3ASGA

Mama d159k mutant 2
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
182
structure length
182
Chain Sequence
DIRQVYYRDKGISHAKAGRYSQAVMLLEQVYDADAFDVDVALHLGIAYVKTGAVDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALKNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPHFKKANELDEGASVELALVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MamA
publication title Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly
pubmed doi rcsb
source organism Magnetospirillum magnetotacticum
molecule tags Protein binding
total genus 69
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07719 TPR_2 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
A PF14559 TPR_19 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3asgA01
1HZ4A 3TG5A 4GYWA 1HXIA 4GZ6A 4GA1A 4I2WA 3IEGA 3MA5A 5HI7A 3RO3A 4BTAA 4CGVA 3HYMB 3CK8A 4KXKB 3QWVA 3PDNA 4EQFA 1NA0A 2Y4TA 4HOQA 5ARFA 4GYYA 1XNFA 5FZRA 4HORA 4CDRA 5AYWD 4Y6CA 1B89A 5G05J 5FZSA 3K9IA 4G24A 2IF4A 3LPZA 5A7DB 2PZIA 3RO2A 4AIFA 3MV3B 1KLXA 3KS2A 5EX3A 4J8FA 3QKYA 1FCHA 1ELRA 5D0OD 4I2ZA 4JHRA 4G1TA 3ZN3A 4WUYA 2VSNA 3ULQA 4XIFA 2PL2A 3ASHA 5KJNA 3MEKA 3CEQA 5KJLA 4AY6A 3PE3A 4N3CA 3QWWA 2VSYA 4JA9A 5A6CA 2KCLA 4GCNA 2HYZA 4AY5A 3CVPA 3UPVA 4G2VA 4UQYA 2IFUA 2KCKA 2KCVA 2XEVA 5JJTA 2XGOA 4YNDA 3AS5A 4ABNA 3S7DA 3LY8A 3TG4A 2HR2A 4LEUA 2HO1A 2VYIA 3N71A 3SF4A 3GYZA 3AS8A 4XI0A 2Q7FA 1IHGA 3ESKA 1ZU2A 5JJ6A 3ASGA 5M72A 2AVPA 3URZA 1IYGA 2V5FA 3CVLA 3NF1A 3GZ2A 5D0QD 3UQ3A 3MKRA 3LY7A 3ASDA 5BW8C 3UUXA 3ZHEA 4UI9J 5CCMA 2WQHA 4N39A 3VTYA 4I9CA 2I6HA 1QQEA 4IN3B 2KC7A 4HOUA 4J0UA 5KJKA 2UY1A 2VGXB 5LCWJ 1TJCA 2BUGA 4A1SA 3S7JA 4BT8A 4GYOA 5G04J 2VQ2A 2LNIA 3LY9A 2C0MA 2Y4UA 3FP3A 4J8DA 1KT1A 3R9AB 4WNDA 2E2EA 2YQ8A 2P58C 3GW4A 4N5CA 4J8EA 4G26A 2FEZA 2R5SA 1E96B 2XGMA 5DBKA 2LSVA 1WM5A 4W9RA 4NQ0A 4APOA 3CKBA 4N3AA 2UWJG 4GZ5A 5FJYA 3OXGA 4I17A 5KJMA 4CGWA 4GA2A 3CKCA 1NA3A 5G05C 4UQZA 5CCLA 3QDNA 1ELWA 2FBNA 4YVQC 5ARGA 4G23A 1KT0A 3CK7A 4WNFA 4H7XA 3S7FA 2XPIA 3PE4A 4GA0A 5EKQD 3LCAA 5DIZA 1QZ2A 3AS4A 3QWPA 2C0LA 2JLBA 4UI9K 2XCBA 3RU0A 3SZ7A 4WNEA 2ONDA 4BTBA 3WXXA 1OUVA 3OXLA 2FI7A 5C1DA 3ZHEB 2GW1A 3MV2B 5JJ7A 3RJVA 1NZNA 3Q15A 4BWRA 2C2LA 2UY1B 2OOEA 1P5QA 4F3VA 4G25A 2QFCA 3FWVA 5CHEE 2PQNA 1YA0A 4U07A 1W3BA 4BT9A 4GZ3A 4U0UA 3ZFWA 3CVQA 2XCCA 4NRHB 2LSUA 3U3WA 2MHKA 2NC9A 5BT1A 3EDTB 3CV0A 4RG6A 4AM9A 2L6JA 5FTPA 2YHCA 4O6FA 3QOUA 4GCOA 4ME2A 3CK9A 5HQ8A 3RIBA 4HOTA 1HH8A 2VGXA 3BEEA 1Y8MA 4XI9A 4WNGA 3Q4AB 4JL0A 3GZ1A 4I9EA 3Q5MA 3TGOA 2J9QA 2VGYA 4B94A 3TAXA 5FT9A 2FF4A 3ASFA 4UI9C 4U0SA 2PQRA 1A17A 3RKVA 4JA7A 3Q49B 4N2SA 4Y6WA 4RG9A 4I1AA 3S7BA 3Q47B 3KD7A 4KYOB 4UQXA 3U4TA 2DBAA 3LKUA 5LCWC 3ZPJA 4GPKA 3O48A 3KAEA 4U04A 5G04C 3VTXA 3CVNA 3FFLA 4KBQA 4HOSA 3JYSA 2KATA 4U0ZA 4N3BA 3LYAA 3OXFA 5FZQA 3ZGQA 4H7YA 2WPVA 4YVOA 3E4BA 4N2QA 5EX0A 5BNWA 1WAO1 1ZBPA 2XGSA 1PC2A 2FO7A
chains in the Genus database with same CATH superfamily
2AW6A 3SD5A 5CRVA 1NI1A 2KXPC 2QZAA 2H6FA 4GYWA 1HXIA 5LX8A 1N52A 4I2WA 5AAOA 4I6GA 2IEJA 3UM2A 4CGVA 4EZKA 4Q96A 5EYLA 1QBQA 2V0PA 2NYJA 1N0RA 4CDMA 4GYYA 3TWXA 1XNFA 4O60A 4KT6B 5AYWD 4I1MA 4G24A 2IF4A 4F1SA 2Y69E 4AIFA 3UIPC 1KLXA 4CT4A 3ULEG 3QKYA 1HO8A 4I2ZA 1MX2A 2DYSE 3FUFA 3E34A 3AU5A 3EU9A 2F0YA 5T8IA 2EIJE 2VSNA 3EUVA 4QFVA 4FADA 3TXNA 1LD7A 3SNXA 3CVWA 2PL2A 4HB5A 2A5UA 3MEKA 3Q79A 1TNUA 5E75A 4WWNA 4I1OB 4BY6A 1UJKA 1IXVA 3FH8A 3FULA 2VSYA 4JA9A 4ILHB 3NBNB 3ASOE 5CMWA 3CVPA 4LUNU 1N94A 1NP7A 4G2VA 1IKND 1UOHA 2XEVA 5JJTA 2AXVA 4ILGA 2AJAA 2B6CA 4GTOA 3KSLA 2X38A 4F1PA 5KBAA 2LXMA 3N71A 1FT2A 3GYZA 3LJNA 1FT1A 1N0QA 4XI0A 2R59A 4GMLA 2DWZA 3ZIMA 3AG3E 2V5FA 1DCEA 2LO6A 2WXFA 2GRPB 4JD2G 1EF1C 4BSZB 4LSZE 3LY7A 5BW8C 3AJIA 4PS7A 4GU5A 1HG2A 1JUQA 1H2TC 2I6HA 4I9CA 3EHRA 3ESLA 1SZAA 3DBSA 2KC7A 4J0UA 4XKCA 5A23A 5LCWJ 1Z3XA 4A1SA 4TUMA 4RSYA 5T4YA 4L23A 2C0MA 3Q75A 1FVFA 3ZRHA 4JW1A 4EPZA 3D9NA 4BSXA 3R9AB 4CRWA 2ZGDA 5BXOA 2IO3C 2E2EA 1K3ZD 3UKRG 2MRIA 2WXOA 3G2VA 4DLQA 1S70B 2GRRB 2OEVA 2R17C 3HXDA 1WY6A 2XGMA 2LSVA 4FJZA 4W9RA 4JEHA 5FQ6A 5BUZA 1NFIE 3LDZA 3OXGA 3T5XA 3JQ0A 5D2MC 1KZOA 5AARA 4I6EA 2V4HC 2VSXE 4UWGA 2GROB 1WDYA 3G2UA 1N9AA 3E32A 5CCLA 1E8XA 3APDA 3D9PA 1ELWA 2A4ZA 4O1OA 4YVQC 3SFXA 4G23A 1KT0A 4WNFA 5B1AE 3CHQA 2E0IA 2WXQA 3PRZA 5EKQD 4DK5A 4KMOA 3D9OA 2EIME 3NAWA 2RFAA 3AU4A 1O1RA 2JABA 1QZ2A 3R9MA 3AS4A 3ZYLA 1MHQA 4FLBA 4F6RD 4UI9K 2XCBA 3RSEG 3FUKA 3FEYA 3DSTA 4BTBA 4BX8A 1JCSA 3OXLA 1JWFA 2FI7A 4U63A 3ZHEB 2CG2A 3NB2A 3MV2B 1H6KA 4GTMA 3TJPA 4ACLA 4GZCA 4J7WA 4HI8A 2RFMA 4J8SA 4GTQA 1KZPA 2V4LA 1Z5SC 3NZSA 4EECA 2DZOA 4PDXA 5LOZA 4GZ3A 4U0UA 2IJGX 5C2YA 1HFAA 2MHKA 5AIJA 2NC9A 4OAUC 3ZU7B 3FUHA 5IY5E 4C0MA 1N54A 5KWDA 2VGEA 2WVIA 4O6FA 1BLXB 3AG4E 5CMYA 4HOTA 1HH8A 2VGXA 3BEEA 2DCPA 4F53A 3Q4AB 4L1BA 2DIWA 3CHOA 1BI8B 2J9QA 3IV0A 1JPLA 1O1SA 2OEWA 2XQ0A 1O1TA 2CHWA 5FT9A 3D3MA 3ASFA 4UI9C 4LNGA 2IOSA 2NSZA 1EYHA 4I1AA 3Q47B 1V54E 3KD7A 2WXIA 2IO2C 3FH7A 2DBAA 3EIJA 3ONLA 4LNBA 3ZW3A 4U04A 4HQDA 2J49A 3VTXA 2XRYA 3CVNA 3MGBA 3JYSA 3FU6A 4N3BA 3LYAA 4JHKA 4U8HA 3D9IA 2IU1A 3OXFA 5FZQA 1TN8A 2P9KG 1H2VC 4JZYA 3ZNGA 5EX0A 5BNWA 1ZBPA 2XGSA 4MLPA 2FO7A 3KSQA 5FINA 2WMNA 4K0RA 3TG5A 1OCZE 5CBOA 4GZ6A 3CQGB 4GA1A 2ILRA 3DXMG 3MA5A 5HKPA 5HI7A 3DWLG 4BTAA 4E85A 3DEPA 3CK8A 5EILA 1N4PA 2KZTB 3PDNA 4EQFA 3DXKG 4HOQA 5ARFA 4GTRA 4HRNA 3SQVA 2BKGA 3Q9NC 1D8DA 3FEXA 4GZDA 4CDRA 5AQ9A 5FZSA 3FU0A 3LPZA 1IQUA 1S64A 3LEWA 3RO2A 2I1KA 3MV3B 3CSFA 1IHBA 3UX4A 5EX3A 4J8FA 1ELRA 2EQXA 5B1BE 1LF8A 3VLDA 1BPOA 2X6HA 4WWPA 1SA5A 3SBTB 3ZKJA 2J4BA 2ZISA 4GTTA 5B3SE 2ETAA 3ASHA 5E76A 1TEZA 3CEQA 4AY6A 1SA4A 4DJAA 3AAAC 4N3CA 4UWLA 3W9GA 2KCLA 3CHRA 1HG5A 3SI5A 4GCNA 2HYZA 2KCKA 4JPSA 4LNUD 2XGOA 4YNDA 2XS8A 2BF0X 5BXUA 3S7DA 3LY8A 3TG4A 4FLHA 1HF8A 2RKKA 2HO1A 1MYOA 3FDHA 2L0TB 2VYIA 1JCRA 2ETCA 4M3OA 3AS8A 3T8KA 1O5MA 3KEZA 5JJ6A 3B13A 3URZA 3F6QA 3GZ2A 3HG0D 3UQ3A 3MKRA 3CVYA 3ASDA 4FP7A 4A63B 3UUXA 2M63A 1DCQA 5CCMA 2WQHA 5KNGA 1U3CA 4N39A 5ENTD 2R03A 1QQEA 4XX5A 3HIZA 1TJCA 2LXLA 4PUCA 3PREA 2WXPA 3BG0B 3V2XA 3S7JA 4BT8A 4GYOA 3TWTA 1D9SA 2KBXA 3LY9A 4FA6A 3FP3A 3LJ3A 2GRNB 3P1UA 1KT1A 4AJWA 1JCQA 5ENSD 1H2UA 4WNDA 5AN8A 4ATGA 3C3RA 4J8EA 2R5SA 3MYVA 4L2YA 1UN8A 3UT4A 3UT8A 2OV8A 1E96B 4GAAA 1UG3A 1WG0A 4NQ0A 4APOA 4LG6A 2ZXWE 5FJYA 3QC1A 4A3VA 5JMND 4TXRA 3T9KA 3FUEA 3FHEA 5G05C 5AJDA 2FBNA 5ARGA 4GMRA 1MJ0A 4EBAA 2DVWA 4UWHA 2VSOE 3B95A 2P9PG 3RK6A 1H6OA 1H19A 3QWPA 4NURA 2Y3AA 5EN5D 3MKQB 3WG7E 3HXFA 3JCKC 3SZ7A 3C5RA 4A3TA 1VDYA 2H6HA 3WXXA 4TV3A 1DNPA 3TWRA 5AENA 5KCMA 2L9BA 2YHEA 2RG8A 3HVEA 4L9PA 5BPPA 2I1JA 1PY1A 5H7PA 4MS6A 2C2LA 3ZYKA 4KVMA 3D9JA 5FQ7A 1L5JA 4G25A 1OCRE 1TJFA 5CHEE 2PQNA 1YA0A 4ATZD 3LS8A 3T5VA 1W3BA 4LCTA 4C48B 4B8AA 5LP0A 5HRYA 3Q73A 2R02A 3AG1E 2XCCA 4NRHB 2LSUA 3U3WA 4TXQA 2QYUA 3TXMA 5BT1A 3UINC 4RG6A 4AM9A 2F8XK 1EPUA 5FTPA 2IOLA 4DLOA 4GCOA 4ME2A 2WXNA 4R7LA 3RIBA 2XRZA 4PH4B 2BEDA 2DYRE 3FU3A 2J07A 1BU9A 1Y8MA 4C0EA 3FTXA 4JL0A 3UMVA 2WQ6A 1E90A 3QNKA 2I2OA 4I9EA 3PEVB 4NIKA 3Q5MA 4DI3A 3BU8A 2VGYA 2J4DA 3RRNB 3TAXA 2MYOA 4J8YA 2P9IG 3ABKE 4U0SA 4YDOA 2YNQA 3PNLB 3RKVA 3MCXA 1RW2A 1S0PA 4UQXA 2PM6A 3UI2A 3PUJA 3E30A 4AP2A 4WWOA 2J09A 4GPKA 5G04C 5FWQA 3NZUA 3LVQE 3DRAA 1PAQA 3SHFA 2WMOA 4H7YA 3RRUA 4YVOA 1WAO1 3FTUA 1PC2A 5ENPD 4FC8A 5J08A 3IXEA 1N4QA 3IEGA 4UWKA 2VJ8A 4RLYA 3UM1A 1YYHA 3FTWA 1SZ9A 1TR4A 3G2SA 4APFA 1OXJA 4Y6CA 1B89A 4B0ZA 2FULA 4L7TA 3ML9A 5A7DB 3FY4A 2PZIA 4K03A 3DEOA 2NXPA 3UKUG 3QK0A 4V3IA 2IONA 4B8CB 5D0OD 3HXBA 4BETA 4JHRA 2L6BA 4AEZC 4LRZA 2XPZA 3ZN3A 4WUYA 5J90A 4XKBA 3NQPA 3QARA 1YCSB 3DPDA 3ULQA 4XIFA 4ANXA 4DX6D 1OWMA 4JEUA 3FTYA 5KJLA 3ZXPA 3PE3A 3NOCD 3QWWA 4C9BB 2HE0A 1N4SA 5CEAA 3UPVA 3D9MA 3I5PA 3BG1B 5EIDA 3TWSA 1OWOA 3D9HA 4UQYA 2IFUA 3APFA 2QC9A 2KCVA 3C72A 3ONKA 1XGWA 4PS8A 4JXTA 4OVVA 1E7VA 4MKTA 3MZLB 4Q94A 3I3NA 4ZHBA 4LEUA 3MX3A 1FPPA 4G8LA 4EZJA 4TUUA 1IHGA 1JWGA 2XZTG 5FQ4A 4DX7D 1Q2ZA 3EJNA 1INZA 5M72A 1K8KG 2AVPA 1TNOA 3CGHA 1IYGA 1N11A 4EHMA 2GRQB 3NF1A 3CHPA 5D0QD 3OAWA 4BEPA 4UI9J 3BUAA 1IQRA 4DX2A 5ANRA 3VTYA 1OWLA 3UT7A 4FU3A 4IULA 4NACA 3PH0C 4HRMB 5KJKA 2UY1A 3I4RB 4PS3A 3LXUX 2ZGGA 1U2VG 2VQ2A 2LNIA 3SFYA 4OYSA 2Y4UA 4FHKA 5G55A 2L0IA 4J8DA 4G11A 4DX1A 4CT0A 3MJWA 4K5BA 3L22A 2YQ8A 1Z6TA 2P58C 3GW4A 3TWUA 2WQ7A 5AQ7A 2FEZA 3FUDA 1YMPA 2B0OE 5DBKA 3R7RA 2LUHA 3FUIA 3PZ3A 2IQCA 3AG2E 4N3AA 5CRUA 2UWJG 4GZ5A 3EHMA 2XZDG 2V8SE 5KJMA 2P9LG 3TWVA 1Y6IA 4CGWA 1BD8A 3SBSA 3CQCB 4J6IA 4RVBA 4GA2A 3CKCA 2X3MA 1HX8A 1TN6A 1NA3A 5HS0A 2CFUA 2XEEA 5EIBE 2P2CP 2IY0C 4U8YD 2KM4A 2OVFA 1E8ZA 4H7XA 3S7FA 2P9SG 3G2TA 3CHSA 5ANLA 3LCAA 1QYMA 2JEKA 4TXPA 2XPYA 2WXLA 4GTSA 2X6JA 3X2QE 2J8SD 5ENRD 2JLBA 4I43A 1OCCE 3IHVA 4WNEA 1U3DA 3E33A 5AQAA 2WXMA 2VTBA 2A5EA 3JXIA 2J08A 1OY3D 3APCA 2GW1A 3ABME 5JJ7A 3O4ZA 1AP7A 4DI4A 3RJVA 3Q15A 3B7TA 4F3VA 1SQMA 4BX9A 5JHBA 4U07A 4G8KA 2I9CA 3HXCA 4IYPA 3FTZA 3L16A 2X6KA 3Q7AA 4CDNA 2R05A 3EDTB 2L6JA 1NL4A 4B89A 2MOWA 2YHCA 3VLFA 3CK9A 3PS6A 2ZU6B 1SW6A 5EDSA 2CHXA 4CEMA 4WNGA 4GPMA 3HXEA 3D9LA 3HHMA 4HRLA 1LTXA 4MBGA 3GZ1A 3UTMA 4B94A 3QAQA 3ZEFA 2GRLA 2PQRA 3TWQA 1A17A 3ZYQA 2HM8A 4BESA 4XE0A 1DVPA 3Q49B 4Y6WA 4RG9A 3FTSA 3CVVA 1HU3A 3FH5A 3ML8A 4KYOB 3U4TA 2OCCE 5LCWC 2DZNA 3PUKA 3PEUB 3QJZA 3L6AA 5AQBA 1MQSA 3FFLA 4HOSA 2KATA 4O1PA 4KZ0A 1S63A 3U9WA 3ZGQA 4FULA 3GZSA 3FTVA 3PNTB 4N2QA 2FO1E 2F8YA 4U96D 3EIQC 3ASNE 1G3NB 1MX4A 3HVEB 1OCOE 4JC8A 2XS1A 3L9TA 2AXZA 1HZ4A 4RQIA 1Z3YA 4HVBA 3UM3A 4U95D 1BI7B 3L08A 3Q9UC 4GTVA 3RO3A 3E37A 1E8WA 3DSXA 3MKQA 4ILIA 3VLEA 3V31A 3HYMB 1UN9A 5CBNA 5BV1A 4KXKB 3QWVA 3SO8A 3TWWA 1NA0A 2Y4TA 5FZRA 3ENEA 2CG3A 4E6HA 4HORA 1K1AA 4ANUA 5ENNA 3V30A 4URKA 5G05J 1FVHA 2CHZA 3L13A 3K9IA 2PM7A 2PNNA 1EDUA 3KS2A 3L82A 1FCHA 2F37A 2WXHA 4G1TA 4TRQA 1D8EA 4OAVB 1HE8A 5CERB 2X6FA 3FU5A 5KJNA 1A5EA 5JA4D 4OVUA 4QQIA 3W9FA 1TNBA 4CYMD 1ZB1A 3Q7FA 5A6CA 4AV7A 4Q69A 4I6JA 2ETBA 4K5CA 4AY5A 2AXUA 5AJLA 2P9NG 4IRUA 4YDWA 2WM9A 2EINE 2XEHA 1UW4B 3B7SA 4XEIG 3AS5A 4D10C 4KZCA 4XZ4A 5KNHD 2LAHA 4ABNA 3IHYA 1H0AA 2CFZA 3ISMC 2HR2A 3FUNA 3B7BA 2GRMA 3J5PA 5EYPF 2OVBA 3SGHA 4CZ2D 2H6IA 4K5AB 3ABLE 3C98A 3G2WA 3SF4A 1OWPA 3PZ1A 2BKKB 2Q7FA 4UUCA 3ESKA 4M7CA 1ELKA 4HS2A 1ZU2A 4EBAG 4A55A 3ASGA 4GB9A 4EZLA 4AVXA 4FJYA 4YDEA 1DC2A 3CVLA 3EHNA 1LD8A 3PVLA 5CECB 3SY2A 3ZHEA 1X81A 1HS6A 4BERA 4GTPA 4UWFA 4IN3B 4HOUA 1TNZA 2VGXB 2BUGA 3U66A 3L54A 4ACKA 3J5QB 1N4RA 5G04J 1N95A 3U64A 3CLJA 2WXJA 1RZ4A 1K1BA 4HBDA 4U8VD 4N5CA 4G26A 3NOGD 2AWIA 3RAUA 2QY7A 1OT8A 1WM5A 2ZIRA 3HRAA 5ENQD 3JXJA 3CKBA 2Y1LE 4I17A 1KPSB 5ITZF 3RRMB 1OWNA 1GW6A 4F7AA 2WXKA 3CHMA 3Q78A 2XHEA 1TN7A 3ZXSA 2EIKE 4UQZA 3QDNA 5ENOD 3PZ4A 4DUIA 3ZUVB 3PZDA 3CK7A 3SFZA 3CVUA 1MX6A 3JUEA 2BTDA 2WB2A 2XPIA 3PE4A 4N5QA 3OTNA 2WXRA 4GA0A 4X8QA 1QNFA 3R7QA 3LVRE 2EILE 3ZVVA 1TNYA 3S2AA 3EHQA 5DIZA 2P9UG 5LFAA 2GGFA 3V79K 2C0LA 4L2LA 4YDYA 3I4GA 5T3RA 3RU0A 3UM0A 2ONDA 2XENA 3B7RL 1OUVA 3T8MA 3JUIA 3C3OA 5C1DA 1E8YA 3JQ1A 3KEAA 1SVXA 5JHAA 4HI9A 3BQOA 5G2NA 1NZNA 3HDXA 4DPRA 3ZYMA 3UXGA 4BWRA 2UY1B 2OOEA 1P5QA 1TYQG 3CVXA 2QFCA 3FWVA 2WXGA 3V2OA 4FHJA 4BT9A 3B7UX 5BV0A 4JB8P 3CSTA 3ZFWA 4AOFA 3CVQA 4JHJA 5CEDB 2KZTA 1X5BA 1E7UA 3DSUA 3UIOC 2V5QC 3DSVA 3D9KA 4JVSA 3CV0A 3FUJA 1AWCB 3IKOB 3QOUA 4GMJA 4CCAA 5HQ8A 2YINA 3ULYA 1H6PA 5FQ8A 4HLEA 4HFGA 4LERA 4A1GA 3DSWA 4MRUA 4XI9A 2RD0A 5D66A 2QYJA 4HLLA 4ANVA 3CIAA 3DPYA 3QB2A 2LAIA 3PZ2A 2Y0BG 3TGOA 4DX5D 4KVOA 3EU5A 2FF4A 3C3QA 4JA7A 4ZFHA 3P2BA 4DRXE 4N2SA 3S7BA 3CR3A 4P29A 1UJJA 3LKUA 4BFRA 4B93B 2X6IA 3ZPJA 3O48A 3KAEA 3TL5A 4ANWA 4HXIA 1MZCA 1V55E 4KBQA 5FIOA 3DSSA 4U0ZA 4HNAD 2H6GA 4WAFA 3FUMA 2VTBB 2WPVA 3L17A 3E4BA 2R2LA 4AXHA 4U7EB 3IBEA 4Z68A
chains in the Genus database with same CATH topology
4JC8A 2AW6A 3SD5A 2WMNA 2AXZA 1HZ4A 1Z3YA 4FC8A 4K0RA 5J08A 3TG5A 4GYWA 1HXIA 4HVBA 5LX8A 1N52A 3CQGB 4GZ6A 4GA1A 2ILRA 4I2WA 3IEGA 4I6GA 3L08A 3MA5A 5HI7A 3RO3A 1E8WA 3MKQA 4BTAA 4E85A 4ILIA 4UWKA 3VLEA 4CGVA 4EZKA 2VJ8A 4Q96A 3HYMB 1UN9A 3CK8A 2V0PA 5BV1A 3FTWA 4KXKB 3QWVA 2KZTB 3PDNA 4EQFA 1NA0A 4CDMA 2Y4TA 1SZ9A 4HOQA 5ARFA 4GYYA 1XNFA 5FZRA 3ENEA 3G2SA 2CG3A 4E6HA 4APFA 4HORA 4KT6B 3FEXA 4GZDA 5AYWD 4ANUA 4I1MA 5ENNA 4CDRA 4Y6CA 4URKA 1B89A 5G05J 4B0ZA 1FVHA 2FULA 5FZSA 2CHZA 3L13A 3K9IA 4G24A 4L7TA 3ML9A 2IF4A 2PM7A 3FU0A 3LPZA 3FY4A 1IQUA 2PZIA 5A7DB 4F1SA 3LEWA 3RO2A 2I1KA 4AIFA 4K03A 3MV3B 2NXPA 1KLXA 1EDUA 3KS2A 3QK0A 3CSFA 4V3IA 3UX4A 5EX3A 4CT4A 4J8FA 3QKYA 2IONA 1FCHA 4B8CB 1ELRA 2EQXA 5D0OD 1HO8A 4I2ZA 1LF8A 3VLDA 1BPOA 2X6HA 2WXHA 4JHRA 4G1TA 3FUFA 4WWPA 4AEZC 4LRZA 3AU5A 4TRQA 2XPZA 5T8IA 3ZN3A 4WUYA 5J90A 2VSNA 3SBTB 4XKBA 3NQPA 4QFVA 3QARA 4FADA 2J4BA 3DPDA 3TXNA 1HE8A 3SNXA 3ULQA 4XIFA 2X6FA 4ANXA 1OWMA 3FU5A 3CVWA 2PL2A 4JEUA 3ASHA 5KJNA 5E76A 1TEZA 3FTYA 2A5UA 3MEKA 3CEQA 5KJLA 4AY6A 5E75A 4OVUA 4WWNA 4DJAA 4I1OB 3PE3A 1UJKA 4BY6A 4N3CA 4UWLA 3FH8A 3QWWA 3FULA 2VSYA 4JA9A 4C9BB 4ILHB 5A6CA 2KCLA 3CHRA 4AV7A 4Q69A 1HG5A 4I6JA 3SI5A 4GCNA 5CMWA 2HYZA 4AY5A 3CVPA 3UPVA 3D9MA 2AXUA 3I5PA 5AJLA 3BG1B 4IRUA 4LUNU 1OWOA 1NP7A 4G2VA 4UQYA 2WM9A 2IFUA 3APFA 2KCKA 4JPSA 2KCVA 2XEVA 3ONKA 5JJTA 2XGOA 4YNDA 1UW4B 1XGWA 2AXVA 3B7SA 4PS8A 4JXTA 3AS5A 4OVVA 4D10C 1E7VA 4ILGA 4KZCA 2BF0X 4XZ4A 2LAHA 4MKTA 4ABNA 3IHYA 3MZLB 1H0AA 2CFZA 4Q94A 3LY8A 3S7DA 3TG4A 2HR2A 3FUNA 3I3NA 4LEUA 2GRMA 4FLHA 1HF8A 2OVBA 3MX3A 3SGHA 2HO1A 3FDHA 2X38A 2L0TB 3C98A 2VYIA 3G2WA 4EZJA 3N71A 3SF4A 3GYZA 1OWPA 4TUUA 4M3OA 3AS8A 4XI0A 2Q7FA 2R59A 1IHGA 3ESKA 4GMLA 3KEZA 1JWGA 1ELKA 4HS2A 1ZU2A 5FQ4A 4EBAG 5JJ6A 3ZIMA 3B13A 4A55A 3EJNA 3ASGA 1INZA 4GB9A 4EZLA 5M72A 2AVPA 3CGHA 4AVXA 4FJYA 3URZA 1IYGA 2V5FA 3CVLA 3EHNA 2LO6A 3NF1A 2WXFA 3PVLA 3CHPA 3GZ2A 5D0QD 1EF1C 3UQ3A 3MKRA 3CVYA 3LY7A 3ASDA 4FP7A 4MLPA 3OAWA 5BW8C 2M63A 3UUXA 4PS7A 4UI9J 3ZHEA 4GU5A 5CCMA 1IQRA 2WQHA 1U3CA 1HG2A 1JUQA 4N39A 5ANRA 3VTYA 1H2TC 2I6HA 4I9CA 3ESLA 1QQEA 1OWLA 1SZAA 1HS6A 3UT7A 4FU3A 4IULA 4UWFA 4NACA 3PH0C 3DBSA 4IN3B 4XX5A 2KC7A 4HOUA 4J0UA 4XKCA 5KJKA 2UY1A 3HIZA 5A23A 2VGXB 3I4RB 5LCWJ 1TJCA 2BUGA 3U66A 4PUCA 3PREA 3L54A 2WXPA 4PS3A 1Z3XA 4ACKA 4A1SA 3LXUX 3BG0B 3S7JA 4BT8A 4GYOA 5G04J 4RSYA 2VQ2A 2LNIA 5T4YA 3LY9A 4OYSA 4L23A 4FA6A 2C0MA 1FVFA 2Y4UA 3FP3A 4FHKA 3U64A 3ZRHA 3LJ3A 4JW1A 4EPZA 5G55A 2L0IA 3P1UA 4J8DA 3D9NA 1KT1A 4BSXA 3CLJA 2WXJA 4AJWA 4G11A 1H2UA 3R9AB 4WNDA 4CRWA 4CT0A 3MJWA 4ATGA 3L22A 2E2EA 2YQ8A 1Z6TA 2MRIA 2P58C 2WXOA 3G2VA 3GW4A 4N5CA 4J8EA 2WQ7A 4G26A 2FEZA 2R5SA 3MYVA 2AWIA 4L2YA 4DLQA 1UN8A 3FUDA 3UT4A 3UT8A 2R17C 2OV8A 1E96B 2QY7A 1WY6A 1UG3A 2XGMA 4GAAA 5DBKA 3R7RA 3FUIA 2LSVA 1WM5A 4FJZA 4W9RA 2IQCA 4JEHA 5FQ6A 5BUZA 4NQ0A 4APOA 3CKBA 4N3AA 2UWJG 4GZ5A 5FJYA 3EHMA 3LDZA 3OXGA 3QC1A 2V8SE 4I17A 3T5XA 4A3VA 3JQ0A 5KJMA 3RRMB 1Y6IA 1OWNA 4I6EA 4CGWA 1GW6A 4F7AA 3SBSA 3CQCB 4J6IA 4RVBA 4GA2A 2VSXE 4UWGA 2WXKA 3CKCA 2X3MA 3CHMA 2XHEA 1HX8A 3FUEA 3G2UA 3FHEA 1NA3A 5G05C 4UQZA 3ZXSA 5CCLA 1E8XA 2CFUA 3QDNA 3APDA 3D9PA 5AJDA 1ELWA 2A4ZA 2FBNA 2KM4A 2OVFA 4YVQC 5ARGA 4G23A 3PZDA 1KT0A 3CK7A 3SFZA 1E8ZA 4EBAA 4WNFA 3CVUA 3CHQA 4H7XA 4UWHA 3S7FA 2E0IA 2WXQA 3PRZA 2BTDA 2WB2A 2XPIA 3PE4A 2VSOE 3OTNA 2WXRA 3G2TA 3CHSA 4GA0A 5EKQD 1QNFA 3R7QA 5ANLA 4DK5A 4KMOA 3LVRE 3D9OA 3LCAA 3RK6A 3ZVVA 3AU4A 2JEKA 3S2AA 5DIZA 2XPYA 1QZ2A 2WXLA 1H19A 3AS4A 2X6JA 3ZYLA 1MHQA 2GGFA 3QWPA 5LFAA 2C0LA 4NURA 2Y3AA 4FLBA 4L2LA 3I4GA 2JLBA 3MKQB 4UI9K 2XCBA 5T3RA 4I43A 3RU0A 3FUKA 3JCKC 3FEYA 3IHVA 3SZ7A 4A3TA 1VDYA 1U3DA 4WNEA 2ONDA 3B7RL 4BTBA 3WXXA 4BX8A 2WXMA 1OUVA 3T8MA 2VTBA 4TV3A 1DNPA 2J08A 3JUIA 3OXLA 1JWFA 2FI7A 5AENA 1E8YA 5C1DA 5KCMA 4U63A 2L9BA 3APCA 2GW1A 3ZHEB 3JQ1A 2CG2A 2YHEA 2RG8A 3MV2B 5JJ7A 1H6KA 3HVEA 3O4ZA 5BPPA 3TJPA 5JHAA 4ACLA 4DI4A 4GZCA 5G2NA 3RJVA 2I1JA 1PY1A 1NZNA 3HDXA 3Q15A 4DPRA 3ZYMA 4MS6A 4BWRA 3B7TA 2C2LA 2UY1B 3ZYKA 2OOEA 4KVMA 3D9JA 1P5QA 4F3VA 1L5JA 4J8SA 5FQ7A 4G25A 3CVXA 2QFCA 1TJFA 1SQMA 3FWVA 2PQNA 5CHEE 4BX9A 5JHBA 2V4LA 1YA0A 2WXGA 3LS8A 3NZSA 3T5VA 4U07A 1W3BA 4FHJA 4LCTA 4BT9A 4EECA 3B7UX 2I9CA 4B8AA 5LP0A 4PDXA 5BV0A 3CSTA 5LOZA 4GZ3A 4IYPA 3FTZA 4U0UA 3ZFWA 3L16A 4AOFA 3CVQA 2IJGX 2X6KA 4JHJA 4CDNA 2KZTA 2XCCA 5C2YA 4NRHB 2LSUA 1X5BA 1E7UA 3U3WA 1HFAA 2MHKA 5AIJA 2NC9A 3TXMA 5BT1A 3D9KA 4JVSA 3FUHA 3EDTB 3CV0A 4RG6A 4AM9A 2L6JA 1EPUA 4B89A 1N54A 3FUJA 4C0MA 5FTPA 2IOLA 2MOWA 2WVIA 2YHCA 3IKOB 3QOUA 4O6FA 4DLOA 4GCOA 3VLFA 4ME2A 3CK9A 4GMJA 4CCAA 5HQ8A 3PS6A 2WXNA 2YINA 4R7LA 3RIBA 2XRZA 5FQ8A 4PH4B 2ZU6B 5CMYA 4HOTA 4HLEA 4HFGA 4LERA 3FU3A 2J07A 1HH8A 3BEEA 2VGXA 4A1GA 2DCPA 1Y8MA 5EDSA 4C0EA 4MRUA 4XI9A 2RD0A 2CHXA 4CEMA 4WNGA 3FTXA 3Q4AB 4F53A 4JL0A 3UMVA 3D9LA 4ANVA 3HHMA 2WQ6A 4L1BA 3CIAA 2DIWA 3QB2A 1E90A 3QNKA 2I2OA 3GZ1A 3PEVB 3CHOA 4I9EA 2LAIA 3Q5MA 3TGOA 4DI3A 2J9QA 3IV0A 1JPLA 2VGYA 4B94A 3QAQA 2J4DA 2XQ0A 4KVOA 3RRNB 2CHWA 3TAXA 5FT9A 2FF4A 3D3MA 3ASFA 3ZEFA 4UI9C 4U0SA 2GRLA 2PQRA 1A17A 2YNQA 3ZYQA 2HM8A 3PNLB 3RKVA 4JA7A 3MCXA 4XE0A 1DVPA 2IOSA 3P2BA 3Q49B 2NSZA 1EYHA 4N2SA 4Y6WA 4RG9A 4I1AA 3S7BA 3FTSA 3Q47B 3CVVA 3KD7A 2WXIA 1HU3A 3FH5A 1S0PA 3ML8A 3FH7A 4KYOB 3CR3A 4P29A 1UJJA 2PM6A 2DBAA 4UQXA 3EIJA 3PUJA 3U4TA 3LKUA 4BFRA 5LCWC 4AP2A 3ONLA 4WWOA 2X6IA 3ZW3A 3PUKA 2J09A 3ZPJA 4GPKA 3O48A 3KAEA 3TL5A 4U04A 4ANWA 3PEUB 4HXIA 3QJZA 5G04C 2J49A 3L6AA 5FWQA 3VTXA 1MQSA 3NZUA 2XRYA 3CVNA 3LVQE 3FFLA 3MGBA 4KBQA 4HOSA 1PAQA 3JYSA 2KATA 3SHFA 4U0ZA 3FU6A 4N3BA 3LYAA 4JHKA 4U8HA 4WAFA 3D9IA 2IU1A 3FUMA 4KZ0A 3U9WA 2WMOA 3OXFA 5FZQA 3ZGQA 4H7YA 2VTBB 3RRUA 2WPVA 4FULA 3GZSA 4YVOA 3L17A 3E4BA 3FTVA 3PNTB 1H2VC 4N2QA 4JZYA 4AXHA 3EIQC 5EX0A 1WAO1 1ZBPA 3FTUA 3IBEA 5BNWA 2XGSA 3HVEB 1PC2A 2FO7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HZ4 A;  3TG5 A;  4GYW A;  1HXI A;  4GZ6 A;  4GA1 A;  4I2W A;  3IEG A;  3MA5 A;  5HI7 A;  3RO3 A;  4BTA A;  4CGV A;  3HYM B;  3CK8 A;  4KXK B;  3QWV A;  3PDN A;  4EQF A;  1NA0 A;  2Y4T A;  4HOQ A;  5ARF A;  4GYY A;  1XNF A;  5FZR A;  4HOR A;  4CDR A;  5AYW D;  4Y6C A;  1B89 A;  5G05 J;  5FZS A;  3K9I A;  4G24 A;  2IF4 A;  3LPZ A;  5A7D B;  2PZI A;  3RO2 A;  4AIF A;  3MV3 B;  1KLX A;  3KS2 A;  5EX3 A;  4J8F A;  3QKY A;  1FCH A;  1ELR A;  5D0O D;  4I2Z A;  4JHR A;  4G1T A;  3ZN3 A;  4WUY A;  2VSN A;  3ULQ A;  4XIF A;  2PL2 A;  3ASH A;  5KJN A;  3MEK A;  3CEQ A;  5KJL A;  4AY6 A;  3PE3 A;  4N3C A;  3QWW A;  2VSY A;  4JA9 A;  5A6C A;  2KCL A;  4GCN A;  2HYZ A;  4AY5 A;  3CVP A;  3UPV A;  4G2V A;  4UQY A;  2IFU A;  2KCK A;  2KCV A;  2XEV A;  5JJT A;  2XGO A;  4YND A;  3AS5 A;  4ABN A;  3S7D A;  3LY8 A;  3TG4 A;  2HR2 A;  4LEU A;  2HO1 A;  2VYI A;  3N71 A;  3SF4 A;  3GYZ A;  3AS8 A;  4XI0 A;  2Q7F A;  1IHG A;  3ESK A;  1ZU2 A;  5JJ6 A;  3ASG A;  5M72 A;  2AVP A;  3URZ A;  1IYG A;  2V5F A;  3CVL A;  3NF1 A;  3GZ2 A;  5D0Q D;  3UQ3 A;  3MKR A;  3LY7 A;  3ASD A;  5BW8 C;  3UUX A;  3ZHE A;  4UI9 J;  5CCM A;  2WQH A;  4N39 A;  3VTY A;  4I9C A;  2I6H A;  1QQE A;  4IN3 B;  2KC7 A;  4HOU A;  4J0U A;  5KJK A;  2UY1 A;  2VGX B;  5LCW J;  1TJC A;  2BUG A;  4A1S A;  3S7J A;  4BT8 A;  4GYO A;  5G04 J;  2VQ2 A;  2LNI A;  3LY9 A;  2C0M A;  2Y4U A;  3FP3 A;  4J8D A;  1KT1 A;  3R9A B;  4WND A;  2E2E A;  2YQ8 A;  2P58 C;  3GW4 A;  4N5C A;  4J8E A;  4G26 A;  2FEZ A;  2R5S A;  1E96 B;  2XGM A;  5DBK A;  2LSV A;  1WM5 A;  4W9R A;  4NQ0 A;  4APO A;  3CKB A;  4N3A A;  2UWJ G;  4GZ5 A;  5FJY A;  3OXG A;  4I17 A;  5KJM A;  4CGW A;  4GA2 A;  3CKC A;  1NA3 A;  5G05 C;  4UQZ A;  5CCL A;  3QDN A;  1ELW A;  2FBN A;  4YVQ C;  5ARG A;  4G23 A;  1KT0 A;  3CK7 A;  4WNF A;  4H7X A;  3S7F A;  2XPI A;  3PE4 A;  4GA0 A;  5EKQ D;  3LCA A;  5DIZ A;  1QZ2 A;  3AS4 A;  3QWP A;  2C0L A;  2JLB A;  4UI9 K;  2XCB A;  3RU0 A;  3SZ7 A;  4WNE A;  2OND A;  4BTB A;  3WXX A;  1OUV A;  3OXL A;  2FI7 A;  5C1D A;  3ZHE B;  2GW1 A;  3MV2 B;  5JJ7 A;  3RJV A;  1NZN A;  3Q15 A;  4BWR A;  2C2L A;  2UY1 B;  2OOE A;  1P5Q A;  4F3V A;  4G25 A;  2QFC A;  3FWV A;  5CHE E;  2PQN A;  1YA0 A;  4U07 A;  1W3B A;  4BT9 A;  4GZ3 A;  4U0U A;  3ZFW A;  3CVQ A;  2XCC A;  4NRH B;  2LSU A;  3U3W A;  2MHK A;  2NC9 A;  5BT1 A;  3EDT B;  3CV0 A;  4RG6 A;  4AM9 A;  2L6J A;  5FTP A;  2YHC A;  4O6F A;  3QOU A;  4GCO A;  4ME2 A;  3CK9 A;  5HQ8 A;  3RIB A;  4HOT A;  1HH8 A;  2VGX A;  3BEE A;  1Y8M A;  4XI9 A;  4WNG A;  3Q4A B;  4JL0 A;  3GZ1 A;  4I9E A;  3Q5M A;  3TGO A;  2J9Q A;  2VGY A;  4B94 A;  3TAX A;  5FT9 A;  2FF4 A;  3ASF A;  4UI9 C;  4U0S A;  2PQR A;  1A17 A;  3RKV A;  4JA7 A;  3Q49 B;  4N2S A;  4Y6W A;  4RG9 A;  4I1A A;  3S7B A;  3Q47 B;  3KD7 A;  4KYO B;  4UQX A;  3U4T A;  2DBA A;  3LKU A;  5LCW C;  3ZPJ A;  4GPK A;  3O48 A;  3KAE A;  4U04 A;  5G04 C;  3VTX A;  3CVN A;  3FFL A;  4KBQ A;  4HOS A;  3JYS A;  2KAT A;  4U0Z A;  4N3B A;  3LYA A;  3OXF A;  5FZQ A;  3ZGQ A;  4H7Y A;  2WPV A;  4YVO A;  3E4B A;  4N2Q A;  5EX0 A;  5BNW A;  1WAO 1;  1ZBP A;  2XGS A;  1PC2 A;  2FO7 A; 
#chains in the Genus database with same CATH topology
 2AW6 A;  3SD5 A;  5CRV A;  1NI1 A;  2KXP C;  2QZA A;  2H6F A;  4GYW A;  1HXI A;  5LX8 A;  1N52 A;  4I2W A;  5AAO A;  4I6G A;  2IEJ A;  3UM2 A;  4CGV A;  4EZK A;  4Q96 A;  5EYL A;  1QBQ A;  2V0P A;  2NYJ A;  1N0R A;  4CDM A;  4GYY A;  3TWX A;  1XNF A;  4O60 A;  4KT6 B;  5AYW D;  4I1M A;  4G24 A;  2IF4 A;  4F1S A;  2Y69 E;  4AIF A;  3UIP C;  1KLX A;  4CT4 A;  3ULE G;  3QKY A;  1HO8 A;  4I2Z A;  1MX2 A;  2DYS E;  3FUF A;  3E34 A;  3AU5 A;  3EU9 A;  2F0Y A;  5T8I A;  2EIJ E;  2VSN A;  3EUV A;  4QFV A;  4FAD A;  3TXN A;  1LD7 A;  3SNX A;  3CVW A;  2PL2 A;  4HB5 A;  2A5U A;  3MEK A;  3Q79 A;  1TNU A;  5E75 A;  4WWN A;  4I1O B;  4BY6 A;  1UJK A;  1IXV A;  3FH8 A;  3FUL A;  2VSY A;  4JA9 A;  4ILH B;  3NBN B;  3ASO E;  5CMW A;  3CVP A;  4LUN U;  1N94 A;  1NP7 A;  4G2V A;  1IKN D;  1UOH A;  2XEV A;  5JJT A;  2AXV A;  4ILG A;  2AJA A;  2B6C A;  4GTO A;  3KSL A;  2X38 A;  4F1P A;  5KBA A;  2LXM A;  3N71 A;  1FT2 A;  3GYZ A;  3LJN A;  1FT1 A;  1N0Q A;  4XI0 A;  2R59 A;  4GML A;  2DWZ A;  3ZIM A;  3AG3 E;  2V5F A;  1DCE A;  2LO6 A;  2WXF A;  2GRP B;  4JD2 G;  1EF1 C;  4BSZ B;  4LSZ E;  3LY7 A;  5BW8 C;  3AJI A;  4PS7 A;  4GU5 A;  1HG2 A;  1JUQ A;  1H2T C;  2I6H A;  4I9C A;  3EHR A;  3ESL A;  1SZA A;  3DBS A;  2KC7 A;  4J0U A;  4XKC A;  5A23 A;  5LCW J;  1Z3X A;  4A1S A;  4TUM A;  4RSY A;  5T4Y A;  4L23 A;  2C0M A;  3Q75 A;  1FVF A;  3ZRH A;  4JW1 A;  4EPZ A;  3D9N A;  4BSX A;  3R9A B;  4CRW A;  2ZGD A;  5BXO A;  2IO3 C;  2E2E A;  1K3Z D;  3UKR G;  2MRI A;  2WXO A;  3G2V A;  4DLQ A;  1S70 B;  2GRR B;  2OEV A;  2R17 C;  3HXD A;  1WY6 A;  2XGM A;  2LSV A;  4FJZ A;  4W9R A;  4JEH A;  5FQ6 A;  5BUZ A;  1NFI E;  3LDZ A;  3OXG A;  3T5X A;  3JQ0 A;  5D2M C;  1KZO A;  5AAR A;  4I6E A;  2V4H C;  2VSX E;  4UWG A;  2GRO B;  1WDY A;  3G2U A;  1N9A A;  3E32 A;  5CCL A;  1E8X A;  3APD A;  3D9P A;  1ELW A;  2A4Z A;  4O1O A;  4YVQ C;  3SFX A;  4G23 A;  1KT0 A;  4WNF A;  5B1A E;  3CHQ A;  2E0I A;  2WXQ A;  3PRZ A;  5EKQ D;  4DK5 A;  4KMO A;  3D9O A;  2EIM E;  3NAW A;  2RFA A;  3AU4 A;  1O1R A;  2JAB A;  1QZ2 A;  3R9M A;  3AS4 A;  3ZYL A;  1MHQ A;  4FLB A;  4F6R D;  4UI9 K;  2XCB A;  3RSE G;  3FUK A;  3FEY A;  3DST A;  4BTB A;  4BX8 A;  1JCS A;  3OXL A;  1JWF A;  2FI7 A;  4U63 A;  3ZHE B;  2CG2 A;  3NB2 A;  3MV2 B;  1H6K A;  4GTM A;  3TJP A;  4ACL A;  4GZC A;  4J7W A;  4HI8 A;  2RFM A;  4J8S A;  4GTQ A;  1KZP A;  2V4L A;  1Z5S C;  3NZS A;  4EEC A;  2DZO A;  4PDX A;  5LOZ A;  4GZ3 A;  4U0U A;  2IJG X;  5C2Y A;  1HFA A;  2MHK A;  5AIJ A;  2NC9 A;  4OAU C;  3ZU7 B;  3FUH A;  5IY5 E;  4C0M A;  1N54 A;  5KWD A;  2VGE A;  2WVI A;  4O6F A;  1BLX B;  3AG4 E;  5CMY A;  4HOT A;  1HH8 A;  2VGX A;  3BEE A;  2DCP A;  4F53 A;  3Q4A B;  4L1B A;  2DIW A;  3CHO A;  1BI8 B;  2J9Q A;  3IV0 A;  1JPL A;  1O1S A;  2OEW A;  2XQ0 A;  1O1T A;  2CHW A;  5FT9 A;  3D3M A;  3ASF A;  4UI9 C;  4LNG A;  2IOS A;  2NSZ A;  1EYH A;  4I1A A;  3Q47 B;  1V54 E;  3KD7 A;  2WXI A;  2IO2 C;  3FH7 A;  2DBA A;  3EIJ A;  3ONL A;  4LNB A;  3ZW3 A;  4U04 A;  4HQD A;  2J49 A;  3VTX A;  2XRY A;  3CVN A;  3MGB A;  3JYS A;  3FU6 A;  4N3B A;  3LYA A;  4JHK A;  4U8H A;  3D9I A;  2IU1 A;  3OXF A;  5FZQ A;  1TN8 A;  2P9K G;  1H2V C;  4JZY A;  3ZNG A;  5EX0 A;  5BNW A;  1ZBP A;  2XGS A;  4MLP A;  2FO7 A;  3KSQ A;  5FIN A;  2WMN A;  4K0R A;  3TG5 A;  1OCZ E;  5CBO A;  4GZ6 A;  3CQG B;  4GA1 A;  2ILR A;  3DXM G;  3MA5 A;  5HKP A;  5HI7 A;  3DWL G;  4BTA A;  4E85 A;  3DEP A;  3CK8 A;  5EIL A;  1N4P A;  2KZT B;  3PDN A;  4EQF A;  3DXK G;  4HOQ A;  5ARF A;  4GTR A;  4HRN A;  3SQV A;  2BKG A;  3Q9N C;  1D8D A;  3FEX A;  4GZD A;  4CDR A;  5AQ9 A;  5FZS A;  3FU0 A;  3LPZ A;  1IQU A;  1S64 A;  3LEW A;  3RO2 A;  2I1K A;  3MV3 B;  3CSF A;  1IHB A;  3UX4 A;  5EX3 A;  4J8F A;  1ELR A;  2EQX A;  5B1B E;  1LF8 A;  3VLD A;  1BPO A;  2X6H A;  4WWP A;  1SA5 A;  3SBT B;  3ZKJ A;  2J4B A;  2ZIS A;  4GTT A;  5B3S E;  2ETA A;  3ASH A;  5E76 A;  1TEZ A;  3CEQ A;  4AY6 A;  1SA4 A;  4DJA A;  3AAA C;  4N3C A;  4UWL A;  3W9G A;  2KCL A;  3CHR A;  1HG5 A;  3SI5 A;  4GCN A;  2HYZ A;  2KCK A;  4JPS A;  4LNU D;  2XGO A;  4YND A;  2XS8 A;  2BF0 X;  5BXU A;  3S7D A;  3LY8 A;  3TG4 A;  4FLH A;  1HF8 A;  2RKK A;  2HO1 A;  1MYO A;  3FDH A;  2L0T B;  2VYI A;  1JCR A;  2ETC A;  4M3O A;  3AS8 A;  3T8K A;  1O5M A;  3KEZ A;  5JJ6 A;  3B13 A;  3URZ A;  3F6Q A;  3GZ2 A;  3HG0 D;  3UQ3 A;  3MKR A;  3CVY A;  3ASD A;  4FP7 A;  4A63 B;  3UUX A;  2M63 A;  1DCQ A;  5CCM A;  2WQH A;  5KNG A;  1U3C A;  4N39 A;  5ENT D;  2R03 A;  1QQE A;  4XX5 A;  3HIZ A;  1TJC A;  2LXL A;  4PUC A;  3PRE A;  2WXP A;  3BG0 B;  3V2X A;  3S7J A;  4BT8 A;  4GYO A;  3TWT A;  1D9S A;  2KBX A;  3LY9 A;  4FA6 A;  3FP3 A;  3LJ3 A;  2GRN B;  3P1U A;  1KT1 A;  4AJW A;  1JCQ A;  5ENS D;  1H2U A;  4WND A;  5AN8 A;  4ATG A;  3C3R A;  4J8E A;  2R5S A;  3MYV A;  4L2Y A;  1UN8 A;  3UT4 A;  3UT8 A;  2OV8 A;  1E96 B;  4GAA A;  1UG3 A;  1WG0 A;  4NQ0 A;  4APO A;  4LG6 A;  2ZXW E;  5FJY A;  3QC1 A;  4A3V A;  5JMN D;  4TXR A;  3T9K A;  3FUE A;  3FHE A;  5G05 C;  5AJD A;  2FBN A;  5ARG A;  4GMR A;  1MJ0 A;  4EBA A;  2DVW A;  4UWH A;  2VSO E;  3B95 A;  2P9P G;  3RK6 A;  1H6O A;  1H19 A;  3QWP A;  4NUR A;  2Y3A A;  5EN5 D;  3MKQ B;  3WG7 E;  3HXF A;  3JCK C;  3SZ7 A;  3C5R A;  4A3T A;  1VDY A;  2H6H A;  3WXX A;  4TV3 A;  1DNP A;  3TWR A;  5AEN A;  5KCM A;  2L9B A;  2YHE A;  2RG8 A;  3HVE A;  4L9P A;  5BPP A;  2I1J A;  1PY1 A;  5H7P A;  4MS6 A;  2C2L A;  3ZYK A;  4KVM A;  3D9J A;  5FQ7 A;  1L5J A;  4G25 A;  1OCR E;  1TJF A;  5CHE E;  2PQN A;  1YA0 A;  4ATZ D;  3LS8 A;  3T5V A;  1W3B A;  4LCT A;  4C48 B;  4B8A A;  5LP0 A;  5HRY A;  3Q73 A;  2R02 A;  3AG1 E;  2XCC A;  4NRH B;  2LSU A;  3U3W A;  4TXQ A;  2QYU A;  3TXM A;  5BT1 A;  3UIN C;  4RG6 A;  4AM9 A;  2F8X K;  1EPU A;  5FTP A;  2IOL A;  4DLO A;  4GCO A;  4ME2 A;  2WXN A;  4R7L A;  3RIB A;  2XRZ A;  4PH4 B;  2BED A;  2DYR E;  3FU3 A;  2J07 A;  1BU9 A;  1Y8M A;  4C0E A;  3FTX A;  4JL0 A;  3UMV A;  2WQ6 A;  1E90 A;  3QNK A;  2I2O A;  4I9E A;  3PEV B;  4NIK A;  3Q5M A;  4DI3 A;  3BU8 A;  2VGY A;  2J4D A;  3RRN B;  3TAX A;  2MYO A;  4J8Y A;  2P9I G;  3ABK E;  4U0S A;  4YDO A;  2YNQ A;  3PNL B;  3RKV A;  3MCX A;  1RW2 A;  1S0P A;  4UQX A;  2PM6 A;  3UI2 A;  3PUJ A;  3E30 A;  4AP2 A;  4WWO A;  2J09 A;  4GPK A;  5G04 C;  5FWQ A;  3NZU A;  3LVQ E;  3DRA A;  1PAQ A;  3SHF A;  2WMO A;  4H7Y A;  3RRU A;  4YVO A;  1WAO 1;  3FTU A;  1PC2 A;  5ENP D;  4FC8 A;  5J08 A;  3IXE A;  1N4Q A;  3IEG A;  4UWK A;  2VJ8 A;  4RLY A;  3UM1 A;  1YYH A;  3FTW A;  1SZ9 A;  1TR4 A;  3G2S A;  4APF A;  1OXJ A;  4Y6C A;  1B89 A;  4B0Z A;  2FUL A;  4L7T A;  3ML9 A;  5A7D B;  3FY4 A;  2PZI A;  4K03 A;  3DEO A;  2NXP A;  3UKU G;  3QK0 A;  4V3I A;  2ION A;  4B8C B;  5D0O D;  3HXB A;  4BET A;  4JHR A;  2L6B A;  4AEZ C;  4LRZ A;  2XPZ A;  3ZN3 A;  4WUY A;  5J90 A;  4XKB A;  3NQP A;  3QAR A;  1YCS B;  3DPD A;  3ULQ A;  4XIF A;  4ANX A;  4DX6 D;  1OWM A;  4JEU A;  3FTY A;  5KJL A;  3ZXP A;  3PE3 A;  3NOC D;  3QWW A;  4C9B B;  2HE0 A;  1N4S A;  5CEA A;  3UPV A;  3D9M A;  3I5P A;  3BG1 B;  5EID A;  3TWS A;  1OWO A;  3D9H A;  4UQY A;  2IFU A;  3APF A;  2QC9 A;  2KCV A;  3C72 A;  3ONK A;  1XGW A;  4PS8 A;  4JXT A;  4OVV A;  1E7V A;  4MKT A;  3MZL B;  4Q94 A;  3I3N A;  4ZHB A;  4LEU A;  3MX3 A;  1FPP A;  4G8L A;  4EZJ A;  4TUU A;  1IHG A;  1JWG A;  2XZT G;  5FQ4 A;  4DX7 D;  1Q2Z A;  3EJN A;  1INZ A;  5M72 A;  1K8K G;  2AVP A;  1TNO A;  3CGH A;  1IYG A;  1N11 A;  4EHM A;  2GRQ B;  3NF1 A;  3CHP A;  5D0Q D;  3OAW A;  4BEP A;  4UI9 J;  3BUA A;  1IQR A;  4DX2 A;  5ANR A;  3VTY A;  1OWL A;  3UT7 A;  4FU3 A;  4IUL A;  4NAC A;  3PH0 C;  4HRM B;  5KJK A;  2UY1 A;  3I4R B;  4PS3 A;  3LXU X;  2ZGG A;  1U2V G;  2VQ2 A;  2LNI A;  3SFY A;  4OYS A;  2Y4U A;  4FHK A;  5G55 A;  2L0I A;  4J8D A;  4G11 A;  4DX1 A;  4CT0 A;  3MJW A;  4K5B A;  3L22 A;  2YQ8 A;  1Z6T A;  2P58 C;  3GW4 A;  3TWU A;  2WQ7 A;  5AQ7 A;  2FEZ A;  3FUD A;  1YMP A;  2B0O E;  5DBK A;  3R7R A;  2LUH A;  3FUI A;  3PZ3 A;  2IQC A;  3AG2 E;  4N3A A;  5CRU A;  2UWJ G;  4GZ5 A;  3EHM A;  2XZD G;  2V8S E;  5KJM A;  2P9L G;  3TWV A;  1Y6I A;  4CGW A;  1BD8 A;  3SBS A;  3CQC B;  4J6I A;  4RVB A;  4GA2 A;  3CKC A;  2X3M A;  1HX8 A;  1TN6 A;  1NA3 A;  5HS0 A;  2CFU A;  2XEE A;  5EIB E;  2P2C P;  2IY0 C;  4U8Y D;  2KM4 A;  2OVF A;  1E8Z A;  4H7X A;  3S7F A;  2P9S G;  3G2T A;  3CHS A;  5ANL A;  3LCA A;  1QYM A;  2JEK A;  4TXP A;  2XPY A;  2WXL A;  4GTS A;  2X6J A;  3X2Q E;  2J8S D;  5ENR D;  2JLB A;  4I43 A;  1OCC E;  3IHV A;  4WNE A;  1U3D A;  3E33 A;  5AQA A;  2WXM A;  2VTB A;  2A5E A;  3JXI A;  2J08 A;  1OY3 D;  3APC A;  2GW1 A;  3ABM E;  5JJ7 A;  3O4Z A;  1AP7 A;  4DI4 A;  3RJV A;  3Q15 A;  3B7T A;  4F3V A;  1SQM A;  4BX9 A;  5JHB A;  4U07 A;  4G8K A;  2I9C A;  3HXC A;  4IYP A;  3FTZ A;  3L16 A;  2X6K A;  3Q7A A;  4CDN A;  2R05 A;  3EDT B;  2L6J A;  1NL4 A;  4B89 A;  2MOW A;  2YHC A;  3VLF A;  3CK9 A;  3PS6 A;  2ZU6 B;  1SW6 A;  5EDS A;  2CHX A;  4CEM A;  4WNG A;  4GPM A;  3HXE A;  3D9L A;  3HHM A;  4HRL A;  1LTX A;  4MBG A;  3GZ1 A;  3UTM A;  4B94 A;  3QAQ A;  3ZEF A;  2GRL A;  2PQR A;  3TWQ A;  1A17 A;  3ZYQ A;  2HM8 A;  4BES A;  4XE0 A;  1DVP A;  3Q49 B;  4Y6W A;  4RG9 A;  3FTS A;  3CVV A;  1HU3 A;  3FH5 A;  3ML8 A;  4KYO B;  3U4T A;  2OCC E;  5LCW C;  2DZN A;  3PUK A;  3PEU B;  3QJZ A;  3L6A A;  5AQB A;  1MQS A;  3FFL A;  4HOS A;  2KAT A;  4O1P A;  4KZ0 A;  1S63 A;  3U9W A;  3ZGQ A;  4FUL A;  3GZS A;  3FTV A;  3PNT B;  4N2Q A;  2FO1 E;  2F8Y A;  4U96 D;  3EIQ C;  3ASN E;  1G3N B;  1MX4 A;  3HVE B;  1OCO E;  4JC8 A;  2XS1 A;  3L9T A;  2AXZ A;  1HZ4 A;  4RQI A;  1Z3Y A;  4HVB A;  3UM3 A;  4U95 D;  1BI7 B;  3L08 A;  3Q9U C;  4GTV A;  3RO3 A;  3E37 A;  1E8W A;  3DSX A;  3MKQ A;  4ILI A;  3VLE A;  3V31 A;  3HYM B;  1UN9 A;  5CBN A;  5BV1 A;  4KXK B;  3QWV A;  3SO8 A;  3TWW A;  1NA0 A;  2Y4T A;  5FZR A;  3ENE A;  2CG3 A;  4E6H A;  4HOR A;  1K1A A;  4ANU A;  5ENN A;  3V30 A;  4URK A;  5G05 J;  1FVH A;  2CHZ A;  3L13 A;  3K9I A;  2PM7 A;  2PNN A;  1EDU A;  3KS2 A;  3L82 A;  1FCH A;  2F37 A;  2WXH A;  4G1T A;  4TRQ A;  1D8E A;  4OAV B;  1HE8 A;  5CER B;  2X6F A;  3FU5 A;  5KJN A;  1A5E A;  5JA4 D;  4OVU A;  4QQI A;  3W9F A;  1TNB A;  4CYM D;  1ZB1 A;  3Q7F A;  5A6C A;  4AV7 A;  4Q69 A;  4I6J A;  2ETB A;  4K5C A;  4AY5 A;  2AXU A;  5AJL A;  2P9N G;  4IRU A;  4YDW A;  2WM9 A;  2EIN E;  2XEH A;  1UW4 B;  3B7S A;  4XEI G;  3AS5 A;  4D10 C;  4KZC A;  4XZ4 A;  5KNH D;  2LAH A;  4ABN A;  3IHY A;  1H0A A;  2CFZ A;  3ISM C;  2HR2 A;  3FUN A;  3B7B A;  2GRM A;  3J5P A;  5EYP F;  2OVB A;  3SGH A;  4CZ2 D;  2H6I A;  4K5A B;  3ABL E;  3C98 A;  3G2W A;  3SF4 A;  1OWP A;  3PZ1 A;  2BKK B;  2Q7F A;  4UUC A;  3ESK A;  4M7C A;  1ELK A;  4HS2 A;  1ZU2 A;  4EBA G;  4A55 A;  3ASG A;  4GB9 A;  4EZL A;  4AVX A;  4FJY A;  4YDE A;  1DC2 A;  3CVL A;  3EHN A;  1LD8 A;  3PVL A;  5CEC B;  3SY2 A;  3ZHE A;  1X81 A;  1HS6 A;  4BER A;  4GTP A;  4UWF A;  4IN3 B;  4HOU A;  1TNZ A;  2VGX B;  2BUG A;  3U66 A;  3L54 A;  4ACK A;  3J5Q B;  1N4R A;  5G04 J;  1N95 A;  3U64 A;  3CLJ A;  2WXJ A;  1RZ4 A;  1K1B A;  4HBD A;  4U8V D;  4N5C A;  4G26 A;  3NOG D;  2AWI A;  3RAU A;  2QY7 A;  1OT8 A;  1WM5 A;  2ZIR A;  3HRA A;  5ENQ D;  3JXJ A;  3CKB A;  2Y1L E;  4I17 A;  1KPS B;  5ITZ F;  3RRM B;  1OWN A;  1GW6 A;  4F7A A;  2WXK A;  3CHM A;  3Q78 A;  2XHE A;  1TN7 A;  3ZXS A;  2EIK E;  4UQZ A;  3QDN A;  5ENO D;  3PZ4 A;  4DUI A;  3ZUV B;  3PZD A;  3CK7 A;  3SFZ A;  3CVU A;  1MX6 A;  3JUE A;  2BTD A;  2WB2 A;  2XPI A;  3PE4 A;  4N5Q A;  3OTN A;  2WXR A;  4GA0 A;  4X8Q A;  1QNF A;  3R7Q A;  3LVR E;  2EIL E;  3ZVV A;  1TNY A;  3S2A A;  3EHQ A;  5DIZ A;  2P9U G;  5LFA A;  2GGF A;  3V79 K;  2C0L A;  4L2L A;  4YDY A;  3I4G A;  5T3R A;  3RU0 A;  3UM0 A;  2OND A;  2XEN A;  3B7R L;  1OUV A;  3T8M A;  3JUI A;  3C3O A;  5C1D A;  1E8Y A;  3JQ1 A;  3KEA A;  1SVX A;  5JHA A;  4HI9 A;  3BQO A;  5G2N A;  1NZN A;  3HDX A;  4DPR A;  3ZYM A;  3UXG A;  4BWR A;  2UY1 B;  2OOE A;  1P5Q A;  1TYQ G;  3CVX A;  2QFC A;  3FWV A;  2WXG A;  3V2O A;  4FHJ A;  4BT9 A;  3B7U X;  5BV0 A;  4JB8 P;  3CST A;  3ZFW A;  4AOF A;  3CVQ A;  4JHJ A;  5CED B;  2KZT A;  1X5B A;  1E7U A;  3DSU A;  3UIO C;  2V5Q C;  3DSV A;  3D9K A;  4JVS A;  3CV0 A;  3FUJ A;  1AWC B;  3IKO B;  3QOU A;  4GMJ A;  4CCA A;  5HQ8 A;  2YIN A;  3ULY A;  1H6P A;  5FQ8 A;  4HLE A;  4HFG A;  4LER A;  4A1G A;  3DSW A;  4MRU A;  4XI9 A;  2RD0 A;  5D66 A;  2QYJ A;  4HLL A;  4ANV A;  3CIA A;  3DPY A;  3QB2 A;  2LAI A;  3PZ2 A;  2Y0B G;  3TGO A;  4DX5 D;  4KVO A;  3EU5 A;  2FF4 A;  3C3Q A;  4JA7 A;  4ZFH A;  3P2B A;  4DRX E;  4N2S A;  3S7B A;  3CR3 A;  4P29 A;  1UJJ A;  3LKU A;  4BFR A;  4B93 B;  2X6I A;  3ZPJ A;  3O48 A;  3KAE A;  3TL5 A;  4ANW A;  4HXI A;  1MZC A;  1V55 E;  4KBQ A;  5FIO A;  3DSS A;  4U0Z A;  4HNA D;  2H6G A;  4WAF A;  3FUM A;  2VTB B;  2WPV A;  3L17 A;  3E4B A;  2R2L A;  4AXH A;  4U7E B;  3IBE A;  4Z68 A; 
#chains in the Genus database with same CATH homology
 4JC8 A;  2AW6 A;  3SD5 A;  2WMN A;  2AXZ A;  1HZ4 A;  1Z3Y A;  4FC8 A;  4K0R A;  5J08 A;  3TG5 A;  4GYW A;  1HXI A;  4HVB A;  5LX8 A;  1N52 A;  3CQG B;  4GZ6 A;  4GA1 A;  2ILR A;  4I2W A;  3IEG A;  4I6G A;  3L08 A;  3MA5 A;  5HI7 A;  3RO3 A;  1E8W A;  3MKQ A;  4BTA A;  4E85 A;  4ILI A;  4UWK A;  3VLE A;  4CGV A;  4EZK A;  2VJ8 A;  4Q96 A;  3HYM B;  1UN9 A;  3CK8 A;  2V0P A;  5BV1 A;  3FTW A;  4KXK B;  3QWV A;  2KZT B;  3PDN A;  4EQF A;  1NA0 A;  4CDM A;  2Y4T A;  1SZ9 A;  4HOQ A;  5ARF A;  4GYY A;  1XNF A;  5FZR A;  3ENE A;  3G2S A;  2CG3 A;  4E6H A;  4APF A;  4HOR A;  4KT6 B;  3FEX A;  4GZD A;  5AYW D;  4ANU A;  4I1M A;  5ENN A;  4CDR A;  4Y6C A;  4URK A;  1B89 A;  5G05 J;  4B0Z A;  1FVH A;  2FUL A;  5FZS A;  2CHZ A;  3L13 A;  3K9I A;  4G24 A;  4L7T A;  3ML9 A;  2IF4 A;  2PM7 A;  3FU0 A;  3LPZ A;  3FY4 A;  1IQU A;  2PZI A;  5A7D B;  4F1S A;  3LEW A;  3RO2 A;  2I1K A;  4AIF A;  4K03 A;  3MV3 B;  2NXP A;  1KLX A;  1EDU A;  3KS2 A;  3QK0 A;  3CSF A;  4V3I A;  3UX4 A;  5EX3 A;  4CT4 A;  4J8F A;  3QKY A;  2ION A;  1FCH A;  4B8C B;  1ELR A;  2EQX A;  5D0O D;  1HO8 A;  4I2Z A;  1LF8 A;  3VLD A;  1BPO A;  2X6H A;  2WXH A;  4JHR A;  4G1T A;  3FUF A;  4WWP A;  4AEZ C;  4LRZ A;  3AU5 A;  4TRQ A;  2XPZ A;  5T8I A;  3ZN3 A;  4WUY A;  5J90 A;  2VSN A;  3SBT B;  4XKB A;  3NQP A;  4QFV A;  3QAR A;  4FAD A;  2J4B A;  3DPD A;  3TXN A;  1HE8 A;  3SNX A;  3ULQ A;  4XIF A;  2X6F A;  4ANX A;  1OWM A;  3FU5 A;  3CVW A;  2PL2 A;  4JEU A;  3ASH A;  5KJN A;  5E76 A;  1TEZ A;  3FTY A;  2A5U A;  3MEK A;  3CEQ A;  5KJL A;  4AY6 A;  5E75 A;  4OVU A;  4WWN A;  4DJA A;  4I1O B;  3PE3 A;  1UJK A;  4BY6 A;  4N3C A;  4UWL A;  3FH8 A;  3QWW A;  3FUL A;  2VSY A;  4JA9 A;  4C9B B;  4ILH B;  5A6C A;  2KCL A;  3CHR A;  4AV7 A;  4Q69 A;  1HG5 A;  4I6J A;  3SI5 A;  4GCN A;  5CMW A;  2HYZ A;  4AY5 A;  3CVP A;  3UPV A;  3D9M A;  2AXU A;  3I5P A;  5AJL A;  3BG1 B;  4IRU A;  4LUN U;  1OWO A;  1NP7 A;  4G2V A;  4UQY A;  2WM9 A;  2IFU A;  3APF A;  2KCK A;  4JPS A;  2KCV A;  2XEV A;  3ONK A;  5JJT A;  2XGO A;  4YND A;  1UW4 B;  1XGW A;  2AXV A;  3B7S A;  4PS8 A;  4JXT A;  3AS5 A;  4OVV A;  4D10 C;  1E7V A;  4ILG A;  4KZC A;  2BF0 X;  4XZ4 A;  2LAH A;  4MKT A;  4ABN A;  3IHY A;  3MZL B;  1H0A A;  2CFZ A;  4Q94 A;  3LY8 A;  3S7D A;  3TG4 A;  2HR2 A;  3FUN A;  3I3N A;  4LEU A;  2GRM A;  4FLH A;  1HF8 A;  2OVB A;  3MX3 A;  3SGH A;  2HO1 A;  3FDH A;  2X38 A;  2L0T B;  3C98 A;  2VYI A;  3G2W A;  4EZJ A;  3N71 A;  3SF4 A;  3GYZ A;  1OWP A;  4TUU A;  4M3O A;  3AS8 A;  4XI0 A;  2Q7F A;  2R59 A;  1IHG A;  3ESK A;  4GML A;  3KEZ A;  1JWG A;  1ELK A;  4HS2 A;  1ZU2 A;  5FQ4 A;  4EBA G;  5JJ6 A;  3ZIM A;  3B13 A;  4A55 A;  3EJN A;  3ASG A;  1INZ A;  4GB9 A;  4EZL A;  5M72 A;  2AVP A;  3CGH A;  4AVX A;  4FJY A;  3URZ A;  1IYG A;  2V5F A;  3CVL A;  3EHN A;  2LO6 A;  3NF1 A;  2WXF A;  3PVL A;  3CHP A;  3GZ2 A;  5D0Q D;  1EF1 C;  3UQ3 A;  3MKR A;  3CVY A;  3LY7 A;  3ASD A;  4FP7 A;  4MLP A;  3OAW A;  5BW8 C;  2M63 A;  3UUX A;  4PS7 A;  4UI9 J;  3ZHE A;  4GU5 A;  5CCM A;  1IQR A;  2WQH A;  1U3C A;  1HG2 A;  1JUQ A;  4N39 A;  5ANR A;  3VTY A;  1H2T C;  2I6H A;  4I9C A;  3ESL A;  1QQE A;  1OWL A;  1SZA A;  1HS6 A;  3UT7 A;  4FU3 A;  4IUL A;  4UWF A;  4NAC A;  3PH0 C;  3DBS A;  4IN3 B;  4XX5 A;  2KC7 A;  4HOU A;  4J0U A;  4XKC A;  5KJK A;  2UY1 A;  3HIZ A;  5A23 A;  2VGX B;  3I4R B;  5LCW J;  1TJC A;  2BUG A;  3U66 A;  4PUC A;  3PRE A;  3L54 A;  2WXP A;  4PS3 A;  1Z3X A;  4ACK A;  4A1S A;  3LXU X;  3BG0 B;  3S7J A;  4BT8 A;  4GYO A;  5G04 J;  4RSY A;  2VQ2 A;  2LNI A;  5T4Y A;  3LY9 A;  4OYS A;  4L23 A;  4FA6 A;  2C0M A;  1FVF A;  2Y4U A;  3FP3 A;  4FHK A;  3U64 A;  3ZRH A;  3LJ3 A;  4JW1 A;  4EPZ A;  5G55 A;  2L0I A;  3P1U A;  4J8D A;  3D9N A;  1KT1 A;  4BSX A;  3CLJ A;  2WXJ A;  4AJW A;  4G11 A;  1H2U A;  3R9A B;  4WND A;  4CRW A;  4CT0 A;  3MJW A;  4ATG A;  3L22 A;  2E2E A;  2YQ8 A;  1Z6T A;  2MRI A;  2P58 C;  2WXO A;  3G2V A;  3GW4 A;  4N5C A;  4J8E A;  2WQ7 A;  4G26 A;  2FEZ A;  2R5S A;  3MYV A;  2AWI A;  4L2Y A;  4DLQ A;  1UN8 A;  3FUD A;  3UT4 A;  3UT8 A;  2R17 C;  2OV8 A;  1E96 B;  2QY7 A;  1WY6 A;  1UG3 A;  2XGM A;  4GAA A;  5DBK A;  3R7R A;  3FUI A;  2LSV A;  1WM5 A;  4FJZ A;  4W9R A;  2IQC A;  4JEH A;  5FQ6 A;  5BUZ A;  4NQ0 A;  4APO A;  3CKB A;  4N3A A;  2UWJ G;  4GZ5 A;  5FJY A;  3EHM A;  3LDZ A;  3OXG A;  3QC1 A;  2V8S E;  4I17 A;  3T5X A;  4A3V A;  3JQ0 A;  5KJM A;  3RRM B;  1Y6I A;  1OWN A;  4I6E A;  4CGW A;  1GW6 A;  4F7A A;  3SBS A;  3CQC B;  4J6I A;  4RVB A;  4GA2 A;  2VSX E;  4UWG A;  2WXK A;  3CKC A;  2X3M A;  3CHM A;  2XHE A;  1HX8 A;  3FUE A;  3G2U A;  3FHE A;  1NA3 A;  5G05 C;  4UQZ A;  3ZXS A;  5CCL A;  1E8X A;  2CFU A;  3QDN A;  3APD A;  3D9P A;  5AJD A;  1ELW A;  2A4Z A;  2FBN A;  2KM4 A;  2OVF A;  4YVQ C;  5ARG A;  4G23 A;  3PZD A;  1KT0 A;  3CK7 A;  3SFZ A;  1E8Z A;  4EBA A;  4WNF A;  3CVU A;  3CHQ A;  4H7X A;  4UWH A;  3S7F A;  2E0I A;  2WXQ A;  3PRZ A;  2BTD A;  2WB2 A;  2XPI A;  3PE4 A;  2VSO E;  3OTN A;  2WXR A;  3G2T A;  3CHS A;  4GA0 A;  5EKQ D;  1QNF A;  3R7Q A;  5ANL A;  4DK5 A;  4KMO A;  3LVR E;  3D9O A;  3LCA A;  3RK6 A;  3ZVV A;  3AU4 A;  2JEK A;  3S2A A;  5DIZ A;  2XPY A;  1QZ2 A;  2WXL A;  1H19 A;  3AS4 A;  2X6J A;  3ZYL A;  1MHQ A;  2GGF A;  3QWP A;  5LFA A;  2C0L A;  4NUR A;  2Y3A A;  4FLB A;  4L2L A;  3I4G A;  2JLB A;  3MKQ B;  4UI9 K;  2XCB A;  5T3R A;  4I43 A;  3RU0 A;  3FUK A;  3JCK C;  3FEY A;  3IHV A;  3SZ7 A;  4A3T A;  1VDY A;  1U3D A;  4WNE A;  2OND A;  3B7R L;  4BTB A;  3WXX A;  4BX8 A;  2WXM A;  1OUV A;  3T8M A;  2VTB A;  4TV3 A;  1DNP A;  2J08 A;  3JUI A;  3OXL A;  1JWF A;  2FI7 A;  5AEN A;  1E8Y A;  5C1D A;  5KCM A;  4U63 A;  2L9B A;  3APC A;  2GW1 A;  3ZHE B;  3JQ1 A;  2CG2 A;  2YHE A;  2RG8 A;  3MV2 B;  5JJ7 A;  1H6K A;  3HVE A;  3O4Z A;  5BPP A;  3TJP A;  5JHA A;  4ACL A;  4DI4 A;  4GZC A;  5G2N A;  3RJV A;  2I1J A;  1PY1 A;  1NZN A;  3HDX A;  3Q15 A;  4DPR A;  3ZYM A;  4MS6 A;  4BWR A;  3B7T A;  2C2L A;  2UY1 B;  3ZYK A;  2OOE A;  4KVM A;  3D9J A;  1P5Q A;  4F3V A;  1L5J A;  4J8S A;  5FQ7 A;  4G25 A;  3CVX A;  2QFC A;  1TJF A;  1SQM A;  3FWV A;  2PQN A;  5CHE E;  4BX9 A;  5JHB A;  2V4L A;  1YA0 A;  2WXG A;  3LS8 A;  3NZS A;  3T5V A;  4U07 A;  1W3B A;  4FHJ A;  4LCT A;  4BT9 A;  4EEC A;  3B7U X;  2I9C A;  4B8A A;  5LP0 A;  4PDX A;  5BV0 A;  3CST A;  5LOZ A;  4GZ3 A;  4IYP A;  3FTZ A;  4U0U A;  3ZFW A;  3L16 A;  4AOF A;  3CVQ A;  2IJG X;  2X6K A;  4JHJ A;  4CDN A;  2KZT A;  2XCC A;  5C2Y A;  4NRH B;  2LSU A;  1X5B A;  1E7U A;  3U3W A;  1HFA A;  2MHK A;  5AIJ A;  2NC9 A;  3TXM A;  5BT1 A;  3D9K A;  4JVS A;  3FUH A;  3EDT B;  3CV0 A;  4RG6 A;  4AM9 A;  2L6J A;  1EPU A;  4B89 A;  1N54 A;  3FUJ A;  4C0M A;  5FTP A;  2IOL A;  2MOW A;  2WVI A;  2YHC A;  3IKO B;  3QOU A;  4O6F A;  4DLO A;  4GCO A;  3VLF A;  4ME2 A;  3CK9 A;  4GMJ A;  4CCA A;  5HQ8 A;  3PS6 A;  2WXN A;  2YIN A;  4R7L A;  3RIB A;  2XRZ A;  5FQ8 A;  4PH4 B;  2ZU6 B;  5CMY A;  4HOT A;  4HLE A;  4HFG A;  4LER A;  3FU3 A;  2J07 A;  1HH8 A;  3BEE A;  2VGX A;  4A1G A;  2DCP A;  1Y8M A;  5EDS A;  4C0E A;  4MRU A;  4XI9 A;  2RD0 A;  2CHX A;  4CEM A;  4WNG A;  3FTX A;  3Q4A B;  4F53 A;  4JL0 A;  3UMV A;  3D9L A;  4ANV A;  3HHM A;  2WQ6 A;  4L1B A;  3CIA A;  2DIW A;  3QB2 A;  1E90 A;  3QNK A;  2I2O A;  3GZ1 A;  3PEV B;  3CHO A;  4I9E A;  2LAI A;  3Q5M A;  3TGO A;  4DI3 A;  2J9Q A;  3IV0 A;  1JPL A;  2VGY A;  4B94 A;  3QAQ A;  2J4D A;  2XQ0 A;  4KVO A;  3RRN B;  2CHW A;  3TAX A;  5FT9 A;  2FF4 A;  3D3M A;  3ASF A;  3ZEF A;  4UI9 C;  4U0S A;  2GRL A;  2PQR A;  1A17 A;  2YNQ A;  3ZYQ A;  2HM8 A;  3PNL B;  3RKV A;  4JA7 A;  3MCX A;  4XE0 A;  1DVP A;  2IOS A;  3P2B A;  3Q49 B;  2NSZ A;  1EYH A;  4N2S A;  4Y6W A;  4RG9 A;  4I1A A;  3S7B A;  3FTS A;  3Q47 B;  3CVV A;  3KD7 A;  2WXI A;  1HU3 A;  3FH5 A;  1S0P A;  3ML8 A;  3FH7 A;  4KYO B;  3CR3 A;  4P29 A;  1UJJ A;  2PM6 A;  2DBA A;  4UQX A;  3EIJ A;  3PUJ A;  3U4T A;  3LKU A;  4BFR A;  5LCW C;  4AP2 A;  3ONL A;  4WWO A;  2X6I A;  3ZW3 A;  3PUK A;  2J09 A;  3ZPJ A;  4GPK A;  3O48 A;  3KAE A;  3TL5 A;  4U04 A;  4ANW A;  3PEU B;  4HXI A;  3QJZ A;  5G04 C;  2J49 A;  3L6A A;  5FWQ A;  3VTX A;  1MQS A;  3NZU A;  2XRY A;  3CVN A;  3LVQ E;  3FFL A;  3MGB A;  4KBQ A;  4HOS A;  1PAQ A;  3JYS A;  2KAT A;  3SHF A;  4U0Z A;  3FU6 A;  4N3B A;  3LYA A;  4JHK A;  4U8H A;  4WAF A;  3D9I A;  2IU1 A;  3FUM A;  4KZ0 A;  3U9W A;  2WMO A;  3OXF A;  5FZQ A;  3ZGQ A;  4H7Y A;  2VTB B;  3RRU A;  2WPV A;  4FUL A;  3GZS A;  4YVO A;  3L17 A;  3E4B A;  3FTV A;  3PNT B;  1H2V C;  4N2Q A;  4JZY A;  4AXH A;  3EIQ C;  5EX0 A;  1WAO 1;  1ZBP A;  3FTU A;  3IBE A;  5BNW A;  2XGS A;  3HVE B;  1PC2 A;  2FO7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...