3ASMA

Crystal structure of q54a mutant protein of bst-rnase hiii
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
308
structure length
308
Chain Sequence
SNYVIQADQQLLDALRAHYEGALSDRLPAGALFAVKRPDVVITAYRSGKVLFAGKAAEQEAAKWISGASASNETADHQPSALAAHQLGSLSAIGSDEVGTGDYFGPIVVAAAYVDRPHIAKIAALGVKDSKQLNDEAIKRIAPAIMETVPHAVTVLDNPQYNRWQRSGMPQTKMKALLHNRTLVKLVDAIAPAEPEAIIIDEFLKRDSYFRYLSDEDRIIRERVHCLPKAESVHVSVAAASIIARYVFLEEMEQLSRAVGLLLPKGAGAIVDEAAARIIRARGEEMLETCAKLHFANTKKALAIAKRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the substrate binding site in the N-terminal TBP-like domain of RNase H3.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
molecule keywords Ribonuclease HIII
total genus 100
structure length 308
sequence length 308
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2010-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
A PF11858 DUF3378 Domain of unknown function (DUF3378)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3asmA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3asmA02
4ROEB 4KV8A 1QSSA 1VK0A 2IS3A 3VQQA 1NKCA 4NCGA 1BISA 3L2RA 1JKHA 2IV8A 3V4IA 4RW9A 1ZBLA 4LSNA 4R5PA 1TL1A 1HNIA 1KCFA 2A1SA 3HYFA 5HRRA 1ZYQA 1X9SA 1JXEA 3MECA 3OYAA 1RTDA 4KB0A 1JLFA 1IKVA 4KHWA 4LSLA 4TSXA 1NK7A 1GOAA 3AVAA 4DFKA 1VRTA 1WSJA 1SKRA 3KD1E 4CIEA 3PX0A 3V6DA 2BGGA 1ZBIA 1TKTA 2G30A 4YNQA 1EP4A 3VQ5A 4AH9A 3TAQA 1QN4A 4CHNA 1TBAB 2YV0X 4OGCA 5IYCP 2EHGA 2X74A 5KGWA 3WNHA 3S3MA 1T7PA 4CHOA 3L3UA 4FJKA 1NJXA 2ZD1A 1IO2A 5FROA 1RT1A 4PY5A 1L3VA 4QOZB 3NCIA 2FBVA 3TABA 2RKIA 1U04A 4M3RA 3RMDA 2YKMA 3SI6A 1WSFA 1RT3A 4O0JA 1NOYA 1DTQA 3S9HA 3ZSWA 4M3WA 4E1NA 2KZMA 1TGOA 1PZDA 4CJKA 3SV4A 4IG3A 3OYBA 4J2BA 2VG5A 3QNOA 4CJ5A 3HPGA 1I3AA 5SWMA 2QXFA 3VQEA 3BGRA 3HXMA 3QEVA 3SUOA 2F8SA 3NF7A 3L2UA 3KLFA 1S1WA 1CZ9A 1KFSA 3LANA 1RTIA 1TV6A 2BDPA 1C0UA 3P83D 4Z4HA 3KLHA 1HQUA 3DLBA 3L3VA 4F3OA 3QEXA 1J9AA 1U48A 1G15A 2LSNA 4KPYA 3SJJA 4FJJA 1N6QA 3K5NA 2YKNA 1WLJA 1LV5A 4I9QA 2KZZA 1JLAA 2OPSA 2Q3SA 4CEFA 3LAMA 4LH4A 1HQEA 1SUQA 1CDWA 4KTWA 1HYVA 1WAFA 4DG1A 2Y1IA 3LZIA 1REVA 4DSIA 1GOCA 3V9ZA 2HHVA 2F8TA 2HHTA 4RW8A 3K59A 3I8DA 1NK8A 3RMCA 4DQIA 4DWIA 3KK1A 3QNNA 4RG8A 3VQPA 1VSDA 4I9LA 2OZMA 3KD5E 3FFIA 3G0ZA 2X6SA 4FJ5A 1RCHA 1HYZA 4AHSA 3M8SA 1Q8IA 3K58A 2IDOA 3AA3A 3TAEA 3PX4A 4CGFA 3RMAA 5KRTA 1VSHA 1QN6A 4AHCA 4FJXA 4M3UA 5J1EA 3NDKA 4CJVA 1R0AA 1FXXA 3P5JA 4HHTA 3ALYA 3QINA 4BACA 2HNYA 1RBUA 3CFOA 3OYLA 3U6FA 4CESA 4K8XA 1QN3A 3DYAA 1YTAA 1KVBA 3H08A 4HCCA 1QTPA 4LH5A 4E19A 3M8QA 2G8KA 3EIKA 1S1XA 1VSIA 3O3HA 3IS9A 2KFZA 2RPIA 3OS1A 1QSYA 3SV3A 1KTQA 1IKXA 4F2RA 4MQ3A 3OYHA 4FM2A 1QTMA 1W80A 1RDDA 4KTZA 3HVRA 4FLWA 4FVMA 4OVLA 3LDSA 3WNFA 4WE1A 1HYSA 4DS5A 4BE1A 3ZT3A 3OYNA 3AA2A 4CIFA 4EP4A 4F8RA 4CGJA 3T1AA 3AVFA 1TL3A 3L8BA 1U49A 3C95A 4LY7A 1WNSA 2WONA 4GW6A 3BDPA 3SZ2A 1QN8A 3VA0A 3L2QA 5HROA 1S1UA 1L3TA 4N41A 2HW3A 3SQ4A 1UA0A 2HNDA 4FW2A 4HTUA 4EZ9A 2ZQBA 3QERA 4W5RA 4O44A 1IKYA 2KQ2A 3M8RA 3TWHA 3HJFA 3DRRA 3NGZA 3ZSZA 3QO9A 4KTQA 3SCXA 2D0AA 1B9DA 2IAJA 3V1QA 3OYKA 1D9DA 5C24A 4B9MA 4AILC 4HVJA 1QE1A 5K14A 3I0SA 1NJWA 4DFMA 2FC0A 3KLGA 3NE6A 4E7KA 1JFIC 1KVCA 3D45A 4XIUA 1HJRA 2DFHA 5D3GA 2XO7A 1D9FA 3AVCA 2PYJA 3NH2A 2Z1HA 4M42A 3TI0A 4F4KA 1GOBA 3ZT0A 4FM0A 2EX3A 3MEDA 2G8UA 1N5YA 3JSMA 1D8YA 4ELVA 3ZT1A 4HUEA 4CFAA 4FJ8A 3MEEA 2IC3A 1BQNA 3AVBA 3K57A 3KK3A 3TANA 1WSIA 1JLCA 1R4XA 3SUPA 4DQSA 4CJRA 3DLRA 4M41A 3OYEA 1KSPA 1TK5A 5FRNA 1O1WA 4M45A 1LAWA 3QLHA 4IFYA 4FW1A 1XHXA 1WSHA 3ULDA 4Q0BA 3ZCMA 1C1CA 4CJWA 4BE2A 1W9HA 4B9VA 2ZE2A 4ICLA 4JLHA 4Y1CA 2OPPA 4UQGA 4PQUA 4CK2A 1RBVA 3PX6A 3C94A 2GBZA 2HMIA 4WZSD 3P1GA 2HHUA 2W42A 1VTOA 4DQRA 4B8CA 2WOMA 2ITGA 4M3TA 3LWLA 5JS2A 3MXIA 1VSEA 1KYFA 4FJNA 4Z0UA 4HUGA 3SPZA 1KRPA 3UIQA 2DTUA 1LWCA 3RRHA 1RBSA 3QEIA 1NGMA 1A5VA 2BE2A 3T19A 3V9XA 5HLFA 2NUBA 4Q5VA 1DLOA 4QCLA 4W5TA 1EXQA 4DF8A 3AVMA 1PCZA 3OS0A 3OJSA 1J5OA 3OY9A 3VN5A 4I7FA 5CZ2A 3WNGA 4J2EA 5HP1A 3OYFA 1RBRA 1KY7A 1T05A 2OA8A 1LAVA 1RNHA 4IBNA 3QIOA 4CK3A 2Z1GA 1SKSA 2VG7A 2OPQA 5CY4A 4FCYA 3RRGA 4FZXC 1QNAA 3S3NA 4B9NA 4DLEA 1VTLE 1Q9XA 4L8RB 4DFJA 3CM5A 4CF1A 3QEWA 3OC3C 1KVAA 1YT3A 4F3TA 1X9MA 1QSLA 1NK9A 3S3OA 1NK4A 1TAUA 2OZSA 5DK5A 3NF6A 1U4BA 4DTXA 5J2QA 4DSLA 2MJ7A 3AVJA 4DSJA 1J53A 1QS4A 4CERA 4KHYA 2AJQA 5KRSA 3SUNA 4CEZA 3QETA 4J2DA 3F73A 4AHRA 3B6PA 1ZBHA 4RW6A 3VQ9A 5HRNA 1D3UA 3TR8A 1XWLA 1SV5A 3HP6A 3LZJA 3HL8A 2P51A 1C0TA 5J2PA 4ZHRA 4JS4A 1TKXA 4H4MA 4B3OA 3OYJA 1FKPA 4LD0A 1JLQA 4DU3A 4FK0A 4PUOA 1TKDA 4OPKA 3OVNA 3K5OA 1HPZA 1C9BB 3ZSVA 2Z1IA 4I2QA 3VQ7A 3VQ8A 1QNCA 4DTMA 2OPRA 4CJQA 3KJVA 1NK5A 1Q9YA 1MU2A 2RN2A 1KFDA 4CE9A 3DLKA 3EZ5A 3KK2A 1KLMA 3V81A 1CXUA 2YNHA 1HNVA 4CF0A 3V9UA 4IFVA 3CQ8A 3DRSA 3U3GA 1QHTA 3ZSRA 4FZYA 3VQBA 1NKEA 4H8KA 3O4NA 3SQ0A 4RW7A 1VSKA 1YVUA 3M8PA 4CEQA 2DFFA 3SYZA 4DTUA 2VWKA 2XY7A 1VSMA 1S1VA 1TK8A 2PZSA 1UOCA 3DLHA 3F9KA 1SL0A 3LP0A 1TGHA 2QK9A 4YFUA 2B6AA 5IYBP 3ZSXA 4B0AA 5C25A 2XHBA 1T03A 3HPOA 4N47A 4KAZA 3TAGA 1B9KA 1K6YA 3OYMA 1WSGA 3O3GA 4DF4A 2E4LA 1NK0A 1Z25A 1Z26A 2ATQA 4CEEA 1KY6A 3O3FA 4KI4A 4AHUA 1MP9A 4E7LA 3RR8A 3AA4A 2JLEA 3OCIA 4BE0A 2KFNA 1NKBA 4GMJB 1S9EA 3CM6A 1ZBFA 2XY8A 4DTJA 4DTPA 4KB1A 1J54A 2B5JA 1QN5A 1JLGA 3LAKA 1BQMA 4JS5A 3SQ1A 2VG6A 3RR7A 2O4GA 3VQ6A 1NH2A 4KFBA 1RTJA 3ZT4A 4CEOA 1JXBA 4B9LA 1VOLB 2IOCA 4Z4CA 1EETA 3IRXA 1C1AA 1JL2A 4DQQA 4DFPA 2G8HA 3NGIA 1BI4A 1ASUA 4DSEA 2QKBA 3LP3A 4OLAA 3NH0A 2YHBA 4ZTJA 4KI6A 1RT6A 4IG0A 1T8EA 2BANA 4FXDA 1RBTA 3HM9A 3OYCA 1S6QA 3LALA 4FM1A 4FK2A 4W5NA 4DSKA 4EZ6A 5EU7A 1RILA 2HNZA 3HS9A 4CHPA 4DTSA 1BGXT 1XHZA 4CGIA 4CF2A 3AVNA 4DS4A 4KHQA 3DLGA 4DLGA 2D0BA 1ITGA 2OYQA 1W0HA 1BIUA 2FBTA 4B9TA 3EY1A 4M3XA 4PWDA 1FK9A 1ZBUA 1KYUA 5I3UA 4H4OA 1WAJA 4CJLA 3L2WA 3T3FA 4OKEA 1S6PA 4CJPA 1VSLA 4BWJA 4E0DA 4CJ3A 4FJHA 2RF2A 1UAXA 5E41A 2YNGA 4JRQA 1HRHA 1X1PA 1NK6A 4NCAA 2HVIA 1WN7A 2DY4A 2PY5A 1TK0A 1BL3A 5CYQA 3DI6A 3DOKA 4CHYA 3ZSOA 4C8KA 1RM1A 4ROCB 1D5AA 3AVLA 3DM2A 3AO5A 3DLEA 5IYDP 3NGYA 5FRMA 3DMJA 3AA5X 1L3SA 1TBPA 2G8WA 3A2FA 1S5JA 4CGHA 3MXMA 3PUFA 3NFAA 4FJIA 3SPYA 1NJYA 1YTUA 3C6TA 4Z4EA 4DTOA 1U47A 2HHSA 1LWEA 1NVPA 1YTFA 1ASVA 4NYFA 2I5JA 3V1OA 1VRUA 2G8FA 4CFCA 4G1QA 5SZTA 3ZSYA 4MFBA 5T7BA 4C8OA 3ISNC 1SKWA 4CCHA 5KGXA 2E6LA 2Z8UA 5J2NA 4FJMA 4FJ9A 2B4JA 4I2PA 4BDZA 4IDKA 4KO0A 4C8NA 3OS2A 3KLEA 4CGDA 4AHVA 4E7IA 3U3YA 1SL1A 3HVTA 4KHUA 3HPHA 3WNEA 5I42A 1EX4A 1VSFA 2VWJA 5HRSA 4DMNA 4Z4GA 1A5WA 1DTTA 2YNFA 2P5GA 3VQAA 4FJLA 4KREA 3HO1A 5JS1A 3G10A 3QIPA 4CHQA 4OLBA 1CXQA 4CK1A 1RT2A 2IV9A 4N76A 1B92A 4O5BA 4KHSA 1WSEA 5KI6A 1HMVA 3HP9A 3SQ2A 1C0MA 1JLBA 1RDAA 3C6UA 1L5UA 1IG9A 4B9UA 4C8LA 4DTRA 1CLQA 3VQDA 4DU1A 4FLVA 3ZSQA 1ASWA 3L2VA 3AV9A 3AO3A 1QNEA 4OKJA 3OYGA 4DTNA 1LW0A 3LP2A 4RW4A 3QESA 3RMBA 1UA1A 4F2SA 4FLTA 1TAQA 2XY5A 2A1RA 3PO5A 3B6OA 4AHTA 2HHXA 4W5OA 3JYTA 2HHQA 2P5OA 2G8VA 3LP1A 2R7YA 3AVHA 4FLUA 4CJSA 3AVKA 4J2AA 4FLXA 1QNBA 4FJGA 2E6MA 4OJRA 5FDLA 3OYIA 1LW2A 3SUQA 4RODB 3ITHA 4FJ7A 1EKEA 4CFBA 4FYDA 3KKRA 1L3UA 2D0CA 2HVHA 2O4IA 1KLNA 4N5SA 1QQCA 4CGGA 4ELUA 1JLEA 4O4GA 3DRPA 1I39A 4BDYA 4BDPA 4CIGA 4Z4FA 1NOZA 4BWMA 4KHNA 2ETJA 3K2PA 1X9WA 4CF9A 3E01A 3V1RA 4OKKA 3MXJA 2X78A 3PV8A 3IAYA 1RT7A 3MEGA 3D0PA 2IGIA 1NJZA 3ASMA 2Y1JA 2YNIA 4CJTA 5KTQA 1C1BA 4M3YA 4B8AB 4HCBA 5HBMA 1C6VA 2HB5A 1YTBA 3HT3A 1CZBA 3NHGA 4E7JA 4IKFA 1BCOA 1TVRA 1RT5A 4C8MA 3CG7A 4DSFA 2PYLA 4FLYA 3HK2A 3TAMA 2HHWA 1JL1A 3MAQA 4E7HA 3PY8A 1FKOA 5HRPA 4ZTFA 3AVGA 4N56A 3KTQA 1QTSA 3EYZA 2G8IA 1BIZA 3VQCA 4E89A 1XI1A 1VOKA 2X6NA 3DOLA 3V9SA 5CZ1A 3K5LA 4FLZA 4OGEA 2GUIA 4GVMA 3IG1A 3AO4A 1E42A 3CFPA 3V9WA 5CYMA 4FZZA 2DFEA 1QN7A 1S1TA 1S9GA 2KTQA 2F96A 4CJEA 1KYDA 2VJ0A 1BI4B 1UWBA 3NF8A 3HS8A 1IKWA 4O55A 4PA1A 3SNNA 4E1MA 4DQPA 5DMRA 4DU4A 4CJUA 4CF8A 1SL2A 4O0IA 1BCMA 1QN9A 3NF9A 3RTVA 2FBYA 2XRIA 1Y97A 4KRFA 4B08A 3RWUA 2JGUA 4QAGA 3TAPA 1LWFA 1RT4A 3THVA 2KW4A 4EP5A 1A5XA 4CHZA 3VA3A 4ELTA 3O4QA 3AO1A 4ID5A 3NAEA 4E3SA 3LPTA 4B9SA 4CJ4A 1BHLA 1AISA 1RDBA 2FBXA 3AO2A 3NH1A 1U45A 4Y1DA 4HUFA 3TAFA 4K8ZA 4CEBA 4OPJA 4NYNA 4CEAA 2XY6A 1F21A 4CEDA 2GV9A 3OYDA 3QEPA 3K5MA 4CECA 1B9FA 3VQ4A 3I0RA 3CYMA 3LPUA 3ZT2A 4JRPA 4KKOA 1XC9A 1VSJA 3NBPA 2QKKA 3OJUA 3HSTB 3KIOA 3LWMA 1RTHA 5C42A 4FK4A 3CFRA 2P1JA 4ID1A 3KLIA 3PO4A 4M3ZA 4NCBA 4Z4IA 2D5RA 4CJFA 3AVIA 5J2MA 1IH7A 2Z1JA 4CFDA 3TARA 3KKSA 1RDCA 1TKZA 3H1ZA 2YHAA 4W5QA
chains in the Genus database with same CATH superfamily
3J80O 2ASOA 3CMEN 1N3CA 3L2RA 1JKHA 3MN6A 5HRRA 1HNIA 1KCFA 2A1SA 3TTCA 1JXEA 3OYAA 4KHWA 1JLFA 1IKVA 4H0XB 1VQON 2Q97A 1VRTA 4BRFA 5HSHA 1WSJA 1Q18A 1SKRA 3D7QA 4DB3A 4EJYA 1QN4A 4ISEA 4OGCA 2NOFA 4DV0K 1NJXA 2ZD1A 3T1HK 1RT1A 2F9TA 4O8KA 1L3VA 2FBVA 2RKIA 4M3RA 3W0LA 4O0JA 2GUPA 3ZSWA 4M3WA 4CZKA 1PZDA 1KQSM 4C7PA 2Q0UA 4CZIA 2HOEA 2NOBA 1I3AA 3EKUA 3ID6A 1N36K 4LFBK 3LDPA 4BREA 3P31A 3I56N 3O6WA 1C0UA 5AQUA 5AQZA 4Z4HA 5AFUA 3DLBA 2JOIA 4WQ5C 4WFAL 2ZM6K 4KPYA 4FJJA 3O9RA 1JLAA 5C2DA 1NU0A 1HQEA 1EUVA 2HHVA 2F8TA 4RW8A 1NK8A 2YA3A 2V92A 3VQPA 1VSDA 4I9LA 4JNEA 1RCHA 3HOSA 3TAEA 2IDOA 3VENA 4M3UA 4FJXA 3NDKA 4CJVA 4BACA 3O1WA 3CFOA 2NOEA 1RBUA 3OYLA 4CESA 5F2RA 1QN3A 1DEJA 3H08A 3OA9A 1QTPA 4LH5A 3F2KA 4E19A 1T6AA 3M8QA 3EIKA 1S1XA 1VSIA 3TPQA 2RPIA 5GIPA 1GLJO 4H0TB 2AA4A 5E26A 2NRVA 3OS1A 3CJ9A 5AQLA 3HVRA 3HTVA 4FLWA 4OVLA 3G4SN 3E1YA 3WNFA 2DKCA 2NRRA 3DXKA 5BMNA 3OYNA 3AA2A 4EP4A 3L8BA 3ULXA 3AVFA 3T1AA 1U49A 4LY7A 3A5NC 1QN8A 1L3TA 1S1UA 4DV6K 3FFKB 4FW2A 3LM2A 2QTDA 2KQ2A 3NGZA 4KTQA 4WXAA 1ILYA 3V1QA 5C24A 4AILC 4PL7A 1QE1A 5K14A 4E7KA 1NNEA 1HJRA 4IZ9A 2XO7A 3NH2A 4M42A 3TI0A 2G8UA 1N5YA 3JSMA 1BA1A 4CFAA 1M5Q1 4CZMA 5AQHA 4HJHA 2P9PA 3QBWA 3AVBA 1WSIA 1XNQK 2HSTA 3CMAN 3M6GA 3SJHA 5AQFA 4JI2K 1TK5A 2P9LA 4Q0BA 3G6EN 1WSHA 2BH1A 4H0OA 2HMPA 4CJWA 4BE2A 1UL7A 4JN4A 4YDUC 4Y1CA 4CK2A 4RCHA 2GBZA 4CZEA 2VWBA 4LFAK 3IMXA 3C65A 3GOIA 4B1YB 4M3TA 3AARA 1KYFA 4ISGA 3N89A 1KRPA 4JK7A 3RRHA 1FN7A 2V51B 1A5VA 5AR0A 4DF8A 3OS0A 1N33K 2GX9A 2QLVA 3WNGA 3CETA 4BRLA 5E84A 4IBNA 3QIOA 5CY4A 2OPQA 2FLOA 1QNAA 3S3NA 4B9NA 4DLEA 3THWB 1TYQB 1D4XA 1YXQA 3CCSN 1NK9A 3C6AA 3S3OA 1NK4A 4TPSA 3D2FB 4MO4A 2MJ7A 4DSJA 4I8OA 1QS4A 4CERA 4LF5K 4IOCL 5KRSA 3I3WA 3QETA 4WQ4C 4A2BA 3BF1A 3VQ9A 1XWLA 4A62A 5J2PA 2ZFDB 4JS4A 4B1UB 1SZ2A 2FSJA 1YUWA 4BY9C 3OYJA 1FKPA 3BEXA 4OPKA 4G9ZA 4I2QA 3N4QA 3NMUA 4DTMA 2OPRA 3FR0A 2CH5A 1KFDA 3DLKA 1CXUA 3CQ8A 3DXMA 3U3GA 3ZSRA 2YI1A 1JCFA 3MMVA 3VERA 4DTUA 1S1VA 3LP0A 1TGHA 3CVTA 2B6AA 5AQSA 3O9SA 2HBLA 3QICA 2D0PA 3KHYA 1B9KA 3TAGA 3UKUA 2O8EA 1JCGA 3O3GA 2QW9A 3ATUA 2P9SA 3ATVA 1Z26A 4E7LA 3RSMA 4BE0A 1S9EA 3CM6A 4DTJA 4KB1A 1QN5A 1BQMA 3RR7A 2O4GA 3VQ6A 1NH2A 3O08A 3T7ZA 4LF4K 4DQQA 4DFPA 2HKPA 3OBWA 4FWNA 4JK8A 3MX2A 4KI6A 4IG0A 5TKYA 4FXDA 4GV6A 1YQLA 1S6QA 4FM1A 4FK2A 2HNZA 4CHPA 4DTSA 1BGXT 1XHZA 4CGIA 4CF2A 1ITGA 4PWDA 1P5GX 3DLLL 1FK9A 1KYUA 1WAJA 3M5RA 4CJ3A 2RF2A 3R8EA 4YDUA 4JRQA 2PY5A 1TK0A 2YX6A 1U6ZA 4CHYA 4C8KA 5FRMA 3AO5A 3NGYA 4XH1A 2G8WA 1VQ5N 1HPMA 3SPYA 2RHKA 1YTUA 3CCQN 4C1NI 3R6MA 4Q11A 2HHSA 3D7EO 1YTFA 1ASVA 1VRUA 5EVZA 2G8FA 4FWOA 3HI0A 4JD2B 3ZETA 4EHUA 2NOLA 4FJ9A 3VEOA 2YH5A 4KO0A 4C8NA 3OS2A 4AHVA 3ZX2A 3HVTA 1HKBA 2JHNA 5HRSA 3M3ZA 1DTTA 2YNFA 1VQPN 2O8BB 5TKWA 3G10A 4H03B 4CHQA 3PDKA 2IV9A 4DV3K 3CCLN 4C8LA 4B9UA 3C6UA 1CLQA 4DTRA 1E4GT 3K9JA 4DU1A 4FLVA 3ZSQA 4LFCK 1ASWA 3L2VA 4RTFD 1ZBSA 3AO3A 3P38A 4DUZK 3RMBA 1UA1A 4F2SA 1M3HA 2E2OA 3CWTA 4FLTA 2XY5A 2WFBA 2HHXA 2P5OA 3EEQA 3LP1A 2R7YA 2FGTA 3AVKA 3VF2A 4QG5A 3ENOC 4RODB 4CFBA 4FYDA 1L3UA 1QQCA 1JLEA 4BDPA 4CZGA 4CIGA 3L6QA 3CHWA 4X62K 3K2PA 4E1JA 4CF9A 4OKKA 2YHYA 3KTUA 3ID8A 1RT7A 4DV1K 2LAEA 4FWLA 4XEIA 2QA4N 4B3RK 5GINA 2YNIA 3LDNA 3TU5A 1C6VA 4X66K 3HT3A 4IKFA 1HNWK 3A5LC 1RT5A 2CGLA 2HZMA 4C8MA 3CG7A 4DSFA 2FSKA 5AQPA 3VTIA 2HHWA 4J8FA 1JL1A 3MAQA 4E7HA 4B1ZA 1BWFO 5AQTA 3E9PA 4E89A 3V9SA 5HOOA 2GUIA 3IG1A 3CFPA 4FZZA 1JCEA 1PCJX 1QN7A 4B3MK 3FLCO 5JLFA 4DR2K 1BI4B 4JV5K 4PA1A 3SNNA 3NVKA 2FF3B 2HBMA 4DQPA 3WXKA 4BRIA 1S72N 1BCMA 3NF9A 4CVNE 4MDBA 2FBYA 2XRIA 3RTVA 1W2BM 2JWKA 4QAGA 3TAPA 2KW4A 5AFUH 2V8QA 1A5XA 3O4QA 3AO1A 4ID5A 3O9UA 4B9SA 2MZ8A 4IXCA 2FBXA 1RDBA 3AO2A 1U45A 1VQLN 4K8ZA 3OYDA 2GV9A 3ZT2A 1XC9A 3OJUA 3KIOA 2BTFA 5AQVA 4FK4A 3PO4A 3PLAA 5GADP 4CJFA 5BR9A 5J2MA 4CFDA 4U7BA 1RDCA 3DPTA 4W5QA 1YAGA 4GV9A 1VK0A 2O8FA 4FPAA 1T3VA 4O5FA 3VQQA 2FUVA 4NCGA 1BISA 3ZLJA 1ZBLA 3V4IA 3H6EA 4LSNA 1TL1A 4GNIA 1X9SA 4LSLA 2Y8LA 4TSXA 1NK7A 3KD1E 5AQOA 4YOTA 3V6DA 3PX0A 1ZBIA 1TKTA 3HRGA 4YNQA 2NZTA 3THYA 3WNHA 5AQNA 3S3MA 2X74A 4FJKA 3L3UA 4AQYK 4WCEL 5LJWA 3I33A 3TABA 4KHPK 3WXMB 2IVNA 2YHXA 1N32K 3MN5A 3DWLA 3SI6A 5GAEP 1WSFA 4K25A 1NOYA 2KZMA 3SV4A 4J2BA 2E8AA 4LF8K 3HPGA 5SWMA 2QXFA 3EE9A 3WXLA 3O9TA 1S1WA 1KFSA 1RTIA 1TV6A 3C7NA 2BDPA 4JI6K 1U2VA 3KLHA 1HQUA 3L3VA 4NXNK 1J9AA 1G15A 3BY5A 2CH6A 2UUCK 3OSTA 4IOXA 3K5NA 2YKNA 1LV5A 2UXCK 2NOZA 2Q3SA 4CEFA 3LAMA 2NRXA 5M1OA 1HYVA 2Y1IA 3CCMN 3LZIA 1REVA 1GOCA 3OH6A 1BO5O 5I9EB 4DWIA 3KK1A 4RG8A 2OZMA 4GY2B 3KD5E 2E20A 3FFIA 4XH4A 3G0ZA 4FJ5A 3THXB 5DM7L 1HR0K 1HYZA 3K58A 3M8SA 1Q8IA 2Q0RA 3TE5A 3VEWA 1QN6A 1HLUA 3O8MA 1R0AA 1SS6A 4HHTA 3QINA 4H0PA 2NRTA 5BPLA 3WXJA 2QEXN 4IOAL 2F9WA 2G8KA 3A5OC 2KFZA 3IS9A 1XMQK 5M1KA 1NG9A 1IKXA 4FM2A 3BZCA 3ENOA 4A5BA 4FVMA 3FZHA 3LDSA 4WE1A 3AAPA 4F8RA 1GLFO 2JHJA 3C95A 4GW6A 3BDPA 4BVPA 3K0SA 3SZ2A 4B1XB 2HW3A 1JJ2M 2HNDA 4HTUA 5GAHP 3M8RA 3HJFA 4BVOA 3DRRA 2O8CA 1B9DA 3VETA 3I0SA 4DFMA 2FC0A 3KLGA 3NE6A 5M1NA 1KVCA 4XIUA 4FOEA 4B1WB 4I6MA 4BR5A 2UXDK 3KK7A 4JI5K 4F4KA 3MEDA 1OH6A 3FGUA 1D8YA 4ELVA 3ZT1A 5BN8A 3MEEA 2KLAA 2HF3A 3SUPA 3OYEA 3DLRA 4M41A 1KSPA 3T69A 1LAWA 5FLXO 3WUHA 3EO3A 1N34K 3WT0A 2W40A 4MRQA 3PX6A 4PHTX 3C94A 2KHOA 2HMIA 4WZSD 1EBMA 2W42A 3E9OA 2HL9A 2WOMA 3LWLA 2O8CB 2DTUA 1LWCA 3LL3A 1OVQA 4BRQA 1NGMA 3QEIA 2BE2A 2EHBD 2A5XA 1DLOA 4QCLA 1HX1A 4NLBA 3AVMA 4IDHA 2ASMA 2ZJRL 5GAGP 3VN5A 3HM8A 4I7FA 5HP1A 4Y0WA 1KY7A 1WBBA 1LAVA 2Z0FA 2E2QA 4FL9A 3RRGA 3IH7A 2YCHA 2IVOA 1Q9XA 1IJJA 4H5VA 4CF1A 1YT3A 2W6KA 1K2YX 1KAYA 1TAUA 5FPNA 3NF6A 4DTXA 1N8RO 1VQ8N 3EZWA 4A57A 3SUNA 1QVGM 4J2DA 3F73A 2Y8QA 3B6PA 3E66A 4RW6A 4EFHA 2P51A 1C0TA 2QRDA 1Z05A 2CGJA 3VGMA 4FK0A 4PUOA 1TKDA 5AQYA 3OVNA 1HPZA 1C9BB 3ZSVA 2QR1A 2Z1IA 3VQ7A 3I8BA 1WBDA 3KJVA 2RN2A 3CJ7A 4CE9A 3EZ5A 1KLMA 3V81A 3R9PA 3V9UA 3J7YP 4IFVA 3DRSA 2ZF5O 2P9LB 1NWKA 3O4NA 4RW7A 1VSKA 2NLVA 3DLHA 1UOCA 2UUAK 2O8DB 2ZGZA 4DR1K 3CJ1A 3ZSXA 4B0AA 4NLCA 1T03A 3HPOA 4QS7A 4N47A 2UXBK 3OYMA 2NRHA 1NK0A 4DF4A 1Z25A 1TUUA 2E88A 1W7AA 1OH7A 1BDGA 4EAIA 2PBDA 3FZMA 1QVFM 1PCMX 3A8YA 1VQNN 2A41A 3G25A 5BREA 1NKBA 2XY8A 1J54A 3SQ1A 4BJUA 4FWPA 3CD6N 2F4VK 4EAKA 2VG6A 4JHDB 1C4GA 3ZT4A 4CEOA 3I55N 2G8HA 3NGIA 1BI4A 4CD1A 5MLCQ 4OLAA 4QS8A 2YHBA 3NH0A 4MDAA 4JKBA 3HM9A 4LF9K 1T6DA 2OCEA 4JKCA 4EALA 4FWSA 4DS4A 3L0QA 4DLGA 2EWSA 5EX5A 3SK3A 1BIUA 3CJCA 2P9UB 4H4OA 3L2WA 3T3FA 3ULEB 4OKEA 1S6PA 4CJPA 2IVPA 4BWJA 4UY8O 4E0DA 5JLHA 4FJHA 1UAXA 1HRHA 1X1PA 2HVIA 4CZHA 1GLDG 4L3QA 4DR4K 1T44A 1ESVA 3DOKA 4BRNA 4C1NK 3JAMO 1RM1A 4ROCB 4FJ7A 4CW7B 3AA5X 3U8XA 4C23A 5HL7L 1S5JA 4CGHA 2Q31A 3DJCA 4FWRA 4FJIA 1GLEG 1U47A 2VYPA 1NLVA 2I5JA 2NNWA 1NMDA 3CCEN 1MPGA 1H1VA 3F0ZA 2F7TA 4G1QA 4YOUA 4MFBA 3ISNC 2E6LA 2Z8UA 3CQXA 4DV4K 3HPHA 3WNEA 5I42A 1EX4A 2VWJA 1A5WA 2P9UA 4KREA 3MWTA 5BMPA 3HO1A 1CXQA 1RT2A 4KHSA 1WSEA 3SQ2A 3H46O 4NXMK 1JLBA 1C0FA 4BR0A 4OKJA 4LF7K 4KAZA 1Q86O 3QFUA 3QESA 2E2PA 1TAQA 4DR3K 2H5AX 3AVHA 4CJSA 4J2AA 2E6MA 2WUSA 3CI5A 5FDLA 1LCUA 3WEEB 4R79A 3OYIA 3SUQA 3KKRA 4JHDA 2O4IA 2V7YA 4BDYA 1M90O 1V4TA 2D0OA 4BWMA 2ETJA 3V1RA 3MXJA 3CVSA 3GDQA 3IAYA 2IGIA 4FSVA 5KQ8A 3ZETB 4CJTA 5LY3A 1C1BA 1QQMA 4M3YA 4B8AB 1YTBA 4YOVA 3NHGA 4E7JA 3AGKA 1TVRA 5LMNK 5AQJA 1J3MA 3HK2A 4AM6A 3IDHA 5HRPA 3QB0A 3KTQA 3ZX0A 3EYZA 2QWLA 2G8IA 1BIZA 3VQCA 4YY3K 3DOLA 4JD2A 4FLZA 3FE1A 1XSZA 4GVMA 1VQ9N 1E42A 3V9WA 3CQYA 5AZJB 4DV5K 2VJ0A 4BRMA 3O80A 1QN9A 4H5TA 4WQ4A 1Y97A 4KRFA 4B08A 2JGUA 4YOWA 1RT4A 3DPUA 4EP5A 4CHZA 3SBTA 4E3SA 3LPTA 1BHLA 1AISA 4Y1DA 2W41A 4HUFA 4FPBA 4CEBA 4NYNA 4YHHK 3QEPA 2V9JA 3MK6A 3VQ4A 3LPUA 4FVUA 1RTHA 2HBJA 4ID1A 4M3ZA 4DR7K 1BG3A 1RDUA 1QHAA 1J6ZA 3KKSA 3CJBA 1TKZA 3H1ZA 2YHAA 4QOZB 4ROEB 4KV8A 2IS3A 2QWRA 2NLXA 3SAHA 5JMVD 4R5PA 3WEEA 1C47A 1ZYQA 1NGFA 2PWWA 4KB0A 3AVAA 4JKFA 2XHIA 3OBYA 5AZIA 1GLAG 4AH9A 4BC4A 1RGIA 4CHNA 1I94K 4BRKA 1TBAB 2YV0X 5KGWA 5IYCP 1T7PA 2OTJN 3BZKA 4B3SK 4CHOA 3I0WA 5FROA 4WX8A 1V4SA 4PY5A 3NCIA 1X9JA 1S3XA 4CZFA 2YKMA 4CBUA 1RT3A 2AP1A 1DTQA 3S9HA 4E1NA 1TGOA 5AQGA 4CJKA 1K9MO 4JKAA 1YF5L 4CJ5A 3CWAA 1LXTA 1K8AO 2QXLA 3BGRA 3SUOA 2F8SA 3NF7A 3L2UA 3KLFA 2H3GX 1CZ9A 1IBLK 5EPCA 3Q7BA 3P83D 4A2AA 3CJAA 3BUZB 3DXMB 1ATSA 1U2VB 4F3OA 1U48A 2LSNA 1K8KB 1N6QA 4JI8K 2OOYA 4I9QA 2UU9K 2KZZA 4WF9L 1SQKA 2OPSA 2O8FB 4DV2K 4LH4A 1SUQA 4DG1A 1CDWA 4KTWA 4DSIA 4BQLA 2I7NA 2HHTA 3K59A 3I8DA 1P5DX 4JAXA 3RMCA 4DQIA 3QNNA 5CR4A 3J7ZO 1MWMA 1X3NA 1BU6O 5KRTA 1VSHA 5J1EA 4OX9K 4BRGA 3LDOA 3ZEUB 4CZJA 3A0IX 1XMOK 2GWKA 5EOYA 3DYAA 1RDWX 3J8AA 5BRHA 1IV0A 4OPAA 1DKGD 1YI2N 5EXWA 5AQRA 1QSYA 3SV3A 1KTQA 4B3TK 4MQ3A 3OYHA 1W80A 1RDDA 4KTZA 2VGNA 3J7AP 2Q36A 4ILJA 2E1YA 4BE1A 4DS5A 3ZT3A 4EJZA 4CIFA 4BG9A 3OHRA 1SAZA 1X3MA 1C0GA 3L2QA 4N41A 1K35A 3SQ4A 1UA0A 1T6CA 5KPTA 4AF1A 3TWHA 4GV3A 3BKQX 3ZSZA 2HF4A 3QO9A 3SCXA 3OYKA 4HVJA 4FWKA 2ZJQL 1JFIC 3CW7A 3EKSA 3H3NO 4JKHA 2DFHA 3ZEUA 1D9FA 2PYJA 4AM7A 2JWLA 3ZT0A 5AN4A 4RWTA 1K73O 4FJ8A 4OPHA 3CCVN 1BQNA 1YJ9N 3KK3A 4YORA 3TANA 1TUOA 1JLCA 2YJEA 1WQAA 4O8UA 3Q7CA 4DQSA 4CJRA 4JI7K 5FRNA 4M45A 3SMSA 3ZCMA 1C1CA 1K8KA 1HKGA 3VTHA 2OTLN 5LMUK 4B9VA 4K42A 4UQGA 1R59O 1RBVA 5AQKA 3P1GA 2HHUA 1HJOA 1VTOA 3S41A 3KVGA 3D2FA 5JS2A 1VKLA 3B8AX 2ZJPL 4Z0UA 4HUGA 1KC8O 3UIQA 3H1QA 3VEZA 1RBSA 3VEYA 3T19A 5HLFA 4Q5VA 5AQMA 2VQEK 1VQ4N 3OJSA 1J5OA 3OY9A 1LOTB 4JKGB 5CZ2A 5JMVA 4J2EA 1OH5A 3OYFA 1RBRA 2P9KA 2OA8A 4JI4K 1RNHA 4IO9L 4CK3A 2Z1GA 1SKSA 4FZXC 4FCYA 1P90A 1VTLE 4F3TA 4DFJA 3CM5A 3QEWA 4LF6K 3O9QA 3VOVA 3GG4A 1U4BA 1YVNA 4DSLA 2P9NA 3IKMA 3FZFA 2ASPA 3HOTA 1DIZA 5C10A 4CEZA 4AHRA 4I6MB 3TR8A 3RVCA 5HRNA 1SV5A 3HP6A 3LZJA 3MWPA 1TKXA 3OTOK 4B3OA 2O3OA 4QS9A 1KD1O 4B9QA 2VQFK 3K5OA 4BR4A 1EQYA 1MU2A 3KK2A 2OANA 1HUXA 2YNHA 4FZYA 4H8KA 3SQ0A 4CEQA 4EAJA 1YVUA 3M8PA 2DFFA 3SYZA 2OZSA 4V19S 2A6AA 1VSMA 3THWA 1TK8A 2PZSA 1VQKN 1YQRA 2FF6A 3F9KA 1SL0A 4YFUA 3F10A 5IYBP 5C25A 1NGJA 1P8ZA 1K6YA 1XNRK 2DPNA 2E4LA 1IBKK 3CC4N 3PIOL 3M1FA 5M1PA 4CEEA 1KY6A 3O3FA 3GL1A 4Z94A 2P9IB 1NM1A 4GMJB 2V7ZA 1BUPA 1ZBFA 4HWIA 1JLGA 3LAKA 3VF4A 4EHTA 4JS5A 2HHHK 4BC3A 1Z6RA 4MLEA 4X64K 5AZJA 1JXBA 4B9LA 2IOCA 4Z4CA 1EETA 3IRXA 1JL2A 3SAFA 1YJWN 4DSEA 3PMGA 3LDLA 4XH5A 3SMPA 1RT6A 4DUYK 2BANA 2GWJA 1RBTA 3LALA 3U9DA 4W5NA 1KFIA 4DSKA 3LM9A 1RILA 4BR2A 3HS9A 4CBWA 3DLGA 3CC7N 1W0HA 4M3XA 4IEIA 3U9ZA 5B8HA 3CCRN 3RSEB 5I3UA 4BG8A 4FWMA 3VMFB 4ILGB 3E9LA 4EAHD 5LJVA 4BROA 2YNGA 1NK6A 3KRMA 4BR7A 2P9IA 4YOYA 1GLCG 3DM2A 5IYDP 2F7LA 3VEXA 4LC9B 3WQUA 3TSQA 3PUFA 1NJYA 3NVMA 2QREA 3CERA 1YQKA 2WC9A 1Q7YO 3V1OA 3MCAB 4CZLA 3ZSYA 5T7BA 3C6HA 3U4LA 2B4JA 4I2PA 4BDZA 4IDKA 5JN5A 3J81O 2Q1NA 2W6LA 3U3YA 1SL1A 1LWWA 1VQMN 3P4IA 3VQAA 1Y64A 3TSPA 5JS1A 1Q81O 1B92A 4O5BA 5IT9O 5KI6A 1HMVA 1J5EK 1C0MA 1RDAA 2J4RA 2QWNA 3AV9A 1QNEA 1LW0A 3LP2A 2H4LX 3PO5A 2FSNA 4AHTA 1VQ7N 3JYTA 4FLUA 4GKKK 5ADXH 3EN9A 4FWQA 3UKRB 4FJGA 3UW2A 3ZYYX 3ITHA 1EKEA 2HVHA 3D2EA 2D0CA 4ELUA 1WUAA 4JI1K 2YJFA 1BOTO 1I39A 3DAWA 4Z4FA 2Q2RA 4WFBL 3PV8A 3ULEA 3SAGA 1VHXA 4WQ5A 2NOHA 3MEGA 3VEVA 2Y1JA 3L4IA 5BRFA 3OSMA 5BPNA 5HBMA 2HB5A 1CZBA 4PKHA 3C0BA 1N39A 1BCOA 2GELA 4DCHA 4BRAA 5AQXA 4EIAA 3VGLA 1KXPA 4K0KK 3ZX3A 3OSEA 3VGKA 3JXUA 1QTSA 1V5SA 1XI1A 2X6NA 5CZ1A 2I7PA 1NGBA 3VPZA 3FZLA 5FPDA 5CYMA 1PVSA 1S1TA 1LWVA 4O55A 3HS8A 2JPIA 1IKWA 4DHYA 4E1MA 4DU4A 3AY9A 3D6RA 2E5LK 5C12A 3RWUA 1N3AA 2FKMX 3MDQA 3H3OB 3THVA 3VA3A 3L4QA 4ELTA 4CJ4A 4BGAA 3UKUB 2O8EB 1RFQA 4OPJA 4CEAA 1YIJN 3F9MA 3P39A 4CECA 4JRPA 4KKOA 4PKIA 1VSJA 2QKKA 1MWKA 2D1KA 4H0YB 1KAXA 4Z4IA 2D5RA 1UT4A 3AVIA 3R1XA 2Z1JA 3TARA 2NVMA 1QSSA 2V52B 1NKCA 3C7NB 2IV8A 4RW9A 3H45C 3HYFA 1FJGK 1RTDA 3MECA 3D2EB 3O5BA 5IWAK 3CCJN 1GOAA 4FO0A 4DFKA 4CIEA 2BGGA 3O4WA 2QWMA 2G30A 1EP4A 4NO7A 3VQ5A 4HTLA 3TAQA 4JYAK 2EHGA 1IO2A 4DQ8A 4JKEA 1U04A 4DR6K 3MN7A 2A40A 3RMDA 3RPJA 1YJNN 3A5MC 4IG3A 3OYBA 2VG5A 3QNOA 3OH9A 2DKDA 3VQEA 3HXMA 3QEVA 3CC2N 2HL8A 1KFQA 5CE3A 3LANA 1GLLO 1M1KO 3GE1A 1NGDA 1G99A 4A59A 5F0XA 1E3MA 3QEXA 3AGRA 3PSIA 1ATNA 3AAQA 3SJJA 3D4VA 1WLJA 4X65K 1WAFA 2P9NB 3V9ZA 2HZSA 1LWYA 1WJWA 3F5TA 5ADXA 2X6SA 5AZIB 2D4WA 4AHSA 3IUCA 3AA3A 3PX4A 1YHQN 4CGFA 3PIPL 3RMAA 4AHCA 4JKDA 4BGBA 1FXXA 3P5JA 3ALYA 4H0VB 2HNYA 3U6FA 4K8XA 3N4PA 3HZ6A 1YTAA 1KVBA 1NGAA 4HCCA 3O3HA 1M3QA 3TDHA 4JK9A 4F2RA 1QTMA 5F1XA 1WB9A 4MLHA 1HYSA 4PL8A 1QZ6A 2WBNA 4F9OA 4CGJA 3EE8A 1TL3A 1WNSA 2WONA 3VA0A 5HROA 5C0YA 3K9KA 4EZ9A 1TYQA 2ZQBA 3QERA 4W5RA 4O44A 1IKYA 2PFUA 3ENHA 2D0AA 3BF3A 2IAJA 1D9DA 4B9MA 1NJWA 3D45A 5D3GA 2QWPA 3AVCA 2Z1HA 2E1ZA 2I5WA 1DGKN 1GOBA 4DV7K 4FM0A 4NB4A 2EX3A 1QZ5A 2P9PB 1HNZK 4HUEA 4H5NA 4A5AA 2IC3A 4A61A 5AQQA 3K57A 1XQSC 1R4XA 4KH4A 2NRWA 1O1WA 3QLHA 4IFYA 4FW1A 1XHXA 3ULDA 4M7YA 1W9HA 2WTUA 4OO1J 2ZE2A 4ICLA 4JLHA 2OPPA 4PQUA 1O13A 3KZBA 5KPZA 4DQRA 1EWQA 4B8CA 2ITGA 2GTDA 1E4FT 3BP8A 1VSEA 5KL0A 3MXIA 4FJNA 3SPZA 1HU0A 1XC3A 1VQ6N 3V9XA 2NUBA 5AQWA 4W5TA 1EXQA 1PCZA 3TTFA 4FOIA 3TSUA 1TUYA 5BN9A 2QI2A 4ISFA 1BA0A 3R3LA 4JKGA 2ITMA 1T05A 4ILHA 4JEPA 3OLPA 3CCUN 2P9KB 5BPMA 2VG7A 1QQNA 2FKFA 2RE2A 1MA9B 4L8RB 4B1VA 3OC3C 1KVAA 2QWQA 1HNXK 1X9MA 1QSLA 3I0XA 2O8DA 5DK5A 5J2QA 3AVJA 1J53A 4KHYA 2UYTA 2AJQA 5BR8K 5BRDA 1ZBHA 2OOXA 5KQDA 3OW2M 1D3UA 3SBGA 2NWVA 3CWSA 3HL8A 4ZHRA 4DR5K 1VAZA 4H4MA 4LD0A 1JLQA 4DU3A 4CJ7A 4IJAA 3VQ8A 1QNCA 1NGCA 4CJQA 1Q9YA 1NK5A 3SNSA 1XUPO 4IO8A 3G71N 1DT9A 1HNVA 4CF0A 4BC2A 1QHTA 3MCPA 3VQBA 1NKEA 4IFEA 4U67L 4CI6A 2XY7A 4M7XA 1NGHA 2VWKA 4CFFA 2QK9A 2XHBA 5LL6Z 1GLBG 5JVHL 3DXKB 1WSGA 3VESA 2P9SB 2R5XA 1MDUB 1YQMA 1EWRA 4IWVA 3OGDA 3EAYA 2ATQA 3W3DA 4KI4A 4AHUA 1MP9A 3RR8A 3AA4A 1UT7A 2JLEA 3HBTA 3OCIA 5AQIA 3THXA 2KFNA 4GVEA 5AJ3K 2PAVA 3QDKA 4DTPA 4GKJK 2B5JA 4KFBA 1RTJA 3UE5A 3C04A 1VOLB 3ENCA 1C1AA 3KWGA 4IJNA 2QKBA 1ASUA 3LP3A 4ZTJA 1IBMK 1T8EA 4KBOA 3OYCA 1FW6A 2VGMA 1ATRA 4IL8A 4EZ6A 5EU7A 3AVNA 4KHQA 2D0BA 3O1BA 3FZKA 2OYQA 4BRPA 4B9TA 2FBTA 5F9CA 3EY1A 1ZBUA 2QWOA 2E2NA 4CJLA 1VSLA 2NRZA 5E41A 3T4NA 5JICA 2NOIA 4NCAA 1WN7A 2DY4A 1BL3A 5CYQA 3DI6A 1OKJA 5M1QA 3KWIA 2DKAA 1D5AA 4H5RA 3ZSOA 3AVLA 1W97L 3DLEA 5A2QO 3DMJA 1L3SA 1TBPA 3H1VX 3A2FA 3MXMA 1JDYA 3CF5L 2FXUA 3NFAA 5KPRA 3CIPA 3QFPA 3C6TA 4Z4EA 3TTDA 4DTOA 1LWEA 4BRDA 1NVPA 4NYFA 1Q82O 2UUBK 4CFCA 5JVGL 4BQZA 5SZTA 4C8OA 4PKGA 1SKWA 4IEEA 1ZC6A 5KGXA 4CCHA 4FJMA 5J2NA 3KLEA 4CGDA 4E7IA 4KHUA 1NGGA 2O8BA 1VSFA 2QM1A 4DMNA 1S22A 2QRCA 2P5GA 2HBKA 4FJLA 4KH5A 3T1YK 4EAGA 3QIPA 3WQTA 4OLBA 4CK1A 5FPMA 4N76A 1L5UA 3HP9A 1IG8A 1IG9A 4KH6A 5C2FA 3VQDA 3OYGA 1NBWA 4DTNA 4NCBA 4RW4A 4Z4GA 2A1RA 3B6OA 4DKWA 4W5OA 2KKZA 2HHQA 2G8VA 4JI0K 3IFRA 1KO9A 4FLXA 1QNBA 3QMLA 4OJRA 1LW2A 2YHWA 3GBTA 3MX5A 4CGGA 4N5SA 1KLNA 4O4GA 3DRPA 1HKCA 1NMNA 4D7RA 1NOZA 4KHNA 3SLCA 1X9WA 2IIRA 4MO5A 3E01A 3RSEA 5DM6L 3PSFA 2X78A 3MN9A 4BC5A 1NGEA 5FPEA 4BRHA 3CWUA 3D0PA 1YITN 5H1SQ 3ASMA 1NJZA 5KTQA 4K41A 2ZGYA 3VF6A 2VCPA 2ZWHA 4HCBA 1NJIO 1NGIA 1CZAN 4K43A 2PYLA 3CXCM 1OH8A 4BR9A 3QBXA 4FLYA 3TAMA 3PY8A 1EO1A 1FKOA 4ZTFA 1Q9UA 2CGKA 3ENBA 5EY4A 3AVGA 4N56A 1VOKA 3K5LA 4OGEA 4WFNL 4WYBA 3AO4A 4DULA 2DFEA 1S9GA 2KTQA 2F96A 4CJEA 1KYDA 1OVYA 1UWBA 3NF8A 2A42A 3EL2A 5DMRA 4CJUA 4CF8A 4YOXA 4O0IA 3THYB 5C15A 1SL2A 3CPWM 4JI3K 3WXIA 1LWFA 3UB5A 4H5WA 2GEMA 3HSCA 3LDQA 3NAEA 5CHIA 1QQOA 3CPEA 1KAZA 3NH1A 1ZXOA 3TAFA 4BRCA 2A3ZA 5M1FA 2XY6A 1F21A 3JS6A 4CEDA 3K5MA 1B9FA 2BUPA 3I0RA 5GIOA 3CYMA 3UKRA 3NBPA 3HSTB 1WOQA 4CD3A 3LWMA 5C42A 4M63C 3CFRA 2P1JA 3KLIA 1IH7A 5ELZA 3NA5A 4CBXA 4D7QA
chains in the Genus database with same CATH topology
4ROEB 4KV8A 1QSSA 1VK0A 2IS3A 3VQQA 1NKCA 4NCGA 1N3CA 1BISA 1JKHA 2IV8A 3L2RA 4RW9A 3V4IA 1ZBLA 4LSNA 4R5PA 1TL1A 1HNIA 1KCFA 2A1SA 3HYFA 5HRRA 4F2SA 1ZYQA 1X9SA 1JXEA 3MECA 3OYAA 1RTDA 4KB0A 1JLFA 1IKVA 4KHWA 4LSLA 4TSXA 1NK7A 1GOAA 3AVAA 4DFKA 1VRTA 1WSJA 1SKRA 3KD1E 2XHIA 4CIEA 3PX0A 3V6DA 2BGGA 1ZBIA 1TKTA 2G30A 4YNQA 4EJYA 1EP4A 3VQ5A 4AH9A 3TAQA 1QN4A 4CHNA 1TBAB 2NOFA 2YV0X 5IYCP 2EHGA 2X74A 4OGCA 5KGWA 3WNHA 3S3MA 4CHOA 3L3UA 4FJKA 3I0WA 1NJXA 2ZD1A 1IO2A 5FROA 1RT1A 4PY5A 1L3VA 4QOZB 3NCIA 2FBVA 3TABA 2RKIA 1U04A 4M3RA 3RMDA 3RPJA 2YKMA 3SI6A 1WSFA 1RT3A 4O0JA 1NOYA 1DTQA 3S9HA 3ZSWA 4M3WA 4E1NA 2KZMA 1TGOA 1PZDA 4CJKA 3SV4A 4IG3A 3OYBA 4J2BA 2VG5A 3QNOA 4CJ5A 3HPGA 2NOBA 1I3AA 5SWMA 2QXFA 3VQEA 3BGRA 3HXMA 3QEVA 3SUOA 2F8SA 3NF7A 3L2UA 3KLFA 1S1WA 1CZ9A 1KFSA 3LANA 1RTIA 1TV6A 2BDPA 1C0UA 3P83D 4Z4HA 3KLHA 1HQUA 3DLBA 2JOIA 3L3VA 4F3OA 3QEXA 1J9AA 1U48A 1G15A 2LSNA 4KPYA 3OSTA 3SJJA 4FJJA 1N6QA 3K5NA 2YKNA 1WLJA 1LV5A 4I9QA 2KZZA 1JLAA 2OPSA 2NOZA 2Q3SA 4CEFA 3LAMA 4LH4A 1HQEA 1SUQA 1CDWA 4KTWA 1HYVA 1WAFA 4DG1A 2Y1IA 3LZIA 1REVA 4DSIA 1GOCA 3V9ZA 2HZSA 1LWYA 2HHVA 2F8TA 2HHTA 4RW8A 3K59A 3I8DA 1NK8A 3RMCA 4DQIA 4DWIA 3KK1A 3QNNA 4RG8A 3VQPA 1VSDA 4I9LA 2OZMA 3KD5E 3FFIA 3G0ZA 2X6SA 4FJ5A 1RCHA 1HYZA 4AHSA 3M8SA 1Q8IA 3K58A 2IDOA 3AA3A 3TAEA 3PX4A 4CGFA 3RMAA 5KRTA 1VSHA 1QN6A 4AHCA 4FJXA 4M3UA 5J1EA 3NDKA 4CJVA 1R0AA 1FXXA 3P5JA 4HHTA 3ALYA 3QINA 4BACA 2HNYA 2NOEA 1RBUA 3CFOA 3OYLA 3U6FA 4CESA 4K8XA 1QN3A 3DYAA 1YTAA 1KVBA 3H08A 4HCCA 1QTPA 4LH5A 4E19A 3M8QA 2G8KA 3EIKA 1S1XA 1VSIA 3O3HA 3IS9A 2KFZA 2RPIA 1M3QA 3OS1A 1QSYA 3SV3A 1KTQA 1IKXA 4F2RA 4MQ3A 3OYHA 4FM2A 1QTMA 1W80A 1RDDA 4KTZA 3HVRA 4FLWA 4FVMA 4OVLA 3LDSA 3WNFA 4WE1A 1HYSA 4DS5A 4BE1A 3ZT3A 4EJZA 3OYNA 3AA2A 4CIFA 4EP4A 4F8RA 4CGJA 3ULXA 3AVFA 1TL3A 3T1AA 3L8BA 3C95A 1U49A 4LY7A 1WNSA 2WONA 4GW6A 3BDPA 3SZ2A 1QN8A 3VA0A 3L2QA 5HROA 1S1UA 1L3TA 4N41A 2HW3A 3SQ4A 1UA0A 2HNDA 4FW2A 4HTUA 4EZ9A 2ZQBA 3QERA 4W5RA 4O44A 1IKYA 2KQ2A 3M8RA 3TWHA 3HJFA 3DRRA 3NGZA 3ZSZA 3QO9A 4KTQA 3SCXA 2D0AA 1B9DA 2IAJA 3V1QA 3OYKA 1D9DA 5C24A 4B9MA 4AILC 4HVJA 1QE1A 5K14A 3I0SA 1NJWA 4DFMA 2FC0A 3KLGA 3NE6A 4E7KA 1JFIC 1KVCA 3D45A 4XIUA 1HJRA 2DFHA 5D3GA 2XO7A 1D9FA 3AVCA 2PYJA 3NH2A 2Z1HA 4M42A 2I5WA 3TI0A 4F4KA 1GOBA 3ZT0A 4FM0A 2EX3A 3MEDA 5AN4A 2G8UA 1N5YA 3JSMA 1D8YA 4ELVA 3ZT1A 4HUEA 4CFAA 4FJ8A 3MEEA 2IC3A 1BQNA 3AVBA 3K57A 3KK3A 3TANA 1WSIA 1JLCA 1R4XA 3SUPA 4DQSA 4CJRA 3DLRA 4M41A 3OYEA 1KSPA 1TK5A 5FRNA 1O1WA 4M45A 1LAWA 3QLHA 4IFYA 4FW1A 1XHXA 1WSHA 3ULDA 4Q0BA 3ZCMA 1C1CA 4CJWA 4BE2A 1W9HA 4B9VA 2ZE2A 4ICLA 4JLHA 4Y1CA 2OPPA 4UQGA 4PQUA 4CK2A 1RBVA 3PX6A 3C94A 2GBZA 2HMIA 4WZSD 1EBMA 3P1GA 2W42A 2HHUA 1VTOA 4DQRA 4B8CA 2WOMA 2ITGA 4M3TA 3LWLA 5JS2A 3MXIA 1VSEA 1KYFA 4FJNA 4Z0UA 4HUGA 3SPZA 3N89A 1KRPA 3UIQA 1LWCA 2DTUA 3RRHA 1RBSA 1FN7A 1HU0A 3QEIA 1NGMA 1A5VA 2BE2A 3T19A 3V9XA 5HLFA 4C8KA 2NUBA 4Q5VA 1DLOA 4QCLA 4W5TA 1EXQA 4DF8A 3AVMA 1PCZA 3OS0A 3OJSA 1J5OA 3OY9A 3VN5A 4I7FA 5CZ2A 3WNGA 4J2EA 5HP1A 3OYFA 1RBRA 1KY7A 1T05A 2OA8A 1LAVA 1RNHA 4IBNA 3QIOA 4CK3A 2Z1GA 1SKSA 2VG7A 2OPQA 5CY4A 4FCYA 3RRGA 4FZXC 3IH7A 1QNAA 3S3NA 4B9NA 4DLEA 1VTLE 1Q9XA 4L8RB 4DFJA 3CM5A 4CF1A 3QEWA 3OC3C 1KVAA 1YT3A 4F3TA 1X9MA 1QSLA 3I0XA 3S3OA 1NK4A 1NK9A 1TAUA 4TPSA 2OZSA 5DK5A 3NF6A 1U4BA 4DTXA 5J2QA 4DSLA 2MJ7A 3AVJA 4DSJA 1J53A 4I8OA 1QS4A 4CERA 4KHYA 2AJQA 5KRSA 3SUNA 4CEZA 3QETA 4J2DA 3F73A 4AHRA 3B6PA 1ZBHA 4RW6A 3VQ9A 5HRNA 1D3UA 3TR8A 1XWLA 1SV5A 3HP6A 3LZJA 3HL8A 2P51A 1C0TA 5J2PA 4ZHRA 4JS4A 1TKXA 4H4MA 4B3OA 2O3OA 3OYJA 1FKPA 4LD0A 1JLQA 4DU3A 4FK0A 4PUOA 1TKDA 4OPKA 3OVNA 3K5OA 1HPZA 1C9BB 3ZSVA 2Z1IA 4I2QA 3VQ7A 3VQ8A 1QNCA 4DTMA 2OPRA 4CJQA 3KJVA 1NK5A 1Q9YA 3SNSA 1MU2A 1KFDA 2RN2A 3DLKA 4CE9A 3KK2A 3EZ5A 1KLMA 3V81A 1CXUA 2YNHA 1HNVA 4CF0A 3V9UA 4IFVA 3CQ8A 3DRSA 3U3GA 1QHTA 3ZSRA 4FZYA 3VQBA 1NKEA 4H8KA 3O4NA 3SQ0A 4RW7A 1VSKA 1YVUA 3M8PA 4CEQA 2DFFA 3SYZA 4DTUA 2VWKA 2XY7A 1VSMA 1S1VA 1TK8A 2PZSA 1UOCA 1YQRA 3F9KA 1SL0A 3LP0A 1TGHA 2QK9A 4YFUA 3F10A 2B6AA 5IYBP 3ZSXA 4B0AA 5C25A 2XHBA 1T03A 3HPOA 4N47A 4KAZA 3TAGA 1B9KA 1K6YA 3OYMA 1WSGA 3O3GA 4DF4A 2E4LA 1NK0A 1Z25A 1YQMA 1Z26A 2ATQA 4CEEA 1KY6A 3O3FA 4KI4A 4AHUA 1MP9A 4E7LA 3RR8A 3AA4A 1UT7A 2JLEA 3OCIA 4BE0A 2KFNA 1NKBA 4GMJB 1S9EA 3CM6A 1ZBFA 2XY8A 4DTJA 4DTPA 4KB1A 1J54A 2B5JA 1QN5A 1JLGA 3LAKA 1BQMA 4JS5A 3SQ1A 2VG6A 3RR7A 2O4GA 3VQ6A 1NH2A 4KFBA 1RTJA 3ZT4A 4CEOA 1JXBA 4B9LA 1VOLB 2IOCA 4Z4CA 1EETA 3IRXA 1C1AA 1JL2A 4DQQA 4DFPA 2G8HA 3NGIA 1BI4A 1ASUA 4DSEA 2QKBA 3LP3A 4OLAA 3NH0A 2YHBA 4ZTJA 4KI6A 1RT6A 4IG0A 1T8EA 2BANA 4FXDA 1YQLA 1RBTA 3HM9A 3OYCA 1S6QA 3LALA 4FM1A 4FK2A 4W5NA 4DSKA 4EZ6A 5EU7A 1RILA 2HNZA 3HS9A 4CHPA 4DTSA 1BGXT 1XHZA 4CGIA 4CF2A 3AVNA 4DS4A 4KHQA 3DLGA 4DLGA 2D0BA 1ITGA 2OYQA 1W0HA 1BIUA 2FBTA 4B9TA 3EY1A 4M3XA 4PWDA 1FK9A 1ZBUA 1KYUA 5I3UA 4H4OA 1WAJA 4CJLA 3L2WA 3T3FA 4OKEA 1S6PA 4CJPA 1VSLA 4BWJA 4E0DA 4CJ3A 4FJHA 2RF2A 1UAXA 5E41A 2YNGA 4JRQA 1HRHA 2NOIA 1X1PA 1NK6A 4NCAA 1WN7A 2HVIA 2PY5A 1TK0A 3KRMA 1BL3A 3DI6A 5CYQA 3DLHA 2DY4A 3DOKA 4CHYA 3ZSOA 1T7PA 1RM1A 4ROCB 1D5AA 3AVLA 3DM2A 3AO5A 3DLEA 5IYDP 3NGYA 5FRMA 3DMJA 3AA5X 1L3SA 1TBPA 2G8WA 3A2FA 1S5JA 4CGHA 3MXMA 3PUFA 3NFAA 4FJIA 3SPYA 1NJYA 1YTUA 3C6TA 4Z4EA 4Q11A 4DTOA 1U47A 2HHSA 1LWEA 1YQKA 1NVPA 1YTFA 1ASVA 4NYFA 2I5JA 3V1OA 1VRUA 2G8FA 4CFCA 3F0ZA 4G1QA 5SZTA 3ZSYA 4MFBA 5T7BA 4C8OA 3ISNC 1SKWA 2NOLA 4CCHA 5KGXA 2E6LA 2Z8UA 5J2NA 4FJMA 4FJ9A 2B4JA 4I2PA 2YH5A 4IDKA 4KO0A 4BDZA 4C8NA 3OS2A 3KLEA 4CGDA 4AHVA 4E7IA 3U3YA 1SL1A 1LWWA 3HVTA 4KHUA 3HPHA 3WNEA 5I42A 1EX4A 1VSFA 2VWJA 5HRSA 4DMNA 4Z4GA 1A5WA 1DTTA 2YNFA 2P5GA 3VQAA 4FJLA 4KREA 3HO1A 5JS1A 3G10A 3QIPA 4CHQA 4OLBA 1CXQA 4CK1A 1RT2A 2IV9A 4N76A 1B92A 4O5BA 4KHSA 1WSEA 5KI6A 1HMVA 3HP9A 3SQ2A 1C0MA 1JLBA 1RDAA 3C6UA 1L5UA 1IG9A 4B9UA 4C8LA 4DTRA 1CLQA 3VQDA 4DU1A 4FLVA 3ZSQA 1ASWA 3L2VA 3AV9A 3AO3A 1QNEA 4OKJA 3OYGA 4DTNA 1LW0A 3LP2A 4RW4A 1M3HA 3QESA 3RMBA 1UA1A 4FLTA 1TAQA 2XY5A 2A1RA 3PO5A 3B6OA 4AHTA 2HHXA 4W5OA 3JYTA 2HHQA 2P5OA 2G8VA 3LP1A 2R7YA 3AVHA 4FLUA 4CJSA 2FGTA 1KO9A 3AVKA 4FLXA 1QNBA 4FJGA 4J2AA 2E6MA 4OJRA 5FDLA 3OYIA 1LW2A 3SUQA 4RODB 3ITHA 4FJ7A 1EKEA 4CFBA 4FYDA 3KKRA 1L3UA 2D0CA 2HVHA 2O4IA 1KLNA 4N5SA 1QQCA 4CGGA 4ELUA 1JLEA 4O4GA 3DRPA 1I39A 4BDYA 4BDPA 4CIGA 4Z4FA 1NOZA 4BWMA 4KHNA 2ETJA 3K2PA 1X9WA 4CF9A 3E01A 3V1RA 4OKKA 3MXJA 2X78A 3PV8A 3KTUA 3IAYA 2NOHA 1RT7A 3MEGA 2LAEA 3D0PA 2IGIA 1NJZA 3ASMA 2Y1JA 2YNIA 4CJTA 5KTQA 1C1BA 3OSMA 4M3YA 4B8AB 4HCBA 5HBMA 1C6VA 2HB5A 1YTBA 3HT3A 1CZBA 3NHGA 4E7JA 4IKFA 1N39A 1BCOA 1TVRA 1RT5A 2HZMA 4C8MA 3CG7A 4DSFA 2PYLA 4FLYA 3HK2A 3TAMA 2HHWA 1JL1A 3MAQA 4E7HA 3PY8A 1FKOA 5HRPA 4ZTFA 3AVGA 4N56A 3KTQA 1QTSA 3EYZA 2G8IA 1BIZA 3VQCA 4E89A 1XI1A 1VOKA 2X6NA 3DOLA 3V9SA 5CZ1A 3K5LA 4FLZA 4OGEA 2GUIA 4GVMA 3IG1A 3AO4A 1E42A 4DULA 3CFPA 5CYMA 3V9WA 4FZZA 2DFEA 1QN7A 1S1TA 1S9GA 2KTQA 2F96A 4CJEA 1KYDA 1LWVA 1UWBA 2VJ0A 1BI4B 3NF8A 3HS8A 1IKWA 4O55A 4PA1A 3SNNA 4E1MA 4DQPA 5DMRA 4DU4A 4CJUA 4CF8A 1SL2A 4O0IA 1BCMA 1QN9A 3NF9A 3RTVA 2FBYA 2XRIA 1Y97A 4KRFA 4B08A 3RWUA 1N3AA 2JGUA 4QAGA 3TAPA 1LWFA 1RT4A 3THVA 3DPUA 2KW4A 4EP5A 1A5XA 4CHZA 3VA3A 4ELTA 3O4QA 3AO1A 4ID5A 3NAEA 4E3SA 3LPTA 2MZ8A 4CJ4A 4B9SA 1BHLA 1AISA 1RDBA 2FBXA 3AO2A 3NH1A 1U45A 4Y1DA 4HUFA 3TAFA 4K8ZA 4CEBA 4OPJA 4NYNA 4CEAA 2XY6A 1F21A 4CEDA 2GV9A 3OYDA 3QEPA 3K5MA 4CECA 1B9FA 3VQ4A 3I0RA 3CYMA 3LPUA 3ZT2A 4JRPA 4KKOA 1XC9A 1VSJA 3NBPA 2QKKA 3OJUA 3HSTB 3KIOA 3LWMA 1RTHA 5C42A 4FK4A 3CFRA 2P1JA 4ID1A 3KLIA 3PO4A 4M3ZA 4NCBA 4Z4IA 2D5RA 4CJFA 1UT4A 3AVIA 5J2MA 1IH7A 2Z1JA 4CFDA 3TARA 3KKSA 1RDCA 3DPTA 1TKZA 3H1ZA 2YHAA 4W5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ROE B;  4KV8 A;  1QSS A;  1VK0 A;  2IS3 A;  3VQQ A;  1NKC A;  4NCG A;  1BIS A;  3L2R A;  1JKH A;  2IV8 A;  3V4I A;  4RW9 A;  1ZBL A;  4LSN A;  4R5P A;  1TL1 A;  1HNI A;  1KCF A;  2A1S A;  3HYF A;  5HRR A;  1ZYQ A;  1X9S A;  1JXE A;  3MEC A;  3OYA A;  1RTD A;  4KB0 A;  1JLF A;  1IKV A;  4KHW A;  4LSL A;  4TSX A;  1NK7 A;  1GOA A;  3AVA A;  4DFK A;  1VRT A;  1WSJ A;  1SKR A;  3KD1 E;  4CIE A;  3PX0 A;  3V6D A;  2BGG A;  1ZBI A;  1TKT A;  2G30 A;  4YNQ A;  1EP4 A;  3VQ5 A;  4AH9 A;  3TAQ A;  1QN4 A;  4CHN A;  1TBA B;  2YV0 X;  4OGC A;  5IYC P;  2EHG A;  2X74 A;  5KGW A;  3WNH A;  3S3M A;  1T7P A;  4CHO A;  3L3U A;  4FJK A;  1NJX A;  2ZD1 A;  1IO2 A;  5FRO A;  1RT1 A;  4PY5 A;  1L3V A;  4QOZ B;  3NCI A;  2FBV A;  3TAB A;  2RKI A;  1U04 A;  4M3R A;  3RMD A;  2YKM A;  3SI6 A;  1WSF A;  1RT3 A;  4O0J A;  1NOY A;  1DTQ A;  3S9H A;  3ZSW A;  4M3W A;  4E1N A;  2KZM A;  1TGO A;  1PZD A;  4CJK A;  3SV4 A;  4IG3 A;  3OYB A;  4J2B A;  2VG5 A;  3QNO A;  4CJ5 A;  3HPG A;  1I3A A;  5SWM A;  2QXF A;  3VQE A;  3BGR A;  3HXM A;  3QEV A;  3SUO A;  2F8S A;  3NF7 A;  3L2U A;  3KLF A;  1S1W A;  1CZ9 A;  1KFS A;  3LAN A;  1RTI A;  1TV6 A;  2BDP A;  1C0U A;  3P83 D;  4Z4H A;  3KLH A;  1HQU A;  3DLB A;  3L3V A;  4F3O A;  3QEX A;  1J9A A;  1U48 A;  1G15 A;  2LSN A;  4KPY A;  3SJJ A;  4FJJ A;  1N6Q A;  3K5N A;  2YKN A;  1WLJ A;  1LV5 A;  4I9Q A;  2KZZ A;  1JLA A;  2OPS A;  2Q3S A;  4CEF A;  3LAM A;  4LH4 A;  1HQE A;  1SUQ A;  1CDW A;  4KTW A;  1HYV A;  1WAF A;  4DG1 A;  2Y1I A;  3LZI A;  1REV A;  4DSI A;  1GOC A;  3V9Z A;  2HHV A;  2F8T A;  2HHT A;  4RW8 A;  3K59 A;  3I8D A;  1NK8 A;  3RMC A;  4DQI A;  4DWI A;  3KK1 A;  3QNN A;  4RG8 A;  3VQP A;  1VSD A;  4I9L A;  2OZM A;  3KD5 E;  3FFI A;  3G0Z A;  2X6S A;  4FJ5 A;  1RCH A;  1HYZ A;  4AHS A;  3M8S A;  1Q8I A;  3K58 A;  2IDO A;  3AA3 A;  3TAE A;  3PX4 A;  4CGF A;  3RMA A;  5KRT A;  1VSH A;  1QN6 A;  4AHC A;  4FJX A;  4M3U A;  5J1E A;  3NDK A;  4CJV A;  1R0A A;  1FXX A;  3P5J A;  4HHT A;  3ALY A;  3QIN A;  4BAC A;  2HNY A;  1RBU A;  3CFO A;  3OYL A;  3U6F A;  4CES A;  4K8X A;  1QN3 A;  3DYA A;  1YTA A;  1KVB A;  3H08 A;  4HCC A;  1QTP A;  4LH5 A;  4E19 A;  3M8Q A;  2G8K A;  3EIK A;  1S1X A;  1VSI A;  3O3H A;  3IS9 A;  2KFZ A;  2RPI A;  3OS1 A;  1QSY A;  3SV3 A;  1KTQ A;  1IKX A;  4F2R A;  4MQ3 A;  3OYH A;  4FM2 A;  1QTM A;  1W80 A;  1RDD A;  4KTZ A;  3HVR A;  4FLW A;  4FVM A;  4OVL A;  3LDS A;  3WNF A;  4WE1 A;  1HYS A;  4DS5 A;  4BE1 A;  3ZT3 A;  3OYN A;  3AA2 A;  4CIF A;  4EP4 A;  4F8R A;  4CGJ A;  3T1A A;  3AVF A;  1TL3 A;  3L8B A;  1U49 A;  3C95 A;  4LY7 A;  1WNS A;  2WON A;  4GW6 A;  3BDP A;  3SZ2 A;  1QN8 A;  3VA0 A;  3L2Q A;  5HRO A;  1S1U A;  1L3T A;  4N41 A;  2HW3 A;  3SQ4 A;  1UA0 A;  2HND A;  4FW2 A;  4HTU A;  4EZ9 A;  2ZQB A;  3QER A;  4W5R A;  4O44 A;  1IKY A;  2KQ2 A;  3M8R A;  3TWH A;  3HJF A;  3DRR A;  3NGZ A;  3ZSZ A;  3QO9 A;  4KTQ A;  3SCX A;  2D0A A;  1B9D A;  2IAJ A;  3V1Q A;  3OYK A;  1D9D A;  5C24 A;  4B9M A;  4AIL C;  4HVJ A;  1QE1 A;  5K14 A;  3I0S A;  1NJW A;  4DFM A;  2FC0 A;  3KLG A;  3NE6 A;  4E7K A;  1JFI C;  1KVC A;  3D45 A;  4XIU A;  1HJR A;  2DFH A;  5D3G A;  2XO7 A;  1D9F A;  3AVC A;  2PYJ A;  3NH2 A;  2Z1H A;  4M42 A;  3TI0 A;  4F4K A;  1GOB A;  3ZT0 A;  4FM0 A;  2EX3 A;  3MED A;  2G8U A;  1N5Y A;  3JSM A;  1D8Y A;  4ELV A;  3ZT1 A;  4HUE A;  4CFA A;  4FJ8 A;  3MEE A;  2IC3 A;  1BQN A;  3AVB A;  3K57 A;  3KK3 A;  3TAN A;  1WSI A;  1JLC A;  1R4X A;  3SUP A;  4DQS A;  4CJR A;  3DLR A;  4M41 A;  3OYE A;  1KSP A;  1TK5 A;  5FRN A;  1O1W A;  4M45 A;  1LAW A;  3QLH A;  4IFY A;  4FW1 A;  1XHX A;  1WSH A;  3ULD A;  4Q0B A;  3ZCM A;  1C1C A;  4CJW A;  4BE2 A;  1W9H A;  4B9V A;  2ZE2 A;  4ICL A;  4JLH A;  4Y1C A;  2OPP A;  4UQG A;  4PQU A;  4CK2 A;  1RBV A;  3PX6 A;  3C94 A;  2GBZ A;  2HMI A;  4WZS D;  3P1G A;  2HHU A;  2W42 A;  1VTO A;  4DQR A;  4B8C A;  2WOM A;  2ITG A;  4M3T A;  3LWL A;  5JS2 A;  3MXI A;  1VSE A;  1KYF A;  4FJN A;  4Z0U A;  4HUG A;  3SPZ A;  1KRP A;  3UIQ A;  2DTU A;  1LWC A;  3RRH A;  1RBS A;  3QEI A;  1NGM A;  1A5V A;  2BE2 A;  3T19 A;  3V9X A;  5HLF A;  2NUB A;  4Q5V A;  1DLO A;  4QCL A;  4W5T A;  1EXQ A;  4DF8 A;  3AVM A;  1PCZ A;  3OS0 A;  3OJS A;  1J5O A;  3OY9 A;  3VN5 A;  4I7F A;  5CZ2 A;  3WNG A;  4J2E A;  5HP1 A;  3OYF A;  1RBR A;  1KY7 A;  1T05 A;  2OA8 A;  1LAV A;  1RNH A;  4IBN A;  3QIO A;  4CK3 A;  2Z1G A;  1SKS A;  2VG7 A;  2OPQ A;  5CY4 A;  4FCY A;  3RRG A;  4FZX C;  1QNA A;  3S3N A;  4B9N A;  4DLE A;  1VTL E;  1Q9X A;  4L8R B;  4DFJ A;  3CM5 A;  4CF1 A;  3QEW A;  3OC3 C;  1KVA A;  1YT3 A;  4F3T A;  1X9M A;  1QSL A;  1NK9 A;  3S3O A;  1NK4 A;  1TAU A;  2OZS A;  5DK5 A;  3NF6 A;  1U4B A;  4DTX A;  5J2Q A;  4DSL A;  2MJ7 A;  3AVJ A;  4DSJ A;  1J53 A;  1QS4 A;  4CER A;  4KHY A;  2AJQ A;  5KRS A;  3SUN A;  4CEZ A;  3QET A;  4J2D A;  3F73 A;  4AHR A;  3B6P A;  1ZBH A;  4RW6 A;  3VQ9 A;  5HRN A;  1D3U A;  3TR8 A;  1XWL A;  1SV5 A;  3HP6 A;  3LZJ A;  3HL8 A;  2P51 A;  1C0T A;  5J2P A;  4ZHR A;  4JS4 A;  1TKX A;  4H4M A;  4B3O A;  3OYJ A;  1FKP A;  4LD0 A;  1JLQ A;  4DU3 A;  4FK0 A;  4PUO A;  1TKD A;  4OPK A;  3OVN A;  3K5O A;  1HPZ A;  1C9B B;  3ZSV A;  2Z1I A;  4I2Q A;  3VQ7 A;  3VQ8 A;  1QNC A;  4DTM A;  2OPR A;  4CJQ A;  3KJV A;  1NK5 A;  1Q9Y A;  1MU2 A;  2RN2 A;  1KFD A;  4CE9 A;  3DLK A;  3EZ5 A;  3KK2 A;  1KLM A;  3V81 A;  1CXU A;  2YNH A;  1HNV A;  4CF0 A;  3V9U A;  4IFV A;  3CQ8 A;  3DRS A;  3U3G A;  1QHT A;  3ZSR A;  4FZY A;  3VQB A;  1NKE A;  4H8K A;  3O4N A;  3SQ0 A;  4RW7 A;  1VSK A;  1YVU A;  3M8P A;  4CEQ A;  2DFF A;  3SYZ A;  4DTU A;  2VWK A;  2XY7 A;  1VSM A;  1S1V A;  1TK8 A;  2PZS A;  1UOC A;  3DLH A;  3F9K A;  1SL0 A;  3LP0 A;  1TGH A;  2QK9 A;  4YFU A;  2B6A A;  5IYB P;  3ZSX A;  4B0A A;  5C25 A;  2XHB A;  1T03 A;  3HPO A;  4N47 A;  4KAZ A;  3TAG A;  1B9K A;  1K6Y A;  3OYM A;  1WSG A;  3O3G A;  4DF4 A;  2E4L A;  1NK0 A;  1Z25 A;  1Z26 A;  2ATQ A;  4CEE A;  1KY6 A;  3O3F A;  4KI4 A;  4AHU A;  1MP9 A;  4E7L A;  3RR8 A;  3AA4 A;  2JLE A;  3OCI A;  4BE0 A;  2KFN A;  1NKB A;  4GMJ B;  1S9E A;  3CM6 A;  1ZBF A;  2XY8 A;  4DTJ A;  4DTP A;  4KB1 A;  1J54 A;  2B5J A;  1QN5 A;  1JLG A;  3LAK A;  1BQM A;  4JS5 A;  3SQ1 A;  2VG6 A;  3RR7 A;  2O4G A;  3VQ6 A;  1NH2 A;  4KFB A;  1RTJ A;  3ZT4 A;  4CEO A;  1JXB A;  4B9L A;  1VOL B;  2IOC A;  4Z4C A;  1EET A;  3IRX A;  1C1A A;  1JL2 A;  4DQQ A;  4DFP A;  2G8H A;  3NGI A;  1BI4 A;  1ASU A;  4DSE A;  2QKB A;  3LP3 A;  4OLA A;  3NH0 A;  2YHB A;  4ZTJ A;  4KI6 A;  1RT6 A;  4IG0 A;  1T8E A;  2BAN A;  4FXD A;  1RBT A;  3HM9 A;  3OYC A;  1S6Q A;  3LAL A;  4FM1 A;  4FK2 A;  4W5N A;  4DSK A;  4EZ6 A;  5EU7 A;  1RIL A;  2HNZ A;  3HS9 A;  4CHP A;  4DTS A;  1BGX T;  1XHZ A;  4CGI A;  4CF2 A;  3AVN A;  4DS4 A;  4KHQ A;  3DLG A;  4DLG A;  2D0B A;  1ITG A;  2OYQ A;  1W0H A;  1BIU A;  2FBT A;  4B9T A;  3EY1 A;  4M3X A;  4PWD A;  1FK9 A;  1ZBU A;  1KYU A;  5I3U A;  4H4O A;  1WAJ A;  4CJL A;  3L2W A;  3T3F A;  4OKE A;  1S6P A;  4CJP A;  1VSL A;  4BWJ A;  4E0D A;  4CJ3 A;  4FJH A;  2RF2 A;  1UAX A;  5E41 A;  2YNG A;  4JRQ A;  1HRH A;  1X1P A;  1NK6 A;  4NCA A;  2HVI A;  1WN7 A;  2DY4 A;  2PY5 A;  1TK0 A;  1BL3 A;  5CYQ A;  3DI6 A;  3DOK A;  4CHY A;  3ZSO A;  4C8K A;  1RM1 A;  4ROC B;  1D5A A;  3AVL A;  3DM2 A;  3AO5 A;  3DLE A;  5IYD P;  3NGY A;  5FRM A;  3DMJ A;  3AA5 X;  1L3S A;  1TBP A;  2G8W A;  3A2F A;  1S5J A;  4CGH A;  3MXM A;  3PUF A;  3NFA A;  4FJI A;  3SPY A;  1NJY A;  1YTU A;  3C6T A;  4Z4E A;  4DTO A;  1U47 A;  2HHS A;  1LWE A;  1NVP A;  1YTF A;  1ASV A;  4NYF A;  2I5J A;  3V1O A;  1VRU A;  2G8F A;  4CFC A;  4G1Q A;  5SZT A;  3ZSY A;  4MFB A;  5T7B A;  4C8O A;  3ISN C;  1SKW A;  4CCH A;  5KGX A;  2E6L A;  2Z8U A;  5J2N A;  4FJM A;  4FJ9 A;  2B4J A;  4I2P A;  4BDZ A;  4IDK A;  4KO0 A;  4C8N A;  3OS2 A;  3KLE A;  4CGD A;  4AHV A;  4E7I A;  3U3Y A;  1SL1 A;  3HVT A;  4KHU A;  3HPH A;  3WNE A;  5I42 A;  1EX4 A;  1VSF A;  2VWJ A;  5HRS A;  4DMN A;  4Z4G A;  1A5W A;  1DTT A;  2YNF A;  2P5G A;  3VQA A;  4FJL A;  4KRE A;  3HO1 A;  5JS1 A;  3G10 A;  3QIP A;  4CHQ A;  4OLB A;  1CXQ A;  4CK1 A;  1RT2 A;  2IV9 A;  4N76 A;  1B92 A;  4O5B A;  4KHS A;  1WSE A;  5KI6 A;  1HMV A;  3HP9 A;  3SQ2 A;  1C0M A;  1JLB A;  1RDA A;  3C6U A;  1L5U A;  1IG9 A;  4B9U A;  4C8L A;  4DTR A;  1CLQ A;  3VQD A;  4DU1 A;  4FLV A;  3ZSQ A;  1ASW A;  3L2V A;  3AV9 A;  3AO3 A;  1QNE A;  4OKJ A;  3OYG A;  4DTN A;  1LW0 A;  3LP2 A;  4RW4 A;  3QES A;  3RMB A;  1UA1 A;  4F2S A;  4FLT A;  1TAQ A;  2XY5 A;  2A1R A;  3PO5 A;  3B6O A;  4AHT A;  2HHX A;  4W5O A;  3JYT A;  2HHQ A;  2P5O A;  2G8V A;  3LP1 A;  2R7Y A;  3AVH A;  4FLU A;  4CJS A;  3AVK A;  4J2A A;  4FLX A;  1QNB A;  4FJG A;  2E6M A;  4OJR A;  5FDL A;  3OYI A;  1LW2 A;  3SUQ A;  4ROD B;  3ITH A;  4FJ7 A;  1EKE A;  4CFB A;  4FYD A;  3KKR A;  1L3U A;  2D0C A;  2HVH A;  2O4I A;  1KLN A;  4N5S A;  1QQC A;  4CGG A;  4ELU A;  1JLE A;  4O4G A;  3DRP A;  1I39 A;  4BDY A;  4BDP A;  4CIG A;  4Z4F A;  1NOZ A;  4BWM A;  4KHN A;  2ETJ A;  3K2P A;  1X9W A;  4CF9 A;  3E01 A;  3V1R A;  4OKK A;  3MXJ A;  2X78 A;  3PV8 A;  3IAY A;  1RT7 A;  3MEG A;  3D0P A;  2IGI A;  1NJZ A;  3ASM A;  2Y1J A;  2YNI A;  4CJT A;  5KTQ A;  1C1B A;  4M3Y A;  4B8A B;  4HCB A;  5HBM A;  1C6V A;  2HB5 A;  1YTB A;  3HT3 A;  1CZB A;  3NHG A;  4E7J A;  4IKF A;  1BCO A;  1TVR A;  1RT5 A;  4C8M A;  3CG7 A;  4DSF A;  2PYL A;  4FLY A;  3HK2 A;  3TAM A;  2HHW A;  1JL1 A;  3MAQ A;  4E7H A;  3PY8 A;  1FKO A;  5HRP A;  4ZTF A;  3AVG A;  4N56 A;  3KTQ A;  1QTS A;  3EYZ A;  2G8I A;  1BIZ A;  3VQC A;  4E89 A;  1XI1 A;  1VOK A;  2X6N A;  3DOL A;  3V9S A;  5CZ1 A;  3K5L A;  4FLZ A;  4OGE A;  2GUI A;  4GVM A;  3IG1 A;  3AO4 A;  1E42 A;  3CFP A;  3V9W A;  5CYM A;  4FZZ A;  2DFE A;  1QN7 A;  1S1T A;  1S9G A;  2KTQ A;  2F96 A;  4CJE A;  1KYD A;  2VJ0 A;  1BI4 B;  1UWB A;  3NF8 A;  3HS8 A;  1IKW A;  4O55 A;  4PA1 A;  3SNN A;  4E1M A;  4DQP A;  5DMR A;  4DU4 A;  4CJU A;  4CF8 A;  1SL2 A;  4O0I A;  1BCM A;  1QN9 A;  3NF9 A;  3RTV A;  2FBY A;  2XRI A;  1Y97 A;  4KRF A;  4B08 A;  3RWU A;  2JGU A;  4QAG A;  3TAP A;  1LWF A;  1RT4 A;  3THV A;  2KW4 A;  4EP5 A;  1A5X A;  4CHZ A;  3VA3 A;  4ELT A;  3O4Q A;  3AO1 A;  4ID5 A;  3NAE A;  4E3S A;  3LPT A;  4B9S A;  4CJ4 A;  1BHL A;  1AIS A;  1RDB A;  2FBX A;  3AO2 A;  3NH1 A;  1U45 A;  4Y1D A;  4HUF A;  3TAF A;  4K8Z A;  4CEB A;  4OPJ A;  4NYN A;  4CEA A;  2XY6 A;  1F21 A;  4CED A;  2GV9 A;  3OYD A;  3QEP A;  3K5M A;  4CEC A;  1B9F A;  3VQ4 A;  3I0R A;  3CYM A;  3LPU A;  3ZT2 A;  4JRP A;  4KKO A;  1XC9 A;  1VSJ A;  3NBP A;  2QKK A;  3OJU A;  3HST B;  3KIO A;  3LWM A;  1RTH A;  5C42 A;  4FK4 A;  3CFR A;  2P1J A;  4ID1 A;  3KLI A;  3PO4 A;  4M3Z A;  4NCB A;  4Z4I A;  2D5R A;  4CJF A;  3AVI A;  5J2M A;  1IH7 A;  2Z1J A;  4CFD A;  3TAR A;  3KKS A;  1RDC A;  1TKZ A;  3H1Z A;  2YHA A;  4W5Q A; 
#chains in the Genus database with same CATH topology
 3J80 O;  2ASO A;  3CME N;  1N3C A;  3L2R A;  1JKH A;  3MN6 A;  5HRR A;  1HNI A;  1KCF A;  2A1S A;  3TTC A;  1JXE A;  3OYA A;  4KHW A;  1JLF A;  1IKV A;  4H0X B;  1VQO N;  2Q97 A;  1VRT A;  4BRF A;  5HSH A;  1WSJ A;  1Q18 A;  1SKR A;  3D7Q A;  4DB3 A;  4EJY A;  1QN4 A;  4ISE A;  4OGC A;  2NOF A;  4DV0 K;  1NJX A;  2ZD1 A;  3T1H K;  1RT1 A;  2F9T A;  4O8K A;  1L3V A;  2FBV A;  2RKI A;  4M3R A;  3W0L A;  4O0J A;  2GUP A;  3ZSW A;  4M3W A;  4CZK A;  1PZD A;  1KQS M;  4C7P A;  2Q0U A;  4CZI A;  2HOE A;  2NOB A;  1I3A A;  3EKU A;  3ID6 A;  1N36 K;  4LFB K;  3LDP A;  4BRE A;  3P31 A;  3I56 N;  3O6W A;  1C0U A;  5AQU A;  5AQZ A;  4Z4H A;  5AFU A;  3DLB A;  2JOI A;  4WQ5 C;  4WFA L;  2ZM6 K;  4KPY A;  4FJJ A;  3O9R A;  1JLA A;  5C2D A;  1NU0 A;  1HQE A;  1EUV A;  2HHV A;  2F8T A;  4RW8 A;  1NK8 A;  2YA3 A;  2V92 A;  3VQP A;  1VSD A;  4I9L A;  4JNE A;  1RCH A;  3HOS A;  3TAE A;  2IDO A;  3VEN A;  4M3U A;  4FJX A;  3NDK A;  4CJV A;  4BAC A;  3O1W A;  3CFO A;  2NOE A;  1RBU A;  3OYL A;  4CES A;  5F2R A;  1QN3 A;  1DEJ A;  3H08 A;  3OA9 A;  1QTP A;  4LH5 A;  3F2K A;  4E19 A;  1T6A A;  3M8Q A;  3EIK A;  1S1X A;  1VSI A;  3TPQ A;  2RPI A;  5GIP A;  1GLJ O;  4H0T B;  2AA4 A;  5E26 A;  2NRV A;  3OS1 A;  3CJ9 A;  5AQL A;  3HVR A;  3HTV A;  4FLW A;  4OVL A;  3G4S N;  3E1Y A;  3WNF A;  2DKC A;  2NRR A;  3DXK A;  5BMN A;  3OYN A;  3AA2 A;  4EP4 A;  3L8B A;  3ULX A;  3AVF A;  3T1A A;  1U49 A;  4LY7 A;  3A5N C;  1QN8 A;  1L3T A;  1S1U A;  4DV6 K;  3FFK B;  4FW2 A;  3LM2 A;  2QTD A;  2KQ2 A;  3NGZ A;  4KTQ A;  4WXA A;  1ILY A;  3V1Q A;  5C24 A;  4AIL C;  4PL7 A;  1QE1 A;  5K14 A;  4E7K A;  1NNE A;  1HJR A;  4IZ9 A;  2XO7 A;  3NH2 A;  4M42 A;  3TI0 A;  2G8U A;  1N5Y A;  3JSM A;  1BA1 A;  4CFA A;  1M5Q 1;  4CZM A;  5AQH A;  4HJH A;  2P9P A;  3QBW A;  3AVB A;  1WSI A;  1XNQ K;  2HST A;  3CMA N;  3M6G A;  3SJH A;  5AQF A;  4JI2 K;  1TK5 A;  2P9L A;  4Q0B A;  3G6E N;  1WSH A;  2BH1 A;  4H0O A;  2HMP A;  4CJW A;  4BE2 A;  1UL7 A;  4JN4 A;  4YDU C;  4Y1C A;  4CK2 A;  4RCH A;  2GBZ A;  4CZE A;  2VWB A;  4LFA K;  3IMX A;  3C65 A;  3GOI A;  4B1Y B;  4M3T A;  3AAR A;  1KYF A;  4ISG A;  3N89 A;  1KRP A;  4JK7 A;  3RRH A;  1FN7 A;  2V51 B;  1A5V A;  5AR0 A;  4DF8 A;  3OS0 A;  1N33 K;  2GX9 A;  2QLV A;  3WNG A;  3CET A;  4BRL A;  5E84 A;  4IBN A;  3QIO A;  5CY4 A;  2OPQ A;  2FLO A;  1QNA A;  3S3N A;  4B9N A;  4DLE A;  3THW B;  1TYQ B;  1D4X A;  1YXQ A;  3CCS N;  1NK9 A;  3C6A A;  3S3O A;  1NK4 A;  4TPS A;  3D2F B;  4MO4 A;  2MJ7 A;  4DSJ A;  4I8O A;  1QS4 A;  4CER A;  4LF5 K;  4IOC L;  5KRS A;  3I3W A;  3QET A;  4WQ4 C;  4A2B A;  3BF1 A;  3VQ9 A;  1XWL A;  4A62 A;  5J2P A;  2ZFD B;  4JS4 A;  4B1U B;  1SZ2 A;  2FSJ A;  1YUW A;  4BY9 C;  3OYJ A;  1FKP A;  3BEX A;  4OPK A;  4G9Z A;  4I2Q A;  3N4Q A;  3NMU A;  4DTM A;  2OPR A;  3FR0 A;  2CH5 A;  1KFD A;  3DLK A;  1CXU A;  3CQ8 A;  3DXM A;  3U3G A;  3ZSR A;  2YI1 A;  1JCF A;  3MMV A;  3VER A;  4DTU A;  1S1V A;  3LP0 A;  1TGH A;  3CVT A;  2B6A A;  5AQS A;  3O9S A;  2HBL A;  3QIC A;  2D0P A;  3KHY A;  1B9K A;  3TAG A;  3UKU A;  2O8E A;  1JCG A;  3O3G A;  2QW9 A;  3ATU A;  2P9S A;  3ATV A;  1Z26 A;  4E7L A;  3RSM A;  4BE0 A;  1S9E A;  3CM6 A;  4DTJ A;  4KB1 A;  1QN5 A;  1BQM A;  3RR7 A;  2O4G A;  3VQ6 A;  1NH2 A;  3O08 A;  3T7Z A;  4LF4 K;  4DQQ A;  4DFP A;  2HKP A;  3OBW A;  4FWN A;  4JK8 A;  3MX2 A;  4KI6 A;  4IG0 A;  5TKY A;  4FXD A;  4GV6 A;  1YQL A;  1S6Q A;  4FM1 A;  4FK2 A;  2HNZ A;  4CHP A;  4DTS A;  1BGX T;  1XHZ A;  4CGI A;  4CF2 A;  1ITG A;  4PWD A;  1P5G X;  3DLL L;  1FK9 A;  1KYU A;  1WAJ A;  3M5R A;  4CJ3 A;  2RF2 A;  3R8E A;  4YDU A;  4JRQ A;  2PY5 A;  1TK0 A;  2YX6 A;  1U6Z A;  4CHY A;  4C8K A;  5FRM A;  3AO5 A;  3NGY A;  4XH1 A;  2G8W A;  1VQ5 N;  1HPM A;  3SPY A;  2RHK A;  1YTU A;  3CCQ N;  4C1N I;  3R6M A;  4Q11 A;  2HHS A;  3D7E O;  1YTF A;  1ASV A;  1VRU A;  5EVZ A;  2G8F A;  4FWO A;  3HI0 A;  4JD2 B;  3ZET A;  4EHU A;  2NOL A;  4FJ9 A;  3VEO A;  2YH5 A;  4KO0 A;  4C8N A;  3OS2 A;  4AHV A;  3ZX2 A;  3HVT A;  1HKB A;  2JHN A;  5HRS A;  3M3Z A;  1DTT A;  2YNF A;  1VQP N;  2O8B B;  5TKW A;  3G10 A;  4H03 B;  4CHQ A;  3PDK A;  2IV9 A;  4DV3 K;  3CCL N;  4C8L A;  4B9U A;  3C6U A;  1CLQ A;  4DTR A;  1E4G T;  3K9J A;  4DU1 A;  4FLV A;  3ZSQ A;  4LFC K;  1ASW A;  3L2V A;  4RTF D;  1ZBS A;  3AO3 A;  3P38 A;  4DUZ K;  3RMB A;  1UA1 A;  4F2S A;  1M3H A;  2E2O A;  3CWT A;  4FLT A;  2XY5 A;  2WFB A;  2HHX A;  2P5O A;  3EEQ A;  3LP1 A;  2R7Y A;  2FGT A;  3AVK A;  3VF2 A;  4QG5 A;  3ENO C;  4ROD B;  4CFB A;  4FYD A;  1L3U A;  1QQC A;  1JLE A;  4BDP A;  4CZG A;  4CIG A;  3L6Q A;  3CHW A;  4X62 K;  3K2P A;  4E1J A;  4CF9 A;  4OKK A;  2YHY A;  3KTU A;  3ID8 A;  1RT7 A;  4DV1 K;  2LAE A;  4FWL A;  4XEI A;  2QA4 N;  4B3R K;  5GIN A;  2YNI A;  3LDN A;  3TU5 A;  1C6V A;  4X66 K;  3HT3 A;  4IKF A;  1HNW K;  3A5L C;  1RT5 A;  2CGL A;  2HZM A;  4C8M A;  3CG7 A;  4DSF A;  2FSK A;  5AQP A;  3VTI A;  2HHW A;  4J8F A;  1JL1 A;  3MAQ A;  4E7H A;  4B1Z A;  1BWF O;  5AQT A;  3E9P A;  4E89 A;  3V9S A;  5HOO A;  2GUI A;  3IG1 A;  3CFP A;  4FZZ A;  1JCE A;  1PCJ X;  1QN7 A;  4B3M K;  3FLC O;  5JLF A;  4DR2 K;  1BI4 B;  4JV5 K;  4PA1 A;  3SNN A;  3NVK A;  2FF3 B;  2HBM A;  4DQP A;  3WXK A;  4BRI A;  1S72 N;  1BCM A;  3NF9 A;  4CVN E;  4MDB A;  2FBY A;  2XRI A;  3RTV A;  1W2B M;  2JWK A;  4QAG A;  3TAP A;  2KW4 A;  5AFU H;  2V8Q A;  1A5X A;  3O4Q A;  3AO1 A;  4ID5 A;  3O9U A;  4B9S A;  2MZ8 A;  4IXC A;  2FBX A;  1RDB A;  3AO2 A;  1U45 A;  1VQL N;  4K8Z A;  3OYD A;  2GV9 A;  3ZT2 A;  1XC9 A;  3OJU A;  3KIO A;  2BTF A;  5AQV A;  4FK4 A;  3PO4 A;  3PLA A;  5GAD P;  4CJF A;  5BR9 A;  5J2M A;  4CFD A;  4U7B A;  1RDC A;  3DPT A;  4W5Q A;  1YAG A;  4GV9 A;  1VK0 A;  2O8F A;  4FPA A;  1T3V A;  4O5F A;  3VQQ A;  2FUV A;  4NCG A;  1BIS A;  3ZLJ A;  1ZBL A;  3V4I A;  3H6E A;  4LSN A;  1TL1 A;  4GNI A;  1X9S A;  4LSL A;  2Y8L A;  4TSX A;  1NK7 A;  3KD1 E;  5AQO A;  4YOT A;  3V6D A;  3PX0 A;  1ZBI A;  1TKT A;  3HRG A;  4YNQ A;  2NZT A;  3THY A;  3WNH A;  5AQN A;  3S3M A;  2X74 A;  4FJK A;  3L3U A;  4AQY K;  4WCE L;  5LJW A;  3I33 A;  3TAB A;  4KHP K;  3WXM B;  2IVN A;  2YHX A;  1N32 K;  3MN5 A;  3DWL A;  3SI6 A;  5GAE P;  1WSF A;  4K25 A;  1NOY A;  2KZM A;  3SV4 A;  4J2B A;  2E8A A;  4LF8 K;  3HPG A;  5SWM A;  2QXF A;  3EE9 A;  3WXL A;  3O9T A;  1S1W A;  1KFS A;  1RTI A;  1TV6 A;  3C7N A;  2BDP A;  4JI6 K;  1U2V A;  3KLH A;  1HQU A;  3L3V A;  4NXN K;  1J9A A;  1G15 A;  3BY5 A;  2CH6 A;  2UUC K;  3OST A;  4IOX A;  3K5N A;  2YKN A;  1LV5 A;  2UXC K;  2NOZ A;  2Q3S A;  4CEF A;  3LAM A;  2NRX A;  5M1O A;  1HYV A;  2Y1I A;  3CCM N;  3LZI A;  1REV A;  1GOC A;  3OH6 A;  1BO5 O;  5I9E B;  4DWI A;  3KK1 A;  4RG8 A;  2OZM A;  4GY2 B;  3KD5 E;  2E20 A;  3FFI A;  4XH4 A;  3G0Z A;  4FJ5 A;  3THX B;  5DM7 L;  1HR0 K;  1HYZ A;  3K58 A;  3M8S A;  1Q8I A;  2Q0R A;  3TE5 A;  3VEW A;  1QN6 A;  1HLU A;  3O8M A;  1R0A A;  1SS6 A;  4HHT A;  3QIN A;  4H0P A;  2NRT A;  5BPL A;  3WXJ A;  2QEX N;  4IOA L;  2F9W A;  2G8K A;  3A5O C;  2KFZ A;  3IS9 A;  1XMQ K;  5M1K A;  1NG9 A;  1IKX A;  4FM2 A;  3BZC A;  3ENO A;  4A5B A;  4FVM A;  3FZH A;  3LDS A;  4WE1 A;  3AAP A;  4F8R A;  1GLF O;  2JHJ A;  3C95 A;  4GW6 A;  3BDP A;  4BVP A;  3K0S A;  3SZ2 A;  4B1X B;  2HW3 A;  1JJ2 M;  2HND A;  4HTU A;  5GAH P;  3M8R A;  3HJF A;  4BVO A;  3DRR A;  2O8C A;  1B9D A;  3VET A;  3I0S A;  4DFM A;  2FC0 A;  3KLG A;  3NE6 A;  5M1N A;  1KVC A;  4XIU A;  4FOE A;  4B1W B;  4I6M A;  4BR5 A;  2UXD K;  3KK7 A;  4JI5 K;  4F4K A;  3MED A;  1OH6 A;  3FGU A;  1D8Y A;  4ELV A;  3ZT1 A;  5BN8 A;  3MEE A;  2KLA A;  2HF3 A;  3SUP A;  3OYE A;  3DLR A;  4M41 A;  1KSP A;  3T69 A;  1LAW A;  5FLX O;  3WUH A;  3EO3 A;  1N34 K;  3WT0 A;  2W40 A;  4MRQ A;  3PX6 A;  4PHT X;  3C94 A;  2KHO A;  2HMI A;  4WZS D;  1EBM A;  2W42 A;  3E9O A;  2HL9 A;  2WOM A;  3LWL A;  2O8C B;  2DTU A;  1LWC A;  3LL3 A;  1OVQ A;  4BRQ A;  1NGM A;  3QEI A;  2BE2 A;  2EHB D;  2A5X A;  1DLO A;  4QCL A;  1HX1 A;  4NLB A;  3AVM A;  4IDH A;  2ASM A;  2ZJR L;  5GAG P;  3VN5 A;  3HM8 A;  4I7F A;  5HP1 A;  4Y0W A;  1KY7 A;  1WBB A;  1LAV A;  2Z0F A;  2E2Q A;  4FL9 A;  3RRG A;  3IH7 A;  2YCH A;  2IVO A;  1Q9X A;  1IJJ A;  4H5V A;  4CF1 A;  1YT3 A;  2W6K A;  1K2Y X;  1KAY A;  1TAU A;  5FPN A;  3NF6 A;  4DTX A;  1N8R O;  1VQ8 N;  3EZW A;  4A57 A;  3SUN A;  1QVG M;  4J2D A;  3F73 A;  2Y8Q A;  3B6P A;  3E66 A;  4RW6 A;  4EFH A;  2P51 A;  1C0T A;  2QRD A;  1Z05 A;  2CGJ A;  3VGM A;  4FK0 A;  4PUO A;  1TKD A;  5AQY A;  3OVN A;  1HPZ A;  1C9B B;  3ZSV A;  2QR1 A;  2Z1I A;  3VQ7 A;  3I8B A;  1WBD A;  3KJV A;  2RN2 A;  3CJ7 A;  4CE9 A;  3EZ5 A;  1KLM A;  3V81 A;  3R9P A;  3V9U A;  3J7Y P;  4IFV A;  3DRS A;  2ZF5 O;  2P9L B;  1NWK A;  3O4N A;  4RW7 A;  1VSK A;  2NLV A;  3DLH A;  1UOC A;  2UUA K;  2O8D B;  2ZGZ A;  4DR1 K;  3CJ1 A;  3ZSX A;  4B0A A;  4NLC A;  1T03 A;  3HPO A;  4QS7 A;  4N47 A;  2UXB K;  3OYM A;  2NRH A;  1NK0 A;  4DF4 A;  1Z25 A;  1TUU A;  2E88 A;  1W7A A;  1OH7 A;  1BDG A;  4EAI A;  2PBD A;  3FZM A;  1QVF M;  1PCM X;  3A8Y A;  1VQN N;  2A41 A;  3G25 A;  5BRE A;  1NKB A;  2XY8 A;  1J54 A;  3SQ1 A;  4BJU A;  4FWP A;  3CD6 N;  2F4V K;  4EAK A;  2VG6 A;  4JHD B;  1C4G A;  3ZT4 A;  4CEO A;  3I55 N;  2G8H A;  3NGI A;  1BI4 A;  4CD1 A;  5MLC Q;  4OLA A;  4QS8 A;  2YHB A;  3NH0 A;  4MDA A;  4JKB A;  3HM9 A;  4LF9 K;  1T6D A;  2OCE A;  4JKC A;  4EAL A;  4FWS A;  4DS4 A;  3L0Q A;  4DLG A;  2EWS A;  5EX5 A;  3SK3 A;  1BIU A;  3CJC A;  2P9U B;  4H4O A;  3L2W A;  3T3F A;  3ULE B;  4OKE A;  1S6P A;  4CJP A;  2IVP A;  4BWJ A;  4UY8 O;  4E0D A;  5JLH A;  4FJH A;  1UAX A;  1HRH A;  1X1P A;  2HVI A;  4CZH A;  1GLD G;  4L3Q A;  4DR4 K;  1T44 A;  1ESV A;  3DOK A;  4BRN A;  4C1N K;  3JAM O;  1RM1 A;  4ROC B;  4FJ7 A;  4CW7 B;  3AA5 X;  3U8X A;  4C23 A;  5HL7 L;  1S5J A;  4CGH A;  2Q31 A;  3DJC A;  4FWR A;  4FJI A;  1GLE G;  1U47 A;  2VYP A;  1NLV A;  2I5J A;  2NNW A;  1NMD A;  3CCE N;  1MPG A;  1H1V A;  3F0Z A;  2F7T A;  4G1Q A;  4YOU A;  4MFB A;  3ISN C;  2E6L A;  2Z8U A;  3CQX A;  4DV4 K;  3HPH A;  3WNE A;  5I42 A;  1EX4 A;  2VWJ A;  1A5W A;  2P9U A;  4KRE A;  3MWT A;  5BMP A;  3HO1 A;  1CXQ A;  1RT2 A;  4KHS A;  1WSE A;  3SQ2 A;  3H46 O;  4NXM K;  1JLB A;  1C0F A;  4BR0 A;  4OKJ A;  4LF7 K;  4KAZ A;  1Q86 O;  3QFU A;  3QES A;  2E2P A;  1TAQ A;  4DR3 K;  2H5A X;  3AVH A;  4CJS A;  4J2A A;  2E6M A;  2WUS A;  3CI5 A;  5FDL A;  1LCU A;  3WEE B;  4R79 A;  3OYI A;  3SUQ A;  3KKR A;  4JHD A;  2O4I A;  2V7Y A;  4BDY A;  1M90 O;  1V4T A;  2D0O A;  4BWM A;  2ETJ A;  3V1R A;  3MXJ A;  3CVS A;  3GDQ A;  3IAY A;  2IGI A;  4FSV A;  5KQ8 A;  3ZET B;  4CJT A;  5LY3 A;  1C1B A;  1QQM A;  4M3Y A;  4B8A B;  1YTB A;  4YOV A;  3NHG A;  4E7J A;  3AGK A;  1TVR A;  5LMN K;  5AQJ A;  1J3M A;  3HK2 A;  4AM6 A;  3IDH A;  5HRP A;  3QB0 A;  3KTQ A;  3ZX0 A;  3EYZ A;  2QWL A;  2G8I A;  1BIZ A;  3VQC A;  4YY3 K;  3DOL A;  4JD2 A;  4FLZ A;  3FE1 A;  1XSZ A;  4GVM A;  1VQ9 N;  1E42 A;  3V9W A;  3CQY A;  5AZJ B;  4DV5 K;  2VJ0 A;  4BRM A;  3O80 A;  1QN9 A;  4H5T A;  4WQ4 A;  1Y97 A;  4KRF A;  4B08 A;  2JGU A;  4YOW A;  1RT4 A;  3DPU A;  4EP5 A;  4CHZ A;  3SBT A;  4E3S A;  3LPT A;  1BHL A;  1AIS A;  4Y1D A;  2W41 A;  4HUF A;  4FPB A;  4CEB A;  4NYN A;  4YHH K;  3QEP A;  2V9J A;  3MK6 A;  3VQ4 A;  3LPU A;  4FVU A;  1RTH A;  2HBJ A;  4ID1 A;  4M3Z A;  4DR7 K;  1BG3 A;  1RDU A;  1QHA A;  1J6Z A;  3KKS A;  3CJB A;  1TKZ A;  3H1Z A;  2YHA A;  4QOZ B;  4ROE B;  4KV8 A;  2IS3 A;  2QWR A;  2NLX A;  3SAH A;  5JMV D;  4R5P A;  3WEE A;  1C47 A;  1ZYQ A;  1NGF A;  2PWW A;  4KB0 A;  3AVA A;  4JKF A;  2XHI A;  3OBY A;  5AZI A;  1GLA G;  4AH9 A;  4BC4 A;  1RGI A;  4CHN A;  1I94 K;  4BRK A;  1TBA B;  2YV0 X;  5KGW A;  5IYC P;  1T7P A;  2OTJ N;  3BZK A;  4B3S K;  4CHO A;  3I0W A;  5FRO A;  4WX8 A;  1V4S A;  4PY5 A;  3NCI A;  1X9J A;  1S3X A;  4CZF A;  2YKM A;  4CBU A;  1RT3 A;  2AP1 A;  1DTQ A;  3S9H A;  4E1N A;  1TGO A;  5AQG A;  4CJK A;  1K9M O;  4JKA A;  1YF5 L;  4CJ5 A;  3CWA A;  1LXT A;  1K8A O;  2QXL A;  3BGR A;  3SUO A;  2F8S A;  3NF7 A;  3L2U A;  3KLF A;  2H3G X;  1CZ9 A;  1IBL K;  5EPC A;  3Q7B A;  3P83 D;  4A2A A;  3CJA A;  3BUZ B;  3DXM B;  1ATS A;  1U2V B;  4F3O A;  1U48 A;  2LSN A;  1K8K B;  1N6Q A;  4JI8 K;  2OOY A;  4I9Q A;  2UU9 K;  2KZZ A;  4WF9 L;  1SQK A;  2OPS A;  2O8F B;  4DV2 K;  4LH4 A;  1SUQ A;  4DG1 A;  1CDW A;  4KTW A;  4DSI A;  4BQL A;  2I7N A;  2HHT A;  3K59 A;  3I8D A;  1P5D X;  4JAX A;  3RMC A;  4DQI A;  3QNN A;  5CR4 A;  3J7Z O;  1MWM A;  1X3N A;  1BU6 O;  5KRT A;  1VSH A;  5J1E A;  4OX9 K;  4BRG A;  3LDO A;  3ZEU B;  4CZJ A;  3A0I X;  1XMO K;  2GWK A;  5EOY A;  3DYA A;  1RDW X;  3J8A A;  5BRH A;  1IV0 A;  4OPA A;  1DKG D;  1YI2 N;  5EXW A;  5AQR A;  1QSY A;  3SV3 A;  1KTQ A;  4B3T K;  4MQ3 A;  3OYH A;  1W80 A;  1RDD A;  4KTZ A;  2VGN A;  3J7A P;  2Q36 A;  4ILJ A;  2E1Y A;  4BE1 A;  4DS5 A;  3ZT3 A;  4EJZ A;  4CIF A;  4BG9 A;  3OHR A;  1SAZ A;  1X3M A;  1C0G A;  3L2Q A;  4N41 A;  1K35 A;  3SQ4 A;  1UA0 A;  1T6C A;  5KPT A;  4AF1 A;  3TWH A;  4GV3 A;  3BKQ X;  3ZSZ A;  2HF4 A;  3QO9 A;  3SCX A;  3OYK A;  4HVJ A;  4FWK A;  2ZJQ L;  1JFI C;  3CW7 A;  3EKS A;  3H3N O;  4JKH A;  2DFH A;  3ZEU A;  1D9F A;  2PYJ A;  4AM7 A;  2JWL A;  3ZT0 A;  5AN4 A;  4RWT A;  1K73 O;  4FJ8 A;  4OPH A;  3CCV N;  1BQN A;  1YJ9 N;  3KK3 A;  4YOR A;  3TAN A;  1TUO A;  1JLC A;  2YJE A;  1WQA A;  4O8U A;  3Q7C A;  4DQS A;  4CJR A;  4JI7 K;  5FRN A;  4M45 A;  3SMS A;  3ZCM A;  1C1C A;  1K8K A;  1HKG A;  3VTH A;  2OTL N;  5LMU K;  4B9V A;  4K42 A;  4UQG A;  1R59 O;  1RBV A;  5AQK A;  3P1G A;  2HHU A;  1HJO A;  1VTO A;  3S41 A;  3KVG A;  3D2F A;  5JS2 A;  1VKL A;  3B8A X;  2ZJP L;  4Z0U A;  4HUG A;  1KC8 O;  3UIQ A;  3H1Q A;  3VEZ A;  1RBS A;  3VEY A;  3T19 A;  5HLF A;  4Q5V A;  5AQM A;  2VQE K;  1VQ4 N;  3OJS A;  1J5O A;  3OY9 A;  1LOT B;  4JKG B;  5CZ2 A;  5JMV A;  4J2E A;  1OH5 A;  3OYF A;  1RBR A;  2P9K A;  2OA8 A;  4JI4 K;  1RNH A;  4IO9 L;  4CK3 A;  2Z1G A;  1SKS A;  4FZX C;  4FCY A;  1P90 A;  1VTL E;  4F3T A;  4DFJ A;  3CM5 A;  3QEW A;  4LF6 K;  3O9Q A;  3VOV A;  3GG4 A;  1U4B A;  1YVN A;  4DSL A;  2P9N A;  3IKM A;  3FZF A;  2ASP A;  3HOT A;  1DIZ A;  5C10 A;  4CEZ A;  4AHR A;  4I6M B;  3TR8 A;  3RVC A;  5HRN A;  1SV5 A;  3HP6 A;  3LZJ A;  3MWP A;  1TKX A;  3OTO K;  4B3O A;  2O3O A;  4QS9 A;  1KD1 O;  4B9Q A;  2VQF K;  3K5O A;  4BR4 A;  1EQY A;  1MU2 A;  3KK2 A;  2OAN A;  1HUX A;  2YNH A;  4FZY A;  4H8K A;  3SQ0 A;  4CEQ A;  4EAJ A;  1YVU A;  3M8P A;  2DFF A;  3SYZ A;  2OZS A;  4V19 S;  2A6A A;  1VSM A;  3THW A;  1TK8 A;  2PZS A;  1VQK N;  1YQR A;  2FF6 A;  3F9K A;  1SL0 A;  4YFU A;  3F10 A;  5IYB P;  5C25 A;  1NGJ A;  1P8Z A;  1K6Y A;  1XNR K;  2DPN A;  2E4L A;  1IBK K;  3CC4 N;  3PIO L;  3M1F A;  5M1P A;  4CEE A;  1KY6 A;  3O3F A;  3GL1 A;  4Z94 A;  2P9I B;  1NM1 A;  4GMJ B;  2V7Z A;  1BUP A;  1ZBF A;  4HWI A;  1JLG A;  3LAK A;  3VF4 A;  4EHT A;  4JS5 A;  2HHH K;  4BC3 A;  1Z6R A;  4MLE A;  4X64 K;  5AZJ A;  1JXB A;  4B9L A;  2IOC A;  4Z4C A;  1EET A;  3IRX A;  1JL2 A;  3SAF A;  1YJW N;  4DSE A;  3PMG A;  3LDL A;  4XH5 A;  3SMP A;  1RT6 A;  4DUY K;  2BAN A;  2GWJ A;  1RBT A;  3LAL A;  3U9D A;  4W5N A;  1KFI A;  4DSK A;  3LM9 A;  1RIL A;  4BR2 A;  3HS9 A;  4CBW A;  3DLG A;  3CC7 N;  1W0H A;  4M3X A;  4IEI A;  3U9Z A;  5B8H A;  3CCR N;  3RSE B;  5I3U A;  4BG8 A;  4FWM A;  3VMF B;  4ILG B;  3E9L A;  4EAH D;  5LJV A;  4BRO A;  2YNG A;  1NK6 A;  3KRM A;  4BR7 A;  2P9I A;  4YOY A;  1GLC G;  3DM2 A;  5IYD P;  2F7L A;  3VEX A;  4LC9 B;  3WQU A;  3TSQ A;  3PUF A;  1NJY A;  3NVM A;  2QRE A;  3CER A;  1YQK A;  2WC9 A;  1Q7Y O;  3V1O A;  3MCA B;  4CZL A;  3ZSY A;  5T7B A;  3C6H A;  3U4L A;  2B4J A;  4I2P A;  4BDZ A;  4IDK A;  5JN5 A;  3J81 O;  2Q1N A;  2W6L A;  3U3Y A;  1SL1 A;  1LWW A;  1VQM N;  3P4I A;  3VQA A;  1Y64 A;  3TSP A;  5JS1 A;  1Q81 O;  1B92 A;  4O5B A;  5IT9 O;  5KI6 A;  1HMV A;  1J5E K;  1C0M A;  1RDA A;  2J4R A;  2QWN A;  3AV9 A;  1QNE A;  1LW0 A;  3LP2 A;  2H4L X;  3PO5 A;  2FSN A;  4AHT A;  1VQ7 N;  3JYT A;  4FLU A;  4GKK K;  5ADX H;  3EN9 A;  4FWQ A;  3UKR B;  4FJG A;  3UW2 A;  3ZYY X;  3ITH A;  1EKE A;  2HVH A;  3D2E A;  2D0C A;  4ELU A;  1WUA A;  4JI1 K;  2YJF A;  1BOT O;  1I39 A;  3DAW A;  4Z4F A;  2Q2R A;  4WFB L;  3PV8 A;  3ULE A;  3SAG A;  1VHX A;  4WQ5 A;  2NOH A;  3MEG A;  3VEV A;  2Y1J A;  3L4I A;  5BRF A;  3OSM A;  5BPN A;  5HBM A;  2HB5 A;  1CZB A;  4PKH A;  3C0B A;  1N39 A;  1BCO A;  2GEL A;  4DCH A;  4BRA A;  5AQX A;  4EIA A;  3VGL A;  1KXP A;  4K0K K;  3ZX3 A;  3OSE A;  3VGK A;  3JXU A;  1QTS A;  1V5S A;  1XI1 A;  2X6N A;  5CZ1 A;  2I7P A;  1NGB A;  3VPZ A;  3FZL A;  5FPD A;  5CYM A;  1PVS A;  1S1T A;  1LWV A;  4O55 A;  3HS8 A;  2JPI A;  1IKW A;  4DHY A;  4E1M A;  4DU4 A;  3AY9 A;  3D6R A;  2E5L K;  5C12 A;  3RWU A;  1N3A A;  2FKM X;  3MDQ A;  3H3O B;  3THV A;  3VA3 A;  3L4Q A;  4ELT A;  4CJ4 A;  4BGA A;  3UKU B;  2O8E B;  1RFQ A;  4OPJ A;  4CEA A;  1YIJ N;  3F9M A;  3P39 A;  4CEC A;  4JRP A;  4KKO A;  4PKI A;  1VSJ A;  2QKK A;  1MWK A;  2D1K A;  4H0Y B;  1KAX A;  4Z4I A;  2D5R A;  1UT4 A;  3AVI A;  3R1X A;  2Z1J A;  3TAR A;  2NVM A;  1QSS A;  2V52 B;  1NKC A;  3C7N B;  2IV8 A;  4RW9 A;  3H45 C;  3HYF A;  1FJG K;  1RTD A;  3MEC A;  3D2E B;  3O5B A;  5IWA K;  3CCJ N;  1GOA A;  4FO0 A;  4DFK A;  4CIE A;  2BGG A;  3O4W A;  2QWM A;  2G30 A;  1EP4 A;  4NO7 A;  3VQ5 A;  4HTL A;  3TAQ A;  4JYA K;  2EHG A;  1IO2 A;  4DQ8 A;  4JKE A;  1U04 A;  4DR6 K;  3MN7 A;  2A40 A;  3RMD A;  3RPJ A;  1YJN N;  3A5M C;  4IG3 A;  3OYB A;  2VG5 A;  3QNO A;  3OH9 A;  2DKD A;  3VQE A;  3HXM A;  3QEV A;  3CC2 N;  2HL8 A;  1KFQ A;  5CE3 A;  3LAN A;  1GLL O;  1M1K O;  3GE1 A;  1NGD A;  1G99 A;  4A59 A;  5F0X A;  1E3M A;  3QEX A;  3AGR A;  3PSI A;  1ATN A;  3AAQ A;  3SJJ A;  3D4V A;  1WLJ A;  4X65 K;  1WAF A;  2P9N B;  3V9Z A;  2HZS A;  1LWY A;  1WJW A;  3F5T A;  5ADX A;  2X6S A;  5AZI B;  2D4W A;  4AHS A;  3IUC A;  3AA3 A;  3PX4 A;  1YHQ N;  4CGF A;  3PIP L;  3RMA A;  4AHC A;  4JKD A;  4BGB A;  1FXX A;  3P5J A;  3ALY A;  4H0V B;  2HNY A;  3U6F A;  4K8X A;  3N4P A;  3HZ6 A;  1YTA A;  1KVB A;  1NGA A;  4HCC A;  3O3H A;  1M3Q A;  3TDH A;  4JK9 A;  4F2R A;  1QTM A;  5F1X A;  1WB9 A;  4MLH A;  1HYS A;  4PL8 A;  1QZ6 A;  2WBN A;  4F9O A;  4CGJ A;  3EE8 A;  1TL3 A;  1WNS A;  2WON A;  3VA0 A;  5HRO A;  5C0Y A;  3K9K A;  4EZ9 A;  1TYQ A;  2ZQB A;  3QER A;  4W5R A;  4O44 A;  1IKY A;  2PFU A;  3ENH A;  2D0A A;  3BF3 A;  2IAJ A;  1D9D A;  4B9M A;  1NJW A;  3D45 A;  5D3G A;  2QWP A;  3AVC A;  2Z1H A;  2E1Z A;  2I5W A;  1DGK N;  1GOB A;  4DV7 K;  4FM0 A;  4NB4 A;  2EX3 A;  1QZ5 A;  2P9P B;  1HNZ K;  4HUE A;  4H5N A;  4A5A A;  2IC3 A;  4A61 A;  5AQQ A;  3K57 A;  1XQS C;  1R4X A;  4KH4 A;  2NRW A;  1O1W A;  3QLH A;  4IFY A;  4FW1 A;  1XHX A;  3ULD A;  4M7Y A;  1W9H A;  2WTU A;  4OO1 J;  2ZE2 A;  4ICL A;  4JLH A;  2OPP A;  4PQU A;  1O13 A;  3KZB A;  5KPZ A;  4DQR A;  1EWQ A;  4B8C A;  2ITG A;  2GTD A;  1E4F T;  3BP8 A;  1VSE A;  5KL0 A;  3MXI A;  4FJN A;  3SPZ A;  1HU0 A;  1XC3 A;  1VQ6 N;  3V9X A;  2NUB A;  5AQW A;  4W5T A;  1EXQ A;  1PCZ A;  3TTF A;  4FOI A;  3TSU A;  1TUY A;  5BN9 A;  2QI2 A;  4ISF A;  1BA0 A;  3R3L A;  4JKG A;  2ITM A;  1T05 A;  4ILH A;  4JEP A;  3OLP A;  3CCU N;  2P9K B;  5BPM A;  2VG7 A;  1QQN A;  2FKF A;  2RE2 A;  1MA9 B;  4L8R B;  4B1V A;  3OC3 C;  1KVA A;  2QWQ A;  1HNX K;  1X9M A;  1QSL A;  3I0X A;  2O8D A;  5DK5 A;  5J2Q A;  3AVJ A;  1J53 A;  4KHY A;  2UYT A;  2AJQ A;  5BR8 K;  5BRD A;  1ZBH A;  2OOX A;  5KQD A;  3OW2 M;  1D3U A;  3SBG A;  2NWV A;  3CWS A;  3HL8 A;  4ZHR A;  4DR5 K;  1VAZ A;  4H4M A;  4LD0 A;  1JLQ A;  4DU3 A;  4CJ7 A;  4IJA A;  3VQ8 A;  1QNC A;  1NGC A;  4CJQ A;  1Q9Y A;  1NK5 A;  3SNS A;  1XUP O;  4IO8 A;  3G71 N;  1DT9 A;  1HNV A;  4CF0 A;  4BC2 A;  1QHT A;  3MCP A;  3VQB A;  1NKE A;  4IFE A;  4U67 L;  4CI6 A;  2XY7 A;  4M7X A;  1NGH A;  2VWK A;  4CFF A;  2QK9 A;  2XHB A;  5LL6 Z;  1GLB G;  5JVH L;  3DXK B;  1WSG A;  3VES A;  2P9S B;  2R5X A;  1MDU B;  1YQM A;  1EWR A;  4IWV A;  3OGD A;  3EAY A;  2ATQ A;  3W3D A;  4KI4 A;  4AHU A;  1MP9 A;  3RR8 A;  3AA4 A;  1UT7 A;  2JLE A;  3HBT A;  3OCI A;  5AQI A;  3THX A;  2KFN A;  4GVE A;  5AJ3 K;  2PAV A;  3QDK A;  4DTP A;  4GKJ K;  2B5J A;  4KFB A;  1RTJ A;  3UE5 A;  3C04 A;  1VOL B;  3ENC A;  1C1A A;  3KWG A;  4IJN A;  2QKB A;  1ASU A;  3LP3 A;  4ZTJ A;  1IBM K;  1T8E A;  4KBO A;  3OYC A;  1FW6 A;  2VGM A;  1ATR A;  4IL8 A;  4EZ6 A;  5EU7 A;  3AVN A;  4KHQ A;  2D0B A;  3O1B A;  3FZK A;  2OYQ A;  4BRP A;  4B9T A;  2FBT A;  5F9C A;  3EY1 A;  1ZBU A;  2QWO A;  2E2N A;  4CJL A;  1VSL A;  2NRZ A;  5E41 A;  3T4N A;  5JIC A;  2NOI A;  4NCA A;  1WN7 A;  2DY4 A;  1BL3 A;  5CYQ A;  3DI6 A;  1OKJ A;  5M1Q A;  3KWI A;  2DKA A;  1D5A A;  4H5R A;  3ZSO A;  3AVL A;  1W97 L;  3DLE A;  5A2Q O;  3DMJ A;  1L3S A;  1TBP A;  3H1V X;  3A2F A;  3MXM A;  1JDY A;  3CF5 L;  2FXU A;  3NFA A;  5KPR A;  3CIP A;  3QFP A;  3C6T A;  4Z4E A;  3TTD A;  4DTO A;  1LWE A;  4BRD A;  1NVP A;  4NYF A;  1Q82 O;  2UUB K;  4CFC A;  5JVG L;  4BQZ A;  5SZT A;  4C8O A;  4PKG A;  1SKW A;  4IEE A;  1ZC6 A;  5KGX A;  4CCH A;  4FJM A;  5J2N A;  3KLE A;  4CGD A;  4E7I A;  4KHU A;  1NGG A;  2O8B A;  1VSF A;  2QM1 A;  4DMN A;  1S22 A;  2QRC A;  2P5G A;  2HBK A;  4FJL A;  4KH5 A;  3T1Y K;  4EAG A;  3QIP A;  3WQT A;  4OLB A;  4CK1 A;  5FPM A;  4N76 A;  1L5U A;  3HP9 A;  1IG8 A;  1IG9 A;  4KH6 A;  5C2F A;  3VQD A;  3OYG A;  1NBW A;  4DTN A;  4NCB A;  4RW4 A;  4Z4G A;  2A1R A;  3B6O A;  4DKW A;  4W5O A;  2KKZ A;  2HHQ A;  2G8V A;  4JI0 K;  3IFR A;  1KO9 A;  4FLX A;  1QNB A;  3QML A;  4OJR A;  1LW2 A;  2YHW A;  3GBT A;  3MX5 A;  4CGG A;  4N5S A;  1KLN A;  4O4G A;  3DRP A;  1HKC A;  1NMN A;  4D7R A;  1NOZ A;  4KHN A;  3SLC A;  1X9W A;  2IIR A;  4MO5 A;  3E01 A;  3RSE A;  5DM6 L;  3PSF A;  2X78 A;  3MN9 A;  4BC5 A;  1NGE A;  5FPE A;  4BRH A;  3CWU A;  3D0P A;  1YIT N;  5H1S Q;  3ASM A;  1NJZ A;  5KTQ A;  4K41 A;  2ZGY A;  3VF6 A;  2VCP A;  2ZWH A;  4HCB A;  1NJI O;  1NGI A;  1CZA N;  4K43 A;  2PYL A;  3CXC M;  1OH8 A;  4BR9 A;  3QBX A;  4FLY A;  3TAM A;  3PY8 A;  1EO1 A;  1FKO A;  4ZTF A;  1Q9U A;  2CGK A;  3ENB A;  5EY4 A;  3AVG A;  4N56 A;  1VOK A;  3K5L A;  4OGE A;  4WFN L;  4WYB A;  3AO4 A;  4DUL A;  2DFE A;  1S9G A;  2KTQ A;  2F96 A;  4CJE A;  1KYD A;  1OVY A;  1UWB A;  3NF8 A;  2A42 A;  3EL2 A;  5DMR A;  4CJU A;  4CF8 A;  4YOX A;  4O0I A;  3THY B;  5C15 A;  1SL2 A;  3CPW M;  4JI3 K;  3WXI A;  1LWF A;  3UB5 A;  4H5W A;  2GEM A;  3HSC A;  3LDQ A;  3NAE A;  5CHI A;  1QQO A;  3CPE A;  1KAZ A;  3NH1 A;  1ZXO A;  3TAF A;  4BRC A;  2A3Z A;  5M1F A;  2XY6 A;  1F21 A;  3JS6 A;  4CED A;  3K5M A;  1B9F A;  2BUP A;  3I0R A;  5GIO A;  3CYM A;  3UKR A;  3NBP A;  3HST B;  1WOQ A;  4CD3 A;  3LWM A;  5C42 A;  4M63 C;  3CFR A;  2P1J A;  3KLI A;  1IH7 A;  5ELZ A;  3NA5 A;  4CBX A;  4D7Q A; 
#chains in the Genus database with same CATH homology
 4ROE B;  4KV8 A;  1QSS A;  1VK0 A;  2IS3 A;  3VQQ A;  1NKC A;  4NCG A;  1N3C A;  1BIS A;  1JKH A;  2IV8 A;  3L2R A;  4RW9 A;  3V4I A;  1ZBL A;  4LSN A;  4R5P A;  1TL1 A;  1HNI A;  1KCF A;  2A1S A;  3HYF A;  5HRR A;  4F2S A;  1ZYQ A;  1X9S A;  1JXE A;  3MEC A;  3OYA A;  1RTD A;  4KB0 A;  1JLF A;  1IKV A;  4KHW A;  4LSL A;  4TSX A;  1NK7 A;  1GOA A;  3AVA A;  4DFK A;  1VRT A;  1WSJ A;  1SKR A;  3KD1 E;  2XHI A;  4CIE A;  3PX0 A;  3V6D A;  2BGG A;  1ZBI A;  1TKT A;  2G30 A;  4YNQ A;  4EJY A;  1EP4 A;  3VQ5 A;  4AH9 A;  3TAQ A;  1QN4 A;  4CHN A;  1TBA B;  2NOF A;  2YV0 X;  5IYC P;  2EHG A;  2X74 A;  4OGC A;  5KGW A;  3WNH A;  3S3M A;  4CHO A;  3L3U A;  4FJK A;  3I0W A;  1NJX A;  2ZD1 A;  1IO2 A;  5FRO A;  1RT1 A;  4PY5 A;  1L3V A;  4QOZ B;  3NCI A;  2FBV A;  3TAB A;  2RKI A;  1U04 A;  4M3R A;  3RMD A;  3RPJ A;  2YKM A;  3SI6 A;  1WSF A;  1RT3 A;  4O0J A;  1NOY A;  1DTQ A;  3S9H A;  3ZSW A;  4M3W A;  4E1N A;  2KZM A;  1TGO A;  1PZD A;  4CJK A;  3SV4 A;  4IG3 A;  3OYB A;  4J2B A;  2VG5 A;  3QNO A;  4CJ5 A;  3HPG A;  2NOB A;  1I3A A;  5SWM A;  2QXF A;  3VQE A;  3BGR A;  3HXM A;  3QEV A;  3SUO A;  2F8S A;  3NF7 A;  3L2U A;  3KLF A;  1S1W A;  1CZ9 A;  1KFS A;  3LAN A;  1RTI A;  1TV6 A;  2BDP A;  1C0U A;  3P83 D;  4Z4H A;  3KLH A;  1HQU A;  3DLB A;  2JOI A;  3L3V A;  4F3O A;  3QEX A;  1J9A A;  1U48 A;  1G15 A;  2LSN A;  4KPY A;  3OST A;  3SJJ A;  4FJJ A;  1N6Q A;  3K5N A;  2YKN A;  1WLJ A;  1LV5 A;  4I9Q A;  2KZZ A;  1JLA A;  2OPS A;  2NOZ A;  2Q3S A;  4CEF A;  3LAM A;  4LH4 A;  1HQE A;  1SUQ A;  1CDW A;  4KTW A;  1HYV A;  1WAF A;  4DG1 A;  2Y1I A;  3LZI A;  1REV A;  4DSI A;  1GOC A;  3V9Z A;  2HZS A;  1LWY A;  2HHV A;  2F8T A;  2HHT A;  4RW8 A;  3K59 A;  3I8D A;  1NK8 A;  3RMC A;  4DQI A;  4DWI A;  3KK1 A;  3QNN A;  4RG8 A;  3VQP A;  1VSD A;  4I9L A;  2OZM A;  3KD5 E;  3FFI A;  3G0Z A;  2X6S A;  4FJ5 A;  1RCH A;  1HYZ A;  4AHS A;  3M8S A;  1Q8I A;  3K58 A;  2IDO A;  3AA3 A;  3TAE A;  3PX4 A;  4CGF A;  3RMA A;  5KRT A;  1VSH A;  1QN6 A;  4AHC A;  4FJX A;  4M3U A;  5J1E A;  3NDK A;  4CJV A;  1R0A A;  1FXX A;  3P5J A;  4HHT A;  3ALY A;  3QIN A;  4BAC A;  2HNY A;  2NOE A;  1RBU A;  3CFO A;  3OYL A;  3U6F A;  4CES A;  4K8X A;  1QN3 A;  3DYA A;  1YTA A;  1KVB A;  3H08 A;  4HCC A;  1QTP A;  4LH5 A;  4E19 A;  3M8Q A;  2G8K A;  3EIK A;  1S1X A;  1VSI A;  3O3H A;  3IS9 A;  2KFZ A;  2RPI A;  1M3Q A;  3OS1 A;  1QSY A;  3SV3 A;  1KTQ A;  1IKX A;  4F2R A;  4MQ3 A;  3OYH A;  4FM2 A;  1QTM A;  1W80 A;  1RDD A;  4KTZ A;  3HVR A;  4FLW A;  4FVM A;  4OVL A;  3LDS A;  3WNF A;  4WE1 A;  1HYS A;  4DS5 A;  4BE1 A;  3ZT3 A;  4EJZ A;  3OYN A;  3AA2 A;  4CIF A;  4EP4 A;  4F8R A;  4CGJ A;  3ULX A;  3AVF A;  1TL3 A;  3T1A A;  3L8B A;  3C95 A;  1U49 A;  4LY7 A;  1WNS A;  2WON A;  4GW6 A;  3BDP A;  3SZ2 A;  1QN8 A;  3VA0 A;  3L2Q A;  5HRO A;  1S1U A;  1L3T A;  4N41 A;  2HW3 A;  3SQ4 A;  1UA0 A;  2HND A;  4FW2 A;  4HTU A;  4EZ9 A;  2ZQB A;  3QER A;  4W5R A;  4O44 A;  1IKY A;  2KQ2 A;  3M8R A;  3TWH A;  3HJF A;  3DRR A;  3NGZ A;  3ZSZ A;  3QO9 A;  4KTQ A;  3SCX A;  2D0A A;  1B9D A;  2IAJ A;  3V1Q A;  3OYK A;  1D9D A;  5C24 A;  4B9M A;  4AIL C;  4HVJ A;  1QE1 A;  5K14 A;  3I0S A;  1NJW A;  4DFM A;  2FC0 A;  3KLG A;  3NE6 A;  4E7K A;  1JFI C;  1KVC A;  3D45 A;  4XIU A;  1HJR A;  2DFH A;  5D3G A;  2XO7 A;  1D9F A;  3AVC A;  2PYJ A;  3NH2 A;  2Z1H A;  4M42 A;  2I5W A;  3TI0 A;  4F4K A;  1GOB A;  3ZT0 A;  4FM0 A;  2EX3 A;  3MED A;  5AN4 A;  2G8U A;  1N5Y A;  3JSM A;  1D8Y A;  4ELV A;  3ZT1 A;  4HUE A;  4CFA A;  4FJ8 A;  3MEE A;  2IC3 A;  1BQN A;  3AVB A;  3K57 A;  3KK3 A;  3TAN A;  1WSI A;  1JLC A;  1R4X A;  3SUP A;  4DQS A;  4CJR A;  3DLR A;  4M41 A;  3OYE A;  1KSP A;  1TK5 A;  5FRN A;  1O1W A;  4M45 A;  1LAW A;  3QLH A;  4IFY A;  4FW1 A;  1XHX A;  1WSH A;  3ULD A;  4Q0B A;  3ZCM A;  1C1C A;  4CJW A;  4BE2 A;  1W9H A;  4B9V A;  2ZE2 A;  4ICL A;  4JLH A;  4Y1C A;  2OPP A;  4UQG A;  4PQU A;  4CK2 A;  1RBV A;  3PX6 A;  3C94 A;  2GBZ A;  2HMI A;  4WZS D;  1EBM A;  3P1G A;  2W42 A;  2HHU A;  1VTO A;  4DQR A;  4B8C A;  2WOM A;  2ITG A;  4M3T A;  3LWL A;  5JS2 A;  3MXI A;  1VSE A;  1KYF A;  4FJN A;  4Z0U A;  4HUG A;  3SPZ A;  3N89 A;  1KRP A;  3UIQ A;  1LWC A;  2DTU A;  3RRH A;  1RBS A;  1FN7 A;  1HU0 A;  3QEI A;  1NGM A;  1A5V A;  2BE2 A;  3T19 A;  3V9X A;  5HLF A;  4C8K A;  2NUB A;  4Q5V A;  1DLO A;  4QCL A;  4W5T A;  1EXQ A;  4DF8 A;  3AVM A;  1PCZ A;  3OS0 A;  3OJS A;  1J5O A;  3OY9 A;  3VN5 A;  4I7F A;  5CZ2 A;  3WNG A;  4J2E A;  5HP1 A;  3OYF A;  1RBR A;  1KY7 A;  1T05 A;  2OA8 A;  1LAV A;  1RNH A;  4IBN A;  3QIO A;  4CK3 A;  2Z1G A;  1SKS A;  2VG7 A;  2OPQ A;  5CY4 A;  4FCY A;  3RRG A;  4FZX C;  3IH7 A;  1QNA A;  3S3N A;  4B9N A;  4DLE A;  1VTL E;  1Q9X A;  4L8R B;  4DFJ A;  3CM5 A;  4CF1 A;  3QEW A;  3OC3 C;  1KVA A;  1YT3 A;  4F3T A;  1X9M A;  1QSL A;  3I0X A;  3S3O A;  1NK4 A;  1NK9 A;  1TAU A;  4TPS A;  2OZS A;  5DK5 A;  3NF6 A;  1U4B A;  4DTX A;  5J2Q A;  4DSL A;  2MJ7 A;  3AVJ A;  4DSJ A;  1J53 A;  4I8O A;  1QS4 A;  4CER A;  4KHY A;  2AJQ A;  5KRS A;  3SUN A;  4CEZ A;  3QET A;  4J2D A;  3F73 A;  4AHR A;  3B6P A;  1ZBH A;  4RW6 A;  3VQ9 A;  5HRN A;  1D3U A;  3TR8 A;  1XWL A;  1SV5 A;  3HP6 A;  3LZJ A;  3HL8 A;  2P51 A;  1C0T A;  5J2P A;  4ZHR A;  4JS4 A;  1TKX A;  4H4M A;  4B3O A;  2O3O A;  3OYJ A;  1FKP A;  4LD0 A;  1JLQ A;  4DU3 A;  4FK0 A;  4PUO A;  1TKD A;  4OPK A;  3OVN A;  3K5O A;  1HPZ A;  1C9B B;  3ZSV A;  2Z1I A;  4I2Q A;  3VQ7 A;  3VQ8 A;  1QNC A;  4DTM A;  2OPR A;  4CJQ A;  3KJV A;  1NK5 A;  1Q9Y A;  3SNS A;  1MU2 A;  1KFD A;  2RN2 A;  3DLK A;  4CE9 A;  3KK2 A;  3EZ5 A;  1KLM A;  3V81 A;  1CXU A;  2YNH A;  1HNV A;  4CF0 A;  3V9U A;  4IFV A;  3CQ8 A;  3DRS A;  3U3G A;  1QHT A;  3ZSR A;  4FZY A;  3VQB A;  1NKE A;  4H8K A;  3O4N A;  3SQ0 A;  4RW7 A;  1VSK A;  1YVU A;  3M8P A;  4CEQ A;  2DFF A;  3SYZ A;  4DTU A;  2VWK A;  2XY7 A;  1VSM A;  1S1V A;  1TK8 A;  2PZS A;  1UOC A;  1YQR A;  3F9K A;  1SL0 A;  3LP0 A;  1TGH A;  2QK9 A;  4YFU A;  3F10 A;  2B6A A;  5IYB P;  3ZSX A;  4B0A A;  5C25 A;  2XHB A;  1T03 A;  3HPO A;  4N47 A;  4KAZ A;  3TAG A;  1B9K A;  1K6Y A;  3OYM A;  1WSG A;  3O3G A;  4DF4 A;  2E4L A;  1NK0 A;  1Z25 A;  1YQM A;  1Z26 A;  2ATQ A;  4CEE A;  1KY6 A;  3O3F A;  4KI4 A;  4AHU A;  1MP9 A;  4E7L A;  3RR8 A;  3AA4 A;  1UT7 A;  2JLE A;  3OCI A;  4BE0 A;  2KFN A;  1NKB A;  4GMJ B;  1S9E A;  3CM6 A;  1ZBF A;  2XY8 A;  4DTJ A;  4DTP A;  4KB1 A;  1J54 A;  2B5J A;  1QN5 A;  1JLG A;  3LAK A;  1BQM A;  4JS5 A;  3SQ1 A;  2VG6 A;  3RR7 A;  2O4G A;  3VQ6 A;  1NH2 A;  4KFB A;  1RTJ A;  3ZT4 A;  4CEO A;  1JXB A;  4B9L A;  1VOL B;  2IOC A;  4Z4C A;  1EET A;  3IRX A;  1C1A A;  1JL2 A;  4DQQ A;  4DFP A;  2G8H A;  3NGI A;  1BI4 A;  1ASU A;  4DSE A;  2QKB A;  3LP3 A;  4OLA A;  3NH0 A;  2YHB A;  4ZTJ A;  4KI6 A;  1RT6 A;  4IG0 A;  1T8E A;  2BAN A;  4FXD A;  1YQL A;  1RBT A;  3HM9 A;  3OYC A;  1S6Q A;  3LAL A;  4FM1 A;  4FK2 A;  4W5N A;  4DSK A;  4EZ6 A;  5EU7 A;  1RIL A;  2HNZ A;  3HS9 A;  4CHP A;  4DTS A;  1BGX T;  1XHZ A;  4CGI A;  4CF2 A;  3AVN A;  4DS4 A;  4KHQ A;  3DLG A;  4DLG A;  2D0B A;  1ITG A;  2OYQ A;  1W0H A;  1BIU A;  2FBT A;  4B9T A;  3EY1 A;  4M3X A;  4PWD A;  1FK9 A;  1ZBU A;  1KYU A;  5I3U A;  4H4O A;  1WAJ A;  4CJL A;  3L2W A;  3T3F A;  4OKE A;  1S6P A;  4CJP A;  1VSL A;  4BWJ A;  4E0D A;  4CJ3 A;  4FJH A;  2RF2 A;  1UAX A;  5E41 A;  2YNG A;  4JRQ A;  1HRH A;  2NOI A;  1X1P A;  1NK6 A;  4NCA A;  1WN7 A;  2HVI A;  2PY5 A;  1TK0 A;  3KRM A;  1BL3 A;  3DI6 A;  5CYQ A;  3DLH A;  2DY4 A;  3DOK A;  4CHY A;  3ZSO A;  1T7P A;  1RM1 A;  4ROC B;  1D5A A;  3AVL A;  3DM2 A;  3AO5 A;  3DLE A;  5IYD P;  3NGY A;  5FRM A;  3DMJ A;  3AA5 X;  1L3S A;  1TBP A;  2G8W A;  3A2F A;  1S5J A;  4CGH A;  3MXM A;  3PUF A;  3NFA A;  4FJI A;  3SPY A;  1NJY A;  1YTU A;  3C6T A;  4Z4E A;  4Q11 A;  4DTO A;  1U47 A;  2HHS A;  1LWE A;  1YQK A;  1NVP A;  1YTF A;  1ASV A;  4NYF A;  2I5J A;  3V1O A;  1VRU A;  2G8F A;  4CFC A;  3F0Z A;  4G1Q A;  5SZT A;  3ZSY A;  4MFB A;  5T7B A;  4C8O A;  3ISN C;  1SKW A;  2NOL A;  4CCH A;  5KGX A;  2E6L A;  2Z8U A;  5J2N A;  4FJM A;  4FJ9 A;  2B4J A;  4I2P A;  2YH5 A;  4IDK A;  4KO0 A;  4BDZ A;  4C8N A;  3OS2 A;  3KLE A;  4CGD A;  4AHV A;  4E7I A;  3U3Y A;  1SL1 A;  1LWW A;  3HVT A;  4KHU A;  3HPH A;  3WNE A;  5I42 A;  1EX4 A;  1VSF A;  2VWJ A;  5HRS A;  4DMN A;  4Z4G A;  1A5W A;  1DTT A;  2YNF A;  2P5G A;  3VQA A;  4FJL A;  4KRE A;  3HO1 A;  5JS1 A;  3G10 A;  3QIP A;  4CHQ A;  4OLB A;  1CXQ A;  4CK1 A;  1RT2 A;  2IV9 A;  4N76 A;  1B92 A;  4O5B A;  4KHS A;  1WSE A;  5KI6 A;  1HMV A;  3HP9 A;  3SQ2 A;  1C0M A;  1JLB A;  1RDA A;  3C6U A;  1L5U A;  1IG9 A;  4B9U A;  4C8L A;  4DTR A;  1CLQ A;  3VQD A;  4DU1 A;  4FLV A;  3ZSQ A;  1ASW A;  3L2V A;  3AV9 A;  3AO3 A;  1QNE A;  4OKJ A;  3OYG A;  4DTN A;  1LW0 A;  3LP2 A;  4RW4 A;  1M3H A;  3QES A;  3RMB A;  1UA1 A;  4FLT A;  1TAQ A;  2XY5 A;  2A1R A;  3PO5 A;  3B6O A;  4AHT A;  2HHX A;  4W5O A;  3JYT A;  2HHQ A;  2P5O A;  2G8V A;  3LP1 A;  2R7Y A;  3AVH A;  4FLU A;  4CJS A;  2FGT A;  1KO9 A;  3AVK A;  4FLX A;  1QNB A;  4FJG A;  4J2A A;  2E6M A;  4OJR A;  5FDL A;  3OYI A;  1LW2 A;  3SUQ A;  4ROD B;  3ITH A;  4FJ7 A;  1EKE A;  4CFB A;  4FYD A;  3KKR A;  1L3U A;  2D0C A;  2HVH A;  2O4I A;  1KLN A;  4N5S A;  1QQC A;  4CGG A;  4ELU A;  1JLE A;  4O4G A;  3DRP A;  1I39 A;  4BDY A;  4BDP A;  4CIG A;  4Z4F A;  1NOZ A;  4BWM A;  4KHN A;  2ETJ A;  3K2P A;  1X9W A;  4CF9 A;  3E01 A;  3V1R A;  4OKK A;  3MXJ A;  2X78 A;  3PV8 A;  3KTU A;  3IAY A;  2NOH A;  1RT7 A;  3MEG A;  2LAE A;  3D0P A;  2IGI A;  1NJZ A;  3ASM A;  2Y1J A;  2YNI A;  4CJT A;  5KTQ A;  1C1B A;  3OSM A;  4M3Y A;  4B8A B;  4HCB A;  5HBM A;  1C6V A;  2HB5 A;  1YTB A;  3HT3 A;  1CZB A;  3NHG A;  4E7J A;  4IKF A;  1N39 A;  1BCO A;  1TVR A;  1RT5 A;  2HZM A;  4C8M A;  3CG7 A;  4DSF A;  2PYL A;  4FLY A;  3HK2 A;  3TAM A;  2HHW A;  1JL1 A;  3MAQ A;  4E7H A;  3PY8 A;  1FKO A;  5HRP A;  4ZTF A;  3AVG A;  4N56 A;  3KTQ A;  1QTS A;  3EYZ A;  2G8I A;  1BIZ A;  3VQC A;  4E89 A;  1XI1 A;  1VOK A;  2X6N A;  3DOL A;  3V9S A;  5CZ1 A;  3K5L A;  4FLZ A;  4OGE A;  2GUI A;  4GVM A;  3IG1 A;  3AO4 A;  1E42 A;  4DUL A;  3CFP A;  5CYM A;  3V9W A;  4FZZ A;  2DFE A;  1QN7 A;  1S1T A;  1S9G A;  2KTQ A;  2F96 A;  4CJE A;  1KYD A;  1LWV A;  1UWB A;  2VJ0 A;  1BI4 B;  3NF8 A;  3HS8 A;  1IKW A;  4O55 A;  4PA1 A;  3SNN A;  4E1M A;  4DQP A;  5DMR A;  4DU4 A;  4CJU A;  4CF8 A;  1SL2 A;  4O0I A;  1BCM A;  1QN9 A;  3NF9 A;  3RTV A;  2FBY A;  2XRI A;  1Y97 A;  4KRF A;  4B08 A;  3RWU A;  1N3A A;  2JGU A;  4QAG A;  3TAP A;  1LWF A;  1RT4 A;  3THV A;  3DPU A;  2KW4 A;  4EP5 A;  1A5X A;  4CHZ A;  3VA3 A;  4ELT A;  3O4Q A;  3AO1 A;  4ID5 A;  3NAE A;  4E3S A;  3LPT A;  2MZ8 A;  4CJ4 A;  4B9S A;  1BHL A;  1AIS A;  1RDB A;  2FBX A;  3AO2 A;  3NH1 A;  1U45 A;  4Y1D A;  4HUF A;  3TAF A;  4K8Z A;  4CEB A;  4OPJ A;  4NYN A;  4CEA A;  2XY6 A;  1F21 A;  4CED A;  2GV9 A;  3OYD A;  3QEP A;  3K5M A;  4CEC A;  1B9F A;  3VQ4 A;  3I0R A;  3CYM A;  3LPU A;  3ZT2 A;  4JRP A;  4KKO A;  1XC9 A;  1VSJ A;  3NBP A;  2QKK A;  3OJU A;  3HST B;  3KIO A;  3LWM A;  1RTH A;  5C42 A;  4FK4 A;  3CFR A;  2P1J A;  4ID1 A;  3KLI A;  3PO4 A;  4M3Z A;  4NCB A;  4Z4I A;  2D5R A;  4CJF A;  1UT4 A;  3AVI A;  5J2M A;  1IH7 A;  2Z1J A;  4CFD A;  3TAR A;  3KKS A;  1RDC A;  3DPT A;  1TKZ A;  3H1Z A;  2YHA A;  4W5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...