3ASMA

Crystal structure of q54a mutant protein of bst-rnase hiii
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
308
structure length
308
Chain Sequence
b'SNYVIQADQQLLDALRAHYEGALSDRLPAGALFAVKRPDVVITAYRSGKVLFAGKAAEQEAAKWISGASASNETADHQPSALAAHQLGSLSAIGSDEVGTGDYFGPIVVAAAYVDRPHIAKIAALGVKDSKQLNDEAIKRIAPAIMETVPHAVTVLDNPQYNRWQRSGMPQTKMKALLHNRTLVKLVDAIAPAEPEAIIIDEFLKRDSYFRYLSDEDRIIRERVHCLPKAESVHVSVAAASIIARYVFLEEMEQLSRAVGLLLPKGAGAIVDEAAARIIRARGEEMLETCAKLHFANTKKALAIAKRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease HIII
publication title Identification of the substrate binding site in the N-terminal TBP-like domain of RNase H3.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Hydrolase
total genus 100
structure length 308
sequence length 308
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2010-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01351 RNase_HII Ribonuclease HII
A PF11858 DUF3378 Domain of unknown function (DUF3378)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.310.10 Alpha Beta 2-Layer Sandwich TATA-Binding Protein TATA-Binding Protein 3asmA01
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3asmA02
3NGYA 1LWFA 4CF9A 1RT5A 2KW4A 3AO5A 3NH1A 3HP6A 1L3VA 2G8IA 4FLWA 1KSPA 1J54A 3KKSA 4QOZB 5C42A 4E7KA 1IKWA 4AH9A 4KV8A 3TR8A 2XO7A 4NYNA 4F8RA 1C9BB 2KZZA 2NUBA 4LH4A 4OKEA 1Q8IA 4B9NA 2B4JA 3KLHA 3ZSRA 4RW8A 4E89A 4CK3A 4DFJA 1DTQA 2G8WA 1MP9A 4W5RA 4CGGA 4BE2A 2HB5A 5I42A 2XHBA 2OZSA 4DTRA 4M3YA 3SQ4A 5SZTA 4DTJA 3OYLA 3OYHA 4BACA 2ZD1A 2BE2A 1TL1A 1RTIA 3KIOA 3CG7A 5SWMA 3AA2A 3PUFA 3QIOA 3K2PA 4H4OA 1YTAA 1L3SA 1EKEA 5KGWA 4M3ZA 1RTJA 5FDLA 2P1JA 3OYGA 2HHWA 4CIGA 1A5XA 3NH2A 4CEZA 3PO4A 4KKOA 1C0UA 1EX4A 2G8UA 4K8XA 3SQ0A 2Z1HA 4CJ3A 1CZ9A 1NVPA 3RR7A 4FLZA 4FLTA 4DTNA 1RBTA 3RRGA 5FRNA 3QEXA 4OPKA 1IG9A 1T7PA 4M3RA 1BI4A 4FJ5A 1LAWA 1NH2A 1QNAA 5J2MA 4L8RB 1BGXT 4M3XA 3VQCA 1O1WA 3WNGA 3IRXA 4DFKA 1QSLA 4C8NA 2KFZA 3AA5X 3V1QA 3V9XA 4FK4A 2JLEA 4CEFA 4CK1A 3M8SA 2Z1JA 4FW1A 1E42A 2R7YA 3HPHA 1X9WA 2P5GA 4KAZA 2HHUA 2G30A 2IS3A 4NCGA 3HT3A 2FBXA 2Z1IA 1C1BA 3LAKA 1U4BA 1A5VA 4FLXA 3VQDA 5DK5A 4CEOA 2IC3A 2ETJA 4DTXA 3QO9A 1JLFA 1HQUA 4W5TA 4CEAA 4RG8A 4KREA 4OGCA 3M8RA 3H1ZA 1WSEA 1RT1A 4B9VA 3LPTA 5IYBP 3P1GA 1N5YA 4K8ZA 3E01A 1VTLE 3EY1A 1D3UA 3OYAA 1CXUA 1W9HA 1SL0A 3FFIA 1QN3A 1BI4B 1DTTA 1KTQA 3SPYA 4KPYA 3ZSOA 3QEWA 2HHTA 4JS5A 5KRTA 4C8KA 1QN7A 4KFBA 2RN2A 1RNHA 3WNFA 4OPJA 3I8DA 3K58A 1U48A 4DF4A 1QN6A 3ULDA 1BISA 4XIUA 5JS1A 5FROA 1S5JA 3MXIA 3DRRA 5HBMA 3CFPA 3O3FA 1AISA 2ITGA 4AHUA 2B6AA 3OYNA 4CIEA 3LWLA 4BDYA 4ZTFA 4FJJA 2OPSA 3AVMA 4CK2A 4I9LA 1W0HA 3AVFA 5IYDP 4KTWA 3NAEA 4CJVA 3DI6A 1VSHA 4CHYA 4FJLA 2GBZA 2E6LA 2WONA 4WE1A 2A1SA 3ITHA 4N41A 3LP1A 1C0MA 1TV6A 1C1CA 3SNNA 2G8FA 2RPIA 2FBTA 4CJWA 3K5NA 1QTMA 3CM6A 1L3TA 4N76A 2IAJA 2ATQA 3OVNA 3G10A 1X9SA 4JLHA 3VQQA 2FBVA 2VJ0A 1CZBA 4IDKA 4BWJA 3C6UA 2Z8UA 1U49A 4JRPA 2G8KA 2HHQA 1QSYA 3KK3A 4KRFA 2ZE2A 1JKHA 3V81A 1D9FA 4OJRA 2YKMA 1VSFA 4OLBA 3BGRA 4W5QA 1CXQA 4M3UA 3K5OA 4CFDA 4DTUA 3AA4A 3NF7A 4DS4A 1NJZA 1WAFA 1ZBUA 1Q9YA 3SQ2A 3AV9A 4FJNA 3AVIA 3RR8A 1KLMA 4CGFA 1TBAB 4CJUA 1HRHA 1QHTA 4RW9A 3VA3A 4HUGA 1ZBLA 4CEBA 1SL2A 3OCIA 1TGHA 1RDAA 3KLIA 3VQAA 1VOKA 3ZSWA 3ZT4A 2FC0A 2DFHA 3VQEA 5KGXA 1NKEA 1QQCA 2IDOA 4JS4A 2HVHA 4ICLA 1QNEA 4M45A 3U3YA 5J1EA 4DFMA 3K59A 1TKTA 2F8SA 4CERA 3LP2A 4TSXA 3TARA 4GVMA 3WNEA 4UQGA 3T3FA 4DQIA 1S1UA 4LSNA 2FBYA 4AHVA 1S1WA 3NDKA 1QE1A 3L2QA 4F3TA 4N5SA 1VSMA 1WSFA 4I7FA 2YV0X 1KYUA 3KLFA 3NF8A 2MJ7A 4DQQA 3AO4A 3C6TA 1JL1A 3OY9A 4HTUA 2XY6A 1BHLA 1NGMA 1RBRA 4CE9A 4CJEA 3KD5E 3ZT0A 4B9SA 3QETA 4KHNA 3QINA 3H08A 4B08A 3ZSQA 3HSTB 4CHPA 4I9QA 1VRUA 3F9KA 4ELUA 2HNYA 1HMVA 2GV9A 3V1RA 3JSMA 3P83D 2OZMA 1KYFA 1JLGA 1JXBA 2YKNA 1IKYA 3S9HA 4Z4IA 3HS9A 3QESA 1S1VA 3DM2A 3TWHA 4FJ7A 5J2QA 3VQPA 3NH0A 3ZSXA 1J9AA 2HNZA 1R0AA 1VSKA 4KB1A 4GMJB 5CY4A 1HPZA 1BQMA 1UA1A 2QK9A 1EP4A 4CGJA 1RT2A 5K14A 3B6PA 4C8MA 5D3GA 3TAFA 3L2VA 4W5NA 4QCLA 3LP3A 2I5JA 3QERA 2HHSA 3IG1A 3A2FA 2OPRA 2OPPA 2XRIA 4CF1A 4CIFA 3NE6A 4CGHA 2O4GA 4ID5A 4CJPA 5J2NA 1C1AA 3PV8A 4KI4A 3MEGA 1QN9A 3DLRA 3OJUA 1B9KA 3MXJA 5HLFA 2IV9A 4LY7A 3IAYA 3TANA 3HS8A 4CF0A 4FM1A 2IOCA 2P51A 3HVTA 4O4GA 4CHZA 3ISNC 3HP9A 1IO2A 5DMRA 3V9UA 4DMNA 3LZIA 3RRHA 2KZMA 5KRSA 2WOMA 4J2BA 3V4IA 1LV5A 3TI0A 4Z4CA 1D8YA 1Q9XA 3VQBA 4CJSA 2RKIA 5J2PA 3ZT3A 2X6NA 2ZQBA 1QNCA 4Y1DA 4AHCA 4FK2A 1VSIA 3DLGA 3T19A 2YNHA 3I0RA 4DQPA 4DWIA 3ASMA 4CJ5A 4DSLA 3LALA 3LAMA 3OYIA 3SUOA 1R4XA 4NCAA 3OYJA 4KO0A 4FZYA 1NK9A 4Q0BA 4M41A 3RMAA 1D5AA 2OPQA 3HK2A 3DRPA 3ZCMA 1B9FA 4C8OA 1C6VA 2G8VA 1HQEA 2D5RA 3KLGA 1J5OA 4O0IA 4IG3A 2DFFA 4DF8A 3RMDA 3PO5A 1F21A 1TKXA 4O0JA 3WNHA 4DQRA 2XY8A 1UOCA 4IFVA 3TAEA 1NK8A 1KY7A 2HMIA 4M3WA 2QKBA 1BQNA 2X74A 1G15A 4DTOA 4CHNA 1VSJA 1NKBA 3S3OA 1KFSA 3ZSYA 4HCBA 4KHWA 4FW2A 4QAGA 4DSFA 4PA1A 4Z4FA 1XHXA 3SYZA 1S1TA 4Z4HA 1TK0A 4FLVA 3MECA 3OYMA 4DS5A 4FJXA 4KHQA 1HYVA 3CM5A 5HRRA 2IV8A 2OYQA 4ZTJA 1NJWA 4DSKA 4FZZA 1T05A 1S1XA 2Y1JA 2KTQA 1RTHA 3ALYA 3ZT2A 2IGIA 4Z4GA 3U3GA 3HPOA 3TAGA 3U6FA 3V9SA 3O4QA 4DG1A 3NF6A 3QNNA 3HYFA 4FVMA 4B9UA 1TK5A 2EX3A 3ZT1A 1L5UA 3EZ5A 4EZ6A 2YNFA 3L3VA 1HYSA 2P5OA 4BDPA 3AVJA 4FJGA 2YHAA 1FKOA 1RBVA 2YNGA 1SKRA 4CECA 3VQ9A 1RTDA 1RDCA 3D0PA 3OYFA 4KTQA 4DLEA 1WLJA 1HNIA 2AJQA 2F96A 4CHOA 4RW7A 1CLQA 3M8QA 4O5BA 5C25A 1MU2A 1VTOA 3CQ8A 5IYCP 3MEDA 4EP5A 3KLEA 3C94A 1U04A 3O3HA 3KK2A 1W80A 1FKPA 1REVA 3DRSA 3AVLA 2VWJA 4ZHRA 3DOKA 1NKCA 4OLAA 4CESA 1NOYA 5EU7A 4BE0A 3EYZA 3CFOA 4KHUA 1ASUA 4NYFA 2E6MA 3SJJA 1YT3A 3OS2A 3I0SA 3OYKA 4CGDA 3M8PA 3B6OA 1GOAA 5CYMA 3SV3A 1T8EA 4HVJA 4B3OA 3LDSA 4FJ8A 1JLCA 4FXDA 2D0BA 1RT7A 3G0ZA 3KD1E 4CJ4A 3V9WA 4F3OA 1WSIA 3AO2A 4CFCA 4J2AA 1S6PA 3DLEA 1KFDA 2HW3A 3P5JA 4RW6A 4RW4A 1XI1A 1QSSA 1D9DA 3LWMA 4DSEA 1JLAA 3LP0A 3V1OA 1A5WA 1TAUA 2PZSA 4FLUA 3AO3A 2BANA 4F4KA 4CJKA 3AVAA 3JYTA 3TAPA 2B5JA 1FXXA 3AA3A 4E1NA 4YFUA 1GOCA 3TABA 1KLNA 5CZ1A 2QKKA 4FYDA 3OYCA 1QN8A 4FLYA 4DQSA 1L3UA 4ELTA 1ZBIA 1WAJA 1B92A 1QS4A 5T7BA 1KYDA 4F2RA 4W5OA 1HYZA 3THVA 3LANA 4E7JA 1QN4A 1VSDA 3T1AA 1NJYA 4DU4A 4FZXC 2VG7A 3NF9A 3HJFA 3KJVA 3RTVA 3OS1A 1IKXA 4J2DA 1ZBHA 4AHTA 3OJSA 4FJMA 3AVGA 3RWUA 1NK4A 2X78A 4MFBA 1N6QA 4E7HA 3HXMA 4CJQA 3DLHA 5CZ2A 4CFBA 5HP1A 3V9ZA 1BCOA 4EZ9A 1EXQA 1LW2A 3NHGA 1XHZA 3VQ5A 1SV5A 1S9EA 3SPZA 1KVBA 3QIPA 1J53A 4CCHA 2XY5A 1XC9A 4DU1A 2XY7A 2VG5A 4E7LA 1TBPA 1UA0A 3ZSVA 1IH7A 1K6YA 3V6DA 2HVIA 3QLHA 1ZBFA 4PWDA 1NJXA 1FK9A 4ELVA 4OKJA 1RT3A 2EHGA 1QN5A 4J2EA 3ZSZA 4CJRA 4KHSA 1LWCA 5KI6A 4IBNA 1U47A 3O3GA 1Z26A 1ZYQA 4DSIA 1QTSA 1Y97A 1NK6A 4AHSA 4ID1A 1I39A 4FCYA 3QEVA 4B9LA 2DTUA 1LWEA 4M42A 4FJIA 4NCBA 5KTQA 1RDDA 1VK0A 2DY4A 1YTUA 4DSJA 3OYBA 1S6QA 3AVHA 1KCFA 4LSLA 3O4NA 1VSEA 2JGUA 4G1QA 4N56A 3DMJA 3LZJA 3PX6A 3TAMA 3S3NA 4AILC 1BIZA 4CJLA 2A1RA 3L3UA 2KFNA 4BE1A 3CFRA 5HROA 3KK1A 4E19A 5HRNA 3AVNA 3QNOA 5HRPA 3L2UA 1YTBA 1I3AA 4WZSD 4PQUA 3OS0A 4HUEA 3OYEA 2BDPA 3AVKA 1KRPA 3DLBA 4CHQA 3SV4A 1RCHA 4CEDA 5CYQA 3VN5A 1X1PA 4CGIA 4Z4EA 3SZ2A 1RM1A 4LH5A 1VOLB 4HHTA 2Y1IA 1U45A 4B9TA 1NOZA 4JRQA 2RF2A 1C0TA 4GW6A 2KQ2A 2LSNA 3NBPA 1HJRA 3AO1A 4KTZA 2W42A 3HPGA 4H8KA 2G8HA 1SUQA 4DTMA 4PUOA 4RODB 3VQ6A 1QTPA 3C95A 4HCCA 2DFEA 1LW0A 2HHVA 1VRTA 1TL3A 4H4MA 4B8CA 3UIQA 4CF2A 3HO1A 4DTPA 4O55A 3VQ8A 4OGEA 5I3UA 1NK5A 1TK8A 3TAQA 3K5LA 4OKKA 4CF8A 3MAQA 1RILA 3SI6A 1KVAA 1WN7A 5FRMA 1YVUA 4Z0UA 2PYJA 4R5PA 4CFAA 1BCMA 1TAQA 1PCZA 1YTFA 3NGIA 4BDZA 2D0CA 3NFAA 3RMCA 4F2SA 3SQ1A 4I2QA 1VSLA 4N47A 2Z1GA 1KY6A 5JS2A 1BL3A 4CEQA 4CEEA 4YNQA 1NK0A 1Z25A 3KKRA 3RMBA 1TKDA 4IKFA 2X6SA 1JLBA 4MQ3A 2VWKA 1SKWA 4FJHA 1RBUA 4IG0A 3L2WA 3CYMA 4ROEB 2PYLA 2O4IA 4CJTA 2VG6A 2YNIA 1WSGA 3LPUA 4PY5A 3HM9A 4B8AB 4DTSA 5HRSA 3OYDA 3QEPA 3AVCA 1X9MA 4FM0A 4KHYA 2HHXA 3VQ4A 4DFPA 3IS9A 5E41A 4C8LA 4KB0A 4FJ9A 4DU3A 1TVRA 4FJKA 1T03A 1PZDA 3K5MA 4BWMA 2PY5A 3K57A 1GOBA 1LAVA 4O44A 1WSJA 4CJFA 2GUIA 3PX4A 3SUQA 1DLOA 2D0AA 1HNVA 4FM2A 4E3SA 4HUFA 3PX0A 4E0DA 3SUPA 3MXMA 3SCXA 1SL1A 4IFYA 1QNBA 1RT4A 1TKZA 3HVRA 1S9GA 4B0AA 1WSHA 4LD0A 3SUNA 4B9MA 1XWLA 3DLKA 2YHBA 1EETA 2BGGA 1JL2A 1NK7A 1JFIC 1SKSA 3EIKA 4Q5VA 3DYAA 4E7IA 1UAXA 3L8BA 3DOLA 3F73A 1ASVA 3MEEA 3HL8A 4I2PA 1ASWA 4Y1CA 1JLQA 3KTQA 3S3MA 3VA0A 2E4LA 1RBSA 4EP4A 3NCIA 1JLEA 1TGOA 2Q3SA 2QXFA 4E1MA 1CDWA 1UWBA 4AHRA 3NGZA 3D45A 1WNSA 1JXEA 2OA8A 4M3TA 4DLGA 3OC3C 1ITGA 3VQ7A 4KI6A 1KVCA 3AVBA 1RDBA 2HNDA 4ROCB 3QEIA 3BDPA 4FK0A 4OVLA 3L2RA 3PY8A 2F8TA 1BIUA 1IKVA 1B9DA 1RT6A 5C24A
chains in the Genus database with same CATH superfamily
3OSEA 1L3VA 4FLWA 1J54A 1LWVA 1LCUA 4E7KA 3TR8A 4NYNA 1C9BB 2V51B 2KZZA 3QFPA 3KLHA 1NJIO 1NGEA 1DTQA 1S22A 2G8WA 4W5RA 5EY4A 5I42A 3SBGA 2OZSA 4DTRA 2ZD1A 1HNWK 4JI7K 3EE9A 3QB0A 3AA2A 4M3ZA 1EKEA 3H1VX 1RTJA 3PIPL 2PFUA 4CIGA 4WQ5C 4JI0K 1IBLK 2JWLA 3A5MC 2QA4N 1C0UA 3PO4A 4K8XA 1CZ9A 1RBTA 4GVEA 1IG9A 2YI1A 4H0XB 1LAWA 3MMVA 4BC2A 2IIRA 1KQSM 3O08A 3WNGA 5M1KA 4C8NA 3TTDA 1HR0K 4CEFA 1X9WA 5HSHA 2G30A 2IS3A 2FBXA 2Z1IA 1KC8O 4CEOA 4HWIA 4RG8A 4KREA 3M8RA 2P9SB 1N5YA 1VTLE 1D3UA 1CXUA 3ENCA 3GBTA 4A61A 4JK7A 3WNFA 3K58A 1U48A 2CGKA 3R3LA 3IDHA 2D4WA 4CZKA 1RDWX 3F0ZA 3O3FA 1AISA 3LWLA 4AHUA 1NK5A 1NNEA 4CIEA 3LDOA 4LF7K 1PVSA 3AVMA 1HKGA 3QBXA 4CK2A 2D0OA 5IYDP 2WFBA 4KTWA 4B3TK 3C04A 4NO7A 1N33K 3LP1A 2ASPA 3K5NA 1YF5L 4N76A 1X9SA 4JLHA 3P38A 1CZBA 2A6AA 4H5WA 4IDKA 2HHQA 1QSYA 2ZE2A 4YY3K 4Y0WA 5F9CA 2WUSA 2CGJA 3AVIA 4H0OA 1TBAB 3VA3A 3A5OC 1NMDA 4H0TB 1ZBLA 4K0KK 1SL2A 3ZSWA 3ZT4A 4YORA 3F9MA 2FC0A 4DFMA 3DWLA 3LP2A 4YOYA 2QEXN 4UQGA 2FBYA 4F3TA 1QE1A 1VSMA 2YV0X 1KYUA 4EAKA 4DR1K 3CJBA 1NGMA 1M3QA 3KWIA 3VGLA 1IJJA 4CE9A 3ZT0A 3QETA 1ATNA 4B08A 4LF8K 3F2KA 3ZSQA 3HSTB 3JSMA 1KYFA 2YKNA 1IKYA 3GDQA 4KH5A 1S1VA 2OANA 3TWHA 4MDBA 4AF1A 4B1YB 1J9AA 1YI2N 1R0AA 3CXCM 1VQ9N 5EPCA 3CC7N 4MRQA 5K14A 2Z0FA 1X9JA 2QWRA 3IFRA 4W5NA 4QCLA 3QERA 2HHSA 4C23A 3IG1A 3P4IA 2XRIA 3U9DA 1Q9UA 3MEGA 2V7YA 3OJUA 2HBJA 1B9KA 2KHOA 5HLFA 1OH7A 1YUWA 2P51A 1QQMA 2D0PA 3ISNC 3WXLA 3HP9A 3VERA 5KRSA 3PSFA 3TTCA 3V4IA 1D8YA 1Q9XA 3VQBA 5J2PA 2RKIA 4AHCA 3TDHA 2AP1A 3DLGA 4EHUA 2YNHA 3SUOA 1R4XA 4LF6K 3OYJA 2P9NB 1D5AA 2OPQA 4C8OA 1NGAA 4IEEA 1J5OA 1NGIA 5LMNK 3RMDA 3PO5A 1F21A 4O0JA 4DQRA 3OSTA 4IFVA 3SAHA 3TAEA 2HZMA 2QKBA 1G15A 1BA1A 4BRKA 4CHNA 4DTOA 1VSJA 1NKBA 1KFSA 2A5XA 5AQUA 4Z4FA 1XHXA 1S1TA 4ISGA 2P9KA 2NZTA 4FZZA 2IV8A 1T05A 5BRFA 3ALYA 3U3GA 3HPOA 3TAGA 1VQLN 3CMAN 3V9SA 4IL8A 3T7ZA 1HYSA 2P5OA 2YHAA 4DHYA 1FKOA 1MWKA 2NRTA 4B1VA 4DR2K 1SKRA 2ZJQL 4V19S 2FF6A 1MA9B 1WLJA 1JDYA 2F96A 1CLQA 2P9KB 4O5BA 4EP5A 1HJOA 4BR0A 2NWVA 3AVLA 4ZHRA 3J7AP 2OTJN 5EU7A 3MDQA 2YHYA 4FWSA 1X3MA 4CZLA 4NYFA 2QWQA 5M1FA 3OS2A 5FRMA 4CGDA 4CZJA 4B3OA 1GOAA 5CYMA 1T8EA 3LDSA 4FJ8A 3D2FA 1QZ6A 3CWAA 1RT7A 4CJ4A 2A40A 4J2AA 4BGAA 1S6PA 3VEYA 2HW3A 3THWA 5FPMA 1TAUA 5JICA 1JLAA 1XC3A 1GLDG 4B3SK 4HTLA 4CJKA 4BRHA 3D7QA 3OH9A 2HF3A 3VENA 3AA3A 4MO5A 1HKCA 5CZ1A 1XNQK 4BVPA 4FLYA 1ZBIA 4GY2B 5T7BA 4F2RA 3H1QA 1QN4A 1VSDA 5AQNA 1M3HA 1FN7A 2HOEA 3ULXA 1ZBHA 3AGRA 3OJSA 3THWB 3CQXA 4FJMA 4H0VB 3HSCA 3ENOC 4CJQA 2Q0UA 1YAGA 5AZJB 5CZ2A 4CFBA 3V9ZA 3BF1A 4EZ9A 1XHZA 1SV5A 3SPZA 1T6DA 2XY7A 1NU0A 2ZM6K 1IH7A 2HVIA 4EIAA 4PWDA 1FK9A 4ELVA 2ZWHA 4OKJA 2EHGA 5EX5A 1OH6A 5AQYA 3SNSA 1LWCA 1U47A 1XQSC 4B9QA 1Y97A 4FCYA 2DTUA 1OH8A 3OBYA 4ILHA 1OKJA 2AA4A 4NCBA 2O8BA 1QVFM 2E88A 1YTUA 1S6QA 3AVHA 3NVMA 2HMPA 3FLCO 1U6ZA 3TAMA 4YHHK 4BRIA 3CPWM 1QHAA 4AILC 4MLHA 4NB4A 4CBUA 2VGNA 4KBOA 4YOTA 3L4QA 4KH4A 5HRPA 3L2UA 4PHTX 4WZSD 3OS0A 3OYEA 4FWPA 3DLBA 5BMNA 4CBXA 4YOUA 2QTDA 1RCHA 3VN5A 2CH6A 5A2QO 1M5Q1 3R6MA 1U45A 2NLXA 4GW6A 2G8HA 1HJRA 1KD1O 3HI0A 1DIZA 4H8KA 1SUQA 4DTMA 3VQ6A 1QTPA 5AR0A 2DFEA 2HHVA 4H4MA 3WUHA 3UIQA 4B1UB 3HO1A 2J4RA 5I3UA 4O55A 2NRZA 4OKKA 1RILA 1KVAA 1YQRA 3I33A 5KQDA 1BCMA 3CMEN 1YHQN 3NGIA 4YOVA 2P9LA 1ZC6A 1J5EK 4I2QA 1N3CA 3CCLN 4N47A 1KY6A 2DKAA 4CEQA 4IKFA 1TKDA 2X6SA 1JLBA 4FJHA 2WC9A 2FXUA 3N4PA 4DTSA 3QEPA 5HRSA 3AVCA 5E41A 1XSZA 4H5VA 4FJKA 1T03A 1C47A 4BWMA 2PY5A 1LAVA 4CI6A 2O8DA 2P9LB 2ASMA 3PX4A 1DLOA 2FF3B 4E3SA 3D4VA 3PX0A 4JYAK 3SUPA 1SL1A 1RT4A 3H46O 1TKZA 3HVRA 1S9GA 4RTFD 4B0AA 1WSHA 4B9MA 1N32K 3VPZA 3DLKA 5KQ8A 2F7TA 5EVZA 2BGGA 1JL2A 3MCAB 2F9WA 1SKSA 3EIKA 1S3XA 2UXDK 3L8BA 3F73A 4XH5A 1K8KA 3HL8A 3CCMN 2O8DB 4Y1CA 3KTQA 3SMSA 3WXJA 4WFNL 3S3MA 3G4SN 1RBSA 3VF6A 4AHRA 3D45A 1JXEA 5AQQA 5BN8A 4KI6A 4KHWA 5GIOA 2HNDA 1RT6A 3NGYA 1LWFA 4CF9A 4EFHA 2G8IA 3DAWA 5FPDA 2WBNA 2O8FA 1IKWA 4KV8A 3M6GA 4B9NA 1Q8IA 1K8KB 4FWQA 4E89A 4DFJA 4CK3A 1VQ8N 2HKPA 4LF4K 3I8BA 4JI8K 4M3YA 4FL9A 4BR7A 3W0LA 2IVPA 2YHXA 2BE2A 2VQFK 3KIOA 5SWMA 4IO9L 3SBTA 1Q18A 4H4OA 1YTAA 1L3SA 5FDLA 2HHWA 2QWNA 3U8XA 1A5XA 2UUAK 4CEZA 3MCPA 1EX4A 4IZ9A 3SQ0A 2Z1HA 3RR7A 3RRGA 4ILGB 4WCEL 1U2VB 3THYB 3G71N 1NH2A 4DFKA 3IRXA 3R8EA 4JI3K 3KWGA 4KAZA 1RDUA 2QLVA 4NCGA 3LAKA 1A5VA 2ETJA 5C2FA 5AQZA 4W5TA 3JS6A 4IEIA 1YJ9N 4K8ZA 3H1ZA 4B9VA 3P1GA 3C6HA 3E01A 3A0IX 3WEEB 2QWOA 3EY1A 1SL0A 4KPYA 4C8KA 5KRTA 3FGUA 2E1ZA 4FWOA 3ZEUB 2RN2A 1RNHA 4OPJA 1BISA 4XIUA 2E2PA 5FROA 5HBMA 2ITGA 1EWRA 4IJNA 2B6AA 3OHRA 3VGKA 2NRRA 3E9PA 4H0YB 1GLLO 2BH1A 1W0HA 4ISFA 3HTVA 4CJVA 3DI6A 4C1NI 4CHYA 4FJLA 2E6LA 2WONA 4WE1A 2A1SA 4N41A 2KLAA 3KVGA 1C1CA 1TYQA 3SMPA 2IAJA 5LY3A 4BRLA 4LFCK 3VQQA 2VJ0A 1UL7A 3C6UA 4WQ5A 2A41A 4JRPA 1M1KO 2G8KA 2A3ZA 3KK3A 2XHIA 3V81A 1D9FA 2JHNA 4OLBA 2YKMA 2NVMA 1CXQA 4M3UA 4CFDA 4DTUA 4JKHA 3O1BA 1NJZA 3SQ2A 1KLMA 1HRHA 4RW9A 3IH7A 1NWKA 3VTIA 3OCIA 1RDAA 3VQAA 4ISEA 2DFHA 3VQEA 1NKEA 1ZXOA 4X62K 4EAHD 2HVHA 3CCQN 4ICLA 1QNEA 2V9JA 1VAZA 1PCJX 1TKTA 3K59A 4CERA 2F8SA 4TSXA 2I7PA 4B3RK 4DQIA 3VETA 5AQHA 1OVYA 4DQQA 3NF8A 2MJ7A 3CQYA 4WFBL 3THXA 3OY9A 1RBRA 3OH6A 4CD1A 2VCPA 3KD5E 1W2BM 3W3DA 3BZCA 3H3OB 4H5RA 3S9HA 1JXBA 4DV4K 1J3MA 5C15A 3ZSXA 1VQON 4KB1A 1HPZA 1BQMA 2DPNA 3THXB 2QK9A 3CCUN 3FZFA 3B6PA 4PKIA 5AQFA 4C8MA 3TAFA 3L2VA 1D4XA 4M7YA 3LP3A 5DM7L 1OH5A 3D2EB 1LWWA 1LXTA 1C1AA 1QN9A 3DLRA 2IV9A 3J7ZO 3IAYA 4PKGA 1KAYA 2P9SA 2MZ8A 2P9IB 4O4GA 1MPGA 2HL9A 1BU6O 4GV9A 1IO2A 2KZMA 3MX2A 1OVQA 3FE1A 2P9PB 4Z4CA 4CJSA 4QS9A 1ILYA 3ZT3A 3J81O 1ATRA 4FK2A 1VSIA 5AZIB 3T19A 4DQPA 4BQLA 4BRGA 1NK9A 3EO3A 5KPTA 3ENBA 2I5WA 1C6VA 2G8VA 3KLGA 4IG3A 4DF8A 2VWBA 2NRWA 1LV5A 3WNHA 3NVKA 2XY8A 4M3WA 1BQNA 4B1WB 1YJWN 4BRPA 2R5XA 3EE8A 3T1HK 4FJXA 2OYQA 5HRRA 5AQOA 4DSKA 4O8UA 1S1XA 3O9RA 4M7XA 3UW2A 3U4LA 1TK5A 1L5UA 1BWFO 4FO0A 4BC4A 1Q81O 1NGFA 3MN9A 3LM9A 4CECA 4BC5A 1RDCA 3D0PA 1HNIA 2AJQA 1MU2A 1VTOA 3O9TA 4QS7A 3MEDA 5KL0A 4JNEA 3KLEA 4YOXA 3C94A 1U04A 4PKHA 1FKPA 4CJ7A 4H0PA 3DRSA 3DOKA 3SLCA 3EYZA 2E6MA 1Q7YO 3LDLA 4CZHA 4R79A 3O6WA 3OBWA 3KD1E 3V9WA 3ZX0A 4FSVA 5E26A 4D7RA 3P5JA 4RW6A 1XI1A 4CZEA 1N39A 2PZSA 3N89A 3AAQA 3MN7A 2GELA 1BA0A 5AQSA 1HU0A 3VESA 2OCEA 1KLNA 1DKGD 3O5BA 3TABA 4FYDA 4DR3K 1QN8A 3E66A 1L3UA 1WAJA 1B92A 3WXIA 1KYDA 4W5OA 1HYZA 4OPHA 4E7JA 3T1AA 1NJYA 1QZ5A 4FZXC 3NF9A 3HJFA 3OS1A 2F7LA 3RWUA 1NK4A 1DGKN 4MFBA 4BR5A 4K41A 3HOSA 3KTUA 1BCOA 4JI1K 3UKUB 1GLAG 3VQ5A 1S9EA 4CCHA 3CI5A 2XY5A 2ZGYA 2V8QA 3IMXA 1DEJA 3G25A 3ZSVA 2ZJPL 3N4QA 2D1KA 3I0XA 2P9NA 1WB9A 4B1ZA 3I55N 4J2EA 3ZSZA 4PL8A 4U67L 3HM8A 1ZYQA 4DSIA 1QTSA 3CIPA 3FZLA 3QEVA 2LAEA 4NLCA 1LWEA 4M42A 4AM6A 4NXMK 2JGUA 4CBWA 3LZJA 1E3MA 1YQKA 3O9SA 2JWKA 3S3NA 2A1RA 2KFNA 5HROA 3QNOA 4PQUA 1E4GT 3SK3A 3I3WA 4ILJA 1N36K 3AVKA 2KKZA 2QWLA 3TPQA 4DR7K 4AM7A 1RM1A 1BO5O 4LH5A 2Y1IA 1NOZA 2RF2A 1C0TA 2HBLA 2W42A 3NBPA 2Q36A 3HPGA 3ENOA 4DV5K 4JK9A 3PDKA 3TSUA 1LW0A 3AAPA 4BVOA 3VQ8A 4G9ZA 2UYTA 3MAQA 5M1PA 4Z0UA 5AQTA 1RFQA 1TAQA 4CFAA 3ATUA 1PCZA 1YTFA 3OTOK 1VSLA 4IFEA 4JKGB 5JS2A 3MWPA 2VWKA 5DM6L 3VEZA 3CYMA 4CJTA 4WF9L 4PY5A 4B8AB 1X9MA 4FM0A 4DFPA 1ZBSA 4XH1A 4A59A 4KB0A 5AQMA 3ID6A 1TVRA 1G99A 3HOTA 1GOBA 4CZIA 1VQ7N 3EKSA 3J7YP 3E1YA 2D0AA 4MDAA 2YJEA 4HUFA 2QRDA 3DXKB 5AZJA 4JKCA 3VMFB 3HBTA 2YJFA 5JMVA 4BROA 1PCMX 3F10A 3DOLA 4I2PA 1ASWA 4IOAL 2HBKA 3J8AA 3VA0A 1JLEA 1CDWA 2OA8A 3NGZA 4M3TA 5BREA 3VQ7A 2RHKA 1RDBA 4ROCB 3PY8A 1IKVA 5C24A 1RT5A 2KW4A 5HOOA 3CWTA 3CJ1A 1GLCG 4FPAA 2XO7A 2Y8LA 4LFBK 2NUBA 4LH4A 2NRVA 4RW8A 2UXCK 4X66K 2E5LK 4BE2A 2HB5A 2E2NA 3PLAA 4YDUC 5TKYA 3SQ4A 4DTJA 4BACA 3OYHA 3CVTA 4BREA 1TL1A 1NG9A 1RTIA 1T44A 2QWPA 3CG7A 3PUFA 2FSNA 5KGWA 3MK6A 5LJWA 2P1JA 3NH2A 1BUPA 3E9LA 1UT4A 4KKOA 2JOIA 5JMVD 4CJ3A 5FRNA 4FLZA 4EHTA 3QEXA 1P5GX 3VF2A 1T7PA 4DV7K 4M3RA 1BI4A 4FJ5A 5J2MA 4L8RB 1BGXT 1V4SA 3UB5A 3V1QA 3V9XA 4FK4A 2KFZA 2P5GA 4CK1A 2BUPA 2Z1JA 1E42A 2R7YA 3DLLL 1KXPA 2YH5A 3A5LC 2HL8A 4DR5K 3VQDA 4OPAA 4DTXA 3QO9A 1HQUA 4CEAA 3QBWA 1WSEA 1RT1A 3OYAA 1W9HA 3FFIA 1QN3A 1BI4B 3A8YA 5FPNA 3SPYA 3ZYYX 3ZSOA 3QEWA 2QRCA 5AQIA 3BUZB 4EJYA 4JN4A 3I8DA 4DF4A 3CJAA 3IUCA 4JEPA 5AJ3K 1NLVA 4LF5K 4GKJK 3OYNA 4ZTFA 4FJJA 1HX1A 5AQVA 4BDYA 4Z94A 4I9LA 3NAEA 2OOXA 1K9MO 1VSHA 3QFUA 3ITHA 1C0MA 3U9ZA 3SNNA 1HNXK 2G8FA 2RPIA 4CJWA 5BPNA 3CM6A 1Z6RA 1L3TA 3ZLJA 2ATQA 3RSMA 3G10A 5KPZA 4B3MK 2FBVA 1WBBA 2QREA 2Z8UA 1NM1A 2NOFA 1VSFA 3BGRA 4W5QA 5GAHP 3NF7A 3AARA 4JK8A 2FKMX 4FJNA 1Q9YA 2ZF5O 3RR8A 1W7AA 4CJUA 4FOIA 2NOEA 1WUAA 4CEBA 4JKFA 3KLIA 2F9TA 4WQ4C 1GLBG 5KGXA 1QQCA 4JS4A 4YOWA 4M45A 5J1EA 3WNEA 5C10A 2DKDA 1S1UA 4LSNA 3LDNA 5AQLA 4AHVA 1S1WA 2NOBA 2VYPA 3L2QA 3NDKA 1E4FT 1UT7A 1WSFA 4I7FA 1IBMK 3KLFA 3P39A 3AO4A 2HBMA 4HTUA 3KZBA 1BHLA 5CE3A 4B9SA 3CHWA 3G6EN 1EUVA 4KHNA 3H08A 1VHXA 4CHPA 4I9QA 1VRUA 2HNYA 1HMVA 3V1RA 2O8CB 3H6EA 1JLGA 4Z4IA 3HS9A 3QESA 3DM2A 3VQPA 3NH0A 3M5RA 3CD6N 1VSKA 1U2VA 5CY4A 3THYA 1EP4A 2P9UB 4J8FA 4I6MA 3FZMA 5D3GA 3SAGA 1N3AA 3GOIA 4JI5K 1YQMA 1SZ2A 4H5TA 4CF1A 2OPRA 2OPPA 3OA9A 3HRGA 4GKKK 4BJUA 4CJPA 5J2NA 3PV8A 4KI4A 5B8HA 1YXQA 3CCVN 3MXJA 4LY7A 2HSTA 4JI4K 4CF0A 3WEEA 4FM1A 4A57A 3VGMA 5DMRA 3V9UA 1XUPO 3LZIA 3ZEUA 4I6MB 4OO1J 3CWSA 2WOMA 4J2BA 3TI0A 4I8OA 4JKEA 2X6NA 4GNIA 1R59O 1J6ZA 2VQEK 2H5AX 5FLXO 4DWIA 5M1QA 4DSLA 1P8ZA 3LALA 3LAMA 4KO0A 4CFFA 4M41A 4DR6K 4BRQA 3HK2A 2IVOA 3OW2M 4O0IA 4JD2A 1TKXA 1NK8A 2Y8QA 1UOCA 4HJHA 1EWQA 1KY7A 2X74A 4MLEA 1P90A 4FVUA 2PAVA 3S3OA 3ZSYA 4FW2A 1BG3A 4DSFA 4PA1A 3H3NO 4X64K 1NGHA 1TK0A 4DV0K 4KHQA 2YA3A 2Y1JA 3ZT2A 3C6AA 4C1NK 4Z4GA 3O4QA 4DG1A 3NF6A 3QNNA 4FVMA 1GLFO 4B9UA 2FSJA 3CETA 4EZ6A 1KAZA 4JD2B 4CZGA 1BOTO 4BDPA 1N34K 4FJGA 1JCEA 3T69A 1NMNA 2YCHA 4H03B 4L3QA 2CH5A 4KTQA 4DLEA 3MN6A 3VEWA 5JN5A 3DPTA 2GUPA 5C25A 3I0WA 5GINA 3CQ8A 3DPUA 1VQNN 2Q31A 3KK2A 1W80A 2VWJA 4EJZA 4BE0A 1NOYA 5AQRA 4A2AA 3PMGA 3C7NB 1QVGM 4KHUA 4BR9A 3SJJA 4PL7A 2H3GX 3I0SA 3M8PA 3B6OA 4HVJA 5BPMA 3TE5A 1JLCA 4FXDA 2D0BA 3VEXA 1WSIA 3AO2A 3L0QA 1MWMA 2ZFDB 5AN4A 4DCHA 1QSSA 4DSEA 3V1OA 5GAEP 4F4KA 4F9OA 3RSEA 3D2EA 5ADXA 3JYTA 3TAPA 2B5JA 1FXXA 4E1NA 4BRMA 1GOCA 3OYCA 4DB3A 4WX8A 4ELTA 1QS4A 3C65A 2P9IA 2E2OA 4DU4A 1GLEG 3KJVA 2QM1A 4D7QA 4AHTA 3FFKB 3RVCA 3UKRB 2P9PA 2Q97A 1N6QA 4IO8A 4E7HA 1JCGA 3DLHA 1EXQA 3RSEB 4WFAL 3NHGA 4RCHA 3S41A 1P5DX 2O8EB 4NLBA 1KVBA 3QIPA 3IKMA 5AZIA 4DU1A 1BDGA 1VQKN 2VG5A 4E7LA 1UA0A 1DT9A 4DULA 1K6YA 3OSMA 1IV0A 1ZBFA 5F1XA 1TUOA 3QDKA 3EKUA 2W41A 1RT3A 5BR9A 1QN5A 1GLJO 4KHSA 4IBNA 2QW9A 3TU5A 3O3GA 1Z26A 3VEOA 1WBDA 1HNZK 4IDHA 1NK6A 3EEQA 5HL7L 4B9LA 2NLVA 1TUYA 4FJIA 1VQMN 1RDDA 1VK0A 4EAJA 3Q7CA 3OYBA 4K43A 4LSLA 1VSEA 4N56A 3PX6A 3WQUA 3QMLA 3D7EO 4BE1A 4BG8A 3KK1A 5HRNA 3AVNA 3CWUA 4BR2A 1MDUB 1HKBA 1V4TA 1SQKA 1KRPA 2QI2A 4CHQA 2UXBK 3FR0A 4CGIA 1V5SA 3ULEA 4HHTA 2EHBD 1K8AO 4JHDA 4JRQA 2QR1A 4KTZA 2LSNA 3AO1A 3NMUA 4HCCA 4FWRA 3ZETA 5BMPA 1TL3A 1VRTA 4CF2A 4BY9C 4DTPA 4U7BA 3TAQA 1VQ6N 2PYJA 1C4GA 1Y64A 1M90O 4BDZA 2D0CA 3NFAA 3SQ1A 3LL3A 1BL3A 4YNQA 3ULEB 4CEEA 3RMBA 4JHDB 4MQ3A 1SKWA 1XMOK 2FLOA 2HF4A 1WSGA 3LPUA 5JVGL 3HM9A 3OYDA 3T1YK 3ZETB 3IS9A 4H5NA 4C8LA 4FJ9A 3K5MA 3WXMB 5BPLA 1C0FA 1QQNA 5BRHA 3GL1A 4O44A 1WSJA 4FM2A 1HNVA 1IG8A 4E0DA 5IT9O 5JLFA 3MXMA 2JPIA 1KO9A 1QNBA 3WT0A 5LMUK 2V92A 2OTLN 3UKUA 2NNWA 3T4NA 1XWLA 1EETA 2GWJA 3VTHA 1JFIC 2NOLA 2W6LA 4E7IA 3OLPA 5JLHA 2DKCA 3DXMA 4CZFA 1ASVA 4OX9K 1JLQA 1O13A 5GAGP 2E4LA 3VEVA 4E1MA 4O5FA 2ITMA 4DLGA 3OC3C 4WYBA 1KVCA 3AVBA 3BDPA 2F8TA 5FPEA 3L2RA 1B9DA 5C2DA 3MX5A 3HP6A 3NH1A 3AO5A 1KSPA 3KKSA 4QOZB 5C42A 2NOZA 4F8RA 4AH9A 3DXMB 4OKEA 2B4JA 1ESVA 3ZSRA 2EWSA 2FUVA 1MP9A 4CGGA 2XHBA 3O1WA 2H4LX 2QWMA 5SZTA 1NGDA 3OYLA 4DV3K 3ZX2A 1JJ2M 4X65K 2Q0RA 1XMQK 3QIOA 3K2PA 3EN9A 4A2BA 3OYGA 3WQTA 1RGIA 2G8UA 1X3NA 3UE5A 1NVPA 4FLTA 4DTNA 1NGGA 4IOCL 4OPKA 4UY8O 3O4WA 1QNAA 1Z05A 4DUYK 4M3XA 3VQCA 1O1WA 4FWLA 1QSLA 3AA5X 2JLEA 3M8SA 4FW1A 2HHUA 2E8AA 3EL2A 3HPHA 4K42A 2A42A 3HT3A 1C1BA 1U4BA 5F0XA 4FLXA 4JKGA 5DK5A 2IC3A 5CR4A 1JLFA 1VQ4N 4OGCA 3LPTA 5IYBP 3BEXA 3TTFA 1DTTA 2HHTA 1KTQA 5M1NA 3ID8A 4JS5A 1QN7A 4KFBA 3BKQX 1QN6A 3ULDA 5JS1A 3MXIA 1S5JA 3DRRA 3AY9A 2RE2A 3CFPA 3CCRN 2OPSA 2YHWA 1QQOA 3AVFA 4CW7B 3DXKA 2GBZA 3OGDA 4YDUA 5GIPA 1TV6A 4IJAA 2FBTA 1QTMA 3GE1A 3OVNA 4DKWA 5BN9A 5AQPA 2ZJRL 4IWVA 1FJGK 4BWJA 1U49A 3AGKA 4KRFA 1JKHA 4EAGA 4OJRA 3K5OA 3BP8A 3AA4A 5EOYA 4DS4A 3JXUA 1WAFA 1ZBUA 3ENHA 3AV9A 4CGFA 4BGBA 4JI6K 2UUBK 1QHTA 4HUGA 5CHIA 1TGHA 5AFUH 1VOKA 4RWTA 1IBKK 3CCSN 1HUXA 4A5BA 3TSPA 2IDOA 3U3YA 3M1FA 2O3OA 3TARA 1LOTB 1T3VA 4GVMA 3KHYA 2HZSA 1SAZA 3T3FA 3KK7A 4B1XB 5M1OA 4JKAA 4N5SA 3C6TA 1JL1A 2XY6A 3TSQA 4CJEA 3CJ9A 3R1XA 5E84A 3QINA 3F9KA 1CZAN 3RPJA 2VGMA 2GV9A 4FWNA 4ELUA 3P83D 2OZMA 4FWKA 3BY5A 3O9UA 4FJ7A 4JAXA 5J2QA 4CD3A 3MWTA 2HNZA 1I94K 3D2FB 4GMJB 1UA1A 4CGJA 3L4IA 1RT2A 3B8AX 1NGCA 2ASOA 1H1VA 2E1YA 5F2RA 2I5JA 4LFAK 4XH4A 3A2FA 4CIFA 3NE6A 4CGHA 4QS8A 2O4GA 5MLCQ 3BZKA 4ID5A 5LL6Z 1YITN 1TUUA 1WJWA 3TANA 3HS8A 4GV6A 4QG5A 1LWYA 2IOCA 3HVTA 2WTUA 4CHZA 4WQ4A 5TKWA 4JI2K 3CF5L 4K25A 4DMNA 3RRHA 1WOQA 3LDPA 4M63C 2V7ZA 1S72N 2ZQBA 5H1SQ 1QNCA 3L6QA 4Y1DA 3ZX3A 4EALA 3FZKA 4DUZK 3I0RA 3ASMA 3VF4A 4CJ5A 3ATVA 4CVNE 3OYIA 4NCAA 4BG9A 4DQ8A 4FZYA 4Q0BA 3JAMO 3RMAA 3DRPA 2GTDA 1B9FA 3ZCMA 1VKLA 3Q7BA 1HQEA 2D5RA 2DFFA 3CERA 2HMIA 5IWAK 2UUCK 2QXLA 4MO4A 4FOEA 4HCBA 4QAGA 5AQKA 3SYZA 4Z4HA 2O8BB 1ATSA 4FLVA 3MECA 3OYMA 4DS5A 1T6AA 1HYVA 3CM5A 3SAFA 4ZTJA 1NJWA 2KTQA 1RTHA 2IGIA 3U6FA 2E2QA 3WXKA 3HYFA 5AFUA 2EX3A 3ZT1A 3EZ5A 2YNFA 3L3VA 3BF3A 3AVJA 4O8KA 1RBVA 2V52B 2YNGA 3VQ9A 1RTDA 5BR8K 3EZWA 3OYFA 4CHOA 3C0BA 4RW7A 3K0SA 3M8QA 4LC9B 2GWKA 4DV2K 1YIJN 1KFQA 5IYCP 4DV6K 3O3HA 5EXWA 1REVA 1NKCA 4OLAA 2HHHK 4CESA 4JV5K 5GADP 1EO1A 2O8CA 5C0YA 2Q1NA 2NOHA 3CFOA 2I7NA 1ASUA 4B9TA 1YT3A 3OYKA 3SV3A 1NGBA 1VQ5N 3G0ZA 4F3OA 2IVNA 5AQXA 4CFCA 3I56N 1W97L 2P9UA 3DLEA 1KFDA 1NBWA 4BC3A 4BQZA 3O9QA 4RW4A 1D9DA 3LWMA 3LP0A 1A5WA 4FLUA 3AO3A 2BANA 2NRXA 1VQPN 2CGLA 3AVAA 2NOIA 3D6RA 2QKKA 4EAIA 4YFUA 2W6KA 4DQSA 4BR4A 3LM2A 3THVA 3LANA 3SJHA 2VG7A 3K9JA 2JHJA 2E20A 4A62A 4CZMA 3RTVA 1IKXA 4J2DA 3EAYA 3AVGA 4JKBA 1WQAA 3LDQA 2X78A 3HXMA 5HP1A 5ADXH 1LW2A 1FW6A 4E1JA 3H45C 5AQJA 1J53A 3CJCA 1XC9A 3MN5A 3CW7A 1TBPA 3GG4A 4JKDA 3R9PA 1YQLA 4A5AA 3V6DA 3QLHA 1HPMA 1EQYA 1NJXA 4IXCA 1N8RO 4KH6A 4CJRA 5KI6A 3PSIA 1SS6A 4AHSA 4ID1A 1I39A 1YJNN 4LF9K 3CPEA 4DV1K 2O8FB 5KTQA 1XNRK 2DY4A 4DSJA 1KCFA 3O4NA 1K35A 4G1QA 3DMJA 1KFIA 1BIZA 4CJLA 3L3UA 2BTFA 3CFRA 4E19A 1YTBA 1I3AA 4FPBA 4HUEA 2BDPA 3DJCA 1T6CA 3SV4A 2FKFA 4BRDA 4CEDA 5CYQA 1X1PA 4GV3A 4Z4EA 3SZ2A 3CVSA 1HLUA 1EBMA 1K2YX 1VOLB 3KRMA 4DR4K 2KQ2A 4PUOA 4TPSA 4BRAA 4RODB 1Q82O 3C95A 2GX9A 5KPRA 4C7PA 2NRHA 4B8CA 4OGEA 5C12A 3CC2N 3C7NA 1TK8A 4WXAA 4BRCA 4CF8A 3K5LA 3SI6A 1WN7A 1YVUA 4R5PA 2OOYA 4F2SA 3RMCA 3CC4N 1Q86O 2Z1GA 3A5NC 1NK0A 1Z25A 3KKRA 3CCJN 3M3ZA 1RBUA 2PWWA 3P31A 4IG0A 3L2WA 4ROEB 2PYLA 2O4IA 2VG6A 2YNIA 4KHPK 5AQGA 2HHXA 4KHYA 3VQ4A 3CJ7A 1K73O 3CCEN 5LJVA 2UU9K 4IOXA 2Q2RA 4DU3A 5BRDA 1PZDA 3K9KA 2FGTA 2FSKA 3K57A 2PBDA 2F4VK 5I9EB 4CJFA 2GUIA 2W40A 3SUQA 1YVNA 5ELZA 3NA5A 5JVHL 3UKRA 3SCXA 4IFYA 1TYQB 4BRFA 3F5TA 3E9OA 4LD0A 3SUNA 5AQWA 2O8EA 2YHBA 3QICA 4Q11A 4XEIA 1NK7A 4BRNA 1KAXA 2GEMA 4Q5VA 1JCFA 3DYAA 4AQYK 1C0GA 1UAXA 3MEEA 4NXNK 3FZHA 3HZ6A 2YX6A 2ZGZA 4EP4A 3VOVA 3NCIA 1TGOA 2Q3SA 2QXFA 1UWBA 1WNSA 3O8MA 1ITGA 3J80O 3PIOL 3O80A 1NGJA 4FWMA 3QEIA 4FK0A 4OVLA 1BIUA
chains in the Genus database with same CATH topology
3NGYA 1LWFA 4CF9A 1RT5A 2KW4A 3AO5A 3NH1A 3HP6A 1L3VA 2G8IA 4FLWA 1KSPA 1J54A 1LWVA 3KKSA 4QOZB 5C42A 2NOZA 1IKWA 4AH9A 4KV8A 3TR8A 2XO7A 4NYNA 4E7KA 4F8RA 1C9BB 2KZZA 2NUBA 4LH4A 4OKEA 1Q8IA 4B9NA 2B4JA 3KLHA 3ZSRA 4RW8A 4E89A 4CK3A 4DFJA 1DTQA 2G8WA 1MP9A 4W5RA 4CGGA 4BE2A 2HB5A 5I42A 2XHBA 2OZSA 4DTRA 4M3YA 3SQ4A 5SZTA 4DTJA 3OYLA 3OYHA 4BACA 2ZD1A 2BE2A 1TL1A 1RTIA 3KIOA 3CG7A 5SWMA 3AA2A 3PUFA 3QIOA 3K2PA 4H4OA 1YTAA 1L3SA 1EKEA 5KGWA 4M3ZA 1RTJA 5FDLA 2P1JA 3OYGA 2HHWA 4CIGA 1A5XA 3NH2A 4CEZA 3PO4A 1UT4A 4KKOA 1C0UA 1EX4A 2G8UA 2JOIA 4K8XA 3SQ0A 2Z1HA 4CJ3A 1CZ9A 1NVPA 3RR7A 4FLZA 4FLTA 4DTNA 1RBTA 3RRGA 5FRNA 3QEXA 4OPKA 1IG9A 1T7PA 4M3RA 1BI4A 4FJ5A 1LAWA 1NH2A 1QNAA 5J2MA 4L8RB 1BGXT 4M3XA 3VQCA 1O1WA 3WNGA 3IRXA 4DFKA 1QSLA 4C8NA 2KFZA 3AA5X 3V1QA 3V9XA 4FK4A 2JLEA 4CEFA 4CK1A 3M8SA 2Z1JA 4FW1A 1E42A 2R7YA 3HPHA 1X9WA 2P5GA 4KAZA 2HHUA 2G30A 2IS3A 4NCGA 3HT3A 2FBXA 2YH5A 2Z1IA 1C1BA 3LAKA 1U4BA 1A5VA 4FLXA 3VQDA 5DK5A 4CEOA 2IC3A 2ETJA 4DTXA 3QO9A 1JLFA 1HQUA 4W5TA 4CEAA 4RG8A 4KREA 4OGCA 3M8RA 3H1ZA 1WSEA 1RT1A 4B9VA 3LPTA 5IYBP 3P1GA 1N5YA 4K8ZA 3E01A 1VTLE 3EY1A 1D3UA 3OYAA 1CXUA 1W9HA 1SL0A 3FFIA 1QN3A 1BI4B 1DTTA 1KTQA 3SPYA 4KPYA 3ZSOA 3QEWA 2HHTA 4JS5A 5KRTA 4C8KA 1QN7A 4KFBA 4EJYA 2RN2A 1RNHA 3WNFA 4OPJA 3I8DA 3K58A 1U48A 4DF4A 1QN6A 3ULDA 1BISA 4XIUA 5JS1A 5FROA 1S5JA 3MXIA 3F0ZA 3DRRA 5HBMA 3CFPA 3O3FA 1AISA 2ITGA 4AHUA 2B6AA 3OYNA 4CIEA 3LWLA 4BDYA 4ZTFA 4FJJA 2OPSA 3AVMA 4CK2A 4I9LA 1W0HA 3AVFA 5IYDP 4KTWA 3NAEA 4CJVA 3DI6A 1VSHA 4CHYA 4FJLA 2GBZA 2E6LA 2WONA 4WE1A 2A1SA 3ITHA 4N41A 3LP1A 1C0MA 1TV6A 1C1CA 3SNNA 2G8FA 2RPIA 2FBTA 4CJWA 3K5NA 1QTMA 3CM6A 1L3TA 4N76A 2IAJA 2ATQA 3OVNA 3G10A 1X9SA 4JLHA 3VQQA 2FBVA 2VJ0A 1CZBA 4IDKA 4BWJA 3C6UA 2Z8UA 1U49A 4JRPA 2G8KA 2HHQA 1QSYA 3KK3A 4KRFA 2XHIA 2ZE2A 1JKHA 3V81A 1D9FA 4OJRA 2YKMA 2NOFA 1VSFA 3BGRA 4W5QA 1CXQA 4M3UA 4OLBA 3K5OA 4CFDA 4DTUA 3AA4A 3NF7A 4DS4A 1NJZA 1WAFA 1ZBUA 1Q9YA 3SQ2A 3AV9A 4FJNA 3AVIA 3RR8A 1KLMA 4CGFA 1TBAB 4CJUA 1HRHA 1QHTA 4RW9A 3VA3A 2NOEA 3IH7A 4HUGA 1ZBLA 4CEBA 1SL2A 3OCIA 1TGHA 1RDAA 3KLIA 3VQAA 1VOKA 3ZSWA 3ZT4A 2FC0A 2DFHA 3VQEA 5KGXA 1NKEA 1QQCA 2IDOA 4JS4A 2HVHA 4ICLA 1QNEA 4M45A 3U3YA 5J1EA 4DFMA 3K59A 1TKTA 2F8SA 4CERA 2O3OA 3LP2A 4TSXA 3TARA 4GVMA 3WNEA 2HZSA 4UQGA 3T3FA 1S1UA 4DQIA 4LSNA 2FBYA 4AHVA 1S1WA 2NOBA 1QE1A 3L2QA 3NDKA 4F3TA 4N5SA 1VSMA 1UT7A 1WSFA 4I7FA 2YV0X 1KYUA 3KLFA 3NF8A 2MJ7A 4DQQA 3AO4A 3C6TA 1JL1A 3OY9A 4HTUA 2XY6A 1BHLA 1NGMA 1M3QA 1RBRA 4CE9A 4CJEA 3KD5E 3ZT0A 4B9SA 3QETA 4KHNA 3QINA 3H08A 4B08A 3ZSQA 3HSTB 4CHPA 4I9QA 1VRUA 3F9KA 3RPJA 4ELUA 2HNYA 1HMVA 2GV9A 3V1RA 3JSMA 3P83D 2OZMA 1KYFA 1JLGA 1JXBA 2YKNA 1IKYA 3S9HA 4Z4IA 3HS9A 3QESA 1S1VA 3DM2A 3TWHA 4FJ7A 5J2QA 3VQPA 3NH0A 3ZSXA 1J9AA 2HNZA 1R0AA 1VSKA 4KB1A 4GMJB 5CY4A 1HPZA 1BQMA 1UA1A 2QK9A 1EP4A 4CGJA 1RT2A 5K14A 3B6PA 4C8MA 5D3GA 3TAFA 3L2VA 4W5NA 4QCLA 1N3AA 3LP3A 2I5JA 1YQMA 3QERA 2HHSA 3IG1A 3A2FA 2OPRA 2OPPA 2XRIA 4CF1A 4CIFA 1LWWA 4CGHA 3NE6A 2O4GA 4ID5A 4CJPA 5J2NA 1C1AA 3PV8A 4KI4A 3MEGA 1QN9A 3DLRA 3OJUA 1B9KA 3MXJA 5HLFA 2IV9A 4LY7A 3IAYA 3TANA 3HS8A 2MZ8A 4CF0A 4FM1A 1LWYA 2IOCA 2P51A 3HVTA 4O4GA 4CHZA 3ISNC 3HP9A 1IO2A 5DMRA 3V9UA 4DMNA 3LZIA 3RRHA 2KZMA 5KRSA 2WOMA 4J2BA 3V4IA 1LV5A 3TI0A 4Z4CA 1D8YA 4I8OA 3VQBA 4CJSA 2RKIA 5J2PA 1Q9XA 3ZT3A 2X6NA 2ZQBA 1QNCA 4Y1DA 4AHCA 4FK2A 1VSIA 3DLGA 3T19A 2YNHA 3I0RA 4DQPA 4DWIA 3ASMA 4CJ5A 4DSLA 3LALA 3LAMA 3OYIA 3SUOA 1R4XA 4NCAA 3OYJA 4KO0A 4FZYA 1NK9A 4Q0BA 4M41A 3RMAA 1D5AA 2OPQA 3HK2A 3DRPA 3ZCMA 1B9FA 4C8OA 2I5WA 1C6VA 2G8VA 1HQEA 2D5RA 3KLGA 1J5OA 4O0IA 4IG3A 2DFFA 4DF8A 3RMDA 3PO5A 1F21A 1TKXA 4O0JA 3WNHA 3OSTA 2XY8A 1UOCA 4IFVA 4DQRA 3TAEA 1KY7A 1NK8A 2HMIA 2HZMA 4M3WA 2QKBA 1BQNA 2X74A 1G15A 4DTOA 4CHNA 1VSJA 1NKBA 3S3OA 1KFSA 3ZSYA 4HCBA 4KHWA 4FW2A 4QAGA 4DSFA 4PA1A 4Z4FA 1XHXA 3SYZA 1S1TA 4Z4HA 1TK0A 4FLVA 3MECA 3OYMA 4DS5A 4FJXA 4KHQA 1HYVA 3CM5A 5HRRA 2IV8A 2OYQA 4ZTJA 1NJWA 4DSKA 4FZZA 1T05A 1S1XA 2Y1JA 2KTQA 1RTHA 3ALYA 3ZT2A 2IGIA 4Z4GA 3U3GA 3HPOA 3TAGA 3U6FA 3V9SA 3O4QA 4DG1A 3NF6A 3QNNA 3HYFA 4FVMA 4B9UA 1TK5A 2EX3A 3ZT1A 1L5UA 3EZ5A 4EZ6A 2YNFA 3L3VA 1HYSA 2P5OA 4BDPA 3AVJA 4FJGA 2YHAA 1FKOA 1RBVA 2YNGA 1SKRA 4CECA 3VQ9A 1RTDA 1RDCA 3D0PA 3OYFA 4KTQA 4DLEA 1WLJA 1HNIA 2AJQA 2F96A 4CHOA 4RW7A 3DPTA 1CLQA 3M8QA 4O5BA 5C25A 1MU2A 3I0WA 1VTOA 3CQ8A 5IYCP 3DPUA 3MEDA 4EP5A 3KLEA 3C94A 1U04A 3O3HA 3KK2A 1W80A 1FKPA 1REVA 3DRSA 3AVLA 2VWJA 4ZHRA 3DOKA 1NKCA 4OLAA 4CESA 4EJZA 5EU7A 4BE0A 1NOYA 3EYZA 2NOHA 3CFOA 4KHUA 1ASUA 4NYFA 2E6MA 3SJJA 1YT3A 3OS2A 3I0SA 3OYKA 4CGDA 3M8PA 3B6OA 1GOAA 5CYMA 3SV3A 1T8EA 4HVJA 4B3OA 3LDSA 4FJ8A 1JLCA 4FXDA 2D0BA 1RT7A 3G0ZA 3KD1E 4CJ4A 3V9WA 4F3OA 1WSIA 3AO2A 4CFCA 4J2AA 1S6PA 3DLEA 1KFDA 2HW3A 5AN4A 3P5JA 4RW6A 4RW4A 1XI1A 1QSSA 1D9DA 3LWMA 1N39A 1JLAA 3LP0A 3V1OA 1A5WA 4DSEA 1TAUA 2PZSA 4FLUA 3N89A 3AO3A 2BANA 4F4KA 4CJKA 1HU0A 3AVAA 2NOIA 3JYTA 3TAPA 2B5JA 1FXXA 3AA3A 4E1NA 4YFUA 1GOCA 3TABA 1KLNA 5CZ1A 2QKKA 4FYDA 3OYCA 1QN8A 4FLYA 4DQSA 1L3UA 4ELTA 1ZBIA 1WAJA 1B92A 1QS4A 5T7BA 1KYDA 4F2RA 4W5OA 1HYZA 3THVA 3LANA 4E7JA 1QN4A 1VSDA 3T1AA 1NJYA 4DU4A 4FZXC 2VG7A 3NF9A 1M3HA 1FN7A 3KJVA 3RTVA 3ULXA 1IKXA 3OS1A 4J2DA 1ZBHA 3HJFA 4AHTA 3OJSA 4FJMA 3AVGA 3RWUA 1NK4A 2X78A 4MFBA 1N6QA 4E7HA 3HXMA 4CJQA 3KTUA 3DLHA 5CZ2A 4CFBA 5HP1A 3V9ZA 1BCOA 4EZ9A 1EXQA 1LW2A 3NHGA 1XHZA 3VQ5A 1SV5A 1S9EA 3SPZA 1KVBA 3QIPA 1J53A 4CCHA 2XY5A 1XC9A 4DU1A 2XY7A 2VG5A 4E7LA 1TBPA 1UA0A 3ZSVA 4DULA 1YQLA 1K6YA 1IH7A 3OSMA 3QLHA 3V6DA 2HVIA 3I0XA 1ZBFA 4PWDA 1NJXA 1FK9A 4ELVA 4OKJA 1RT3A 2EHGA 1QN5A 4J2EA 3ZSZA 4CJRA 3SNSA 4KHSA 1LWCA 5KI6A 4IBNA 2G8HA 1U47A 3O3GA 1Z26A 1ZYQA 4DSIA 1QTSA 1Y97A 1NK6A 4AHSA 4ID1A 1I39A 4FCYA 2LAEA 3QEVA 4B9LA 2DTUA 1LWEA 4M42A 4FJIA 4NCBA 5KTQA 1RDDA 1VK0A 2DY4A 1YTUA 4DSJA 3OYBA 1S6QA 3AVHA 1KCFA 4LSLA 3O4NA 1VSEA 2JGUA 4G1QA 4N56A 3DMJA 1YQKA 3LZJA 3PX6A 3TAMA 3S3NA 4AILC 1BIZA 4CJLA 2A1RA 3L3UA 2KFNA 4BE1A 3CFRA 5HROA 3KK1A 4E19A 5HRNA 3AVNA 3QNOA 5HRPA 3L2UA 1YTBA 1I3AA 4WZSD 4PQUA 3OS0A 4HUEA 3OYEA 2BDPA 3AVKA 1KRPA 3DLBA 4CHQA 3SV4A 1RCHA 4CEDA 5CYQA 3VN5A 1X1PA 4CGIA 4Z4EA 3SZ2A 1RM1A 1EBMA 4LH5A 1VOLB 4HHTA 2Y1IA 3KRMA 1U45A 4B9TA 1NOZA 4JRQA 2RF2A 1C0TA 4GW6A 2KQ2A 2LSNA 3NBPA 1HJRA 3AO1A 4KTZA 2W42A 3HPGA 4TPSA 4H8KA 1SUQA 4DTMA 4PUOA 4RODB 3VQ6A 1QTPA 3C95A 4HCCA 2DFEA 1LW0A 2HHVA 1VRTA 1TL3A 4H4MA 4B8CA 3UIQA 4CF2A 3HO1A 4DTPA 4O55A 3VQ8A 4OGEA 5I3UA 1NK5A 1TK8A 3TAQA 3K5LA 4OKKA 4CF8A 3MAQA 1RILA 3SI6A 1KVAA 1WN7A 5FRMA 1YVUA 1YQRA 4Z0UA 4R5PA 2PYJA 4CFAA 1BCMA 1TAQA 1PCZA 1YTFA 3NGIA 4BDZA 2D0CA 3NFAA 3RMCA 4F2SA 3SQ1A 4I2QA 1N3CA 1VSLA 4N47A 2Z1GA 1KY6A 5JS2A 1BL3A 4CEQA 4CEEA 4YNQA 1NK0A 1Z25A 3KKRA 3RMBA 1TKDA 4IKFA 2X6SA 1JLBA 4MQ3A 2VWKA 1SKWA 4FJHA 1RBUA 4IG0A 3L2WA 3CYMA 4ROEB 2PYLA 2O4IA 4CJTA 2VG6A 2YNIA 1WSGA 3LPUA 4PY5A 3HM9A 4B8AB 4DTSA 5HRSA 3OYDA 3QEPA 3AVCA 1X9MA 4FM0A 4KHYA 2HHXA 3VQ4A 4DFPA 3IS9A 5E41A 4C8LA 4KB0A 4FJ9A 4DU3A 1TVRA 4FJKA 1T03A 1PZDA 3K5MA 2FGTA 4BWMA 2PY5A 3K57A 1GOBA 1LAVA 4O44A 1WSJA 4CJFA 2GUIA 3PX4A 3SUQA 1DLOA 2D0AA 1HNVA 4FM2A 4E3SA 4HUFA 3PX0A 4E0DA 3SUPA 3MXMA 3SCXA 1SL1A 4IFYA 1KO9A 1QNBA 1RT4A 1TKZA 3HVRA 1S9GA 4B0AA 1WSHA 4LD0A 3SUNA 4B9MA 1XWLA 3DLKA 2YHBA 1EETA 2BGGA 1JL2A 4Q11A 1NK7A 1JFIC 2NOLA 1SKSA 3EIKA 4Q5VA 3DYAA 4E7IA 1UAXA 3L8BA 3F10A 3DOLA 3F73A 1ASVA 3MEEA 3HL8A 4I2PA 1ASWA 4Y1CA 1JLQA 3KTQA 3S3MA 3VA0A 2E4LA 1RBSA 4EP4A 3NCIA 1JLEA 1TGOA 2Q3SA 2QXFA 4E1MA 1CDWA 1UWBA 4AHRA 3NGZA 3D45A 1WNSA 1JXEA 2OA8A 4M3TA 4DLGA 3OC3C 1ITGA 3VQ7A 4KI6A 1KVCA 3AVBA 1RDBA 2HNDA 4ROCB 3QEIA 3BDPA 4FK0A 4OVLA 3L2RA 3PY8A 2F8TA 1BIUA 1IKVA 1B9DA 1RT6A 5C24A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NGY A;  1LWF A;  4CF9 A;  1RT5 A;  2KW4 A;  3AO5 A;  3NH1 A;  3HP6 A;  1L3V A;  2G8I A;  4FLW A;  1KSP A;  1J54 A;  3KKS A;  4QOZ B;  5C42 A;  4E7K A;  1IKW A;  4AH9 A;  4KV8 A;  3TR8 A;  2XO7 A;  4NYN A;  4F8R A;  1C9B B;  2KZZ A;  2NUB A;  4LH4 A;  4OKE A;  1Q8I A;  4B9N A;  2B4J A;  3KLH A;  3ZSR A;  4RW8 A;  4E89 A;  4CK3 A;  4DFJ A;  1DTQ A;  2G8W A;  1MP9 A;  4W5R A;  4CGG A;  4BE2 A;  2HB5 A;  5I42 A;  2XHB A;  2OZS A;  4DTR A;  4M3Y A;  3SQ4 A;  5SZT A;  4DTJ A;  3OYL A;  3OYH A;  4BAC A;  2ZD1 A;  2BE2 A;  1TL1 A;  1RTI A;  3KIO A;  3CG7 A;  5SWM A;  3AA2 A;  3PUF A;  3QIO A;  3K2P A;  4H4O A;  1YTA A;  1L3S A;  1EKE A;  5KGW A;  4M3Z A;  1RTJ A;  5FDL A;  2P1J A;  3OYG A;  2HHW A;  4CIG A;  1A5X A;  3NH2 A;  4CEZ A;  3PO4 A;  4KKO A;  1C0U A;  1EX4 A;  2G8U A;  4K8X A;  3SQ0 A;  2Z1H A;  4CJ3 A;  1CZ9 A;  1NVP A;  3RR7 A;  4FLZ A;  4FLT A;  4DTN A;  1RBT A;  3RRG A;  5FRN A;  3QEX A;  4OPK A;  1IG9 A;  1T7P A;  4M3R A;  1BI4 A;  4FJ5 A;  1LAW A;  1NH2 A;  1QNA A;  5J2M A;  4L8R B;  1BGX T;  4M3X A;  3VQC A;  1O1W A;  3WNG A;  3IRX A;  4DFK A;  1QSL A;  4C8N A;  2KFZ A;  3AA5 X;  3V1Q A;  3V9X A;  4FK4 A;  2JLE A;  4CEF A;  4CK1 A;  3M8S A;  2Z1J A;  4FW1 A;  1E42 A;  2R7Y A;  3HPH A;  1X9W A;  2P5G A;  4KAZ A;  2HHU A;  2G30 A;  2IS3 A;  4NCG A;  3HT3 A;  2FBX A;  2Z1I A;  1C1B A;  3LAK A;  1U4B A;  1A5V A;  4FLX A;  3VQD A;  5DK5 A;  4CEO A;  2IC3 A;  2ETJ A;  4DTX A;  3QO9 A;  1JLF A;  1HQU A;  4W5T A;  4CEA A;  4RG8 A;  4KRE A;  4OGC A;  3M8R A;  3H1Z A;  1WSE A;  1RT1 A;  4B9V A;  3LPT A;  5IYB P;  3P1G A;  1N5Y A;  4K8Z A;  3E01 A;  1VTL E;  3EY1 A;  1D3U A;  3OYA A;  1CXU A;  1W9H A;  1SL0 A;  3FFI A;  1QN3 A;  1BI4 B;  1DTT A;  1KTQ A;  3SPY A;  4KPY A;  3ZSO A;  3QEW A;  2HHT A;  4JS5 A;  5KRT A;  4C8K A;  1QN7 A;  4KFB A;  2RN2 A;  1RNH A;  3WNF A;  4OPJ A;  3I8D A;  3K58 A;  1U48 A;  4DF4 A;  1QN6 A;  3ULD A;  1BIS A;  4XIU A;  5JS1 A;  5FRO A;  1S5J A;  3MXI A;  3DRR A;  5HBM A;  3CFP A;  3O3F A;  1AIS A;  2ITG A;  4AHU A;  2B6A A;  3OYN A;  4CIE A;  3LWL A;  4BDY A;  4ZTF A;  4FJJ A;  2OPS A;  3AVM A;  4CK2 A;  4I9L A;  1W0H A;  3AVF A;  5IYD P;  4KTW A;  3NAE A;  4CJV A;  3DI6 A;  1VSH A;  4CHY A;  4FJL A;  2GBZ A;  2E6L A;  2WON A;  4WE1 A;  2A1S A;  3ITH A;  4N41 A;  3LP1 A;  1C0M A;  1TV6 A;  1C1C A;  3SNN A;  2G8F A;  2RPI A;  2FBT A;  4CJW A;  3K5N A;  1QTM A;  3CM6 A;  1L3T A;  4N76 A;  2IAJ A;  2ATQ A;  3OVN A;  3G10 A;  1X9S A;  4JLH A;  3VQQ A;  2FBV A;  2VJ0 A;  1CZB A;  4IDK A;  4BWJ A;  3C6U A;  2Z8U A;  1U49 A;  4JRP A;  2G8K A;  2HHQ A;  1QSY A;  3KK3 A;  4KRF A;  2ZE2 A;  1JKH A;  3V81 A;  1D9F A;  4OJR A;  2YKM A;  1VSF A;  4OLB A;  3BGR A;  4W5Q A;  1CXQ A;  4M3U A;  3K5O A;  4CFD A;  4DTU A;  3AA4 A;  3NF7 A;  4DS4 A;  1NJZ A;  1WAF A;  1ZBU A;  1Q9Y A;  3SQ2 A;  3AV9 A;  4FJN A;  3AVI A;  3RR8 A;  1KLM A;  4CGF A;  1TBA B;  4CJU A;  1HRH A;  1QHT A;  4RW9 A;  3VA3 A;  4HUG A;  1ZBL A;  4CEB A;  1SL2 A;  3OCI A;  1TGH A;  1RDA A;  3KLI A;  3VQA A;  1VOK A;  3ZSW A;  3ZT4 A;  2FC0 A;  2DFH A;  3VQE A;  5KGX A;  1NKE A;  1QQC A;  2IDO A;  4JS4 A;  2HVH A;  4ICL A;  1QNE A;  4M45 A;  3U3Y A;  5J1E A;  4DFM A;  3K59 A;  1TKT A;  2F8S A;  4CER A;  3LP2 A;  4TSX A;  3TAR A;  4GVM A;  3WNE A;  4UQG A;  3T3F A;  4DQI A;  1S1U A;  4LSN A;  2FBY A;  4AHV A;  1S1W A;  3NDK A;  1QE1 A;  3L2Q A;  4F3T A;  4N5S A;  1VSM A;  1WSF A;  4I7F A;  2YV0 X;  1KYU A;  3KLF A;  3NF8 A;  2MJ7 A;  4DQQ A;  3AO4 A;  3C6T A;  1JL1 A;  3OY9 A;  4HTU A;  2XY6 A;  1BHL A;  1NGM A;  1RBR A;  4CE9 A;  4CJE A;  3KD5 E;  3ZT0 A;  4B9S A;  3QET A;  4KHN A;  3QIN A;  3H08 A;  4B08 A;  3ZSQ A;  3HST B;  4CHP A;  4I9Q A;  1VRU A;  3F9K A;  4ELU A;  2HNY A;  1HMV A;  2GV9 A;  3V1R A;  3JSM A;  3P83 D;  2OZM A;  1KYF A;  1JLG A;  1JXB A;  2YKN A;  1IKY A;  3S9H A;  4Z4I A;  3HS9 A;  3QES A;  1S1V A;  3DM2 A;  3TWH A;  4FJ7 A;  5J2Q A;  3VQP A;  3NH0 A;  3ZSX A;  1J9A A;  2HNZ A;  1R0A A;  1VSK A;  4KB1 A;  4GMJ B;  5CY4 A;  1HPZ A;  1BQM A;  1UA1 A;  2QK9 A;  1EP4 A;  4CGJ A;  1RT2 A;  5K14 A;  3B6P A;  4C8M A;  5D3G A;  3TAF A;  3L2V A;  4W5N A;  4QCL A;  3LP3 A;  2I5J A;  3QER A;  2HHS A;  3IG1 A;  3A2F A;  2OPR A;  2OPP A;  2XRI A;  4CF1 A;  4CIF A;  3NE6 A;  4CGH A;  2O4G A;  4ID5 A;  4CJP A;  5J2N A;  1C1A A;  3PV8 A;  4KI4 A;  3MEG A;  1QN9 A;  3DLR A;  3OJU A;  1B9K A;  3MXJ A;  5HLF A;  2IV9 A;  4LY7 A;  3IAY A;  3TAN A;  3HS8 A;  4CF0 A;  4FM1 A;  2IOC A;  2P51 A;  3HVT A;  4O4G A;  4CHZ A;  3ISN C;  3HP9 A;  1IO2 A;  5DMR A;  3V9U A;  4DMN A;  3LZI A;  3RRH A;  2KZM A;  5KRS A;  2WOM A;  4J2B A;  3V4I A;  1LV5 A;  3TI0 A;  4Z4C A;  1D8Y A;  1Q9X A;  3VQB A;  4CJS A;  2RKI A;  5J2P A;  3ZT3 A;  2X6N A;  2ZQB A;  1QNC A;  4Y1D A;  4AHC A;  4FK2 A;  1VSI A;  3DLG A;  3T19 A;  2YNH A;  3I0R A;  4DQP A;  4DWI A;  3ASM A;  4CJ5 A;  4DSL A;  3LAL A;  3LAM A;  3OYI A;  3SUO A;  1R4X A;  4NCA A;  3OYJ A;  4KO0 A;  4FZY A;  1NK9 A;  4Q0B A;  4M41 A;  3RMA A;  1D5A A;  2OPQ A;  3HK2 A;  3DRP A;  3ZCM A;  1B9F A;  4C8O A;  1C6V A;  2G8V A;  1HQE A;  2D5R A;  3KLG A;  1J5O A;  4O0I A;  4IG3 A;  2DFF A;  4DF8 A;  3RMD A;  3PO5 A;  1F21 A;  1TKX A;  4O0J A;  3WNH A;  4DQR A;  2XY8 A;  1UOC A;  4IFV A;  3TAE A;  1NK8 A;  1KY7 A;  2HMI A;  4M3W A;  2QKB A;  1BQN A;  2X74 A;  1G15 A;  4DTO A;  4CHN A;  1VSJ A;  1NKB A;  3S3O A;  1KFS A;  3ZSY A;  4HCB A;  4KHW A;  4FW2 A;  4QAG A;  4DSF A;  4PA1 A;  4Z4F A;  1XHX A;  3SYZ A;  1S1T A;  4Z4H A;  1TK0 A;  4FLV A;  3MEC A;  3OYM A;  4DS5 A;  4FJX A;  4KHQ A;  1HYV A;  3CM5 A;  5HRR A;  2IV8 A;  2OYQ A;  4ZTJ A;  1NJW A;  4DSK A;  4FZZ A;  1T05 A;  1S1X A;  2Y1J A;  2KTQ A;  1RTH A;  3ALY A;  3ZT2 A;  2IGI A;  4Z4G A;  3U3G A;  3HPO A;  3TAG A;  3U6F A;  3V9S A;  3O4Q A;  4DG1 A;  3NF6 A;  3QNN A;  3HYF A;  4FVM A;  4B9U A;  1TK5 A;  2EX3 A;  3ZT1 A;  1L5U A;  3EZ5 A;  4EZ6 A;  2YNF A;  3L3V A;  1HYS A;  2P5O A;  4BDP A;  3AVJ A;  4FJG A;  2YHA A;  1FKO A;  1RBV A;  2YNG A;  1SKR A;  4CEC A;  3VQ9 A;  1RTD A;  1RDC A;  3D0P A;  3OYF A;  4KTQ A;  4DLE A;  1WLJ A;  1HNI A;  2AJQ A;  2F96 A;  4CHO A;  4RW7 A;  1CLQ A;  3M8Q A;  4O5B A;  5C25 A;  1MU2 A;  1VTO A;  3CQ8 A;  5IYC P;  3MED A;  4EP5 A;  3KLE A;  3C94 A;  1U04 A;  3O3H A;  3KK2 A;  1W80 A;  1FKP A;  1REV A;  3DRS A;  3AVL A;  2VWJ A;  4ZHR A;  3DOK A;  1NKC A;  4OLA A;  4CES A;  1NOY A;  5EU7 A;  4BE0 A;  3EYZ A;  3CFO A;  4KHU A;  1ASU A;  4NYF A;  2E6M A;  3SJJ A;  1YT3 A;  3OS2 A;  3I0S A;  3OYK A;  4CGD A;  3M8P A;  3B6O A;  1GOA A;  5CYM A;  3SV3 A;  1T8E A;  4HVJ A;  4B3O A;  3LDS A;  4FJ8 A;  1JLC A;  4FXD A;  2D0B A;  1RT7 A;  3G0Z A;  3KD1 E;  4CJ4 A;  3V9W A;  4F3O A;  1WSI A;  3AO2 A;  4CFC A;  4J2A A;  1S6P A;  3DLE A;  1KFD A;  2HW3 A;  3P5J A;  4RW6 A;  4RW4 A;  1XI1 A;  1QSS A;  1D9D A;  3LWM A;  4DSE A;  1JLA A;  3LP0 A;  3V1O A;  1A5W A;  1TAU A;  2PZS A;  4FLU A;  3AO3 A;  2BAN A;  4F4K A;  4CJK A;  3AVA A;  3JYT A;  3TAP A;  2B5J A;  1FXX A;  3AA3 A;  4E1N A;  4YFU A;  1GOC A;  3TAB A;  1KLN A;  5CZ1 A;  2QKK A;  4FYD A;  3OYC A;  1QN8 A;  4FLY A;  4DQS A;  1L3U A;  4ELT A;  1ZBI A;  1WAJ A;  1B92 A;  1QS4 A;  5T7B A;  1KYD A;  4F2R A;  4W5O A;  1HYZ A;  3THV A;  3LAN A;  4E7J A;  1QN4 A;  1VSD A;  3T1A A;  1NJY A;  4DU4 A;  4FZX C;  2VG7 A;  3NF9 A;  3HJF A;  3KJV A;  3RTV A;  3OS1 A;  1IKX A;  4J2D A;  1ZBH A;  4AHT A;  3OJS A;  4FJM A;  3AVG A;  3RWU A;  1NK4 A;  2X78 A;  4MFB A;  1N6Q A;  4E7H A;  3HXM A;  4CJQ A;  3DLH A;  5CZ2 A;  4CFB A;  5HP1 A;  3V9Z A;  1BCO A;  4EZ9 A;  1EXQ A;  1LW2 A;  3NHG A;  1XHZ A;  3VQ5 A;  1SV5 A;  1S9E A;  3SPZ A;  1KVB A;  3QIP A;  1J53 A;  4CCH A;  2XY5 A;  1XC9 A;  4DU1 A;  2XY7 A;  2VG5 A;  4E7L A;  1TBP A;  1UA0 A;  3ZSV A;  1IH7 A;  1K6Y A;  3V6D A;  2HVI A;  3QLH A;  1ZBF A;  4PWD A;  1NJX A;  1FK9 A;  4ELV A;  4OKJ A;  1RT3 A;  2EHG A;  1QN5 A;  4J2E A;  3ZSZ A;  4CJR A;  4KHS A;  1LWC A;  5KI6 A;  4IBN A;  1U47 A;  3O3G A;  1Z26 A;  1ZYQ A;  4DSI A;  1QTS A;  1Y97 A;  1NK6 A;  4AHS A;  4ID1 A;  1I39 A;  4FCY A;  3QEV A;  4B9L A;  2DTU A;  1LWE A;  4M42 A;  4FJI A;  4NCB A;  5KTQ A;  1RDD A;  1VK0 A;  2DY4 A;  1YTU A;  4DSJ A;  3OYB A;  1S6Q A;  3AVH A;  1KCF A;  4LSL A;  3O4N A;  1VSE A;  2JGU A;  4G1Q A;  4N56 A;  3DMJ A;  3LZJ A;  3PX6 A;  3TAM A;  3S3N A;  4AIL C;  1BIZ A;  4CJL A;  2A1R A;  3L3U A;  2KFN A;  4BE1 A;  3CFR A;  5HRO A;  3KK1 A;  4E19 A;  5HRN A;  3AVN A;  3QNO A;  5HRP A;  3L2U A;  1YTB A;  1I3A A;  4WZS D;  4PQU A;  3OS0 A;  4HUE A;  3OYE A;  2BDP A;  3AVK A;  1KRP A;  3DLB A;  4CHQ A;  3SV4 A;  1RCH A;  4CED A;  5CYQ A;  3VN5 A;  1X1P A;  4CGI A;  4Z4E A;  3SZ2 A;  1RM1 A;  4LH5 A;  1VOL B;  4HHT A;  2Y1I A;  1U45 A;  4B9T A;  1NOZ A;  4JRQ A;  2RF2 A;  1C0T A;  4GW6 A;  2KQ2 A;  2LSN A;  3NBP A;  1HJR A;  3AO1 A;  4KTZ A;  2W42 A;  3HPG A;  4H8K A;  2G8H A;  1SUQ A;  4DTM A;  4PUO A;  4ROD B;  3VQ6 A;  1QTP A;  3C95 A;  4HCC A;  2DFE A;  1LW0 A;  2HHV A;  1VRT A;  1TL3 A;  4H4M A;  4B8C A;  3UIQ A;  4CF2 A;  3HO1 A;  4DTP A;  4O55 A;  3VQ8 A;  4OGE A;  5I3U A;  1NK5 A;  1TK8 A;  3TAQ A;  3K5L A;  4OKK A;  4CF8 A;  3MAQ A;  1RIL A;  3SI6 A;  1KVA A;  1WN7 A;  5FRM A;  1YVU A;  4Z0U A;  2PYJ A;  4R5P A;  4CFA A;  1BCM A;  1TAQ A;  1PCZ A;  1YTF A;  3NGI A;  4BDZ A;  2D0C A;  3NFA A;  3RMC A;  4F2S A;  3SQ1 A;  4I2Q A;  1VSL A;  4N47 A;  2Z1G A;  1KY6 A;  5JS2 A;  1BL3 A;  4CEQ A;  4CEE A;  4YNQ A;  1NK0 A;  1Z25 A;  3KKR A;  3RMB A;  1TKD A;  4IKF A;  2X6S A;  1JLB A;  4MQ3 A;  2VWK A;  1SKW A;  4FJH A;  1RBU A;  4IG0 A;  3L2W A;  3CYM A;  4ROE B;  2PYL A;  2O4I A;  4CJT A;  2VG6 A;  2YNI A;  1WSG A;  3LPU A;  4PY5 A;  3HM9 A;  4B8A B;  4DTS A;  5HRS A;  3OYD A;  3QEP A;  3AVC A;  1X9M A;  4FM0 A;  4KHY A;  2HHX A;  3VQ4 A;  4DFP A;  3IS9 A;  5E41 A;  4C8L A;  4KB0 A;  4FJ9 A;  4DU3 A;  1TVR A;  4FJK A;  1T03 A;  1PZD A;  3K5M A;  4BWM A;  2PY5 A;  3K57 A;  1GOB A;  1LAV A;  4O44 A;  1WSJ A;  4CJF A;  2GUI A;  3PX4 A;  3SUQ A;  1DLO A;  2D0A A;  1HNV A;  4FM2 A;  4E3S A;  4HUF A;  3PX0 A;  4E0D A;  3SUP A;  3MXM A;  3SCX A;  1SL1 A;  4IFY A;  1QNB A;  1RT4 A;  1TKZ A;  3HVR A;  1S9G A;  4B0A A;  1WSH A;  4LD0 A;  3SUN A;  4B9M A;  1XWL A;  3DLK A;  2YHB A;  1EET A;  2BGG A;  1JL2 A;  1NK7 A;  1JFI C;  1SKS A;  3EIK A;  4Q5V A;  3DYA A;  4E7I A;  1UAX A;  3L8B A;  3DOL A;  3F73 A;  1ASV A;  3MEE A;  3HL8 A;  4I2P A;  1ASW A;  4Y1C A;  1JLQ A;  3KTQ A;  3S3M A;  3VA0 A;  2E4L A;  1RBS A;  4EP4 A;  3NCI A;  1JLE A;  1TGO A;  2Q3S A;  2QXF A;  4E1M A;  1CDW A;  1UWB A;  4AHR A;  3NGZ A;  3D45 A;  1WNS A;  1JXE A;  2OA8 A;  4M3T A;  4DLG A;  3OC3 C;  1ITG A;  3VQ7 A;  4KI6 A;  1KVC A;  3AVB A;  1RDB A;  2HND A;  4ROC B;  3QEI A;  3BDP A;  4FK0 A;  4OVL A;  3L2R A;  3PY8 A;  2F8T A;  1BIU A;  1IKV A;  1B9D A;  1RT6 A;  5C24 A; 
#chains in the Genus database with same CATH topology
 3OSE A;  1L3V A;  4FLW A;  1J54 A;  1LWV A;  1LCU A;  4E7K A;  3TR8 A;  4NYN A;  1C9B B;  2V51 B;  2KZZ A;  3QFP A;  3KLH A;  1NJI O;  1NGE A;  1DTQ A;  1S22 A;  2G8W A;  4W5R A;  5EY4 A;  5I42 A;  3SBG A;  2OZS A;  4DTR A;  2ZD1 A;  1HNW K;  4JI7 K;  3EE9 A;  3QB0 A;  3AA2 A;  4M3Z A;  1EKE A;  3H1V X;  1RTJ A;  3PIP L;  2PFU A;  4CIG A;  4WQ5 C;  4JI0 K;  1IBL K;  2JWL A;  3A5M C;  2QA4 N;  1C0U A;  3PO4 A;  4K8X A;  1CZ9 A;  1RBT A;  4GVE A;  1IG9 A;  2YI1 A;  4H0X B;  1LAW A;  3MMV A;  4BC2 A;  2IIR A;  1KQS M;  3O08 A;  3WNG A;  5M1K A;  4C8N A;  3TTD A;  1HR0 K;  4CEF A;  1X9W A;  5HSH A;  2G30 A;  2IS3 A;  2FBX A;  2Z1I A;  1KC8 O;  4CEO A;  4HWI A;  4RG8 A;  4KRE A;  3M8R A;  2P9S B;  1N5Y A;  1VTL E;  1D3U A;  1CXU A;  3ENC A;  3GBT A;  4A61 A;  4JK7 A;  3WNF A;  3K58 A;  1U48 A;  2CGK A;  3R3L A;  3IDH A;  2D4W A;  4CZK A;  1RDW X;  3F0Z A;  3O3F A;  1AIS A;  3LWL A;  4AHU A;  1NK5 A;  1NNE A;  4CIE A;  3LDO A;  4LF7 K;  1PVS A;  3AVM A;  1HKG A;  3QBX A;  4CK2 A;  2D0O A;  5IYD P;  2WFB A;  4KTW A;  4B3T K;  3C04 A;  4NO7 A;  1N33 K;  3LP1 A;  2ASP A;  3K5N A;  1YF5 L;  4N76 A;  1X9S A;  4JLH A;  3P38 A;  1CZB A;  2A6A A;  4H5W A;  4IDK A;  2HHQ A;  1QSY A;  2ZE2 A;  4YY3 K;  4Y0W A;  5F9C A;  2WUS A;  2CGJ A;  3AVI A;  4H0O A;  1TBA B;  3VA3 A;  3A5O C;  1NMD A;  4H0T B;  1ZBL A;  4K0K K;  1SL2 A;  3ZSW A;  3ZT4 A;  4YOR A;  3F9M A;  2FC0 A;  4DFM A;  3DWL A;  3LP2 A;  4YOY A;  2QEX N;  4UQG A;  2FBY A;  4F3T A;  1QE1 A;  1VSM A;  2YV0 X;  1KYU A;  4EAK A;  4DR1 K;  3CJB A;  1NGM A;  1M3Q A;  3KWI A;  3VGL A;  1IJJ A;  4CE9 A;  3ZT0 A;  3QET A;  1ATN A;  4B08 A;  4LF8 K;  3F2K A;  3ZSQ A;  3HST B;  3JSM A;  1KYF A;  2YKN A;  1IKY A;  3GDQ A;  4KH5 A;  1S1V A;  2OAN A;  3TWH A;  4MDB A;  4AF1 A;  4B1Y B;  1J9A A;  1YI2 N;  1R0A A;  3CXC M;  1VQ9 N;  5EPC A;  3CC7 N;  4MRQ A;  5K14 A;  2Z0F A;  1X9J A;  2QWR A;  3IFR A;  4W5N A;  4QCL A;  3QER A;  2HHS A;  4C23 A;  3IG1 A;  3P4I A;  2XRI A;  3U9D A;  1Q9U A;  3MEG A;  2V7Y A;  3OJU A;  2HBJ A;  1B9K A;  2KHO A;  5HLF A;  1OH7 A;  1YUW A;  2P51 A;  1QQM A;  2D0P A;  3ISN C;  3WXL A;  3HP9 A;  3VER A;  5KRS A;  3PSF A;  3TTC A;  3V4I A;  1D8Y A;  1Q9X A;  3VQB A;  5J2P A;  2RKI A;  4AHC A;  3TDH A;  2AP1 A;  3DLG A;  4EHU A;  2YNH A;  3SUO A;  1R4X A;  4LF6 K;  3OYJ A;  2P9N B;  1D5A A;  2OPQ A;  4C8O A;  1NGA A;  4IEE A;  1J5O A;  1NGI A;  5LMN K;  3RMD A;  3PO5 A;  1F21 A;  4O0J A;  4DQR A;  3OST A;  4IFV A;  3SAH A;  3TAE A;  2HZM A;  2QKB A;  1G15 A;  1BA1 A;  4BRK A;  4CHN A;  4DTO A;  1VSJ A;  1NKB A;  1KFS A;  2A5X A;  5AQU A;  4Z4F A;  1XHX A;  1S1T A;  4ISG A;  2P9K A;  2NZT A;  4FZZ A;  2IV8 A;  1T05 A;  5BRF A;  3ALY A;  3U3G A;  3HPO A;  3TAG A;  1VQL N;  3CMA N;  3V9S A;  4IL8 A;  3T7Z A;  1HYS A;  2P5O A;  2YHA A;  4DHY A;  1FKO A;  1MWK A;  2NRT A;  4B1V A;  4DR2 K;  1SKR A;  2ZJQ L;  4V19 S;  2FF6 A;  1MA9 B;  1WLJ A;  1JDY A;  2F96 A;  1CLQ A;  2P9K B;  4O5B A;  4EP5 A;  1HJO A;  4BR0 A;  2NWV A;  3AVL A;  4ZHR A;  3J7A P;  2OTJ N;  5EU7 A;  3MDQ A;  2YHY A;  4FWS A;  1X3M A;  4CZL A;  4NYF A;  2QWQ A;  5M1F A;  3OS2 A;  5FRM A;  4CGD A;  4CZJ A;  4B3O A;  1GOA A;  5CYM A;  1T8E A;  3LDS A;  4FJ8 A;  3D2F A;  1QZ6 A;  3CWA A;  1RT7 A;  4CJ4 A;  2A40 A;  4J2A A;  4BGA A;  1S6P A;  3VEY A;  2HW3 A;  3THW A;  5FPM A;  1TAU A;  5JIC A;  1JLA A;  1XC3 A;  1GLD G;  4B3S K;  4HTL A;  4CJK A;  4BRH A;  3D7Q A;  3OH9 A;  2HF3 A;  3VEN A;  3AA3 A;  4MO5 A;  1HKC A;  5CZ1 A;  1XNQ K;  4BVP A;  4FLY A;  1ZBI A;  4GY2 B;  5T7B A;  4F2R A;  3H1Q A;  1QN4 A;  1VSD A;  5AQN A;  1M3H A;  1FN7 A;  2HOE A;  3ULX A;  1ZBH A;  3AGR A;  3OJS A;  3THW B;  3CQX A;  4FJM A;  4H0V B;  3HSC A;  3ENO C;  4CJQ A;  2Q0U A;  1YAG A;  5AZJ B;  5CZ2 A;  4CFB A;  3V9Z A;  3BF1 A;  4EZ9 A;  1XHZ A;  1SV5 A;  3SPZ A;  1T6D A;  2XY7 A;  1NU0 A;  2ZM6 K;  1IH7 A;  2HVI A;  4EIA A;  4PWD A;  1FK9 A;  4ELV A;  2ZWH A;  4OKJ A;  2EHG A;  5EX5 A;  1OH6 A;  5AQY A;  3SNS A;  1LWC A;  1U47 A;  1XQS C;  4B9Q A;  1Y97 A;  4FCY A;  2DTU A;  1OH8 A;  3OBY A;  4ILH A;  1OKJ A;  2AA4 A;  4NCB A;  2O8B A;  1QVF M;  2E88 A;  1YTU A;  1S6Q A;  3AVH A;  3NVM A;  2HMP A;  3FLC O;  1U6Z A;  3TAM A;  4YHH K;  4BRI A;  3CPW M;  1QHA A;  4AIL C;  4MLH A;  4NB4 A;  4CBU A;  2VGN A;  4KBO A;  4YOT A;  3L4Q A;  4KH4 A;  5HRP A;  3L2U A;  4PHT X;  4WZS D;  3OS0 A;  3OYE A;  4FWP A;  3DLB A;  5BMN A;  4CBX A;  4YOU A;  2QTD A;  1RCH A;  3VN5 A;  2CH6 A;  5A2Q O;  1M5Q 1;  3R6M A;  1U45 A;  2NLX A;  4GW6 A;  2G8H A;  1HJR A;  1KD1 O;  3HI0 A;  1DIZ A;  4H8K A;  1SUQ A;  4DTM A;  3VQ6 A;  1QTP A;  5AR0 A;  2DFE A;  2HHV A;  4H4M A;  3WUH A;  3UIQ A;  4B1U B;  3HO1 A;  2J4R A;  5I3U A;  4O55 A;  2NRZ A;  4OKK A;  1RIL A;  1KVA A;  1YQR A;  3I33 A;  5KQD A;  1BCM A;  3CME N;  1YHQ N;  3NGI A;  4YOV A;  2P9L A;  1ZC6 A;  1J5E K;  4I2Q A;  1N3C A;  3CCL N;  4N47 A;  1KY6 A;  2DKA A;  4CEQ A;  4IKF A;  1TKD A;  2X6S A;  1JLB A;  4FJH A;  2WC9 A;  2FXU A;  3N4P A;  4DTS A;  3QEP A;  5HRS A;  3AVC A;  5E41 A;  1XSZ A;  4H5V A;  4FJK A;  1T03 A;  1C47 A;  4BWM A;  2PY5 A;  1LAV A;  4CI6 A;  2O8D A;  2P9L B;  2ASM A;  3PX4 A;  1DLO A;  2FF3 B;  4E3S A;  3D4V A;  3PX0 A;  4JYA K;  3SUP A;  1SL1 A;  1RT4 A;  3H46 O;  1TKZ A;  3HVR A;  1S9G A;  4RTF D;  4B0A A;  1WSH A;  4B9M A;  1N32 K;  3VPZ A;  3DLK A;  5KQ8 A;  2F7T A;  5EVZ A;  2BGG A;  1JL2 A;  3MCA B;  2F9W A;  1SKS A;  3EIK A;  1S3X A;  2UXD K;  3L8B A;  3F73 A;  4XH5 A;  1K8K A;  3HL8 A;  3CCM N;  2O8D B;  4Y1C A;  3KTQ A;  3SMS A;  3WXJ A;  4WFN L;  3S3M A;  3G4S N;  1RBS A;  3VF6 A;  4AHR A;  3D45 A;  1JXE A;  5AQQ A;  5BN8 A;  4KI6 A;  4KHW A;  5GIO A;  2HND A;  1RT6 A;  3NGY A;  1LWF A;  4CF9 A;  4EFH A;  2G8I A;  3DAW A;  5FPD A;  2WBN A;  2O8F A;  1IKW A;  4KV8 A;  3M6G A;  4B9N A;  1Q8I A;  1K8K B;  4FWQ A;  4E89 A;  4DFJ A;  4CK3 A;  1VQ8 N;  2HKP A;  4LF4 K;  3I8B A;  4JI8 K;  4M3Y A;  4FL9 A;  4BR7 A;  3W0L A;  2IVP A;  2YHX A;  2BE2 A;  2VQF K;  3KIO A;  5SWM A;  4IO9 L;  3SBT A;  1Q18 A;  4H4O A;  1YTA A;  1L3S A;  5FDL A;  2HHW A;  2QWN A;  3U8X A;  1A5X A;  2UUA K;  4CEZ A;  3MCP A;  1EX4 A;  4IZ9 A;  3SQ0 A;  2Z1H A;  3RR7 A;  3RRG A;  4ILG B;  4WCE L;  1U2V B;  3THY B;  3G71 N;  1NH2 A;  4DFK A;  3IRX A;  3R8E A;  4JI3 K;  3KWG A;  4KAZ A;  1RDU A;  2QLV A;  4NCG A;  3LAK A;  1A5V A;  2ETJ A;  5C2F A;  5AQZ A;  4W5T A;  3JS6 A;  4IEI A;  1YJ9 N;  4K8Z A;  3H1Z A;  4B9V A;  3P1G A;  3C6H A;  3E01 A;  3A0I X;  3WEE B;  2QWO A;  3EY1 A;  1SL0 A;  4KPY A;  4C8K A;  5KRT A;  3FGU A;  2E1Z A;  4FWO A;  3ZEU B;  2RN2 A;  1RNH A;  4OPJ A;  1BIS A;  4XIU A;  2E2P A;  5FRO A;  5HBM A;  2ITG A;  1EWR A;  4IJN A;  2B6A A;  3OHR A;  3VGK A;  2NRR A;  3E9P A;  4H0Y B;  1GLL O;  2BH1 A;  1W0H A;  4ISF A;  3HTV A;  4CJV A;  3DI6 A;  4C1N I;  4CHY A;  4FJL A;  2E6L A;  2WON A;  4WE1 A;  2A1S A;  4N41 A;  2KLA A;  3KVG A;  1C1C A;  1TYQ A;  3SMP A;  2IAJ A;  5LY3 A;  4BRL A;  4LFC K;  3VQQ A;  2VJ0 A;  1UL7 A;  3C6U A;  4WQ5 A;  2A41 A;  4JRP A;  1M1K O;  2G8K A;  2A3Z A;  3KK3 A;  2XHI A;  3V81 A;  1D9F A;  2JHN A;  4OLB A;  2YKM A;  2NVM A;  1CXQ A;  4M3U A;  4CFD A;  4DTU A;  4JKH A;  3O1B A;  1NJZ A;  3SQ2 A;  1KLM A;  1HRH A;  4RW9 A;  3IH7 A;  1NWK A;  3VTI A;  3OCI A;  1RDA A;  3VQA A;  4ISE A;  2DFH A;  3VQE A;  1NKE A;  1ZXO A;  4X62 K;  4EAH D;  2HVH A;  3CCQ N;  4ICL A;  1QNE A;  2V9J A;  1VAZ A;  1PCJ X;  1TKT A;  3K59 A;  4CER A;  2F8S A;  4TSX A;  2I7P A;  4B3R K;  4DQI A;  3VET A;  5AQH A;  1OVY A;  4DQQ A;  3NF8 A;  2MJ7 A;  3CQY A;  4WFB L;  3THX A;  3OY9 A;  1RBR A;  3OH6 A;  4CD1 A;  2VCP A;  3KD5 E;  1W2B M;  3W3D A;  3BZC A;  3H3O B;  4H5R A;  3S9H A;  1JXB A;  4DV4 K;  1J3M A;  5C15 A;  3ZSX A;  1VQO N;  4KB1 A;  1HPZ A;  1BQM A;  2DPN A;  3THX B;  2QK9 A;  3CCU N;  3FZF A;  3B6P A;  4PKI A;  5AQF A;  4C8M A;  3TAF A;  3L2V A;  1D4X A;  4M7Y A;  3LP3 A;  5DM7 L;  1OH5 A;  3D2E B;  1LWW A;  1LXT A;  1C1A A;  1QN9 A;  3DLR A;  2IV9 A;  3J7Z O;  3IAY A;  4PKG A;  1KAY A;  2P9S A;  2MZ8 A;  2P9I B;  4O4G A;  1MPG A;  2HL9 A;  1BU6 O;  4GV9 A;  1IO2 A;  2KZM A;  3MX2 A;  1OVQ A;  3FE1 A;  2P9P B;  4Z4C A;  4CJS A;  4QS9 A;  1ILY A;  3ZT3 A;  3J81 O;  1ATR A;  4FK2 A;  1VSI A;  5AZI B;  3T19 A;  4DQP A;  4BQL A;  4BRG A;  1NK9 A;  3EO3 A;  5KPT A;  3ENB A;  2I5W A;  1C6V A;  2G8V A;  3KLG A;  4IG3 A;  4DF8 A;  2VWB A;  2NRW A;  1LV5 A;  3WNH A;  3NVK A;  2XY8 A;  4M3W A;  1BQN A;  4B1W B;  1YJW N;  4BRP A;  2R5X A;  3EE8 A;  3T1H K;  4FJX A;  2OYQ A;  5HRR A;  5AQO A;  4DSK A;  4O8U A;  1S1X A;  3O9R A;  4M7X A;  3UW2 A;  3U4L A;  1TK5 A;  1L5U A;  1BWF O;  4FO0 A;  4BC4 A;  1Q81 O;  1NGF A;  3MN9 A;  3LM9 A;  4CEC A;  4BC5 A;  1RDC A;  3D0P A;  1HNI A;  2AJQ A;  1MU2 A;  1VTO A;  3O9T A;  4QS7 A;  3MED A;  5KL0 A;  4JNE A;  3KLE A;  4YOX A;  3C94 A;  1U04 A;  4PKH A;  1FKP A;  4CJ7 A;  4H0P A;  3DRS A;  3DOK A;  3SLC A;  3EYZ A;  2E6M A;  1Q7Y O;  3LDL A;  4CZH A;  4R79 A;  3O6W A;  3OBW A;  3KD1 E;  3V9W A;  3ZX0 A;  4FSV A;  5E26 A;  4D7R A;  3P5J A;  4RW6 A;  1XI1 A;  4CZE A;  1N39 A;  2PZS A;  3N89 A;  3AAQ A;  3MN7 A;  2GEL A;  1BA0 A;  5AQS A;  1HU0 A;  3VES A;  2OCE A;  1KLN A;  1DKG D;  3O5B A;  3TAB A;  4FYD A;  4DR3 K;  1QN8 A;  3E66 A;  1L3U A;  1WAJ A;  1B92 A;  3WXI A;  1KYD A;  4W5O A;  1HYZ A;  4OPH A;  4E7J A;  3T1A A;  1NJY A;  1QZ5 A;  4FZX C;  3NF9 A;  3HJF A;  3OS1 A;  2F7L A;  3RWU A;  1NK4 A;  1DGK N;  4MFB A;  4BR5 A;  4K41 A;  3HOS A;  3KTU A;  1BCO A;  4JI1 K;  3UKU B;  1GLA G;  3VQ5 A;  1S9E A;  4CCH A;  3CI5 A;  2XY5 A;  2ZGY A;  2V8Q A;  3IMX A;  1DEJ A;  3G25 A;  3ZSV A;  2ZJP L;  3N4Q A;  2D1K A;  3I0X A;  2P9N A;  1WB9 A;  4B1Z A;  3I55 N;  4J2E A;  3ZSZ A;  4PL8 A;  4U67 L;  3HM8 A;  1ZYQ A;  4DSI A;  1QTS A;  3CIP A;  3FZL A;  3QEV A;  2LAE A;  4NLC A;  1LWE A;  4M42 A;  4AM6 A;  4NXM K;  2JGU A;  4CBW A;  3LZJ A;  1E3M A;  1YQK A;  3O9S A;  2JWK A;  3S3N A;  2A1R A;  2KFN A;  5HRO A;  3QNO A;  4PQU A;  1E4G T;  3SK3 A;  3I3W A;  4ILJ A;  1N36 K;  3AVK A;  2KKZ A;  2QWL A;  3TPQ A;  4DR7 K;  4AM7 A;  1RM1 A;  1BO5 O;  4LH5 A;  2Y1I A;  1NOZ A;  2RF2 A;  1C0T A;  2HBL A;  2W42 A;  3NBP A;  2Q36 A;  3HPG A;  3ENO A;  4DV5 K;  4JK9 A;  3PDK A;  3TSU A;  1LW0 A;  3AAP A;  4BVO A;  3VQ8 A;  4G9Z A;  2UYT A;  3MAQ A;  5M1P A;  4Z0U A;  5AQT A;  1RFQ A;  1TAQ A;  4CFA A;  3ATU A;  1PCZ A;  1YTF A;  3OTO K;  1VSL A;  4IFE A;  4JKG B;  5JS2 A;  3MWP A;  2VWK A;  5DM6 L;  3VEZ A;  3CYM A;  4CJT A;  4WF9 L;  4PY5 A;  4B8A B;  1X9M A;  4FM0 A;  4DFP A;  1ZBS A;  4XH1 A;  4A59 A;  4KB0 A;  5AQM A;  3ID6 A;  1TVR A;  1G99 A;  3HOT A;  1GOB A;  4CZI A;  1VQ7 N;  3EKS A;  3J7Y P;  3E1Y A;  2D0A A;  4MDA A;  2YJE A;  4HUF A;  2QRD A;  3DXK B;  5AZJ A;  4JKC A;  3VMF B;  3HBT A;  2YJF A;  5JMV A;  4BRO A;  1PCM X;  3F10 A;  3DOL A;  4I2P A;  1ASW A;  4IOA L;  2HBK A;  3J8A A;  3VA0 A;  1JLE A;  1CDW A;  2OA8 A;  3NGZ A;  4M3T A;  5BRE A;  3VQ7 A;  2RHK A;  1RDB A;  4ROC B;  3PY8 A;  1IKV A;  5C24 A;  1RT5 A;  2KW4 A;  5HOO A;  3CWT A;  3CJ1 A;  1GLC G;  4FPA A;  2XO7 A;  2Y8L A;  4LFB K;  2NUB A;  4LH4 A;  2NRV A;  4RW8 A;  2UXC K;  4X66 K;  2E5L K;  4BE2 A;  2HB5 A;  2E2N A;  3PLA A;  4YDU C;  5TKY A;  3SQ4 A;  4DTJ A;  4BAC A;  3OYH A;  3CVT A;  4BRE A;  1TL1 A;  1NG9 A;  1RTI A;  1T44 A;  2QWP A;  3CG7 A;  3PUF A;  2FSN A;  5KGW A;  3MK6 A;  5LJW A;  2P1J A;  3NH2 A;  1BUP A;  3E9L A;  1UT4 A;  4KKO A;  2JOI A;  5JMV D;  4CJ3 A;  5FRN A;  4FLZ A;  4EHT A;  3QEX A;  1P5G X;  3VF2 A;  1T7P A;  4DV7 K;  4M3R A;  1BI4 A;  4FJ5 A;  5J2M A;  4L8R B;  1BGX T;  1V4S A;  3UB5 A;  3V1Q A;  3V9X A;  4FK4 A;  2KFZ A;  2P5G A;  4CK1 A;  2BUP A;  2Z1J A;  1E42 A;  2R7Y A;  3DLL L;  1KXP A;  2YH5 A;  3A5L C;  2HL8 A;  4DR5 K;  3VQD A;  4OPA A;  4DTX A;  3QO9 A;  1HQU A;  4CEA A;  3QBW A;  1WSE A;  1RT1 A;  3OYA A;  1W9H A;  3FFI A;  1QN3 A;  1BI4 B;  3A8Y A;  5FPN A;  3SPY A;  3ZYY X;  3ZSO A;  3QEW A;  2QRC A;  5AQI A;  3BUZ B;  4EJY A;  4JN4 A;  3I8D A;  4DF4 A;  3CJA A;  3IUC A;  4JEP A;  5AJ3 K;  1NLV A;  4LF5 K;  4GKJ K;  3OYN A;  4ZTF A;  4FJJ A;  1HX1 A;  5AQV A;  4BDY A;  4Z94 A;  4I9L A;  3NAE A;  2OOX A;  1K9M O;  1VSH A;  3QFU A;  3ITH A;  1C0M A;  3U9Z A;  3SNN A;  1HNX K;  2G8F A;  2RPI A;  4CJW A;  5BPN A;  3CM6 A;  1Z6R A;  1L3T A;  3ZLJ A;  2ATQ A;  3RSM A;  3G10 A;  5KPZ A;  4B3M K;  2FBV A;  1WBB A;  2QRE A;  2Z8U A;  1NM1 A;  2NOF A;  1VSF A;  3BGR A;  4W5Q A;  5GAH P;  3NF7 A;  3AAR A;  4JK8 A;  2FKM X;  4FJN A;  1Q9Y A;  2ZF5 O;  3RR8 A;  1W7A A;  4CJU A;  4FOI A;  2NOE A;  1WUA A;  4CEB A;  4JKF A;  3KLI A;  2F9T A;  4WQ4 C;  1GLB G;  5KGX A;  1QQC A;  4JS4 A;  4YOW A;  4M45 A;  5J1E A;  3WNE A;  5C10 A;  2DKD A;  1S1U A;  4LSN A;  3LDN A;  5AQL A;  4AHV A;  1S1W A;  2NOB A;  2VYP A;  3L2Q A;  3NDK A;  1E4F T;  1UT7 A;  1WSF A;  4I7F A;  1IBM K;  3KLF A;  3P39 A;  3AO4 A;  2HBM A;  4HTU A;  3KZB A;  1BHL A;  5CE3 A;  4B9S A;  3CHW A;  3G6E N;  1EUV A;  4KHN A;  3H08 A;  1VHX A;  4CHP A;  4I9Q A;  1VRU A;  2HNY A;  1HMV A;  3V1R A;  2O8C B;  3H6E A;  1JLG A;  4Z4I A;  3HS9 A;  3QES A;  3DM2 A;  3VQP A;  3NH0 A;  3M5R A;  3CD6 N;  1VSK A;  1U2V A;  5CY4 A;  3THY A;  1EP4 A;  2P9U B;  4J8F A;  4I6M A;  3FZM A;  5D3G A;  3SAG A;  1N3A A;  3GOI A;  4JI5 K;  1YQM A;  1SZ2 A;  4H5T A;  4CF1 A;  2OPR A;  2OPP A;  3OA9 A;  3HRG A;  4GKK K;  4BJU A;  4CJP A;  5J2N A;  3PV8 A;  4KI4 A;  5B8H A;  1YXQ A;  3CCV N;  3MXJ A;  4LY7 A;  2HST A;  4JI4 K;  4CF0 A;  3WEE A;  4FM1 A;  4A57 A;  3VGM A;  5DMR A;  3V9U A;  1XUP O;  3LZI A;  3ZEU A;  4I6M B;  4OO1 J;  3CWS A;  2WOM A;  4J2B A;  3TI0 A;  4I8O A;  4JKE A;  2X6N A;  4GNI A;  1R59 O;  1J6Z A;  2VQE K;  2H5A X;  5FLX O;  4DWI A;  5M1Q A;  4DSL A;  1P8Z A;  3LAL A;  3LAM A;  4KO0 A;  4CFF A;  4M41 A;  4DR6 K;  4BRQ A;  3HK2 A;  2IVO A;  3OW2 M;  4O0I A;  4JD2 A;  1TKX A;  1NK8 A;  2Y8Q A;  1UOC A;  4HJH A;  1EWQ A;  1KY7 A;  2X74 A;  4MLE A;  1P90 A;  4FVU A;  2PAV A;  3S3O A;  3ZSY A;  4FW2 A;  1BG3 A;  4DSF A;  4PA1 A;  3H3N O;  4X64 K;  1NGH A;  1TK0 A;  4DV0 K;  4KHQ A;  2YA3 A;  2Y1J A;  3ZT2 A;  3C6A A;  4C1N K;  4Z4G A;  3O4Q A;  4DG1 A;  3NF6 A;  3QNN A;  4FVM A;  1GLF O;  4B9U A;  2FSJ A;  3CET A;  4EZ6 A;  1KAZ A;  4JD2 B;  4CZG A;  1BOT O;  4BDP A;  1N34 K;  4FJG A;  1JCE A;  3T69 A;  1NMN A;  2YCH A;  4H03 B;  4L3Q A;  2CH5 A;  4KTQ A;  4DLE A;  3MN6 A;  3VEW A;  5JN5 A;  3DPT A;  2GUP A;  5C25 A;  3I0W A;  5GIN A;  3CQ8 A;  3DPU A;  1VQN N;  2Q31 A;  3KK2 A;  1W80 A;  2VWJ A;  4EJZ A;  4BE0 A;  1NOY A;  5AQR A;  4A2A A;  3PMG A;  3C7N B;  1QVG M;  4KHU A;  4BR9 A;  3SJJ A;  4PL7 A;  2H3G X;  3I0S A;  3M8P A;  3B6O A;  4HVJ A;  5BPM A;  3TE5 A;  1JLC A;  4FXD A;  2D0B A;  3VEX A;  1WSI A;  3AO2 A;  3L0Q A;  1MWM A;  2ZFD B;  5AN4 A;  4DCH A;  1QSS A;  4DSE A;  3V1O A;  5GAE P;  4F4K A;  4F9O A;  3RSE A;  3D2E A;  5ADX A;  3JYT A;  3TAP A;  2B5J A;  1FXX A;  4E1N A;  4BRM A;  1GOC A;  3OYC A;  4DB3 A;  4WX8 A;  4ELT A;  1QS4 A;  3C65 A;  2P9I A;  2E2O A;  4DU4 A;  1GLE G;  3KJV A;  2QM1 A;  4D7Q A;  4AHT A;  3FFK B;  3RVC A;  3UKR B;  2P9P A;  2Q97 A;  1N6Q A;  4IO8 A;  4E7H A;  1JCG A;  3DLH A;  1EXQ A;  3RSE B;  4WFA L;  3NHG A;  4RCH A;  3S41 A;  1P5D X;  2O8E B;  4NLB A;  1KVB A;  3QIP A;  3IKM A;  5AZI A;  4DU1 A;  1BDG A;  1VQK N;  2VG5 A;  4E7L A;  1UA0 A;  1DT9 A;  4DUL A;  1K6Y A;  3OSM A;  1IV0 A;  1ZBF A;  5F1X A;  1TUO A;  3QDK A;  3EKU A;  2W41 A;  1RT3 A;  5BR9 A;  1QN5 A;  1GLJ O;  4KHS A;  4IBN A;  2QW9 A;  3TU5 A;  3O3G A;  1Z26 A;  3VEO A;  1WBD A;  1HNZ K;  4IDH A;  1NK6 A;  3EEQ A;  5HL7 L;  4B9L A;  2NLV A;  1TUY A;  4FJI A;  1VQM N;  1RDD A;  1VK0 A;  4EAJ A;  3Q7C A;  3OYB A;  4K43 A;  4LSL A;  1VSE A;  4N56 A;  3PX6 A;  3WQU A;  3QML A;  3D7E O;  4BE1 A;  4BG8 A;  3KK1 A;  5HRN A;  3AVN A;  3CWU A;  4BR2 A;  1MDU B;  1HKB A;  1V4T A;  1SQK A;  1KRP A;  2QI2 A;  4CHQ A;  2UXB K;  3FR0 A;  4CGI A;  1V5S A;  3ULE A;  4HHT A;  2EHB D;  1K8A O;  4JHD A;  4JRQ A;  2QR1 A;  4KTZ A;  2LSN A;  3AO1 A;  3NMU A;  4HCC A;  4FWR A;  3ZET A;  5BMP A;  1TL3 A;  1VRT A;  4CF2 A;  4BY9 C;  4DTP A;  4U7B A;  3TAQ A;  1VQ6 N;  2PYJ A;  1C4G A;  1Y64 A;  1M90 O;  4BDZ A;  2D0C A;  3NFA A;  3SQ1 A;  3LL3 A;  1BL3 A;  4YNQ A;  3ULE B;  4CEE A;  3RMB A;  4JHD B;  4MQ3 A;  1SKW A;  1XMO K;  2FLO A;  2HF4 A;  1WSG A;  3LPU A;  5JVG L;  3HM9 A;  3OYD A;  3T1Y K;  3ZET B;  3IS9 A;  4H5N A;  4C8L A;  4FJ9 A;  3K5M A;  3WXM B;  5BPL A;  1C0F A;  1QQN A;  5BRH A;  3GL1 A;  4O44 A;  1WSJ A;  4FM2 A;  1HNV A;  1IG8 A;  4E0D A;  5IT9 O;  5JLF A;  3MXM A;  2JPI A;  1KO9 A;  1QNB A;  3WT0 A;  5LMU K;  2V92 A;  2OTL N;  3UKU A;  2NNW A;  3T4N A;  1XWL A;  1EET A;  2GWJ A;  3VTH A;  1JFI C;  2NOL A;  2W6L A;  4E7I A;  3OLP A;  5JLH A;  2DKC A;  3DXM A;  4CZF A;  1ASV A;  4OX9 K;  1JLQ A;  1O13 A;  5GAG P;  2E4L A;  3VEV A;  4E1M A;  4O5F A;  2ITM A;  4DLG A;  3OC3 C;  4WYB A;  1KVC A;  3AVB A;  3BDP A;  2F8T A;  5FPE A;  3L2R A;  1B9D A;  5C2D A;  3MX5 A;  3HP6 A;  3NH1 A;  3AO5 A;  1KSP A;  3KKS A;  4QOZ B;  5C42 A;  2NOZ A;  4F8R A;  4AH9 A;  3DXM B;  4OKE A;  2B4J A;  1ESV A;  3ZSR A;  2EWS A;  2FUV A;  1MP9 A;  4CGG A;  2XHB A;  3O1W A;  2H4L X;  2QWM A;  5SZT A;  1NGD A;  3OYL A;  4DV3 K;  3ZX2 A;  1JJ2 M;  4X65 K;  2Q0R A;  1XMQ K;  3QIO A;  3K2P A;  3EN9 A;  4A2B A;  3OYG A;  3WQT A;  1RGI A;  2G8U A;  1X3N A;  3UE5 A;  1NVP A;  4FLT A;  4DTN A;  1NGG A;  4IOC L;  4OPK A;  4UY8 O;  3O4W A;  1QNA A;  1Z05 A;  4DUY K;  4M3X A;  3VQC A;  1O1W A;  4FWL A;  1QSL A;  3AA5 X;  2JLE A;  3M8S A;  4FW1 A;  2HHU A;  2E8A A;  3EL2 A;  3HPH A;  4K42 A;  2A42 A;  3HT3 A;  1C1B A;  1U4B A;  5F0X A;  4FLX A;  4JKG A;  5DK5 A;  2IC3 A;  5CR4 A;  1JLF A;  1VQ4 N;  4OGC A;  3LPT A;  5IYB P;  3BEX A;  3TTF A;  1DTT A;  2HHT A;  1KTQ A;  5M1N A;  3ID8 A;  4JS5 A;  1QN7 A;  4KFB A;  3BKQ X;  1QN6 A;  3ULD A;  5JS1 A;  3MXI A;  1S5J A;  3DRR A;  3AY9 A;  2RE2 A;  3CFP A;  3CCR N;  2OPS A;  2YHW A;  1QQO A;  3AVF A;  4CW7 B;  3DXK A;  2GBZ A;  3OGD A;  4YDU A;  5GIP A;  1TV6 A;  4IJA A;  2FBT A;  1QTM A;  3GE1 A;  3OVN A;  4DKW A;  5BN9 A;  5AQP A;  2ZJR L;  4IWV A;  1FJG K;  4BWJ A;  1U49 A;  3AGK A;  4KRF A;  1JKH A;  4EAG A;  4OJR A;  3K5O A;  3BP8 A;  3AA4 A;  5EOY A;  4DS4 A;  3JXU A;  1WAF A;  1ZBU A;  3ENH A;  3AV9 A;  4CGF A;  4BGB A;  4JI6 K;  2UUB K;  1QHT A;  4HUG A;  5CHI A;  1TGH A;  5AFU H;  1VOK A;  4RWT A;  1IBK K;  3CCS N;  1HUX A;  4A5B A;  3TSP A;  2IDO A;  3U3Y A;  3M1F A;  2O3O A;  3TAR A;  1LOT B;  1T3V A;  4GVM A;  3KHY A;  2HZS A;  1SAZ A;  3T3F A;  3KK7 A;  4B1X B;  5M1O A;  4JKA A;  4N5S A;  3C6T A;  1JL1 A;  2XY6 A;  3TSQ A;  4CJE A;  3CJ9 A;  3R1X A;  5E84 A;  3QIN A;  3F9K A;  1CZA N;  3RPJ A;  2VGM A;  2GV9 A;  4FWN A;  4ELU A;  3P83 D;  2OZM A;  4FWK A;  3BY5 A;  3O9U A;  4FJ7 A;  4JAX A;  5J2Q A;  4CD3 A;  3MWT A;  2HNZ A;  1I94 K;  3D2F B;  4GMJ B;  1UA1 A;  4CGJ A;  3L4I A;  1RT2 A;  3B8A X;  1NGC A;  2ASO A;  1H1V A;  2E1Y A;  5F2R A;  2I5J A;  4LFA K;  4XH4 A;  3A2F A;  4CIF A;  3NE6 A;  4CGH A;  4QS8 A;  2O4G A;  5MLC Q;  3BZK A;  4ID5 A;  5LL6 Z;  1YIT N;  1TUU A;  1WJW A;  3TAN A;  3HS8 A;  4GV6 A;  4QG5 A;  1LWY A;  2IOC A;  3HVT A;  2WTU A;  4CHZ A;  4WQ4 A;  5TKW A;  4JI2 K;  3CF5 L;  4K25 A;  4DMN A;  3RRH A;  1WOQ A;  3LDP A;  4M63 C;  2V7Z A;  1S72 N;  2ZQB A;  5H1S Q;  1QNC A;  3L6Q A;  4Y1D A;  3ZX3 A;  4EAL A;  3FZK A;  4DUZ K;  3I0R A;  3ASM A;  3VF4 A;  4CJ5 A;  3ATV A;  4CVN E;  3OYI A;  4NCA A;  4BG9 A;  4DQ8 A;  4FZY A;  4Q0B A;  3JAM O;  3RMA A;  3DRP A;  2GTD A;  1B9F A;  3ZCM A;  1VKL A;  3Q7B A;  1HQE A;  2D5R A;  2DFF A;  3CER A;  2HMI A;  5IWA K;  2UUC K;  2QXL A;  4MO4 A;  4FOE A;  4HCB A;  4QAG A;  5AQK A;  3SYZ A;  4Z4H A;  2O8B B;  1ATS A;  4FLV A;  3MEC A;  3OYM A;  4DS5 A;  1T6A A;  1HYV A;  3CM5 A;  3SAF A;  4ZTJ A;  1NJW A;  2KTQ A;  1RTH A;  2IGI A;  3U6F A;  2E2Q A;  3WXK A;  3HYF A;  5AFU A;  2EX3 A;  3ZT1 A;  3EZ5 A;  2YNF A;  3L3V A;  3BF3 A;  3AVJ A;  4O8K A;  1RBV A;  2V52 B;  2YNG A;  3VQ9 A;  1RTD A;  5BR8 K;  3EZW A;  3OYF A;  4CHO A;  3C0B A;  4RW7 A;  3K0S A;  3M8Q A;  4LC9 B;  2GWK A;  4DV2 K;  1YIJ N;  1KFQ A;  5IYC P;  4DV6 K;  3O3H A;  5EXW A;  1REV A;  1NKC A;  4OLA A;  2HHH K;  4CES A;  4JV5 K;  5GAD P;  1EO1 A;  2O8C A;  5C0Y A;  2Q1N A;  2NOH A;  3CFO A;  2I7N A;  1ASU A;  4B9T A;  1YT3 A;  3OYK A;  3SV3 A;  1NGB A;  1VQ5 N;  3G0Z A;  4F3O A;  2IVN A;  5AQX A;  4CFC A;  3I56 N;  1W97 L;  2P9U A;  3DLE A;  1KFD A;  1NBW A;  4BC3 A;  4BQZ A;  3O9Q A;  4RW4 A;  1D9D A;  3LWM A;  3LP0 A;  1A5W A;  4FLU A;  3AO3 A;  2BAN A;  2NRX A;  1VQP N;  2CGL A;  3AVA A;  2NOI A;  3D6R A;  2QKK A;  4EAI A;  4YFU A;  2W6K A;  4DQS A;  4BR4 A;  3LM2 A;  3THV A;  3LAN A;  3SJH A;  2VG7 A;  3K9J A;  2JHJ A;  2E20 A;  4A62 A;  4CZM A;  3RTV A;  1IKX A;  4J2D A;  3EAY A;  3AVG A;  4JKB A;  1WQA A;  3LDQ A;  2X78 A;  3HXM A;  5HP1 A;  5ADX H;  1LW2 A;  1FW6 A;  4E1J A;  3H45 C;  5AQJ A;  1J53 A;  3CJC A;  1XC9 A;  3MN5 A;  3CW7 A;  1TBP A;  3GG4 A;  4JKD A;  3R9P A;  1YQL A;  4A5A A;  3V6D A;  3QLH A;  1HPM A;  1EQY A;  1NJX A;  4IXC A;  1N8R O;  4KH6 A;  4CJR A;  5KI6 A;  3PSI A;  1SS6 A;  4AHS A;  4ID1 A;  1I39 A;  1YJN N;  4LF9 K;  3CPE A;  4DV1 K;  2O8F B;  5KTQ A;  1XNR K;  2DY4 A;  4DSJ A;  1KCF A;  3O4N A;  1K35 A;  4G1Q A;  3DMJ A;  1KFI A;  1BIZ A;  4CJL A;  3L3U A;  2BTF A;  3CFR A;  4E19 A;  1YTB A;  1I3A A;  4FPB A;  4HUE A;  2BDP A;  3DJC A;  1T6C A;  3SV4 A;  2FKF A;  4BRD A;  4CED A;  5CYQ A;  1X1P A;  4GV3 A;  4Z4E A;  3SZ2 A;  3CVS A;  1HLU A;  1EBM A;  1K2Y X;  1VOL B;  3KRM A;  4DR4 K;  2KQ2 A;  4PUO A;  4TPS A;  4BRA A;  4ROD B;  1Q82 O;  3C95 A;  2GX9 A;  5KPR A;  4C7P A;  2NRH A;  4B8C A;  4OGE A;  5C12 A;  3CC2 N;  3C7N A;  1TK8 A;  4WXA A;  4BRC A;  4CF8 A;  3K5L A;  3SI6 A;  1WN7 A;  1YVU A;  4R5P A;  2OOY A;  4F2S A;  3RMC A;  3CC4 N;  1Q86 O;  2Z1G A;  3A5N C;  1NK0 A;  1Z25 A;  3KKR A;  3CCJ N;  3M3Z A;  1RBU A;  2PWW A;  3P31 A;  4IG0 A;  3L2W A;  4ROE B;  2PYL A;  2O4I A;  2VG6 A;  2YNI A;  4KHP K;  5AQG A;  2HHX A;  4KHY A;  3VQ4 A;  3CJ7 A;  1K73 O;  3CCE N;  5LJV A;  2UU9 K;  4IOX A;  2Q2R A;  4DU3 A;  5BRD A;  1PZD A;  3K9K A;  2FGT A;  2FSK A;  3K57 A;  2PBD A;  2F4V K;  5I9E B;  4CJF A;  2GUI A;  2W40 A;  3SUQ A;  1YVN A;  5ELZ A;  3NA5 A;  5JVH L;  3UKR A;  3SCX A;  4IFY A;  1TYQ B;  4BRF A;  3F5T A;  3E9O A;  4LD0 A;  3SUN A;  5AQW A;  2O8E A;  2YHB A;  3QIC A;  4Q11 A;  4XEI A;  1NK7 A;  4BRN A;  1KAX A;  2GEM A;  4Q5V A;  1JCF A;  3DYA A;  4AQY K;  1C0G A;  1UAX A;  3MEE A;  4NXN K;  3FZH A;  3HZ6 A;  2YX6 A;  2ZGZ A;  4EP4 A;  3VOV A;  3NCI A;  1TGO A;  2Q3S A;  2QXF A;  1UWB A;  1WNS A;  3O8M A;  1ITG A;  3J80 O;  3PIO L;  3O80 A;  1NGJ A;  4FWM A;  3QEI A;  4FK0 A;  4OVL A;  1BIU A; 
#chains in the Genus database with same CATH homology
 3NGY A;  1LWF A;  4CF9 A;  1RT5 A;  2KW4 A;  3AO5 A;  3NH1 A;  3HP6 A;  1L3V A;  2G8I A;  4FLW A;  1KSP A;  1J54 A;  1LWV A;  3KKS A;  4QOZ B;  5C42 A;  2NOZ A;  1IKW A;  4AH9 A;  4KV8 A;  3TR8 A;  2XO7 A;  4NYN A;  4E7K A;  4F8R A;  1C9B B;  2KZZ A;  2NUB A;  4LH4 A;  4OKE A;  1Q8I A;  4B9N A;  2B4J A;  3KLH A;  3ZSR A;  4RW8 A;  4E89 A;  4CK3 A;  4DFJ A;  1DTQ A;  2G8W A;  1MP9 A;  4W5R A;  4CGG A;  4BE2 A;  2HB5 A;  5I42 A;  2XHB A;  2OZS A;  4DTR A;  4M3Y A;  3SQ4 A;  5SZT A;  4DTJ A;  3OYL A;  3OYH A;  4BAC A;  2ZD1 A;  2BE2 A;  1TL1 A;  1RTI A;  3KIO A;  3CG7 A;  5SWM A;  3AA2 A;  3PUF A;  3QIO A;  3K2P A;  4H4O A;  1YTA A;  1L3S A;  1EKE A;  5KGW A;  4M3Z A;  1RTJ A;  5FDL A;  2P1J A;  3OYG A;  2HHW A;  4CIG A;  1A5X A;  3NH2 A;  4CEZ A;  3PO4 A;  1UT4 A;  4KKO A;  1C0U A;  1EX4 A;  2G8U A;  2JOI A;  4K8X A;  3SQ0 A;  2Z1H A;  4CJ3 A;  1CZ9 A;  1NVP A;  3RR7 A;  4FLZ A;  4FLT A;  4DTN A;  1RBT A;  3RRG A;  5FRN A;  3QEX A;  4OPK A;  1IG9 A;  1T7P A;  4M3R A;  1BI4 A;  4FJ5 A;  1LAW A;  1NH2 A;  1QNA A;  5J2M A;  4L8R B;  1BGX T;  4M3X A;  3VQC A;  1O1W A;  3WNG A;  3IRX A;  4DFK A;  1QSL A;  4C8N A;  2KFZ A;  3AA5 X;  3V1Q A;  3V9X A;  4FK4 A;  2JLE A;  4CEF A;  4CK1 A;  3M8S A;  2Z1J A;  4FW1 A;  1E42 A;  2R7Y A;  3HPH A;  1X9W A;  2P5G A;  4KAZ A;  2HHU A;  2G30 A;  2IS3 A;  4NCG A;  3HT3 A;  2FBX A;  2YH5 A;  2Z1I A;  1C1B A;  3LAK A;  1U4B A;  1A5V A;  4FLX A;  3VQD A;  5DK5 A;  4CEO A;  2IC3 A;  2ETJ A;  4DTX A;  3QO9 A;  1JLF A;  1HQU A;  4W5T A;  4CEA A;  4RG8 A;  4KRE A;  4OGC A;  3M8R A;  3H1Z A;  1WSE A;  1RT1 A;  4B9V A;  3LPT A;  5IYB P;  3P1G A;  1N5Y A;  4K8Z A;  3E01 A;  1VTL E;  3EY1 A;  1D3U A;  3OYA A;  1CXU A;  1W9H A;  1SL0 A;  3FFI A;  1QN3 A;  1BI4 B;  1DTT A;  1KTQ A;  3SPY A;  4KPY A;  3ZSO A;  3QEW A;  2HHT A;  4JS5 A;  5KRT A;  4C8K A;  1QN7 A;  4KFB A;  4EJY A;  2RN2 A;  1RNH A;  3WNF A;  4OPJ A;  3I8D A;  3K58 A;  1U48 A;  4DF4 A;  1QN6 A;  3ULD A;  1BIS A;  4XIU A;  5JS1 A;  5FRO A;  1S5J A;  3MXI A;  3F0Z A;  3DRR A;  5HBM A;  3CFP A;  3O3F A;  1AIS A;  2ITG A;  4AHU A;  2B6A A;  3OYN A;  4CIE A;  3LWL A;  4BDY A;  4ZTF A;  4FJJ A;  2OPS A;  3AVM A;  4CK2 A;  4I9L A;  1W0H A;  3AVF A;  5IYD P;  4KTW A;  3NAE A;  4CJV A;  3DI6 A;  1VSH A;  4CHY A;  4FJL A;  2GBZ A;  2E6L A;  2WON A;  4WE1 A;  2A1S A;  3ITH A;  4N41 A;  3LP1 A;  1C0M A;  1TV6 A;  1C1C A;  3SNN A;  2G8F A;  2RPI A;  2FBT A;  4CJW A;  3K5N A;  1QTM A;  3CM6 A;  1L3T A;  4N76 A;  2IAJ A;  2ATQ A;  3OVN A;  3G10 A;  1X9S A;  4JLH A;  3VQQ A;  2FBV A;  2VJ0 A;  1CZB A;  4IDK A;  4BWJ A;  3C6U A;  2Z8U A;  1U49 A;  4JRP A;  2G8K A;  2HHQ A;  1QSY A;  3KK3 A;  4KRF A;  2XHI A;  2ZE2 A;  1JKH A;  3V81 A;  1D9F A;  4OJR A;  2YKM A;  2NOF A;  1VSF A;  3BGR A;  4W5Q A;  1CXQ A;  4M3U A;  4OLB A;  3K5O A;  4CFD A;  4DTU A;  3AA4 A;  3NF7 A;  4DS4 A;  1NJZ A;  1WAF A;  1ZBU A;  1Q9Y A;  3SQ2 A;  3AV9 A;  4FJN A;  3AVI A;  3RR8 A;  1KLM A;  4CGF A;  1TBA B;  4CJU A;  1HRH A;  1QHT A;  4RW9 A;  3VA3 A;  2NOE A;  3IH7 A;  4HUG A;  1ZBL A;  4CEB A;  1SL2 A;  3OCI A;  1TGH A;  1RDA A;  3KLI A;  3VQA A;  1VOK A;  3ZSW A;  3ZT4 A;  2FC0 A;  2DFH A;  3VQE A;  5KGX A;  1NKE A;  1QQC A;  2IDO A;  4JS4 A;  2HVH A;  4ICL A;  1QNE A;  4M45 A;  3U3Y A;  5J1E A;  4DFM A;  3K59 A;  1TKT A;  2F8S A;  4CER A;  2O3O A;  3LP2 A;  4TSX A;  3TAR A;  4GVM A;  3WNE A;  2HZS A;  4UQG A;  3T3F A;  1S1U A;  4DQI A;  4LSN A;  2FBY A;  4AHV A;  1S1W A;  2NOB A;  1QE1 A;  3L2Q A;  3NDK A;  4F3T A;  4N5S A;  1VSM A;  1UT7 A;  1WSF A;  4I7F A;  2YV0 X;  1KYU A;  3KLF A;  3NF8 A;  2MJ7 A;  4DQQ A;  3AO4 A;  3C6T A;  1JL1 A;  3OY9 A;  4HTU A;  2XY6 A;  1BHL A;  1NGM A;  1M3Q A;  1RBR A;  4CE9 A;  4CJE A;  3KD5 E;  3ZT0 A;  4B9S A;  3QET A;  4KHN A;  3QIN A;  3H08 A;  4B08 A;  3ZSQ A;  3HST B;  4CHP A;  4I9Q A;  1VRU A;  3F9K A;  3RPJ A;  4ELU A;  2HNY A;  1HMV A;  2GV9 A;  3V1R A;  3JSM A;  3P83 D;  2OZM A;  1KYF A;  1JLG A;  1JXB A;  2YKN A;  1IKY A;  3S9H A;  4Z4I A;  3HS9 A;  3QES A;  1S1V A;  3DM2 A;  3TWH A;  4FJ7 A;  5J2Q A;  3VQP A;  3NH0 A;  3ZSX A;  1J9A A;  2HNZ A;  1R0A A;  1VSK A;  4KB1 A;  4GMJ B;  5CY4 A;  1HPZ A;  1BQM A;  1UA1 A;  2QK9 A;  1EP4 A;  4CGJ A;  1RT2 A;  5K14 A;  3B6P A;  4C8M A;  5D3G A;  3TAF A;  3L2V A;  4W5N A;  4QCL A;  1N3A A;  3LP3 A;  2I5J A;  1YQM A;  3QER A;  2HHS A;  3IG1 A;  3A2F A;  2OPR A;  2OPP A;  2XRI A;  4CF1 A;  4CIF A;  1LWW A;  4CGH A;  3NE6 A;  2O4G A;  4ID5 A;  4CJP A;  5J2N A;  1C1A A;  3PV8 A;  4KI4 A;  3MEG A;  1QN9 A;  3DLR A;  3OJU A;  1B9K A;  3MXJ A;  5HLF A;  2IV9 A;  4LY7 A;  3IAY A;  3TAN A;  3HS8 A;  2MZ8 A;  4CF0 A;  4FM1 A;  1LWY A;  2IOC A;  2P51 A;  3HVT A;  4O4G A;  4CHZ A;  3ISN C;  3HP9 A;  1IO2 A;  5DMR A;  3V9U A;  4DMN A;  3LZI A;  3RRH A;  2KZM A;  5KRS A;  2WOM A;  4J2B A;  3V4I A;  1LV5 A;  3TI0 A;  4Z4C A;  1D8Y A;  4I8O A;  3VQB A;  4CJS A;  2RKI A;  5J2P A;  1Q9X A;  3ZT3 A;  2X6N A;  2ZQB A;  1QNC A;  4Y1D A;  4AHC A;  4FK2 A;  1VSI A;  3DLG A;  3T19 A;  2YNH A;  3I0R A;  4DQP A;  4DWI A;  3ASM A;  4CJ5 A;  4DSL A;  3LAL A;  3LAM A;  3OYI A;  3SUO A;  1R4X A;  4NCA A;  3OYJ A;  4KO0 A;  4FZY A;  1NK9 A;  4Q0B A;  4M41 A;  3RMA A;  1D5A A;  2OPQ A;  3HK2 A;  3DRP A;  3ZCM A;  1B9F A;  4C8O A;  2I5W A;  1C6V A;  2G8V A;  1HQE A;  2D5R A;  3KLG A;  1J5O A;  4O0I A;  4IG3 A;  2DFF A;  4DF8 A;  3RMD A;  3PO5 A;  1F21 A;  1TKX A;  4O0J A;  3WNH A;  3OST A;  2XY8 A;  1UOC A;  4IFV A;  4DQR A;  3TAE A;  1KY7 A;  1NK8 A;  2HMI A;  2HZM A;  4M3W A;  2QKB A;  1BQN A;  2X74 A;  1G15 A;  4DTO A;  4CHN A;  1VSJ A;  1NKB A;  3S3O A;  1KFS A;  3ZSY A;  4HCB A;  4KHW A;  4FW2 A;  4QAG A;  4DSF A;  4PA1 A;  4Z4F A;  1XHX A;  3SYZ A;  1S1T A;  4Z4H A;  1TK0 A;  4FLV A;  3MEC A;  3OYM A;  4DS5 A;  4FJX A;  4KHQ A;  1HYV A;  3CM5 A;  5HRR A;  2IV8 A;  2OYQ A;  4ZTJ A;  1NJW A;  4DSK A;  4FZZ A;  1T05 A;  1S1X A;  2Y1J A;  2KTQ A;  1RTH A;  3ALY A;  3ZT2 A;  2IGI A;  4Z4G A;  3U3G A;  3HPO A;  3TAG A;  3U6F A;  3V9S A;  3O4Q A;  4DG1 A;  3NF6 A;  3QNN A;  3HYF A;  4FVM A;  4B9U A;  1TK5 A;  2EX3 A;  3ZT1 A;  1L5U A;  3EZ5 A;  4EZ6 A;  2YNF A;  3L3V A;  1HYS A;  2P5O A;  4BDP A;  3AVJ A;  4FJG A;  2YHA A;  1FKO A;  1RBV A;  2YNG A;  1SKR A;  4CEC A;  3VQ9 A;  1RTD A;  1RDC A;  3D0P A;  3OYF A;  4KTQ A;  4DLE A;  1WLJ A;  1HNI A;  2AJQ A;  2F96 A;  4CHO A;  4RW7 A;  3DPT A;  1CLQ A;  3M8Q A;  4O5B A;  5C25 A;  1MU2 A;  3I0W A;  1VTO A;  3CQ8 A;  5IYC P;  3DPU A;  3MED A;  4EP5 A;  3KLE A;  3C94 A;  1U04 A;  3O3H A;  3KK2 A;  1W80 A;  1FKP A;  1REV A;  3DRS A;  3AVL A;  2VWJ A;  4ZHR A;  3DOK A;  1NKC A;  4OLA A;  4CES A;  4EJZ A;  5EU7 A;  4BE0 A;  1NOY A;  3EYZ A;  2NOH A;  3CFO A;  4KHU A;  1ASU A;  4NYF A;  2E6M A;  3SJJ A;  1YT3 A;  3OS2 A;  3I0S A;  3OYK A;  4CGD A;  3M8P A;  3B6O A;  1GOA A;  5CYM A;  3SV3 A;  1T8E A;  4HVJ A;  4B3O A;  3LDS A;  4FJ8 A;  1JLC A;  4FXD A;  2D0B A;  1RT7 A;  3G0Z A;  3KD1 E;  4CJ4 A;  3V9W A;  4F3O A;  1WSI A;  3AO2 A;  4CFC A;  4J2A A;  1S6P A;  3DLE A;  1KFD A;  2HW3 A;  5AN4 A;  3P5J A;  4RW6 A;  4RW4 A;  1XI1 A;  1QSS A;  1D9D A;  3LWM A;  1N39 A;  1JLA A;  3LP0 A;  3V1O A;  1A5W A;  4DSE A;  1TAU A;  2PZS A;  4FLU A;  3N89 A;  3AO3 A;  2BAN A;  4F4K A;  4CJK A;  1HU0 A;  3AVA A;  2NOI A;  3JYT A;  3TAP A;  2B5J A;  1FXX A;  3AA3 A;  4E1N A;  4YFU A;  1GOC A;  3TAB A;  1KLN A;  5CZ1 A;  2QKK A;  4FYD A;  3OYC A;  1QN8 A;  4FLY A;  4DQS A;  1L3U A;  4ELT A;  1ZBI A;  1WAJ A;  1B92 A;  1QS4 A;  5T7B A;  1KYD A;  4F2R A;  4W5O A;  1HYZ A;  3THV A;  3LAN A;  4E7J A;  1QN4 A;  1VSD A;  3T1A A;  1NJY A;  4DU4 A;  4FZX C;  2VG7 A;  3NF9 A;  1M3H A;  1FN7 A;  3KJV A;  3RTV A;  3ULX A;  1IKX A;  3OS1 A;  4J2D A;  1ZBH A;  3HJF A;  4AHT A;  3OJS A;  4FJM A;  3AVG A;  3RWU A;  1NK4 A;  2X78 A;  4MFB A;  1N6Q A;  4E7H A;  3HXM A;  4CJQ A;  3KTU A;  3DLH A;  5CZ2 A;  4CFB A;  5HP1 A;  3V9Z A;  1BCO A;  4EZ9 A;  1EXQ A;  1LW2 A;  3NHG A;  1XHZ A;  3VQ5 A;  1SV5 A;  1S9E A;  3SPZ A;  1KVB A;  3QIP A;  1J53 A;  4CCH A;  2XY5 A;  1XC9 A;  4DU1 A;  2XY7 A;  2VG5 A;  4E7L A;  1TBP A;  1UA0 A;  3ZSV A;  4DUL A;  1YQL A;  1K6Y A;  1IH7 A;  3OSM A;  3QLH A;  3V6D A;  2HVI A;  3I0X A;  1ZBF A;  4PWD A;  1NJX A;  1FK9 A;  4ELV A;  4OKJ A;  1RT3 A;  2EHG A;  1QN5 A;  4J2E A;  3ZSZ A;  4CJR A;  3SNS A;  4KHS A;  1LWC A;  5KI6 A;  4IBN A;  2G8H A;  1U47 A;  3O3G A;  1Z26 A;  1ZYQ A;  4DSI A;  1QTS A;  1Y97 A;  1NK6 A;  4AHS A;  4ID1 A;  1I39 A;  4FCY A;  2LAE A;  3QEV A;  4B9L A;  2DTU A;  1LWE A;  4M42 A;  4FJI A;  4NCB A;  5KTQ A;  1RDD A;  1VK0 A;  2DY4 A;  1YTU A;  4DSJ A;  3OYB A;  1S6Q A;  3AVH A;  1KCF A;  4LSL A;  3O4N A;  1VSE A;  2JGU A;  4G1Q A;  4N56 A;  3DMJ A;  1YQK A;  3LZJ A;  3PX6 A;  3TAM A;  3S3N A;  4AIL C;  1BIZ A;  4CJL A;  2A1R A;  3L3U A;  2KFN A;  4BE1 A;  3CFR A;  5HRO A;  3KK1 A;  4E19 A;  5HRN A;  3AVN A;  3QNO A;  5HRP A;  3L2U A;  1YTB A;  1I3A A;  4WZS D;  4PQU A;  3OS0 A;  4HUE A;  3OYE A;  2BDP A;  3AVK A;  1KRP A;  3DLB A;  4CHQ A;  3SV4 A;  1RCH A;  4CED A;  5CYQ A;  3VN5 A;  1X1P A;  4CGI A;  4Z4E A;  3SZ2 A;  1RM1 A;  1EBM A;  4LH5 A;  1VOL B;  4HHT A;  2Y1I A;  3KRM A;  1U45 A;  4B9T A;  1NOZ A;  4JRQ A;  2RF2 A;  1C0T A;  4GW6 A;  2KQ2 A;  2LSN A;  3NBP A;  1HJR A;  3AO1 A;  4KTZ A;  2W42 A;  3HPG A;  4TPS A;  4H8K A;  1SUQ A;  4DTM A;  4PUO A;  4ROD B;  3VQ6 A;  1QTP A;  3C95 A;  4HCC A;  2DFE A;  1LW0 A;  2HHV A;  1VRT A;  1TL3 A;  4H4M A;  4B8C A;  3UIQ A;  4CF2 A;  3HO1 A;  4DTP A;  4O55 A;  3VQ8 A;  4OGE A;  5I3U A;  1NK5 A;  1TK8 A;  3TAQ A;  3K5L A;  4OKK A;  4CF8 A;  3MAQ A;  1RIL A;  3SI6 A;  1KVA A;  1WN7 A;  5FRM A;  1YVU A;  1YQR A;  4Z0U A;  4R5P A;  2PYJ A;  4CFA A;  1BCM A;  1TAQ A;  1PCZ A;  1YTF A;  3NGI A;  4BDZ A;  2D0C A;  3NFA A;  3RMC A;  4F2S A;  3SQ1 A;  4I2Q A;  1N3C A;  1VSL A;  4N47 A;  2Z1G A;  1KY6 A;  5JS2 A;  1BL3 A;  4CEQ A;  4CEE A;  4YNQ A;  1NK0 A;  1Z25 A;  3KKR A;  3RMB A;  1TKD A;  4IKF A;  2X6S A;  1JLB A;  4MQ3 A;  2VWK A;  1SKW A;  4FJH A;  1RBU A;  4IG0 A;  3L2W A;  3CYM A;  4ROE B;  2PYL A;  2O4I A;  4CJT A;  2VG6 A;  2YNI A;  1WSG A;  3LPU A;  4PY5 A;  3HM9 A;  4B8A B;  4DTS A;  5HRS A;  3OYD A;  3QEP A;  3AVC A;  1X9M A;  4FM0 A;  4KHY A;  2HHX A;  3VQ4 A;  4DFP A;  3IS9 A;  5E41 A;  4C8L A;  4KB0 A;  4FJ9 A;  4DU3 A;  1TVR A;  4FJK A;  1T03 A;  1PZD A;  3K5M A;  2FGT A;  4BWM A;  2PY5 A;  3K57 A;  1GOB A;  1LAV A;  4O44 A;  1WSJ A;  4CJF A;  2GUI A;  3PX4 A;  3SUQ A;  1DLO A;  2D0A A;  1HNV A;  4FM2 A;  4E3S A;  4HUF A;  3PX0 A;  4E0D A;  3SUP A;  3MXM A;  3SCX A;  1SL1 A;  4IFY A;  1KO9 A;  1QNB A;  1RT4 A;  1TKZ A;  3HVR A;  1S9G A;  4B0A A;  1WSH A;  4LD0 A;  3SUN A;  4B9M A;  1XWL A;  3DLK A;  2YHB A;  1EET A;  2BGG A;  1JL2 A;  4Q11 A;  1NK7 A;  1JFI C;  2NOL A;  1SKS A;  3EIK A;  4Q5V A;  3DYA A;  4E7I A;  1UAX A;  3L8B A;  3F10 A;  3DOL A;  3F73 A;  1ASV A;  3MEE A;  3HL8 A;  4I2P A;  1ASW A;  4Y1C A;  1JLQ A;  3KTQ A;  3S3M A;  3VA0 A;  2E4L A;  1RBS A;  4EP4 A;  3NCI A;  1JLE A;  1TGO A;  2Q3S A;  2QXF A;  4E1M A;  1CDW A;  1UWB A;  4AHR A;  3NGZ A;  3D45 A;  1WNS A;  1JXE A;  2OA8 A;  4M3T A;  4DLG A;  3OC3 C;  1ITG A;  3VQ7 A;  4KI6 A;  1KVC A;  3AVB A;  1RDB A;  2HND A;  4ROC B;  3QEI A;  3BDP A;  4FK0 A;  4OVL A;  3L2R A;  3PY8 A;  2F8T A;  1BIU A;  1IKV A;  1B9D A;  1RT6 A;  5C24 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...