3ASGA

Mama d159k mutant 2
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
182
structure length
182
Chain Sequence
b'DIRQVYYRDKGISHAKAGRYSQAVMLLEQVYDADAFDVDVALHLGIAYVKTGAVDRGTELLERSLADAPDNVKVATVLGLTYVQVQKYDLAVPLLIKVAEANPINFNVRFRLGVALKNLGRFDEAIDSFKIALGLRPNEGKVHRAIAFSYEQMGRHEEALPHFKKANELDEGASVELALVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MamA
publication title Self-recognition mechanism of MamA, a magnetosome-associated TPR-containing protein, promotes complex assembly
pubmed doi rcsb
source organism Magnetospirillum magnetotacticum
molecule tags Protein binding
total genus 69
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07719 TPR_2 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
A PF14559 TPR_19 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3asgA01
5EX3A 1HH8A 2VSYA 4GZ3A 4HOUA 4HOSA 4U07A 4J0UA 5BNWA 2KCLA 2HYZA 4UI9J 1Y8MA 5ARGA 5M72A 4JL0A 3EDTB 5D0OD 5FZQA 4A1SA 1E96B 3BEEA 3UQ3A 3TAXA 5HI7A 2KCVA 2FI7A 3RU0A 4UQYA 4WNDA 3TG4A 4AY6A 3HYMB 3S7DA 3AS4A 4N3CA 3IEGA 5EX0A 4NQ0A 2LSVA 4EQFA 3ASHA 2VGXB 2VSNA 2V5FA 4RG9A 4G25A 2E2EA 1KLXA 4XI0A 3LKUA 5KJNA 3RKVA 4U04A 5FTPA 5KJLA 3ASDA 2LSUA 3QKYA 3CVLA 2Y4UA 2BUGA 2IF4A 4N2SA 4BWRA 3Q4AB 5D0QD 3FFLA 3VTYA 3QDNA 5LCWC 4IN3B 3S7FA 3QWWA 4I17A 3MV3B 3RJVA 1HXIA 3Q49B 2VGYA 3GYZA 2XEVA 5FZSA 1A17A 4XI9A 2VYIA 5CHEE 5G05C 4W9RA 3MEKA 4GA2A 4GYYA 4N3BA 4HOTA 1ZBPA 4N2QA 3ULQA 4UQXA 4APOA 2XGOA 3S7BA 4O6FA 4AM9A 4I2ZA 3CV0A 2I6HA 2WQHA 4GYWA 5BW8C 3Q5MA 3ZHEA 4CGVA 5JJ7A 4YVQC 2XPIA 4CDRA 4H7XA 3CK7A 3E4BA 3VTXA 3CVPA 5DBKA 2FO7A 5A7DB 1QZ2A 2P58C 3MKRA 4GPKA 4CGWA 2PL2A 4F3VA 3CK9A 4WNFA 3LYAA 3FWVA 4I9CA 4U0SA 5BT1A 2C0MA 4KBQA 2PQRA 2HR2A 4JA9A 3ZN3A 4KYOB 2OOEA 3TG5A 4WNEA 3PE4A 5AYWD 3K9IA 1ELWA 4N5CA 5G04C 3S7JA 3GZ1A 2QFCA 4BT9A 2AVPA 3CKBA 4HORA 4G23A 3ASGA 4J8EA 5KJMA 3RO2A 3RO3A 2PZIA 3Q15A 3RIBA 1TJCA 2XGSA 4I9EA 5LCWJ 2HO1A 2NC9A 4GZ6A 2DBAA 3PE3A 4Y6CA 5JJ6A 5A6CA 1YA0A 4UQZA 2ONDA 1WAO1 4WUYA 4G1TA 4WNGA 1B89A 2FBNA 3LPZA 3OXLA 3Q47B 1NZNA 5G05J 3AS8A 4LEUA 2J9QA 4YVOA 2LNIA 3U3WA 4UI9K 4I1AA 2YQ8A 3ZFWA 1IYGA 2L6JA 4J8DA 3LY9A 3PDNA 4J8FA 2UY1B 4JA7A 1NA0A 3JYSA 3ASFA 4U0ZA 3U4TA 4GYOA 4JHRA 3LY7A 2FF4A 1KT0A 3LCAA 4GZ5A 2PQNA 4U0UA 4AY5A 2WPVA 2C0LA 4N3AA 2VQ2A 4YNDA 4XIFA 1P5QA 2Q7FA 4ME2A 4G2VA 3UUXA 4GCNA 4G26A 3OXGA 5FJYA 3ZHEB 1NA3A 3SF4A 4GA1A 2GW1A 4B94A 4RG6A 4UI9C 3CVNA 3KS2A 3QOUA 3GW4A 2UWJG 5CCLA 3MA5A 4HOQA 5G04J 3CVQA 3ZGQA 4BT8A 2YHCA 3FP3A 5JJTA 1QQEA 5DIZA 2KCKA 3KD7A 1HZ4A 4BTAA 3CEQA 2IFUA 1IHGA 4AIFA 2VGXA 4NRHB 3AS5A 4GA0A 3ESKA 4Y6WA 5HQ8A 3CKCA 1XNFA 4G24A 4ABNA 5C1DA 3GZ2A 5EKQD 3URZA 3CK8A 2KATA 3ZPJA 2XCCA 3TGOA 1FCHA 5CCMA 2KC7A 5FT9A 4N39A 3OXFA 4GCOA 3MV2B 3QWVA 1ELRA 3O48A 3R9AB 1PC2A 3LY8A 5KJKA 2C2LA 4KXKB 1ZU2A 5FZRA 3WXXA 1OUVA 3KAEA 4BTBA 3N71A 3SZ7A 1WM5A 1W3BA 2JLBA 2MHKA 3QWPA 2UY1A 2XCBA 3UPVA 2XGMA 4H7YA 2FEZA 5ARFA 1KT1A 3NF1A 4I2WA 2Y4TA 2R5SA
chains in the Genus database with same CATH superfamily
5EN5D 3DSVA 3TWVA 3EU5A 4U63A 4ANXA 2ETCA 5HS0A 3APCA 1E90A 3TXNA 4J0UA 5BNWA 4HBDA 2HYZA 3AU4A 1K3ZD 4UI9J 2I2OA 3TJPA 4BX8A 2ILRA 4YDOA 5HRYA 1X81A 2VSXE 4UWLA 2LAIA 4DX6D 2EILE 3X2QE 2MOWA 3IKOB 3MYVA 3UT4A 3ENEA 2FI7A 2KZTA 4WNDA 3MX3A 4QQIA 1IQUA 4AY6A 1RW2A 3HYMB 5IY5E 3IEGA 1U3CA 1U3DA 3VLEA 4GTSA 3CSTA 3KEAA 2LSVA 3RSEG 2RFMA 2OCCE 3ASHA 2J4BA 3B7RL 3ZYKA 4GTTA 3D9NA 5FWQA 3NZSA 2IO3C 3QK0A 5KJNA 2OVFA 4U04A 3FUMA 1V54E 2YNQA 3CLJA 2WVIA 1TJFA 5KJLA 3ASDA 3E32A 4GTOA 2OEVA 4HQDA 2X3MA 1NP7A 4O1PA 5JHAA 2Y4UA 2BUGA 2RG8A 2J08A 2GRNB 3FFLA 2WXGA 3IBEA 3ZYQA 3PNLB 5LFAA 4JHJA 2P9KG 4AP2A 4AOFA 4L2LA 3JXIA 4U95D 4W9RA 4L7TA 5ENOD 4GB9A 2LUHA 1JWFA 4N3BA 4HXIA 2AXZA 2DWZA 3GZSA 4UQXA 3UM2A 4GZCA 1OWNA 4I6EA 5B1BE 2BKKB 1K8KG 3CQCB 4MRUA 3UT7A 5BPPA 4TV3A 3T8KA 5JJ7A 3T8MA 3ULYA 3FH5A 4CDRA 4H7XA 3CK7A 3VTXA 3PRZA 2X6KA 3PEVB 5DBKA 1SW6A 5A7DB 2WXHA 1QZ2A 4PDXA 4GAAA 4I6JA 5CMYA 4F3VA 2CG3A 3CK9A 1FVHA 1LD7A 3LYAA 1DC2A 3FWVA 4A55A 3E34A 3QAQA 4KBQA 4U8YD 3R7QA 4KYOB 3DPYA 3SQVA 3EU9A 5AYWD 3FTWA 3S7JA 1D8EA 4NACA 2IU1A 2XQ0A 4WAFA 2AVPA 2WXFA 4HI9A 2XPZA 3RRNB 2AXUA 3I4RB 3RO3A 2A4ZA 4K5CA 3V30A 4B89A 4DPRA 3KSQA 3DSXA 2ZISA 1E8WA 1HO8A 5LCWJ 4KZCA 3JQ1A 3Q78A 4ANUA 1TN7A 4Y6CA 5A6CA 1DCQA 3I4GA 5T4YA 4JD2G 1N9AA 2PM6A 2ONDA 1WAO1 3FTSA 2DYRE 1H2UA 4WUYA 4E85A 4WNGA 1TNZA 2FBNA 3LPZA 1NZNA 4RLYA 3AS8A 1LD8A 1FVFA 1K1BA 2A5EA 5ENPD 4V3IA 3L16A 4JA7A 3UKRG 1NA0A 4U0ZA 2WMOA 3F6QA 5KBAA 3U4TA 2OEWA 1KT0A 4CZ2D 4DLOA 1AWCB 1E8YA 2PQNA 1N54A 4FA6A 2X6IA 4LCTA 1SQMA 2PM7A 3QJZA 3EHQA 3ML8A 2VQ2A 3NAWA 4YNDA 4JPSA 3APFA 3CQGB 5KWDA 2DVWA 3UUXA 2GRMA 4BY6A 3JUEA 1UN8A 4GCNA 5FJYA 1EPUA 4HRMB 3SGHA 2AJAA 4UI9C 3KS2A 3ESLA 5ENQD 1MX2A 5AARA 4GPMA 4JHKA 2UWJG 1HE8A 3MA5A 4C9BB 1WDYA 4L23A 3FP3A 5ANLA 2R2LA 4BETA 3TWRA 2NSZA 3B7BA 4MBGA 3UTMA 1FT1A 3PNTB 4LG6A 3NB2A 4NURA 2JEKA 4GA0A 3ESKA 4Y6WA 5HQ8A 3ML9A 3CKCA 3CHOA 2WXOA 4DJAA 1NFIE 4K5BA 3IXEA 3URZA 2KATA 5FQ6A 4ILGA 2GRQB 2EIKE 3OXFA 1BU9A 1MHQA 1SA4A 1Z3YA 2P9LG 3LY8A 1SZAA 1LF8A 3DBSA 4KXKB 4WWOA 1ZU2A 5FZRA 3WXXA 5ENSD 4ATGA 3FH8A 3QWPA 2IY0C 3L9TA 3FEYA 2UY1A 3T5VA 1AP7A 3ASNE 3CVWA 1N95A 1KT1A 4I2WA 3D9JA 2Y4TA 4EECA 2WMNA 3CGHA 5BXOA 3E30A 2VSYA 4DLQA 2OVBA 2VTBB 4GMJA 5EYLA 4KT6B 2EINE 4XE0A 2KCLA 1OWLA 3LJNA 3FU0A 3W9GA 4JVSA 4EHMA 2R17C 5ARGA 1N4RA 2AWIA 3MJWA 4LSZE 5FZQA 2WXPA 3BEEA 5CERB 1N11A 1JWGA 2LAHA 4EPZA 1HFAA 3AS4A 4N3CA 2PNNA 4JC8A 4BSXA 1SZ9A 5FINA 3APDA 1N0QA 1PY1A 5JHBA 3ZKJA 5LX8A 5D66A 2VGXB 2VSNA 4RG9A 2L6BA 1N94A 3MKQB 4XI0A 4PH4B 3PREA 4ILIA 3SHFA 2Y69E 1OCZE 5KCMA 3ABLE 1MQSA 2CFUA 2XZDG 3SO8A 3BUAA 5CRUA 3Q4AB 5D0QD 4HRNA 3ABKE 2WXMA 3QDNA 3CVYA 5LCWC 3QC1A 4HFGA 3RJVA 4DX2A 2WXQA 3Q49B 4YDYA 5ENRD 2XRYA 1UW4B 2Y1LE 4UUCA 1UG3A 3P1UA 3ULEG 4XX5A 2GROB 2X38A 3MEKA 4GA2A 3EUVA 5FIOA 1QNFA 4HOTA 1E8XA 3ULQA 4I1MA 4HS2A 1WG0A 3UXGA 1BPOA 3C3OA 3C98A 2L9BA 4FULA 2I6HA 2WQHA 5BW8C 1Z6TA 4CGVA 2HE0A 2IOSA 4FJZA 5FQ7A 4HLEA 3CVPA 3LS8A 4J7WA 1YCSB 5H7PA 3MKRA 4GPKA 2PL2A 2FO1E 3IHVA 1DCEA 4GTVA 1N4PA 3SFYA 2WXRA 4R7LA 2Y3AA 2PQRA 3SNXA 4JA9A 4FHKA 5EYPF 3IV0A 2OOEA 2I1JA 4HI8A 1UJKA 1ELWA 1U2VG 2I9CA 2QFCA 1N0RA 4GU5A 3ASGA 5KJMA 5CRVA 4P29A 3SFZA 2PZIA 2ZU6B 1TJCA 3DSUA 4I9EA 4B0ZA 1HU3A 4G11A 2HM8A 2HO1A 2X6HA 4GTQA 2DBAA 3PE3A 4B8CB 1EF1C 2JABA 2YHEA 3DEPA 4TXQA 5ENNA 4ILHB 3TWUA 3FTXA 2OV8A 3V31A 2J9QA 3ZXSA 4RSYA 3U66A 5B1AE 4N5QA 3ZFWA 5ANRA 3ZU7B 1HG2A 2L6JA 4U96D 5ENTD 3PDNA 2XEHA 4J8FA 4A1GA 2UY1B 3ASFA 1S70B 4K0RA 2BEDA 4EZKA 3Q73A 2FF4A 4AEZC 2VTBA 1GW6A 5ITZF 3SBSA 4N3AA 4DX5D 1DVPA 3CHMA 3CHPA 1JCRA 2Q7FA 3CHRA 4DRXE 3EHMA 4G2VA 1BI7B 3DRAA 3ZEFA 5CECB 3ZHEB 1NA3A 3UX4A 4A63B 4B94A 3MZLB 3RK6A 2P9SG 2IJGX 2BTDA 3O4ZA 3E37A 3G2UA 3L13A 3SFXA 4CCAA 3FUJA 3FUFA 5EIBE 4HOQA 4BESA 2WXJA 4OYSA 3D9PA 1OWOA 1TNOA 1VDYA 3BG0B 1HZ4A 4BTAA 5G55A 3OTNA 2IFUA 1IHGA 1HX8A 2R59A 2VGXA 2A5UA 4UWGA 3MKQA 3DEOA 5J08A 1TNUA 1TN6A 1JUQA 4AJWA 5EKQD 4DX1A 3B13A 3HXFA 2XCCA 4DI4A 5D2MC 3ZRHA 3TGOA 5C2YA 5FT9A 4APFA 3D9LA 5EIDA 3QB2A 3MV2B 1HS6A 4M7CA 4F1SA 4XEIG 3B7UX 1MYOA 2M63A 3QWVA 4Q69A 2XS1A 3Q75A 4C0MA 2RFAA 2P9IG 5JMND 4JEUA 4JW1A 2X6JA 3U9WA 4EBAG 3PZ3A 3N71A 3HXDA 3SZ7A 1WM5A 2QYUA 1W3BA 2MHKA 4CT0A 3SBTB 2XCBA 3UPVA 2BF0X 2XGMA 1Z5SC 2XEEA 3G2TA 4H7YA 4GTPA 1Y6IA 2R5SA 4PS3A 3J5QB 3B7TA 4G8LA 3UM0A 1D9SA 4HOSA 1WY6A 4OAUC 2VJ8A 1NL4A 2WXIA 4CT4A 1SVXA 3FHEA 3E33A 4U8VD 2J4DA 4DK5A 2IONA 4Z68A 3G2VA 5D0OD 1MX4A 4EZJA 1E96B 3RAUA 3RRMB 2ETAA 3ZUVB 1Q2ZA 3UQ3A 3ZXPA 1JCQA 2GGFA 3CHQA 3UMVA 4FHJA 3PZ4A 4UQYA 3TG4A 3V79K 4HLLA 4BEPA 3PZ1A 3HXEA 3S7DA 5AAOA 2CHZA 3FU5A 3TWTA 3C5RA 3UIOC 1IQRA 3EIQC 5B3SE 2WXLA 2XPYA 1K1AA 2V5FA 3D9HA 2DIWA 1UOHA 2H6HA 2E2EA 2QZAA 3ABME 4A3TA 3FULA 4WWNA 1JCSA 4F6RD 3LKUA 1OWMA 3RKVA 3WG7E 5FTPA 4CDMA 1E7UA 4DI3A 2LSUA 3QKYA 1LTXA 2F8YA 2H6FA 4L9PA 3CVLA 3FUHA 4FLHA 4BWRA 4J8YA 3TWXA 1INZA 3NZUA 4WWPA 1TR4A 1FPPA 1ZB1A 2CG2A 3AJIA 4BFRA 3G2SA 4ANWA 2R02A 4IN3B 3S7FA 3QWWA 4I17A 3MV3B 2ZXWE 3PH0C 2XEVA 5FZSA 1A17A 4XI9A 1H2TC 5CHEE 2J09A 3ZVVA 5AIJA 5BV1A 4GTRA 3FTZA 3FU3A 4GYYA 4RVBA 4BERA 2WXNA 3NBNB 4G8KA 3BU8A 4TUUA 2WXKA 2XGOA 5FQ8A 4K03A 2L0IA 5CMWA 2EQXA 5KNHD 5AQBA 4I2ZA 3CV0A 3HXBA 2V4LA 5EDSA 2CFZA 5AENA 3Q5MA 3ZHEA 4FU3A 2XPIA 1TNBA 4KMOA 1Z3XA 4L1BA 2Y0BG 3FUDA 3ZNGA 1A5EA 5T3RA 4CGWA 4IULA 5J90A 2EIME 3ZIMA 3FUIA 2GRPB 2V0PA 1TNYA 3SI5A 3FUNA 5BV0A 4I9CA 3HG0D 3DSTA 3I5PA 3L08A 3ZN3A 3ZW3A 2J07A 3TG5A 4WNEA 3HXCA 3R7RA 3ASOE 3IHYA 3K9IA 3L54A 3UM1A 4N5CA 3CR3A 4XKCA 5T8IA 2ZIRA 3S2AA 3PZ2A 3ONLA 1G3NB 4KVOA 4GMRA 2P9UG 4G23A 4K5AB 3UT8A 4LNUD 3RO2A 1MZCA 1UJJA 3CVVA 3Q15A 3PZDA 3EJNA 2X6FA 2WM9A 4HNAD 3FDHA 2AXVA 1BLXB 4Q94A 2XGSA 4URKA 3QARA 3AG2E 3PEUB 3JUIA 4MLPA 3FEXA 5JJ6A 4UQZA 4BX9A 1B89A 3Q47B 5BUZA 5G05J 4YVOA 2LNIA 4UI9K 4A3VA 2XRZA 1IYGA 3CVXA 4C48B 1S64A 3FTVA 4J8DA 3LY9A 3TWQA 3Q79A 3SD5A 3CVUA 4GYOA 3Q9UC 3LY7A 3ZYLA 4U8HA 1BI8B 3NQPA 4TRQA 2AW6A 4U0UA 3QNKA 2RKKA 4I43A 1SA5A 4CYMD 2QY7A 2P2CP 4ME2A 4QFVA 3C3QA 4CRWA 2RD0A 4HVBA 4G26A 3OXGA 1OCRE 2GW1A 4CEMA 4GMLA 3HHMA 3B7SA 3AG4E 3CVNA 3QOUA 2XZTG 3D3MA 3MGBA 4ACLA 4LNGA 5G04J 3CVQA 2H6GA 3ZGQA 4BT8A 2YHCA 5JJTA 1QQEA 1H6OA 1UN9A 2KCKA 1IKND 3KD7A 4GZDA 4YDEA 3CEQA 3EIJA 4NIKA 5AN8A 4FP7A 1MX6A 4OAVB 5G2NA 4ABNA 5C1DA 1KZPA 3GZ2A 3TWWA 5E75A 2XENA 4I6GA 4F1PA 3HDXA 3I3NA 5CBNA 5CCMA 2KC7A 2H6IA 4GCOA 1X5BA 1H0AA 5HKPA 2LXLA 3R9AB 5KJKA 2C2LA 3AAAC 4PS8A 1MJ0A 2IQCA 1FT2A 2DZOA 3UM3A 1OUVA 5LOZA 2WB2A 2IOLA 2V4HC 3KAEA 4BTBA 2JLBA 5AJLA 1OT8A 3KEZA 1L5JA 3ONKA 3Q7FA 2CHWA 2MYOA 3FY4A 2LO6A 4RQIA 5EX3A 1HH8A 1OCOE 4GZ3A 4HOUA 4TUMA 2R03A 2DYSE 3C3RA 4U07A 3T5XA 2FULA 4BSZB 1Y8MA 1S63A 5M72A 4JL0A 1OWPA 2E0IA 3EDTB 4A1SA 3FTUA 2XS8A 3VLDA 4E6HA 3TAXA 5HI7A 2KCVA 1N52A 3RU0A 3FUEA 2VGEA 3V2XA 2NXPA 3UI2A 3DSSA 3FU6A 5EX0A 4NQ0A 1YYHA 4EQFA 4FLBA 3D9IA 4I1OB 2WQ7A 1N4QA 4G25A 1KLXA 1HF8A 4OVVA 3BQOA 1H6PA 4KVMA 4F53A 5JA4D 2XHEA 3TWSA 4Q96A 4D10C 3RRUA 4YDWA 3HVEB 4UWFA 2IF4A 1O5MA 4UWHA 4N2SA 2LXMA 3L22A 3JQ0A 1TEZA 4TXPA 3VTYA 3UKUG 1HG5A 2J49A 3UINC 1OXJA 4IRUA 3DWLG 1HXIA 3JCKC 2VGYA 3GYZA 4ATZD 3FUKA 2VYIA 4XZ4A 5G05C 1XGWA 2DCPA 3AU5A 5KNGA 3LVQE 1NI1A 1ZBPA 5CEAA 4N2QA 2BKGA 1N4SA 3LEWA 4LUNU 4PUCA 4APOA 4PS7A 4O1OA 2QYJA 3CSFA 4HB5A 3ZYMA 4LERA 3S7BA 4O6FA 3TL5A 4JB8P 4AM9A 2F8XK 3C72A 4UWKA 4GYWA 3LDZA 4YVQC 2GRLA 3E4BA 5FQ4A 4EBAA 1ELKA 2MRIA 2FO7A 2KXPC 2P58C 3HRAA 5AQ7A 4JXTA 4LRZA 4JEHA 4ZFHA 3D9KA 4WNFA 4U0SA 5BT1A 2C0MA 3BG1B 1YMPA 2HR2A 2P9NG 4CDNA 3EHNA 2KZTB 3PVLA 3L17A 5LP0A 3AG3E 4GTMA 1E7VA 1RZ4A 5E76A 1H6KA 2B6CA 3PE4A 1IXVA 2I1KA 3DPDA 3V2OA 4F7AA 2EIJE 4B8AA 5G04C 3GZ1A 2YINA 4BT9A 3MCXA 3CKBA 3ISMC 4HORA 3FH7A 4J8EA 1O1TA 3PUKA 2P9PG 2IEJA 2L0TB 3TXMA 3LJ3A 3RIBA 1H19A 4X8QA 4XKBA 3VLFA 4FJYA 4OVUA 4ANVA 1S0PA 4LNBA 4DX7D 3G2WA 2NC9A 4GZ6A 3EHRA 1TYQG 4ZHBA 1QYMA 4ACKA 1YA0A 2KM4A 3DSWA 1EYHA 3PUJA 3R9MA 3AG1E 4G1TA 4FADA 2R05A 3OXLA 2NYJA 1H2VC 5AQAA 3JXJA 4LEUA 1IHBA 4L2YA 1TN8A 3U3WA 4I1AA 2CHXA 2YQ8A 3NOCD 2V5QC 1KZOA 2GRRB 4AVXA 3JYSA 2B0OE 3FTYA 4TXRA 3OAWA 4JHRA 1E8ZA 3B95A 2ETBA 3LCAA 4GZ5A 4HRLA 4J6IA 3U64A 4AY5A 2WPVA 2C0LA 2V8SE 3J5PA 1QBQA 4O60A 4XIFA 1P5QA 1OCCE 3HIZA 4IYPA 3UIPC 4AV7A 3KSLA 2IO2C 3DXMG 4FC8A 3SF4A 5A23A 4GA1A 3DXKG 2KBXA 4MKTA 4RG6A 5AQ9A 1JPLA 2WQ6A 3CHSA 3GW4A 5CCLA 2VSOE 4JZYA 1PAQA 4AXHA 5BXUA 3D9MA 1EDUA 5DIZA 4AIFA 4KZ0A 1D8DA 4NRHB 3CIAA 1BD8A 3PS6A 2J8SD 1KPSB 3AS5A 3D9OA 4C0EA 5CEDB 1XNFA 2DZNA 4G24A 2ZGDA 3LXUX 4MS6A 3Q9NC 3T9KA 3CK8A 4EZLA 3HVEA 3ZPJA 3NOGD 3P2BA 1V55E 1FCHA 2QC9A 4N39A 5EILA 4J8SA 4U7EB 1ELRA 3L6AA 3O48A 1PC2A 1O1RA 3LVRE 2F0YA 5AJDA 5CBOA 1OY3D 3Q7AA 2F37A 1O1SA 4DUIA 1DNPA 2ZGGA 4B93B 2FEZA 5ARFA 3NF1A 3L82A 4M3OA 3W9FA 3SY2A
chains in the Genus database with same CATH topology
4PS3A 5EX3A 1HH8A 2VSYA 3B7TA 4GZ3A 4HOUA 4U63A 4DLQA 4ANXA 2OVBA 2VTBB 4GMJA 4HOSA 4U07A 1WY6A 3APCA 1E90A 3T5XA 3TXNA 4KT6B 2FULA 2VJ8A 4XE0A 4J0UA 5BNWA 2KCLA 1OWLA 3FU0A 2HYZA 3AU4A 4JVSA 2WXIA 4CT4A 4UI9J 3FHEA 1Y8MA 2R17C 5ARGA 5M72A 2I2OA 3TJPA 4JL0A 2J4DA 1OWPA 2ILRA 4BX8A 4DK5A 2IONA 2AWIA 3MJWA 3G2VA 2E0IA 3EDTB 5D0OD 4EZJA 5FZQA 2WXPA 4A1SA 3FTUA 1E96B 3BEEA 3RRMB 2VSXE 4UWLA 2LAIA 3UQ3A 2MOWA 3VLDA 3IKOB 4E6HA 3MYVA 3UT4A 3TAXA 5HI7A 1JWGA 2KCVA 2LAHA 2GGFA 1N52A 2FI7A 3CHQA 3ENEA 4FHJA 1HFAA 3RU0A 2KZTA 4UQYA 4WNDA 3TG4A 3FUEA 3MX3A 1IQUA 4AY6A 3HYMB 3S7DA 2NXPA 3AS4A 4N3CA 3IEGA 1U3CA 1U3DA 3VLEA 2CHZA 4JC8A 4BSXA 3FU6A 5EX0A 4NQ0A 3CSTA 2LSVA 3FU5A 1SZ9A 3APDA 4EQFA 1PY1A 5JHBA 4FLBA 3D9IA 1IQRA 3EIQC 3ASHA 5LX8A 2WXLA 2XPYA 4I1OB 2VGXB 2VSNA 2J4BA 2V5FA 3B7RL 2DIWA 4RG9A 3ZYKA 2WQ7A 4G25A 2E2EA 1KLXA 1HF8A 3FULA 3MKQB 4OVVA 4A3TA 4WWNA 3D9NA 5FWQA 4XI0A 3NZSA 4PH4B 3QK0A 3LKUA 4KVMA 5KJNA 1OWMA 3RKVA 4F53A 2XHEA 2OVFA 3PREA 4U04A 3FUMA 5FTPA 4CDMA 2YNQA 3CLJA 2WVIA 1TJFA 4ILIA 3SHFA 5KJLA 4Q96A 4D10C 3ASDA 1E7UA 5KCMA 4DI3A 2LSUA 3RRUA 1MQSA 3QKYA 2CFUA 2X3MA 3HVEB 1NP7A 5JHAA 3CVLA 2Y4UA 2BUGA 2RG8A 4UWFA 2IF4A 4UWHA 2J08A 3FUHA 4FLHA 4N2SA 4BWRA 3Q4AB 5D0QD 3L22A 1INZA 3JQ0A 1TEZA 3FFLA 2WXMA 3NZUA 4WWPA 3VTYA 3QDNA 2WXGA 3CVYA 1HG5A 5LCWC 2CG2A 4BFRA 3QC1A 2J49A 3G2SA 3IBEA 4HFGA 4ANWA 4IN3B 3S7FA 3ZYQA 3QWWA 4I17A 3PNLB 5LFAA 4JHJA 3MV3B 3RJVA 2WXQA 4IRUA 1HXIA 3Q49B 2XRYA 3JCKC 1UW4B 2VGYA 3GYZA 3PH0C 4AP2A 4AOFA 4L2LA 1UG3A 2XEVA 5FZSA 1A17A 4XI9A 3FUKA 3P1UA 2VYIA 1H2TC 5CHEE 2J09A 4XX5A 4XZ4A 5G05C 3ZVVA 1XGWA 5AIJA 5BV1A 4W9RA 2X38A 4L7TA 3MEKA 4GA2A 2DCPA 4GB9A 3FTZA 3FU3A 1JWFA 3AU5A 4GYYA 4N3BA 3LVQE 1QNFA 1ZBPA 4HOTA 4HXIA 4RVBA 2AXZA 1E8XA 4N2QA 3ULQA 3LEWA 4LUNU 4I1MA 4HS2A 2WXNA 4PUCA 3GZSA 4UQXA 4APOA 4PS7A 4GZCA 4TUUA 1OWNA 4I6EA 2WXKA 3CSFA 3ZYMA 1BPOA 2XGOA 4LERA 3S7BA 4O6FA 5FQ8A 3C98A 4K03A 2L0IA 5CMWA 2L9BA 3TL5A 3CQCB 2EQXA 4FULA 4AM9A 4I2ZA 3CV0A 4UWKA 2I6HA 4MRUA 2WQHA 4GYWA 5BW8C 2V4LA 3UT7A 5BPPA 2CFZA 3LDZA 5AENA 1Z6TA 4TV3A 5EDSA 3Q5MA 3ZHEA 4CGVA 5JJ7A 3T8MA 4YVQC 4FU3A 2XPIA 3FH5A 2IOSA 4FJZA 4CDRA 4H7XA 4KMOA 5FQ7A 3CK7A 2GRLA 3E4BA 1Z3XA 3VTXA 4EPZA 4HLEA 3PRZA 2X6KA 5FQ4A 4L1BA 3CVPA 1ELKA 3LS8A 3PEVB 4EBAA 5DBKA 2MRIA 3FUDA 2FO7A 5A7DB 2WXHA 1QZ2A 2P58C 3MKRA 5T3RA 4GPKA 4PDXA 4CGWA 4IULA 2PL2A 4JXTA 4LRZA 5J90A 4GAAA 3IHVA 4I6JA 3ZIMA 5CMYA 3FUIA 4JEHA 4F3VA 2CG3A 3CK9A 3D9KA 1FVHA 2V0PA 3LYAA 4WNFA 3FWVA 3SI5A 3FUNA 5BV0A 4I9CA 4U0SA 4A55A 5BT1A 2C0MA 2WXRA 3QAQA 4KBQA 2Y3AA 2PQRA 3BG1B 4R7LA 3I5PA 2HR2A 3SNXA 4JA9A 3R7QA 4CDNA 3L08A 4FHKA 3ZN3A 3EHNA 4KYOB 2KZTB 3PVLA 3IV0A 3L17A 3ZW3A 5LP0A 2OOEA 2I1JA 2J07A 3TG5A 1E7VA 4WNEA 5E76A 1UJKA 1H6KA 3PE4A 5AYWD 2I1KA 3DPDA 3R7RA 3IHYA 3FTWA 3K9IA 3L54A 4B8AA 4F7AA 1ELWA 4N5CA 5G04C 2I9CA 3S7JA 3CR3A 3GZ1A 4XKCA 5T8IA 4NACA 2YINA 2IU1A 2XQ0A 4WAFA 2QFCA 3S2AA 4BT9A 3ONLA 4KVOA 2AVPA 3MCXA 4GU5A 2WXFA 3CKBA 4HORA 4G23A 2XPZA 3FH7A 3ASGA 4J8EA 3RRNB 2AXUA 3UT8A 5KJMA 3I4RB 3RO2A 3PUKA 4P29A 3SFZA 1UJJA 3RO3A 3CVVA 2L0TB 2PZIA 3TXMA 3Q15A 2A4ZA 3LJ3A 3PZDA 2ZU6B 3RIBA 1H19A 2X6FA 1TJCA 2WM9A 3EJNA 3FDHA 2AXVA 4Q94A 4XKBA 2XGSA 3VLFA 4URKA 3QARA 4FJYA 4B89A 4OVUA 4ANVA 4DPRA 1S0PA 3PEUB 1E8WA 4I9EA 3JUIA 4B0ZA 1HO8A 1HU3A 3G2WA 4G11A 5LCWJ 2HM8A 2HO1A 2NC9A 2X6HA 4GZ6A 4KZCA 3JQ1A 4MLPA 2DBAA 3PE3A 4ANUA 4B8CB 4ACKA 3FEXA 4Y6CA 5JJ6A 5A6CA 3I4GA 5T4YA 1YA0A 4UQZA 2PM6A 1EF1C 1WAO1 2ONDA 3FTSA 2KM4A 1H2UA 2YHEA 4BX9A 1EYHA 3PUJA 4WUYA 4FADA 4G1TA 4E85A 4WNGA 1B89A 5ENNA 2FBNA 3LPZA 4ILHB 3OXLA 3Q47B 3FTXA 1NZNA 2OV8A 1H2VC 5BUZA 5G05J 3AS8A 4LEUA 2J9QA 3ZXSA 4YVOA 2LNIA 4L2YA 4RSYA 3U66A 4UI9K 3U3WA 4I1AA 2CHXA 2YQ8A 3ZFWA 1FVFA 4A3VA 5ANRA 2XRZA 1IYGA 3CVXA 1HG2A 3FTVA 2L6JA 4J8DA 3LY9A 3PDNA 4V3IA 4J8FA 3L16A 4A1GA 2UY1B 4JA7A 1NA0A 4AVXA 3JYSA 3SD5A 3ASFA 4U0ZA 2WMOA 3FTYA 4K0RA 3U4TA 3CVUA 4GYOA 4EZKA 3OAWA 4JHRA 1E8ZA 3LY7A 2FF4A 1KT0A 3ZYLA 4U8HA 4DLOA 3LCAA 4GZ5A 4AEZC 3NQPA 2VTBA 1E8YA 1GW6A 2PQNA 4J6IA 1N54A 4TRQA 2AW6A 4U0UA 3U64A 4FA6A 4AY5A 3QNKA 2WPVA 3SBSA 2X6IA 4LCTA 1SQMA 2PM7A 3QJZA 2C0LA 2V8SE 3UMVA 4N3AA 3ML8A 4I43A 2VQ2A 1DVPA 3CHMA 3CHPA 2QY7A 4YNDA 4XIFA 1P5QA 4JPSA 2Q7FA 3APFA 3CHRA 3CQGB 4ME2A 4QFVA 3EHMA 3HIZA 4G2VA 3UUXA 4CRWA 4IYPA 3ZEFA 2RD0A 4AV7A 2GRMA 4HVBA 4BY6A 1UN8A 4G26A 4GCNA 3OXGA 5FJYA 3ZHEB 1NA3A 1EPUA 4FC8A 3SF4A 5A23A 4GA1A 2GW1A 3UX4A 4CEMA 4GMLA 3SGHA 3HHMA 4MKTA 4B94A 3MZLB 3RK6A 3B7SA 4RG6A 4UI9C 3CVNA 2IJGX 2BTDA 3KS2A 3QOUA 1JPLA 3O4ZA 2WQ6A 3ESLA 3D3MA 3CHSA 3G2UA 3MGBA 4ACLA 3GW4A 3L13A 4JHKA 2UWJG 4CCAA 3FUJA 5CCLA 2VSOE 1HE8A 3FUFA 3MA5A 4HOQA 4JZYA 1PAQA 5G04J 4C9BB 4AXHA 2WXJA 3CVQA 3ZGQA 3D9MA 3D9PA 4OYSA 4L23A 4BT8A 1EDUA 2YHCA 3FP3A 5ANLA 5JJTA 1QQEA 1OWOA 5DIZA 1UN9A 2KCKA 1VDYA 3BG0B 3KD7A 4GZDA 1HZ4A 4BTAA 5G55A 3CEQA 3OTNA 2IFUA 3EIJA 1IHGA 1HX8A 2R59A 2NSZA 4AIFA 2VGXA 4KZ0A 4NRHB 2A5UA 4UWGA 3CIAA 4NURA 3PNTB 3MKQA 2JEKA 3PS6A 5J08A 3AS5A 3D9OA 4FP7A 3ESKA 4GA0A 4Y6WA 3FY4A 4C0EA 3ML9A 3CKCA 1JUQA 5HQ8A 1XNFA 3CHOA 5G2NA 2WXOA 4AJWA 4G24A 4ABNA 4DJAA 5C1DA 3GZ2A 5EKQD 5E75A 3LXUX 3URZA 4MS6A 4EZLA 3CK8A 2KATA 3B13A 5FQ6A 3HVEA 3ZPJA 4I6GA 4ILGA 2XCCA 3HDXA 3I3NA 3P2BA 4DI4A 3ZRHA 3TGOA 5C2YA 1FCHA 5CCMA 2KC7A 5FT9A 4N39A 4APFA 3D9LA 3OXFA 3QB2A 1MHQA 4GCOA 3MV2B 1HS6A 4F1SA 3B7UX 1X5BA 1Z3YA 2M63A 3QWVA 4J8SA 4Q69A 1H0AA 1ELRA 3L6AA 3O48A 1PC2A 3R9AB 3LY8A 4C0MA 5KJKA 1SZAA 2C2LA 3LVRE 1LF8A 3DBSA 4KXKB 2R5SA 4WWOA 4PS8A 2IQCA 5AJDA 1ZU2A 5FZRA 3WXXA 4JEUA 1OUVA 4ATGA 4JW1A 2X6JA 5LOZA 2WB2A 2IOLA 3U9WA 3KAEA 4EBAG 4BTBA 3N71A 3SZ7A 3FH8A 1WM5A 1W3BA 2JLBA 2MHKA 3QWPA 1DNPA 5AJLA 3FEYA 2UY1A 4CT0A 3SBTB 2XCBA 3T5VA 3UPVA 2BF0X 2XGMA 3KEZA 1L5JA 3CVWA 3G2TA 4H7YA 2FEZA 3ONKA 5ARFA 1KT1A 3NF1A 4I2WA 2CHWA 4M3OA 3D9JA 2Y4TA 4EECA 2WMNA 1Y6IA 2LO6A 3CGHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EX3 A;  1HH8 A;  2VSY A;  4GZ3 A;  4HOU A;  4HOS A;  4U07 A;  4J0U A;  5BNW A;  2KCL A;  2HYZ A;  4UI9 J;  1Y8M A;  5ARG A;  5M72 A;  4JL0 A;  3EDT B;  5D0O D;  5FZQ A;  4A1S A;  1E96 B;  3BEE A;  3UQ3 A;  3TAX A;  5HI7 A;  2KCV A;  2FI7 A;  3RU0 A;  4UQY A;  4WND A;  3TG4 A;  4AY6 A;  3HYM B;  3S7D A;  3AS4 A;  4N3C A;  3IEG A;  5EX0 A;  4NQ0 A;  2LSV A;  4EQF A;  3ASH A;  2VGX B;  2VSN A;  2V5F A;  4RG9 A;  4G25 A;  2E2E A;  1KLX A;  4XI0 A;  3LKU A;  5KJN A;  3RKV A;  4U04 A;  5FTP A;  5KJL A;  3ASD A;  2LSU A;  3QKY A;  3CVL A;  2Y4U A;  2BUG A;  2IF4 A;  4N2S A;  4BWR A;  3Q4A B;  5D0Q D;  3FFL A;  3VTY A;  3QDN A;  5LCW C;  4IN3 B;  3S7F A;  3QWW A;  4I17 A;  3MV3 B;  3RJV A;  1HXI A;  3Q49 B;  2VGY A;  3GYZ A;  2XEV A;  5FZS A;  1A17 A;  4XI9 A;  2VYI A;  5CHE E;  5G05 C;  4W9R A;  3MEK A;  4GA2 A;  4GYY A;  4N3B A;  4HOT A;  1ZBP A;  4N2Q A;  3ULQ A;  4UQX A;  4APO A;  2XGO A;  3S7B A;  4O6F A;  4AM9 A;  4I2Z A;  3CV0 A;  2I6H A;  2WQH A;  4GYW A;  5BW8 C;  3Q5M A;  3ZHE A;  4CGV A;  5JJ7 A;  4YVQ C;  2XPI A;  4CDR A;  4H7X A;  3CK7 A;  3E4B A;  3VTX A;  3CVP A;  5DBK A;  2FO7 A;  5A7D B;  1QZ2 A;  2P58 C;  3MKR A;  4GPK A;  4CGW A;  2PL2 A;  4F3V A;  3CK9 A;  4WNF A;  3LYA A;  3FWV A;  4I9C A;  4U0S A;  5BT1 A;  2C0M A;  4KBQ A;  2PQR A;  2HR2 A;  4JA9 A;  3ZN3 A;  4KYO B;  2OOE A;  3TG5 A;  4WNE A;  3PE4 A;  5AYW D;  3K9I A;  1ELW A;  4N5C A;  5G04 C;  3S7J A;  3GZ1 A;  2QFC A;  4BT9 A;  2AVP A;  3CKB A;  4HOR A;  4G23 A;  3ASG A;  4J8E A;  5KJM A;  3RO2 A;  3RO3 A;  2PZI A;  3Q15 A;  3RIB A;  1TJC A;  2XGS A;  4I9E A;  5LCW J;  2HO1 A;  2NC9 A;  4GZ6 A;  2DBA A;  3PE3 A;  4Y6C A;  5JJ6 A;  5A6C A;  1YA0 A;  4UQZ A;  2OND A;  1WAO 1;  4WUY A;  4G1T A;  4WNG A;  1B89 A;  2FBN A;  3LPZ A;  3OXL A;  3Q47 B;  1NZN A;  5G05 J;  3AS8 A;  4LEU A;  2J9Q A;  4YVO A;  2LNI A;  3U3W A;  4UI9 K;  4I1A A;  2YQ8 A;  3ZFW A;  1IYG A;  2L6J A;  4J8D A;  3LY9 A;  3PDN A;  4J8F A;  2UY1 B;  4JA7 A;  1NA0 A;  3JYS A;  3ASF A;  4U0Z A;  3U4T A;  4GYO A;  4JHR A;  3LY7 A;  2FF4 A;  1KT0 A;  3LCA A;  4GZ5 A;  2PQN A;  4U0U A;  4AY5 A;  2WPV A;  2C0L A;  4N3A A;  2VQ2 A;  4YND A;  4XIF A;  1P5Q A;  2Q7F A;  4ME2 A;  4G2V A;  3UUX A;  4GCN A;  4G26 A;  3OXG A;  5FJY A;  3ZHE B;  1NA3 A;  3SF4 A;  4GA1 A;  2GW1 A;  4B94 A;  4RG6 A;  4UI9 C;  3CVN A;  3KS2 A;  3QOU A;  3GW4 A;  2UWJ G;  5CCL A;  3MA5 A;  4HOQ A;  5G04 J;  3CVQ A;  3ZGQ A;  4BT8 A;  2YHC A;  3FP3 A;  5JJT A;  1QQE A;  5DIZ A;  2KCK A;  3KD7 A;  1HZ4 A;  4BTA A;  3CEQ A;  2IFU A;  1IHG A;  4AIF A;  2VGX A;  4NRH B;  3AS5 A;  4GA0 A;  3ESK A;  4Y6W A;  5HQ8 A;  3CKC A;  1XNF A;  4G24 A;  4ABN A;  5C1D A;  3GZ2 A;  5EKQ D;  3URZ A;  3CK8 A;  2KAT A;  3ZPJ A;  2XCC A;  3TGO A;  1FCH A;  5CCM A;  2KC7 A;  5FT9 A;  4N39 A;  3OXF A;  4GCO A;  3MV2 B;  3QWV A;  1ELR A;  3O48 A;  3R9A B;  1PC2 A;  3LY8 A;  5KJK A;  2C2L A;  4KXK B;  1ZU2 A;  5FZR A;  3WXX A;  1OUV A;  3KAE A;  4BTB A;  3N71 A;  3SZ7 A;  1WM5 A;  1W3B A;  2JLB A;  2MHK A;  3QWP A;  2UY1 A;  2XCB A;  3UPV A;  2XGM A;  4H7Y A;  2FEZ A;  5ARF A;  1KT1 A;  3NF1 A;  4I2W A;  2Y4T A;  2R5S A; 
#chains in the Genus database with same CATH topology
 5EN5 D;  3DSV A;  3TWV A;  3EU5 A;  4U63 A;  4ANX A;  2ETC A;  5HS0 A;  3APC A;  1E90 A;  3TXN A;  4J0U A;  5BNW A;  4HBD A;  2HYZ A;  3AU4 A;  1K3Z D;  4UI9 J;  2I2O A;  3TJP A;  4BX8 A;  2ILR A;  4YDO A;  5HRY A;  1X81 A;  2VSX E;  4UWL A;  2LAI A;  4DX6 D;  2EIL E;  3X2Q E;  2MOW A;  3IKO B;  3MYV A;  3UT4 A;  3ENE A;  2FI7 A;  2KZT A;  4WND A;  3MX3 A;  4QQI A;  1IQU A;  4AY6 A;  1RW2 A;  3HYM B;  5IY5 E;  3IEG A;  1U3C A;  1U3D A;  3VLE A;  4GTS A;  3CST A;  3KEA A;  2LSV A;  3RSE G;  2RFM A;  2OCC E;  3ASH A;  2J4B A;  3B7R L;  3ZYK A;  4GTT A;  3D9N A;  5FWQ A;  3NZS A;  2IO3 C;  3QK0 A;  5KJN A;  2OVF A;  4U04 A;  3FUM A;  1V54 E;  2YNQ A;  3CLJ A;  2WVI A;  1TJF A;  5KJL A;  3ASD A;  3E32 A;  4GTO A;  2OEV A;  4HQD A;  2X3M A;  1NP7 A;  4O1P A;  5JHA A;  2Y4U A;  2BUG A;  2RG8 A;  2J08 A;  2GRN B;  3FFL A;  2WXG A;  3IBE A;  3ZYQ A;  3PNL B;  5LFA A;  4JHJ A;  2P9K G;  4AP2 A;  4AOF A;  4L2L A;  3JXI A;  4U95 D;  4W9R A;  4L7T A;  5ENO D;  4GB9 A;  2LUH A;  1JWF A;  4N3B A;  4HXI A;  2AXZ A;  2DWZ A;  3GZS A;  4UQX A;  3UM2 A;  4GZC A;  1OWN A;  4I6E A;  5B1B E;  2BKK B;  1K8K G;  3CQC B;  4MRU A;  3UT7 A;  5BPP A;  4TV3 A;  3T8K A;  5JJ7 A;  3T8M A;  3ULY A;  3FH5 A;  4CDR A;  4H7X A;  3CK7 A;  3VTX A;  3PRZ A;  2X6K A;  3PEV B;  5DBK A;  1SW6 A;  5A7D B;  2WXH A;  1QZ2 A;  4PDX A;  4GAA A;  4I6J A;  5CMY A;  4F3V A;  2CG3 A;  3CK9 A;  1FVH A;  1LD7 A;  3LYA A;  1DC2 A;  3FWV A;  4A55 A;  3E34 A;  3QAQ A;  4KBQ A;  4U8Y D;  3R7Q A;  4KYO B;  3DPY A;  3SQV A;  3EU9 A;  5AYW D;  3FTW A;  3S7J A;  1D8E A;  4NAC A;  2IU1 A;  2XQ0 A;  4WAF A;  2AVP A;  2WXF A;  4HI9 A;  2XPZ A;  3RRN B;  2AXU A;  3I4R B;  3RO3 A;  2A4Z A;  4K5C A;  3V30 A;  4B89 A;  4DPR A;  3KSQ A;  3DSX A;  2ZIS A;  1E8W A;  1HO8 A;  5LCW J;  4KZC A;  3JQ1 A;  3Q78 A;  4ANU A;  1TN7 A;  4Y6C A;  5A6C A;  1DCQ A;  3I4G A;  5T4Y A;  4JD2 G;  1N9A A;  2PM6 A;  2OND A;  1WAO 1;  3FTS A;  2DYR E;  1H2U A;  4WUY A;  4E85 A;  4WNG A;  1TNZ A;  2FBN A;  3LPZ A;  1NZN A;  4RLY A;  3AS8 A;  1LD8 A;  1FVF A;  1K1B A;  2A5E A;  5ENP D;  4V3I A;  3L16 A;  4JA7 A;  3UKR G;  1NA0 A;  4U0Z A;  2WMO A;  3F6Q A;  5KBA A;  3U4T A;  2OEW A;  1KT0 A;  4CZ2 D;  4DLO A;  1AWC B;  1E8Y A;  2PQN A;  1N54 A;  4FA6 A;  2X6I A;  4LCT A;  1SQM A;  2PM7 A;  3QJZ A;  3EHQ A;  3ML8 A;  2VQ2 A;  3NAW A;  4YND A;  4JPS A;  3APF A;  3CQG B;  5KWD A;  2DVW A;  3UUX A;  2GRM A;  4BY6 A;  3JUE A;  1UN8 A;  4GCN A;  5FJY A;  1EPU A;  4HRM B;  3SGH A;  2AJA A;  4UI9 C;  3KS2 A;  3ESL A;  5ENQ D;  1MX2 A;  5AAR A;  4GPM A;  4JHK A;  2UWJ G;  1HE8 A;  3MA5 A;  4C9B B;  1WDY A;  4L23 A;  3FP3 A;  5ANL A;  2R2L A;  4BET A;  3TWR A;  2NSZ A;  3B7B A;  4MBG A;  3UTM A;  1FT1 A;  3PNT B;  4LG6 A;  3NB2 A;  4NUR A;  2JEK A;  4GA0 A;  3ESK A;  4Y6W A;  5HQ8 A;  3ML9 A;  3CKC A;  3CHO A;  2WXO A;  4DJA A;  1NFI E;  4K5B A;  3IXE A;  3URZ A;  2KAT A;  5FQ6 A;  4ILG A;  2GRQ B;  2EIK E;  3OXF A;  1BU9 A;  1MHQ A;  1SA4 A;  1Z3Y A;  2P9L G;  3LY8 A;  1SZA A;  1LF8 A;  3DBS A;  4KXK B;  4WWO A;  1ZU2 A;  5FZR A;  3WXX A;  5ENS D;  4ATG A;  3FH8 A;  3QWP A;  2IY0 C;  3L9T A;  3FEY A;  2UY1 A;  3T5V A;  1AP7 A;  3ASN E;  3CVW A;  1N95 A;  1KT1 A;  4I2W A;  3D9J A;  2Y4T A;  4EEC A;  2WMN A;  3CGH A;  5BXO A;  3E30 A;  2VSY A;  4DLQ A;  2OVB A;  2VTB B;  4GMJ A;  5EYL A;  4KT6 B;  2EIN E;  4XE0 A;  2KCL A;  1OWL A;  3LJN A;  3FU0 A;  3W9G A;  4JVS A;  4EHM A;  2R17 C;  5ARG A;  1N4R A;  2AWI A;  3MJW A;  4LSZ E;  5FZQ A;  2WXP A;  3BEE A;  5CER B;  1N11 A;  1JWG A;  2LAH A;  4EPZ A;  1HFA A;  3AS4 A;  4N3C A;  2PNN A;  4JC8 A;  4BSX A;  1SZ9 A;  5FIN A;  3APD A;  1N0Q A;  1PY1 A;  5JHB A;  3ZKJ A;  5LX8 A;  5D66 A;  2VGX B;  2VSN A;  4RG9 A;  2L6B A;  1N94 A;  3MKQ B;  4XI0 A;  4PH4 B;  3PRE A;  4ILI A;  3SHF A;  2Y69 E;  1OCZ E;  5KCM A;  3ABL E;  1MQS A;  2CFU A;  2XZD G;  3SO8 A;  3BUA A;  5CRU A;  3Q4A B;  5D0Q D;  4HRN A;  3ABK E;  2WXM A;  3QDN A;  3CVY A;  5LCW C;  3QC1 A;  4HFG A;  3RJV A;  4DX2 A;  2WXQ A;  3Q49 B;  4YDY A;  5ENR D;  2XRY A;  1UW4 B;  2Y1L E;  4UUC A;  1UG3 A;  3P1U A;  3ULE G;  4XX5 A;  2GRO B;  2X38 A;  3MEK A;  4GA2 A;  3EUV A;  5FIO A;  1QNF A;  4HOT A;  1E8X A;  3ULQ A;  4I1M A;  4HS2 A;  1WG0 A;  3UXG A;  1BPO A;  3C3O A;  3C98 A;  2L9B A;  4FUL A;  2I6H A;  2WQH A;  5BW8 C;  1Z6T A;  4CGV A;  2HE0 A;  2IOS A;  4FJZ A;  5FQ7 A;  4HLE A;  3CVP A;  3LS8 A;  4J7W A;  1YCS B;  5H7P A;  3MKR A;  4GPK A;  2PL2 A;  2FO1 E;  3IHV A;  1DCE A;  4GTV A;  1N4P A;  3SFY A;  2WXR A;  4R7L A;  2Y3A A;  2PQR A;  3SNX A;  4JA9 A;  4FHK A;  5EYP F;  3IV0 A;  2OOE A;  2I1J A;  4HI8 A;  1UJK A;  1ELW A;  1U2V G;  2I9C A;  2QFC A;  1N0R A;  4GU5 A;  3ASG A;  5KJM A;  5CRV A;  4P29 A;  3SFZ A;  2PZI A;  2ZU6 B;  1TJC A;  3DSU A;  4I9E A;  4B0Z A;  1HU3 A;  4G11 A;  2HM8 A;  2HO1 A;  2X6H A;  4GTQ A;  2DBA A;  3PE3 A;  4B8C B;  1EF1 C;  2JAB A;  2YHE A;  3DEP A;  4TXQ A;  5ENN A;  4ILH B;  3TWU A;  3FTX A;  2OV8 A;  3V31 A;  2J9Q A;  3ZXS A;  4RSY A;  3U66 A;  5B1A E;  4N5Q A;  3ZFW A;  5ANR A;  3ZU7 B;  1HG2 A;  2L6J A;  4U96 D;  5ENT D;  3PDN A;  2XEH A;  4J8F A;  4A1G A;  2UY1 B;  3ASF A;  1S70 B;  4K0R A;  2BED A;  4EZK A;  3Q73 A;  2FF4 A;  4AEZ C;  2VTB A;  1GW6 A;  5ITZ F;  3SBS A;  4N3A A;  4DX5 D;  1DVP A;  3CHM A;  3CHP A;  1JCR A;  2Q7F A;  3CHR A;  4DRX E;  3EHM A;  4G2V A;  1BI7 B;  3DRA A;  3ZEF A;  5CEC B;  3ZHE B;  1NA3 A;  3UX4 A;  4A63 B;  4B94 A;  3MZL B;  3RK6 A;  2P9S G;  2IJG X;  2BTD A;  3O4Z A;  3E37 A;  3G2U A;  3L13 A;  3SFX A;  4CCA A;  3FUJ A;  3FUF A;  5EIB E;  4HOQ A;  4BES A;  2WXJ A;  4OYS A;  3D9P A;  1OWO A;  1TNO A;  1VDY A;  3BG0 B;  1HZ4 A;  4BTA A;  5G55 A;  3OTN A;  2IFU A;  1IHG A;  1HX8 A;  2R59 A;  2VGX A;  2A5U A;  4UWG A;  3MKQ A;  3DEO A;  5J08 A;  1TNU A;  1TN6 A;  1JUQ A;  4AJW A;  5EKQ D;  4DX1 A;  3B13 A;  3HXF A;  2XCC A;  4DI4 A;  5D2M C;  3ZRH A;  3TGO A;  5C2Y A;  5FT9 A;  4APF A;  3D9L A;  5EID A;  3QB2 A;  3MV2 B;  1HS6 A;  4M7C A;  4F1S A;  4XEI G;  3B7U X;  1MYO A;  2M63 A;  3QWV A;  4Q69 A;  2XS1 A;  3Q75 A;  4C0M A;  2RFA A;  2P9I G;  5JMN D;  4JEU A;  4JW1 A;  2X6J A;  3U9W A;  4EBA G;  3PZ3 A;  3N71 A;  3HXD A;  3SZ7 A;  1WM5 A;  2QYU A;  1W3B A;  2MHK A;  4CT0 A;  3SBT B;  2XCB A;  3UPV A;  2BF0 X;  2XGM A;  1Z5S C;  2XEE A;  3G2T A;  4H7Y A;  4GTP A;  1Y6I A;  2R5S A;  4PS3 A;  3J5Q B;  3B7T A;  4G8L A;  3UM0 A;  1D9S A;  4HOS A;  1WY6 A;  4OAU C;  2VJ8 A;  1NL4 A;  2WXI A;  4CT4 A;  1SVX A;  3FHE A;  3E33 A;  4U8V D;  2J4D A;  4DK5 A;  2ION A;  4Z68 A;  3G2V A;  5D0O D;  1MX4 A;  4EZJ A;  1E96 B;  3RAU A;  3RRM B;  2ETA A;  3ZUV B;  1Q2Z A;  3UQ3 A;  3ZXP A;  1JCQ A;  2GGF A;  3CHQ A;  3UMV A;  4FHJ A;  3PZ4 A;  4UQY A;  3TG4 A;  3V79 K;  4HLL A;  4BEP A;  3PZ1 A;  3HXE A;  3S7D A;  5AAO A;  2CHZ A;  3FU5 A;  3TWT A;  3C5R A;  3UIO C;  1IQR A;  3EIQ C;  5B3S E;  2WXL A;  2XPY A;  1K1A A;  2V5F A;  3D9H A;  2DIW A;  1UOH A;  2H6H A;  2E2E A;  2QZA A;  3ABM E;  4A3T A;  3FUL A;  4WWN A;  1JCS A;  4F6R D;  3LKU A;  1OWM A;  3RKV A;  3WG7 E;  5FTP A;  4CDM A;  1E7U A;  4DI3 A;  2LSU A;  3QKY A;  1LTX A;  2F8Y A;  2H6F A;  4L9P A;  3CVL A;  3FUH A;  4FLH A;  4BWR A;  4J8Y A;  3TWX A;  1INZ A;  3NZU A;  4WWP A;  1TR4 A;  1FPP A;  1ZB1 A;  2CG2 A;  3AJI A;  4BFR A;  3G2S A;  4ANW A;  2R02 A;  4IN3 B;  3S7F A;  3QWW A;  4I17 A;  3MV3 B;  2ZXW E;  3PH0 C;  2XEV A;  5FZS A;  1A17 A;  4XI9 A;  1H2T C;  5CHE E;  2J09 A;  3ZVV A;  5AIJ A;  5BV1 A;  4GTR A;  3FTZ A;  3FU3 A;  4GYY A;  4RVB A;  4BER A;  2WXN A;  3NBN B;  4G8K A;  3BU8 A;  4TUU A;  2WXK A;  2XGO A;  5FQ8 A;  4K03 A;  2L0I A;  5CMW A;  2EQX A;  5KNH D;  5AQB A;  4I2Z A;  3CV0 A;  3HXB A;  2V4L A;  5EDS A;  2CFZ A;  5AEN A;  3Q5M A;  3ZHE A;  4FU3 A;  2XPI A;  1TNB A;  4KMO A;  1Z3X A;  4L1B A;  2Y0B G;  3FUD A;  3ZNG A;  1A5E A;  5T3R A;  4CGW A;  4IUL A;  5J90 A;  2EIM E;  3ZIM A;  3FUI A;  2GRP B;  2V0P A;  1TNY A;  3SI5 A;  3FUN A;  5BV0 A;  4I9C A;  3HG0 D;  3DST A;  3I5P A;  3L08 A;  3ZN3 A;  3ZW3 A;  2J07 A;  3TG5 A;  4WNE A;  3HXC A;  3R7R A;  3ASO E;  3IHY A;  3K9I A;  3L54 A;  3UM1 A;  4N5C A;  3CR3 A;  4XKC A;  5T8I A;  2ZIR A;  3S2A A;  3PZ2 A;  3ONL A;  1G3N B;  4KVO A;  4GMR A;  2P9U G;  4G23 A;  4K5A B;  3UT8 A;  4LNU D;  3RO2 A;  1MZC A;  1UJJ A;  3CVV A;  3Q15 A;  3PZD A;  3EJN A;  2X6F A;  2WM9 A;  4HNA D;  3FDH A;  2AXV A;  1BLX B;  4Q94 A;  2XGS A;  4URK A;  3QAR A;  3AG2 E;  3PEU B;  3JUI A;  4MLP A;  3FEX A;  5JJ6 A;  4UQZ A;  4BX9 A;  1B89 A;  3Q47 B;  5BUZ A;  5G05 J;  4YVO A;  2LNI A;  4UI9 K;  4A3V A;  2XRZ A;  1IYG A;  3CVX A;  4C48 B;  1S64 A;  3FTV A;  4J8D A;  3LY9 A;  3TWQ A;  3Q79 A;  3SD5 A;  3CVU A;  4GYO A;  3Q9U C;  3LY7 A;  3ZYL A;  4U8H A;  1BI8 B;  3NQP A;  4TRQ A;  2AW6 A;  4U0U A;  3QNK A;  2RKK A;  4I43 A;  1SA5 A;  4CYM D;  2QY7 A;  2P2C P;  4ME2 A;  4QFV A;  3C3Q A;  4CRW A;  2RD0 A;  4HVB A;  4G26 A;  3OXG A;  1OCR E;  2GW1 A;  4CEM A;  4GML A;  3HHM A;  3B7S A;  3AG4 E;  3CVN A;  3QOU A;  2XZT G;  3D3M A;  3MGB A;  4ACL A;  4LNG A;  5G04 J;  3CVQ A;  2H6G A;  3ZGQ A;  4BT8 A;  2YHC A;  5JJT A;  1QQE A;  1H6O A;  1UN9 A;  2KCK A;  1IKN D;  3KD7 A;  4GZD A;  4YDE A;  3CEQ A;  3EIJ A;  4NIK A;  5AN8 A;  4FP7 A;  1MX6 A;  4OAV B;  5G2N A;  4ABN A;  5C1D A;  1KZP A;  3GZ2 A;  3TWW A;  5E75 A;  2XEN A;  4I6G A;  4F1P A;  3HDX A;  3I3N A;  5CBN A;  5CCM A;  2KC7 A;  2H6I A;  4GCO A;  1X5B A;  1H0A A;  5HKP A;  2LXL A;  3R9A B;  5KJK A;  2C2L A;  3AAA C;  4PS8 A;  1MJ0 A;  2IQC A;  1FT2 A;  2DZO A;  3UM3 A;  1OUV A;  5LOZ A;  2WB2 A;  2IOL A;  2V4H C;  3KAE A;  4BTB A;  2JLB A;  5AJL A;  1OT8 A;  3KEZ A;  1L5J A;  3ONK A;  3Q7F A;  2CHW A;  2MYO A;  3FY4 A;  2LO6 A;  4RQI A;  5EX3 A;  1HH8 A;  1OCO E;  4GZ3 A;  4HOU A;  4TUM A;  2R03 A;  2DYS E;  3C3R A;  4U07 A;  3T5X A;  2FUL A;  4BSZ B;  1Y8M A;  1S63 A;  5M72 A;  4JL0 A;  1OWP A;  2E0I A;  3EDT B;  4A1S A;  3FTU A;  2XS8 A;  3VLD A;  4E6H A;  3TAX A;  5HI7 A;  2KCV A;  1N52 A;  3RU0 A;  3FUE A;  2VGE A;  3V2X A;  2NXP A;  3UI2 A;  3DSS A;  3FU6 A;  5EX0 A;  4NQ0 A;  1YYH A;  4EQF A;  4FLB A;  3D9I A;  4I1O B;  2WQ7 A;  1N4Q A;  4G25 A;  1KLX A;  1HF8 A;  4OVV A;  3BQO A;  1H6P A;  4KVM A;  4F53 A;  5JA4 D;  2XHE A;  3TWS A;  4Q96 A;  4D10 C;  3RRU A;  4YDW A;  3HVE B;  4UWF A;  2IF4 A;  1O5M A;  4UWH A;  4N2S A;  2LXM A;  3L22 A;  3JQ0 A;  1TEZ A;  4TXP A;  3VTY A;  3UKU G;  1HG5 A;  2J49 A;  3UIN C;  1OXJ A;  4IRU A;  3DWL G;  1HXI A;  3JCK C;  2VGY A;  3GYZ A;  4ATZ D;  3FUK A;  2VYI A;  4XZ4 A;  5G05 C;  1XGW A;  2DCP A;  3AU5 A;  5KNG A;  3LVQ E;  1NI1 A;  1ZBP A;  5CEA A;  4N2Q A;  2BKG A;  1N4S A;  3LEW A;  4LUN U;  4PUC A;  4APO A;  4PS7 A;  4O1O A;  2QYJ A;  3CSF A;  4HB5 A;  3ZYM A;  4LER A;  3S7B A;  4O6F A;  3TL5 A;  4JB8 P;  4AM9 A;  2F8X K;  3C72 A;  4UWK A;  4GYW A;  3LDZ A;  4YVQ C;  2GRL A;  3E4B A;  5FQ4 A;  4EBA A;  1ELK A;  2MRI A;  2FO7 A;  2KXP C;  2P58 C;  3HRA A;  5AQ7 A;  4JXT A;  4LRZ A;  4JEH A;  4ZFH A;  3D9K A;  4WNF A;  4U0S A;  5BT1 A;  2C0M A;  3BG1 B;  1YMP A;  2HR2 A;  2P9N G;  4CDN A;  3EHN A;  2KZT B;  3PVL A;  3L17 A;  5LP0 A;  3AG3 E;  4GTM A;  1E7V A;  1RZ4 A;  5E76 A;  1H6K A;  2B6C A;  3PE4 A;  1IXV A;  2I1K A;  3DPD A;  3V2O A;  4F7A A;  2EIJ E;  4B8A A;  5G04 C;  3GZ1 A;  2YIN A;  4BT9 A;  3MCX A;  3CKB A;  3ISM C;  4HOR A;  3FH7 A;  4J8E A;  1O1T A;  3PUK A;  2P9P G;  2IEJ A;  2L0T B;  3TXM A;  3LJ3 A;  3RIB A;  1H19 A;  4X8Q A;  4XKB A;  3VLF A;  4FJY A;  4OVU A;  4ANV A;  1S0P A;  4LNB A;  4DX7 D;  3G2W A;  2NC9 A;  4GZ6 A;  3EHR A;  1TYQ G;  4ZHB A;  1QYM A;  4ACK A;  1YA0 A;  2KM4 A;  3DSW A;  1EYH A;  3PUJ A;  3R9M A;  3AG1 E;  4G1T A;  4FAD A;  2R05 A;  3OXL A;  2NYJ A;  1H2V C;  5AQA A;  3JXJ A;  4LEU A;  1IHB A;  4L2Y A;  1TN8 A;  3U3W A;  4I1A A;  2CHX A;  2YQ8 A;  3NOC D;  2V5Q C;  1KZO A;  2GRR B;  4AVX A;  3JYS A;  2B0O E;  3FTY A;  4TXR A;  3OAW A;  4JHR A;  1E8Z A;  3B95 A;  2ETB A;  3LCA A;  4GZ5 A;  4HRL A;  4J6I A;  3U64 A;  4AY5 A;  2WPV A;  2C0L A;  2V8S E;  3J5P A;  1QBQ A;  4O60 A;  4XIF A;  1P5Q A;  1OCC E;  3HIZ A;  4IYP A;  3UIP C;  4AV7 A;  3KSL A;  2IO2 C;  3DXM G;  4FC8 A;  3SF4 A;  5A23 A;  4GA1 A;  3DXK G;  2KBX A;  4MKT A;  4RG6 A;  5AQ9 A;  1JPL A;  2WQ6 A;  3CHS A;  3GW4 A;  5CCL A;  2VSO E;  4JZY A;  1PAQ A;  4AXH A;  5BXU A;  3D9M A;  1EDU A;  5DIZ A;  4AIF A;  4KZ0 A;  1D8D A;  4NRH B;  3CIA A;  1BD8 A;  3PS6 A;  2J8S D;  1KPS B;  3AS5 A;  3D9O A;  4C0E A;  5CED B;  1XNF A;  2DZN A;  4G24 A;  2ZGD A;  3LXU X;  4MS6 A;  3Q9N C;  3T9K A;  3CK8 A;  4EZL A;  3HVE A;  3ZPJ A;  3NOG D;  3P2B A;  1V55 E;  1FCH A;  2QC9 A;  4N39 A;  5EIL A;  4J8S A;  4U7E B;  1ELR A;  3L6A A;  3O48 A;  1PC2 A;  1O1R A;  3LVR E;  2F0Y A;  5AJD A;  5CBO A;  1OY3 D;  3Q7A A;  2F37 A;  1O1S A;  4DUI A;  1DNP A;  2ZGG A;  4B93 B;  2FEZ A;  5ARF A;  3NF1 A;  3L82 A;  4M3O A;  3W9F A;  3SY2 A; 
#chains in the Genus database with same CATH homology
 4PS3 A;  5EX3 A;  1HH8 A;  2VSY A;  3B7T A;  4GZ3 A;  4HOU A;  4U63 A;  4DLQ A;  4ANX A;  2OVB A;  2VTB B;  4GMJ A;  4HOS A;  4U07 A;  1WY6 A;  3APC A;  1E90 A;  3T5X A;  3TXN A;  4KT6 B;  2FUL A;  2VJ8 A;  4XE0 A;  4J0U A;  5BNW A;  2KCL A;  1OWL A;  3FU0 A;  2HYZ A;  3AU4 A;  4JVS A;  2WXI A;  4CT4 A;  4UI9 J;  3FHE A;  1Y8M A;  2R17 C;  5ARG A;  5M72 A;  2I2O A;  3TJP A;  4JL0 A;  2J4D A;  1OWP A;  2ILR A;  4BX8 A;  4DK5 A;  2ION A;  2AWI A;  3MJW A;  3G2V A;  2E0I A;  3EDT B;  5D0O D;  4EZJ A;  5FZQ A;  2WXP A;  4A1S A;  3FTU A;  1E96 B;  3BEE A;  3RRM B;  2VSX E;  4UWL A;  2LAI A;  3UQ3 A;  2MOW A;  3VLD A;  3IKO B;  4E6H A;  3MYV A;  3UT4 A;  3TAX A;  5HI7 A;  1JWG A;  2KCV A;  2LAH A;  2GGF A;  1N52 A;  2FI7 A;  3CHQ A;  3ENE A;  4FHJ A;  1HFA A;  3RU0 A;  2KZT A;  4UQY A;  4WND A;  3TG4 A;  3FUE A;  3MX3 A;  1IQU A;  4AY6 A;  3HYM B;  3S7D A;  2NXP A;  3AS4 A;  4N3C A;  3IEG A;  1U3C A;  1U3D A;  3VLE A;  2CHZ A;  4JC8 A;  4BSX A;  3FU6 A;  5EX0 A;  4NQ0 A;  3CST A;  2LSV A;  3FU5 A;  1SZ9 A;  3APD A;  4EQF A;  1PY1 A;  5JHB A;  4FLB A;  3D9I A;  1IQR A;  3EIQ C;  3ASH A;  5LX8 A;  2WXL A;  2XPY A;  4I1O B;  2VGX B;  2VSN A;  2J4B A;  2V5F A;  3B7R L;  2DIW A;  4RG9 A;  3ZYK A;  2WQ7 A;  4G25 A;  2E2E A;  1KLX A;  1HF8 A;  3FUL A;  3MKQ B;  4OVV A;  4A3T A;  4WWN A;  3D9N A;  5FWQ A;  4XI0 A;  3NZS A;  4PH4 B;  3QK0 A;  3LKU A;  4KVM A;  5KJN A;  1OWM A;  3RKV A;  4F53 A;  2XHE A;  2OVF A;  3PRE A;  4U04 A;  3FUM A;  5FTP A;  4CDM A;  2YNQ A;  3CLJ A;  2WVI A;  1TJF A;  4ILI A;  3SHF A;  5KJL A;  4Q96 A;  4D10 C;  3ASD A;  1E7U A;  5KCM A;  4DI3 A;  2LSU A;  3RRU A;  1MQS A;  3QKY A;  2CFU A;  2X3M A;  3HVE B;  1NP7 A;  5JHA A;  3CVL A;  2Y4U A;  2BUG A;  2RG8 A;  4UWF A;  2IF4 A;  4UWH A;  2J08 A;  3FUH A;  4FLH A;  4N2S A;  4BWR A;  3Q4A B;  5D0Q D;  3L22 A;  1INZ A;  3JQ0 A;  1TEZ A;  3FFL A;  2WXM A;  3NZU A;  4WWP A;  3VTY A;  3QDN A;  2WXG A;  3CVY A;  1HG5 A;  5LCW C;  2CG2 A;  4BFR A;  3QC1 A;  2J49 A;  3G2S A;  3IBE A;  4HFG A;  4ANW A;  4IN3 B;  3S7F A;  3ZYQ A;  3QWW A;  4I17 A;  3PNL B;  5LFA A;  4JHJ A;  3MV3 B;  3RJV A;  2WXQ A;  4IRU A;  1HXI A;  3Q49 B;  2XRY A;  3JCK C;  1UW4 B;  2VGY A;  3GYZ A;  3PH0 C;  4AP2 A;  4AOF A;  4L2L A;  1UG3 A;  2XEV A;  5FZS A;  1A17 A;  4XI9 A;  3FUK A;  3P1U A;  2VYI A;  1H2T C;  5CHE E;  2J09 A;  4XX5 A;  4XZ4 A;  5G05 C;  3ZVV A;  1XGW A;  5AIJ A;  5BV1 A;  4W9R A;  2X38 A;  4L7T A;  3MEK A;  4GA2 A;  2DCP A;  4GB9 A;  3FTZ A;  3FU3 A;  1JWF A;  3AU5 A;  4GYY A;  4N3B A;  3LVQ E;  1QNF A;  1ZBP A;  4HOT A;  4HXI A;  4RVB A;  2AXZ A;  1E8X A;  4N2Q A;  3ULQ A;  3LEW A;  4LUN U;  4I1M A;  4HS2 A;  2WXN A;  4PUC A;  3GZS A;  4UQX A;  4APO A;  4PS7 A;  4GZC A;  4TUU A;  1OWN A;  4I6E A;  2WXK A;  3CSF A;  3ZYM A;  1BPO A;  2XGO A;  4LER A;  3S7B A;  4O6F A;  5FQ8 A;  3C98 A;  4K03 A;  2L0I A;  5CMW A;  2L9B A;  3TL5 A;  3CQC B;  2EQX A;  4FUL A;  4AM9 A;  4I2Z A;  3CV0 A;  4UWK A;  2I6H A;  4MRU A;  2WQH A;  4GYW A;  5BW8 C;  2V4L A;  3UT7 A;  5BPP A;  2CFZ A;  3LDZ A;  5AEN A;  1Z6T A;  4TV3 A;  5EDS A;  3Q5M A;  3ZHE A;  4CGV A;  5JJ7 A;  3T8M A;  4YVQ C;  4FU3 A;  2XPI A;  3FH5 A;  2IOS A;  4FJZ A;  4CDR A;  4H7X A;  4KMO A;  5FQ7 A;  3CK7 A;  2GRL A;  3E4B A;  1Z3X A;  3VTX A;  4EPZ A;  4HLE A;  3PRZ A;  2X6K A;  5FQ4 A;  4L1B A;  3CVP A;  1ELK A;  3LS8 A;  3PEV B;  4EBA A;  5DBK A;  2MRI A;  3FUD A;  2FO7 A;  5A7D B;  2WXH A;  1QZ2 A;  2P58 C;  3MKR A;  5T3R A;  4GPK A;  4PDX A;  4CGW A;  4IUL A;  2PL2 A;  4JXT A;  4LRZ A;  5J90 A;  4GAA A;  3IHV A;  4I6J A;  3ZIM A;  5CMY A;  3FUI A;  4JEH A;  4F3V A;  2CG3 A;  3CK9 A;  3D9K A;  1FVH A;  2V0P A;  3LYA A;  4WNF A;  3FWV A;  3SI5 A;  3FUN A;  5BV0 A;  4I9C A;  4U0S A;  4A55 A;  5BT1 A;  2C0M A;  2WXR A;  3QAQ A;  4KBQ A;  2Y3A A;  2PQR A;  3BG1 B;  4R7L A;  3I5P A;  2HR2 A;  3SNX A;  4JA9 A;  3R7Q A;  4CDN A;  3L08 A;  4FHK A;  3ZN3 A;  3EHN A;  4KYO B;  2KZT B;  3PVL A;  3IV0 A;  3L17 A;  3ZW3 A;  5LP0 A;  2OOE A;  2I1J A;  2J07 A;  3TG5 A;  1E7V A;  4WNE A;  5E76 A;  1UJK A;  1H6K A;  3PE4 A;  5AYW D;  2I1K A;  3DPD A;  3R7R A;  3IHY A;  3FTW A;  3K9I A;  3L54 A;  4B8A A;  4F7A A;  1ELW A;  4N5C A;  5G04 C;  2I9C A;  3S7J A;  3CR3 A;  3GZ1 A;  4XKC A;  5T8I A;  4NAC A;  2YIN A;  2IU1 A;  2XQ0 A;  4WAF A;  2QFC A;  3S2A A;  4BT9 A;  3ONL A;  4KVO A;  2AVP A;  3MCX A;  4GU5 A;  2WXF A;  3CKB A;  4HOR A;  4G23 A;  2XPZ A;  3FH7 A;  3ASG A;  4J8E A;  3RRN B;  2AXU A;  3UT8 A;  5KJM A;  3I4R B;  3RO2 A;  3PUK A;  4P29 A;  3SFZ A;  1UJJ A;  3RO3 A;  3CVV A;  2L0T B;  2PZI A;  3TXM A;  3Q15 A;  2A4Z A;  3LJ3 A;  3PZD A;  2ZU6 B;  3RIB A;  1H19 A;  2X6F A;  1TJC A;  2WM9 A;  3EJN A;  3FDH A;  2AXV A;  4Q94 A;  4XKB A;  2XGS A;  3VLF A;  4URK A;  3QAR A;  4FJY A;  4B89 A;  4OVU A;  4ANV A;  4DPR A;  1S0P A;  3PEU B;  1E8W A;  4I9E A;  3JUI A;  4B0Z A;  1HO8 A;  1HU3 A;  3G2W A;  4G11 A;  5LCW J;  2HM8 A;  2HO1 A;  2NC9 A;  2X6H A;  4GZ6 A;  4KZC A;  3JQ1 A;  4MLP A;  2DBA A;  3PE3 A;  4ANU A;  4B8C B;  4ACK A;  3FEX A;  4Y6C A;  5JJ6 A;  5A6C A;  3I4G A;  5T4Y A;  1YA0 A;  4UQZ A;  2PM6 A;  1EF1 C;  1WAO 1;  2OND A;  3FTS A;  2KM4 A;  1H2U A;  2YHE A;  4BX9 A;  1EYH A;  3PUJ A;  4WUY A;  4FAD A;  4G1T A;  4E85 A;  4WNG A;  1B89 A;  5ENN A;  2FBN A;  3LPZ A;  4ILH B;  3OXL A;  3Q47 B;  3FTX A;  1NZN A;  2OV8 A;  1H2V C;  5BUZ A;  5G05 J;  3AS8 A;  4LEU A;  2J9Q A;  3ZXS A;  4YVO A;  2LNI A;  4L2Y A;  4RSY A;  3U66 A;  4UI9 K;  3U3W A;  4I1A A;  2CHX A;  2YQ8 A;  3ZFW A;  1FVF A;  4A3V A;  5ANR A;  2XRZ A;  1IYG A;  3CVX A;  1HG2 A;  3FTV A;  2L6J A;  4J8D A;  3LY9 A;  3PDN A;  4V3I A;  4J8F A;  3L16 A;  4A1G A;  2UY1 B;  4JA7 A;  1NA0 A;  4AVX A;  3JYS A;  3SD5 A;  3ASF A;  4U0Z A;  2WMO A;  3FTY A;  4K0R A;  3U4T A;  3CVU A;  4GYO A;  4EZK A;  3OAW A;  4JHR A;  1E8Z A;  3LY7 A;  2FF4 A;  1KT0 A;  3ZYL A;  4U8H A;  4DLO A;  3LCA A;  4GZ5 A;  4AEZ C;  3NQP A;  2VTB A;  1E8Y A;  1GW6 A;  2PQN A;  4J6I A;  1N54 A;  4TRQ A;  2AW6 A;  4U0U A;  3U64 A;  4FA6 A;  4AY5 A;  3QNK A;  2WPV A;  3SBS A;  2X6I A;  4LCT A;  1SQM A;  2PM7 A;  3QJZ A;  2C0L A;  2V8S E;  3UMV A;  4N3A A;  3ML8 A;  4I43 A;  2VQ2 A;  1DVP A;  3CHM A;  3CHP A;  2QY7 A;  4YND A;  4XIF A;  1P5Q A;  4JPS A;  2Q7F A;  3APF A;  3CHR A;  3CQG B;  4ME2 A;  4QFV A;  3EHM A;  3HIZ A;  4G2V A;  3UUX A;  4CRW A;  4IYP A;  3ZEF A;  2RD0 A;  4AV7 A;  2GRM A;  4HVB A;  4BY6 A;  1UN8 A;  4G26 A;  4GCN A;  3OXG A;  5FJY A;  3ZHE B;  1NA3 A;  1EPU A;  4FC8 A;  3SF4 A;  5A23 A;  4GA1 A;  2GW1 A;  3UX4 A;  4CEM A;  4GML A;  3SGH A;  3HHM A;  4MKT A;  4B94 A;  3MZL B;  3RK6 A;  3B7S A;  4RG6 A;  4UI9 C;  3CVN A;  2IJG X;  2BTD A;  3KS2 A;  3QOU A;  1JPL A;  3O4Z A;  2WQ6 A;  3ESL A;  3D3M A;  3CHS A;  3G2U A;  3MGB A;  4ACL A;  3GW4 A;  3L13 A;  4JHK A;  2UWJ G;  4CCA A;  3FUJ A;  5CCL A;  2VSO E;  1HE8 A;  3FUF A;  3MA5 A;  4HOQ A;  4JZY A;  1PAQ A;  5G04 J;  4C9B B;  4AXH A;  2WXJ A;  3CVQ A;  3ZGQ A;  3D9M A;  3D9P A;  4OYS A;  4L23 A;  4BT8 A;  1EDU A;  2YHC A;  3FP3 A;  5ANL A;  5JJT A;  1QQE A;  1OWO A;  5DIZ A;  1UN9 A;  2KCK A;  1VDY A;  3BG0 B;  3KD7 A;  4GZD A;  1HZ4 A;  4BTA A;  5G55 A;  3CEQ A;  3OTN A;  2IFU A;  3EIJ A;  1IHG A;  1HX8 A;  2R59 A;  2NSZ A;  4AIF A;  2VGX A;  4KZ0 A;  4NRH B;  2A5U A;  4UWG A;  3CIA A;  4NUR A;  3PNT B;  3MKQ A;  2JEK A;  3PS6 A;  5J08 A;  3AS5 A;  3D9O A;  4FP7 A;  3ESK A;  4GA0 A;  4Y6W A;  3FY4 A;  4C0E A;  3ML9 A;  3CKC A;  1JUQ A;  5HQ8 A;  1XNF A;  3CHO A;  5G2N A;  2WXO A;  4AJW A;  4G24 A;  4ABN A;  4DJA A;  5C1D A;  3GZ2 A;  5EKQ D;  5E75 A;  3LXU X;  3URZ A;  4MS6 A;  4EZL A;  3CK8 A;  2KAT A;  3B13 A;  5FQ6 A;  3HVE A;  3ZPJ A;  4I6G A;  4ILG A;  2XCC A;  3HDX A;  3I3N A;  3P2B A;  4DI4 A;  3ZRH A;  3TGO A;  5C2Y A;  1FCH A;  5CCM A;  2KC7 A;  5FT9 A;  4N39 A;  4APF A;  3D9L A;  3OXF A;  3QB2 A;  1MHQ A;  4GCO A;  3MV2 B;  1HS6 A;  4F1S A;  3B7U X;  1X5B A;  1Z3Y A;  2M63 A;  3QWV A;  4J8S A;  4Q69 A;  1H0A A;  1ELR A;  3L6A A;  3O48 A;  1PC2 A;  3R9A B;  3LY8 A;  4C0M A;  5KJK A;  1SZA A;  2C2L A;  3LVR E;  1LF8 A;  3DBS A;  4KXK B;  2R5S A;  4WWO A;  4PS8 A;  2IQC A;  5AJD A;  1ZU2 A;  5FZR A;  3WXX A;  4JEU A;  1OUV A;  4ATG A;  4JW1 A;  2X6J A;  5LOZ A;  2WB2 A;  2IOL A;  3U9W A;  3KAE A;  4EBA G;  4BTB A;  3N71 A;  3SZ7 A;  3FH8 A;  1WM5 A;  1W3B A;  2JLB A;  2MHK A;  3QWP A;  1DNP A;  5AJL A;  3FEY A;  2UY1 A;  4CT0 A;  3SBT B;  2XCB A;  3T5V A;  3UPV A;  2BF0 X;  2XGM A;  3KEZ A;  1L5J A;  3CVW A;  3G2T A;  4H7Y A;  2FEZ A;  3ONK A;  5ARF A;  1KT1 A;  3NF1 A;  4I2W A;  2CHW A;  4M3O A;  3D9J A;  2Y4T A;  4EEC A;  2WMN A;  1Y6I A;  2LO6 A;  3CGH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...