IONA 2PQRA 4ZHBA 3ULYA 1G3NB 4U0ZA 5KJMA 4GYWA 4U8HA 4KVOA 4EHMA 4FHKA 2VGXA 3Q7FA 1NZNA 3JUEA 4OYSA 2GW1A 5LX8A 3QWWA 4GCNA 2IO2C 1LF8A 5JJ6A 3DSSA 3Q47B 4AJWA 4A3VA 3ESLA 3GW4A 4CT4A 1UW4B 5BPPA 3AS5A 4HBDA 3FFLA 1KZPA 1TNUA 3CIAA 2ILRA 4GTMA 1ZBPA 4L2YA 1S63A 5CEAA 2X6KA 4I6EA 3TWVA 3TGOA 4N3BA 2YHCA 3PZ2A 3QWPA 2EIKE 3IHVA 4LNBA 4G26A 2GRMA 3MGBA 3RK6A 3QC1A 5EYPF 3SF4A 2XS8A 3APCA 1K3ZD 3D9JA 1KZOA 2WXIA 3CVNA 3CHSA 3T5VA 3MV2B 4B94A 1H19A 2XEEA 1DCEA 5FQ4A 3UI2A 3QWVA 4CGWA 5JA4D 3G2VA 1TJCA 5EIBE 1QNFA 2P9UG 3UM1A 1N4SA 1INZA 4EECA 3CKCA 3ONKA 3SBSA 1OCZE 2XS1A 2WXQA 3BG0B 2X6IA 5FQ6A 3NF1A 5AARA 5G55A 4JD2G 1UJJA 3J5QB 4UWGA 4APOA 1OXJA 3EHQA 1IYGA 2V8SE 4TRQA 2NSZA 3MYVA 3UM3A 2XPZA 4GTPA 1X81A 1N4RA 3APDA 3APFA 1LTXA 2AJAA 3Q73A 4HOTA 2P9KG 3ENEA 3L08A 2VSNA 1UN9A 3LYAA 3IXEA 4KMOA 4PH4B 4O60A 4I17A 4FP7A 4C48B 4HB5A 5FQ8A 2LXMA 5KWDA 3JXIA 5CMYA 5C2YA 5ENOD 1H2VC 3ML8A 4M3OA 5ENQD 2P9SG 3SNXA 4CDMA 4BETA 1OWOA 3IEGA 4X8QA 1H6OA 4G2VA 3OXFA 2HYZA 3LVQE 3JCKC 4GTTA 1N0RA 2NXPA 3IV0A 3AAAC 4EZJA 4A3TA 5JJ7A 1PC2A 3ULQA 4HXIA 3PH0C 5AYWD 3DSXA 4AY6A 3RSEG 4G11A 4D10C 4HORA 3ZHEB 3NOGD 5EDSA 5H7PA 3P2BA 1N4PA 4C0MA 4FULA 2DVWA 3I4GA 1O1SA 4CCAA 3MX3A 4XZ4A 3JUIA 3PZDA 4HVBA 4U07A 4CDRA 4DX1A 4LNUD 1U3DA 1A5EA 2A5UA 3KS2A 3FH8A 2C2LA 4JB8P 2R5SA 4UI9K 4IRUA 4TUMA 5C1DA 3Q7AA 4GPMA 3OXLA 4A1GA 5ENNA 3L9TA 2JABA 2DIWA 4GTVA 5AAOA 4WNEA 2V5QC 2R59A 5AIJA 4GCOA 2AWIA 3RRMB 4NQ0A 1SA4A 2YNQA 4J7WA 2QYJA 3VTXA 3L54A 3HRAA 4J0UA 4C0EA 4U8VD 3QAQA 4IN3B 3R9MA 3FULA 4CT0A 2XGMA 2F8YA 3FEXA 2YQ8A 4ACLA 5AQ9A 2BKGA 2PL2A 3VLFA 1LD7A 1QYMA 3FTWA 4AXHA 4HFGA 4DK5A 1FPPA 4JEHA 3PE3A 4YVOA 5T3RA 2C0MA 4ANXA 4TUUA 5D2MC 4FLBA 1OCRE 1O1RA 1NP7A 2DBAA 4ANWA 3OXGA 3VLDA 4K0RA 3UINC 5CCMA 2WB2A 2ZU6B 3FUMA 1V55E 3KAEA 2ONDA 4HQDA 5HS0A 3LY8A 3AG1E 2H6FA 3V2OA 4I9CA 4UQZA 1KT0A 4G1TA 3URZA 3VTYA 4GYYA 4GTQA 3SFXA 4JHKA 3UM2A 4FJZA 4N2QA 3MEKA 2XGSA 3Q49B 5B3SE 4MS6A 2XGOA 2R2LA 2I6HA 2OEVA 5BW8C 3CVLA 3LVRE 1WG0A 5EILA 4FC8A 1TN6A 3KEAA 2LSUA 2WXKA 4EZKA 3UX4A 2LNIA 3MKQA 3D3MA 1Y6IA 3TG5A 4GA2A 5FIOA 4L2LA 3ESKA 2MRIA 4CEMA 4K5AB 3RO2A 4WUYA 1BI8B 1GW6A 1N11A 1PAQA 3L13A 2BEDA 3V31A 1WY6A 2FF4A 5AQ7A 5BNWA 3EDTB 4GA0A 4RQIA 1YMPA 2CFZA 5FTPA 2DWZA 3ZYMA 4H7XA 2Y0BG 4DX6D 1HFAA 4AP2A 5AQBA 3PZ4A 2ZGDA 2VSOE 3T8MA 2P9PG 5T8IA 4BESA 4FADA 1NL4A 1EF1C 4GU5A 1YCSB 3U4TA 3CHPA 3MKQB 4GZDA 3O48A 2XPIA 3LPZA 4DX7D 2XHEA 1TNZA 3FEYA 1BD8A 1E8ZA 5EN5D 1K8KG 3ASDA 3WXXA 3CK9A 5ANLA 1FT2A 3PUJA 5FQ7A 1S70B 2QZAA 2CHZA 5ENRD 3CHOA 2R03A 3S2AA 2P2CP 3K9IA 4KZCA 5LOZA 3PDNA 4WWPA 3ZN3A 4XIFA 5FZQA 3PZ1A 4JC8A 3UTMA 3MCXA 4N5QA 1N52A 1Z3XA 1SZAA 3TL5A 4WNFA 1O1TA 5A6CA 1MJ0A 4ILHB 2NYJA 2WXFA 2VJ8A 3L22A 2AXUA 2UY1A 3NQPA 5FZRA 2XRYA 4DUIA 3G2TA 4FU3A 4P29A 2GROB 4ZFHA 2PQNA 4JEUA 4DX5D 3P1UA 5KJKA 5D0QD 3Q9NC 4K03A 3OAWA 1MX6A 1MHQA 1KLXA 4B89A 4GZCA 2OVBA 5AN8A 1E7VA 3B7RL 4XEIG 3D9KA 5AJDA 4URKA 3FU0A 3PRZA 2Y1LE 3SD5A 3LY7A 2JEKA 4LCTA 3RRNB 2WXPA 3AU5A 2WXLA 1X5BA 2P9IG 3NAWA 5CRVA 4HOUA 1DC2A 2E0IA 3LCAA 5ENTD 1U2VG 2KZTA 2V4LA 4J8SA 3AJIA 2X38A 4ME2A 3TWQA 4NIKA 3GZ2A 3QNKA 1IHBA 5ITZF 4RLYA 5JJTA 1ELKA 2BF0X 4CRWA 5FT9A 4JW1A 4AEZC 1UOHA 1P5QA 4KYOB 2OVFA 4UWHA 3BQOA 2XCBA 3ASGA 4Q69A 2Y3AA 3UKUG 2VTBA 3RIBA 2BUGA 1MZCA 3E34A 2ZIRA 2VSYA 3UQ3A 5CEDB 3GZSA 2KM4A 4V3IA 3FUJA 4W9RA 5DBKA 2WM9A 2R17C 4EBAA 1N95A 4N3AA 2AXZA 3ONLA 4APFA 5G04C 1TN8A 3GZ1A 3NB2A 3QB2A 3D9MA 5AJLA 3FUNA 1E7UA 2XEHA 1MYOA 4XI0A 1U3CA 1NFIE 3DSWA 2P9LG 4KT6B 2WQ6A 2LAHA 3D9IA 3L17A 3FUKA 5EYLA 3QARA 3JQ1A 3EJNA 1D9SA 1H0AA 2GRQB 3AU4A 5BXOA 3UT7A 4DI4A 4BSXA 4YDWA 2RD0A 5CERB 1DCQA 2J49A 5JHBA 4EZLA 3Q79A 3RAUA 3D9LA 3QDNA 2V4HC 4ATZD 5KNGA 4I6GA 1OT8A 3RU0A 2L9BA 1Y8MA 1QZ2A 3R7RA 3JYSA 2HR2A 2XENA 2BTDA 4BTBA 1HX8A 4HNAD 3UIOC 4YDEA 3TWWA 2J4BA 3SO8A 4U04A 4HLLA 4U95D 5DIZA 2LXLA 3L16A 3LEWA 5EX3A 4WNGA 4L7TA 3ABME 4PS7A 3HYMB 2CFUA 3EHRA 1RZ4A 5KJNA 1E96B 2WPVA 3NOCD 3B13A 4J6IA 4GTSA 5HI7A 3ASHA 1IQUA 2UY1B 1H2UA 5CHEE 4GMJA 3DWLG 4RG9A 4L23A 4OVVA 2QC9A 4HRLA 2F8XK 3RKVA 2JLBA 4F1SA 3CV0A 3MJWA 2KATA 1L5JA 3WG7E 3JXJA 1IHGA 1SA5A 3E32A 3ZW3A 2P58C 4CYMD 5CMWA 2CHXA 4LNGA 3ZRHA 3EIJA 3SZ7A 3DRAA 4EBAG 3I4RB 1V54E 5CBNA 2IJGX 3FHEA 4WAFA 1HG5A 3CK8A 2CG3A 3D9PA 5HRYA 2OCCE 3EHMA 2ETBA 4A1SA 1JCRA 2WXGA 2GRRB 1D8EA 3CEQA 3W9FA 4E6HA 2WQ7A 1FVFA 2HO1A 2MOWA 4HLEA 4PUCA 4LSZE 3FTVA 1N94A 4JZYA 2XRZA 2L6BA 3KD7A 4U96D 3PEUB 3JQ0A 5LFAA 4IYPA 3U9WA 2ZGGA 1TN7A 3TG4A 4C9BB 3CKBA 4OAVB 2FEZA 4J8FA 3PREA 2QY7A 2BKKB 4G8KA 1HF8A 3TAXA 3ZVVA 1Z5SC 5EIDA 2KCKA 2VGEA 3RRUA 1NA3A 4GZ5A 3FU6A 2LUHA 5T4YA 3B7TA 4ABNA 4YDOA 2AW6A 1OWNA 3AG3E 4GZ6A 2FO1E 5BV0A 3R7QA 3ZHEA 4F7AA 1DVPA 2HE0A 2OEWA 2FBNA 2PNNA 2ZXWE 4I1AA 5CCLA 1E8YA 5B1BE 2IF4A 4Q96A 4PDXA 3B95A 3ABKE 4RG6A 3DSTA 4CDNA 2AVPA 2KZTB 1SVXA 3TXNA 5D0OD 3DEOA 2KCLA 3FUHA 3LS8A 3MZLB 4O6FA 2RKKA 1JCSA 2I1JA 4UWLA 3HDXA 3I5PA 2V5FA 1WDYA 3BUAA 1SW6A 1QBQA 1TNOA 4BT9A 4GA1A 3EIQC 5E75A 3RO3A 4E85A 5KNHD 4BERA 4F3VA 2H6GA 2IOSA 4TXQA 1WM5A 4YNDA 4HI9A 1TNYA 2DYRE 3S7FA 4F6RD 3ZYLA 4AM9A 3QK0A 5FINA 2X3MA 3AG4E 4I43A 4J8YA 4NURA 1OUVA 1JCQA 4B0ZA 1LD8A 3NBNB 3MV3B 1HE8A 2IOLA 1JWFA 3R9AB 2VGYA 3FTUA 2DCPA 3CSTA 3NZUA 2WXRA 3TWUA 3CVVA 4DLQA 2L0TB 3U3WA 1UJKA 4L1BA 2WXHA 3U66A 1H2TC 2XPYA 4YDYA 1IQRA 1RW2A 2EQXA 3TJPA 1N4QA 3PUKA 4WWOA 2R05A 4GMRA 3SGHA 4DJAA 5EX0A 3L82A 3ABLE 5B1AE 2CG2A 3N71A 2H6IA 1AP7A 1FCHA 2Q7FA 4KXKB 3LJ3A 1KT1A 4NRHB 5KCMA 3V2XA 5KBAA 3TXMA 3UXGA 2FI7A 4GB9A 2OV8A 1HH8A 4JHRA 1SQMA 1EPUA 5LCWC 4I9EA 3ZGQA 3DBSA 4M7CA 2HM8A 3ZFWA 4DPRA 3EU9A 4UI9J 4HI8A 4BEPA 4TXRA 1WAO1 2XQ0A 5E76A 3HG0D 5G04J 2VSXE 3TWRA 4BSZB 1OWLA 3LKUA 3D9NA 3HXBA 3CGHA 4NACA 1HZ4A 3C72A 3LXUX 3MKRA 4BY6A 1ZU2A 4FJYA 4U0SA 1VDYA 3ZUVB 3FTYA 5HQ8A 2P9NG 3ISMC 4HRNA 4GTRA 5IY5E 4UI9C 5G2NA 4JA9A 1FVHA 2E2EA 4KVMA 5BUZA 4ILGA 1QQEA 5LCWJ 4XX5A 4BX9A 1MX4A 4ANVA 3C3QA 1FT1A 4CGVA 1XNFA 3QKYA 4U7EB 3CVUA 3I3NA 4N5CA 5BV1A 2WXOA 3U64A 4BX8A 4GMLA 3FUIA 3FU5A 1OCCE 3ZYQA 4GTOA
chains in the Genus database with same CATH topology
3OXGA 4J6IA 3VLDA 2QFCA 4K0RA 5HI7A 3ASHA 3PEVB 1IQUA 5FZSA 3FTSA 2LSVA 3PNTB 2ZU6B 2UY1B 3FUMA 4DLOA 5CCMA 4Y6WA 2WB2A 3Q15A 3SBTB 3KAEA 3FH7A 3UPVA 2ONDA 1H2UA 3CQGB 5CHEE 4GMJA 4ANUA 4RG9A 4L23A 4OVVA 4LERA 4YVQC 1TEZA 3CVQA 4I2WA 3RKVA 3LY8A 2JLBA 4UWKA 4F1SA 2WQHA 3CV0A 4FA6A 3MJWA 2KATA 3Q4AB 1L5JA 4I9CA 4R7LA 5A23A 1IHGA 4UQZA 1KT0A 4G1TA 3ZW3A 3URZA 2P58C 2CHWA 3VTYA 4GYYA 2I1KA 2J08A 3ZIMA 5CMWA 1HG2A 2CHXA 4JHKA 3G2WA 2I9CA 3ZRHA 5JHAA 4FJZA 3BEEA 3EIJA 3B13A 1E8WA 3SZ7A 4EBAG 3ZXSA 3MEKA 4N2QA 2XGSA 3Q49B 3I4RB 3FUEA 2NC9A 2VYIA 2IJGX 3FHEA 4MS6A 4WAFA 2GRLA 1HG5A 2X6FA 2XGOA 3BG1B 3CK8A 3CHRA 2RG8A 2CG3A 3CVPA 4OVUA 5EKQD 2I6HA 3D9PA 5BW8C 3CVLA 4TV3A 4U0UA 2J09A 3EHMA 2IU1A 4A1SA 3LVRE 2WXGA 3SFZA 4HOQA 3CEQA 4LEUA 2LO6A 5G05J 4XE0A 1S0PA 4E6HA 4FC8A 4BT8A 2WQ7A 4BFRA 2LSUA 4UWFA 4JXTA 2WXKA 4BWRA 1FVFA 2HO1A 4I1OB 4A55A 4EZKA 3UX4A 2LNIA 3MKQA 2MOWA 3D3MA 4HLEA 1Y6IA 4PUCA 3TG5A 4GA2A 4ACKA 1A17A 3CVXA 1HXIA 3FTVA 2VQ2A 4I1MA 4L2LA 3ESKA 2MRIA 2J9QA 4CEMA 1HS6A 3RO2A 3T5XA 3OTNA 4FHJA 2V0PA 4JZYA 4UQXA 4WUYA 4MKTA 1H6KA 2XRZA 2WXMA 2A4ZA 4HOSA 1GW6A 3KD7A 1PAQA 4I6JA 3L13A 1YA0A 2YINA 3JQ0A 3PEUB 2VGXB 5LFAA 2IONA 2PQRA 1WY6A 3FH5A 2FF4A 4IYPA 3CVYA 3U9WA 3UMVA 5BNWA 3EDTB 4U0ZA 5KJMA 1TJFA 4GA0A 4GYWA 4U8HA 4KVOA 2CFZA 4FHKA 2VGXA 3TG4A 4C9BB 3CKBA 5FTPA 2FEZA 4J8FA 3PREA 3ZYMA 3CVWA 1NZNA 4AV7A 4H7XA 4OYSA 2GW1A 2QY7A 2I2OA 1HFAA 5LX8A 4MRUA 4AP2A 3QWWA 5J90A 4GCNA 2VSOE 3T8MA 5T8IA 3KEZA 1MQSA 4FADA 1LF8A 1HF8A 3TAXA 3SHFA 1EF1C 4GZ3A 3ZVVA 5JJ6A 3Q47B 4GU5A 4AJWA 4A3VA 3ESLA 3GW4A 3U4TA 4CT4A 3CHPA 3MKQB 4GZDA 3O48A 4J8EA 2KCKA 2XPIA 3LPZA 3RRUA 1UW4B 1NA3A 2AXVA 5BPPA 2XHEA 4GZ5A 3AS5A 3FEYA 5M72A 3FU6A 3FFLA 1E8ZA 3QJZA 5A7DB 4G25A 3CIAA 5T4YA 3B7TA 2ILRA 3ASDA 4ABNA 2GGFA 3WXXA 3CK9A 5ANLA 4GAAA 1ZBPA 4L2YA 2AW6A 3PUJA 5FQ7A 2X6KA 3D9OA 1OWNA 2CHZA 4I6EA 4GZ6A 3CHQA 5BV0A 3LDZA 3R7QA 3ZHEA 1DVPA 3CHOA 4F7AA 1E90A 3TGOA 2L0IA 3HVEB 1DNPA 3CSFA 3O4ZA 4N3BA 2FBNA 2YHCA 3PNLB 3S2AA 4PS8A 4I1AA 3K9IA 4KZCA 5LOZA 5CCLA 3PDNA 3QWPA 4WWPA 3IHVA 3ZN3A 4XIFA 5FZQA 4JC8A 4XI9A 3FU3A 4G26A 2GRMA 3AS4A 3MCXA 3MGBA 3NZSA 1N52A 3RK6A 1Z3XA 3QC1A 1SZAA 3TL5A 3SF4A 1E8YA 2WMOA 4WNFA 3APCA 2IF4A 5A6CA 4Q96A 3D9JA 4PDXA 4ILHB 2WXFA 3CLJA 4JL0A 4RG6A 2VJ8A 1HO8A 1BPOA 3L22A 2AXUA 2UY1A 3NQPA 3UT4A 5FZRA 2XRYA 2WXIA 3CVNA 4CDNA 3CHSA 3G2TA 3T5VA 2AVPA 4FU3A 4P29A 3MV2B 2KZTB 4KZ0A 3TXNA 4KBQA 4B94A 1H19A 5D0OD 4N2SA 1UN8A 5J08A 2PQNA 5FQ4A 2KCLA 3FUHA 3IKOB 4JEUA 3QWVA 3P1UA 5KJKA 4B8CB 4N39A 5D0QD 4CGWA 3LS8A 3MZLB 4LUNU 4DI3A 3G2VA 1TJCA 1QNFA 3GYZA 4K03A 3OAWA 4O6FA 1HU3A 1MHQA 1KLXA 4Q94A 2I1JA 4UWLA 4B89A 4GZCA 4N3CA 1INZA 2OVBA 3CQCB 3HVEA 3HDXA 3I5PA 5ANRA 4MLPA 4EECA 1E7VA 3CKCA 3ONKA 2V5FA 3SBSA 3B7RL 4B8AA 2WXQA 3BG0B 2X6IA 4WNDA 3D9KA 5AJDA 4XKBA 5FQ6A 3FU0A 3PRZA 4URKA 3NF1A 2WMNA 3FY4A 4BT9A 5G55A 1UJJA 4UWGA 4GA1A 4JHJA 2C0LA 3EIQC 5E75A 3RO3A 4APOA 3HIZA 4E85A 3SD5A 3LY7A 1IYGA 4F3VA 2V8SE 4TRQA 2NSZA 3MYVA 2JEKA 2MHKA 4LCTA 2XPZA 1JWGA 3RRNB 2IOSA 3LY9A 1WM5A 4YNDA 2WXPA 2Y4UA 3AU5A 2WXLA 4GYOA 1ELRA 4U63A 3APDA 1X5BA 3FP3A 3APFA 3S7DA 3U66A 2KCVA 3S7FA 4HOTA 2XEVA 4LRZA 3ENEA 2X6JA 3ZYLA 4AM9A 4HOUA 3G2SA 3AS8A 2VSNA 1UN9A 2E0IA 3L08A 3LYAA 3LCAA 3MA5A 3QK0A 4FLHA 2KZTA 2V4LA 4J8SA 2X3MA 4KMOA 1EYHA 3UT8A 2X38A 4I43A 4ME2A 4PH4B 4NURA 4Y6CA 2J07A 1XGWA 4I17A 1OUVA 4FP7A 4B0ZA 1OWMA 3GZ2A 4BTAA 3QNKA 5FQ8A 4IULA 4I2ZA 2X6HA 3MV3B 1HE8A 2IOLA 3B7UX 5CMYA 1UG3A 5C2YA 1ELKA 1JUQA 1JWFA 2BF0X 3R9AB 5FT9A 4CRWA 5JJTA 1H2VC 2VGYA 4JW1A 3ML8A 4M3OA 3SNXA 3FTUA 4AEZC 4CDMA 2DCPA 3CSTA 1OWOA 3NZUA 3IEGA 1P5QA 4RSYA 3VLEA 2WXRA 4G2VA 4KYOB 3CVVA 4H7YA 3L6AA 4DLQA 2L0TB 3U3WA 1UJKA 4L1BA 2WXHA 4EPZA 2OVFA 4UWHA 2XCBA 1H2TC 2HYZA 3LVQE 3ASGA 2XPYA 3OXFA 3FUFA 2Y3AA 4AOFA 4F53A 4Q69A 4EQFA 1IQRA 2VTBA 3RIBA 3JCKC 2BUGA 2EQXA 2NXPA 3IV0A 3TJPA 3Q5MA 4JA7A 4EZJA 4RVBA 2VSYA 4A3TA 5JJ7A 3PUKA 3G2UA 1PC2A 4WWOA 3PS6A 3UQ3A 3ULQA 5FWQA 4HXIA 3HHMA 3PH0C 3SGHA 4DJAA 5EX0A 5AYWD 4UQYA 4ANWA 3GZSA 2KM4A 3FWVA 4AY6A 4V3IA 3FUJA 2CG2A 4G11A 4W9RA 4D10C 2M63A 4HORA 2WXJA 3N71A 5DBKA 3ZHEB 2WM9A 5EDSA 2R17C 3EHNA 1FCHA 3P2BA 2Q7FA 4EBAA 3CHMA 4G24A 4KXKB 3LJ3A 5BT1A 4N3AA 1KT1A 4NRHB 5KCMA 2AXZA 2PM6A 3ONLA 3C98A 4APFA 5G04C 4C0MA 3ZYKA 3PE4A 4AIFA 3S7BA 4FULA 3TXMA 3GZ1A 2FO7A 3S7JA 2FI7A 3I4GA 3QB2A 3D9MA 5AJLA 1W3BA 4GB9A 3MX3A 5G05C 3FUNA 4CCAA 2OV8A 1E7UA 4XZ4A 3JUIA 1HH8A 4XI0A 1U3CA 4JHRA 2YHEA 1Z3YA 4KT6B 1NA0A 1N54A 1SQMA 2LAHA 2WQ6A 1EPUA 5LCWC 4I9EA 3PZDA 3ZGQA 3DBSA 4HVBA 3D9IA 4AVXA 1JPLA 2HM8A 2Y4TA 5ARGA 4U07A 4CDRA 1U3DA 4J8DA 3FTXA 3ZFWA 1Z6TA 3L17A 3ML9A 3FUKA 5ARFA 4DPRA 3QARA 3JQ1A 3EJNA 1H0AA 2A5UA 3AU4A 3KS2A 4UI9J 4QFVA 3FH8A 2C2LA 3UT7A 4AY5A 2R5SA 4UI9K 4DI4A 4BSXA 2RD0A 4IRUA 5C1DA 1ELWA 1WAO1 2XQ0A 3E4BA 2J49A 2PM7A 5JHBA 3OXLA 4EZLA 4A1GA 5E76A 5ENNA 2UWJG 5G04J 3D9LA 4JVSA 2VSXE 3QDNA 2DIWA 2WXNA 3ASFA 5KJLA 3IBEA 1E8XA 4WNEA 2R59A 4I6GA 4GCOA 5AIJA 2WVIA 2AWIA 3RRMB 1OWLA 3LKUA 3CK7A 3FTZA 4ATGA 3RU0A 1SZ9A 2IQCA 2L9BA 4NQ0A 1Y8MA 3D9NA 1QZ2A 2YNQA 4G23A 3R7RA 4HS2A 3CGHA 4NACA 3JYSA 1HZ4A 2FULA 2HR2A 3L54A 3RJVA 3VTXA 1PY1A 2BTDA 2KC7A 3LXUX 4BTBA 1HX8A 4J0UA 4C0EA 3MKRA 4BY6A 1ZU2A 4FJYA 1EDUA 3QAQA 1VDYA 4U0SA 2IFUA 3FTYA 5HQ8A 4IN3B 3PVLA 3DPDA 5AENA 3ZEFA 2J4BA 4U04A 3FDHA 4UI9C 5G2NA 3FULA 2LAIA 2L6JA 3IHYA 4JA9A 3SI5A 1FVHA 2XGMA 3FUDA 4CT0A 3FEXA 2E2EA 4XKCA 2VTBB 2XCCA 2YQ8A 4ACLA 4KVMA 3CR3A 4PS3A 1B89A 5BUZA 2PL2A 5DIZA 3VLFA 4ILGA 1QQEA 3L16A 1OWPA 5LCWJ 3LEWA 4XX5A 4BX9A 3FTWA 5EX3A 4AXHA 4HFGA 4DK5A 4WNGA 4JEHA 3PE3A 4ANVA 4YVOA 5T3RA 4CGVA 4L7TA 5LP0A 1XNFA 2OOEA 3QKYA 4PS7A 2C0MA 2PZIA 3HYMB 4ANXA 3QOUA 4JPSA 3UUXA 4GPKA 2CFUA 3CVUA 4TUUA 3I3NA 4N5CA 5KJNA 4FLBA 5BV1A 2WXOA 1E96B 3U64A 4BX8A 1NP7A 2WPVA 2DBAA 4GMLA 3FUIA 3FU5A 4ILIA 4WWNA 3ZPJA 5FJYA 2J4DA 3ZYQA 3B7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OXG A;  4GZ3 A;  3LY7 A;  5JJ6 A;  1IYG A;  3Q47 B;  1HH8 A;  2QFC A;  5HI7 A;  4XI0 A;  3ASH A;  3U4T A;  3GW4 A;  4JHR A;  5FZS A;  4F3V A;  2LSV A;  5CCM A;  2UY1 B;  2MHK A;  4Y6W A;  3Q15 A;  3O48 A;  4J8E A;  1NA0 A;  2KCK A;  2XPI A;  3KAE A;  3LPZ A;  3UPV A;  2OND A;  4I9E A;  5LCW C;  1NA3 A;  1WM5 A;  3LY9 A;  5CHE E;  4YND A;  4RG9 A;  3ZGQ A;  2Y4U A;  2Y4T A;  1ELR A;  4GYO A;  3AS5 A;  4GZ5 A;  4U07 A;  5ARG A;  4CDR A;  4YVQ C;  3FP3 A;  3ZFW A;  3CVQ A;  4J8D A;  4I2W A;  3LY8 A;  3RKV A;  3S7D A;  5M72 A;  3FFL A;  5ARF A;  2JLB A;  2KCV A;  3S7F A;  2WQH A;  3CV0 A;  5A7D B;  4HOT A;  2XEV A;  2KAT A;  3Q4A B;  4G25 A;  3KS2 A;  4UI9 J;  4I9C A;  4AM9 A;  4HOU A;  2VSN A;  2C2L A;  3ASD A;  3AS8 A;  1IHG A;  3LYA A;  3LCA A;  1KT0 A;  3MA5 A;  3CK9 A;  4G1T A;  4UQZ A;  2P58 C;  2R5S A;  4UI9 K;  3URZ A;  3WXX A;  4AY5 A;  1ZBP A;  3VTY A;  4GYY A;  4ME2 A;  5C1D A;  5KJM A;  1ELW A;  1WAO 1;  4Y6C A;  3E4B A;  4GZ6 A;  3ZHE A;  3BEE A;  3OXL A;  4I17 A;  1OUV A;  3TGO A;  3SZ7 A;  3GZ2 A;  4N3B A;  2FBN A;  2YHC A;  4N2Q A;  2UWJ G;  3MEK A;  2XGS A;  3Q49 B;  4I1A A;  5G04 J;  4BTA A;  2NC9 A;  2VYI A;  3K9I A;  4I2Z A;  5CCL A;  3MV3 B;  3PDN A;  3QDN A;  3QWP A;  3ZN3 A;  2XGO A;  4XIF A;  3CK8 A;  3CVP A;  3ASF A;  5FZQ A;  4XI9 A;  5EKQ D;  5KJL A;  5JJT A;  2I6H A;  4G26 A;  5BW8 C;  3R9A B;  3AS4 A;  3CVL A;  5FT9 A;  4U0U A;  2VGY A;  4WNE A;  4A1S A;  4GCO A;  3IEG A;  1P5Q A;  4HOQ A;  3SF4 A;  4WNF A;  3LKU A;  2IF4 A;  3CK7 A;  5A6C A;  3CEQ A;  4LEU A;  5G05 J;  4G2V A;  4KYO B;  4NQ0 A;  3RU0 A;  4H7Y A;  4JL0 A;  1Y8M A;  4G23 A;  1QZ2 A;  4RG6 A;  4BT8 A;  3U3W A;  2LSU A;  3JYS A;  1HZ4 A;  2HR2 A;  2XCB A;  2HYZ A;  2UY1 A;  3ASG A;  3OXF A;  5FZR A;  3RJV A;  3VTX A;  4BWR A;  2HO1 A;  2KC7 A;  4BTB A;  4EQF A;  4J0U A;  3CVN A;  3RIB A;  2LNI A;  3MKR A;  2AVP A;  2BUG A;  1ZU2 A;  3MV2 B;  4U0S A;  3TG5 A;  4GA2 A;  4KBQ A;  1A17 A;  4B94 A;  1HXI A;  2IFU A;  2VQ2 A;  5D0O D;  4IN3 B;  4APO A;  5HQ8 A;  4N2S A;  3Q5M A;  4JA7 A;  2PQN A;  3ESK A;  2VSY A;  2J9Q A;  4U04 A;  5JJ7 A;  3RO2 A;  4UI9 C;  2KCL A;  1PC2 A;  4JA9 A;  2L6J A;  4UQX A;  4WUY A;  2XGM A;  3QWV A;  3UQ3 A;  5KJK A;  2E2E A;  4N39 A;  5D0Q D;  2XCC A;  3ULQ A;  2YQ8 A;  3KD7 A;  4CGW A;  4HOS A;  5EX0 A;  5AYW D;  4UQY A;  1B89 A;  1YA0 A;  2PL2 A;  1TJC A;  5DIZ A;  2VGX B;  3GYZ A;  1QQE A;  3FWV A;  2PQR A;  4AY6 A;  2FF4 A;  4O6F A;  5LCW J;  1KLX A;  4W9R A;  5EX3 A;  5BNW A;  4HOR A;  3N71 A;  4N3C A;  5DBK A;  3ZHE B;  4WNG A;  3EDT B;  3PE3 A;  4U0Z A;  1FCH A;  4GA0 A;  2Q7F A;  4GYW A;  4YVO A;  1XNF A;  2OOE A;  3QKY A;  4CGV A;  2C0M A;  2PZI A;  4G24 A;  4KXK B;  3HYM B;  2VGX A;  3TG4 A;  5BT1 A;  3QOU A;  3CKB A;  1KT1 A;  4NRH B;  4N3A A;  2FEZ A;  3CKC A;  4J8F A;  2V5F A;  5FTP A;  3UUX A;  4GPK A;  5G04 C;  1NZN A;  4H7X A;  2GW1 A;  3PE4 A;  4N5C A;  4WND A;  4AIF A;  5KJN A;  3S7B A;  1E96 B;  3NF1 A;  3GZ1 A;  3QWW A;  2FO7 A;  2WPV A;  2DBA A;  2FI7 A;  3S7J A;  4BT9 A;  4GCN A;  3ZPJ A;  4GA1 A;  5FJY A;  1W3B A;  5G05 C;  2C0L A;  3RO3 A;  3TAX A;  4ABN A; 
#chains in the Genus database with same CATH topology
 1K1A A;  3PEV B;  5FZS A;  3FTS A;  2LSV A;  4Y6W A;  3Q15 A;  3UPV A;  4ANU A;  4LER A;  3CVQ A;  4I2W A;  4UWK A;  4FA6 A;  4DRX E;  2CHW A;  2I1K A;  2J08 A;  1S64 A;  3HXD A;  3BEE A;  1E8W A;  3ZNG A;  2VYI A;  3BG1 B;  3X2Q E;  5HKP A;  3CVP A;  4OVU A;  3C3R A;  5CEC B;  5CBO A;  3SFZ A;  5G05 J;  3DEP A;  4XE0 A;  4BFR A;  2ETA A;  4JXT A;  4ACK A;  1A17 A;  3CVX A;  4I1M A;  4K5C A;  3T5X A;  4FHJ A;  2V0P A;  4UQX A;  2A4Z A;  4HOS A;  1MX2 A;  4I6J A;  3Q78 A;  3HXE A;  5ENP D;  2YIN A;  2VGX B;  3FH5 A;  3CVY A;  3UMV A;  1TJF A;  2J8S D;  1TR4 A;  4F1P A;  3CVW A;  4AV7 A;  2I2O A;  3J5P A;  4MRU A;  5J90 A;  2EIJ E;  2R02 A;  3KEZ A;  1MQS A;  3SHF A;  4GZ3 A;  2EIL E;  3LJN A;  4J8E A;  3ZKJ A;  2AXV A;  5M72 A;  2ZIS A;  3QJZ A;  5A7D B;  2A5E A;  3B7B A;  4G25 A;  2GGF A;  4GAA A;  1K1B A;  4O1O A;  4G8L A;  3D9O A;  3CHQ A;  3LDZ A;  1E90 A;  2L0I A;  3HVE B;  1DNP A;  3CSF A;  3HXF A;  3O4Z A;  3PZ3 A;  3PNL B;  2KBX A;  4PS8 A;  4XI9 A;  3FU3 A;  3AS4 A;  3NZS A;  2WMO A;  3ZXP A;  3CLJ A;  4JL0 A;  1TNB A;  1HO8 A;  1BPO A;  3UT4 A;  4LG6 A;  4KZ0 A;  3Q75 A;  4KBQ A;  4N2S A;  4MBG A;  1UN8 A;  5J08 A;  3DSV A;  3E30 A;  3IKO B;  4B8C B;  4N39 A;  4LUN U;  4DI3 A;  3GYZ A;  1HU3 A;  4Q94 A;  5D66 A;  2EIN E;  4N3C A;  3CQC B;  3HVE A;  1OCO E;  1BU9 A;  5ANR A;  4A63 B;  3TWS A;  4MLP A;  4B8A A;  4WND A;  4XKB A;  2WMN A;  2B6C A;  3FY4 A;  4JHJ A;  2C0L A;  3HIZ A;  3F6Q A;  2MHK A;  1JWG A;  1O5M A;  3LY9 A;  1KPS B;  2Y4U A;  4GYO A;  1ELR A;  4U63 A;  3FP3 A;  3S7D A;  2KCV A;  1YYH A;  2XEV A;  4LRZ A;  2X6J A;  3G2S A;  2Y69 E;  3AS8 A;  4FLH A;  3MA5 A;  3UT8 A;  1EYH A;  4Y6C A;  2F0Y A;  2J07 A;  2DZN A;  1XGW A;  2DZO A;  1OWM A;  2F37 A;  4BTA A;  4IUL A;  4I2Z A;  4CZ2 D;  2X6H A;  3B7U X;  1UG3 A;  1JUQ A;  2GRP B;  4RSY A;  3VLE A;  3TWX A;  3BU8 A;  4H7Y A;  3L6A A;  4EPZ A;  4B93 B;  4AOF A;  3FUF A;  4F53 A;  4EQF A;  4K5B A;  3Q5M A;  4JA7 A;  5ENS D;  3D9H A;  4RVB A;  3E37 A;  3KSQ A;  3G2U A;  3Q9U C;  3PS6 A;  5FWQ A;  3HHM A;  4UQY A;  3ZU7 B;  3W9G A;  3FWV A;  3SY2 A;  1OY3 D;  2M63 A;  2WXJ A;  3EHN A;  3CHM A;  4G24 A;  5BT1 A;  1IXV A;  2PM6 A;  3C98 A;  2RFM A;  3C5R A;  3ZYK A;  3PE4 A;  4AIF A;  3S7B A;  2FO7 A;  4TXP A;  3S7J A;  1W3B A;  5G05 C;  5AQA A;  1H6P A;  1TYQ G;  4O1P A;  5JMN D;  3KSL A;  2YHE A;  1Z3Y A;  2QYU A;  1NA0 A;  1N54 A;  2XZD G;  1IKN D;  4AVX A;  1JPL A;  2Y4T A;  5ARG A;  3UM0 A;  4J8D A;  3FTX A;  3AG2 E;  1Z6T A;  3ML9 A;  5ARF A;  4QFV A;  3EUV A;  3V79 K;  4AY5 A;  2IEJ A;  1ELW A;  3ULE G;  4UUC A;  3E4B A;  1Q2Z A;  2PM7 A;  1ZB1 A;  2UWJ G;  2XZT G;  4JVS A;  4QQI A;  2RFA A;  2WXN A;  3ASF A;  5KJL A;  3IBE A;  1E8X A;  2KXP C;  4L9P A;  3T8K A;  2WVI A;  5BXU A;  3DSU A;  3DPY A;  3CK7 A;  3FTZ A;  4ATG A;  1SZ9 A;  2IQC A;  4G23 A;  3UKR G;  4HS2 A;  2EIM E;  2FUL A;  3RJV A;  1PY1 A;  2KC7 A;  1EDU A;  2IFU A;  2GRN B;  3PVL A;  3DPD A;  5AEN A;  3ZEF A;  1NI1 A;  3FDH A;  3SI5 A;  2LAI A;  2L6J A;  3IHY A;  2VTB B;  3FUD A;  4XKC A;  2XCC A;  3CR3 A;  4PS3 A;  1B89 A;  1OWP A;  3TWT A;  1BI7 B;  5LP0 A;  3SQV A;  2IO3 C;  2OOE A;  2PZI A;  3QOU A;  4JPS A;  3E33 A;  3UUX A;  3V30 A;  4GPK A;  2B0O E;  3DXM G;  3ASN E;  3ZPJ A;  4ILI A;  4WWN A;  3ASO E;  5FJY A;  2J4D A;  3B7S A;  2IY0 C;  2ETC A;  2QFC A;  3DXK G;  4DLO A;  3PNT B;  3SBT B;  3UIP C;  3FH7 A;  3CQG B;  3HXC A;  4YVQ C;  1TEZ A;  2WQH A;  3Q4A B;  4R7L A;  5A23 A;  3SFY A;  3ZIM A;  1HG2 A;  3G2W A;  2I9C A;  4DX2 A;  1N9A A;  5JHA A;  1D8D A;  4U8Y D;  3ZXS A;  3FUE A;  2NC9 A;  2H6H A;  2GRL A;  2X6F A;  3CHR A;  4OAU C;  2RG8 A;  5EKQ D;  4TV3 A;  4U0U A;  2J09 A;  3C3O A;  4Z68 A;  2IU1 A;  4HOQ A;  4LEU A;  2LO6 A;  1S0P A;  3T9K A;  4BT8 A;  4UWF A;  4BWR A;  4I1O B;  1BLX B;  4A55 A;  2DYS E;  3EU5 A;  1HXI A;  2VQ2 A;  2MYO A;  5CRU A;  2J9Q A;  1HS6 A;  3OTN A;  4MKT A;  1H6K A;  1AWC B;  2WXM A;  1N0Q A;  1YA0 A;  4HRM B;  2ION A;  2PQR A;  4ZHB A;  3ULY A;  1G3N B;  4U0Z A;  5KJM A;  4GYW A;  4U8H A;  4KVO A;  4EHM A;  4FHK A;  2VGX A;  3Q7F A;  1NZN A;  3JUE A;  4OYS A;  2GW1 A;  5LX8 A;  3QWW A;  4GCN A;  2IO2 C;  1LF8 A;  5JJ6 A;  3DSS A;  3Q47 B;  4AJW A;  4A3V A;  3ESL A;  3GW4 A;  4CT4 A;  1UW4 B;  5BPP A;  3AS5 A;  4HBD A;  3FFL A;  1KZP A;  1TNU A;  3CIA A;  2ILR A;  4GTM A;  1ZBP A;  4L2Y A;  1S63 A;  5CEA A;  2X6K A;  4I6E A;  3TWV A;  3TGO A;  4N3B A;  2YHC A;  3PZ2 A;  3QWP A;  2EIK E;  3IHV A;  4LNB A;  4G26 A;  2GRM A;  3MGB A;  3RK6 A;  3QC1 A;  5EYP F;  3SF4 A;  2XS8 A;  3APC A;  1K3Z D;  3D9J A;  1KZO A;  2WXI A;  3CVN A;  3CHS A;  3T5V A;  3MV2 B;  4B94 A;  1H19 A;  2XEE A;  1DCE A;  5FQ4 A;  3UI2 A;  3QWV A;  4CGW A;  5JA4 D;  3G2V A;  1TJC A;  5EIB E;  1QNF A;  2P9U G;  3UM1 A;  1N4S A;  1INZ A;  4EEC A;  3CKC A;  3ONK A;  3SBS A;  1OCZ E;  2XS1 A;  2WXQ A;  3BG0 B;  2X6I A;  5FQ6 A;  3NF1 A;  5AAR A;  5G55 A;  4JD2 G;  1UJJ A;  3J5Q B;  4UWG A;  4APO A;  1OXJ A;  3EHQ A;  1IYG A;  2V8S E;  4TRQ A;  2NSZ A;  3MYV A;  3UM3 A;  2XPZ A;  4GTP A;  1X81 A;  1N4R A;  3APD A;  3APF A;  1LTX A;  2AJA A;  3Q73 A;  4HOT A;  2P9K G;  3ENE A;  3L08 A;  2VSN A;  1UN9 A;  3LYA A;  3IXE A;  4KMO A;  4PH4 B;  4O60 A;  4I17 A;  4FP7 A;  4C48 B;  4HB5 A;  5FQ8 A;  2LXM A;  5KWD A;  3JXI A;  5CMY A;  5C2Y A;  5ENO D;  1H2V C;  3ML8 A;  4M3O A;  5ENQ D;  2P9S G;  3SNX A;  4CDM A;  4BET A;  1OWO A;  3IEG A;  4X8Q A;  1H6O A;  4G2V A;  3OXF A;  2HYZ A;  3LVQ E;  3JCK C;  4GTT A;  1N0R A;  2NXP A;  3IV0 A;  3AAA C;  4EZJ A;  4A3T A;  5JJ7 A;  1PC2 A;  3ULQ A;  4HXI A;  3PH0 C;  5AYW D;  3DSX A;  4AY6 A;  3RSE G;  4G11 A;  4D10 C;  4HOR A;  3ZHE B;  3NOG D;  5EDS A;  5H7P A;  3P2B A;  1N4P A;  4C0M A;  4FUL A;  2DVW A;  3I4G A;  1O1S A;  4CCA A;  3MX3 A;  4XZ4 A;  3JUI A;  3PZD A;  4HVB A;  4U07 A;  4CDR A;  4DX1 A;  4LNU D;  1U3D A;  1A5E A;  2A5U A;  3KS2 A;  3FH8 A;  2C2L A;  4JB8 P;  2R5S A;  4UI9 K;  4IRU A;  4TUM A;  5C1D A;  3Q7A A;  4GPM A;  3OXL A;  4A1G A;  5ENN A;  3L9T A;  2JAB A;  2DIW A;  4GTV A;  5AAO A;  4WNE A;  2V5Q C;  2R59 A;  5AIJ A;  4GCO A;  2AWI A;  3RRM B;  4NQ0 A;  1SA4 A;  2YNQ A;  4J7W A;  2QYJ A;  3VTX A;  3L54 A;  3HRA A;  4J0U A;  4C0E A;  4U8V D;  3QAQ A;  4IN3 B;  3R9M A;  3FUL A;  4CT0 A;  2XGM A;  2F8Y A;  3FEX A;  2YQ8 A;  4ACL A;  5AQ9 A;  2BKG A;  2PL2 A;  3VLF A;  1LD7 A;  1QYM A;  3FTW A;  4AXH A;  4HFG A;  4DK5 A;  1FPP A;  4JEH A;  3PE3 A;  4YVO A;  5T3R A;  2C0M A;  4ANX A;  4TUU A;  5D2M C;  4FLB A;  1OCR E;  1O1R A;  1NP7 A;  2DBA A;  4ANW A;  3OXG A;  3VLD A;  4K0R A;  3UIN C;  5CCM A;  2WB2 A;  2ZU6 B;  3FUM A;  1V55 E;  3KAE A;  2OND A;  4HQD A;  5HS0 A;  3LY8 A;  3AG1 E;  2H6F A;  3V2O A;  4I9C A;  4UQZ A;  1KT0 A;  4G1T A;  3URZ A;  3VTY A;  4GYY A;  4GTQ A;  3SFX A;  4JHK A;  3UM2 A;  4FJZ A;  4N2Q A;  3MEK A;  2XGS A;  3Q49 B;  5B3S E;  4MS6 A;  2XGO A;  2R2L A;  2I6H A;  2OEV A;  5BW8 C;  3CVL A;  3LVR E;  1WG0 A;  5EIL A;  4FC8 A;  1TN6 A;  3KEA A;  2LSU A;  2WXK A;  4EZK A;  3UX4 A;  2LNI A;  3MKQ A;  3D3M A;  1Y6I A;  3TG5 A;  4GA2 A;  5FIO A;  4L2L A;  3ESK A;  2MRI A;  4CEM A;  4K5A B;  3RO2 A;  4WUY A;  1BI8 B;  1GW6 A;  1N11 A;  1PAQ A;  3L13 A;  2BED A;  3V31 A;  1WY6 A;  2FF4 A;  5AQ7 A;  5BNW A;  3EDT B;  4GA0 A;  4RQI A;  1YMP A;  2CFZ A;  5FTP A;  2DWZ A;  3ZYM A;  4H7X A;  2Y0B G;  4DX6 D;  1HFA A;  4AP2 A;  5AQB A;  3PZ4 A;  2ZGD A;  2VSO E;  3T8M A;  2P9P G;  5T8I A;  4BES A;  4FAD A;  1NL4 A;  1EF1 C;  4GU5 A;  1YCS B;  3U4T A;  3CHP A;  3MKQ B;  4GZD A;  3O48 A;  2XPI A;  3LPZ A;  4DX7 D;  2XHE A;  1TNZ A;  3FEY A;  1BD8 A;  1E8Z A;  5EN5 D;  1K8K G;  3ASD A;  3WXX A;  3CK9 A;  5ANL A;  1FT2 A;  3PUJ A;  5FQ7 A;  1S70 B;  2QZA A;  2CHZ A;  5ENR D;  3CHO A;  2R03 A;  3S2A A;  2P2C P;  3K9I A;  4KZC A;  5LOZ A;  3PDN A;  4WWP A;  3ZN3 A;  4XIF A;  5FZQ A;  3PZ1 A;  4JC8 A;  3UTM A;  3MCX A;  4N5Q A;  1N52 A;  1Z3X A;  1SZA A;  3TL5 A;  4WNF A;  1O1T A;  5A6C A;  1MJ0 A;  4ILH B;  2NYJ A;  2WXF A;  2VJ8 A;  3L22 A;  2AXU A;  2UY1 A;  3NQP A;  5FZR A;  2XRY A;  4DUI A;  3G2T A;  4FU3 A;  4P29 A;  2GRO B;  4ZFH A;  2PQN A;  4JEU A;  4DX5 D;  3P1U A;  5KJK A;  5D0Q D;  3Q9N C;  4K03 A;  3OAW A;  1MX6 A;  1MHQ A;  1KLX A;  4B89 A;  4GZC A;  2OVB A;  5AN8 A;  1E7V A;  3B7R L;  4XEI G;  3D9K A;  5AJD A;  4URK A;  3FU0 A;  3PRZ A;  2Y1L E;  3SD5 A;  3LY7 A;  2JEK A;  4LCT A;  3RRN B;  2WXP A;  3AU5 A;  2WXL A;  1X5B A;  2P9I G;  3NAW A;  5CRV A;  4HOU A;  1DC2 A;  2E0I A;  3LCA A;  5ENT D;  1U2V G;  2KZT A;  2V4L A;  4J8S A;  3AJI A;  2X38 A;  4ME2 A;  3TWQ A;  4NIK A;  3GZ2 A;  3QNK A;  1IHB A;  5ITZ F;  4RLY A;  5JJT A;  1ELK A;  2BF0 X;  4CRW A;  5FT9 A;  4JW1 A;  4AEZ C;  1UOH A;  1P5Q A;  4KYO B;  2OVF A;  4UWH A;  3BQO A;  2XCB A;  3ASG A;  4Q69 A;  2Y3A A;  3UKU G;  2VTB A;  3RIB A;  2BUG A;  1MZC A;  3E34 A;  2ZIR A;  2VSY A;  3UQ3 A;  5CED B;  3GZS A;  2KM4 A;  4V3I A;  3FUJ A;  4W9R A;  5DBK A;  2WM9 A;  2R17 C;  4EBA A;  1N95 A;  4N3A A;  2AXZ A;  3ONL A;  4APF A;  5G04 C;  1TN8 A;  3GZ1 A;  3NB2 A;  3QB2 A;  3D9M A;  5AJL A;  3FUN A;  1E7U A;  2XEH A;  1MYO A;  4XI0 A;  1U3C A;  1NFI E;  3DSW A;  2P9L G;  4KT6 B;  2WQ6 A;  2LAH A;  3D9I A;  3L17 A;  3FUK A;  5EYL A;  3QAR A;  3JQ1 A;  3EJN A;  1D9S A;  1H0A A;  2GRQ B;  3AU4 A;  5BXO A;  3UT7 A;  4DI4 A;  4BSX A;  4YDW A;  2RD0 A;  5CER B;  1DCQ A;  2J49 A;  5JHB A;  4EZL A;  3Q79 A;  3RAU A;  3D9L A;  3QDN A;  2V4H C;  4ATZ D;  5KNG A;  4I6G A;  1OT8 A;  3RU0 A;  2L9B A;  1Y8M A;  1QZ2 A;  3R7R A;  3JYS A;  2HR2 A;  2XEN A;  2BTD A;  4BTB A;  1HX8 A;  4HNA D;  3UIO C;  4YDE A;  3TWW A;  2J4B A;  3SO8 A;  4U04 A;  4HLL A;  4U95 D;  5DIZ A;  2LXL A;  3L16 A;  3LEW A;  5EX3 A;  4WNG A;  4L7T A;  3ABM E;  4PS7 A;  3HYM B;  2CFU A;  3EHR A;  1RZ4 A;  5KJN A;  1E96 B;  2WPV A;  3NOC D;  3B13 A;  4J6I A;  4GTS A;  5HI7 A;  3ASH A;  1IQU A;  2UY1 B;  1H2U A;  5CHE E;  4GMJ A;  3DWL G;  4RG9 A;  4L23 A;  4OVV A;  2QC9 A;  4HRL A;  2F8X K;  3RKV A;  2JLB A;  4F1S A;  3CV0 A;  3MJW A;  2KAT A;  1L5J A;  3WG7 E;  3JXJ A;  1IHG A;  1SA5 A;  3E32 A;  3ZW3 A;  2P58 C;  4CYM D;  5CMW A;  2CHX A;  4LNG A;  3ZRH A;  3EIJ A;  3SZ7 A;  3DRA A;  4EBA G;  3I4R B;  1V54 E;  5CBN A;  2IJG X;  3FHE A;  4WAF A;  1HG5 A;  3CK8 A;  2CG3 A;  3D9P A;  5HRY A;  2OCC E;  3EHM A;  2ETB A;  4A1S A;  1JCR A;  2WXG A;  2GRR B;  1D8E A;  3CEQ A;  3W9F A;  4E6H A;  2WQ7 A;  1FVF A;  2HO1 A;  2MOW A;  4HLE A;  4PUC A;  4LSZ E;  3FTV A;  1N94 A;  4JZY A;  2XRZ A;  2L6B A;  3KD7 A;  4U96 D;  3PEU B;  3JQ0 A;  5LFA A;  4IYP A;  3U9W A;  2ZGG A;  1TN7 A;  3TG4 A;  4C9B B;  3CKB A;  4OAV B;  2FEZ A;  4J8F A;  3PRE A;  2QY7 A;  2BKK B;  4G8K A;  1HF8 A;  3TAX A;  3ZVV A;  1Z5S C;  5EID A;  2KCK A;  2VGE A;  3RRU A;  1NA3 A;  4GZ5 A;  3FU6 A;  2LUH A;  5T4Y A;  3B7T A;  4ABN A;  4YDO A;  2AW6 A;  1OWN A;  3AG3 E;  4GZ6 A;  2FO1 E;  5BV0 A;  3R7Q A;  3ZHE A;  4F7A A;  1DVP A;  2HE0 A;  2OEW A;  2FBN A;  2PNN A;  2ZXW E;  4I1A A;  5CCL A;  1E8Y A;  5B1B E;  2IF4 A;  4Q96 A;  4PDX A;  3B95 A;  3ABK E;  4RG6 A;  3DST A;  4CDN A;  2AVP A;  2KZT B;  1SVX A;  3TXN A;  5D0O D;  3DEO A;  2KCL A;  3FUH A;  3LS8 A;  3MZL B;  4O6F A;  2RKK A;  1JCS A;  2I1J A;  4UWL A;  3HDX A;  3I5P A;  2V5F A;  1WDY A;  3BUA A;  1SW6 A;  1QBQ A;  1TNO A;  4BT9 A;  4GA1 A;  3EIQ C;  5E75 A;  3RO3 A;  4E85 A;  5KNH D;  4BER A;  4F3V A;  2H6G A;  2IOS A;  4TXQ A;  1WM5 A;  4YND A;  4HI9 A;  1TNY A;  2DYR E;  3S7F A;  4F6R D;  3ZYL A;  4AM9 A;  3QK0 A;  5FIN A;  2X3M A;  3AG4 E;  4I43 A;  4J8Y A;  4NUR A;  1OUV A;  1JCQ A;  4B0Z A;  1LD8 A;  3NBN B;  3MV3 B;  1HE8 A;  2IOL A;  1JWF A;  3R9A B;  2VGY A;  3FTU A;  2DCP A;  3CST A;  3NZU A;  2WXR A;  3TWU A;  3CVV A;  4DLQ A;  2L0T B;  3U3W A;  1UJK A;  4L1B A;  2WXH A;  3U66 A;  1H2T C;  2XPY A;  4YDY A;  1IQR A;  1RW2 A;  2EQX A;  3TJP A;  1N4Q A;  3PUK A;  4WWO A;  2R05 A;  4GMR A;  3SGH A;  4DJA A;  5EX0 A;  3L82 A;  3ABL E;  5B1A E;  2CG2 A;  3N71 A;  2H6I A;  1AP7 A;  1FCH A;  2Q7F A;  4KXK B;  3LJ3 A;  1KT1 A;  4NRH B;  5KCM A;  3V2X A;  5KBA A;  3TXM A;  3UXG A;  2FI7 A;  4GB9 A;  2OV8 A;  1HH8 A;  4JHR A;  1SQM A;  1EPU A;  5LCW C;  4I9E A;  3ZGQ A;  3DBS A;  4M7C A;  2HM8 A;  3ZFW A;  4DPR A;  3EU9 A;  4UI9 J;  4HI8 A;  4BEP A;  4TXR A;  1WAO 1;  2XQ0 A;  5E76 A;  3HG0 D;  5G04 J;  2VSX E;  3TWR A;  4BSZ B;  1OWL A;  3LKU A;  3D9N A;  3HXB A;  3CGH A;  4NAC A;  1HZ4 A;  3C72 A;  3LXU X;  3MKR A;  4BY6 A;  1ZU2 A;  4FJY A;  4U0S A;  1VDY A;  3ZUV B;  3FTY A;  5HQ8 A;  2P9N G;  3ISM C;  4HRN A;  4GTR A;  5IY5 E;  4UI9 C;  5G2N A;  4JA9 A;  1FVH A;  2E2E A;  4KVM A;  5BUZ A;  4ILG A;  1QQE A;  5LCW J;  4XX5 A;  4BX9 A;  1MX4 A;  4ANV A;  3C3Q A;  1FT1 A;  4CGV A;  1XNF A;  3QKY A;  4U7E B;  3CVU A;  3I3N A;  4N5C A;  5BV1 A;  2WXO A;  3U64 A;  4BX8 A;  4GML A;  3FUI A;  3FU5 A;  1OCC E;  3ZYQ A;  4GTO A; 
#chains in the Genus database with same CATH homology
 3OXG A;  4J6I A;  3VLD A;  2QFC A;  4K0R A;  5HI7 A;  3ASH A;  3PEV B;  1IQU A;  5FZS A;  3FTS A;  2LSV A;  3PNT B;  2ZU6 B;  2UY1 B;  3FUM A;  4DLO A;  5CCM A;  4Y6W A;  2WB2 A;  3Q15 A;  3SBT B;  3KAE A;  3FH7 A;  3UPV A;  2OND A;  1H2U A;  3CQG B;  5CHE E;  4GMJ A;  4ANU A;  4RG9 A;  4L23 A;  4OVV A;  4LER A;  4YVQ C;  1TEZ A;  3CVQ A;  4I2W A;  3RKV A;  3LY8 A;  2JLB A;  4UWK A;  4F1S A;  2WQH A;  3CV0 A;  4FA6 A;  3MJW A;  2KAT A;  3Q4A B;  1L5J A;  4I9C A;  4R7L A;  5A23 A;  1IHG A;  4UQZ A;  1KT0 A;  4G1T A;  3ZW3 A;  3URZ A;  2P58 C;  2CHW A;  3VTY A;  4GYY A;  2I1K A;  2J08 A;  3ZIM A;  5CMW A;  1HG2 A;  2CHX A;  4JHK A;  3G2W A;  2I9C A;  3ZRH A;  5JHA A;  4FJZ A;  3BEE A;  3EIJ A;  3B13 A;  1E8W A;  3SZ7 A;  4EBA G;  3ZXS A;  3MEK A;  4N2Q A;  2XGS A;  3Q49 B;  3I4R B;  3FUE A;  2NC9 A;  2VYI A;  2IJG X;  3FHE A;  4MS6 A;  4WAF A;  2GRL A;  1HG5 A;  2X6F A;  2XGO A;  3BG1 B;  3CK8 A;  3CHR A;  2RG8 A;  2CG3 A;  3CVP A;  4OVU A;  5EKQ D;  2I6H A;  3D9P A;  5BW8 C;  3CVL A;  4TV3 A;  4U0U A;  2J09 A;  3EHM A;  2IU1 A;  4A1S A;  3LVR E;  2WXG A;  3SFZ A;  4HOQ A;  3CEQ A;  4LEU A;  2LO6 A;  5G05 J;  4XE0 A;  1S0P A;  4E6H A;  4FC8 A;  4BT8 A;  2WQ7 A;  4BFR A;  2LSU A;  4UWF A;  4JXT A;  2WXK A;  4BWR A;  1FVF A;  2HO1 A;  4I1O B;  4A55 A;  4EZK A;  3UX4 A;  2LNI A;  3MKQ A;  2MOW A;  3D3M A;  4HLE A;  1Y6I A;  4PUC A;  3TG5 A;  4GA2 A;  4ACK A;  1A17 A;  3CVX A;  1HXI A;  3FTV A;  2VQ2 A;  4I1M A;  4L2L A;  3ESK A;  2MRI A;  2J9Q A;  4CEM A;  1HS6 A;  3RO2 A;  3T5X A;  3OTN A;  4FHJ A;  2V0P A;  4JZY A;  4UQX A;  4WUY A;  4MKT A;  1H6K A;  2XRZ A;  2WXM A;  2A4Z A;  4HOS A;  1GW6 A;  3KD7 A;  1PAQ A;  4I6J A;  3L13 A;  1YA0 A;  2YIN A;  3JQ0 A;  3PEU B;  2VGX B;  5LFA A;  2ION A;  2PQR A;  1WY6 A;  3FH5 A;  2FF4 A;  4IYP A;  3CVY A;  3U9W A;  3UMV A;  5BNW A;  3EDT B;  4U0Z A;  5KJM A;  1TJF A;  4GA0 A;  4GYW A;  4U8H A;  4KVO A;  2CFZ A;  4FHK A;  2VGX A;  3TG4 A;  4C9B B;  3CKB A;  5FTP A;  2FEZ A;  4J8F A;  3PRE A;  3ZYM A;  3CVW A;  1NZN A;  4AV7 A;  4H7X A;  4OYS A;  2GW1 A;  2QY7 A;  2I2O A;  1HFA A;  5LX8 A;  4MRU A;  4AP2 A;  3QWW A;  5J90 A;  4GCN A;  2VSO E;  3T8M A;  5T8I A;  3KEZ A;  1MQS A;  4FAD A;  1LF8 A;  1HF8 A;  3TAX A;  3SHF A;  1EF1 C;  4GZ3 A;  3ZVV A;  5JJ6 A;  3Q47 B;  4GU5 A;  4AJW A;  4A3V A;  3ESL A;  3GW4 A;  3U4T A;  4CT4 A;  3CHP A;  3MKQ B;  4GZD A;  3O48 A;  4J8E A;  2KCK A;  2XPI A;  3LPZ A;  3RRU A;  1UW4 B;  1NA3 A;  2AXV A;  5BPP A;  2XHE A;  4GZ5 A;  3AS5 A;  3FEY A;  5M72 A;  3FU6 A;  3FFL A;  1E8Z A;  3QJZ A;  5A7D B;  4G25 A;  3CIA A;  5T4Y A;  3B7T A;  2ILR A;  3ASD A;  4ABN A;  2GGF A;  3WXX A;  3CK9 A;  5ANL A;  4GAA A;  1ZBP A;  4L2Y A;  2AW6 A;  3PUJ A;  5FQ7 A;  2X6K A;  3D9O A;  1OWN A;  2CHZ A;  4I6E A;  4GZ6 A;  3CHQ A;  5BV0 A;  3LDZ A;  3R7Q A;  3ZHE A;  1DVP A;  3CHO A;  4F7A A;  1E90 A;  3TGO A;  2L0I A;  3HVE B;  1DNP A;  3CSF A;  3O4Z A;  4N3B A;  2FBN A;  2YHC A;  3PNL B;  3S2A A;  4PS8 A;  4I1A A;  3K9I A;  4KZC A;  5LOZ A;  5CCL A;  3PDN A;  3QWP A;  4WWP A;  3IHV A;  3ZN3 A;  4XIF A;  5FZQ A;  4JC8 A;  4XI9 A;  3FU3 A;  4G26 A;  2GRM A;  3AS4 A;  3MCX A;  3MGB A;  3NZS A;  1N52 A;  3RK6 A;  1Z3X A;  3QC1 A;  1SZA A;  3TL5 A;  3SF4 A;  1E8Y A;  2WMO A;  4WNF A;  3APC A;  2IF4 A;  5A6C A;  4Q96 A;  3D9J A;  4PDX A;  4ILH B;  2WXF A;  3CLJ A;  4JL0 A;  4RG6 A;  2VJ8 A;  1HO8 A;  1BPO A;  3L22 A;  2AXU A;  2UY1 A;  3NQP A;  3UT4 A;  5FZR A;  2XRY A;  2WXI A;  3CVN A;  4CDN A;  3CHS A;  3G2T A;  3T5V A;  2AVP A;  4FU3 A;  4P29 A;  3MV2 B;  2KZT B;  4KZ0 A;  3TXN A;  4KBQ A;  4B94 A;  1H19 A;  5D0O D;  4N2S A;  1UN8 A;  5J08 A;  2PQN A;  5FQ4 A;  2KCL A;  3FUH A;  3IKO B;  4JEU A;  3QWV A;  3P1U A;  5KJK A;  4B8C B;  4N39 A;  5D0Q D;  4CGW A;  3LS8 A;  3MZL B;  4LUN U;  4DI3 A;  3G2V A;  1TJC A;  1QNF A;  3GYZ A;  4K03 A;  3OAW A;  4O6F A;  1HU3 A;  1MHQ A;  1KLX A;  4Q94 A;  2I1J A;  4UWL A;  4B89 A;  4GZC A;  4N3C A;  1INZ A;  2OVB A;  3CQC B;  3HVE A;  3HDX A;  3I5P A;  5ANR A;  4MLP A;  4EEC A;  1E7V A;  3CKC A;  3ONK A;  2V5F A;  3SBS A;  3B7R L;  4B8A A;  2WXQ A;  3BG0 B;  2X6I A;  4WND A;  3D9K A;  5AJD A;  4XKB A;  5FQ6 A;  3FU0 A;  3PRZ A;  4URK A;  3NF1 A;  2WMN A;  3FY4 A;  4BT9 A;  5G55 A;  1UJJ A;  4UWG A;  4GA1 A;  4JHJ A;  2C0L A;  3EIQ C;  5E75 A;  3RO3 A;  4APO A;  3HIZ A;  4E85 A;  3SD5 A;  3LY7 A;  1IYG A;  4F3V A;  2V8S E;  4TRQ A;  2NSZ A;  3MYV A;  2JEK A;  2MHK A;  4LCT A;  2XPZ A;  1JWG A;  3RRN B;  2IOS A;  3LY9 A;  1WM5 A;  4YND A;  2WXP A;  2Y4U A;  3AU5 A;  2WXL A;  4GYO A;  1ELR A;  4U63 A;  3APD A;  1X5B A;  3FP3 A;  3APF A;  3S7D A;  3U66 A;  2KCV A;  3S7F A;  4HOT A;  2XEV A;  4LRZ A;  3ENE A;  2X6J A;  3ZYL A;  4AM9 A;  4HOU A;  3G2S A;  3AS8 A;  2VSN A;  1UN9 A;  2E0I A;  3L08 A;  3LYA A;  3LCA A;  3MA5 A;  3QK0 A;  4FLH A;  2KZT A;  2V4L A;  4J8S A;  2X3M A;  4KMO A;  1EYH A;  3UT8 A;  2X38 A;  4I43 A;  4ME2 A;  4PH4 B;  4NUR A;  4Y6C A;  2J07 A;  1XGW A;  4I17 A;  1OUV A;  4FP7 A;  4B0Z A;  1OWM A;  3GZ2 A;  4BTA A;  3QNK A;  5FQ8 A;  4IUL A;  4I2Z A;  2X6H A;  3MV3 B;  1HE8 A;  2IOL A;  3B7U X;  5CMY A;  1UG3 A;  5C2Y A;  1ELK A;  1JUQ A;  1JWF A;  2BF0 X;  3R9A B;  5FT9 A;  4CRW A;  5JJT A;  1H2V C;  2VGY A;  4JW1 A;  3ML8 A;  4M3O A;  3SNX A;  3FTU A;  4AEZ C;  4CDM A;  2DCP A;  3CST A;  1OWO A;  3NZU A;  3IEG A;  1P5Q A;  4RSY A;  3VLE A;  2WXR A;  4G2V A;  4KYO B;  3CVV A;  4H7Y A;  3L6A A;  4DLQ A;  2L0T B;  3U3W A;  1UJK A;  4L1B A;  2WXH A;  4EPZ A;  2OVF A;  4UWH A;  2XCB A;  1H2T C;  2HYZ A;  3LVQ E;  3ASG A;  2XPY A;  3OXF A;  3FUF A;  2Y3A A;  4AOF A;  4F53 A;  4Q69 A;  4EQF A;  1IQR A;  2VTB A;  3RIB A;  3JCK C;  2BUG A;  2EQX A;  2NXP A;  3IV0 A;  3TJP A;  3Q5M A;  4JA7 A;  4EZJ A;  4RVB A;  2VSY A;  4A3T A;  5JJ7 A;  3PUK A;  3G2U A;  1PC2 A;  4WWO A;  3PS6 A;  3UQ3 A;  3ULQ A;  5FWQ A;  4HXI A;  3HHM A;  3PH0 C;  3SGH A;  4DJA A;  5EX0 A;  5AYW D;  4UQY A;  4ANW A;  3GZS A;  2KM4 A;  3FWV A;  4AY6 A;  4V3I A;  3FUJ A;  2CG2 A;  4G11 A;  4W9R A;  4D10 C;  2M63 A;  4HOR A;  2WXJ A;  3N71 A;  5DBK A;  3ZHE B;  2WM9 A;  5EDS A;  2R17 C;  3EHN A;  1FCH A;  3P2B A;  2Q7F A;  4EBA A;  3CHM A;  4G24 A;  4KXK B;  3LJ3 A;  5BT1 A;  4N3A A;  1KT1 A;  4NRH B;  5KCM A;  2AXZ A;  2PM6 A;  3ONL A;  3C98 A;  4APF A;  5G04 C;  4C0M A;  3ZYK A;  3PE4 A;  4AIF A;  3S7B A;  4FUL A;  3TXM A;  3GZ1 A;  2FO7 A;  3S7J A;  2FI7 A;  3I4G A;  3QB2 A;  3D9M A;  5AJL A;  1W3B A;  4GB9 A;  3MX3 A;  5G05 C;  3FUN A;  4CCA A;  2OV8 A;  1E7U A;  4XZ4 A;  3JUI A;  1HH8 A;  4XI0 A;  1U3C A;  4JHR A;  2YHE A;  1Z3Y A;  4KT6 B;  1NA0 A;  1N54 A;  1SQM A;  2LAH A;  2WQ6 A;  1EPU A;  5LCW C;  4I9E A;  3PZD A;  3ZGQ A;  3DBS A;  4HVB A;  3D9I A;  4AVX A;  1JPL A;  2HM8 A;  2Y4T A;  5ARG A;  4U07 A;  4CDR A;  1U3D A;  4J8D A;  3FTX A;  3ZFW A;  1Z6T A;  3L17 A;  3ML9 A;  3FUK A;  5ARF A;  4DPR A;  3QAR A;  3JQ1 A;  3EJN A;  1H0A A;  2A5U A;  3AU4 A;  3KS2 A;  4UI9 J;  4QFV A;  3FH8 A;  2C2L A;  3UT7 A;  4AY5 A;  2R5S A;  4UI9 K;  4DI4 A;  4BSX A;  2RD0 A;  4IRU A;  5C1D A;  1ELW A;  1WAO 1;  2XQ0 A;  3E4B A;  2J49 A;  2PM7 A;  5JHB A;  3OXL A;  4EZL A;  4A1G A;  5E76 A;  5ENN A;  2UWJ G;  5G04 J;  3D9L A;  4JVS A;  2VSX E;  3QDN A;  2DIW A;  2WXN A;  3ASF A;  5KJL A;  3IBE A;  1E8X A;  4WNE A;  2R59 A;  4I6G A;  4GCO A;  5AIJ A;  2WVI A;  2AWI A;  3RRM B;  1OWL A;  3LKU A;  3CK7 A;  3FTZ A;  4ATG A;  3RU0 A;  1SZ9 A;  2IQC A;  2L9B A;  4NQ0 A;  1Y8M A;  3D9N A;  1QZ2 A;  2YNQ A;  4G23 A;  3R7R A;  4HS2 A;  3CGH A;  4NAC A;  3JYS A;  1HZ4 A;  2FUL A;  2HR2 A;  3L54 A;  3RJV A;  3VTX A;  1PY1 A;  2BTD A;  2KC7 A;  3LXU X;  4BTB A;  1HX8 A;  4J0U A;  4C0E A;  3MKR A;  4BY6 A;  1ZU2 A;  4FJY A;  1EDU A;  3QAQ A;  1VDY A;  4U0S A;  2IFU A;  3FTY A;  5HQ8 A;  4IN3 B;  3PVL A;  3DPD A;  5AEN A;  3ZEF A;  2J4B A;  4U04 A;  3FDH A;  4UI9 C;  5G2N A;  3FUL A;  2LAI A;  2L6J A;  3IHY A;  4JA9 A;  3SI5 A;  1FVH A;  2XGM A;  3FUD A;  4CT0 A;  3FEX A;  2E2E A;  4XKC A;  2VTB B;  2XCC A;  2YQ8 A;  4ACL A;  4KVM A;  3CR3 A;  4PS3 A;  1B89 A;  5BUZ A;  2PL2 A;  5DIZ A;  3VLF A;  4ILG A;  1QQE A;  3L16 A;  1OWP A;  5LCW J;  3LEW A;  4XX5 A;  4BX9 A;  3FTW A;  5EX3 A;  4AXH A;  4HFG A;  4DK5 A;  4WNG A;  4JEH A;  3PE3 A;  4ANV A;  4YVO A;  5T3R A;  4CGV A;  4L7T A;  5LP0 A;  1XNF A;  2OOE A;  3QKY A;  4PS7 A;  2C0M A;  2PZI A;  3HYM B;  4ANX A;  3QOU A;  4JPS A;  3UUX A;  4GPK A;  2CFU A;  3CVU A;  4TUU A;  3I3N A;  4N5C A;  5KJN A;  4FLB A;  5BV1 A;  2WXO A;  1E96 B;  3U64 A;  4BX8 A;  1NP7 A;  2WPV A;  2DBA A;  4GML A;  3FUI A;  3FU5 A;  4ILI A;  4WWN A;  3ZPJ A;  5FJY A;  2J4D A;  3ZYQ A;  3B7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...