3ASOB

Bovine heart cytochrome c oxidase in the fully oxidized state measured at 0.9 angstrom wavelength
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinguishing between Cl- and O2(2-) as the bridging element between Fe3+ and Cu2+ in resting-oxidized cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 67
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3asoB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3asoB02
4CSPA 3NSFA 3T71A 3SBRA 1JOIA 5B7EA 2PP9A 1BQKA 1KV7A 4G71B 2XXGA 5B1BB 2VW4A 5B1JC 1ET8A 2YAOA 2X87A 2WSDA 1GR7A 3C75A 4GXFA 2J56A 4BXSV 1NZRA 2CALA 4L0PB 3BVDB 3ZIYA 4F7KA 4E9QA 3G5WA 1IKOP 4QKTA 2PP7A 1BYPA 4K9JA 4Q8BA 2YQBA 4AKOA 3AZUA 1ADWA 5D4IA 2FQEA 3PCYA 3QJQB 4DP0X 1PNDA 3NT0A 1OCRB 2HX9A 1IUZA 2DV6A 3TU6A 1RCYA 4YSUA 2DWSA 3V9CA 1GW0A 2QPDB 4DP1X 2MTAA 3NSYA 3ERXA 2HLEB 2XUWA 2J5WA 5AKRA 3FSWA 2FJSA 1KDJA 1NIEA 4KO7A 1DZ0A 2QPEB 1T5KA 2DWTA 2HRHA 1AG0A 5F7AA 1PZAA 5I6OA 1PZCA 3CVBA 4YSTA 3ZDWA 4A2DA 3PPSA 1WA1X 4QLWA 2YAMA 1SDDB 3MBWB 1A8ZA 1W6LA 8PAZA 3SQRA 1CUOA 1EZLA 1MDAA 5PAZA 1IBZA 1JZFA 1NTDA 2YEVB 1JZJA 4A66A 1KDIA 2FQGA 1JERA 1PY0A 3FPXA 3T6VA 4BXVA 3FQ2A 2ZXWB 2CJ3A 1WS7A 1NPJA 2I7OA 4E9VA 1AZUA 1NICA 4UF7C 2BZ7A 3S8GB 1NDTA 1GS8A 2ZONA 1NIAA 4E9YA 2AZUA 2OV0A 4YSQA 4AI7A 1PLBA 2DYRB 5A7EA 3H4FA 3FPYA 1SHXA 1BXVA 3H56A 1J5CA 3KW7A 4FA7B 3IE9A 2XVBA 5B1JA 3ZBMA 5AFAA 3QJRB 1AZCA 4YSRA 3TA4D 4A67A 3EH3B 2EIKB 2I7SA 3UAEA 1NPNA 4YSAA 4ENZA 2BP0A 2BWDA 2FQFA 2GIMA 3FS9A 2UX7A 1OF0A 3FU8A 1TKWA 4KOCA 3CG8A 1JXDA 1AZRA 1ID2A 2I85A 3TBCA 3QJUB 4G7SB 1ZDSA 2VW6A 3QJSB 2FQDA 2UX6A 4M4RB 4ZK8A 1OV8A 2P80A 2YXWA 4E9WA 3NJFA 1SDDA 1BQ5A 3ASOB 1V54B 1RKRA 1UATA 1WAEA 1R1CA 4E9SA 4F2EA 1V10A 1VLXA 4DP8X 1M56B 4YSEA 2YXVA 3V9EA 2OJ1A 5I5JA 4JKNA 3CZUB 3NSCA 5D4JA 2BO0A 2Q9OA 5AZUA 3JT2A 1ILSA 1GY2A 2P80D 4TXVB 1J5DA 3OMIB 4JHVA 1SJMA 3FQ1A 2JFCA 1JZGA 1JVLA 1GS7A 2H3XC 1SFHA 2EINB 5I5IA 2R7EB 4KOBA 2IWKA 2HRGA 3NSDA 4GYBA 1W8EA 4KO5A 4YSPA 2XX1A 4NB7A 3HEIB 4DPBX 2GHZA 1HFUA 4GP4B 4DP9X 3NJLA 1J9TA 1ZV2A 1AACA 1JZIA 2HX7A 1L9RA 4HIPA 4N4YB 4WTQA 2IWEA 2TSBA 4HCFA 5F7BA 1CC3A 3UACA 6PCYA 2B08A 1HAUA 3IN0A 2BW5A 2XXFA 1GSKA 4KO6A 1MG2C 4NAJA 3WNIA 3NYKA 4BWWA 4DP7X 1AR1B 2DY2A 3H4HA 2PPEA 5B3SB 3DIVA 4NERA 4BDVA 1DYZA 1ET7A 1PNCA 1PMYA 1ZIAA 4AZUA 3EHBB 2MRYA 1I53A 1PCSA 2YAQA 5FC9A 3T6WA 4M3HA 2PPCA 3NJMA 2EIMB 4P5RA 2CAKA 3ZX1A 3GXUB 4UANA 1JZEA 4Q89A 2VMJA 1A4CA 2Q5BA 2TSAA 1BAWA 5B1KA 3SBQA 1OCCB 4PCYA 3OQRA 2EIJB 4PAZA 1KCWA 4DPAX 1SFDA 1KCBA 4W1TA 2VN3A 1RZQA 1NIBA 2OCCB 3AG4B 3UADA 1M9WA 6PAZA 5ANHA 3ASNB 2W8CA 2ZOOA 1SHWA 1V55B 2IDSA 3WG7B 2QT6A 3X1EA 1A3ZA 4UAHA 5TK2A 2WO2B 4DP2X 3AG1B 3X1FA 2PLTA 3NJHA 3QJVB 4BWUA 3FSZA 5I5MA 2IDUA 5I6LA 1OE3A 3ABGA 3NJJA 2H47C 1E67A 1A65A 2JXMA 2PCFA 2FNWA 4BDVB 2UXGA 2N0MA 2PPDA 4A68A 2GI0A 2B3IA 1B3IA 2DYSB 1TU2A 4MFHA 4G7QB 3PAUA 1L9OA 4E9TA 2CUAA 2FT6A 1SF5A 1QLEB 2IWFA 3BQVA 4AX3A 9PCYA 1OCOB 7PCYA 3TBBA 3JTBA 2GC7C 3S3DB 5E9NA 2HX8A 1OE1A 1TEFA 1ASPA 1A4BA 2GSMB 4BK5C 1AIZA 2BP0B 3X1GA 4YSSA 1JZHA 2BW4A 2IDQA 2BZCA 1PLCA 3EH4B 3PXLA 3WKQA 3FYIB 1GYCA 3CVDA 3GYRA 1M57B 1L9PA 3KW8A 2XV2A 3NP4A 3TASA 2VM3A 1L9TA 4HCGA 5LDUA 1JXGA 4A2EA 1RZPA 3T6ZA 1N68A 1X9UA 3FSVA 4HHGA 3CDZB 1YLBB 3UAAA 1AZBA 5D4HA 1AS8A 2AFNA 2GC4C 1ZDQA 3EF4A 1ILUA 2FT8A 2IDTA 1BYOA 1IC0A 3N55A 4KO9A 3OMAB 3QJTB 5B7FA 3SBPA 4X4KA 1TEGA 5TK4A 3ABKB 4GP8B 3HB3B 4G70B 1OOWA 2WO3B 1XB3A 2FWLB 2PP8A 1NIFA 2R7EA 2VM4A 1KYAA 1E5YA 3FT0A 1KBVA 2AANA 1WA2X 4A2GA 3PLYA 4DP4X 5B7MA 4N8UA 1BXAA 3ABLB 1CYWA 1MZYA 3RYMA 1IBYA 3NJGA 3UABA 2UXFA 1SNRA 1AQ8A 2XV3A 2XU9A 3AG3B 5B1AB 1KBWA 2HZHA 5I28A 3FU9A 3OMNB 3AG2B 3EH5B 2PCYA 4DPCX 4YSCA 2CBPA 1BXUA 3X1NA 3L45A 3PAVA 1J9RA 1PAZA 3NJNA 4KNSA 3MX0B 3NJKA 3CDZA 1ASQA 3FQYA 2CCWA 5IY5B 1NWOA 3QPKA 1FWXA 1SF3A 1XMEB 4WKXA 1EHKB 3IBOA 5I6MA 5I6KA 1JVOA 1GS6X 4YSDA 1J9QA 4AKPA 1AOZA 2IDFA 4KNTA 1L9SA 1FFTB 1A4AA 3S8FB 5EHFA 1CURA 2PPAA 5I6NA 2AZAA 3NJIA 4YL4A 1MZZA 3PAZA 2UXTA 1NWPA 4EF3A 3WIAA 1HAWA 1WA0X 4YSOA 3T9WA 1J9SA 7PAZA 2QDWA 2YAHA 1ASOA 3T6XA 3WNJA 2GB2A 3N2JA 3GDCA 2BP8B 2E86A 2NRDA 4W9ZA 2XV0A 2X88A 2GBAA 3S3BB 4E9RA 2JKWA 2XX0A 4F2FA 1PZBA 4CSZA 1OE2A 1XB8A 3U25A 4A2FA 4AKQA 1N70A 2XWZA 1URIA 3IN2A 2QDVA 2J55A 2BWIA 4HCIA 1CYXA 1L9QA 2UXVA 4FAAB 3OM3B 1OCZB 3FYEB 1ETJA 1QNIA 2IH8A 1PF3A 4KNUA 2YARA 1AANA 1AZNA 1AAJA 4JHUA 1F56A 1NIDA 4YVNA 4BWTA 2VSMB 3AW5A 2FTAA 1ET5A 4HALA 5PCYA 1AG6A 1X9RA 3FSAA 1BQRA 2VSKB 1NINA 3OD3A 2VW7A 2YAFA 1XB6A 2YAPA 3FU7B 4GP5B 3QQXA 1ZIBA 2A3TA 1AS7A 4E9XA 2XYBA 1W6WA 2LLNA 1JXFA 2BP8A 2W88A 1ZPUA 1BEXA 4RH4A 3NP3A 3S3CB 3DKHA 1MG3C 5I26A 4HAKA 1KGYE 2IAAC 3WI9A 2EILB 4P5SA 4HHWA 4DP5X 3DTUB 4G7RB 1FA4A 1PLAA 1QHQA 2FT7A 3D12B 3X2QB 1E30A 4HZ1A 1AS6A 1GY1A 4A2HA 2ZWNA 3UGEA 1E5ZA 2BHFA 1E65A 3IEAA 4YVUA 2YAEA 2Y69B 2HXAA 3WKPA 4DP6X 2IH9A 3FU7A 2J57A 2H5UA 2RACA 4G72B 3CVCA 3ABMB 2Y1AA 2XLLA 1WS8A 2PPFA 4GY4A 3AY2A 5I6PA 2AVFA 3X1BA
chains in the Genus database with same CATH superfamily
3WS3B 1PX8A 2SEBB 4TLKA 2ZNIA 1XMQB 4QCIA 1JOIA 8FABA 4BZ1A 1VDGA 2M7WA 2E6PA 5E51A 3FHQA 5LXTA 2W0FB 1G94A 2Z4QB 3HPLA 4PBXA 5D72H 4E9LA 1FYJA 1BQHG 3TCLA 1NZRA 2Z34A 1OGAD 2AQTA 1PX3A 2OW6A 4HSCX 4I0CC 4R4FL 1I8MA 4DUYB 3GBML 3GSQA 3NSJA 1MRFH 1FG2B 2Z1KA 1E4JA 3HAEB 3IMBA 3WFZA 3GDBA 3QZOA 3SKOB 2NQCA 3ZYOA 4HT1L 1YITV 2FHFA 2XASA 4E41D 1KBPA 2W95A 1R33A 2QADC 4PRDB 2Y36L 5C0CD 2V2TB 1U9KA 3DV6A 3STBA 1IUZA 2DV6A 4GQZA 3ULUH 3PJSB 1HQRB 2BSEA 4BW5A 3CMOH 3OLGA 3ASOC 4KKAD 3CXFA 4B9ZA 4EDWL 2B4CC 1VIBA 1NBQA 1PDKB 2MTAA 3NSYA 5JIQA 5AG8A 3ULVF 2EIJC 1JA8A 2P47B 2BZDA 3PN1A 4PR5B 4NUJB 1QI4A 3SODB 3HVDA 4OLYH 2DWTA 4NC0B 2CDEB 3VD1A 2EZ0D 2OYMA 4K8ZA 1QEWB 2EDQA 1IC5L 2OTWB 3PE9A 3MRQA 3L5WA 1Y18A 4FEMA 3SPVB 5J9PA 2XQ0A 4WV1A 5I1CH 4RRPG 1UA6H 1BGXL 4FG2A 5DFVD 1QFHA 4LMQE 2CUIA 1XILA 1HHHB 4GXVL 1SJEB 5E70A 2NPLX 4IS6B 1XSKA 4MAYD 3SKJH 1ZKAA 1DUYA 5T1KD 1EANA 1UT9A 2J1XA 3CB2A 3AS0A 4WJG3 4I9QA 1SOQA 3CUPB 4LASL 4NNXA 4F24A 3ARFC 3H42L 3S3SA 4XPHL 4MJHA 4LPWA 5LHHA 2CK0L 4WWPA 1GCYA 4JJ5A 2NOYA 5J2TB 3QNEA 2XICA 2AJ3B 4X20A 2JB5H 1VFBB 4JFWA 3BSZL 4IBYA 3RE0A 3SY0B 1KJ2A 2VISB 1TQSA 2CJ3A 5AZ2H 1AD0A 4M3JA 1KTJA 5J6HA 3EH1A 1AZUA 4JRFA 1J18A 3WFEH 4XP9H 1PLBA 5IYCO 4NO3A 2IJJA 3CC7V 5ADOL 4V1DE 1GPOL 3LTVA 2OMVA 3CAFA 4PJHA 3GSOB 4ODTH 1UOLA 2DLGA 5TH2B 4JREB 1E9OA 3O4LA 4EE2A 4JO2H 4PJ7E 1UOKA 4IJTA 4N2BA 1BYNA 1UD3A 2JCCE 2AEOA 2OJZH 3GMPB 3L5HA 4GI9A 5C0JB 4Y4FB 3CCSV 2P8MA 3HI6L 4MMZA 5FO9B 1XGTA 4ZW7A 5LXVA 2PCXA 3WCYA 3KG2A 1DCEA 1IGML 1L9NA 1NAMH 4P4RA 5BZDB 1PZ5A 3CC1A 4YDKL 1QVGU 1ZLUK 3STZA 2X53A 3B9EA 4IU2A 4Z0BH 1KFGA 3OTFA 4X1YA 1KULA 4JAUA 3OAWA 4M7LL 3K6IA 1RPUA 3CFIC 3UEQA 5FA4A 1DO5A 3APNA 4LARL 5KBPA 2XWCA 4N0UA 4HCRL 1UGKA 2W6IG 4Q0XH 1TTUA 5C07B 4Y5XA 5CSZA 4JFXB 1PG7L 3FQRB 5INDB 2Y3AA 5KZCB 5LXGL 2Z3YA 3A0BZ 2BERA 3OB0H 4ONGL 2KL6A 3KPSE 3DRQB 3KYKH 4UIKL 5AD0A 1KY6A 1OGAA 3BFQG 2ZT9C 2VWEC 4YXLL 1GY2A 4JHVA 2YBRA 1SJMA 4ZFZA 3TCUA 3TIEB 5JIIA 2ROXA 1E6JL 2RJMA 5GZOC 3VXMB 4PJEE 5IEHB 1HT6A 2VERA 4WW2B 2C3VB 1ZUQA 4F92B 4J3BA 2G9HA 3GGWA 4YFDB 1OARL 3P2DA 5HYFA 3X11A 2JIXD 1J8HA 1I7ZA 3TPKA 1V55C 2N3JA 1QW8A 1ZX3A 3HEIB 2GITB 1EAOA 1HFUA 4PYGA 1I1AD 5SWQA 2WSPA 3NJLA 2WCSA 4FKKA 4GX1A 5FHBL 4AE1A 2VDKH 2UY6A 2QSCH 2XAFA 3K06A 3GMLB 1XEDA 4QD2E 1XL4A 3KLQA 3U0WH 3RA7L 3D36A 5AB0A 1FNLA 2FE0A 4OR1A 1VCBC 3QXUA 4OUUB 5IHUH 4OIIL 4FG6C 1BM3H 2BOBA 4DP7X 4FHJA 4F15B 5EC1C 1MCIA 4B0MB 1XEQA 1FRGL 4X6DA 5DJZB 2Q87A 1US6A 4BA8A 4XDJA 1F8TH 4ZW5A 4YJ2B 1GC1C 4F93B 3SO3B 3BEVA 4QXGH 1NCWH 4CVWA 1EHXA 3MV9A 5B1NA 5CHNB 4LWSB 4P2OB 1LEGB 1PCSA 5CKAA 4I48A 4DR5B 2EIMB 1KCKA 2WWKO 4UM9A 4ZPVB 4IQHA 4TTDC 2NW2A 3WFCL 2W9DH 1M7UA 3HMWH 3QJFA 5ITZA 4NM4H 1NGPL 2WIIB 2WQWA 1J9CT 5FGCE 2JTYA 2BVQB 2NY1D 1PVHA 2OXGB 4WI0A 2J8HA 4W1TA 1IGJA 2IH3B 3AG4B 1KXVC 3VWJA 3K71A 4BQCA 2QE7G 1OW0A 3K2MC 3MOAH 5CBHA 2W8CA 3KNBB 3L9DA 1X6NA 2WAHA 4CADB 4U6VH 3L6FB 3TH4T 4BKSC 1B06A 3IFNH 2HFFB 4HKBA 1SA0A 1S7WA 2EABA 1HHJA 2YFOA 3AG1B 2PLTA 4BWUA 1Q1JL 3D87B 3K6DA 1KCUH 1BZEA 5I6LA 2FLRT 2HG5C 1A4KB 2IOOA 3R4DA 3MNDA 5EUOE 3EGSA 4LU5H 4M8QA 1FL6A 1S5LZ 1WFMA 2WLLA 1QX1A 2B1AH 2E47A 2F7QA 2Y1YA 1GM8A 4JN1H 4M1CD 5GGSB 5CEXB 2MOQA 4X5RA 4IBUA 1TO5A 4HC1H 2ENYA 1Z5LA 2XQYA 4K4KA 4H7VA 3Q48A 3TNMA 2VRAA 2ZKHH 1LWHA 5D1XD 5AYUL 2C9AA 3NIDB 2R0WL 4X7FC 3ILDA 4B08A 5CS7A 2KI6A 2QR0A 5IHZB 3QFJE 4BIOA 1J8RA 4IL6Z 1DBAL 2EXTA 3ZKQD 1L9OA 2WVSA 4AX3A 4TRPL 1KT2A 2ZPKH 2BVPB 4BKTC 4IJ3C 1JYWA 4AEHL 3JTBA 1T2JA 3FFDA 4CDGC 5IVZB 1TEFA 3RUGE 2XWXA 3JSLA 1ASPA 1R75A 3F04A 4XNXH 5D1ZI 1NC2B 5IR1A 5IWAB 1HINH 1KB5H 1J1OH 1JZHA 2HLAB 2YIDA 2XA8L 5HYJD 3L3DA 3RGHA 4PIBA 3RWGA 3WKQA 4KK8C 3FTYA 4LAQH 1DJHA 5CCKL 4IGBA 4MJIE 3TWCL 3WLWC 5C86A 3MRPB 3ULVC 5GRWA 1L9PA 1IDSA 1AP2B 4DV1O 3HI1B 2H6UA 3HFMH 1QYGL 5DI8A 2B2XL 3MV8B 4FL4C 2H8PA 4RGNC 3SKUD 3PHOA 4YFEA 4LC1A 1CL7I 4LPVA 3HFFA 3AQDA 4U7OA 3DWTA 4DFIA 2J1YA 3L2MA 3L08A 2L8AA 1TTFA 4OGYL 3WNKA 3ETSA 4I3SL 4YHOL 4AL8L 3WTXA 1T21B 3UP6A 2WMPA 4GSQA 2ICWJ 1MFDH 1KB5B 3QDMD 4NZRL 2DJSA 2G2RA 4O02H 5C09B 1S5HC 1OAJA 4HKXA 4GKKO 3OXRB 3KLSA 2Y3NA 4PGDA 3QIWA 5JHMA 1WBXB 2NSMA 1G9MC 2I5YL 4Y1AB 1IT9L 2P5WE 1QLEC 3N2KA 1EZSA 1ZHKB 4YGVB 4NN7B 3EDJA 3C6LD 3WY1A 5K93A 3CFKA 4PJFF 4N8PA 1BSMA 3KCPA 3X3GL 3DYMA 5DHEA 3RY6A 5E94A 3AROA 4X5WA 2H6PA 4OD2B 1IBKO 3MAWA 5KVEH 4PWKA 4AG4H 4OF8A 3R65A 4NQCB 1DVFB 1Q94A 2QHRL 1F6AB 4UMGA 4IKIA 1KWGA 3IPFA 5HGAA 3KPSD 3EH5B 1JFFB 3CRMA 2UZXA 2EP6A 3K4ZA 4Y1TA 1TCMA 5GGVH 3EFFA 3NJNA 5FNVB 3VXOA 4I7ZB 3LZLA 3MBEB 5IMKA 4NKMB 4HX1A 5AAMA 2ICEA 4OCXL 4OQTH 4RDBA 4B0MM 1NFAA 1FVDA 1ZSDA 4WFGA 1U2YA 3P32A 3HMXA 3EW3B 1NBMG 1WBYA 2ATKB 1GOHA 1N6UA 2JJ2G 4UB6Z 3OEEG 2BSED 3FQUB 3FW6A 1ACZA 3MFGB 1F4WH 3BPCA 1TTRA 1JYNA 4ZD3H 5BS0A 4G1EA 4PD4F 4Y16C 1EXUA 4E9RA 3QRGH 4MVBD 4AKPA 4Q52A 4TVUA 2CA3A 2WYTA 2CJUL 3EYOB 1KLFA 1IM9A 3L3HA 5K1XA 4XX5A 2OI9C 2Q7EA 3VWJC 3MUHL 3X14B 1KPRB 5ENWB 3F85A 1X4XA 2EJ1A 4AZ8B 4PRPB 3CCQV 4QTIH 3T0DA 1X7QB 2A38A 1T2XA 3P77B 1J9SA 1XF3A 2QDWA 4ORGB 4X9FA 4DAGL 5E8DL 2PUQT 3L4XA 3E0GA 5FECB 1HKLH 1S9YA 4WWNA 2F7IA 3N2JA 4NQCE 25C8L 4S1QH 3T0WA 4W4LA 1ROWA 3KJ6L 2X88A 2Z92B 5CA3A 1P84K 2A9ML 1KV3A 3ZDYF 1MNUL 3ZE1B 4XTRD 5L4MA 5CBAB 2BY1A 1HYSC 4F2FA 2EECA 1WZKA 2XJKA 4XVTL 3ESUF 5K1PA 2ZSWB 3HMXH 4EI5D 1HNWB 8CGTA 4HUNB 2JMRA 4MVRA 4WGVB 4XNMB 5E1GA 4J80A 2Q0AA 3HZKB 4N2LA 5T5NF 4EI5C 4ICWA 4RAHA 4FAAB 3OM3B 3IAPA 3FFCD 1EFXD 3WIIH 4DN3H 3A8TA 1JI1A 4BUQA 1NDMA 3J8F7 2X6MA 5TDPB 3DGGB 4QI3A 3BAYA 5HPOA 1NC4A 3JWDC 1EHNA 1N6VA 3BXNA 5TDNA 2PWEA 3T77A 2Q76B 3K80A 1X9RA 4JQIA 1JNLL 3LXCA 5MI0B 4G82A 4NZDA 2DQHH 3L3OC 1C5DA 1OAYL 4U6TA 3W7WA 2J72A 2YAPA 1U8JA 1RM1B 4LPCA 1HXMA 1XF2B 3ZJZA 1ND0B 4TNGA 4E9XA 1BAFL 3JALB 2XYBA 3T4AC 3OTTA 1QBLH 3VXUD 2ATPA 3ARVA 1TQCB 4RH4A 3SGEH 3V0GA 5JIDA 3GSUB 4JYYA 2X4NA 4B7EA 4U7NA 3S5LG 1MI5E 5ADPH 3QQ4B 1YNLH 2KSDA 5SV4A 4BRVA 1UJ3C 4JRXB 4G7RB 4K71B 4R3SA 2XG4B 3DK2A 4S2SA 1A9EA 4FTVA 1GN3A 1H38A 1HIML 2FEDC 2DQEH 2QZ5A 3FCSB 3BRDA 2R4RL 5D7IA 4NUGL 3EDKA 2RBLA 5ID0A 1GSMA 1U8LA 3IXTA 2Q8VA 4LFCB 4DVBB 2AMGA 5KHGA 2IH9A 2J57A 1CXZB 1AO7E 1H8OA 1HL9A 3Q06A 3KH3A 4HJUA 5CU9A 3NSFA 5GGRY 6TAAA 2NZ9D 4RZCB 4J39A 3GWJA 4MD0B 1R3HB 3BMVA 3CZSA 1HQ4A 4LSPL 5D7JA 1XT5A 4YL9A 3EFOA 5ETUB 5KAQF 4M6OH 5DYFA 2D2CB 1Y76B 4QRQA 4KNQA 1YHQV 2E5EA 4HYTB 1YEIH 4JMXA 2LU7A 5CILL 5DU7A 1UT2A 3P30L 1X7SA 2AEPL 4R26L 2NR6D 4RAVA 3ULUD 1JWSA 2BRQA 4DO6A 2FJUB 1HNFA 4HJJH 3PP4L 5LGUA 3WOVA 4AGMA 1F00I 1VFBA 3OR6B 3ATEA 4OZHF 1ONQB 3ZE0B 2K4WA 4G6KL 4L0ZA 1XAUA 1KFAH 4JRXE 1RCYA 4FG6D 2P42B 4U1KB 4B9KC 4DP1X 3BWAA 3IFXA 1YN7A 4N85A 3DX6A 4PJ5D 1ZANL 4Y9CA 5CN3A 4LOUC 2XTJD 3GTVA 4DR4B 1M2OA 2EYRA 3QORB 5JA8B 5JUEH 1NGZB 3OLEA 2FJSA 4GG8A 4K9EH 2UU9O 1A7RH 2FX8H 1YEDA 5JH7B 3DSQA 4AJVA 2PKDA 1S9XA 1AG0A 3DOHA 4Y2OB 1WZMA 4L05A 5JJNB 1YEJL 3D39E 3QWOA 1KJVA 1Q6UA 1AR2A 1HL5A 4G80B 3V4LA 3ZDWA 3RZCD 1DSWA 1SMAA 3V4PH 1SQBH 3OD4A 5B1AC 2KBGA 2QLVB 5B8CB 4HU8A 5KSAD 3ZSTA 5F0MB 2P8MB 3SDXF 1NUGA 4LSQH 2ZM6O 4QOKE 2DL2A 4X42A 4XO3A 5C6TH 3QUMA 1EXGA 1IGMH 3DV6B 3WTWA 3VYPA 3IYLW 1JZFA 2CJTA 3STZB 4PJ5E 3THMH 3TNNB 4GW5B 4C4UA 4HF5L 1MCWW 2AW9A 3CRAA 2X4UA 4X9YA 3T6VA 1ML0A 1S9KC 2JXMB 2L6LA 3EJUA 4LSSH 4PJ9B 4BRJA 5ID1A 3IU4L 5E6ZA 3H9VA 1NDTA 1NDGB 2FWUA 3QDJB 1NIAA 4P06A 5CCKH 5LMUB 1A6ZB 3MNVB 5E8OB 1T89A 4L8JA 1E3ZA 1T89C 3NABL 1ZOXA 3OG4B 1T7VA 1QP1A 5J12B 1MKFA 3DRQA 1EK3A 1F23A 4NPJA 5AVYB 3QO8A 2OTLV 1ZXQA 1OSEA 1CT8A 1TFPA 3MRMB 1GZHA 1PAMA 2YBRB 4KDWA 3TIEA 1S7VA 3HZYB 4WWKB 4XVUC 4PJXB 4DV2B 1Y6XA 5H94A 3SQBB 4E41E 5IOKA 3QJXA 3FB6A 5A2AA 5KHKA 2V2WA 2D7OA 1BQLL 5I30L 5DUPL 3MV7D 3VCLB 3VG9C 4BHUI 1LLAA 3N27A 5C08E 2BNUB 4PS4H 3W11D 3M7MX 4MJ5A 4X9QA 4XP6L 1ACCA 3FO1A 1UASA 1AD0B 1II4E 4QTHB 1EDYA 1G4RA 4J7KA 2X4PB 4KXRA 3O41B 4Z7UA 4Q6IC 3QJSB 4O2BB 2DM7A 4NO3B 1OV8A 1E3XA 3NJFA 4XCFH 1JNHA 2BOBB 4PVLA 5EUOF 4BKLB 5MENA 3AAZB 3IKCB 3CNKA 4OM0H 5MERB 1R6TA 1OWWA 4QHUA 2VE6B 1WAAE 1FRGH 4F2EA 3W38A 3ZHSA 1D5ZA 2H32H 2RR3A 5EBGA 1GIGH 2YXVA 3JBG7 1W9XA 3D3VE 2CR0A 1UD6A 4B3MB 3D2UD 3JT2A 2X1QA 1SYVB 2YOAA 4MMZB 5MHSE 3UOAB 4JR9H 1JVLA 1GS7A 2JKIS 4GW4A 2R51A 3IXAB 4XNQB 4LP5A 2Q2EB 5EYPB 1U3HB 3IDUA 4K7PL 1TVDA 3LNNA 3PQYB 3BP5A 3VWJB 2FYVA 4D7TA 3FB8C 4NB7A 5DD5H 3T1HB 3C60B 2YPVL 3C6LC 5F1SA 3IRPX 3DUSA 3B09A 2BP3A 3RGVC 5IQOA 2XJLA 1HN1A 3IDIB 5DD3L 5CJ8A 1S7WB 3IFNL 4WW2C 3KVQA 3FQRA 1PZDA 4V11A 1OSPL 4MVOA 1DE4B 3TOPA 4NNPL 4J3OF 2RCSL 5FIEA 2FLBT 5SWZE 4PLJD 1PZSA 2WLLB 3HHRB 3FQWA 4PLJC 3CWGA 4KI5C 1TEYA 5FW6A 2ALAA 2OWOA 1FDLH 3LZQA 2R4SL 2R23A 1AGFB 1OK8A 1FFRA 1ZHBB 4K9EC 4M3HA 2P3YA 2G5RA 5FUOH 2AV1A 1R5VB 2HTLC 2YA1A 5FYKE 4LSVH 4UANA 3RX5A 5E95B 3HLKA 4F7CA 1J8HB 1F97A 1MNUH 3QZNA 1BAWA 5EBLB 3RWEA 2CIKB 4PJ8B 5EBMB 1ZV9A 4YEFA 2BSTB 3VRJA 4AEIL 4U1MA 2WQUA 2WZ6A 2VABB 1RZQA 1OJHA 3SQOL 5IVZA 2FBJH 2DWXA 4CS4A 1FYHB 2OTUB 4X4ZA 5E8NB 1K3IA 1ETB1 5C0DA 1NC2A 1F1GA 1ZT7A 3S36H 4DZBA 4FN0A 3ZW3A 1NGQL 5CKGA 1BZQK 3ENEA 4X6EB 4LBAA 3B2VL 1J95A 2Q6WA 2IDSA 5J0BA 1KSRA 1IGFL 3X1EA 5GZNC 1MUJB 4X6DB 2PABA 3X1FA 4NWTH 4H44B 5DRNA 3O4LE 1JZDC 1FP5A 1F90H 1FZJA 4BH8A 3O3DA 1KBGH 3KPQA 4ZUUB 1OOAA 2KZBA 3IETB 3VFNB 1N4CA 3DVIA 2P6JA 4KRPD 1NGWB 1BD2B 4DW2H 4PV8B 2PCFA 4FQQB 5DEGB 4HH8A 5IUCA 2FB4L 2H26A 3A6CH 3QDHA 4AJWA 1LE9A 2OSYA 2GEQA 3MNZB 5JDJA 3QISA 3CCEV 2P5PA 4AV5A 4PJGA 3AREA 1U97A 4JFFE 4P5MA 2AZ0A 4RGOL 3QYCA 1NOAA 4FOMA 5KSVA 4P57B 3L9RA 4K5OA 3OV6A 3BPLC 3L6FA 5IF0A 1OZ0A 4M62L 4QJFB 2FDBP 4E0RB 1L0QA 4FJ6A 2Y7SA 3DXAB 4X6CA 2YOCA 2ARJQ 4IIZA 4AYSA 1XBDA 3II3A 4R5TA 1F7YA 2NUTB 1RZJL 4NUGH 4QRRE 3OKMA 4DHLA 2AVGA 4LCCC 5EOTB 4NQCA 5KW9H 4WK0B 5AENA 2PWDA 1P6WA 5LDUA 4F80A 1G9NC 1T66C 3EO1A 3TCXA 4ZFOB 1C5CL 4YX2H 4JLRB 3I3BA 1CG9A 2ZOKB 2YRLA 2SODB 4WI4A 4JFEB 3CV5A 2IDTA 2NY3B 3H9ZA 5JPMC 2QSTA 5F7KC 4U4BA 3FT2A 4DV5B 1RMFH 3AG1C 4Z8FH 4OZIE 4JFFB 4JM4H 3HCVA 2CCLA 5T5FL 3E83A 2ZF8A 1OT1A 3HB3B 2W9EL 3TJTA 4N9OB 3LNFA 4Y88A 4ZUVB 5J3HC 4X65O 4NQEE 4LCUA 3QWNA 4LEOA 3UAJD 1W0VA 2YXHA 2K9FB 5DS8B 4ANWA 2Y23A 3WS3A 1E4XH 3B4NA 2AANA 3DNKA 3MJ7B 2EEFA 3ARZA 1SBSL 3PLYA 3QZLA 2IJKA 1C9SA 2XN9E 3SKJL 4YDZA 5DI8B 3CJHA 3EAKA 4PELA 1VIWA 3NBNA 5J2UB 1CQKA 1T4KA 3AG3B 5B1AB 1A7QH 1XCXA 3D4ZA 1JV2A 5BV7B 2W81C 5A6LA 2NW3B 5KOVC 3Q4HB 2G2NA 1GZQA 4GEIA 2WMPB 1LP9E 5JOFB 2ZD0A 1PAZA 1H6TA 2ZCHH 4HU2A 3ABKC 4MCZB 2YIBD 4OZFG 2IBGA 4P07A 3V4PL 2V5SA 3BSHA 5C2BL 5KYWA 1P84F 5I0DA 1SM3H 1SQ2N 3HBGA 4JI5B 1TYRA 3WFEL 3HJ0A 3KS0J 3C2AH 1QNZL 2AXHA 4JKWA 4KJWD 2PTUA 2CJSA 4NKDB 4BUHA 1V7ML 3UPCA 5MENE 1BWMA 1JV5B 3HNVH 2P24B 1JVOA 5E08L 2EEXA 4YSDA 4ONFH 5BV7H 2A83B 2EE3A 4HUWB 1IZKA 4ZTEA 4JCWA 4PRAA 3WIHA 1SEQL 2DYPA 4AH2B 2LLGA 3QPQD 2DYSC 2XOKG 4J1UB 1AC0A 5JWPA 1AMXA 1QEWA 2BSKB 5B3NA 4MA7H 3BCFA 1EO5A 3NFNB 4R7DA 4GW1B 2K9PA 4WV1B 3SPGA 2Q20A 4FLOA 4NKOA 3PIQB 1HCYA 1HHHA 3BVXA 3QP3A 3B8NA 1I9JL 3QHFH 2UXTA 4EF3A 5EEYA 1JZ3A 2W9LA 2CKBH 3BC9A 4B96A 3U0ZA 3HOGA 1SZTA 3MCLL 4LF9B 5K9JH 1HXYB 3BGMA 2ZOLB 3LRKA 1NAMB 5TPWL 2X6VA 1F02I 3SJCC 2EJ7A 1KN4H 2NRDA 1HHKB 3FO9B 4XHQA 1QAWA 3N06B 1I82A 5F9DC 4GKZB 3S37H 3F62A 4DGYL 1B6DA 3NOIA 5ECGA 2VDRH 5DFWH 4ANVA 2F8OA 4OGAD 1XB8A 4IOIA 3E6HA 3GSVA 3HS0A 3JV6A 1BJMA 1OCRC 3UPAA 2QDVA 4QRBA 4WIQA 5DDHB 3DDFA 1KTLA 3IMTA 1A9EB 1X44A 4IOFD 2YXFA 2VXUL 2OQJB 4PMFA 5J5EA 3WY4A 2HB0A 2NUPB 2F2HA 3GJFB 3GBLA 3PDOA 2WGXA 3DO4A 4XCNB 5EU4A 1KP3A 3MLRH 3MRKA 5CLTA 5C0AE 1JYXA 3TXQA 3FCBA 3GB7A 4OY9A 1LYQA 5C0BD 4L5FH 3DGEA 3PGDB 3TO2A 1HJCA 1Q7YW 1XMWA 4HALA 4L1DA 3VWKA 5SWSB 1E7VA 1ROCA 1BEYH 5EG6C 1JJ2U 1NAKL 1UWYA 4MD0A 1PIGA 2VW7A 2DW4A 2Z92A 2ZICA 5BZBA 1AGEB 3BAEH 1GMGA 3AMLA 2P1YA 3AS1A 4HIHB 4ZI7B 1RP8A 1HC1A 3ESVF 4WY7H 1CXLA 1NM4A 1R17A 3K5RA 5E5MA 4QRQB 2NSXA 3QC5X 3VXRA 1U8NA 4YLQT 4WUUD 3RYIA 1JWSB 1A47A 3BVOA 3BAXA 3FOMA 2V17H 3LPPA 3FK3A 1XXFC 1DQKA 1RZKH 2L0DA 3ORJA 4QT5A 3WY2A 4ZMZA 3UEZA 1LGVA 3Q8CA 3QWQB 2FT7A 4I88A 3D12B 4GINA 1K5SA 1NEZG 4J28A 4N3UA 2OTJV 1JF5A 1UA6L 3RVVD 1ECZA 4R0LC 2C9VA 1GVIA 1OANA 1S78C 1XR8B 2BHFA 3IMVA 4UOZA 5GZOA 4UQ2B 3ASWA 1KMGA 5LBSH 2EXWD 2EQDA 1LK3L 1PP9H 2DQDH 2CQVA 5JUEL 2GV9A 4P2QE 2Z5UA 1YEWA 2BOBC 3QGVA 3L5XH 3LB6C 4JHAL 5IGXL 3FONB 1IBLO 2CO2A 3DMMA 4K7FB 1U93B 3WJLA 4YDVB 3VFTA 3VFSB 3NVQA 2FCBA 3QWOB 3NGBB 5F1KC 4O2CB 3ZKMD 4G71B 2F4VO 2LOEA 4LQFL 1PEWA 2VMEA 5F3BA 3H1KH 1Q9KA 3QK0A 1AD9B 1PG7W 4MMXA 3ISYA 1GR7A 1EJOL 1PNLA 3IS0X 5EOCL 4FKEA 4HCRA 3IAYA 4NIYE 2NY5L 3SDCD 2CNZA 5FFLA 4AIEA 2YQBA 1ADWA 5D4IA 1BS3A 1JFQL 2AXGB 1KIPA 4W4NA 5I76B 2AJVL 1RJYB 2G3NA 1FYTD 5HYEA 3QA3B 4GJTB 2ENPA 3B2VH 4D0DA 2R2BB 3CPUA 1IGFH 5I23A 5DN6G 2PI4A 2X4SB 3GSNA 4Q56A 4FQHA 4NOBA 3UQ8A 1A66A 3UIYA 2IQAA 1DBAH 4U6YB 4UNVA 1SZXA 1AHMA 3IPEA 3RL1B 4YE4L 4GBXB 4O2FA 4U3CA 3A6BH 2BVQA 4M8UA 1KBBA 3GZOA 3ZHTA 2BJMH 2JVUA 3CQFA 3GRWL 2NNRA 3FB6B 4RAVB 1INQB 4L3EA 3STZC 1R73A 1J5IA 3FU5A 2GSIA 5E00A 5EU6B 2YAMA 4LE8A 4EN3C 2JB6A 5DVNA 1ED3B 1W0WA 3MA9H 3OR6A 4G9DB 4QJ4B 1YF2A 4PS4L 2WLYA 4J4PC 1CVRA 1LO3H 4I5SA 4TQFA 2ZKYA 3SDAD 3U4EA 1E40A 3RVWC 3T0EA 2A0LC 1KJ2L 3O6LH 4O51A 5I1IL 4IKNA 1JPTL 4Z7UB 3K9SA 4UIKH 2A6DB 4A66A 1G5AA 5SWZA 3FQ2A 1PCXA 4HZLA 5FO7B 1BOYA 5LYJB 3SEPA 1WAPA 3NEXA 1AP6A 1HSBA 1P69B 4KTYA 5GS2D 1SLVA 2X4TA 2NY2C 2YD4A 1CZ8L 4X4XB 5HYSA 3LSUA 3WJJC 1FN4A 3K0YA 1YMMD 2HTKD 2NY2D 2OV0A 4HA1A 1S9XB 4C54A 4JM2F 4M5ZH 4PJBA 2RNBA 1YNTA 3REVA 2V8LA 3ULUC 1NTMH 4HULB 3WLWD 3ULVD 3PJSA 5AFAA 5DVMA 3RHWF 6FABH 1KYUA 2BSSB 5LQBH 4GW4B 3MXWH 4N26A 2E9WA 5TE4H 4Z76A 2ZQMA 1EFQA 1ORQB 2WV3A 4C59B 1FI8C 2GIMA 4H0LC 4GW5A 2UX7A 2IV8A 1TKWA 3L3DB 3CX5F 1EERB 2GIYA 2OYKA 4QRSA 1XNQO 1YY9C 1PM9A 2ADGA 3QZWB 1A6TA 1A7PL 4EZLA 4LF5B 2NY7H 2QHRH 2OL3H 4QTFA 3VGBA 4ZFFB 2AHZA 3FCUB 3QUZC 5C0IB 2NNAA 4XB8A 4XCCL 4N0YL 3HE6B 4PRBA 5I74C 3CIAA 4IS6A 1K92A 1H2MA 4NO0A 4QRFA 4PD4J 5C0EB 4AEFA 2P80A 1HNXB 4X66B 5AVWB 4P5TD 3D3VD 2X09A 4YHMH 2IC2A 3HG4A 4H1LA 1WC7B 5FO8B 3PGFL 2PYLA 1IILE 4Z77A 1GMIA 1XGYL 4IHOA 1IAIL 4K73A 3D3IA 5FGCB 2N74A 1RZGA 4GKSB 2RB8A 4JO4H 4YDLB 4ONOA 3F6JA 5DJXA 4JY6A 1QA9B 1XH3A 4WWID 3ZRXA 1AGFA 2Z35B 1KB9J 3QFJD 5AZUA 1S6NA 4HKXB 3ZE2B 1MREH 3ZCCA 5BZXA 3P3YA 4XNUL 1KJ3L 4Z3EA 3QRGL 2HKFL 4O4IA 1BZ7B 3FQ1A 1FG9C 1E28B 2IXQA 5D2LB 4Y1AA 2BNUA 3ROOA 1THZA 2BC4B 4LPUA 2HRLA 3ZSSA 4HS6B 1FLTX 4YGVA 4ZNEE 3LEYH 4ZXBA 2Q9LA 2G75B 3C2AL 4UZSA 4LF3B 1AJNA 4KO5A 3AGVA 5I9QB 4LU5L 5KANG 1AIFA 4GUOA 3HNVL 4FQLH 4WUKH 5TH2A 3EYSH 1XWVA 4ONFL 5BV7L 4L0YA 1FQ9C 3HNTL 3JSNA 5DZAA 1YXBA 1FCGA 1WZAA 2A6IA 2GTZA 2GY7B 4LEXL 1MUJA 5F7LB 5FLUA 3SDXA 5KYYB 5BZWA 4CH4A 4M7ZB 3QZMA 4JZNB 4Y4FA 3F6LA 4NAJA 1MFEH 4RNRA 1D7DA 1BD2A 5C8JB 2J25A 3MZTA 4EQ3A 3QG6A 2XN0A 3MLYH 4IU2B 4CU7A 4PI2A 4NQED 1T22B 1QPXA 2PXYD 3ZDXB 1KP2A 2DQ3A 4PJ0Z 3BPCB 3ZX1A 5DD0L 4PJGB 4F6RB 3LN4A 1ZL8B 4N0UB 1KIRA 1EXUB 4M93B 5FA3B 4MNQE 1Z3GH 4K0KB 1OCCB 3M17B 5J6GA 3MTXA 4YZWA 3MLTB 1BP3B 4W4KA 2DQJL 1P7KA 3IDIA 4N5UA 5LN8A 4WSGA 2OBGA 2KPWA 5ANHA 1X7QA 2B77A 1T6BX 3D25B 4I0PB 1SUJA 1V55B 1U30A 1GJUA 1IFRA 2XWBB 5ALBH 2NX5A 1QABA 3GINA 1A8JH 2YRBA 3GRGA 5DHMC 3IFPA 5LCVH 4BFIB 2OR9L 3FUJA 1LO4H 5CFAA 1XBRA 1I7RB 2ALWA 5D1QB 5HHVL 3GHBH 4EIZC 1U8PA 4K3JL 1XZWA 1X3DA 3WJJA 4FLYA 1G7IB 3HG0A 3A0RA 3MZGB 5GONA 2JRIA 2OI9B 5CMAA 2ICES 2QKIB 2IG2H 3RGVD 4Z7NE 1NMBH 3K91A 2XKNB 4OUUA 2DI8A 4MZRA 4UV4H 4V1DB 5HXMA 2PW2B 2OMZA 2X7LB 4E9TA 1YPZF 1SF5A 3TZVA 4QY8A 4AMKL 4BR6A 4RETB 3BSGA 4J11A 3MGOB 1OQOA 3QEQD 4UWQB 5DK0B 3RWCA 4YJ2A 3U1SH 2F08A 1I1RA 5F7FA 4NXNO 1SY6H 4ZUVA 4U7MA 4LWSA 1VMGA 1I9RH 3MSPA 3MDSA 1LEGA 1YEKL 3NIFE 1SBBA 1I9IH 4ILDA 2BP0B 5DS8A 1NBVH 1SJHB 1J5EO 1C5DB 1TMCB 4ZUUA 1J8KA 1PLCA 4LSRL 3IETA 4HGMA 3UJJL 5ITZB 1X5FA 3PXLA 1URZA 1YDPA 2P5EA 1O5PA 3M1OA 4PV8A 3LYRA 2BSBA 3UBHA 3ZGIA 2HLFD 4GUPB 1MXGA 5F1NB 1RK0A 5GS3A 2ATPB 1RSOA 2VM3A 4QRPE 4FLWA 1ITBB 3Q4HA 1K85A 2X4NB 2Z6FA 3QIBA 2WLHA 3T6ZA 1N68A 2AJYL 4JFOA 5DO8A 2AHYA 5BW7C 3VG0H 1A64A 2OSXA 3D39D 1FNGB 1YLBB 3CDCA 3NJXA 2XG4A 3GIZH 5JXAL 3D34A 3KXFB 1U2HA 1S7TB 3ZLQC 4YHYC 1DEEA 3NEEA 3W0WB 3TV3L 3DTXA 3OQ3B 4RIRA 4KO9A 1JD9A 2L7JA 5EO9B 1K5QA 5CEXA 1H8EG 1FVCA 3FX7A 2A74B 4X6CB 5E4EC 5C1MB 4AGPA 1Z5LB 1I1AC 1RIHH 2ZSVA 2DEWX 2NUTA 5FPIA 3CRRA 2DYPB 2ZKOA 4IHBA 2ETWA 2P90A 5DQ9A 5GGQL 2R7EA 1WD8A 4ICXA 3F7YB 2C1PA 3MODH 5EOTA 1WBZA 1C08A 2QEJA 4YOKA 1WEJL 1ZWIB 4LPXA 5HSFA 1SLWA 3Q7JA 1HH6A 5EULV 2CHWA 1FJGO 1U8HA 4LLDA 5IQMA 2RCVA 1KU9A 2FGWH 2XNDG 4DO2A 1A6PA 2IGLA 5DCCA 4ZFOA 5KVGL 3FFDB 4B3TO 3OMNB 1FBIL 3HC3L 1JF1B 3X2QC 2EACA 2OW7A 2GHWB 1F58L 2Y0SA 2ZX6A 3BPOB 1KPUA 1JP5A 3L3OB 4UUJA 5CD5C 4YH6A 3AG7A 3PAVA 3WIIL 4DN3L 3W11C 2LLLA 2BX5A 2EVFA 1IZJA 5JW4N 2XQYK 3NA4A 5JIHA 5TJWK 4U1KA 4S1SH 2VKXA 4R50A 5L7XH 2GJJA 3WIFB 1E3FA 4QGYA 4PV1B 1OAYH 5D55A 3TA3A 3QORA 5KBLA 4TSCH 4P2RA 1B6UA 2VDMB 4KVNH 1FFTB 2FEJA 2BIMA 3MLRL 2KHAA 5A40E 3FH5A 2HLDG 3TWYA 1B0GB 1CIDA 2EYTB 2J7LA 2NW3A 3NJIA 5EZOH 1E4WH 3BP4A 1RJCA 1SQMA 3BFOA 3VWKC 2RJZA 4ZOCA 5HDBE 2CHZA 4HZ3A 4KHPO 1E27A 1TLKA 3HRZC 4X7TA 3ETBJ 3O0RH 1ZHKA 2XZAH 4NRYA 4HEPG 4FTVD 2IWGA 1J5OL 2F8XC 5AL8A 4YDNA 3VXQB 4AHCA 3SR2C 4OZHA 4NQDD 4W9ZA 5B4MC 1U8NB 1C12A 1FD9A 7FABH 3KYNB 2O30A 4IRZH 1TQUA 4JO3H 2IH3C 4N1CA 4HVBA 4UQIM 2H6PB 4OD2A 1KCSH 1LMIA 1OVZA 2ZT9B 1PZBA 3M07A 4B5ZA 3FN9A 3OKDA 1A0QL 1TQTA 4PRAB 1F6AA 1J11A 4BWAA 4AMXA 3I9PA 1M7XA 4LK4A 4DKFH 1UFIA 1N70A 1NDGA 2OXHA 2XWZA 4HBCH 2BSKA 1BBJA 3VQWA 2K4AA 2OTPA 4XNZC 4DV6O 3MRGA 4OLUL 1DVYA 3BIKB 4TSAH 4NKOB 4PJCF 3DX9A 3LKRB 3EDDA 1I7FA 3N3EA 4J2QA 2JE8A 1Z5HA 1JSYA 3D9AL 5HHOB 1NOFA 4A1RA 1HXYA 2I9TA 3B8SA 2Q8BH 1IM3D 3FONA 4BZYA 3DMMB 3V4VA 3QF7A 1WJZA 2V3DA 3LN5B 1XBLA 1JRHH 2G4EA 4PRHD 3RNQA 3PGCA 1DQIA 4DEPB 1CLOL 4OSUL 3B3BA 4ZTOH 1EFXA 1P7GA 2A3TA 1KEGH 1F51A 1IM9B 3UBXI 5L3GA 5FUZH 5KN5B 4BFNA 2EKSA 3ROLA 1J12A 5ENWA 3OZ9L 1JPGB 5IFJB 1XGQA 3LZOA 3RYFB 4A7GA 4ORGA 3NTCL 4FFVD 1K4CB 1K8IB 1ZEAL 2NCEA 4P9HC 3ZXAC 2AQSA 3BJLA 3EYSL 3KPRA 4HUXA 5E1HB 3EYUH 1AYOA 4D0DB 3JZYA 3K58A 2FYUH 3TO2B 1OTSC 5JLZA 3HG1E 5H6QA 5HYIA 4LLWA 3IEAA 3CU7A 2Y22A 5SWSA 5IJKC 4B7KA 4XXWA 1CE6A 1RSFA 1LP9A 4WI7A 3BVUA 2OMXB 3WUZA 2JS5A 1GJWA 5HD8C 1AXTL 4G72B 1LE5B 3OPZH 2Y1AA 5E6UB 2PPFA 4XNMA 5I6PA 4Y0GA 4DZ8B 2CXKA 1BREA 2D3JA 3BH8B 4L4VB 2CRYA 4L29A 4N6RB 5IB3A 2IJHA 5FOJA 2D4FA 4OI9A 4ODXB 3JWDH 2HFGH 3PV6A 5F72S 5TDPA 1A5FH 1WA8A 1KKDA 2P48B 1DJZA 4J8RA 3D3QA 1FXKC 2H94A 1D3CA 2R15A 3DO3A 3HZVB 3R0NA 3AU0A 4HKJB 4Z0XA 3MNWA 3SJVB 1Z3GL 2J44A 2FL5B 3NIGE 3VJ6B 2VERN 4YLBA 2Q76A 5E2UL 3T0EB 5BW7A 1NVPB 2JKTM 2PY5A 1R47A 4B5EA 5AB1A 4NNYB 2PP7A 3KBHE 1A3RH 3GI9H 1CGSH 3E8BA 1XR8A 2DBLL 3NT0A 5ITBL 3GM0A 5J1AA 5IKCA 3JALA 1COWG 2P43B 3Q8BA 4HZLB 4RRPA 5AAWC 4KAQL 4ZUTA 2NY1C 3K8MA 3W7TA 3W9DB 4DV4O 4O02B 4ZS6C 3ARXA 3DX7A 3RGBA 4Y16D 3V7AE 3V9CA 2ICEC 3I56V 1G6RB 5DEFB 1JK9A 4TLUA 4K07A 3HR5A 2X89D 4L4TD 3ZL4H 1OTTD 4J6RH 1S5IH 4Y9GA 3D30A 2BCMA 2E5LB 4UT9L 5A2BA 2J5WA 2JKNA 1NIEA 2QPEB 5D9SA 1KNOA 3VFUB 3S5LB 1P9MC 4HD5A 3HRZB 3FCSA 1QSEA 3MRRA 4L37B 3NH7H 3CVBA 1FH2A 2FX7H 1N0XL 2VDNB 4N0CD 4Z7QB 2ZUYA 2CIIB 5F9WC 1HWYA 1JPSH 2AKRB 1MI5B 3UZVA 3LD8B 4ADJA 2HJFC 3U79A 4FXKC 3T1HO 2XQBL 3PWPA 2I32A 4KQ0A 3FN0L 4JO1L 2DQCH 2ZP0T 1DQLH 4FFYH 4LKXB 3O3DB 3D36C 1JZJA 2B1IA 3AT0A 4W9KC 1IC5H 1ZGLB 4M4PA 3VFNA 5HYJE 4OCWH 4MA8H 4XP4L 5LGYA 1VADA 5HDBF 4HJSA 1FNFA 1NBVL 1SC5B 1DLHA 3E9UA 1K8AW 5D2NE 4U6YA 4WFHA 4YJ3B 2D03L 1LE9B 2LE9A 5FO8A 1GS8A 4TN9A 5GIRA 3HG2A 4CN1A 4IHOB 3C8DA 1TZHA 5E56A 1H3GA 1P4BL 3O8XB 1OLLA 4Y4KB 2B15A 1AR1C 3E2HC 4IGBD 4YDKH 5KBMA 5E4AA 1H8NA 3H3PL 1DLFL 4O00A 5KSVB 3BPLB 4ZO8A 2XFXB 1CDGA 5CJQH 3QUXB 3VSTA 5SX4H 3U2SB 4JI0B 3EH3B 1QUNB 1AGCA 3IU3A 3L4ZA 4QNHB 4ZZFA 4K7PX 3U83A 5HHQA 5T1DL 3VD4A 4NQXA 4DW1A 2UUBO 4LF3A 2B5IC 4Q6IA 2OSLA 4JI1B 1H5BB 4LO9A 4CVXA 3CG8A 4H88L 4KVPA 5DZNA 3ZMUA 4RQEA 4X83A 5SWZB 2CO4A 1MRCH 2WLJA 3DI3B 5FO7A 3L8QA 4FG4A 2FLMA 4DR6B 2W5PA 4XXCC 3L4CA 5D7LB 1C7TA 2ID5A 5EIIG 4G7SB 4CC4C 2PWFA 3KXFE 5GGQH 3FTWA 2LGWA 1QLFB 1JGLL 3G5ZB 3L3JA 4NC1E 2A9HA 2XTAA 4HMDA 4DGIL 1SQGA 1U0QA 4K0KO 2CPUA 3LHPH 5B38B 4AIZB 2DQGH 3OB0K 1R1CA 4JJHA 3KR3L 4ATTA 3ZHFA 2LW7A 4OCRL 3U1QA 3BE1H 4D8PA 3L75H 5IT9N 3W1ZA 4PP1C 5TDOA 2E5LO 1OO2A 4UZGA 4ZQKB 2XCMC 5J11C 2UZIH 3ZTDC 3T04D 2B5UA 1EZVY 4H25B 1WLEA 3QEHA 4PJAA 4IIQA 5T5FA 2JFCA 5JDSB 5GSRA 1KIRB 1T0MB 5CZKA 5KVDH 2EINB 4LCUB 2ADGB 3QZWA 1OZUA 4DERA 1BMFG 3P3NA 3D0VA 5KHIA 4IOFC 3STLA 3UDWA 5K1NA 2B0SH 4PH8A 4O2EB 15C8L 4YSPA 5C0IA 2Z8VC 1CGUA 3HE6A 1MWAL 4DR3B 3CJHB 4NO0B 4CILA 1O7SA 2GFBB 2WAQA 4LF7B 2EDRA 1AACA 1TCRA 2ERJB 3H9SA 4HIPA 4LLQB 4WJ5A 3T3PE 3TO4D 3UP1A 2NXYD 1WC7A 3MV9D 3UACA 3QXAA 5C08B 4JGSA 1UG9A 3HMWL 3N6YA 1GZQB 2WC7A 5H4ZA 5ICYB 4KO6A 2NT1A 4JM2C 3WXWH 1OXYA 3RFZB 2YPLB 3WEXB 1EZUA 3FO1B 4U1NA 2R56L 3DIVA 3HUJB 4Z78B 1E2VA 2APSA 5DVKA 4D3CH 3R7QA 3KWUA 3W3BA 1ET7A 1NH2B 1J5CA 4FYQA 2ADFH 1ZIAA 3RQ3A 3HPJB 2MRYA 1HNGA 5FHBH 4I8DA 3UJIH 2R9AA 1JD7A 1EMTH 2G75A 3ULUL 5MP6L 3U0WL 2VLRA 4XBPA 3IKCA 3N42B 3HKDA 1N0LA 4DQOH 4JI5O 1K6QL 1CEZA 4OFIA 3RWCB 2NYKA 2XY2A 4XRCB 4X1IB 1SVZA 2ZOTA 4OLYL 3MLVH 4G3YL 4WF9V 3GK8L 4JYCA 5DO2C 3F58H 2OYLA 2QFPA 4RCAA 3SDDB 2CO1A 5I1CL 5L9DH 1BMWA 1BGXH 3CC5A 4MS2A 1XHXA 4W9LC 1X4YA 3WXVH 3BGMB 2FJGB 4WY7L 2Y7LA 3T0VA 2VC2L 3CXHF 5C8JA 1AH1A 3CRQA 4AV0A 1KLGA 2X9YA 3KGSA 1U6AL 5I5MA 1UH2A 5DZJA 1HHKA 3FO9A 1Q8MA 3DPBA 1F3JA 3AVEA 1A2YA 4CVUA 3RW0A 1F2QA 5AAMC 3SBWA 2IH1C 4PUBH 3LZRA 3KWWA 2AP2A 5JZ7D 5DK2B 2GUOA 2ADJB 3HKZA 4X7SH 4BDVB 4JY4B 3EJYD 3PL6C 1R4XA 2GBOA 2D7TH 3M17A 4O5LH 5J6GB 3AB0B 4I4WA 4ZFQA 3G80A 1Q9LA 4WLCA 5DDHA 4HV8A 1NCOA 1KTLB 2CLVB 4OF7A 5E2VL 4P59L 3DTXB 4RIRB 3K5OA 1MAJA 4G7QB 5FDWB 5B21A 3TH2T 3WFDH 4PGZA 4M7ZC 3FQWB 2WZPD 4MHHI 2VDOB 5KSBA 4JBSA 5E2WL 1O9VA 3B2MA 5E9NA 4H8PA 1RUPH 4PJEA 5JPMA 4X64O 1PKQB 2R2CA 3ZHVA 2NX5B 3N44B 1UOWA 3T2PA 5DEDA 1C08B 3CLFH 3IKKA 3CSYB 3HR0A 3K2KA 3N9GH 4KK8D 4PYHA 5DRWB 5DRXB 3S4SG 3UBGA 3ZHNA 1A3LH 1G1XB 2UVFA 2W94A 3L7EA 2QV4A 3MRDA 4P2RD 4PJ8A 5EUOB 4WTWA 4MJ6A 1CIUA 2WOBA 5CGYD 3PG2A 4Y4HA 1M57B 2E7CA 4JV5B 4M6ML 4DVRH 4MNGE 1DTOA 1M7DA 1T0PB 2XV2A 5D5MF 5DC2A 5F7DA 4F8OA 4DK0A 1MHEB 3TVMB 1A7NH 3HAEH 3VVVA 5GS0H 3D5OF 5JMOC 5TGBA 4ORZC 2OMZB 3EDEA 4G7YL 2L7UA 2FO1A 4HZAA 3RDTD 2XA8H 1NCNA 3G5VA 2UZPA 4Z7OF 2V9UA 3MGOA 3QEGL 4YO0A 3UMNA 4UQCA 2J8UE 1PBYA 1BYOA 2GIXA 4PPTA 4ZMPA 4HCRH 1DQML 3OKLA 1YYLH 1TLMA 3P4OB 5CZXD 4F8NA 4UQ2A 2V1DA 2YMXL 3HFML 3QO0B 5GRVL 1SJHA 2RAMA 3WJLC 5EZYA 4F57L 5DHVH 1QW9A 5KLVH 1IGIH 1AJ7L 1O9GA 1GN4A 4NDMB 4ZUWB 1LP9F 4EDXB 4D94A 4CNIB 1T5EA 4QNPF 4DP4X 5E0FA 3ZMSA 1GL4B 2NZ1A 2V0AA 2KQXA 1S7QB 5EF0A 3FQTB 2BIQA 2BNRD 3GRBA 1WIUA 2C7UB 4I50B 3KPLB 1FL5B 3MJ6A 4XOEA 1SNRA 5LBVA 2AXJA 1PLGH 1JHTB 3DXAE 1L7TL 1ZTXE 3FU9A 4Q7DA 4G6FB 3BZ4B 1PZ2A 5KWYC 1H9VA 2ZCKL 5H8DA 2P7TC 2UWEF 3VXQA 4WFEE 1H8SA 3OGCB 4KNSA 5GZNA 4EAEA 2ZE7A 2GW5A 4C4KO 2WCGA 3CMAV 4ZMOA 3QA3A 1MW0A 1CZ8H 2QTEA 2ZSVB 4XXCA 2VLMD 5IV2A 4Y16A 4FTVE 4KHPB 2DMGA 2GJ6A 3RZCC 4FQ2H 1WN7A 5FPRA 4O4LA 1Y6MR 3BKML 3CFDB 3F7YA 4FG0A 3SOTA 1UURA 2CGRL 3VM5A 5D70L 1L9SA 4Q4EA 3TT3L 2ZOKA 5C0FB 2LGQA 4ODWA 2ZKMX 1OP5H 5C7XL 5HTSA 5GZOD 4PTUB 4OAWB 4OM1H 2XTSA 4U1HB 4N87A 1LQSR 2F54D 2CRZA 2OJEA 3QEQA 3ZO9A 1HAWA 1WA0X 1YRKA 3LUTB 2GT9B 4RO2A 3FT1A 1JF6A 3HN8A 4PJGE 2E3VA 4GXUN 2R8SL 1MFUA 3DV4A 4WFGE 1E8YA 2AJZB 2QR4A 2LO1A 1MCBA 1N8RW 4RBPH 3VI4E 4MDJA 2RDCA 4L1HA 4LLUA 2P67A 2AW2A 3H9SE 2GBAA 5IMLA 2EADA 2W6JG 4UUJC 2A6DA 3FTVA 3OX8B 4NT6B 3EF7A 4LCYA 2JJ1G 2BS9A 4PJXF 5F2FA 2QSAA 3V0IA 4G42A 3U7YL 4A2FA 2GJ6D 1HSBB 4HLJA 3V8CA 2D3NA 4ODVL 3WIHH 3L5XL 3CVHH 2LTQB 5H5NA 4P8QA 3LIZA 1G9HA 2BNQD 2J55A 1Q9OB 1CYXA 3M1BB 3GQFA 3HC4H 4Q2ZB 4B3MO 3H01A 1OF2B 1MJ8L 4FNSA 2F53B 3Q8EA 2EIZB 3GS4A 3UG4A 4NFCA 5FR3A 3IVKB 3QCUH 4PDLA 2AQNA 4NKDA 4WI9A 5BV7C 3BWSA 4HOWA 3ECWA 1AG6A 4LIQL 1BE3H 1Q0EA 3GXDA 2QL1A 3OKYA 2A83A 4R8WH 5F6IB 1A6WL 2YAFA 2VL4A 1F13A 1C12B 4WTZA 2IM9A 5EWIL 2VJ0A 3JWDL 5JA9A 2FRGP 2DKSA 3OKKA 1ZIBA 4LBEA 1AS7A 2X89A 2V4DA 4XP5L 1EV2E 4BSWA 1EHLL 3VJ6A 3ZPDA 2Y72A 4LHUB 1FLRH 1MG3C 1T6WA 2YI9A 5KJ4A 3UZEC 3V9FA 4ZS7L 3ZN0A 4N22A 1MAMH 1A3RL 3BIKA 5L8KB 2EILB 3RJQB 2E7LC 2H4EA 3LKRA 4FMVA 2DQHL 3MN8A 1QHQA 3FT3A 3KYMB 1MEXH 1HZHH 3AXHA 5IQ9A 5AQ0A 1UM5H 2FHBA 5GPRA 2CCVA 4XVSL 3FOLB 1PY9A 1FZMA 3GRWH 4A7QA 3ETEA 5AKSA 5MHSD 2K8QA 5G4OA 1N32O 3SGDI 1BLNB 1YVWA 3VOUA 3F65A 3TBYB 4PBWD 4N2OA 5E7BA 2EDOA 5E6SB 5AW9B 3ZHDA 1KTKE 3FU7A 4G7VH 4CMMB 1K5WA 2O61B 4KJQC 4EZJA 2ODMA 3CVCA 5FLVA 4G83A 2PGGA 3JV6B 4FLXA 2GVYA 1JMKC 5KBKA 3N43F 3V10A 4ZXBB 4I18B 2OQJA 4RFOH 5B7EA 4KGJA 2PP9A 3ZYJA 2XN2A 4OF0A 1RZ8A 3TV8A 1P7QA 2VW4A 1AIFB 2HKAA 4EUPH 2FHCA 3HPLC 3V6OE 4NP9A 3CHQA 1BVNT 1J8SA 4XB7A 1W72B 5CCHE 1U42A 3ECQA 3U6RB 5IHLB 3SKMB 3A0OA 5F9OH 1KEML 1X6LA 4HFUL 3KPRB 3WG7C 1XH2A 5EBWA 4IYIA 2WP3O 4J3OC 3SCMD 4YXKH 5T3ZE 2WZPA 2VQ1B 4FYRA 2H3KA 3RYHB 4EI6A 4R6ZA 3PCYA 3FUKA 2XKSA 4P5TA 4C56E 1FIEA 4IOSA 1EN5A 5LG1A 3FQNA 3G71V 3L3IB 3ZEDA 3KDMA 3MXVH 1QSEE 4JS7A 1OGTA 3CXHK 3MJ8A 4LHUG 1IBMO 2CNYA 4NHUB 3V6FB 4JDTH 2ILMA 4P46C 4QT5B 4TNVF 3FB5B 3C5JA 5CD3A 4NYKA 5L0QC 4GKJO 1UQSA 1TPXC 2HRHA 5FA3A 1TTGA 5GGRB 3TIDB 5B66Z 2BP5M 2GCYB 2VLLA 2HH0H 1P6AB 3MLWH 2XFXA 3U2SA 1PZAA 5D1QC 1ZCRA 1JQ0A 3HZVA 5HVWA 1P1VA 2FL5A 4Y5VA 3IU3B 5HHQB 3I6GA 5FHAL 5L2KB 4GRMA 1WIOA 2O5YL 2YLHA 1E8ZA 3L3KA 4A39A 1GN6A 3TFKD 2R69A 3CXDH 4UVBA 4N8CL 3MOBH 3R0MA 4QTIL 4H88H 5J1AB 4CH5A 1RPOA 1MDAA 4YBQC 2YMTA 4BA0A 3CRCA 4YDVA 4S0TD 4UT6H 1O7VA 2X3AA 4O2CA 4OJYA 3S2AA 1K33A 4TQEH 1NFIB 1DJXA 2HPOA 3EJJX 4W4OC 1PY0A 3FPXA 2WNWA 4Y19D 3HR5B 1AD9A 4MMXB 1A6AA 1OK0A 2CDFA 4FZEL 3RWHB 3RYCA 1ZD6A 2IOMA 3SE9H 3V6ZA 5CEZH 4GIPD 1DVSA 1IC1A 2WLIB 3H85A 4GAJH 3VH8G 3QDME 3EJTA 2LHAA 2ZCZA 4DVRL 5JZ7C 1R5WA 4D8PB 2R2EB 1QSEB 3MRRB 3WMPA 3BKJH 4LH6A 1T5WB 3EH2A 5LDSA 3S9DB 3MROB 2F58L 1FXKA 1P49A 4KZCA 2XTJE 3KW7A 4ZO7A 5AW3B 5AWNL 1MFBL 1PPJH 4DV1B 5HHMB 2C9SA 2BY0A 1B3JA 4IJ3B 3X3FL 1MI5A 3UZVB 4YWGH 3G7TA 2G3MA 5EIQA 3QCVL 1P4IL 4OCMC 2QGCA 4DEWA 1MCLA 2EUXA 3B9KA 3PWPB 3H9SD 4X6FA 2CDYA 3QUKB 4K5LA 4JAVA 4F7MA 2R59A 4EZMA 1R3JC 1F4XH 2BP0A 2CKBB 2P5ED 3BH4A 1QSFD 2H45A 2UZYA 2XVKA 3TESA 2KT6A 4XMZA 4NXNB 3QPXL 1ID2A 3U9WA 3BT2L 1U8OB 5F7MC 5MEOB 1WWWX 3C5ZB 3EHBD 4GO6B 4OZGA 4F57H 4E5XA 5FW7A 1BAFH 2DQUH 4LNUA 3CFEB 4WK4B 3C08H 3VGGA 2PO6B 1JGDB 2W38A 2P9RA 4J7ZA 4LSUH 4G9DA 2MQCA 1UATA 3JAWB 3SJQC 2PWHA 4JPKH 4KMTH 4E9SA 4Z78A 1BF5A 3SD5A 2Y06L 5L7XL 3KXFA 2NDGA 1HR0O 1PSKL 2OJ1A 3VW3H 3G5XB 4MSWC 2J43A 3ARYA 5EO9A 2XPGB 2AITA 2DQMA 4NQXB 4LP4A 2HJKA 4CKQA 3RB5A 3ZTJG 3V5KB 4M48H 1MJJA 4C57C 5JORA 3ZTNL 3EJCA 3OJDA 5KSBE 2I26N 1IEAA 4D0CB 1FAKT 2EO7A 4XCFL 5E6YA 2V6HA 1VF6C 2C1PB 2DQ0A 5DR5H 4Y5YB 1YMMA 3EGXB 1U58B 3DX8A 3REVB 3KLKA 5HHVH 1T80A 4PJIE 1YAZA 1F11B 2IANA 3BKMH 4M4RA 3STLC 1S46A 1AHWA 4KQ3L 1XTMA 2CBOA 1BFVL 3O81A 2LTQC 4P99A 4KKCD 1QBMH 2QVKA 2DAVA 1CF1A 4S1DC 1PKOA 4OM1L 4UV4L 3QUHA 4L8DA 4P9PA 3P30H 5TDOB 4QRSB 1NR1A 4PJIF 1F3JB 5I18H 5ES4B 3T0EC 4DV0B 1HI6B 4KXAA 3PFQA 3SQOH 3QEHB 4BK8A 4DSYA 3U1SL 2BVOA 4ZFFA 4BDVA 4POYA 4Z3HA 2F0CA 2YPVH 4KKLD 4WFHD 1Q9LB 4WU7B 5DJAA 2YQGA 2A77H 4FQXA 4O2EA 5E2VH 4HK0B 4N2FA 2I07A 1CFSB 3LRLA 4AK1A 4MB1A 4XDLA 3GSXB 5I1LB 5AOJA 2FTKA 3O2DL 1M05A 2AV7A 4IBZA 4EKWA 4BH7B 1UPGA 3AGWA 4XCEA 2Z35A 5GGTL 3A6CL 5DJ6A 1M9WA 1MW1A 3LPFA 5IJBC 4MD5A 1WT5C 3SDAC 2PUSA 3U11A 3S34L 1Q81W 3E22A 1RU9H 1KEGL 3N50A 3WEXA 4HS6A 1BQHA 2A4ZA 5F3HB 3S7GA 5TK2A 2WO2B 4JG0L 4Y4HB 2WXMA 2FWSA 1GA2A 2C34A 2YKKA 4AJYV 4ELMF 5IIEA 1HVXA 1OB1A 1W8OA 2VJ8A 3QE5A 3VRLE 1CQYA 3DJSA 4XE5B 4IRSD 3VXSB 2H47C 4X99B 4L4TA 1BHGA 3D18B 1OW0C 2ESVE 4MZIA 5JQIB 2M83A 1GO3F 4N5EC 4EB6B 2CO7B 4J3OD 3CLWA 1SN5A 1BZ8A 3VGAB 5HI4D 2LR4A 1IURA 4ANUA 1UKTA 1OHHG 2CG9X 4QRTB 3FUFA 5LGHH 3V55A 5I8EB 2OJZL 4WGWB 2Q5ZA 1TUBB 2FT6A 3BZ5A 1DBBH 4FXTA 3WB0A 1UB5A 1MSWD 2GTWA 2ZNWA 4K0OA 1AXTH 3AITA 3WL9A 4BYHA 7PCYA 1T22A 2PCPA 2WNKA 4JFPA 5BJTA 2GC7C 2DOCA 4U3JB 2A99A 4U7KA 5KANI 2F68X 4Y9BA 4N0UE 3FB8B 4EDXA 3AJ7A 1ZT1B 3LV3A 3FZUD 5FO2A 1E2WA 2XVGA 4UQ3A 2EJRA 2Y5QA 3DPBB 3FQTA 3TH3T 3T09A 4F7TB 1FHGA 5IT2H 3S48A 4LVEA 2VN6A 4OZIB 4JV5O 3KBEA 3H3KA 4IRJD 4HUMB 2Q7AA 2JTDA 1R3KC 2ZWKA 5T1LB 3BD3A 3CBJB 2AI0H 4AVJA 1C7SA 1OAUH 3QC6X 1VF5B 2KDGA 4RFNB 4J27A 1BG9A 4NC1C 2J3SA 2RQEA 1QQDA 3OPUA 1G1YA 1JR9A 2A9CA 4HHGA 3CE1A 3U7WH 2YFNA 2F5BH 3GEWB 4HUXB 1XXDC 4JQIH 4UT7H 4XP9L 3VXTB 1LEKB 3DBSA 5AVRB 3WDHA 1OAQH 4PJCA 1K2DB 3VWKD 1J5HA 3K0GA 4CN4A 4AC4A 4MTXA 5EZOL 3LQZB 5E5LA 2X05A 3MX0A 1K73W 1UADC 4FNPA 4ZAKB 3MOAL 5IFHH 4Z7NB 1UEYA 3B8YA 3HTLX 5TQ2H 1BPVA 1CP9A 1GAFL 3AT8A 3T4AB 5KS9B 1NIFA 1CGXA 1SLUA 3SGDH 4Y5XC 5KA5A 4JO8A 4PTUA 4OAWA 1ORSB 4N8UA 5H6RA 4ODXA 5EFIB 1FXVA 4TLSA 1B9ZA 1T04A 4GAAA 3UABA 4LL1A 5IHUL 2XZCH 3EBIA 4LF5O 4XE0A 5DC9B 3JQOB 5TGBB 5CR1A 5I28A 4Z0XB 2BOCB 4DKFL 3NCFB 1DJIA 3A23A 2UWEB 2DM3A 1TIUA 2FSDA 2XAHA 2JK5B 1IQDA 2VSDA 5ANMB 2NR6A 1IBMB 1UVQA 4W9HC 4KJPD 4CU8A 5IWLA 3KKYA 4TVPL 3KPNA 1WICA 3BESR 3D3VA 2WBJA 5IKCB 5HBBA 2VZOA 3RI5K 1OSPH 1BVKB 1NMCC 3KGUA 5F7EL 3DOSB 5F1NA 5D7JD 2CLZB 3PWLB 1I3GH 1Z9LA 4O02A 3QXDB 4NN5B 4NXMO 2WLZA 4PRNB 2NY6D 3QIBB 1JRHL 1GS6X 2VO5A 1FYTA 3MMEB 3LRSB 3O9WD 4XNXL 3QEQE 3RIKA 1X5YA 4E5XG 5AW4B 5E9DE 3ARUA 1U92B 5JPNB 1DCLA 2C7UA 3VFUA 3MLUL 1YEEH 4FLZA 1F18A 2O72A 4YN3A 3VX1A 2Q3XA 1PQZA 4P46D 3QHZL 2YUVA 4W93A 4AQ1A 2DWYA 3CX2A 2BVEA 3ZL1A 1NEPA 3OLIA 1WZ1L 1L6XA 4DK5A 1FVCB 2A74A 4AIOA 5EB9A 2YO3A 3T9WA 2AJSH 1AZVA 1USZA 2LT9A 3OGCA 2D3OW 2DQFB 2YAHA 4ODUB 2WZ0A 1K97A 3T4YA 5L0QB 5DQ9B 1A6VL 2CWRA 3OHXC 3S2CA 4NHCL 4WCEV 2GB2A 2ZOUA 1TQWA 3KYAA 3V0WL 1WSST 4DUYO 1KN2L 2A4CA 1ZWIA 5EA0L 1HESA 2R0WH 1D6EB 3RNKA 3DO7B 1H15A 5ANME 1U8HB 4LLDB 3BOVA 3IK2A 3DVGB 4XZUA 2XPYA 3EOBA 3FRUA 4A7TA 1OE2A 3D48R 3QI9D 2WWNA 2OK0L 4YE0A 3LDEA 5DURD 3QULA 3CGTA 4HCIA 2EDJA 1P1ZB 4PJ7B 3OR6C 1FZMB 4BZ2H 2H32B 3SGKA 3T8MA 2UUDK 1E90A 1YYML 3GHEH 2Q67A 3SKNA 1J1PL 4QNPE 5BRZB 4L3ED 2KDYA 2O61A 4BWTA 1RIUL 4Z1VA 1QUNA 5FAAA 1TSRA 2KUTA 4H8WL 2A2QT 4X8XA 1H3WM 15C8H 5IMOB 3RWIA 2VLJD 3KLAA 3F7VB 3PU7A 5FL7G 3US0A 3S97C 1LO5A 1U4FA 5SX5K 5GGVL 1DL7L 1G4YB 3CD4A 4OVUA 1MWOA 2ZUTA 1W6WA 4TNFA 2BP8A 4WO4B 3ZMTA 3H1LH 1YEFH 1RZJH 1J0KA 2DDQH 4CH6A 1H3XA 2W1NA 2WSSG 4G8FB 5H37H 5EF2A 3AC0A 1HP8A 4OZGF 2DQDL 4MQXD 3WV0A 2R1WB 1BHAA 4ELMB 4OQTA 4ZNCD 5DT1L 1Q9OA 5C71A 1SMOA 3TN0B 1BQSA 5SX4I 4OTXL 1HR0B 5D7SL 1T1WA 4DP5X 1AVMA 1H6EA 3HJEA 4JRLA 4XGZA 2IBBA 1IT9H 3IVKA 1C8PA 4IRSC 3BRFA 2XWJB 1M3IA 1OP9A 1NTKH 2ZWNA 3EIFA 3VFRB 4ODHL 4G8GB 3GF8A 4HS3A 5AOZA 4ETQB 4GT7A 3RVUC 4LRNH 2R83A 3VI3B 4IIQB 3H1IH 4P23B 4APQD 1UQSB 4TNVK 1MZFA 4A6YB 1BMGA 3ZUNC 5T3XE 4NENA 5E8DH 5FLXN 1FGVL 2A9BA 3VXNA 2ZUXA 3D8CA 4GQQA 4XAKE 4N0FA 3T71A 1RH8A 1I9EA 1JG9A 1BW8A 3FQXB 4EFEA 2ICCA 1AXSB 3DX9B 3UYRL 4ASUG 1S3KH 1FKAO 2L04A 1QO3B 2WSDA 4GRWE 2A9MH 3C75A 1GYAA 1WZLA 2QHLA 3D2UA 2HR3A 4F7PB 2PW1A 4UDTB 3ZIYA 2KQMA 4XMKH 1BVOA 3AG3C 2PXYC 3RL2B 2Y25A 4QKTA 2QSQA 2XC8A 4POZD 3AZUA 2RFXA 4DR1B 3O6KH 4Y8DC 2KPNA 5FUCC 1TG8A 2FAUA 4YS4A 1QLRA 1MG1A 4DK3A 3F5WC 4YHOH 4AL8H 3JSSA 1YEGH 5EIVA 2L35A 1NCBL 4BQ9A 4MLSA 2YEVA 4I55A 1XF4B 1JZ6A 5C2BH 1T3FA 5AW5B 1ITCA 2CM6A 4G9FA 5EOCH 1V05A 1R5WB 2MSPA 4RAUA 1IXBA 3BAIA 4N8VG 4KKBD 4XOAA 3U48A 4Q9RH 4PREB 3FSWA 1FO0L 5AKRA 1P7QB 2C26A 3EOTH 1EX0A 2F58H 2H6OA 4L2LA 3QIWD 3MAQA 4FIPC 2BIIA 1X4TA 2ESVD 4PGBB 4AMWA 5CJ5A 1A25A 5F7AA 3T1CA 4ZPTB 1PZCA 1NKRA 2YXLA 4Y9FA 1YMME 3V52H 3WE6B 4I3RL 1XDCA 3EJSA 1LP9B 3X3GH 1KLUA 2ITDA 5I1DB 4P3CH 5HYSG 4WFEA 3M8OH 3LHAA 3WSQH 1NCAL 3SGKC 2IU0A 2X2HA 2WLMA 2UZYB 3INUL 3CCUV 3K6SA 1HHIB 3K2IA 4FQXD 1FFOA 2Y4UA 4JPWH 2DQTL 1BG1A 2UXDO 1SJXA 3FQNB 2VWJA 4L8BB 3FAXA 3BH9B 4OI7A 2HKHL 1KDIA 5LQBL 5GS0L 4DR7B 4UCSA 2ZXWB 1WS7A 3D52A 5EBLC 5ESQB 1EBAA 2NY4B 3I85A 3O45A 4K8RD 2AXFA 3UTPE 3JAWA 1FHNA 5IT2L 3PPEA 3TF7C 5GGRA 4RDQF 1O9ZA 4ZI8A 3SHSA 1JNNH 3EXLA 4ZYKA 2CLVA 2AEWA 2QGBA 4IKKA 3G5XA 4JN2B 3VI4B 1QRKA 2DICA 3P73A 4DR5O 1TVBB 2WUBH 3B37A 2DL9A 3TA3C 1SN0A 3ME0B 4PSPA 4ZUTB 4JPVL 4X6BB 1A4JA 1GYUA 1HSAB 1AZCA 3DYPA 4AXWA 2Z9TA 1SXZA 3EOAA 4M48L 5EC2C 3LKQB 1U95B 3U7WL 2EIKB 5DHVB 4D0CA 4JQIL 4UILL 4RGND 4UT7L 4JHWH 2F5AH 5L2KE 4X1KB 1P2CB 1BFOB 2PYFB 5DHDA 4Y1AE 2ITFA 2YD1A 2XT1B 3U9UA 3BPZA 4WHDA 1TOXA 1VFUA 2EDBA 4K8RL 5E8EA 3W81A 3TJPA 1AHWB 1EDHA 1X4ZA 5DLML 3UTTA 5EIIA 3V6ZB 1SESA 3MJ9A 2DYRC 5AEAA 2HKFH 1IKNA 1KFAL 3SY0A 1HDJA 3OKOB 4FJZA 1EMTL 4TOYH 4ZK8A 6FABL 2QV2A 2AKRA 4A38A 2VN4A 2X6BA 1T5WA 4ELDA 5L2JA 1V54B 5KJRH 3RUGA 3ARED 5KYUA 1O9WA 3W57A 4OFVA 4B3EA 2DJ4A 3WELA 1KYFA 4DP8X 4LKXA 3RTQB 4HFWA 2R69H 1ZGLA 5B3JF 1P84J 4A5UB 1UZ6E 3LNEA 3LS5H 5IQNA 4BZ1L 1SVCP 3NSCA 2CA4A 3I2CH 3NK3A 5L9DL 4HIIA 4RBPK 3SE4A 1J5DA 1E9OB 3O4LB 1VACB 1BA9A 3KCWA 4H1LH 4W68A 5AW8B 5KOMC 4ACPA 5FB8B 2VKWA 2OR8A 2HEPA 2VNCA 4EFBA 1PG7X 4OD1L 3K08A 3WKMH 1I1CA 2ED6A 1K3ZA 3B9KD 3Q6FB 4DR1O 2AEPH 4R26H 4XCEB 3WTVA 3GBNH 1AI6A 2A0LA 2Y6SD 4G8EA 3IDJB 3OGIB 4LNUB 3QQNA 4GP4B 4JO4L 4P0DA 4XAKD 2DLFL 1J9TA 3KM1A 3DBXA 3AK1A 5LP6A 2J6WA 4N2DA 4Q9QL 4OJEH 4B3SO 2D7NA 4NS0A 4NBZB 4V2CB 4X80H 2UXBO 3PWVB 3VA2C 1HAUA 1J10A 4R4ND 2EH8L 5GTIZ 3WJMA 4PY7B 1LDSA 4NN6B 1H5BA 2VITA 1R3LC 4U0RB 1N59A 1AR1B 3E2HB 1NH6A 1Y0LB 3O3EA 3DRTB 4LCVA 5CN2A 1OY3B 3D18A 1QKZH 3LSOB 3HKCB 1H2KA 1CFMA 1GGBH 3C87A 4CVZB 4LAJH 4AYGA 1T83C 4M7KL 4GKNB 5CGYC 5H35A 4KROD 5LNEA 1AO7B 1X5XA 3G6AB 4KY2A 1MJ8H 5JR1L 5LGHL 4AQAA 4PI0A 3VXMA 1B0RB 4PCYA 5TISZ 4DF9A 1I4FA 1KG0A 1NUNB 4IMKC 4PAZA 4EVNB 5BMFH 1YHPA 2A3QA 4ZT1A 1NIBA 4KKZA 5DK3A 3JAMN 4ZX4A 4XDKA 3FB8A 1XUQA 2V8MA 4ZO9A 1SHWA 3GHPA 1QU7A 2F15A 3K8LA 3BLBA 3GT6A 4YR6B 3UBXB 2YD8A 4UAHA 3H53A 4F9LC 1OEZW 2J8UF 4L8SB 3FSZA 3FFQA 3NZHH 4M9OA 5LMNB 1HOCA 1KXTB 3TP4A 5ICZB 1Z6JT 2XZZA 3ZN6A 4YHKL 1GIGL 4EI5A 4RFEB 1E67A 4XVOA 5A1AA 5D6DA 4MTFA 2OX5A 5KBDA 1R3LB 5C0CE 1LNUA 4LF7O 4I1RA 3ZHUA 12E8H 2FD6H 3FMGL 3OAUH 1W2BU 2NR6C 1AJ7H 4NUQA 5INCB 4F3FA 4X50A 3ISRA 3H1ZA 1IGCL 4M6NL 3FCTB 4OB5L 4ABVA 3RPIA 1OV9A 2F74B 4Q2ZA 3QAQA 3QXTA 1OGAE 3SPIA 2IALB 5DUPH 2BOLA 4CC1A 4MD5B 3HUJA 2OR9H 5AVZB 5DGRA 3SDCA 2Z91A 4LDLB 2QGDA 2GY5A 3IMRA 1IGJB 4XP6H 2IH3A 1G8MA 2AJYH 1SQVH 1TVKA 3CHRA 5F1OB 2JQMA 3MACL 1YNKL 4GLRH 1XCQA 4PJ7F 3F2LA 2COQA 2NY0B 1FCCA 1BFTA 4YSSA 2X40A 1O75A 5AW0B 2IDQA 3UL4A 1Y7VA 4ODHH 2WIMA 1UFUA 1V5JA 3QT2A 3V0JA 5KSUB 1LUWA 4JQXA 5F9JB 5AYQA 3K1DA 1EHAA 3FBKA 1BCIA 5LAXA 4YDLC 1W72H 5DLLA 1ID5I 4XRCA 3G4SV 1CE1H 3FCGA 4MS8C 5A2IH 4YXKL 1JXGA 1FJ1B 5L8LB 1HK6A 3N1MC 1TJHL 3SDDA 3BUIA 4TV9B 1R3KB 4JUSA 5LNGA 2Z8SA 4ODSL 4BQ8A 2LW3A 3WU1A 4TVPH 1P6FA 2VN7A 3ILPA 4OGAC 3TBWA 4LVOB 3UC2A 5D4HA 3S96B 1PL4A 2AFNA 3JD0A 4ZODA 2ZAGA 4JFPB 5BJTB 1D9KA 1YQ2A 4R90L 1AHWC 4PJEF 4AEIH 1WGVA 1F3RB 1BLNA 2NSQA 4L3CB 4MJIB 2RMKB 4G6JH 5DD1H 1O7DE 2QQNH 1LHZA 1N19A 3I9GH 3Q8AA 3D8MA 4GG6E 1CLYL 5B3SC 4FMFA 3W82A 5DMKB 4Z0BL 4EI0A 5JPNA 4L48A 4F7TA 5CSBA 2FWLB 4I4WB 5LHDA 4UT9A 3IWVA 3VXRD 1TETH 1UM6L 2Z65C 4TUKL 4FQIH 3LKOB 4QYAA 4H8WC 3DJZA 3MRLB 3S5YA 5FDWA 4K94C 1XOUA 1G7PB 4QHLB 2JVDA 4N25A 3K04A 3GIZL 4I3GA 3V0DA 5JXAH 1WPCA 4YDMA 3ARQA 2UXFA 3B2UC 3P9MB 5IYBO 3QJHB 1AP2A 2GJPA 3HI1A 3EOTL 5IJ0A 1Q9WA 4CGUB 1JMXA 4OVVA 4APXA 2PCYA 3TS8A 5IDJA 3BEWB 3S3JA 5IBTL 2HSIA 2J1WA 2VQ1A 2VYRE 3CSYA 4BGLA 3U