3ASMA

Crystal structure of q54a mutant protein of bst-rnase hiii
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
308
structure length
308
Chain Sequence
SNYVIQADQQLLDALRAHYEGALSDRLPAGALFAVKRPDVVITAYRSGKVLFAGKAAEQEAAKWISGASASNETADHQPSALAAHQLGSLSAIGSDEVGTGDYFGPIVVAAAYVDRPHIAKIAALGVKDSKQLNDEAIKRIAPAIMETVPHAVTVLDNPQYNRWQRSGMPQTKMKALLHNRTLVKLVDAIAPAEPEAIIIDEFLKRDSYFRYLSDEDRIIRERVHCLPKAESVHVSVAAASIIARYVFLEEMEQLSRAVGLLLPKGAGAIVDEAAARIIRARGEEMLETCAKLHFANTKKALAIAKRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HIII
publication title Identification of the substrate binding site in the N-terminal TBP-like domain of RNase H3.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 100
structure length 308
sequence length 308
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2010-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
A PF11858 DUF3378 Domain of unknown function (DUF3378)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3asmA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3asmA02
3NGIA 4F3OA 4PY5A 1S1UA 2IGIA 2YKNA 4DQQA 2OPRA 4KB0A 4OGEA 4HHTA 2FBYA 4CEBA 5I42A 1TKXA 3AVNA 1KYUA 2ZQBA 1JL2A 1REVA 3RMBA 4M3UA 1LAVA 4Z4EA 2HW3A 2X74A 3QIOA 4LH4A 1WAFA 3VN5A 2DFHA 1L3UA 4DG1A 2OZSA 2NUBA 3VQDA 1BI4B 3G0ZA 2G8VA 1BCMA 4E7IA 4AHCA 1MU2A 3O4NA 4JS5A 3V9SA 1NK6A 4PWDA 2G8KA 2Y1JA 1ZYQA 3VQ7A 1WSGA 4CHOA 3V4IA 4DF8A 2HHTA 3IRXA 2Y1IA 5IYDP 1EXQA 1NH2A 4CJEA 1NK4A 3VQ5A 3ZSVA 1JXBA 3OVNA 5SWMA 2VWJA 2P5OA 3SJJA 1KY6A 4EP4A 4CJVA 3TAPA 1T03A 2DTUA 3DM2A 4ELVA 3V9WA 3LPTA 1YTFA 1TAUA 3CG7A 4BE2A 3DLEA 4LSNA 2ZE2A 4CE9A 1NJYA 4IG0A 3SCXA 4CF8A 1NKBA 2DFFA 3DRPA 1JL1A 4NCGA 1PZDA 2A1RA 1T05A 1NKCA 5CZ2A 1XC9A 1KFSA 1RTDA 1RBVA 1S1WA 4BWJA 3QEVA 4FJGA 4I2QA 4CJ5A 3BDPA 1RT1A 2KQ2A 1HQUA 4CEZA 4B9TA 2P51A 1ZBIA 1I3AA 1SKWA 3L3UA 3THVA 3E01A 4B0AA 4OGCA 1TL1A 3ZSZA 4CIEA 3NE6A 3TARA 1SKSA 1NKEA 4J2EA 1NVPA 2QXFA 4FLVA 3ZSRA 4M3XA 4QCLA 4RODB 3KLEA 5FRMA 3UIQA 2I5JA 3OCIA 3OS0A 1YTAA 3LZIA 3HL8A 1VSEA 1S1VA 1UAXA 3P1GA 4O4GA 3K57A 4FJXA 1BHLA 3NDKA 1VSJA 3LANA 1L3SA 4DU1A 4AHSA 2XHBA 2ZD1A 1FXXA 1TBAB 4RW9A 3RTVA 3VQ4A 1QN7A 4CHNA 3LDSA 1QSSA 3VQ8A 3G10A 3V1OA 4PQUA 1W9HA 4I7FA 2X78A 4B9LA 3V9ZA 1KYDA 1YVUA 4CECA 1TGOA 1C9BB 1Q9YA 4FJNA 5FROA 2XY7A 3MEDA 1JLCA 2GBZA 3C94A 4I9LA 2FBVA 4FJLA 1HMVA 4JLHA 3SI6A 3C6UA 2YNGA 3ASMA 4ID1A 2PZSA 1IKYA 3MECA 1TKTA 4MQ3A 4RW4A 1QNEA 5HRRA 3NF9A 2HMIA 4CK1A 1NOZA 1JLGA 2R7YA 4OKKA 1C1BA 1KVCA 1ZBFA 3LP2A 4M41A 1U4BA 3HK2A 4KI6A 3KJVA 4F3TA 3CFOA 1C1AA 1IH7A 1RDBA 3HPOA 4FJIA 3K58A 1S5JA 3HPGA 4CJQA 1JKHA 1N5YA 4KHUA 1W0HA 4ROCB 3QLHA 3HS9A 5KGWA 1TVRA 3KK3A 3PX0A 3RMAA 3OYAA 2D0AA 4B9SA 1KFDA 4CESA 1KLMA 3LAMA 2VJ0A 2MJ7A 3ZT2A 2ATQA 2RKIA 5KRTA 1R4XA 4PUOA 1HYVA 1SL2A 2HVHA 3QETA 1RBTA 4OLAA 2HHVA 1RDCA 5KRSA 3AVMA 3TR8A 4O0IA 4IFYA 3WNHA 2E6MA 3M8QA 4BDZA 1N6QA 4ZTFA 1B9FA 2YHAA 3I0RA 4LH5A 1S9EA 5DK5A 3KK1A 4E89A 1C6VA 2IV9A 4CK2A 4DSJA 4HCCA 4C8OA 2W42A 2OPSA 3DLHA 1NOYA 3B6OA 1JLEA 4FK4A 3IS9A 1NGMA 3DMJA 3QEWA 4FJHA 4CJRA 3HO1A 1R0AA 4E0DA 3DLRA 4N47A 1RDAA 4DTSA 3HXMA 4AHTA 3K5OA 4DTXA 3MXJA 3KLFA 2IV8A 1JLAA 4GW6A 3AVKA 5CYQA 3HT3A 2B5JA 3S3NA 4FYDA 2HHUA 1BGXT 4YFUA 1UA0A 2VG6A 2X6SA 3VQBA 3T19A 4I2PA 3ZT4A 4E7KA 3V9UA 1TK8A 4ELTA 3NF8A 4CJFA 3O4QA 3DLGA 1QNAA 3C95A 3VA3A 4FJKA 3ZSOA 4HCBA 3QINA 3TAFA 2QKKA 2A1SA 3NHGA 4MFBA 3VA0A 1X1PA 2KZMA 3V1RA 3ZSWA 4BWMA 1BQMA 3IG1A 4CFAA 5J2NA 1Z26A 1J9AA 4ID5A 3TAEA 1NJWA 1FK9A 3SUOA 2YNFA 3AA3A 4M3RA 1GOBA 1NK9A 1JXEA 4IBNA 4CGDA 5T7BA 1S6PA 3F9KA 4N41A 3OYBA 3OYDA 4CJ4A 1WSHA 3LAKA 1RTJA 4OPKA 3TANA 1UOCA 2HB5A 3WNEA 2KZZA 3CM6A 1HYSA 4FCYA 3SUNA 4KB1A 4Z0UA 2HNZA 3BGRA 2XO7A 3KTQA 5J2MA 3ZSQA 3TAMA 1KYFA 2F8SA 3SPYA 1VSFA 1JLBA 1VSLA 3QEPA 4CF1A 2OPQA 3AVJA 4IFVA 5J1EA 3MEEA 4HTUA 2BE2A 5CZ1A 3RMCA 4AILC 3DRRA 3VQEA 4Z4IA 4H8KA 4I9QA 1CZBA 4F8RA 2ETJA 1VTOA 3WNFA 5SZTA 3OYJA 2HNDA 4KKOA 3RWUA 1D9FA 4M3ZA 3NAEA 3VQQA 4DQPA 3WNGA 3AV9A 4CERA 3S3OA 1CLQA 4OLBA 3OJSA 1RT5A 3D45A 4G1QA 3PO5A 3QEXA 2F8TA 3O3FA 2DFEA 4EZ6A 4RW7A 4BDYA 2VWKA 4HUEA 3KIOA 4LD0A 1SL1A 1B9DA 2YHBA 4CIFA 5J2PA 4KAZA 2G8WA 3VQ6A 1BQNA 4CEDA 4DFPA 3AVGA 5KTQA 1NK8A 3KD5E 3LALA 3U3GA 3OS1A 4O5BA 3AO5A 4CEOA 4KHYA 1C0MA 1VRTA 4IDKA 3ZT3A 1U04A 2Z1IA 3L2RA 3RR8A 4CF0A 3ZT0A 3HS8A 4CGGA 3SYZA 3PX4A 3PX6A 1U47A 4DU4A 4PA1A 3I0SA 3SQ0A 1VRUA 1RT7A 2RPIA 4CIGA 4DTRA 3TAGA 3NH1A 4ROEB 5DMRA 2PY5A 1C1CA 1L5UA 1CXUA 1CZ9A 4B3OA 3V9XA 1D9DA 3AA4A 4FJMA 4FZZA 1D3UA 1PCZA 1RBUA 3IAYA 4FM0A 4Z4CA 4KFBA 4C8MA 4CEQA 1RTIA 3NGYA 5FRNA 3TAQA 2B4JA 4Z4GA 4FW1A 4FJ7A 1Y97A 1IKWA 4DFKA 1KSPA 5JS2A 4NCBA 3KKSA 1RT4A 2GV9A 4ZTJA 1NJZA 1BI4A 1Q8IA 1QNBA 3P83D 1DLOA 4E1MA 3M8PA 4M3YA 4C8LA 3DOKA 3OYFA 3AVLA 4FLZA 3DI6A 1KVAA 4W5RA 4IG3A 3CM5A 4CJPA 4DLEA 1ZBLA 1LW0A 4EP5A 1X9SA 3JSMA 1RNHA 1A5WA 4CK3A 4W5OA 4FLUA 2HHSA 1QN8A 4LY7A 1WSEA 1B9KA 3AO3A 4WE1A 4M45A 1MP9A 3KLGA 3MXIA 3U6FA 3PO4A 5EU7A 4F2SA 2BDPA 4W5QA 4KHNA 1HRHA 3AVIA 3QERA 4KO0A 3K5NA 3CFPA 4FZYA 4DQRA 1K6YA 3PY8A 1QN3A 4R5PA 3VQPA 1GOAA 1QQCA 4ICLA 3OJUA 3L8BA 3CQ8A 1KVBA 2G8IA 1RDDA 4RW8A 1XHZA 1L3VA 4AHUA 3OYCA 4OVLA 1HPZA 1RTHA 3SZ2A 3QNNA 1NK5A 3L2QA 4FVMA 5C42A 3RR7A 3OYIA 4B9NA 1D8YA 1XWLA 1Z25A 3NBPA 3ZT1A 3T1AA 1QTMA 1AISA 4O44A 3NGZA 4C8NA 4GVMA 1WLJA 4FZXC 3U3YA 1S6QA 4AHRA 4CHPA 3SQ2A 2DY4A 1YTBA 1WSFA 1LAWA 3LP0A 3OYGA 1RBRA 5FDLA 4FK0A 2B6AA 4CFCA 1X9MA 4FJJA 2HHXA 3NH2A 3JYTA 2Z1JA 4CCHA 1ZBHA 4FM1A 1T7PA 5HBMA 2G30A 1W80A 2Z8UA 3H08A 3KK2A 1A5VA 2Z1HA 1NJXA 1UA1A 3QNOA 1SUQA 4OKJA 4CJWA 1TAQA 3SQ1A 4FLWA 1SV5A 3LWMA 2IOCA 2G8UA 1S1TA 3M8RA 4OKEA 4M3WA 3K5LA 3NFAA 4DTPA 1ASVA 3LP1A 4DLGA 3SV4A 3SPZA 1KRPA 4E3SA 1TK5A 5HRPA 3DOLA 3O3GA 3LWLA 1WAJA 1FKPA 1TV6A 4CF9A 1QNCA 3OYMA 3OYEA 3KD1E 4KTQA 3ZCMA 2YV0X 3VQAA 4K8XA 2O4IA 1HNVA 1QHTA 1BIUA 4B08A 4KPYA 3LPUA 3P5JA 3LZJA 2EHGA 2QK9A 4CEAA 4Q0BA 4H4OA 1D5AA 4IKFA 3OYLA 4FW2A 4FJ8A 4E7LA 3HSTB 4KHSA 2YKMA 2X6NA 3OYKA 3HYFA 4EZ9A 1WSJA 1EX4A 1S1XA 5HRNA 2P5GA 4HUGA 3FFIA 3QEIA 3OYHA 1VTLE 5C24A 1VSKA 4DS5A 4E1NA 2G8FA 3EIKA 3L3VA 4AHVA 4O0JA 2KW4A 1VSIA 1BISA 3ITHA 4BE1A 4XIUA 4JS4A 2RN2A 3AVHA 3OC3C 4CGIA 1DTTA 1UWBA 1BIZA 1HYZA 3MEGA 4E7JA 1YT3A 1DTQA 4CEFA 3KLIA 2PYLA 4DTUA 4N56A 3NCIA 1J53A 4B9VA 4K8ZA 3SUPA 3OYNA 2KTQA 1SKRA 5E41A 3EY1A 4KHQA 1JLQA 3AA2A 1E42A 4CJKA 4JRQA 3ALYA 4DTNA 4CJUA 1VSDA 1IKVA 4KV8A 4CGHA 2HNYA 4BE0A 2XY8A 3O3HA 4DSLA 3C6TA 3RRHA 1VOKA 2D0BA 3QO9A 4B8AB 4RG8A 4DWIA 2HVIA 4CFBA 4DQSA 1ASWA 2EX3A 2XRIA 3KLHA 4LSLA 3L2UA 5IYCP 2IS3A 3LP3A 3ZSXA 4Y1DA 3HPHA 3RMDA 1L3TA 1VK0A 4OPJA 3SUQA 1QSYA 4J2AA 1ASUA 3PUFA 4CJ3A 3VQ9A 1RT3A 1I39A 3HP6A 1TKZA 2O4GA 4E7HA 3S3MA 1U45A 3AVCA 1QTSA 1X9WA 2HHWA 2E4LA 4KTWA 3M8SA 4FXDA 2D5RA 1GOCA 1LWFA 4DF4A 1RM1A 3V6DA 1TK0A 2FC0A 3HJFA 1RILA 1NK7A 4J2DA 3DLBA 3TWHA 2OYQA 1A5XA 4CJLA 1TL3A 4CHYA 2F96A 4N5SA 4DSFA 1VSMA 3V81A 1QN6A 1IG9A 1LWEA 2ITGA 3EZ5A 4F2RA 1J54A 3S9HA 4H4MA 4UQGA 4M42A 2QKBA 4DFJA 4QAGA 2WONA 2OZMA 4L8RB 1ZBUA 4QOZB 3ZSYA 4CHZA 4DU3A 2VG5A 3AA5X 3A2FA 2JGUA 3AVBA 5CY4A 1U48A 2WOMA 4FJ5A 4Q5VA 4W5TA 2PYJA 3QIPA 2YNIA 3DLKA 4F4KA 3CFRA 1RT6A 2D0CA 4KREA 1WN7A 3H1ZA 1YTUA 3MXMA 2FBXA 5KGXA 4W5NA 1O1WA 4DSEA 4DTMA 5CYMA 1BCOA 4M3TA 4TSXA 1LV5A 1QN4A 4FLXA 4OJRA 1XHXA 2VG7A 3HVTA 1CXQA 3D0PA 4FM2A 4KI4A 3SQ4A 3ISNC 1WNSA 4C8KA 1NK0A 5HP1A 1G15A 3DRSA 3K5MA 2IAJA 1LW2A 4RW6A 3VQCA 4ZHRA 4WZSD 1C0TA 5K14A 3SV3A 4CEEA 1BL3A 3QESA 1IKXA 1KTQA 1RT2A 2HHQA 3RRGA 4CHQA 3NF7A 3K59A 4NYNA 1S9GA 1EKEA 2IDOA 4FLYA 3TI0A 4ELUA 4FLTA 2GUIA 3HM9A 4DFMA 3CYMA 4KHWA 1IO2A 2JLEA 1TGHA 4B8CA 2IC3A 1QTPA 1QN9A 5HRSA 4J2BA 4FK2A 1EP4A 1QE1A 5HROA 4Z4FA 4KRFA 4GMJB 4Y1CA 5KI6A 2KFZA 3L2VA 2XY5A 1RCHA 5IYBP 1F21A 3MAQA 3F73A 2E6LA 1Q9XA 1JLFA 2YNHA 3HVRA 2OPPA 4DSKA 1KLNA 4CGFA 2G8HA 1RBSA 1WSIA 1FKOA 1VOLB 2RF2A 4N76A 3DYAA 1KY7A 4AH9A 1QN5A 1SL0A 3AVFA 1EETA 1U49A 4BDPA 5I3UA 3HP9A 3V1QA 5C25A 4B9MA 4DTOA 1TBPA 4YNQA 4HUFA 1ITGA 3I8DA 4Z4HA 1B92A 1LWCA 4BACA 3AO4A 2BGGA 2LSNA 1HQEA 2FBTA 1CDWA 4DMNA 4DQIA 2Q3SA 4DSIA 5JS1A 3NF6A 4HVJA 4NYFA 2XY6A 3EYZA 2OA8A 1QS4A 1T8EA 4DTJA 1JFIC 2KFNA 4JRPA 1KCFA 3AO1A 1VSHA 2BANA 4CF2A 4B9UA 1HJRA 4CJSA 3NH0A 4FJ9A 4CFDA 1QSLA 4E19A 1HNIA 3B6PA 2P1JA 3K2PA 3KKRA 1J5OA 4NCAA 3L2WA 3AO2A 2AJQA 3OS2A 3ULDA 3AVAA 3T3FA 4CGJA 4O55A 4KTZA 5D3GA 3PV8A 3SNNA 5HLFA 4DS4A 5J2QA 3TABA 1XI1A 1C0UA 2Z1GA 4CJTA 3OY9A 1TKDA
chains in the Genus database with same CATH superfamily
1VQ4N 1YHQN 3VOVA 3NGIA 2IGIA 2YHYA 4BRMA 3C0BA 1EWRA 5I42A 4JKGB 4M3UA 1LAVA 2E2QA 2X74A 1L3UA 2DFHA 4CZEA 2CGJA 3ID6A 2Y8QA 2YJFA 4JKFA 1MA9B 2P9KB 1MU2A 2A41A 2Y8LA 2UUBK 3QBWA 2E2PA 4K41A 3V4IA 2QWPA 3J81O 2IVPA 4CJEA 3OVNA 1HKCA 3V9WA 4DQ8A 4M7YA 2YH5A 1ATSA 2AA4A 2ZE2A 1GLCG 1DEJA 2A1RA 3AGKA 1XC9A 1RBVA 3QEVA 1S22A 1RT1A 1ZBIA 4WYBA 3AAPA 5KQ8A 3THVA 5AQLA 4HCCA 2IIRA 4BREA 4J2EA 1NVPA 4PKHA 3ZSRA 3DLLL 4KHPK 4LFBK 3T4NA 4IEIA 3LZIA 3OCIA 1YTAA 1VSEA 4DR3K 4JEPA 3P1GA 5AQJA 1BHLA 3NDKA 1OH5A 2A5XA 4DU1A 4AHSA 2XHBA 2ZJRL 4CBUA 5JICA 4JK9A 2PWWA 3VQ4A 1QN7A 4I7FA 2BTFA 3PMGA 4YDUC 4BRCA 4FJNA 3CCSN 2YA3A 2XY7A 5AN4A 2O8DA 4CZGA 3SI6A 3C6UA 2YNGA 2PZSA 1M1KO 3CI5A 3MECA 2FUVA 5F0XA 4FOEA 1NGCA 2OANA 5AQFA 3LP2A 5BMPA 3FFKB 1IBMK 3CFOA 4V19S 1C1AA 5AQOA 2FKMX 4FJIA 1S5JA 1JKHA 4BRDA 3HS9A 1OKJA 3EKUA 2NOIA 4CESA 4YORA 2VJ0A 3ZT2A 2E1ZA 2RKIA 1SL2A 2HVHA 1IBKK 5KRSA 3TR8A 1SZ2A 1B9FA 5BRFA 3I0RA 3I3WA 1S72N 3MN7A 4FVUA 3R8EA 1VQMN 1NOYA 4PL8A 3HO1A 3QEWA 1W97L 1KAZA 4N47A 2QWRA 2JOIA 3K5OA 3MXJA 5AQTA 2IV8A 5CYQA 3EL2A 3AVKA 3O9QA 2H3GX 5JMVD 2ZJPL 3VQBA 2O8FB 4I2PA 2MZ8A 2AP1A 4BRIA 1QVGM 3O4QA 3H6EA 1YJ9N 3QINA 3TAFA 3V1RA 4CFAA 2Q0RA 5J2NA 3LDOA 3SAGA 1NJWA 3SUOA 1BA1A 2Q31A 5T7BA 5AQKA 5GINA 3F9KA 4N41A 4CJ4A 3LAKA 1WBDA 1VKLA 1HYSA 3IH7A 5J2MA 1NGHA 1KYFA 1NGEA 1XSZA 1VSFA 1JLBA 3MEEA 3QFUA 3MN9A 4O8KA 3VQEA 3I56N 4H8KA 1JCFA 1MWMA 3VEYA 1Y64A 1VTOA 1KAXA 5SZTA 3U9DA 4DV4K 3EE8A 4WQ5C 3VMFB 3WNGA 3AV9A 3THWA 4BRKA 1RT5A 3QEXA 2F8TA 3KZBA 3CPEA 3KIOA 2P9LB 2JWLA 3G25A 4LD0A 4BGAA 5JMVA 3CQXA 3CVSA 5J2PA 4KAZA 3VQ6A 1BQNA 3OW2M 4KH6A 3LALA 3AO5A 4QS7A 3U4LA 4IDKA 2Z1IA 3PX6A 1FW6A 1UL7A 4JKHA 4DU4A 2NOHA 1RT7A 2RPIA 1MDUB 3QMLA 4CIGA 4C1NK 4BR2A 4ROEB 4WFAL 5DMRA 2PY5A 3RSMA 3F0ZA 3QBXA 4NB4A 1CZ9A 3V9XA 3HSCA 1D3UA 1PCZA 1RBUA 3ENOA 2A3ZA 5HSHA 2CGLA 4C8MA 4I6MA 4MRQA 1RTIA 5FRNA 3TAQA 4FW1A 1Y97A 4DFKA 1RT4A 1CZAN 1DLOA 5C2FA 4E1MA 2FKFA 3RPJA 2KLAA 4DV1K 4FLZA 2E88A 3WQTA 4BG8A 4W5RA 2NRVA 4IG3A 5FPMA 3JSMA 3TU5A 1B9KA 4GV6A 3MXIA 5EU7A 3N4PA 4DQRA 1QN3A 2KHOA 2G8IA 5GAEP 1YXQA 5GIPA 3OTOK 3FE1A 1L3VA 4HJHA 1N34K 2W6KA 4FWKA 5FPNA 5I9EB 5C42A 4QG5A 4IOCL 4B9NA 1XWLA 3ULEB 3NBPA 3C65A 1QTMA 1AISA 1KC8O 1WLJA 1S6QA 5CHIA 1LAWA 3LP0A 5FDLA 2HHXA 2B6AA 3A5NC 4CBXA 4BRFA 3AGRA 4CCHA 2CH6A 4WFBL 2ZJQL 4FM1A 5HBMA 1W80A 2G30A 3UE5A 4B9QA 1A5VA 2I5WA 4ILJA 4ILGB 3QNOA 4OKJA 4CJWA 3CPWM 3OBWA 3SQ1A 3T69A 2QW9A 3BF1A 5JVHL 1S1TA 2YCHA 1G99A 4DR1K 1BG3A 4GV9A 3NFAA 1MPGA 1ASVA 3MX2A 4JI7K 3R6MA 3DOLA 3OYMA 1TV6A 3KD1E 1PCMX 2NWVA 2YV0X 1HNVA 3UKRA 3CCRN 1Q81O 4CEAA 2GX9A 4H4OA 1D5AA 1SS6A 4IKFA 4LF5K 2HBKA 4JI5K 3HSTB 5EOYA 2UYTA 1NGDA 1P5GX 1S1XA 4MO4A 1VSKA 1DIZA 4E1NA 4O0JA 3M6GA 2KKZA 1UWBA 3MEGA 4CZIA 4E7JA 4B9VA 2D0OA 4K8ZA 4CZLA 4E1JA 5F2RA 5ADXH 4DV0K 3OYNA 1XQSC 3E1YA 5CR4A 4YOVA 3O4WA 3CCMN 3GBTA 1JLQA 3ID8A 3AA2A 1J3MA 4CJKA 3ALYA 3ATVA 3C6AA 4DTNA 1VSDA 1IKVA 4DSLA 3N4QA 3ZX2A 4RWTA 2WC9A 3EN9A 4B8AB 2HVIA 1V4TA 3DXKB 4BVPA 3LP3A 4H0PA 4Y1DA 3JAMO 5LY3A 1QSYA 1ASUA 2E8AA 3O1WA 1RT3A 1TKZA 2O4GA 1U45A 2P9IB 1HKGA 1YQRA 3WXKA 1U2VA 1GOCA 3C04A 1M3HA 1TK0A 2FC0A 3HJFA 2OYQA 1A5XA 1TL3A 5LL6Z 2F96A 1T6AA 1Q18A 4F2RA 1BU6O 2GTDA 1J54A 4H4MA 2QKBA 4DFJA 4AM6A 2WONA 4L8RB 1LOTB 5AZIA 3HTVA 4DU3A 2VG5A 3O1BA 1U48A 3KK7A 4FJ5A 4Q5VA 3QIPA 4WFNL 3CFRA 3VTHA 4NLBA 4BRLA 5KGXA 4DSEA 1XHXA 3HVTA 3D0PA 1CXQA 1NGFA 3B8AX 3ISNC 1DGKN 2P9NB 5HP1A 3K5MA 3OBYA 4JI8K 1QZ6A 2IAJA 4BRHA 1MWKA 4ZHRA 1C0TA 3QESA 3O80A 3SMSA 2P9SA 4DV2K 4DFMA 4KHWA 2BUPA 5HRSA 1EP4A 1QE1A 3BF3A 4GMJB 5KI6A 4JI2K 3O9RA 3L2VA 3CWTA 1RCHA 4JNEA 1JLFA 3PSFA 2FSNA 2HBLA 4NLCA 4DSKA 4CW7B 2G8HA 1RBSA 4N76A 1HNXK 1KY7A 2HL9A 3KWGA 1EETA 4BDPA 5C25A 1BA0A 4HUFA 3I8DA 4FWSA 4BR9A 4Z4HA 1LWCA 2CH5A 1Z05A 4BACA 1LWWA 4EIAA 3UKUA 2NRXA 4C1NI 4HVJA 4BROA 4CZKA 1JFIC 4D7RA 5AZJB 3AO1A 3MWPA 4CJSA 4ISEA 4CFDA 3CD6N 4E19A 2OTLN 3K2PA 2AJQA 3ULDA 4CGJA 3NVMA 5AQMA 3WUHA 5D3GA 2V7YA 2Z1GA 1N3CA 3PIOL 3ZETB 2YKNA 4DQQA 2OPRA 2VYPA 4OGEA 4B1VA 4HHTA 1ZXOA 4CEBA 3CETA 4FO0A 3AVNA 2ZQBA 3RMBA 1REVA 3T1HK 2UXBK 1GLEG 1XMOK 3TPQA 3VQDA 3G0ZA 2NLVA 3OSMA 1V5SA 3VPZA 3V9SA 2HBJA 2G8KA 3VQ7A 4CHOA 4DF8A 2Y1IA 4IEEA 2FXUA 3ZSVA 2VWJA 3SAHA 1KY6A 4HWIA 1T03A 2DTUA 4NXMK 1HU0A 3CG7A 5JN5A 3BEXA 4LSNA 1NMDA 4IL8A 4CE9A 4IG0A 4DUYK 1NKBA 1K2YX 4BJUA 4NCGA 1PZDA 1NU0A 1KFSA 4FJGA 1XNRK 1RTDA 4I2QA 4CJ5A 1HQUA 1EWQA 1I3AA 4JD2A 3L3UA 5B8HA 3E01A 4B0AA 1TL1A 1SKSA 1IV0A 2QXFA 3CF5L 2E20A 4BC5A 5FRMA 3OS0A 3HL8A 1S1VA 3SNSA 2V7ZA 1VSJA 3LANA 1FXXA 2HL8A 1BUPA 3RTVA 3VGKA 3LDSA 4JKAA 3G10A 4B3SK 2X78A 4AF1A 3ENHA 4FWLA 4IZ9A 1EUVA 3V9ZA 1YVUA 2ZGZA 4CECA 3LDNA 4BRQA 3MEDA 4JI3K 1JLCA 2GBZA 1WBBA 4ID1A 1QQMA 5A2QO 1VHXA 4RW4A 1QNEA 3HOTA 3NF9A 3CWAA 4DR6K 1S3XA 2A40A 1C1BA 2QWOA 2O8EA 3HK2A 3KJVA 2V8QA 5H1SQ 1IH7A 1RDBA 3KTUA 3K58A 1M3QA 3HPGA 3QLHA 3CMEN 1Q9UA 1TVRA 3KK3A 3PX0A 3OYAA 1XC3A 5EY4A 3M3ZA 2ATQA 5KRTA 4PUOA 1HYVA 2HHVA 1RDCA 3OY9A 3LL3A 2JHNA 1VQKN 5JLFA 4BDZA 4CJ7A 4ZTFA 2YHAA 5DK5A 2UUAK 4E89A 2P9UA 4DSJA 1NGJA 3TTDA 2W42A 2OPSA 4MDBA 1JLEA 1NGMA 2YJEA 3DXMB 1KQSM 1R0AA 2R5XA 1QQNA 3DLRA 1RDAA 3HXMA 4B1ZA 4DTXA 1GLLO 3R9PA 4GW6A 4EALA 4CVNE 2B5JA 3HT3A 3S3NA 4AM7A 4BQZA 5C12A 4FYDA 2HHUA 3KHYA 1Z6RA 1QQOA 2VG6A 1TK8A 3T19A 2NOBA 3BP8A 3FZLA 1QNAA 3ZSOA 2A1SA 5AZIB 1W2BM 2KZMA 1X1PA 5AQZA 4BWMA 1BQMA 5KPRA 4ID5A 1P90A 2YNFA 4M3RA 4CGDA 2W41A 3I55N 1UOCA 2HB5A 3WNEA 5M1NA 2E5LK 3CM6A 3SUNA 4Z0UA 2XO7A 4X62K 2WBNA 3KTQA 1J6ZA 4B1UB 2F8SA 3ATUA 4M63C 3O9SA 1VSLA 2ZM6K 4CF1A 2OPQA 5J1EA 2BE2A 1VQLN 3RMCA 4AILC 1WUAA 4Z4IA 4I9QA 1CZBA 4F8RA 1HKBA 3OYJA 2HNDA 2P9SB 3RWUA 1K9MO 4CERA 4OLBA 3OJSA 3D45A 3CJBA 3O3FA 2DFEA 1VQ9N 2ZWHA 2YI1A 3E9OA 1E3MA 3A5MC 2YX6A 4ISFA 4DFPA 3AVGA 4GVEA 3KD5E 2O8CA 3THYA 1YITN 1GLJO 3IKMA 1VRTA 3RR8A 1KFIA 3HS8A 3GL1A 3PX4A 1U47A 2O8BA 4PA1A 1HNWK 4FSVA 5C2DA 4A62A 1CXUA 4B3OA 1E4FT 4I8OA 1ESVA 2UUCK 1YQLA 5JVGL 3IAYA 4FM0A 4Z4CA 4JYAK 1OVQA 3FLCO 5AQQA 5FPDA 3DJCA 4NCBA 3KKSA 4JI4K 4ZTJA 2GV9A 2HHHK 3VF6A 1QNBA 3P83D 2QRDA 3OYFA 1FN7A 4EJZA 3U8XA 3WT0A 4W5OA 4LF6K 2HHSA 4LY7A 3AO3A 4WE1A 3U6FA 4EJYA 5FLXO 1J5EK 5AQSA 3QERA 1IBLK 4KO0A 4YOYA 2KFNA 3L8BA 3CQ8A 2V51B 2QWMA 4Z94A 2FGTA 3OYCA 4OVLA 3OYIA 5AFUA 1Z25A 1TYQB 1Q7YO 1KO9A 4O8UA 4O44A 1X3NA 3NGZA 2HBMA 4GVMA 4CHPA 2DY4A 2F7TA 5AQGA 5BRDA 3OYGA 3EO3A 4CFCA 1X9MA 1YQMA 3NH2A 4JD2B 2Z1JA 1T7PA 3H08A 2RE2A 1C4GA 3TTFA 1SUQA 3MMVA 3LWMA 4BRPA 3M8RA 5GIOA 3K5LA 4DLGA 3G71N 4QS9A 3O3GA 3LWLA 1WAJA 1QNCA 3WXLA 1U6ZA 4KTQA 4K8XA 4KH4A 2O4IA 3W3DA 4B08A 1EBMA 2QWNA 4KPYA 3P5JA 3LZJA 1VQNN 1NGAA 3OLPA 4KHSA 2YKMA 3OYKA 4EZ9A 1WSJA 1JCEA 1RDWX 2P5GA 3C7NB 5C24A 4DS5A 4AHVA 1VQON 5TKYA 4XIUA 4CGIA 3OC3C 1D4XA 4FWRA 4FZXC 1DTQA 4N56A 3NCIA 1W7AA 5E41A 3JXUA 4KHQA 3QDKA 2P9PB 4FWOA 4EAGA 2XY8A 1NWKA 3RRHA 3CHWA 3SAFA 3IFRA 4DWIA 1T6DA 3Q7CA 3LM2A 4CFBA 4DQSA 4BRAA 2EX3A 3L2UA 5KPZA 1K8KA 3HPHA 2CGKA 3RMDA 1L3TA 3SUQA 3J7ZO 1T6CA 3VQ9A 1PVSA 1XNQK 4E7HA 3J80O 2E2NA 3CCJN 1QTSA 2P9UB 4FXDA 1LWFA 5BR9A 2HMPA 4DF4A 1RM1A 4J2DA 3RSEA 2NOLA 3CQYA 3D2FB 2QI2A 3LDLA 1VSMA 3S9HA 4UQGA 4QAGA 2VCPA 3H3NO 3WXIA 4BY9C 4QOZB 4DV3K 1NJIO 4IDHA 1VQ8N 4W5TA 2PYJA 3BUZB 4DUZK 2D0CA 4JKEA 1WN7A 2FBXA 5FPEA 3A5LC 1QZ5A 3WQUA 1QN4A 4GV3A 4FM2A 3P38A 3SQ4A 4IFEA 4DR2K 4XEIA 3DRSA 4B1XB 4RW6A 4LF4K 4FWNA 1RT2A 3RRGA 3NF7A 2IVOA 4NYNA 4NO7A 4WXAA 1S9GA 3TI0A 3KVGA 3GDQA 4H0XB 4B3MK 2GUIA 5BREA 2OOXA 2IC3A 2JPIA 4FK2A 3VGMA 4Z4FA 4Y1CA 4F9OA 5IYBP 1F21A 3MAQA 3F73A 4H5TA 4YY3K 2RF2A 1VOLB 3DYAA 1QN5A 1U49A 4H0OA 5I3UA 4DTOA 4WQ4C 3D2EA 5BPLA 2NRZA 4CBWA 4PKGA 4EFHA 4UY8O 1BOTO 5GAHP 4DR7K 1HQEA 4DMNA 1CDWA 3ZEUA 3RVCA 4JHDA 3BKQX 4JRPA 1KCFA 4CF2A 3AY9A 1HJRA 1OH6A 4L3QA 1QSLA 2W40A 5AQHA 3KKRA 1J5OA 3L2WA 3OS2A 5JLHA 3AVAA 3TE5A 3SBGA 3SNNA 5HLFA 2NRHA 2O8DB 4X65K 1SL1A 5EX5A 3SMPA 3D7EO 4GKJK 4F3OA 5F9CA 1S1UA 4KB0A 2FBYA 3BY5A 1DT9A 1KYUA 1JL2A 3P31A 2HW3A 3QIOA 2OZSA 4DG1A 3SBTA 2NOEA 5E84A 4AHCA 3O4NA 4PWDA 4EAHD 2Y1JA 3EAYA 1WSGA 2HHTA 3IRXA 1EXQA 2WTUA 1NH2A 5SWMA 5TKWA 2QRCA 3MN6A 1ZBSA 4EP4A 4CJVA 2FF3B 1YTFA 4O5FA 1TAUA 4BE2A 3DLEA 2JHJA 4PHTX 4CZJA 1NJYA 4CF8A 2DFFA 3DRPA 1JL1A 1T05A 4B3TK 3ZYYX 4A57A 1S1WA 1KFQA 3OHRA 4JK8A 3VEOA 4CEZA 4B9TA 4CIEA 3NE6A 4OGCA 4YDUA 3TARA 1NG9A 4LFCK 4M3XA 3KLEA 3UIQA 3CMAN 4MO5A 4IXCA 3EZWA 4LFAK 4FJXA 3A0IX 4PL7A 2DKDA 3QICA 4A59A 5HOOA 4RW9A 4CHNA 4PQUA 3IUCA 3CWUA 3EE9A 4IJNA 4WCEL 1Q9YA 1TGOA 1C9BB 4LF9K 5FROA 2NOFA 1EO1A 4JI1K 2DKCA 3C94A 3THXA 1EQYA 2FBVA 4FJLA 3ASMA 1IKYA 1YQKA 4JKGA 2YHWA 2HMIA 4CK1A 1NOZA 4WF9L 1U4BA 1ZBFA 4M41A 3F2KA 2VWBA 4KI6A 3VETA 3OA9A 4KHUA 5AQWA 2P9KA 4BG9A 4ROCB 5KGWA 1WQAA 2V9JA 1NBWA 1KFDA 4IJAA 2MJ7A 2FSJA 4FWMA 2HZSA 4FOIA 2H5AX 4O0IA 3K0SA 3THWB 4XH5A 1SAZA 3M8QA 1N6QA 4BRGA 2WFBA 3KK1A 1C6VA 4OPAA 2IV9A 1V4SA 4LC9B 3DLHA 4FK4A 5KL0A 3IS9A 3DMJA 4FJHA 4CJRA 1WJWA 4C23A 3NMUA 5F1XA 5E26A 2GWJA 3KLFA 4H5NA 3F10A 4YFUA 1UA0A 3NF8A 4CJFA 3DLGA 3C95A 2XHIA 1BDGA 4FJKA 2QKKA 3NHGA 1Q82O 3IG1A 4I6MB 1J9AA 1X9JA 3AA3A 1GOBA 1JXEA 4IBNA 3PIPL 1ATRA 2HOEA 3TANA 3R1XA 4WQ5A 2IVNA 4FCYA 4CD1A 2HNZA 3BGRA 3CCEN 1ILYA 3ZSQA 3TAMA 3O5BA 3QEPA 3I8BA 4IFVA 3BZKA 5LJVA 1IJJA 4H0VB 4IO8A 3WNFA 4KKOA 4CZMA 1VQ7N 1NGIA 1HJOA 1D9FA 3NAEA 4DQPA 1CLQA 3PO5A 4G1QA 4D7QA 5BN9A 4EZ6A 4RW7A 4BDYA 2VWKA 4HUEA 1M90O 3KRMA 1B9DA 2YHBA 4BC4A 2VGNA 3OSEA 2I7NA 1T44A 5KTQA 1NK8A 3H46O 2NNWA 3I0WA 4IOXA 4CEOA 3M1FA 1U04A 3L2RA 5AQIA 4CF0A 3ZT0A 4CGGA 1HR0K 1K35A 4YOXA 1VRUA 3KWIA 4EAIA 2O8FA 1C1CA 3F9MA 1D9DA 4FJMA 3ZLJA 2BH1A 2NRTA 4H0TB 3UKRB 2A42A 1ATNA 1VAZA 3NGYA 4FJ7A 1IKWA 1KSPA 4LF7K 5JS2A 1BI4A 2Q2RA 4M3YA 4YHHK 2ASPA 3CVTA 3FZKA 4A2AA 3MWTA 4DLEA 4X64K 3CM5A 2W6LA 4CJPA 4EP5A 1LXTA 1RNHA 1A5WA 4CK3A 4FLUA 4CZFA 1QN8A 3WEEA 3PO4A 4M45A 4F2SA 3ENOC 4KHNA 4JKBA 1HRHA 3AVIA 3K5NA 4FZYA 2KZZA 5AQRA 1K6YA 3VQPA 1QQCA 1X3MA 4ICLA 1RDDA 4RW8A 1XHZA 3J7YP 3MDQA 2UU9K 2O3OA 1HPZA 3QNNA 1NK5A 5EPCA 2GEMA 3L2QA 3SLCA 4DV6K 4H5WA 4A61A 1C0FA 3CJ1A 2P9LA 4C8NA 2OOYA 1NLVA 1LWVA 1BWFO 4AQYK 1WSFA 1U2VB 4FK0A 1RBRA 3OSTA 4FJJA 2HF4A 3JYTA 3G6EN 5AJ3K 3KK2A 1P8ZA 1DKGD 1TUOA 2HF3A 1TAQA 4FLWA 3CC7N 1SV5A 4DULA 4DTPA 3LP1A 4U7BA 1NNEA 4E3SA 5HRPA 4CD3A 4CF9A 5M1OA 3ZCMA 3VQAA 1QHTA 1VQPN 1BIUA 5AQVA 3OGDA 3VF2A 2EHGA 2QK9A 3CC4N 5LMUK 3QFPA 3OYLA 3LDQA 2X6NA 5M1FA 3FFIA 3QEIA 3OYHA 3A8YA 2J4RA 3L3VA 2KW4A 1BISA 3ITHA 4K42A 2RN2A 4BR7A 1HYZA 4J2AA 4CFFA 3KLIA 4GNIA 4DTUA 3SJHA 5DM6L 3SUPA 2LAEA 4OX9K 2KTQA 3QB0A 1SKRA 3EY1A 5AQYA 1JCGA 1N36K 1KD1O 4KV8A 1JDYA 2HNYA 4BE0A 1I94K 3OH9A 2D0BA 1K73O 1ASWA 2OTJN 2JWKA 2XRIA 5IYCP 2IS3A 3VENA 4RTFD 3ZSXA 3SK3A 1XMQK 3D6RA 3ULEA 4B1YB 5CE3A 3CERA 3PUFA 4CJ3A 4YOTA 2E2OA 4R79A 2F9WA 4RCHA 1RGIA 3AVCA 3PLAA 4KTWA 4DB3A 3O6WA 3UKUB 3V6DA 3TWHA 4CJLA 3DPUA 4N5SA 4DSFA 1QN6A 1IG9A 4B1WB 3H1QA 1QHAA 4M42A 1ZBUA 1N32K 3EEQA 3AA5X 3NVKA 2F7LA 2D0PA 3AARA 2Q97A 1RDUA 1WOQA 1RT6A 5BR8K 3TSQA 4KREA 2D1KA 1YTUA 4C7PA 1O1WA 1TUUA 4DTMA 3PSIA 2DKAA 2NRRA 1BCOA 5CYMA 4TSXA 2FF6A 1LV5A 3CCQN 4OJRA 2VG7A 5AQPA 1WNSA 4C8KA 1NK0A 1G15A 1YAGA 3E9PA 2PFUA 1BL3A 1KTQA 2HHQA 3J7AP 2WUSA 4CHQA 3K59A 2IDOA 3CCUN 4ELUA 2ZGYA 3HM9A 2Q1NA 3CYMA 2JLEA 1TGHA 4B8CA 1QTPA 3O08A 5HROA 3MX5A 4YOWA 3CJCA 2XY5A 4FL9A 4DCHA 4JKCA 2E6LA 3LDPA 5HL7L 2YNHA 3HVRA 1VQ5N 2OPPA 3DXKA 5AQXA 4CGFA 1KLNA 4JN4A 3AVFA 1KAYA 3MK6A 1N33K 4B9MA 4YNQA 2ASMA 1ITGA 2P9IA 4BQLA 1B92A 4DR5K 2LSNA 4DQIA 4DSIA 2Q3SA 2OA8A 4NYFA 2XY6A 3EYZA 1QS4A 4QS8A 2BANA 4BC3A 4BR5A 4B9UA 3NH0A 4FJ9A 5ADXA 2NLXA 1HNIA 3FR0A 4FWQA 2P1JA 1YUWA 2UXCK 2QWLA 4KTZA 4O55A 1LCUA 3PV8A 3H1VX 4DV7K 4DS4A 1C0UA 3VEZA 4FPAA 1UT7A 4CJTA 3SCXA 2F9TA 4PY5A 4K0KK 3T1YK 1TKXA 3MN5A 4Z4EA 3VTIA 2O8EB 4BVOA 3F5TA 4LH4A 1WAFA 3VN5A 3CW7A 2NUBA 1BI4B 2P9NA 5BN8A 1BCMA 2G8VA 3HBTA 4E7IA 3MCPA 4PKIA 4JS5A 1NK6A 1ZYQA 5IYDP 4JI6K 2P5OA 3WEEB 1NK4A 3VQ5A 3CCLN 1JXBA 4GKKK 3SJJA 3L0QA 3TAPA 3DM2A 4ELVA 3LPTA 2H4LX 3GE1A 2PAVA 1FJGK 4NXNK 1NKCA 5CZ2A 4BWJA 3BDPA 2KQ2A 2P51A 5AQNA 1SKWA 3I33A 5C15A 3ZSZA 1NKEA 4FLVA 4IO9L 4QCLA 4RODB 3VESA 3HRGA 1GLDG 2I5JA 3FGUA 4KBOA 1UAXA 4O4GA 3K57A 2E1YA 5DM7L 5AZJA 1L3SA 2HKPA 2ZD1A 4J8FA 1TBAB 1QSSA 3VQ8A 3V1OA 1W9HA 4BRNA 4B9LA 1WB9A 3H45C 1N39A 4K43A 1KYDA 4MLEA 1YI2N 4I9LA 3PDKA 1HMVA 4JLHA 3CWSA 3ZETA 3S41A 1TKTA 4MQ3A 2GELA 2UXDK 5HRRA 3CCVN 4H03B 3CJ9A 4Q11A 2R7YA 1JLGA 3VEVA 4OKKA 1KVCA 4F3TA 2QA4N 2VQFK 2V92A 3EKSA 1C47A 3HZ6A 3HPOA 4G9ZA 2Q0UA 4CJQA 1N5YA 1W0HA 3TSUA 4TPSA 3C6HA 3RMAA 1GLFO 5M1QA 2D0AA 4B9SA 1KLMA 3LAMA 1R4XA 5EVZA 3QETA 1RBTA 3CJAA 4OLAA 3AVMA 1HLUA 1NGBA 4IFYA 3ENCA 3FZMA 2E6MA 2RHKA 3WNHA 3UB5A 2QR1A 4LH5A 1S9EA 4CK2A 2QTDA 4IWVA 4JI0K 4C8OA 1IG8A 2QREA 2O8CB 3B6OA 3P4IA 3THYB 1JJ2M 1H1VA 2Q36A 2QWQA 4E0DA 5GAGP 3TDHA 5AQUA 4DTSA 2FSKA 3FZFA 2O8BB 4AHTA 4EAKA 1JLAA 3L4IA 3LM9A 5IT9O 3L6QA 1BGXT 2QLVA 2X6SA 4E7KA 4ELTA 3ZT4A 1OH7A 3V9UA 1ZC6A 2QM1A 3VA3A 4HCBA 3O9UA 3VA0A 4MFBA 4DKWA 3ZSWA 3DAWA 4IOAL 1Z26A 3Q7BA 3TAEA 5AFUH 1FK9A 2OCEA 1QVFM 1NK9A 1S6PA 3OYBA 3OYDA 1WSHA 4XH1A 1RTJA 4OPKA 3TTCA 3G4SN 5M1KA 4KB1A 4K25A 4DR4K 3SPYA 1R59O 3AVJA 4HTUA 4JK7A 5CZ1A 3U9ZA 3DRRA 1OH8A 3CJ7A 3DWLA 2ETJA 3K9JA 2NVMA 2ZF5O 4M3ZA 4A5BA 3VQQA 5LJWA 3S3OA 3T7ZA 4BGBA 3WXMB 1C0GA 4CIFA 2G8WA 4CI6A 1P5DX 2F4VK 4CEDA 3U3GA 3OS1A 3OH6A 3DXMA 4O5BA 3VGLA 4KHYA 1C0MA 4OPHA 1YJWN 1HNZK 2I7PA 3ZT3A 3SYZA 5KPTA 4EAJA 3VEWA 3I0SA 3SQ0A 2QXLA 2QEXN 4DTRA 3TAGA 3NH1A 1NGGA 3E66A 1L5UA 5KQDA 5BMNA 3AA4A 4FZZA 1RFQA 3VEXA 3I0XA 3ZX0A 4BR4A 2D4WA 4KFBA 4CEQA 2DPNA 2B4JA 1N3AA 4Z4GA 1LWYA 5C0YA 2ZFDB 1NJZA 1Q8IA 3M8PA 4C8LA 3L4QA 3DOKA 3AVLA 3DI6A 1KVAA 1ZBLA 1LW0A 1X9SA 3HM8A 4LF8K 4JV5K 4X66K 1WSEA 1T3VA 3KLGA 1MP9A 1HUXA 2BDPA 4W5QA 3CFPA 2NZTA 3PY8A 2YHXA 4R5PA 1GOAA 3NA5A 3OJUA 4OO1J 1KVBA 3D7QA 1E4GT 4AHUA 1RTHA 3SZ2A 3R3LA 4FVMA 4JKDA 3O9TA 3RR7A 1K8KB 1NMNA 1D8YA 3VF4A 3T1AA 3ZT1A 2GUPA 3ZX3A 3TSPA 1GLAG 3U3YA 2FLOA 3UW2A 4AHRA 1Q86O 3SQ2A 1YTBA 5BPNA 1PCJX 3P39A 3A5OC 3RSEB 1ZBHA 2Z8UA 2GWKA 2Z1HA 2HSTA 1NJXA 1UA1A 2IOCA 2G8UA 4OKEA 4M3WA 1OVYA 5ELZA 3SV4A 2V52B 4H5VA 3SPZA 1KRPA 1TK5A 2EWSA 3E9LA 3IDHA 1FKPA 2PBDA 3OYEA 4EHUA 4Q0BA 1YF5L 3LPUA 4U67L 2NOZA 2VQEK 1HPMA 4FW2A 5MLCQ 4H5RA 4FJ8A 4E7LA 4MLHA 4JAXA 4ISGA 3HYFA 2ITMA 1EX4A 4BR0A 5HRNA 4HUGA 1VTLE 4A5AA 2G8FA 3EIKA 4MDAA 1VSIA 4BE1A 4JS4A 3AVHA 4H0YB 1HX1A 1DTTA 1BIZA 2PYLA 1YT3A 4CEFA 4XH4A 1J53A 2NRWA 3BZCA 3ULXA 1E42A 4JRQA 4ILHA 1K8AO 3AAQA 4CJUA 5GADP 4CGHA 3O3HA 3C6TA 1UT4A 1VOKA 3QO9A 4RG8A 1KXPA 5EXWA 3J8AA 3WXJA 3KLHA 2HZMA 4LSLA 1YVNA 1TYQA 1VK0A 3VERA 4OPJA 3CC2N 1I39A 3HP6A 3S3MA 3D2EB 1X9WA 2HHWA 2E4LA 3HOSA 3M8SA 4CZHA 2D5RA 3ZEUB 3H3OB 1RILA 4YOUA 1NK7A 4JHDB 3DLBA 4CHYA 3V81A 3M5RA 1LWEA 2ITGA 3EZ5A 3DPTA 3GG4A 4FPBA 2OZMA 1SQKA 1XUPO 3ENBA 3ZSYA 4CHZA 1TUYA 3A2FA 2JGUA 3AVBA 5CY4A 2WOMA 1BO5O 2YNIA 3DLKA 4BC2A 3O8MA 4F4KA 3H1ZA 4EHTA 3MXMA 4HTLA 4W5NA 3IMXA 4M3TA 3JS6A 4FLXA 4KI4A 3C7NA 3K9KA 5M1PA 4WX8A 3D4VA 4B3RK 1LW2A 5BPMA 3VQCA 3SV3A 4WZSD 5K14A 2Z0FA 4CEEA 1IKXA 4Y0WA 5C10A 4FLYA 1EKEA 3GOIA 5AR0A 2A6AA 4FLTA 4WQ4A 3W0LA 1IO2A 2P9PA 2ASOA 1QN9A 4J2BA 4KRFA 1NM1A 4M7XA 2KFZA 3CIPA 1Q9XA 1WSIA 1FKOA 4GY2B 4AH9A 2VGMA 1SL0A 3HP9A 3MCAB 3V1QA 3FZHA 1TBPA 1VQ6N 3AO4A 2BGGA 2FBTA 1YIJN 3HI0A 5BRHA 1N8RO 5JS1A 3NF6A 1T8EA 4DHYA 4DTJA 3D2FA 1YJNN 1VSHA 1O13A 4FWPA 4DV5K 5IWAK 1M5Q1 3B6PA 5LMNK 4NCAA 3AO2A 4A2BA 3T3FA 3N89A 5J2QA 3TABA 3CXCM 1XI1A 2EHBD 1GLBG 4KH5A 3THXB 1TKDA
chains in the Genus database with same CATH topology
1N3CA 3NGIA 4F3OA 4PY5A 1S1UA 2IGIA 2YKNA 4DQQA 2OPRA 4KB0A 4OGEA 4HHTA 2FBYA 4CEBA 5I42A 1TKXA 3AVNA 1KYUA 2ZQBA 1JL2A 1REVA 3RMBA 4M3UA 1LAVA 4Z4EA 2HW3A 2X74A 3QIOA 4LH4A 1WAFA 3VN5A 2DFHA 1L3UA 4DG1A 2OZSA 2NUBA 3VQDA 1BI4B 2NOEA 3G0ZA 1BCMA 2G8VA 3OSMA 4E7IA 4AHCA 1MU2A 3O4NA 4JS5A 3V9SA 1NK6A 4PWDA 2G8KA 2Y1JA 1ZYQA 3VQ7A 1WSGA 4CHOA 3V4IA 4DF8A 2HHTA 3IRXA 2Y1IA 5IYDP 1EXQA 4Q0BA 1NH2A 4CJEA 1NK4A 3VQ5A 3ZSVA 1JXBA 3OVNA 5SWMA 2VWJA 2P5OA 3SJJA 1KY6A 4EP4A 4CJVA 3TAPA 1T03A 2DTUA 3DM2A 4ELVA 3V9WA 3LPTA 1YTFA 1TAUA 1HU0A 3CG7A 4BE2A 3DLEA 4LSNA 2YH5A 2ZE2A 4CE9A 1NJYA 4IG0A 3SCXA 4CF8A 1NKBA 2DFFA 3DRPA 1JL1A 4NCGA 1PZDA 2A1RA 1T05A 1NKCA 5CZ2A 1XC9A 1KFSA 1RTDA 1RBVA 1S1WA 4BWJA 3QEVA 4FJGA 4I2QA 4CJ5A 3BDPA 1RT1A 2KQ2A 1HQUA 4CEZA 4B9TA 2P51A 1ZBIA 1I3AA 1SKWA 3L3UA 3THVA 3E01A 4B0AA 4OGCA 1TL1A 3ZSZA 4CIEA 3NE6A 3TARA 1SKSA 1NKEA 4J2EA 1NVPA 2QXFA 4FLVA 3ZSRA 4M3XA 4QCLA 4RODB 3KLEA 5FRMA 3UIQA 2I5JA 3OCIA 3OS0A 1YTAA 3LZIA 3HL8A 1VSEA 1S1VA 1UAXA 3P1GA 4O4GA 3K57A 4FJXA 1BHLA 3SNSA 3NDKA 1VSJA 3LANA 1L3SA 4DU1A 4AHSA 2XHBA 2ZD1A 1FXXA 1TBAB 4RW9A 3RTVA 3VQ4A 1QN7A 4CHNA 3LDSA 1QSSA 3VQ8A 3G10A 3V1OA 4PQUA 1W9HA 4I7FA 2X78A 4B9LA 3V9ZA 1N39A 1KYDA 1YVUA 4CECA 1TGOA 1C9BB 1Q9YA 4FJNA 5FROA 2NOFA 2XY7A 5AN4A 3MEDA 1JLCA 2GBZA 3C94A 4I9LA 2FBVA 4FJLA 1HMVA 4JLHA 3SI6A 3C6UA 2YNGA 3ASMA 4ID1A 2PZSA 1IKYA 3MECA 1TKTA 1YQKA 4MQ3A 4RW4A 1QNEA 5HRRA 3NF9A 4Q11A 4CK1A 1NOZA 1JLGA 2R7YA 4OKKA 1C1BA 1KVCA 1ZBFA 3LP2A 4M41A 1U4BA 3HK2A 4KI6A 3KJVA 4F3TA 3CFOA 1C1AA 1IH7A 1RDBA 3HPOA 3KTUA 4FJIA 3K58A 1S5JA 1M3QA 3HPGA 1JKHA 4CJQA 1N5YA 4KHUA 1W0HA 4ROCB 3QLHA 3HS9A 5KGWA 4TPSA 1TVRA 3KK3A 3PX0A 3RMAA 3OYAA 2D0AA 4B9SA 2NOIA 1KFDA 4CESA 1KLMA 3LAMA 2VJ0A 2MJ7A 3ZT2A 2ATQA 2RKIA 5KRTA 1R4XA 4PUOA 1HYVA 1SL2A 2HVHA 3QETA 2HZSA 1RBTA 4OLAA 2HHVA 1RDCA 5KRSA 3AVMA 3TR8A 4O0IA 4IFYA 3WNHA 2E6MA 3M8QA 4BDZA 1N6QA 4ZTFA 1B9FA 2YHAA 3I0RA 4LH5A 1S9EA 5DK5A 3KK1A 4E89A 1C6VA 2IV9A 4CK2A 4DSJA 4HCCA 4ELTA 4C8OA 2W42A 2OPSA 3DLHA 1NOYA 3B6OA 1JLEA 4FK4A 3IS9A 1NGMA 3DMJA 3QEWA 4FJHA 4CJRA 3HO1A 1R0AA 4E0DA 3DLRA 4N47A 1RDAA 2JOIA 4DTSA 3HXMA 4AHTA 3K5OA 4DTXA 3MXJA 3KLFA 2IV8A 1JLAA 4GW6A 3AVKA 5CYQA 3HT3A 3F10A 2B5JA 3S3NA 4FYDA 2HHUA 1BGXT 4YFUA 1UA0A 2VG6A 2X6SA 3VQBA 3T19A 4I2PA 3ZT4A 2MZ8A 2NOBA 3V9UA 4E7KA 1TK8A 3NF8A 4CJFA 3O4QA 3DLGA 1QNAA 3C95A 3VA3A 2XHIA 4FJKA 3ZSOA 4HCBA 3QINA 3TAFA 2QKKA 2A1SA 3NHGA 4MFBA 3VA0A 1X1PA 2KZMA 3V1RA 3ZSWA 4BWMA 1BQMA 3IG1A 4CFAA 5J2NA 1Z26A 1J9AA 4ID5A 3TAEA 1NJWA 1FK9A 3SUOA 2YNFA 3AA3A 4M3RA 1GOBA 1NK9A 1JXEA 4IBNA 4CGDA 5T7BA 1S6PA 3F9KA 4N41A 3OYBA 3OYDA 4CJ4A 1WSHA 3LAKA 1RTJA 4OPKA 3TANA 1UOCA 2HB5A 3WNEA 2KZZA 3CM6A 1HYSA 4FCYA 3SUNA 4KB1A 4Z0UA 2HNZA 3IH7A 3BGRA 2XO7A 5J2MA 3ZSQA 3KTQA 3TAMA 1KYFA 2F8SA 3SPYA 1VSFA 1JLBA 1VSLA 3QEPA 4CF1A 2OPQA 3AVJA 4IFVA 5J1EA 3MEEA 4HTUA 2BE2A 5CZ1A 3RMCA 4AILC 3DRRA 3VQEA 4Z4IA 4H8KA 4I9QA 1CZBA 4F8RA 2ETJA 1VTOA 3WNFA 5SZTA 3OYJA 2HNDA 4KKOA 3RWUA 1D9FA 4M3ZA 3NAEA 3VQQA 4DQPA 3WNGA 3AV9A 4CERA 3S3OA 1CLQA 4OLBA 3OJSA 1RT5A 3D45A 4G1QA 3PO5A 3QEXA 2F8TA 3O3FA 2DFEA 4EZ6A 4RW7A 4BDYA 2VWKA 4HUEA 3KIOA 4LD0A 3KRMA 1B9DA 1SL1A 2YHBA 4CIFA 5J2PA 4KAZA 2G8WA 3VQ6A 1BQNA 4CEDA 4DFPA 3AVGA 5KTQA 1NK8A 3KD5E 3LALA 3U3GA 3OS1A 3I0WA 4O5BA 3AO5A 4CEOA 4KHYA 1C0MA 1VRTA 4CJTA 4IDKA 3ZT3A 1U04A 2Z1IA 3L2RA 3RR8A 4CF0A 3ZT0A 3HS8A 4CGGA 3SYZA 3PX4A 3PX6A 1U47A 4DU4A 4PA1A 3I0SA 3SQ0A 2NOHA 1RT7A 1VRUA 2RPIA 4CIGA 4DTRA 3TAGA 3NH1A 4ROEB 5DMRA 2PY5A 1C1CA 3F0ZA 1L5UA 1CXUA 1CZ9A 4B3OA 3V9XA 1D9DA 3AA4A 4FJMA 4FZZA 1D3UA 4I8OA 1PCZA 3I0XA 1YQLA 1RBUA 3IAYA 4FM0A 4Z4CA 4FK0A 4KFBA 4C8MA 4CEQA 1RTIA 3NGYA 5FRNA 3TAQA 2B4JA 1N3AA 4Z4GA 4FW1A 1LWYA 1Y97A 1IKWA 4FJ7A 4DFKA 1KSPA 5JS2A 4NCBA 3KKSA 1RT4A 2GV9A 4ZTJA 1NJZA 1BI4A 1Q8IA 1QNBA 3P83D 1DLOA 4E1MA 3M8PA 4M3YA 4C8LA 3RPJA 3DOKA 3OYFA 3AVLA 4FLZA 3DI6A 1KVAA 4W5RA 4IG3A 1FN7A 4EJZA 3CM5A 4CJPA 4DLEA 1LW0A 4EP5A 1ZBLA 3JSMA 1RNHA 1X9SA 1A5WA 4CK3A 4W5OA 4FLUA 2HHSA 1QN8A 4LY7A 1WSEA 1B9KA 3AO3A 4WE1A 4M45A 1MP9A 3KLGA 3MXIA 3U6FA 4EJYA 5EU7A 3PO4A 2BDPA 4W5QA 4KHNA 1HRHA 3AVIA 3QERA 4KO0A 3K5NA 3CFPA 4FZYA 4DQRA 1K6YA 3PY8A 1QN3A 4R5PA 3VQPA 1GOAA 1QQCA 4ICLA 3OJUA 3L8BA 3CQ8A 1KVBA 2G8IA 1RDDA 4RW8A 1XHZA 2O3OA 2FGTA 1L3VA 4AHUA 3OYCA 4OVLA 1HPZA 1RTHA 3SZ2A 3QNNA 1NK5A 3L2QA 4FVMA 5C42A 3RR7A 3OYIA 4B9NA 1D8YA 1XWLA 1Z25A 3NBPA 3ZT1A 3T1AA 1QTMA 1AISA 1KO9A 4O44A 3NGZA 4C8NA 4GVMA 1WLJA 4FZXC 1LWVA 3U3YA 1S6QA 4AHRA 4CHPA 3SQ2A 2DY4A 1YTBA 1WSFA 1LAWA 3LP0A 3OYGA 1RBRA 5FDLA 3OSTA 2B6AA 4CFCA 1X9MA 1YQMA 4FJJA 2HHXA 3NH2A 3JYTA 2Z1JA 4CCHA 1ZBHA 4FM1A 1T7PA 5HBMA 1W80A 2G30A 2Z8UA 3H08A 3KK2A 1A5VA 2I5WA 2Z1HA 1NJXA 1UA1A 3QNOA 1SUQA 4OKJA 4CJWA 1TAQA 3SQ1A 4FLWA 1SV5A 3LWMA 2IOCA 2G8UA 1S1TA 3M8RA 4OKEA 4DULA 3K5LA 3NFAA 4DTPA 4M3WA 1ASVA 3LP1A 4DLGA 3SV4A 3SPZA 1KRPA 4E3SA 1TK5A 5HRPA 3DOLA 3O3GA 3LWLA 1WAJA 1FKPA 1TV6A 4CF9A 1QNCA 3OYMA 3OYEA 3KD1E 4KTQA 3ZCMA 2YV0X 3VQAA 4K8XA 2O4IA 1HNVA 1QHTA 1BIUA 1EBMA 4B08A 3LPUA 3P5JA 3LZJA 2EHGA 4KPYA 4CEAA 2QK9A 2NOZA 4H4OA 1D5AA 4IKFA 3OYLA 4FW2A 4FJ8A 4E7LA 3HSTB 4KHSA 2YKMA 2X6NA 3OYKA 3HYFA 4EZ9A 1WSJA 1EX4A 1S1XA 5HRNA 2P5GA 4HUGA 3FFIA 3QEIA 3OYHA 1VTLE 5C24A 1VSKA 4DS5A 4E1NA 2G8FA 3EIKA 3L3VA 4AHVA 4O0JA 2KW4A 1VSIA 1BISA 3ITHA 4BE1A 4XIUA 4JS4A 2RN2A 3AVHA 3OC3C 4CGIA 1DTTA 1UWBA 1BIZA 1HYZA 3MEGA 4E7JA 1YT3A 1DTQA 4CEFA 3KLIA 2PYLA 4DTUA 4N56A 3NCIA 1J53A 4B9VA 4K8ZA 3SUPA 2LAEA 3OYNA 2KTQA 1SKRA 5E41A 3EY1A 4KHQA 3ULXA 1JLQA 3AA2A 1E42A 4CJKA 4JRQA 3ALYA 4DTNA 4CJUA 1VSDA 1IKVA 4KV8A 4CGHA 2HNYA 4BE0A 2XY8A 3O3HA 4DSLA 3C6TA 1UT4A 3RRHA 1VOKA 2D0BA 3QO9A 4B8AB 4RG8A 4DWIA 2HVIA 4CFBA 4DQSA 1ASWA 2EX3A 2XRIA 3KLHA 2HZMA 4LSLA 5IYCP 2IS3A 3LP3A 3ZSXA 3L2UA 4Y1DA 3HPHA 3RMDA 1L3TA 1VK0A 4OPJA 3SUQA 1QSYA 4J2AA 1ASUA 3PUFA 4CJ3A 3VQ9A 1RT3A 1I39A 3HP6A 1TKZA 2O4GA 4E7HA 3S3MA 1U45A 3AVCA 1QTSA 1YQRA 1X9WA 2HHWA 2E4LA 4KTWA 3M8SA 4FXDA 2D5RA 1GOCA 1LWFA 1M3HA 4DF4A 1RM1A 3V6DA 1TK0A 2FC0A 3HJFA 1RILA 1NK7A 4J2DA 3DLBA 2NOLA 3TWHA 2OYQA 1A5XA 4CJLA 1TL3A 3DPUA 2F96A 4CHYA 4N5SA 1VSMA 4DSFA 1QN6A 3V81A 1IG9A 1LWEA 2ITGA 3EZ5A 4F2RA 1J54A 3S9HA 3DPTA 4H4MA 4UQGA 4M42A 2QKBA 4DFJA 4QAGA 2WONA 2OZMA 4L8RB 1ZBUA 4QOZB 3ZSYA 4CHZA 4DU3A 2VG5A 3AA5X 3A2FA 2JGUA 3AVBA 5CY4A 1U48A 2WOMA 4FJ5A 4Q5VA 4W5TA 2PYJA 3QIPA 2YNIA 3DLKA 4F4KA 3CFRA 1RT6A 2D0CA 4KREA 1WN7A 3H1ZA 1YTUA 3MXMA 2FBXA 5KGXA 4F2SA 4W5NA 1O1WA 4DSEA 4DTMA 5CYMA 1BCOA 4M3TA 4TSXA 1LV5A 1QN4A 4FLXA 4OJRA 1XHXA 2VG7A 3HVTA 1CXQA 3D0PA 4FM2A 4KI4A 3SQ4A 3ISNC 1WNSA 4C8KA 1NK0A 5HP1A 1G15A 3DRSA 3K5MA 2IAJA 1LW2A 4RW6A 3VQCA 4ZHRA 4WZSD 1C0TA 5K14A 3SV3A 4CEEA 1BL3A 3QESA 1IKXA 1KTQA 1RT2A 2HMIA 2HHQA 3RRGA 4CHQA 3NF7A 3K59A 4NYNA 1S9GA 1EKEA 2IDOA 4FLYA 3TI0A 4ELUA 4FLTA 2GUIA 3HM9A 4DFMA 3CYMA 4KHWA 1IO2A 2JLEA 1TGHA 4B8CA 2IC3A 1QTPA 1QN9A 5HRSA 4J2BA 4FK2A 1EP4A 1QE1A 5HROA 4Z4FA 4KRFA 4GMJB 4Y1CA 5KI6A 2KFZA 3L2VA 2XY5A 1RCHA 5IYBP 1F21A 3MAQA 3F73A 2E6LA 1Q9XA 1JLFA 2YNHA 3HVRA 2OPPA 4DSKA 1KLNA 4CGFA 2G8HA 1RBSA 1WSIA 1FKOA 1VOLB 2RF2A 4N76A 3DYAA 1KY7A 4AH9A 1QN5A 1SL0A 3AVFA 1EETA 1U49A 4BDPA 5I3UA 3HP9A 3V1QA 5C25A 4B9MA 4DTOA 1TBPA 4YNQA 4HUFA 1ITGA 3I8DA 4Z4HA 1B92A 1LWCA 4BACA 3AO4A 2BGGA 1LWWA 2LSNA 1HQEA 2FBTA 1CDWA 4DMNA 4DQIA 2Q3SA 4DSIA 5JS1A 3NF6A 4HVJA 4NYFA 2XY6A 3EYZA 2OA8A 1QS4A 1T8EA 4DTJA 1JFIC 2KFNA 4JRPA 1KCFA 3AO1A 1VSHA 2BANA 4CF2A 4B9UA 1HJRA 4CJSA 3NH0A 4FJ9A 4CFDA 1QSLA 4E19A 1HNIA 3B6PA 2P1JA 3K2PA 3KKRA 1J5OA 4NCAA 3L2WA 3AO2A 2AJQA 3OS2A 3ULDA 3AVAA 3T3FA 4CGJA 4O55A 4KTZA 5D3GA 3PV8A 3SNNA 3N89A 4DS4A 5HLFA 5J2QA 3TABA 1XI1A 1C0UA 2Z1GA 1UT7A 3OY9A 1TKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NGI A;  4F3O A;  4PY5 A;  1S1U A;  2IGI A;  2YKN A;  4DQQ A;  2OPR A;  4KB0 A;  4OGE A;  4HHT A;  2FBY A;  4CEB A;  5I42 A;  1TKX A;  3AVN A;  1KYU A;  2ZQB A;  1JL2 A;  1REV A;  3RMB A;  4M3U A;  1LAV A;  4Z4E A;  2HW3 A;  2X74 A;  3QIO A;  4LH4 A;  1WAF A;  3VN5 A;  2DFH A;  1L3U A;  4DG1 A;  2OZS A;  2NUB A;  3VQD A;  1BI4 B;  3G0Z A;  2G8V A;  1BCM A;  4E7I A;  4AHC A;  1MU2 A;  3O4N A;  4JS5 A;  3V9S A;  1NK6 A;  4PWD A;  2G8K A;  2Y1J A;  1ZYQ A;  3VQ7 A;  1WSG A;  4CHO A;  3V4I A;  4DF8 A;  2HHT A;  3IRX A;  2Y1I A;  5IYD P;  1EXQ A;  1NH2 A;  4CJE A;  1NK4 A;  3VQ5 A;  3ZSV A;  1JXB A;  3OVN A;  5SWM A;  2VWJ A;  2P5O A;  3SJJ A;  1KY6 A;  4EP4 A;  4CJV A;  3TAP A;  1T03 A;  2DTU A;  3DM2 A;  4ELV A;  3V9W A;  3LPT A;  1YTF A;  1TAU A;  3CG7 A;  4BE2 A;  3DLE A;  4LSN A;  2ZE2 A;  4CE9 A;  1NJY A;  4IG0 A;  3SCX A;  4CF8 A;  1NKB A;  2DFF A;  3DRP A;  1JL1 A;  4NCG A;  1PZD A;  2A1R A;  1T05 A;  1NKC A;  5CZ2 A;  1XC9 A;  1KFS A;  1RTD A;  1RBV A;  1S1W A;  4BWJ A;  3QEV A;  4FJG A;  4I2Q A;  4CJ5 A;  3BDP A;  1RT1 A;  2KQ2 A;  1HQU A;  4CEZ A;  4B9T A;  2P51 A;  1ZBI A;  1I3A A;  1SKW A;  3L3U A;  3THV A;  3E01 A;  4B0A A;  4OGC A;  1TL1 A;  3ZSZ A;  4CIE A;  3NE6 A;  3TAR A;  1SKS A;  1NKE A;  4J2E A;  1NVP A;  2QXF A;  4FLV A;  3ZSR A;  4M3X A;  4QCL A;  4ROD B;  3KLE A;  5FRM A;  3UIQ A;  2I5J A;  3OCI A;  3OS0 A;  1YTA A;  3LZI A;  3HL8 A;  1VSE A;  1S1V A;  1UAX A;  3P1G A;  4O4G A;  3K57 A;  4FJX A;  1BHL A;  3NDK A;  1VSJ A;  3LAN A;  1L3S A;  4DU1 A;  4AHS A;  2XHB A;  2ZD1 A;  1FXX A;  1TBA B;  4RW9 A;  3RTV A;  3VQ4 A;  1QN7 A;  4CHN A;  3LDS A;  1QSS A;  3VQ8 A;  3G10 A;  3V1O A;  4PQU A;  1W9H A;  4I7F A;  2X78 A;  4B9L A;  3V9Z A;  1KYD A;  1YVU A;  4CEC A;  1TGO A;  1C9B B;  1Q9Y A;  4FJN A;  5FRO A;  2XY7 A;  3MED A;  1JLC A;  2GBZ A;  3C94 A;  4I9L A;  2FBV A;  4FJL A;  1HMV A;  4JLH A;  3SI6 A;  3C6U A;  2YNG A;  3ASM A;  4ID1 A;  2PZS A;  1IKY A;  3MEC A;  1TKT A;  4MQ3 A;  4RW4 A;  1QNE A;  5HRR A;  3NF9 A;  2HMI A;  4CK1 A;  1NOZ A;  1JLG A;  2R7Y A;  4OKK A;  1C1B A;  1KVC A;  1ZBF A;  3LP2 A;  4M41 A;  1U4B A;  3HK2 A;  4KI6 A;  3KJV A;  4F3T A;  3CFO A;  1C1A A;  1IH7 A;  1RDB A;  3HPO A;  4FJI A;  3K58 A;  1S5J A;  3HPG A;  4CJQ A;  1JKH A;  1N5Y A;  4KHU A;  1W0H A;  4ROC B;  3QLH A;  3HS9 A;  5KGW A;  1TVR A;  3KK3 A;  3PX0 A;  3RMA A;  3OYA A;  2D0A A;  4B9S A;  1KFD A;  4CES A;  1KLM A;  3LAM A;  2VJ0 A;  2MJ7 A;  3ZT2 A;  2ATQ A;  2RKI A;  5KRT A;  1R4X A;  4PUO A;  1HYV A;  1SL2 A;  2HVH A;  3QET A;  1RBT A;  4OLA A;  2HHV A;  1RDC A;  5KRS A;  3AVM A;  3TR8 A;  4O0I A;  4IFY A;  3WNH A;  2E6M A;  3M8Q A;  4BDZ A;  1N6Q A;  4ZTF A;  1B9F A;  2YHA A;  3I0R A;  4LH5 A;  1S9E A;  5DK5 A;  3KK1 A;  4E89 A;  1C6V A;  2IV9 A;  4CK2 A;  4DSJ A;  4HCC A;  4C8O A;  2W42 A;  2OPS A;  3DLH A;  1NOY A;  3B6O A;  1JLE A;  4FK4 A;  3IS9 A;  1NGM A;  3DMJ A;  3QEW A;  4FJH A;  4CJR A;  3HO1 A;  1R0A A;  4E0D A;  3DLR A;  4N47 A;  1RDA A;  4DTS A;  3HXM A;  4AHT A;  3K5O A;  4DTX A;  3MXJ A;  3KLF A;  2IV8 A;  1JLA A;  4GW6 A;  3AVK A;  5CYQ A;  3HT3 A;  2B5J A;  3S3N A;  4FYD A;  2HHU A;  1BGX T;  4YFU A;  1UA0 A;  2VG6 A;  2X6S A;  3VQB A;  3T19 A;  4I2P A;  3ZT4 A;  4E7K A;  3V9U A;  1TK8 A;  4ELT A;  3NF8 A;  4CJF A;  3O4Q A;  3DLG A;  1QNA A;  3C95 A;  3VA3 A;  4FJK A;  3ZSO A;  4HCB A;  3QIN A;  3TAF A;  2QKK A;  2A1S A;  3NHG A;  4MFB A;  3VA0 A;  1X1P A;  2KZM A;  3V1R A;  3ZSW A;  4BWM A;  1BQM A;  3IG1 A;  4CFA A;  5J2N A;  1Z26 A;  1J9A A;  4ID5 A;  3TAE A;  1NJW A;  1FK9 A;  3SUO A;  2YNF A;  3AA3 A;  4M3R A;  1GOB A;  1NK9 A;  1JXE A;  4IBN A;  4CGD A;  5T7B A;  1S6P A;  3F9K A;  4N41 A;  3OYB A;  3OYD A;  4CJ4 A;  1WSH A;  3LAK A;  1RTJ A;  4OPK A;  3TAN A;  1UOC A;  2HB5 A;  3WNE A;  2KZZ A;  3CM6 A;  1HYS A;  4FCY A;  3SUN A;  4KB1 A;  4Z0U A;  2HNZ A;  3BGR A;  2XO7 A;  3KTQ A;  5J2M A;  3ZSQ A;  3TAM A;  1KYF A;  2F8S A;  3SPY A;  1VSF A;  1JLB A;  1VSL A;  3QEP A;  4CF1 A;  2OPQ A;  3AVJ A;  4IFV A;  5J1E A;  3MEE A;  4HTU A;  2BE2 A;  5CZ1 A;  3RMC A;  4AIL C;  3DRR A;  3VQE A;  4Z4I A;  4H8K A;  4I9Q A;  1CZB A;  4F8R A;  2ETJ A;  1VTO A;  3WNF A;  5SZT A;  3OYJ A;  2HND A;  4KKO A;  3RWU A;  1D9F A;  4M3Z A;  3NAE A;  3VQQ A;  4DQP A;  3WNG A;  3AV9 A;  4CER A;  3S3O A;  1CLQ A;  4OLB A;  3OJS A;  1RT5 A;  3D45 A;  4G1Q A;  3PO5 A;  3QEX A;  2F8T A;  3O3F A;  2DFE A;  4EZ6 A;  4RW7 A;  4BDY A;  2VWK A;  4HUE A;  3KIO A;  4LD0 A;  1SL1 A;  1B9D A;  2YHB A;  4CIF A;  5J2P A;  4KAZ A;  2G8W A;  3VQ6 A;  1BQN A;  4CED A;  4DFP A;  3AVG A;  5KTQ A;  1NK8 A;  3KD5 E;  3LAL A;  3U3G A;  3OS1 A;  4O5B A;  3AO5 A;  4CEO A;  4KHY A;  1C0M A;  1VRT A;  4IDK A;  3ZT3 A;  1U04 A;  2Z1I A;  3L2R A;  3RR8 A;  4CF0 A;  3ZT0 A;  3HS8 A;  4CGG A;  3SYZ A;  3PX4 A;  3PX6 A;  1U47 A;  4DU4 A;  4PA1 A;  3I0S A;  3SQ0 A;  1VRU A;  1RT7 A;  2RPI A;  4CIG A;  4DTR A;  3TAG A;  3NH1 A;  4ROE B;  5DMR A;  2PY5 A;  1C1C A;  1L5U A;  1CXU A;  1CZ9 A;  4B3O A;  3V9X A;  1D9D A;  3AA4 A;  4FJM A;  4FZZ A;  1D3U A;  1PCZ A;  1RBU A;  3IAY A;  4FM0 A;  4Z4C A;  4KFB A;  4C8M A;  4CEQ A;  1RTI A;  3NGY A;  5FRN A;  3TAQ A;  2B4J A;  4Z4G A;  4FW1 A;  4FJ7 A;  1Y97 A;  1IKW A;  4DFK A;  1KSP A;  5JS2 A;  4NCB A;  3KKS A;  1RT4 A;  2GV9 A;  4ZTJ A;  1NJZ A;  1BI4 A;  1Q8I A;  1QNB A;  3P83 D;  1DLO A;  4E1M A;  3M8P A;  4M3Y A;  4C8L A;  3DOK A;  3OYF A;  3AVL A;  4FLZ A;  3DI6 A;  1KVA A;  4W5R A;  4IG3 A;  3CM5 A;  4CJP A;  4DLE A;  1ZBL A;  1LW0 A;  4EP5 A;  1X9S A;  3JSM A;  1RNH A;  1A5W A;  4CK3 A;  4W5O A;  4FLU A;  2HHS A;  1QN8 A;  4LY7 A;  1WSE A;  1B9K A;  3AO3 A;  4WE1 A;  4M45 A;  1MP9 A;  3KLG A;  3MXI A;  3U6F A;  3PO4 A;  5EU7 A;  4F2S A;  2BDP A;  4W5Q A;  4KHN A;  1HRH A;  3AVI A;  3QER A;  4KO0 A;  3K5N A;  3CFP A;  4FZY A;  4DQR A;  1K6Y A;  3PY8 A;  1QN3 A;  4R5P A;  3VQP A;  1GOA A;  1QQC A;  4ICL A;  3OJU A;  3L8B A;  3CQ8 A;  1KVB A;  2G8I A;  1RDD A;  4RW8 A;  1XHZ A;  1L3V A;  4AHU A;  3OYC A;  4OVL A;  1HPZ A;  1RTH A;  3SZ2 A;  3QNN A;  1NK5 A;  3L2Q A;  4FVM A;  5C42 A;  3RR7 A;  3OYI A;  4B9N A;  1D8Y A;  1XWL A;  1Z25 A;  3NBP A;  3ZT1 A;  3T1A A;  1QTM A;  1AIS A;  4O44 A;  3NGZ A;  4C8N A;  4GVM A;  1WLJ A;  4FZX C;  3U3Y A;  1S6Q A;  4AHR A;  4CHP A;  3SQ2 A;  2DY4 A;  1YTB A;  1WSF A;  1LAW A;  3LP0 A;  3OYG A;  1RBR A;  5FDL A;  4FK0 A;  2B6A A;  4CFC A;  1X9M A;  4FJJ A;  2HHX A;  3NH2 A;  3JYT A;  2Z1J A;  4CCH A;  1ZBH A;  4FM1 A;  1T7P A;  5HBM A;  2G30 A;  1W80 A;  2Z8U A;  3H08 A;  3KK2 A;  1A5V A;  2Z1H A;  1NJX A;  1UA1 A;  3QNO A;  1SUQ A;  4OKJ A;  4CJW A;  1TAQ A;  3SQ1 A;  4FLW A;  1SV5 A;  3LWM A;  2IOC A;  2G8U A;  1S1T A;  3M8R A;  4OKE A;  4M3W A;  3K5L A;  3NFA A;  4DTP A;  1ASV A;  3LP1 A;  4DLG A;  3SV4 A;  3SPZ A;  1KRP A;  4E3S A;  1TK5 A;  5HRP A;  3DOL A;  3O3G A;  3LWL A;  1WAJ A;  1FKP A;  1TV6 A;  4CF9 A;  1QNC A;  3OYM A;  3OYE A;  3KD1 E;  4KTQ A;  3ZCM A;  2YV0 X;  3VQA A;  4K8X A;  2O4I A;  1HNV A;  1QHT A;  1BIU A;  4B08 A;  4KPY A;  3LPU A;  3P5J A;  3LZJ A;  2EHG A;  2QK9 A;  4CEA A;  4Q0B A;  4H4O A;  1D5A A;  4IKF A;  3OYL A;  4FW2 A;  4FJ8 A;  4E7L A;  3HST B;  4KHS A;  2YKM A;  2X6N A;  3OYK A;  3HYF A;  4EZ9 A;  1WSJ A;  1EX4 A;  1S1X A;  5HRN A;  2P5G A;  4HUG A;  3FFI A;  3QEI A;  3OYH A;  1VTL E;  5C24 A;  1VSK A;  4DS5 A;  4E1N A;  2G8F A;  3EIK A;  3L3V A;  4AHV A;  4O0J A;  2KW4 A;  1VSI A;  1BIS A;  3ITH A;  4BE1 A;  4XIU A;  4JS4 A;  2RN2 A;  3AVH A;  3OC3 C;  4CGI A;  1DTT A;  1UWB A;  1BIZ A;  1HYZ A;  3MEG A;  4E7J A;  1YT3 A;  1DTQ A;  4CEF A;  3KLI A;  2PYL A;  4DTU A;  4N56 A;  3NCI A;  1J53 A;  4B9V A;  4K8Z A;  3SUP A;  3OYN A;  2KTQ A;  1SKR A;  5E41 A;  3EY1 A;  4KHQ A;  1JLQ A;  3AA2 A;  1E42 A;  4CJK A;  4JRQ A;  3ALY A;  4DTN A;  4CJU A;  1VSD A;  1IKV A;  4KV8 A;  4CGH A;  2HNY A;  4BE0 A;  2XY8 A;  3O3H A;  4DSL A;  3C6T A;  3RRH A;  1VOK A;  2D0B A;  3QO9 A;  4B8A B;  4RG8 A;  4DWI A;  2HVI A;  4CFB A;  4DQS A;  1ASW A;  2EX3 A;  2XRI A;  3KLH A;  4LSL A;  3L2U A;  5IYC P;  2IS3 A;  3LP3 A;  3ZSX A;  4Y1D A;  3HPH A;  3RMD A;  1L3T A;  1VK0 A;  4OPJ A;  3SUQ A;  1QSY A;  4J2A A;  1ASU A;  3PUF A;  4CJ3 A;  3VQ9 A;  1RT3 A;  1I39 A;  3HP6 A;  1TKZ A;  2O4G A;  4E7H A;  3S3M A;  1U45 A;  3AVC A;  1QTS A;  1X9W A;  2HHW A;  2E4L A;  4KTW A;  3M8S A;  4FXD A;  2D5R A;  1GOC A;  1LWF A;  4DF4 A;  1RM1 A;  3V6D A;  1TK0 A;  2FC0 A;  3HJF A;  1RIL A;  1NK7 A;  4J2D A;  3DLB A;  3TWH A;  2OYQ A;  1A5X A;  4CJL A;  1TL3 A;  4CHY A;  2F96 A;  4N5S A;  4DSF A;  1VSM A;  3V81 A;  1QN6 A;  1IG9 A;  1LWE A;  2ITG A;  3EZ5 A;  4F2R A;  1J54 A;  3S9H A;  4H4M A;  4UQG A;  4M42 A;  2QKB A;  4DFJ A;  4QAG A;  2WON A;  2OZM A;  4L8R B;  1ZBU A;  4QOZ B;  3ZSY A;  4CHZ A;  4DU3 A;  2VG5 A;  3AA5 X;  3A2F A;  2JGU A;  3AVB A;  5CY4 A;  1U48 A;  2WOM A;  4FJ5 A;  4Q5V A;  4W5T A;  2PYJ A;  3QIP A;  2YNI A;  3DLK A;  4F4K A;  3CFR A;  1RT6 A;  2D0C A;  4KRE A;  1WN7 A;  3H1Z A;  1YTU A;  3MXM A;  2FBX A;  5KGX A;  4W5N A;  1O1W A;  4DSE A;  4DTM A;  5CYM A;  1BCO A;  4M3T A;  4TSX A;  1LV5 A;  1QN4 A;  4FLX A;  4OJR A;  1XHX A;  2VG7 A;  3HVT A;  1CXQ A;  3D0P A;  4FM2 A;  4KI4 A;  3SQ4 A;  3ISN C;  1WNS A;  4C8K A;  1NK0 A;  5HP1 A;  1G15 A;  3DRS A;  3K5M A;  2IAJ A;  1LW2 A;  4RW6 A;  3VQC A;  4ZHR A;  4WZS D;  1C0T A;  5K14 A;  3SV3 A;  4CEE A;  1BL3 A;  3QES A;  1IKX A;  1KTQ A;  1RT2 A;  2HHQ A;  3RRG A;  4CHQ A;  3NF7 A;  3K59 A;  4NYN A;  1S9G A;  1EKE A;  2IDO A;  4FLY A;  3TI0 A;  4ELU A;  4FLT A;  2GUI A;  3HM9 A;  4DFM A;  3CYM A;  4KHW A;  1IO2 A;  2JLE A;  1TGH A;  4B8C A;  2IC3 A;  1QTP A;  1QN9 A;  5HRS A;  4J2B A;  4FK2 A;  1EP4 A;  1QE1 A;  5HRO A;  4Z4F A;  4KRF A;  4GMJ B;  4Y1C A;  5KI6 A;  2KFZ A;  3L2V A;  2XY5 A;  1RCH A;  5IYB P;  1F21 A;  3MAQ A;  3F73 A;  2E6L A;  1Q9X A;  1JLF A;  2YNH A;  3HVR A;  2OPP A;  4DSK A;  1KLN A;  4CGF A;  2G8H A;  1RBS A;  1WSI A;  1FKO A;  1VOL B;  2RF2 A;  4N76 A;  3DYA A;  1KY7 A;  4AH9 A;  1QN5 A;  1SL0 A;  3AVF A;  1EET A;  1U49 A;  4BDP A;  5I3U A;  3HP9 A;  3V1Q A;  5C25 A;  4B9M A;  4DTO A;  1TBP A;  4YNQ A;  4HUF A;  1ITG A;  3I8D A;  4Z4H A;  1B92 A;  1LWC A;  4BAC A;  3AO4 A;  2BGG A;  2LSN A;  1HQE A;  2FBT A;  1CDW A;  4DMN A;  4DQI A;  2Q3S A;  4DSI A;  5JS1 A;  3NF6 A;  4HVJ A;  4NYF A;  2XY6 A;  3EYZ A;  2OA8 A;  1QS4 A;  1T8E A;  4DTJ A;  1JFI C;  2KFN A;  4JRP A;  1KCF A;  3AO1 A;  1VSH A;  2BAN A;  4CF2 A;  4B9U A;  1HJR A;  4CJS A;  3NH0 A;  4FJ9 A;  4CFD A;  1QSL A;  4E19 A;  1HNI A;  3B6P A;  2P1J A;  3K2P A;  3KKR A;  1J5O A;  4NCA A;  3L2W A;  3AO2 A;  2AJQ A;  3OS2 A;  3ULD A;  3AVA A;  3T3F A;  4CGJ A;  4O55 A;  4KTZ A;  5D3G A;  3PV8 A;  3SNN A;  5HLF A;  4DS4 A;  5J2Q A;  3TAB A;  1XI1 A;  1C0U A;  2Z1G A;  4CJT A;  3OY9 A;  1TKD A; 
#chains in the Genus database with same CATH topology
 1VQ4 N;  1YHQ N;  3VOV A;  3NGI A;  2IGI A;  2YHY A;  4BRM A;  3C0B A;  1EWR A;  5I42 A;  4JKG B;  4M3U A;  1LAV A;  2E2Q A;  2X74 A;  1L3U A;  2DFH A;  4CZE A;  2CGJ A;  3ID6 A;  2Y8Q A;  2YJF A;  4JKF A;  1MA9 B;  2P9K B;  1MU2 A;  2A41 A;  2Y8L A;  2UUB K;  3QBW A;  2E2P A;  4K41 A;  3V4I A;  2QWP A;  3J81 O;  2IVP A;  4CJE A;  3OVN A;  1HKC A;  3V9W A;  4DQ8 A;  4M7Y A;  2YH5 A;  1ATS A;  2AA4 A;  2ZE2 A;  1GLC G;  1DEJ A;  2A1R A;  3AGK A;  1XC9 A;  1RBV A;  3QEV A;  1S22 A;  1RT1 A;  1ZBI A;  4WYB A;  3AAP A;  5KQ8 A;  3THV A;  5AQL A;  4HCC A;  2IIR A;  4BRE A;  4J2E A;  1NVP A;  4PKH A;  3ZSR A;  3DLL L;  4KHP K;  4LFB K;  3T4N A;  4IEI A;  3LZI A;  3OCI A;  1YTA A;  1VSE A;  4DR3 K;  4JEP A;  3P1G A;  5AQJ A;  1BHL A;  3NDK A;  1OH5 A;  2A5X A;  4DU1 A;  4AHS A;  2XHB A;  2ZJR L;  4CBU A;  5JIC A;  4JK9 A;  2PWW A;  3VQ4 A;  1QN7 A;  4I7F A;  2BTF A;  3PMG A;  4YDU C;  4BRC A;  4FJN A;  3CCS N;  2YA3 A;  2XY7 A;  5AN4 A;  2O8D A;  4CZG A;  3SI6 A;  3C6U A;  2YNG A;  2PZS A;  1M1K O;  3CI5 A;  3MEC A;  2FUV A;  5F0X A;  4FOE A;  1NGC A;  2OAN A;  5AQF A;  3LP2 A;  5BMP A;  3FFK B;  1IBM K;  3CFO A;  4V19 S;  1C1A A;  5AQO A;  2FKM X;  4FJI A;  1S5J A;  1JKH A;  4BRD A;  3HS9 A;  1OKJ A;  3EKU A;  2NOI A;  4CES A;  4YOR A;  2VJ0 A;  3ZT2 A;  2E1Z A;  2RKI A;  1SL2 A;  2HVH A;  1IBK K;  5KRS A;  3TR8 A;  1SZ2 A;  1B9F A;  5BRF A;  3I0R A;  3I3W A;  1S72 N;  3MN7 A;  4FVU A;  3R8E A;  1VQM N;  1NOY A;  4PL8 A;  3HO1 A;  3QEW A;  1W97 L;  1KAZ A;  4N47 A;  2QWR A;  2JOI A;  3K5O A;  3MXJ A;  5AQT A;  2IV8 A;  5CYQ A;  3EL2 A;  3AVK A;  3O9Q A;  2H3G X;  5JMV D;  2ZJP L;  3VQB A;  2O8F B;  4I2P A;  2MZ8 A;  2AP1 A;  4BRI A;  1QVG M;  3O4Q A;  3H6E A;  1YJ9 N;  3QIN A;  3TAF A;  3V1R A;  4CFA A;  2Q0R A;  5J2N A;  3LDO A;  3SAG A;  1NJW A;  3SUO A;  1BA1 A;  2Q31 A;  5T7B A;  5AQK A;  5GIN A;  3F9K A;  4N41 A;  4CJ4 A;  3LAK A;  1WBD A;  1VKL A;  1HYS A;  3IH7 A;  5J2M A;  1NGH A;  1KYF A;  1NGE A;  1XSZ A;  1VSF A;  1JLB A;  3MEE A;  3QFU A;  3MN9 A;  4O8K A;  3VQE A;  3I56 N;  4H8K A;  1JCF A;  1MWM A;  3VEY A;  1Y64 A;  1VTO A;  1KAX A;  5SZT A;  3U9D A;  4DV4 K;  3EE8 A;  4WQ5 C;  3VMF B;  3WNG A;  3AV9 A;  3THW A;  4BRK A;  1RT5 A;  3QEX A;  2F8T A;  3KZB A;  3CPE A;  3KIO A;  2P9L B;  2JWL A;  3G25 A;  4LD0 A;  4BGA A;  5JMV A;  3CQX A;  3CVS A;  5J2P A;  4KAZ A;  3VQ6 A;  1BQN A;  3OW2 M;  4KH6 A;  3LAL A;  3AO5 A;  4QS7 A;  3U4L A;  4IDK A;  2Z1I A;  3PX6 A;  1FW6 A;  1UL7 A;  4JKH A;  4DU4 A;  2NOH A;  1RT7 A;  2RPI A;  1MDU B;  3QML A;  4CIG A;  4C1N K;  4BR2 A;  4ROE B;  4WFA L;  5DMR A;  2PY5 A;  3RSM A;  3F0Z A;  3QBX A;  4NB4 A;  1CZ9 A;  3V9X A;  3HSC A;  1D3U A;  1PCZ A;  1RBU A;  3ENO A;  2A3Z A;  5HSH A;  2CGL A;  4C8M A;  4I6M A;  4MRQ A;  1RTI A;  5FRN A;  3TAQ A;  4FW1 A;  1Y97 A;  4DFK A;  1RT4 A;  1CZA N;  1DLO A;  5C2F A;  4E1M A;  2FKF A;  3RPJ A;  2KLA A;  4DV1 K;  4FLZ A;  2E88 A;  3WQT A;  4BG8 A;  4W5R A;  2NRV A;  4IG3 A;  5FPM A;  3JSM A;  3TU5 A;  1B9K A;  4GV6 A;  3MXI A;  5EU7 A;  3N4P A;  4DQR A;  1QN3 A;  2KHO A;  2G8I A;  5GAE P;  1YXQ A;  5GIP A;  3OTO K;  3FE1 A;  1L3V A;  4HJH A;  1N34 K;  2W6K A;  4FWK A;  5FPN A;  5I9E B;  5C42 A;  4QG5 A;  4IOC L;  4B9N A;  1XWL A;  3ULE B;  3NBP A;  3C65 A;  1QTM A;  1AIS A;  1KC8 O;  1WLJ A;  1S6Q A;  5CHI A;  1LAW A;  3LP0 A;  5FDL A;  2HHX A;  2B6A A;  3A5N C;  4CBX A;  4BRF A;  3AGR A;  4CCH A;  2CH6 A;  4WFB L;  2ZJQ L;  4FM1 A;  5HBM A;  1W80 A;  2G30 A;  3UE5 A;  4B9Q A;  1A5V A;  2I5W A;  4ILJ A;  4ILG B;  3QNO A;  4OKJ A;  4CJW A;  3CPW M;  3OBW A;  3SQ1 A;  3T69 A;  2QW9 A;  3BF1 A;  5JVH L;  1S1T A;  2YCH A;  1G99 A;  4DR1 K;  1BG3 A;  4GV9 A;  3NFA A;  1MPG A;  1ASV A;  3MX2 A;  4JI7 K;  3R6M A;  3DOL A;  3OYM A;  1TV6 A;  3KD1 E;  1PCM X;  2NWV A;  2YV0 X;  1HNV A;  3UKR A;  3CCR N;  1Q81 O;  4CEA A;  2GX9 A;  4H4O A;  1D5A A;  1SS6 A;  4IKF A;  4LF5 K;  2HBK A;  4JI5 K;  3HST B;  5EOY A;  2UYT A;  1NGD A;  1P5G X;  1S1X A;  4MO4 A;  1VSK A;  1DIZ A;  4E1N A;  4O0J A;  3M6G A;  2KKZ A;  1UWB A;  3MEG A;  4CZI A;  4E7J A;  4B9V A;  2D0O A;  4K8Z A;  4CZL A;  4E1J A;  5F2R A;  5ADX H;  4DV0 K;  3OYN A;  1XQS C;  3E1Y A;  5CR4 A;  4YOV A;  3O4W A;  3CCM N;  3GBT A;  1JLQ A;  3ID8 A;  3AA2 A;  1J3M A;  4CJK A;  3ALY A;  3ATV A;  3C6A A;  4DTN A;  1VSD A;  1IKV A;  4DSL A;  3N4Q A;  3ZX2 A;  4RWT A;  2WC9 A;  3EN9 A;  4B8A B;  2HVI A;  1V4T A;  3DXK B;  4BVP A;  3LP3 A;  4H0P A;  4Y1D A;  3JAM O;  5LY3 A;  1QSY A;  1ASU A;  2E8A A;  3O1W A;  1RT3 A;  1TKZ A;  2O4G A;  1U45 A;  2P9I B;  1HKG A;  1YQR A;  3WXK A;  1U2V A;  1GOC A;  3C04 A;  1M3H A;  1TK0 A;  2FC0 A;  3HJF A;  2OYQ A;  1A5X A;  1TL3 A;  5LL6 Z;  2F96 A;  1T6A A;  1Q18 A;  4F2R A;  1BU6 O;  2GTD A;  1J54 A;  4H4M A;  2QKB A;  4DFJ A;  4AM6 A;  2WON A;  4L8R B;  1LOT B;  5AZI A;  3HTV A;  4DU3 A;  2VG5 A;  3O1B A;  1U48 A;  3KK7 A;  4FJ5 A;  4Q5V A;  3QIP A;  4WFN L;  3CFR A;  3VTH A;  4NLB A;  4BRL A;  5KGX A;  4DSE A;  1XHX A;  3HVT A;  3D0P A;  1CXQ A;  1NGF A;  3B8A X;  3ISN C;  1DGK N;  2P9N B;  5HP1 A;  3K5M A;  3OBY A;  4JI8 K;  1QZ6 A;  2IAJ A;  4BRH A;  1MWK A;  4ZHR A;  1C0T A;  3QES A;  3O80 A;  3SMS A;  2P9S A;  4DV2 K;  4DFM A;  4KHW A;  2BUP A;  5HRS A;  1EP4 A;  1QE1 A;  3BF3 A;  4GMJ B;  5KI6 A;  4JI2 K;  3O9R A;  3L2V A;  3CWT A;  1RCH A;  4JNE A;  1JLF A;  3PSF A;  2FSN A;  2HBL A;  4NLC A;  4DSK A;  4CW7 B;  2G8H A;  1RBS A;  4N76 A;  1HNX K;  1KY7 A;  2HL9 A;  3KWG A;  1EET A;  4BDP A;  5C25 A;  1BA0 A;  4HUF A;  3I8D A;  4FWS A;  4BR9 A;  4Z4H A;  1LWC A;  2CH5 A;  1Z05 A;  4BAC A;  1LWW A;  4EIA A;  3UKU A;  2NRX A;  4C1N I;  4HVJ A;  4BRO A;  4CZK A;  1JFI C;  4D7R A;  5AZJ B;  3AO1 A;  3MWP A;  4CJS A;  4ISE A;  4CFD A;  3CD6 N;  4E19 A;  2OTL N;  3K2P A;  2AJQ A;  3ULD A;  4CGJ A;  3NVM A;  5AQM A;  3WUH A;  5D3G A;  2V7Y A;  2Z1G A;  1N3C A;  3PIO L;  3ZET B;  2YKN A;  4DQQ A;  2OPR A;  2VYP A;  4OGE A;  4B1V A;  4HHT A;  1ZXO A;  4CEB A;  3CET A;  4FO0 A;  3AVN A;  2ZQB A;  3RMB A;  1REV A;  3T1H K;  2UXB K;  1GLE G;  1XMO K;  3TPQ A;  3VQD A;  3G0Z A;  2NLV A;  3OSM A;  1V5S A;  3VPZ A;  3V9S A;  2HBJ A;  2G8K A;  3VQ7 A;  4CHO A;  4DF8 A;  2Y1I A;  4IEE A;  2FXU A;  3ZSV A;  2VWJ A;  3SAH A;  1KY6 A;  4HWI A;  1T03 A;  2DTU A;  4NXM K;  1HU0 A;  3CG7 A;  5JN5 A;  3BEX A;  4LSN A;  1NMD A;  4IL8 A;  4CE9 A;  4IG0 A;  4DUY K;  1NKB A;  1K2Y X;  4BJU A;  4NCG A;  1PZD A;  1NU0 A;  1KFS A;  4FJG A;  1XNR K;  1RTD A;  4I2Q A;  4CJ5 A;  1HQU A;  1EWQ A;  1I3A A;  4JD2 A;  3L3U A;  5B8H A;  3E01 A;  4B0A A;  1TL1 A;  1SKS A;  1IV0 A;  2QXF A;  3CF5 L;  2E20 A;  4BC5 A;  5FRM A;  3OS0 A;  3HL8 A;  1S1V A;  3SNS A;  2V7Z A;  1VSJ A;  3LAN A;  1FXX A;  2HL8 A;  1BUP A;  3RTV A;  3VGK A;  3LDS A;  4JKA A;  3G10 A;  4B3S K;  2X78 A;  4AF1 A;  3ENH A;  4FWL A;  4IZ9 A;  1EUV A;  3V9Z A;  1YVU A;  2ZGZ A;  4CEC A;  3LDN A;  4BRQ A;  3MED A;  4JI3 K;  1JLC A;  2GBZ A;  1WBB A;  4ID1 A;  1QQM A;  5A2Q O;  1VHX A;  4RW4 A;  1QNE A;  3HOT A;  3NF9 A;  3CWA A;  4DR6 K;  1S3X A;  2A40 A;  1C1B A;  2QWO A;  2O8E A;  3HK2 A;  3KJV A;  2V8Q A;  5H1S Q;  1IH7 A;  1RDB A;  3KTU A;  3K58 A;  1M3Q A;  3HPG A;  3QLH A;  3CME N;  1Q9U A;  1TVR A;  3KK3 A;  3PX0 A;  3OYA A;  1XC3 A;  5EY4 A;  3M3Z A;  2ATQ A;  5KRT A;  4PUO A;  1HYV A;  2HHV A;  1RDC A;  3OY9 A;  3LL3 A;  2JHN A;  1VQK N;  5JLF A;  4BDZ A;  4CJ7 A;  4ZTF A;  2YHA A;  5DK5 A;  2UUA K;  4E89 A;  2P9U A;  4DSJ A;  1NGJ A;  3TTD A;  2W42 A;  2OPS A;  4MDB A;  1JLE A;  1NGM A;  2YJE A;  3DXM B;  1KQS M;  1R0A A;  2R5X A;  1QQN A;  3DLR A;  1RDA A;  3HXM A;  4B1Z A;  4DTX A;  1GLL O;  3R9P A;  4GW6 A;  4EAL A;  4CVN E;  2B5J A;  3HT3 A;  3S3N A;  4AM7 A;  4BQZ A;  5C12 A;  4FYD A;  2HHU A;  3KHY A;  1Z6R A;  1QQO A;  2VG6 A;  1TK8 A;  3T19 A;  2NOB A;  3BP8 A;  3FZL A;  1QNA A;  3ZSO A;  2A1S A;  5AZI B;  1W2B M;  2KZM A;  1X1P A;  5AQZ A;  4BWM A;  1BQM A;  5KPR A;  4ID5 A;  1P90 A;  2YNF A;  4M3R A;  4CGD A;  2W41 A;  3I55 N;  1UOC A;  2HB5 A;  3WNE A;  5M1N A;  2E5L K;  3CM6 A;  3SUN A;  4Z0U A;  2XO7 A;  4X62 K;  2WBN A;  3KTQ A;  1J6Z A;  4B1U B;  2F8S A;  3ATU A;  4M63 C;  3O9S A;  1VSL A;  2ZM6 K;  4CF1 A;  2OPQ A;  5J1E A;  2BE2 A;  1VQL N;  3RMC A;  4AIL C;  1WUA A;  4Z4I A;  4I9Q A;  1CZB A;  4F8R A;  1HKB A;  3OYJ A;  2HND A;  2P9S B;  3RWU A;  1K9M O;  4CER A;  4OLB A;  3OJS A;  3D45 A;  3CJB A;  3O3F A;  2DFE A;  1VQ9 N;  2ZWH A;  2YI1 A;  3E9O A;  1E3M A;  3A5M C;  2YX6 A;  4ISF A;  4DFP A;  3AVG A;  4GVE A;  3KD5 E;  2O8C A;  3THY A;  1YIT N;  1GLJ O;  3IKM A;  1VRT A;  3RR8 A;  1KFI A;  3HS8 A;  3GL1 A;  3PX4 A;  1U47 A;  2O8B A;  4PA1 A;  1HNW K;  4FSV A;  5C2D A;  4A62 A;  1CXU A;  4B3O A;  1E4F T;  4I8O A;  1ESV A;  2UUC K;  1YQL A;  5JVG L;  3IAY A;  4FM0 A;  4Z4C A;  4JYA K;  1OVQ A;  3FLC O;  5AQQ A;  5FPD A;  3DJC A;  4NCB A;  3KKS A;  4JI4 K;  4ZTJ A;  2GV9 A;  2HHH K;  3VF6 A;  1QNB A;  3P83 D;  2QRD A;  3OYF A;  1FN7 A;  4EJZ A;  3U8X A;  3WT0 A;  4W5O A;  4LF6 K;  2HHS A;  4LY7 A;  3AO3 A;  4WE1 A;  3U6F A;  4EJY A;  5FLX O;  1J5E K;  5AQS A;  3QER A;  1IBL K;  4KO0 A;  4YOY A;  2KFN A;  3L8B A;  3CQ8 A;  2V51 B;  2QWM A;  4Z94 A;  2FGT A;  3OYC A;  4OVL A;  3OYI A;  5AFU A;  1Z25 A;  1TYQ B;  1Q7Y O;  1KO9 A;  4O8U A;  4O44 A;  1X3N A;  3NGZ A;  2HBM A;  4GVM A;  4CHP A;  2DY4 A;  2F7T A;  5AQG A;  5BRD A;  3OYG A;  3EO3 A;  4CFC A;  1X9M A;  1YQM A;  3NH2 A;  4JD2 B;  2Z1J A;  1T7P A;  3H08 A;  2RE2 A;  1C4G A;  3TTF A;  1SUQ A;  3MMV A;  3LWM A;  4BRP A;  3M8R A;  5GIO A;  3K5L A;  4DLG A;  3G71 N;  4QS9 A;  3O3G A;  3LWL A;  1WAJ A;  1QNC A;  3WXL A;  1U6Z A;  4KTQ A;  4K8X A;  4KH4 A;  2O4I A;  3W3D A;  4B08 A;  1EBM A;  2QWN A;  4KPY A;  3P5J A;  3LZJ A;  1VQN N;  1NGA A;  3OLP A;  4KHS A;  2YKM A;  3OYK A;  4EZ9 A;  1WSJ A;  1JCE A;  1RDW X;  2P5G A;  3C7N B;  5C24 A;  4DS5 A;  4AHV A;  1VQO N;  5TKY A;  4XIU A;  4CGI A;  3OC3 C;  1D4X A;  4FWR A;  4FZX C;  1DTQ A;  4N56 A;  3NCI A;  1W7A A;  5E41 A;  3JXU A;  4KHQ A;  3QDK A;  2P9P B;  4FWO A;  4EAG A;  2XY8 A;  1NWK A;  3RRH A;  3CHW A;  3SAF A;  3IFR A;  4DWI A;  1T6D A;  3Q7C A;  3LM2 A;  4CFB A;  4DQS A;  4BRA A;  2EX3 A;  3L2U A;  5KPZ A;  1K8K A;  3HPH A;  2CGK A;  3RMD A;  1L3T A;  3SUQ A;  3J7Z O;  1T6C A;  3VQ9 A;  1PVS A;  1XNQ K;  4E7H A;  3J80 O;  2E2N A;  3CCJ N;  1QTS A;  2P9U B;  4FXD A;  1LWF A;  5BR9 A;  2HMP A;  4DF4 A;  1RM1 A;  4J2D A;  3RSE A;  2NOL A;  3CQY A;  3D2F B;  2QI2 A;  3LDL A;  1VSM A;  3S9H A;  4UQG A;  4QAG A;  2VCP A;  3H3N O;  3WXI A;  4BY9 C;  4QOZ B;  4DV3 K;  1NJI O;  4IDH A;  1VQ8 N;  4W5T A;  2PYJ A;  3BUZ B;  4DUZ K;  2D0C A;  4JKE A;  1WN7 A;  2FBX A;  5FPE A;  3A5L C;  1QZ5 A;  3WQU A;  1QN4 A;  4GV3 A;  4FM2 A;  3P38 A;  3SQ4 A;  4IFE A;  4DR2 K;  4XEI A;  3DRS A;  4B1X B;  4RW6 A;  4LF4 K;  4FWN A;  1RT2 A;  3RRG A;  3NF7 A;  2IVO A;  4NYN A;  4NO7 A;  4WXA A;  1S9G A;  3TI0 A;  3KVG A;  3GDQ A;  4H0X B;  4B3M K;  2GUI A;  5BRE A;  2OOX A;  2IC3 A;  2JPI A;  4FK2 A;  3VGM A;  4Z4F A;  4Y1C A;  4F9O A;  5IYB P;  1F21 A;  3MAQ A;  3F73 A;  4H5T A;  4YY3 K;  2RF2 A;  1VOL B;  3DYA A;  1QN5 A;  1U49 A;  4H0O A;  5I3U A;  4DTO A;  4WQ4 C;  3D2E A;  5BPL A;  2NRZ A;  4CBW A;  4PKG A;  4EFH A;  4UY8 O;  1BOT O;  5GAH P;  4DR7 K;  1HQE A;  4DMN A;  1CDW A;  3ZEU A;  3RVC A;  4JHD A;  3BKQ X;  4JRP A;  1KCF A;  4CF2 A;  3AY9 A;  1HJR A;  1OH6 A;  4L3Q A;  1QSL A;  2W40 A;  5AQH A;  3KKR A;  1J5O A;  3L2W A;  3OS2 A;  5JLH A;  3AVA A;  3TE5 A;  3SBG A;  3SNN A;  5HLF A;  2NRH A;  2O8D B;  4X65 K;  1SL1 A;  5EX5 A;  3SMP A;  3D7E O;  4GKJ K;  4F3O A;  5F9C A;  1S1U A;  4KB0 A;  2FBY A;  3BY5 A;  1DT9 A;  1KYU A;  1JL2 A;  3P31 A;  2HW3 A;  3QIO A;  2OZS A;  4DG1 A;  3SBT A;  2NOE A;  5E84 A;  4AHC A;  3O4N A;  4PWD A;  4EAH D;  2Y1J A;  3EAY A;  1WSG A;  2HHT A;  3IRX A;  1EXQ A;  2WTU A;  1NH2 A;  5SWM A;  5TKW A;  2QRC A;  3MN6 A;  1ZBS A;  4EP4 A;  4CJV A;  2FF3 B;  1YTF A;  4O5F A;  1TAU A;  4BE2 A;  3DLE A;  2JHJ A;  4PHT X;  4CZJ A;  1NJY A;  4CF8 A;  2DFF A;  3DRP A;  1JL1 A;  1T05 A;  4B3T K;  3ZYY X;  4A57 A;  1S1W A;  1KFQ A;  3OHR A;  4JK8 A;  3VEO A;  4CEZ A;  4B9T A;  4CIE A;  3NE6 A;  4OGC A;  4YDU A;  3TAR A;  1NG9 A;  4LFC K;  4M3X A;  3KLE A;  3UIQ A;  3CMA N;  4MO5 A;  4IXC A;  3EZW A;  4LFA K;  4FJX A;  3A0I X;  4PL7 A;  2DKD A;  3QIC A;  4A59 A;  5HOO A;  4RW9 A;  4CHN A;  4PQU A;  3IUC A;  3CWU A;  3EE9 A;  4IJN A;  4WCE L;  1Q9Y A;  1TGO A;  1C9B B;  4LF9 K;  5FRO A;  2NOF A;  1EO1 A;  4JI1 K;  2DKC A;  3C94 A;  3THX A;  1EQY A;  2FBV A;  4FJL A;  3ASM A;  1IKY A;  1YQK A;  4JKG A;  2YHW A;  2HMI A;  4CK1 A;  1NOZ A;  4WF9 L;  1U4B A;  1ZBF A;  4M41 A;  3F2K A;  2VWB A;  4KI6 A;  3VET A;  3OA9 A;  4KHU A;  5AQW A;  2P9K A;  4BG9 A;  4ROC B;  5KGW A;  1WQA A;  2V9J A;  1NBW A;  1KFD A;  4IJA A;  2MJ7 A;  2FSJ A;  4FWM A;  2HZS A;  4FOI A;  2H5A X;  4O0I A;  3K0S A;  3THW B;  4XH5 A;  1SAZ A;  3M8Q A;  1N6Q A;  4BRG A;  2WFB A;  3KK1 A;  1C6V A;  4OPA A;  2IV9 A;  1V4S A;  4LC9 B;  3DLH A;  4FK4 A;  5KL0 A;  3IS9 A;  3DMJ A;  4FJH A;  4CJR A;  1WJW A;  4C23 A;  3NMU A;  5F1X A;  5E26 A;  2GWJ A;  3KLF A;  4H5N A;  3F10 A;  4YFU A;  1UA0 A;  3NF8 A;  4CJF A;  3DLG A;  3C95 A;  2XHI A;  1BDG A;  4FJK A;  2QKK A;  3NHG A;  1Q82 O;  3IG1 A;  4I6M B;  1J9A A;  1X9J A;  3AA3 A;  1GOB A;  1JXE A;  4IBN A;  3PIP L;  1ATR A;  2HOE A;  3TAN A;  3R1X A;  4WQ5 A;  2IVN A;  4FCY A;  4CD1 A;  2HNZ A;  3BGR A;  3CCE N;  1ILY A;  3ZSQ A;  3TAM A;  3O5B A;  3QEP A;  3I8B A;  4IFV A;  3BZK A;  5LJV A;  1IJJ A;  4H0V B;  4IO8 A;  3WNF A;  4KKO A;  4CZM A;  1VQ7 N;  1NGI A;  1HJO A;  1D9F A;  3NAE A;  4DQP A;  1CLQ A;  3PO5 A;  4G1Q A;  4D7Q A;  5BN9 A;  4EZ6 A;  4RW7 A;  4BDY A;  2VWK A;  4HUE A;  1M90 O;  3KRM A;  1B9D A;  2YHB A;  4BC4 A;  2VGN A;  3OSE A;  2I7N A;  1T44 A;  5KTQ A;  1NK8 A;  3H46 O;  2NNW A;  3I0W A;  4IOX A;  4CEO A;  3M1F A;  1U04 A;  3L2R A;  5AQI A;  4CF0 A;  3ZT0 A;  4CGG A;  1HR0 K;  1K35 A;  4YOX A;  1VRU A;  3KWI A;  4EAI A;  2O8F A;  1C1C A;  3F9M A;  1D9D A;  4FJM A;  3ZLJ A;  2BH1 A;  2NRT A;  4H0T B;  3UKR B;  2A42 A;  1ATN A;  1VAZ A;  3NGY A;  4FJ7 A;  1IKW A;  1KSP A;  4LF7 K;  5JS2 A;  1BI4 A;  2Q2R A;  4M3Y A;  4YHH K;  2ASP A;  3CVT A;  3FZK A;  4A2A A;  3MWT A;  4DLE A;  4X64 K;  3CM5 A;  2W6L A;  4CJP A;  4EP5 A;  1LXT A;  1RNH A;  1A5W A;  4CK3 A;  4FLU A;  4CZF A;  1QN8 A;  3WEE A;  3PO4 A;  4M45 A;  4F2S A;  3ENO C;  4KHN A;  4JKB A;  1HRH A;  3AVI A;  3K5N A;  4FZY A;  2KZZ A;  5AQR A;  1K6Y A;  3VQP A;  1QQC A;  1X3M A;  4ICL A;  1RDD A;  4RW8 A;  1XHZ A;  3J7Y P;  3MDQ A;  2UU9 K;  2O3O A;  1HPZ A;  3QNN A;  1NK5 A;  5EPC A;  2GEM A;  3L2Q A;  3SLC A;  4DV6 K;  4H5W A;  4A61 A;  1C0F A;  3CJ1 A;  2P9L A;  4C8N A;  2OOY A;  1NLV A;  1LWV A;  1BWF O;  4AQY K;  1WSF A;  1U2V B;  4FK0 A;  1RBR A;  3OST A;  4FJJ A;  2HF4 A;  3JYT A;  3G6E N;  5AJ3 K;  3KK2 A;  1P8Z A;  1DKG D;  1TUO A;  2HF3 A;  1TAQ A;  4FLW A;  3CC7 N;  1SV5 A;  4DUL A;  4DTP A;  3LP1 A;  4U7B A;  1NNE A;  4E3S A;  5HRP A;  4CD3 A;  4CF9 A;  5M1O A;  3ZCM A;  3VQA A;  1QHT A;  1VQP N;  1BIU A;  5AQV A;  3OGD A;  3VF2 A;  2EHG A;  2QK9 A;  3CC4 N;  5LMU K;  3QFP A;  3OYL A;  3LDQ A;  2X6N A;  5M1F A;  3FFI A;  3QEI A;  3OYH A;  3A8Y A;  2J4R A;  3L3V A;  2KW4 A;  1BIS A;  3ITH A;  4K42 A;  2RN2 A;  4BR7 A;  1HYZ A;  4J2A A;  4CFF A;  3KLI A;  4GNI A;  4DTU A;  3SJH A;  5DM6 L;  3SUP A;  2LAE A;  4OX9 K;  2KTQ A;  3QB0 A;  1SKR A;  3EY1 A;  5AQY A;  1JCG A;  1N36 K;  1KD1 O;  4KV8 A;  1JDY A;  2HNY A;  4BE0 A;  1I94 K;  3OH9 A;  2D0B A;  1K73 O;  1ASW A;  2OTJ N;  2JWK A;  2XRI A;  5IYC P;  2IS3 A;  3VEN A;  4RTF D;  3ZSX A;  3SK3 A;  1XMQ K;  3D6R A;  3ULE A;  4B1Y B;  5CE3 A;  3CER A;  3PUF A;  4CJ3 A;  4YOT A;  2E2O A;  4R79 A;  2F9W A;  4RCH A;  1RGI A;  3AVC A;  3PLA A;  4KTW A;  4DB3 A;  3O6W A;  3UKU B;  3V6D A;  3TWH A;  4CJL A;  3DPU A;  4N5S A;  4DSF A;  1QN6 A;  1IG9 A;  4B1W B;  3H1Q A;  1QHA A;  4M42 A;  1ZBU A;  1N32 K;  3EEQ A;  3AA5 X;  3NVK A;  2F7L A;  2D0P A;  3AAR A;  2Q97 A;  1RDU A;  1WOQ A;  1RT6 A;  5BR8 K;  3TSQ A;  4KRE A;  2D1K A;  1YTU A;  4C7P A;  1O1W A;  1TUU A;  4DTM A;  3PSI A;  2DKA A;  2NRR A;  1BCO A;  5CYM A;  4TSX A;  2FF6 A;  1LV5 A;  3CCQ N;  4OJR A;  2VG7 A;  5AQP A;  1WNS A;  4C8K A;  1NK0 A;  1G15 A;  1YAG A;  3E9P A;  2PFU A;  1BL3 A;  1KTQ A;  2HHQ A;  3J7A P;  2WUS A;  4CHQ A;  3K59 A;  2IDO A;  3CCU N;  4ELU A;  2ZGY A;  3HM9 A;  2Q1N A;  3CYM A;  2JLE A;  1TGH A;  4B8C A;  1QTP A;  3O08 A;  5HRO A;  3MX5 A;  4YOW A;  3CJC A;  2XY5 A;  4FL9 A;  4DCH A;  4JKC A;  2E6L A;  3LDP A;  5HL7 L;  2YNH A;  3HVR A;  1VQ5 N;  2OPP A;  3DXK A;  5AQX A;  4CGF A;  1KLN A;  4JN4 A;  3AVF A;  1KAY A;  3MK6 A;  1N33 K;  4B9M A;  4YNQ A;  2ASM A;  1ITG A;  2P9I A;  4BQL A;  1B92 A;  4DR5 K;  2LSN A;  4DQI A;  4DSI A;  2Q3S A;  2OA8 A;  4NYF A;  2XY6 A;  3EYZ A;  1QS4 A;  4QS8 A;  2BAN A;  4BC3 A;  4BR5 A;  4B9U A;  3NH0 A;  4FJ9 A;  5ADX A;  2NLX A;  1HNI A;  3FR0 A;  4FWQ A;  2P1J A;  1YUW A;  2UXC K;  2QWL A;  4KTZ A;  4O55 A;  1LCU A;  3PV8 A;  3H1V X;  4DV7 K;  4DS4 A;  1C0U A;  3VEZ A;  4FPA A;  1UT7 A;  4CJT A;  3SCX A;  2F9T A;  4PY5 A;  4K0K K;  3T1Y K;  1TKX A;  3MN5 A;  4Z4E A;  3VTI A;  2O8E B;  4BVO A;  3F5T A;  4LH4 A;  1WAF A;  3VN5 A;  3CW7 A;  2NUB A;  1BI4 B;  2P9N A;  5BN8 A;  1BCM A;  2G8V A;  3HBT A;  4E7I A;  3MCP A;  4PKI A;  4JS5 A;  1NK6 A;  1ZYQ A;  5IYD P;  4JI6 K;  2P5O A;  3WEE B;  1NK4 A;  3VQ5 A;  3CCL N;  1JXB A;  4GKK K;  3SJJ A;  3L0Q A;  3TAP A;  3DM2 A;  4ELV A;  3LPT A;  2H4L X;  3GE1 A;  2PAV A;  1FJG K;  4NXN K;  1NKC A;  5CZ2 A;  4BWJ A;  3BDP A;  2KQ2 A;  2P51 A;  5AQN A;  1SKW A;  3I33 A;  5C15 A;  3ZSZ A;  1NKE A;  4FLV A;  4IO9 L;  4QCL A;  4ROD B;  3VES A;  3HRG A;  1GLD G;  2I5J A;  3FGU A;  4KBO A;  1UAX A;  4O4G A;  3K57 A;  2E1Y A;  5DM7 L;  5AZJ A;  1L3S A;  2HKP A;  2ZD1 A;  4J8F A;  1TBA B;  1QSS A;  3VQ8 A;  3V1O A;  1W9H A;  4BRN A;  4B9L A;  1WB9 A;  3H45 C;  1N39 A;  4K43 A;  1KYD A;  4MLE A;  1YI2 N;  4I9L A;  3PDK A;  1HMV A;  4JLH A;  3CWS A;  3ZET A;  3S41 A;  1TKT A;  4MQ3 A;  2GEL A;  2UXD K;  5HRR A;  3CCV N;  4H03 B;  3CJ9 A;  4Q11 A;  2R7Y A;  1JLG A;  3VEV A;  4OKK A;  1KVC A;  4F3T A;  2QA4 N;  2VQF K;  2V92 A;  3EKS A;  1C47 A;  3HZ6 A;  3HPO A;  4G9Z A;  2Q0U A;  4CJQ A;  1N5Y A;  1W0H A;  3TSU A;  4TPS A;  3C6H A;  3RMA A;  1GLF O;  5M1Q A;  2D0A A;  4B9S A;  1KLM A;  3LAM A;  1R4X A;  5EVZ A;  3QET A;  1RBT A;  3CJA A;  4OLA A;  3AVM A;  1HLU A;  1NGB A;  4IFY A;  3ENC A;  3FZM A;  2E6M A;  2RHK A;  3WNH A;  3UB5 A;  2QR1 A;  4LH5 A;  1S9E A;  4CK2 A;  2QTD A;  4IWV A;  4JI0 K;  4C8O A;  1IG8 A;  2QRE A;  2O8C B;  3B6O A;  3P4I A;  3THY B;  1JJ2 M;  1H1V A;  2Q36 A;  2QWQ A;  4E0D A;  5GAG P;  3TDH A;  5AQU A;  4DTS A;  2FSK A;  3FZF A;  2O8B B;  4AHT A;  4EAK A;  1JLA A;  3L4I A;  3LM9 A;  5IT9 O;  3L6Q A;  1BGX T;  2QLV A;  2X6S A;  4E7K A;  4ELT A;  3ZT4 A;  1OH7 A;  3V9U A;  1ZC6 A;  2QM1 A;  3VA3 A;  4HCB A;  3O9U A;  3VA0 A;  4MFB A;  4DKW A;  3ZSW A;  3DAW A;  4IOA L;  1Z26 A;  3Q7B A;  3TAE A;  5AFU H;  1FK9 A;  2OCE A;  1QVF M;  1NK9 A;  1S6P A;  3OYB A;  3OYD A;  1WSH A;  4XH1 A;  1RTJ A;  4OPK A;  3TTC A;  3G4S N;  5M1K A;  4KB1 A;  4K25 A;  4DR4 K;  3SPY A;  1R59 O;  3AVJ A;  4HTU A;  4JK7 A;  5CZ1 A;  3U9Z A;  3DRR A;  1OH8 A;  3CJ7 A;  3DWL A;  2ETJ A;  3K9J A;  2NVM A;  2ZF5 O;  4M3Z A;  4A5B A;  3VQQ A;  5LJW A;  3S3O A;  3T7Z A;  4BGB A;  3WXM B;  1C0G A;  4CIF A;  2G8W A;  4CI6 A;  1P5D X;  2F4V K;  4CED A;  3U3G A;  3OS1 A;  3OH6 A;  3DXM A;  4O5B A;  3VGL A;  4KHY A;  1C0M A;  4OPH A;  1YJW N;  1HNZ K;  2I7P A;  3ZT3 A;  3SYZ A;  5KPT A;  4EAJ A;  3VEW A;  3I0S A;  3SQ0 A;  2QXL A;  2QEX N;  4DTR A;  3TAG A;  3NH1 A;  1NGG A;  3E66 A;  1L5U A;  5KQD A;  5BMN A;  3AA4 A;  4FZZ A;  1RFQ A;  3VEX A;  3I0X A;  3ZX0 A;  4BR4 A;  2D4W A;  4KFB A;  4CEQ A;  2DPN A;  2B4J A;  1N3A A;  4Z4G A;  1LWY A;  5C0Y A;  2ZFD B;  1NJZ A;  1Q8I A;  3M8P A;  4C8L A;  3L4Q A;  3DOK A;  3AVL A;  3DI6 A;  1KVA A;  1ZBL A;  1LW0 A;  1X9S A;  3HM8 A;  4LF8 K;  4JV5 K;  4X66 K;  1WSE A;  1T3V A;  3KLG A;  1MP9 A;  1HUX A;  2BDP A;  4W5Q A;  3CFP A;  2NZT A;  3PY8 A;  2YHX A;  4R5P A;  1GOA A;  3NA5 A;  3OJU A;  4OO1 J;  1KVB A;  3D7Q A;  1E4G T;  4AHU A;  1RTH A;  3SZ2 A;  3R3L A;  4FVM A;  4JKD A;  3O9T A;  3RR7 A;  1K8K B;  1NMN A;  1D8Y A;  3VF4 A;  3T1A A;  3ZT1 A;  2GUP A;  3ZX3 A;  3TSP A;  1GLA G;  3U3Y A;  2FLO A;  3UW2 A;  4AHR A;  1Q86 O;  3SQ2 A;  1YTB A;  5BPN A;  1PCJ X;  3P39 A;  3A5O C;  3RSE B;  1ZBH A;  2Z8U A;  2GWK A;  2Z1H A;  2HST A;  1NJX A;  1UA1 A;  2IOC A;  2G8U A;  4OKE A;  4M3W A;  1OVY A;  5ELZ A;  3SV4 A;  2V52 B;  4H5V A;  3SPZ A;  1KRP A;  1TK5 A;  2EWS A;  3E9L A;  3IDH A;  1FKP A;  2PBD A;  3OYE A;  4EHU A;  4Q0B A;  1YF5 L;  3LPU A;  4U67 L;  2NOZ A;  2VQE K;  1HPM A;  4FW2 A;  5MLC Q;  4H5R A;  4FJ8 A;  4E7L A;  4MLH A;  4JAX A;  4ISG A;  3HYF A;  2ITM A;  1EX4 A;  4BR0 A;  5HRN A;  4HUG A;  1VTL E;  4A5A A;  2G8F A;  3EIK A;  4MDA A;  1VSI A;  4BE1 A;  4JS4 A;  3AVH A;  4H0Y B;  1HX1 A;  1DTT A;  1BIZ A;  2PYL A;  1YT3 A;  4CEF A;  4XH4 A;  1J53 A;  2NRW A;  3BZC A;  3ULX A;  1E42 A;  4JRQ A;  4ILH A;  1K8A O;  3AAQ A;  4CJU A;  5GAD P;  4CGH A;  3O3H A;  3C6T A;  1UT4 A;  1VOK A;  3QO9 A;  4RG8 A;  1KXP A;  5EXW A;  3J8A A;  3WXJ A;  3KLH A;  2HZM A;  4LSL A;  1YVN A;  1TYQ A;  1VK0 A;  3VER A;  4OPJ A;  3CC2 N;  1I39 A;  3HP6 A;  3S3M A;  3D2E B;  1X9W A;  2HHW A;  2E4L A;  3HOS A;  3M8S A;  4CZH A;  2D5R A;  3ZEU B;  3H3O B;  1RIL A;  4YOU A;  1NK7 A;  4JHD B;  3DLB A;  4CHY A;  3V81 A;  3M5R A;  1LWE A;  2ITG A;  3EZ5 A;  3DPT A;  3GG4 A;  4FPB A;  2OZM A;  1SQK A;  1XUP O;  3ENB A;  3ZSY A;  4CHZ A;  1TUY A;  3A2F A;  2JGU A;  3AVB A;  5CY4 A;  2WOM A;  1BO5 O;  2YNI A;  3DLK A;  4BC2 A;  3O8M A;  4F4K A;  3H1Z A;  4EHT A;  3MXM A;  4HTL A;  4W5N A;  3IMX A;  4M3T A;  3JS6 A;  4FLX A;  4KI4 A;  3C7N A;  3K9K A;  5M1P A;  4WX8 A;  3D4V A;  4B3R K;  1LW2 A;  5BPM A;  3VQC A;  3SV3 A;  4WZS D;  5K14 A;  2Z0F A;  4CEE A;  1IKX A;  4Y0W A;  5C10 A;  4FLY A;  1EKE A;  3GOI A;  5AR0 A;  2A6A A;  4FLT A;  4WQ4 A;  3W0L A;  1IO2 A;  2P9P A;  2ASO A;  1QN9 A;  4J2B A;  4KRF A;  1NM1 A;  4M7X A;  2KFZ A;  3CIP A;  1Q9X A;  1WSI A;  1FKO A;  4GY2 B;  4AH9 A;  2VGM A;  1SL0 A;  3HP9 A;  3MCA B;  3V1Q A;  3FZH A;  1TBP A;  1VQ6 N;  3AO4 A;  2BGG A;  2FBT A;  1YIJ N;  3HI0 A;  5BRH A;  1N8R O;  5JS1 A;  3NF6 A;  1T8E A;  4DHY A;  4DTJ A;  3D2F A;  1YJN N;  1VSH A;  1O13 A;  4FWP A;  4DV5 K;  5IWA K;  1M5Q 1;  3B6P A;  5LMN K;  4NCA A;  3AO2 A;  4A2B A;  3T3F A;  3N89 A;  5J2Q A;  3TAB A;  3CXC M;  1XI1 A;  2EHB D;  1GLB G;  4KH5 A;  3THX B;  1TKD A; 
#chains in the Genus database with same CATH homology
 1N3C A;  3NGI A;  4F3O A;  4PY5 A;  1S1U A;  2IGI A;  2YKN A;  4DQQ A;  2OPR A;  4KB0 A;  4OGE A;  4HHT A;  2FBY A;  4CEB A;  5I42 A;  1TKX A;  3AVN A;  1KYU A;  2ZQB A;  1JL2 A;  1REV A;  3RMB A;  4M3U A;  1LAV A;  4Z4E A;  2HW3 A;  2X74 A;  3QIO A;  4LH4 A;  1WAF A;  3VN5 A;  2DFH A;  1L3U A;  4DG1 A;  2OZS A;  2NUB A;  3VQD A;  1BI4 B;  2NOE A;  3G0Z A;  1BCM A;  2G8V A;  3OSM A;  4E7I A;  4AHC A;  1MU2 A;  3O4N A;  4JS5 A;  3V9S A;  1NK6 A;  4PWD A;  2G8K A;  2Y1J A;  1ZYQ A;  3VQ7 A;  1WSG A;  4CHO A;  3V4I A;  4DF8 A;  2HHT A;  3IRX A;  2Y1I A;  5IYD P;  1EXQ A;  4Q0B A;  1NH2 A;  4CJE A;  1NK4 A;  3VQ5 A;  3ZSV A;  1JXB A;  3OVN A;  5SWM A;  2VWJ A;  2P5O A;  3SJJ A;  1KY6 A;  4EP4 A;  4CJV A;  3TAP A;  1T03 A;  2DTU A;  3DM2 A;  4ELV A;  3V9W A;  3LPT A;  1YTF A;  1TAU A;  1HU0 A;  3CG7 A;  4BE2 A;  3DLE A;  4LSN A;  2YH5 A;  2ZE2 A;  4CE9 A;  1NJY A;  4IG0 A;  3SCX A;  4CF8 A;  1NKB A;  2DFF A;  3DRP A;  1JL1 A;  4NCG A;  1PZD A;  2A1R A;  1T05 A;  1NKC A;  5CZ2 A;  1XC9 A;  1KFS A;  1RTD A;  1RBV A;  1S1W A;  4BWJ A;  3QEV A;  4FJG A;  4I2Q A;  4CJ5 A;  3BDP A;  1RT1 A;  2KQ2 A;  1HQU A;  4CEZ A;  4B9T A;  2P51 A;  1ZBI A;  1I3A A;  1SKW A;  3L3U A;  3THV A;  3E01 A;  4B0A A;  4OGC A;  1TL1 A;  3ZSZ A;  4CIE A;  3NE6 A;  3TAR A;  1SKS A;  1NKE A;  4J2E A;  1NVP A;  2QXF A;  4FLV A;  3ZSR A;  4M3X A;  4QCL A;  4ROD B;  3KLE A;  5FRM A;  3UIQ A;  2I5J A;  3OCI A;  3OS0 A;  1YTA A;  3LZI A;  3HL8 A;  1VSE A;  1S1V A;  1UAX A;  3P1G A;  4O4G A;  3K57 A;  4FJX A;  1BHL A;  3SNS A;  3NDK A;  1VSJ A;  3LAN A;  1L3S A;  4DU1 A;  4AHS A;  2XHB A;  2ZD1 A;  1FXX A;  1TBA B;  4RW9 A;  3RTV A;  3VQ4 A;  1QN7 A;  4CHN A;  3LDS A;  1QSS A;  3VQ8 A;  3G10 A;  3V1O A;  4PQU A;  1W9H A;  4I7F A;  2X78 A;  4B9L A;  3V9Z A;  1N39 A;  1KYD A;  1YVU A;  4CEC A;  1TGO A;  1C9B B;  1Q9Y A;  4FJN A;  5FRO A;  2NOF A;  2XY7 A;  5AN4 A;  3MED A;  1JLC A;  2GBZ A;  3C94 A;  4I9L A;  2FBV A;  4FJL A;  1HMV A;  4JLH A;  3SI6 A;  3C6U A;  2YNG A;  3ASM A;  4ID1 A;  2PZS A;  1IKY A;  3MEC A;  1TKT A;  1YQK A;  4MQ3 A;  4RW4 A;  1QNE A;  5HRR A;  3NF9 A;  4Q11 A;  4CK1 A;  1NOZ A;  1JLG A;  2R7Y A;  4OKK A;  1C1B A;  1KVC A;  1ZBF A;  3LP2 A;  4M41 A;  1U4B A;  3HK2 A;  4KI6 A;  3KJV A;  4F3T A;  3CFO A;  1C1A A;  1IH7 A;  1RDB A;  3HPO A;  3KTU A;  4FJI A;  3K58 A;  1S5J A;  1M3Q A;  3HPG A;  1JKH A;  4CJQ A;  1N5Y A;  4KHU A;  1W0H A;  4ROC B;  3QLH A;  3HS9 A;  5KGW A;  4TPS A;  1TVR A;  3KK3 A;  3PX0 A;  3RMA A;  3OYA A;  2D0A A;  4B9S A;  2NOI A;  1KFD A;  4CES A;  1KLM A;  3LAM A;  2VJ0 A;  2MJ7 A;  3ZT2 A;  2ATQ A;  2RKI A;  5KRT A;  1R4X A;  4PUO A;  1HYV A;  1SL2 A;  2HVH A;  3QET A;  2HZS A;  1RBT A;  4OLA A;  2HHV A;  1RDC A;  5KRS A;  3AVM A;  3TR8 A;  4O0I A;  4IFY A;  3WNH A;  2E6M A;  3M8Q A;  4BDZ A;  1N6Q A;  4ZTF A;  1B9F A;  2YHA A;  3I0R A;  4LH5 A;  1S9E A;  5DK5 A;  3KK1 A;  4E89 A;  1C6V A;  2IV9 A;  4CK2 A;  4DSJ A;  4HCC A;  4ELT A;  4C8O A;  2W42 A;  2OPS A;  3DLH A;  1NOY A;  3B6O A;  1JLE A;  4FK4 A;  3IS9 A;  1NGM A;  3DMJ A;  3QEW A;  4FJH A;  4CJR A;  3HO1 A;  1R0A A;  4E0D A;  3DLR A;  4N47 A;  1RDA A;  2JOI A;  4DTS A;  3HXM A;  4AHT A;  3K5O A;  4DTX A;  3MXJ A;  3KLF A;  2IV8 A;  1JLA A;  4GW6 A;  3AVK A;  5CYQ A;  3HT3 A;  3F10 A;  2B5J A;  3S3N A;  4FYD A;  2HHU A;  1BGX T;  4YFU A;  1UA0 A;  2VG6 A;  2X6S A;  3VQB A;  3T19 A;  4I2P A;  3ZT4 A;  2MZ8 A;  2NOB A;  3V9U A;  4E7K A;  1TK8 A;  3NF8 A;  4CJF A;  3O4Q A;  3DLG A;  1QNA A;  3C95 A;  3VA3 A;  2XHI A;  4FJK A;  3ZSO A;  4HCB A;  3QIN A;  3TAF A;  2QKK A;  2A1S A;  3NHG A;  4MFB A;  3VA0 A;  1X1P A;  2KZM A;  3V1R A;  3ZSW A;  4BWM A;  1BQM A;  3IG1 A;  4CFA A;  5J2N A;  1Z26 A;  1J9A A;  4ID5 A;  3TAE A;  1NJW A;  1FK9 A;  3SUO A;  2YNF A;  3AA3 A;  4M3R A;  1GOB A;  1NK9 A;  1JXE A;  4IBN A;  4CGD A;  5T7B A;  1S6P A;  3F9K A;  4N41 A;  3OYB A;  3OYD A;  4CJ4 A;  1WSH A;  3LAK A;  1RTJ A;  4OPK A;  3TAN A;  1UOC A;  2HB5 A;  3WNE A;  2KZZ A;  3CM6 A;  1HYS A;  4FCY A;  3SUN A;  4KB1 A;  4Z0U A;  2HNZ A;  3IH7 A;  3BGR A;  2XO7 A;  5J2M A;  3ZSQ A;  3KTQ A;  3TAM A;  1KYF A;  2F8S A;  3SPY A;  1VSF A;  1JLB A;  1VSL A;  3QEP A;  4CF1 A;  2OPQ A;  3AVJ A;  4IFV A;  5J1E A;  3MEE A;  4HTU A;  2BE2 A;  5CZ1 A;  3RMC A;  4AIL C;  3DRR A;  3VQE A;  4Z4I A;  4H8K A;  4I9Q A;  1CZB A;  4F8R A;  2ETJ A;  1VTO A;  3WNF A;  5SZT A;  3OYJ A;  2HND A;  4KKO A;  3RWU A;  1D9F A;  4M3Z A;  3NAE A;  3VQQ A;  4DQP A;  3WNG A;  3AV9 A;  4CER A;  3S3O A;  1CLQ A;  4OLB A;  3OJS A;  1RT5 A;  3D45 A;  4G1Q A;  3PO5 A;  3QEX A;  2F8T A;  3O3F A;  2DFE A;  4EZ6 A;  4RW7 A;  4BDY A;  2VWK A;  4HUE A;  3KIO A;  4LD0 A;  3KRM A;  1B9D A;  1SL1 A;  2YHB A;  4CIF A;  5J2P A;  4KAZ A;  2G8W A;  3VQ6 A;  1BQN A;  4CED A;  4DFP A;  3AVG A;  5KTQ A;  1NK8 A;  3KD5 E;  3LAL A;  3U3G A;  3OS1 A;  3I0W A;  4O5B A;  3AO5 A;  4CEO A;  4KHY A;  1C0M A;  1VRT A;  4CJT A;  4IDK A;  3ZT3 A;  1U04 A;  2Z1I A;  3L2R A;  3RR8 A;  4CF0 A;  3ZT0 A;  3HS8 A;  4CGG A;  3SYZ A;  3PX4 A;  3PX6 A;  1U47 A;  4DU4 A;  4PA1 A;  3I0S A;  3SQ0 A;  2NOH A;  1RT7 A;  1VRU A;  2RPI A;  4CIG A;  4DTR A;  3TAG A;  3NH1 A;  4ROE B;  5DMR A;  2PY5 A;  1C1C A;  3F0Z A;  1L5U A;  1CXU A;  1CZ9 A;  4B3O A;  3V9X A;  1D9D A;  3AA4 A;  4FJM A;  4FZZ A;  1D3U A;  4I8O A;  1PCZ A;  3I0X A;  1YQL A;  1RBU A;  3IAY A;  4FM0 A;  4Z4C A;  4FK0 A;  4KFB A;  4C8M A;  4CEQ A;  1RTI A;  3NGY A;  5FRN A;  3TAQ A;  2B4J A;  1N3A A;  4Z4G A;  4FW1 A;  1LWY A;  1Y97 A;  1IKW A;  4FJ7 A;  4DFK A;  1KSP A;  5JS2 A;  4NCB A;  3KKS A;  1RT4 A;  2GV9 A;  4ZTJ A;  1NJZ A;  1BI4 A;  1Q8I A;  1QNB A;  3P83 D;  1DLO A;  4E1M A;  3M8P A;  4M3Y A;  4C8L A;  3RPJ A;  3DOK A;  3OYF A;  3AVL A;  4FLZ A;  3DI6 A;  1KVA A;  4W5R A;  4IG3 A;  1FN7 A;  4EJZ A;  3CM5 A;  4CJP A;  4DLE A;  1LW0 A;  4EP5 A;  1ZBL A;  3JSM A;  1RNH A;  1X9S A;  1A5W A;  4CK3 A;  4W5O A;  4FLU A;  2HHS A;  1QN8 A;  4LY7 A;  1WSE A;  1B9K A;  3AO3 A;  4WE1 A;  4M45 A;  1MP9 A;  3KLG A;  3MXI A;  3U6F A;  4EJY A;  5EU7 A;  3PO4 A;  2BDP A;  4W5Q A;  4KHN A;  1HRH A;  3AVI A;  3QER A;  4KO0 A;  3K5N A;  3CFP A;  4FZY A;  4DQR A;  1K6Y A;  3PY8 A;  1QN3 A;  4R5P A;  3VQP A;  1GOA A;  1QQC A;  4ICL A;  3OJU A;  3L8B A;  3CQ8 A;  1KVB A;  2G8I A;  1RDD A;  4RW8 A;  1XHZ A;  2O3O A;  2FGT A;  1L3V A;  4AHU A;  3OYC A;  4OVL A;  1HPZ A;  1RTH A;  3SZ2 A;  3QNN A;  1NK5 A;  3L2Q A;  4FVM A;  5C42 A;  3RR7 A;  3OYI A;  4B9N A;  1D8Y A;  1XWL A;  1Z25 A;  3NBP A;  3ZT1 A;  3T1A A;  1QTM A;  1AIS A;  1KO9 A;  4O44 A;  3NGZ A;  4C8N A;  4GVM A;  1WLJ A;  4FZX C;  1LWV A;  3U3Y A;  1S6Q A;  4AHR A;  4CHP A;  3SQ2 A;  2DY4 A;  1YTB A;  1WSF A;  1LAW A;  3LP0 A;  3OYG A;  1RBR A;  5FDL A;  3OST A;  2B6A A;  4CFC A;  1X9M A;  1YQM A;  4FJJ A;  2HHX A;  3NH2 A;  3JYT A;  2Z1J A;  4CCH A;  1ZBH A;  4FM1 A;  1T7P A;  5HBM A;  1W80 A;  2G30 A;  2Z8U A;  3H08 A;  3KK2 A;  1A5V A;  2I5W A;  2Z1H A;  1NJX A;  1UA1 A;  3QNO A;  1SUQ A;  4OKJ A;  4CJW A;  1TAQ A;  3SQ1 A;  4FLW A;  1SV5 A;  3LWM A;  2IOC A;  2G8U A;  1S1T A;  3M8R A;  4OKE A;  4DUL A;  3K5L A;  3NFA A;  4DTP A;  4M3W A;  1ASV A;  3LP1 A;  4DLG A;  3SV4 A;  3SPZ A;  1KRP A;  4E3S A;  1TK5 A;  5HRP A;  3DOL A;  3O3G A;  3LWL A;  1WAJ A;  1FKP A;  1TV6 A;  4CF9 A;  1QNC A;  3OYM A;  3OYE A;  3KD1 E;  4KTQ A;  3ZCM A;  2YV0 X;  3VQA A;  4K8X A;  2O4I A;  1HNV A;  1QHT A;  1BIU A;  1EBM A;  4B08 A;  3LPU A;  3P5J A;  3LZJ A;  2EHG A;  4KPY A;  4CEA A;  2QK9 A;  2NOZ A;  4H4O A;  1D5A A;  4IKF A;  3OYL A;  4FW2 A;  4FJ8 A;  4E7L A;  3HST B;  4KHS A;  2YKM A;  2X6N A;  3OYK A;  3HYF A;  4EZ9 A;  1WSJ A;  1EX4 A;  1S1X A;  5HRN A;  2P5G A;  4HUG A;  3FFI A;  3QEI A;  3OYH A;  1VTL E;  5C24 A;  1VSK A;  4DS5 A;  4E1N A;  2G8F A;  3EIK A;  3L3V A;  4AHV A;  4O0J A;  2KW4 A;  1VSI A;  1BIS A;  3ITH A;  4BE1 A;  4XIU A;  4JS4 A;  2RN2 A;  3AVH A;  3OC3 C;  4CGI A;  1DTT A;  1UWB A;  1BIZ A;  1HYZ A;  3MEG A;  4E7J A;  1YT3 A;  1DTQ A;  4CEF A;  3KLI A;  2PYL A;  4DTU A;  4N56 A;  3NCI A;  1J53 A;  4B9V A;  4K8Z A;  3SUP A;  2LAE A;  3OYN A;  2KTQ A;  1SKR A;  5E41 A;  3EY1 A;  4KHQ A;  3ULX A;  1JLQ A;  3AA2 A;  1E42 A;  4CJK A;  4JRQ A;  3ALY A;  4DTN A;  4CJU A;  1VSD A;  1IKV A;  4KV8 A;  4CGH A;  2HNY A;  4BE0 A;  2XY8 A;  3O3H A;  4DSL A;  3C6T A;  1UT4 A;  3RRH A;  1VOK A;  2D0B A;  3QO9 A;  4B8A B;  4RG8 A;  4DWI A;  2HVI A;  4CFB A;  4DQS A;  1ASW A;  2EX3 A;  2XRI A;  3KLH A;  2HZM A;  4LSL A;  5IYC P;  2IS3 A;  3LP3 A;  3ZSX A;  3L2U A;  4Y1D A;  3HPH A;  3RMD A;  1L3T A;  1VK0 A;  4OPJ A;  3SUQ A;  1QSY A;  4J2A A;  1ASU A;  3PUF A;  4CJ3 A;  3VQ9 A;  1RT3 A;  1I39 A;  3HP6 A;  1TKZ A;  2O4G A;  4E7H A;  3S3M A;  1U45 A;  3AVC A;  1QTS A;  1YQR A;  1X9W A;  2HHW A;  2E4L A;  4KTW A;  3M8S A;  4FXD A;  2D5R A;  1GOC A;  1LWF A;  1M3H A;  4DF4 A;  1RM1 A;  3V6D A;  1TK0 A;  2FC0 A;  3HJF A;  1RIL A;  1NK7 A;  4J2D A;  3DLB A;  2NOL A;  3TWH A;  2OYQ A;  1A5X A;  4CJL A;  1TL3 A;  3DPU A;  2F96 A;  4CHY A;  4N5S A;  1VSM A;  4DSF A;  1QN6 A;  3V81 A;  1IG9 A;  1LWE A;  2ITG A;  3EZ5 A;  4F2R A;  1J54 A;  3S9H A;  3DPT A;  4H4M A;  4UQG A;  4M42 A;  2QKB A;  4DFJ A;  4QAG A;  2WON A;  2OZM A;  4L8R B;  1ZBU A;  4QOZ B;  3ZSY A;  4CHZ A;  4DU3 A;  2VG5 A;  3AA5 X;  3A2F A;  2JGU A;  3AVB A;  5CY4 A;  1U48 A;  2WOM A;  4FJ5 A;  4Q5V A;  4W5T A;  2PYJ A;  3QIP A;  2YNI A;  3DLK A;  4F4K A;  3CFR A;  1RT6 A;  2D0C A;  4KRE A;  1WN7 A;  3H1Z A;  1YTU A;  3MXM A;  2FBX A;  5KGX A;  4F2S A;  4W5N A;  1O1W A;  4DSE A;  4DTM A;  5CYM A;  1BCO A;  4M3T A;  4TSX A;  1LV5 A;  1QN4 A;  4FLX A;  4OJR A;  1XHX A;  2VG7 A;  3HVT A;  1CXQ A;  3D0P A;  4FM2 A;  4KI4 A;  3SQ4 A;  3ISN C;  1WNS A;  4C8K A;  1NK0 A;  5HP1 A;  1G15 A;  3DRS A;  3K5M A;  2IAJ A;  1LW2 A;  4RW6 A;  3VQC A;  4ZHR A;  4WZS D;  1C0T A;  5K14 A;  3SV3 A;  4CEE A;  1BL3 A;  3QES A;  1IKX A;  1KTQ A;  1RT2 A;  2HMI A;  2HHQ A;  3RRG A;  4CHQ A;  3NF7 A;  3K59 A;  4NYN A;  1S9G A;  1EKE A;  2IDO A;  4FLY A;  3TI0 A;  4ELU A;  4FLT A;  2GUI A;  3HM9 A;  4DFM A;  3CYM A;  4KHW A;  1IO2 A;  2JLE A;  1TGH A;  4B8C A;  2IC3 A;  1QTP A;  1QN9 A;  5HRS A;  4J2B A;  4FK2 A;  1EP4 A;  1QE1 A;  5HRO A;  4Z4F A;  4KRF A;  4GMJ B;  4Y1C A;  5KI6 A;  2KFZ A;  3L2V A;  2XY5 A;  1RCH A;  5IYB P;  1F21 A;  3MAQ A;  3F73 A;  2E6L A;  1Q9X A;  1JLF A;  2YNH A;  3HVR A;  2OPP A;  4DSK A;  1KLN A;  4CGF A;  2G8H A;  1RBS A;  1WSI A;  1FKO A;  1VOL B;  2RF2 A;  4N76 A;  3DYA A;  1KY7 A;  4AH9 A;  1QN5 A;  1SL0 A;  3AVF A;  1EET A;  1U49 A;  4BDP A;  5I3U A;  3HP9 A;  3V1Q A;  5C25 A;  4B9M A;  4DTO A;  1TBP A;  4YNQ A;  4HUF A;  1ITG A;  3I8D A;  4Z4H A;  1B92 A;  1LWC A;  4BAC A;  3AO4 A;  2BGG A;  1LWW A;  2LSN A;  1HQE A;  2FBT A;  1CDW A;  4DMN A;  4DQI A;  2Q3S A;  4DSI A;  5JS1 A;  3NF6 A;  4HVJ A;  4NYF A;  2XY6 A;  3EYZ A;  2OA8 A;  1QS4 A;  1T8E A;  4DTJ A;  1JFI C;  2KFN A;  4JRP A;  1KCF A;  3AO1 A;  1VSH A;  2BAN A;  4CF2 A;  4B9U A;  1HJR A;  4CJS A;  3NH0 A;  4FJ9 A;  4CFD A;  1QSL A;  4E19 A;  1HNI A;  3B6P A;  2P1J A;  3K2P A;  3KKR A;  1J5O A;  4NCA A;  3L2W A;  3AO2 A;  2AJQ A;  3OS2 A;  3ULD A;  3AVA A;  3T3F A;  4CGJ A;  4O55 A;  4KTZ A;  5D3G A;  3PV8 A;  3SNN A;  3N89 A;  4DS4 A;  5HLF A;  5J2Q A;  3TAB A;  1XI1 A;  1C0U A;  2Z1G A;  1UT7 A;  3OY9 A;  1TKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...