3ASOB

Bovine heart cytochrome c oxidase in the fully oxidized state measured at 0.9 angstrom wavelength
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
226
structure length
226
Chain Sequence
b'AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Distinguishing between Cl- and O2(2-) as the bridging element between Fe3+ and Cu2+ in resting-oxidized cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 67
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3asoB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3asoB02
3PXLA 1NZRA 2J56A 2IWKA 3CZUB 3T6VA 1GY2A 3S8GB 2CAKA 1OCOB 2R7EA 2PP8A 4YSSA 2XU9A 4KO7A 5IY5B 1JXFA 3ZIYA 1BXAA 1IUZA 3EH4B 3JT2A 4NAJA 1A8ZA 2PCFA 1L9QA 1NIAA 7PCYA 1SDDB 1ET5A 4AKQA 1PF3A 1BAWA 1IC0A 4Q89A 3AG2B 4A2DA 2PPFA 4EF3A 1RCYA 2Q9OA 1KV7A 4KO6A 5B1BB 2CJ3A 2YARA 1KDJA 2PPDA 1PMYA 1OCCB 1OE1A 4DP8X 2HLEB 2XX0A 1AR1B 1E65A 1AAJA 4YVUA 2XV0A 2BP8A 2BO0A 2EILB 5TK2A 1AACA 2IH8A 3ASNB 1UATA 3PAVA 2GSMB 2N0MA 2CBPA 1E67A 4KO5A 5I5IA 1J5CA 2YAMA 8PAZA 4HZ1A 1NIEA 3KW8A 2H3XC 2WO2B 3AG4B 1HFUA 1AZUA 2GC4C 3NP3A 5AZUA 3NJLA 4E9TA 2IDQA 2AANA 2ZOOA 1KBVA 1KDIA 3FPXA 1X9RA 3X1NA 3NJGA 1JZGA 3FSWA 3UACA 2Y1AA 4DP4X 3T6XA 4JHUA 5I6KA 2QDVA 1BEXA 2XV2A 4E9SA 5LDUA 1JZIA 2FTAA 1OV8A 4X4KA 3GDCA 3JTBA 2J55A 3OMNB 3OM3B 3QQXA 2FQDA 1ZDQA 7PAZA 1TEGA 1PNCA 1ZPUA 1EZLA 2A3TA 4NERA 4M3HA 4YSRA 2BW4A 5PCYA 2VW4A 5I6OA 2NRDA 4UAHA 1JXGA 1GR7A 4RH4A 2UXVA 1BYPA 1XMEB 2HZHA 2P80A 4A2FA 3WG7B 3C75A 4BWWA 1ASPA 2PLTA 3AG1B 1V55B 5I28A 1IBZA 3QJQB 4GY4A 2EIJB 1OF0A 4G70B 3WI9A 2FT6A 3AG3B 3PAZA 4HIPA 1EHKB 3TA4D 1URIA 2BZCA 2J57A 2RACA 1ID2A 3AZUA 3EF4A 1NPNA 2FQFA 1NINA 1ZIBA 4JHVA 1AS8A 2DYSB 1AIZA 3SBQA 5B7MA 2EIKB 1CYWA 1M57B 1ASQA 3UGEA 1OOWA 4HHWA 2AFNA 3ABKB 2JFCA 3ZBMA 3N2JA 4DP0X 5I5JA 3L45A 1PZBA 3WNJA 2FT8A 3NYKA 3NJNA 1JOIA 2TSBA 2XX1A 4N4YB 1FA4A 2H5UA 2XLLA 1PCSA 3ABGA 1AG6A 3SQRA 2CCWA 2YAFA 4G7RB 4WTQA 1NWOA 5B1JA 4YSTA 4DP9X 1NIDA 2IWFA 3T9WA 3FPYA 1RZQA 2ZONA 6PCYA 3MBWB 1L9SA 3D12B 1A65A 1JVLA 3IBOA 1MZYA 3HB3B 1GS6X 3X2QB 4YVNA 5TK4A 3ZX1A 1GYCA 4F2EA 3FU9A 1FFTB 1BQ5A 3T6ZA 2IWEA 2X87A 2B08A 4G7SB 2GI0A 1WA2X 3DTUB 3NSFA 4A2GA 4A2EA 1QNIA 4AKPA 1I53A 3CVBA 5B7EA 3IEAA 1ET7A 4FAAB 2P80D 3FU8A 2EIMB 4YSCA 2UXGA 3PPSA 3CDZB 4GP4B 4DP1X 3AW5A 4DPCX 4YSAA 1FWXA 3FT0A 2MRYA 1L9TA 4HCFA 1WA1X 1NICA 3PAUA 3UAAA 2PCYA 1XB3A 3PCYA 4DP5X 5A7EA 2VW7A 2VN3A 2BHFA 4AI7A 2UXTA 1J9QA 4E9WA 1AG0A 2MTAA 2CALA 3H56A 3U25A 4N8UA 2AZAA 2GC7C 2XXGA 1NIFA 1PLBA 1QLEB 2Y69B 4HHGA 2W88A 1PZAA 2IDUA 2E86A 1JZFA 1SF5A 3X1EA 3OMAB 1E5ZA 2IDFA 4E9VA 1ZIAA 4ZK8A 1PZCA 4QLWA 1SFHA 1SDDA 4W1TA 1JZHA 1KCWA 2DYRB 1HAUA 1JERA 4E9YA 2OJ1A 1HAWA 1R1CA 2IDTA 1MG2C 3TU6A 1SJMA 2WSDA 4BDVB 2I7SA 1ILSA 1BQKA 4TXVB 1N68A 3PLYA 3H4HA 1ETJA 3G5WA 5B1JC 2PP7A 2GB2A 3CVCA 3CDZA 2Q5BA 3ABMB 3SBRA 2BWDA 3TASA 4Q8BA 3GXUB 4GYBA 3DKHA 3QPKA 2QPEB 4DP6X 1XB8A 2FQEA 2VMJA 1QHQA 2ZWNA 1CURA 3FQYA 4YSEA 4KNUA 1L9OA 1RZPA 3NJJA 3FSAA 1T5KA 2HX7A 4E9QA 2WO3B 1MDAA 3IN0A 1AZBA 2XYBA 5F7AA 4E9RA 1J5DA 3ERXA 4KOCA 3NJKA 1L9PA 2BP0B 4UANA 3IN2A 4UF7C 5B3SB 3WIAA 1ILUA 3FSZA 1GS7A 2BWIA 1F56A 4GP5B 2YXWA 2VM3A 2JXMA 1GSKA 1A4BA 4P5SA 4W9ZA 4BWTA 1W6WA 3QJSB 5F7BA 2YQBA 1NWPA 3QJVB 2R7EB 2CUAA 1JZEA 1NDTA 1AZRA 1AS6A 2YEVB 2PPCA 4A66A 4G71B 5D4JA 1W6LA 1NPJA 1KCBA 4DP7X 2VM4A 1IBYA 3QJRB 1DZ0A 3V9EA 2IDSA 2XWZA 1TU2A 5ANHA 2LLNA 1PNDA 2PPAA 3OMIB 1ET8A 4GXFA 4M4RB 1JXDA 1JZJA 2PP9A 3FYIB 4JKNA 4BWUA 2I7OA 3QJUB 1M9WA 1OCZB 1RKRA 2IAAC 3RYMA 2BP0A 1PLCA 5D4HA 2FQGA 1M56B 4L0PB 3OQRA 4YSQA 1WAEA 4YSDA 1ZDSA 1J9SA 3S8FB 3FU7B 2VSKB 1CUOA 3NJMA 4G72B 1VLXA 1WS7A 5FC9A 2PPEA 1MZZA 1MG3C 4YSPA 3OD3A 3NSYA 3BQVA 3FS9A 4GP8B 2X88A 4AKOA 1ASOA 2YAHA 2XXFA 1PAZA 3ZDWA 2OV0A 3NSCA 4PCYA 1X9UA 4G7QB 5B1AB 4E9XA 2UX6A 1A4AA 3WKPA 2EINB 1TEFA 2AZUA 4DP2X 4BK5C 4NB7A 3NSDA 4KOBA 1V54B 1GY1A 3AY2A 2J5WA 1DYZA 2DWTA 2YAQA 3TBBA 2OCCB 1KBWA 1BQRA 3NT0A 2FNWA 2W8CA 4DPBX 3X1GA 3EHBB 1A3ZA 1J9TA 2H47C 5I6PA 1SHXA 3WNIA 1KGYE 3S3BB 9PCYA 1NIBA 4HCGA 4WKXA 3EH3B 3NJIA 4KNSA 4KO9A 3QJTB 3FU7A 3SBPA 2YAPA 5I5MA 1AANA 2XUWA 4DPAX 2UXFA 2HXAA 2UX7A 4AZUA 3BVDB 4K9JA 1B3IA 5B1KA 2YAEA 3H4FA 4F2FA 2FJSA 1W8EA 4ENZA 1YLBB 4HALA 4MFHA 3TBCA 4AX3A 1PLAA 2GBAA 3S3CB 1BYOA 1AQ8A 1A4CA 4F7KA 2YXVA 1TKWA 1WS8A 5PAZA 3DIVA 1SNRA 2I85A 2ZXWB 4KNTA 1AOZA 2QPDB 1E5YA 4YSOA 3IE9A 3NP4A 1JVOA 1OE3A 4CSPA 1BXVA 3GYRA 6PAZA 2BW5A 1E30A 1WA0X 3X1BA 2HX9A 5I6LA 3KW7A 3WKQA 2BZ7A 3V9CA 4CSZA 4QKTA 2FT7A 5I26A 1V10A 2DY2A 1CC3A 5AFAA 5E9NA 1IKOP 4P5RA 4BXSV 1OE2A 1XB6A 2HRGA 2YAOA 3CVDA 4HAKA 3ABLB 4FA7B 3UAEA 1AZCA 4A68A 3FQ2A 1J9RA 2VW6A 1CYXA 4BDVA 4BXVA 1AZNA 2FWLB 3FQ1A 3S3DB 3HEIB 2DWSA 1GW0A 2GHZA 2AVFA 1L9RA 1N70A 3UADA 2HX8A 5B7FA 1ADWA 3N55A 5EHFA 2DV6A 1PY0A 1SFDA 2GIMA 1GS8A 2XVBA 3FSVA 3NJHA 3UABA 5I6MA 4PAZA 5AKRA 4YSUA 1NTDA 2IH9A 4YL4A 3NJFA 1KYAA 2JKWA 1AS7A 2VSMB 3X1FA 1SF3A 3T6WA 4HCIA 1SHWA 2BP8B 3T71A 3FYEB 2HRHA 1OCRB 3ASOB 2B3IA 2QT6A 1ZV2A 4A67A 1BXUA 3EH5B 2TSAA 2QDWA 2XV3A 3CG8A 4A2HA 5D4IA 5I6NA 3MX0B
chains in the Genus database with same CATH superfamily
2VDRB 5LBSA 3WAKA 1PD1A 3K74B 2OMYA 3L3GB 1F3JA 4KQ4L 5L6YL 1W0VB 5D2LF 5ABZA 4X6DF 2J20A 3GRWH 1YMME 3CC7V 3EHBD 1TDQA 5AUMA 3SE9H 3TH3T 2IH3C 3D36A 1OAYL 2NOYA 5BV7L 1QQDB 3DETC 1K5SA 4PHZA 5CU5A 3WXVL 3ZO9A 3ARDB 5DK3A 4APQB 3BH9A 4YDLB 2CGYA 3G6DL 3HI6H 1C16B 1AE6H 2EDNA 2HT4D 4RETB 1F3DH 3H9ZA 2EXWC 4Y4FA 4G8GE 5I1KL 2BZDA 2D4DA 4P9MH 3QFGA 2HT4C 3JARB 4GX5A 4JR9L 3UZQA 1E65A 3DPDA 3HN5A 3VGGA 1CTNA 3O3EA 4MJHA 3QAZC 4WFEE 3F6LA 2WTOA 1J1OL 4IKLA 4PJEF 5E4OA 1OPOA 5HVWA 1IAMA 1NJIW 3E89A 1AACA 2Z65C 2V9RA 2Y7QB 3X11B 2X38A 1ZVSB 1S7WB 1K5NB 2YGNA 1DVFB 3CVHL 3D85B 1E67A 3FCUB 3QHFL 3OVUB 1I7FA 3QJXA 4ONGH 4ECNA 2FJHB 5IQLA 3L3HB 4M6OL 4BK4A 2BHZA 5DDHB 4HZ1A 2A38A 3VH8G 2ZG2A 1AZUA 1ES0A 5GPRA 3ROOB 3VM5A 4HHAA 3GT6A 2NT1A 1LEIA 5FW7A 1AGEA 5AENA 4GW4B 2XZQL 3CFBA 2AJVL 4Y1TA 5IQNA 5DJ2B 3VXTB 4X88A 2JCCE 1MCWM 1X9RA 4JFZH 4C54A 4ZOLA 2NY5L 1NVPB 5KSAD 3MRRA 2OAAA 4PJDA 1E3FA 2GY7B 3VFSA 1DEDA 3GLAA 2Q4PA 2FB4H 4OCXL 4M8UA 1M9NA 5E2VL 3BUTA 5F1SA 1QBBA 1F4HA 4OVVA 1T66C 2K7QA 4MBRA 2WNKA 3GTNA 5JZ7D 4WCEV 3F12A 1VEOA 1H9DA 1E9OB 2JKNA 1SXCA 1TUBA 4YIOA 1KIPB 3C90A 4NERA 3KYMA 1HHIB 4NKOA 8CGTA 4F7PA 1VGKB 3ESUF 4GUCA 5J9PB 1ICTA 2R1XA 3FQRA 3FB6C 4HBQA 4JZ2A 3CUPA 1CXHA 3N9GL 4XH2A 3UZEA 4Z3HA 5HI5D 5AAPA 3WG7B 4LPWA 5DQDH 4XXDB 1S72V 1GGTA 4MAYD 1BMFG 3VI3A 4FE9A 4KXZI 4LB8A 4FX5A 4OGXL 5ADOL 5CEXA 5CFAA 1IBZA 3PIQB 2APWA 4G70B 5DMGD 3BPOB 4KUMA 4LVOB 4M7JH 4DO6A 4NGHL 3HKFA 1YC7A 4L8CA 3GBMH 2K70A 3KL5A 1JF1A 1S7VB 4OKVA 1BV8A 4U1SA 4UCRA 4UOW1 3Q13A 1YAIA 4ZUTB 3VWJA 2NQ3A 5SWSA 3ZDXE 4OCWH 3WFVA 4M29A 5IT2L 3W39B 3RWHA 1K92A 4OGAC 5J0BA 4TPRL 4XX1E 3CJHB 3NABL 1GZPA 2P8PA 3JALA 2WZPA 1CLOL 3OKDB 4KK5C 4M6NH 4HMEA 1B06A 5HP5A 2I5YL 5IOKA 1RZ7L 3VD3A 4UDTB 2OMXA 3UQ8A 3HNSL 2FECL 4NO3A 1MCFA 2X6MA 3BFWA 5FKPB 4D3CH 2XVKA 4HKZA 5BJTB 2EEBA 2HJLA 2R69H 1NDMB 3QRGH 3NN8B 3KLHC 2CLZB 3U36B 3AGWA 4L5FH 1MCIA 1BFOB 1XZ0A 2GTZB 1G87A 1AHWB 1F4WL 1KCSL 1XF5B 3Q2VA 1KY7A 5FA3B 3FQXA 4AYDC 1FRGH 4TOYH 1RUPL 5DJ0B 4F7CA 1JVLA 1F13A 1ORQA 3U2SA 3CN1A 4N87A 2XETA 3AT0A 4JM4L 2SODB 3QJHB 4K94H 4J3BA 3TH2T 3ZQXA 3K04A 2APBA 3B5GA 3FU9A 4ES9A 4IDJL 1IQWH 1ADQH 4FFZL 2AEQH 5C3TA 1IAKB 2Y2TA 4NBZB 3VYNA 2EE6A 4KTEL 3ULUD 1M7DA 4HLJA 4IJTA 4NIKB 2WXOA 2EDMA 4PRBB 1P84K 4TUKH 5AL0A 3K71A 2Q7EA 3CSGA 4HLZG 4FAAB 3RT3C 2KH2B 2UXGA 5T1DH 5JCOC 1HL5A 4QRPE 1K4CC 4MTMA 1VZGA 1ZTXL 4UTCA 4R8CA 4U6VL 2CHNA 1S9XA 1EFRG 2MJWA 4EN3B 4F7TB 4U3JA 3W56A 1YQVH 4F7EA 4Z7WF 4LHUB 1BT8A 2D7NA 3KDMB 5HYQB 2CDYA 5DQJB 2PZSA 3RVUC 5ID1B 3VDAA 4XC3H 3QWOA 2EYSB 3QDGA 5GRXG 1A1MA 1E6JH 4QHKJ 1CDYA 2VXQA 2P9RA 1KN2H 5D7IA 5IVZB 4ZFZA 1WZAA 3UBXB 1GN2A 3N43B 1YSCA 5CMUA 3IKKA 2ID5A 3PXJA 1F90H 5D2NA 3ZTCC 4ZX6A 4IJ3C 4G5ZL 5E6IC 5CCHE 4DAGH 1HIMH 3BRFA 3G6JB 4JY5H 3V4VL 1DLFL 4ZI7A 1QI5A 2XI9A 2X4SB 2PXYD 2D4FA 4JJ5A 4L3CA 2MNJB 1A3LH 3QPQD 3AREC 3GJFA 4AYFB 2GYSA 5BZWB 1UVQB 1KCWA 3LRSB 4HCRH 2CCVA 4LLAA 4MD5B 5DEGA 1HAUA 4QOKD 1QVOB 3L5JA 1J9CT 5ICZA 1HE8A 3H7BA 5ICYB 1U3HC 4N28A 4BQ6A 3RUGA 1OGAB 5SWQA 2YUWA 3M7OA 4PWIA 3LNIA 2IPUG 2KPNA 5IMMB 1Q1PA 1SYSA 1F8TL 2FDBP 2E7DA 3OLEA 3THML 4DUVA 3SDXA 4GYBA 2X41A 1HZLA 1XF2B 4OZGE 1R3KA 5BZDA 3SGIA 5KVMC 3II1A 1CFSB 3OAAG 3CDFA 1QHQA 4JCWA 3H6AA 4PRID 1I9JH 4XBMA 1AGCA 4JO1H 1CMOA 2WAQA 2QGBA 2VIRA 3FO1A 1ZA6A 2R9HD 4MMYA 2NW3B 3D9AH 5ESVB 5LLIC 2QKCA 3MMEB 4D6TH 3P11L 5CCKH 3DV4A 4PW4A 4KOCA 3Q8EA 1L9PA 1XMOO 1JPFB 4XVJH 4UF7C 4X8CA 3BQUB 5E9DA 4BK5A 5EIIA 2JVDA 4XP9L 2BWIA 4FLYA 4K3HA 1JFFA 4PM1A 1T0OA 3PABB 4HOZA 1GKEA 4XVUD 1V7NH 2WC7A 1HXYA 1TFPA 2YSUB 3NAAL 1P4LA 3C6SA 3RYFA 3MRQB 1KBPA 2CDEB 3L9BA 3KM1A 4F8TA 4XVUC 2OYMA 3VXMB 1S5IH 4N2GA 4X5XA 1KZQA 2DICA 2D7TL 4Z76B 1ZANH 3ZKXB 4AYID 1AS6A 2DLHA 3FCSA 3G5ZB 2JLPA 4F58H 5C0BA 3K0GA 3MA9H 1XX9C 3U30B 3X3GH 4S11A 1RLWA 1IBYA 2OK0H 1JZ4A 4S2SA 2OW6A 5BV7B 1JUFA 1VCBC 3OKMB 2VABB 4KI5E 3MD0A 3GSRB 1RZKL 3K2KA 5EZLA 5K9QI 3JSNA 1PY4A 4WHYH 4ZX5A 1IBBA 3FYIB 2MKLC 2I7OA 3RL1A 3VRIB 1HSAB 1J8KA 4YXWG 1FZMB 1P6WA 1VKXA 3O2WL 3WEMA 1GN4A 3ZL4L 1LUWA 2FQGA 2XRAL 3MACL 3K06A 3L5WA 4PRPD 2O6CA 2XVGA 3BD4A 4ORGA 1OEZW 2I26N 5DWUL 1XEDA 1H9VA 2BNRA 4RZCA 3MA7B 5HHQA 4DZ8B 1KCVL 3MLZH 3VCLA 5TH2A 1BX2A 1CK0L 3MJ8A 2RDCA 1G1CA 3ARVA 1JZ7A 4NNYB 4OLXL 3EYOB 3DYPA 1VF5C 1ZVYA 1DF4A 2Y3NA 2DI7A 4J3XA 3I6SA 4F2ME 1T5WA 3KPSE 3CVHB 3BMWA 4ZTEA 5H4YA 3VSVA 1LO2L 2R29L 3C2SA 2BY2A 4I7ZB 1URLA 2Y25A 1E4XH 1MJ7L 2IFFH 4KOBA 4MJ6B 3IDIB 3RYIB 5HDBB 3F05A 3IWVA 3EYFB 3DIDA 1UASA 4Q4EA 3K5SA 4JJHA 5EIIG 3RVWD 2W8CA 4K5LA 4MA1C 5GRYA 4XXWA 2P5WB 1X5XA 4PU2A 1KEML 2VWJA 4WTZA 2OTLV 2CBOA 4XMKH 2XJKA 3WNIA 3CXFA 4KVCL 1S9YB 1GC1H 3F5WA 3TEWA 2UZXB 4E0RA 3E1ZA 4N20A 1AKJD 4RDBA 1DVXA 4JI0B 2XY2A 1SXAA 3QFJE 4FQIH 2E7CA 4WFFA 2F53A 3KYNA 4K94C 3ARGD 4GKNB 3Q3GA 3QZWB 4JE0A 2IMNA 4LVNC 5CKAA 3I6KB 4H8PA 1EJFA 1INQA 4IU3B 2YDEA 5FYJH 4XPTH 4CH3A 2ITCA 3KNBA 4JHAH 4LASH 3WEXB 1LE9B 1T21B 1RXLA 4A7QA 5KYNA 4QKXB 2FJSA 1YLBB 5IYDO 4XWOD 5BR8B 2H9GB 4U6YB 3TBCA 3TURA 1EAPA 5FHAH 4QRTB 2MNUA 5IEHA 1XCQA 4GG6A 5K39A 3EGXA 4LCYA 5JO5B 4N5UA 1Q8MA 5DA4A 5SX4I 3IDUA 1Z5VA 1LDPH 3ZL1A 3CBJB 4FQJH 2VL5B 4H5SA 2VXUH 1KLGA 2QPDB 5L4FA 2YC0A 3CSTA 3QXAA 4DR2O 4HW6A 1ETZB 3FU6A 1KNOB 4LR3A 3CV5A 2ITDA 3HN8A 4B3SO 4IRSD 3ZZLA 1YITV 2XQYA 3P30A 2ZYSA 3B9KD 1MQKH 3OMZA 3IJ8A 3KBHE 4H8HA 3QDJA 1NFIB 4KKNA 2O4EA 3E8GA 3H3KA 3ULVD 2N01B 1SZXA 1UCBH 4IIJA 2YQ3A 1R6VA 4O2EB 5JA9A 2DIJA 2VLKB 2B0SL 2FT7A 2L7QA 3RWFA 5J6HA 3OTTA 4K8ZA 1WIPA 4O00A 4HK0B 2HHHO 4NYLA 2A6DB 2X09A 1EANA 1WPXA 3UJJL 4JI4O 1DBJH 5AOIA 4MQTB 3ZR6A 7FABH 3TF7C 1UZ6F 4TV9B 2JCWA 1UEMA 1T03H 1AZNA 3FT2A 4Z0BL 5CLZA 4OR1A 1CR9L 4P46B 1CF1A 2NY6B 4UB6Z 3MJ6A 5J13B 5LNGA 3QZBA 3ZYIA 4FRWA 5C2UB 2VE6B 4TL5A 5GZND 4ZMXA 2BVUA 1EHLL 3GXFA 1DQML 4EZJA 4WTZG 1PY0A 5CN3A 3FOMA 1MUJA 2PO6D 4JG1L 4JHZA 1WSST 1EDHA 3QZOA 4MSWB 3T4YA 2BC4A 4EVNA 1N3NB 4L8DB 1RZFL 1WLHA 4JG0H 3TWCL 4JFDE 2AQTA 4MNQB 3S35X 2WXQA 1RJYA 4KKLD 5C6WH 3HNVL 1QLFB 2Z31D 4ZAKB 4KHPO 2FSEA 4NT6B 5A16B 3QPXL 3GBLA 1M7IB 3G04B 1I3GL 4ZOEA 1JIBA 2CDFB 3X13B 3MV11 1FFOA 1XZWA 4BKLB 3D39A 1SRDA 5CHNB 4EXPX 1EHXA 5E7FA 2ZTBA 1U92A 1KJMA 5EPMB 1YHQV 3O45A 1HEZB 3NFNB 1P7KB 4GQPH 3OHXA 2HVKC 3G71V 2H2SC 5I0VA 1R3LB 1VQ6V 3CG8A 3CLEH 1NBVH 2ZOUA 2IWKA 5MP6L 2C9XA 4L8BB 3S8GB 1WJZA 2DQFA 3KDPB 5BRZB 4QWWC 2OULB 4Y4HA 3SOBH 4OQTH 1NZ6A 3AUWB 2NSMA 3QQ3A 1PV0A 2XZAH 2W91A 3KH3A 4PV9B 1SQMA 2C9PA 4XCYB 5FGSA 5E8EB 3P4LA 3PQYA 4CGUB 2MPAL 3V4VB 2CO6B 5GJSH 2PPFA 5E2TH 1RFYA 5C93A 1CBJA 2WJ7A 1F3RB 2XZZA 1NAML 5IMKA 3MNZB 1A6PA 4M4RA 4J8QA 5B1BB 5DK2A 4PG2A 4MW3A 4N24A 3TYGL 2OP4H 1KJ2A 1XIWA 4FNRA 1ZL8B 3KE0A 2AC0A 5E1QA 1QKZH 5C08D 1Q0XL 3UZVA 1EEQA 3ALXA 5CGMA 1XF4A 3FH8A 1CD1B 5AW8B 1C8PA 5L2JA 2FO4A 5C3LD 5HI4D 3HZVA 5EUOF 2IH8A 5EC2B 4ODUB 4ODTH 3VYOA 2CTQA 2QR0A 1J86A 2ICEB 4R84A 4M1DH 3U9UB 2GSMB 5GS2H 4R90H 4GSRA 3ARSA 1XH3A 5A2CA 4P23A 5I5IA 3ZMZA 1J5CA 1YN7B 3QUZB 4QXWA 2HJFB 5IKCB 1RIHH 1X3DA 2P42B 4GSXA 2H3XC 1G9NH 1PIFA 2BNQB 3CCHA 2IIJA 4OSUH 1FFXA 2J4WH 2VH5H 3RGVC 3CXDH 4X6CA 5AD0A 3E6FB 1R5IB 1CZ8L 5EU6D 4HDIA 4Z18A 1R3JC 5HGHB 2ZQMA 1T0PB 3FSWA 4UT9H 4CILA 4NO5A 3F7YC 2KZ1B 2W9DH 5ICXB 3ES6B 3IXAB 5L2KD 1YI2V 1RULL 3IMUA 4OZIB 2EVFA 3EGSB 3L9RA 3VACA 3O8XA 1FO0L 3K7UA 4ZFOA 3E22B 1L3WA 5DHXB 3I2CH 2EDEA 1GC1C 2KUTA 4N0FB 3WN5B 5JJNB 3RJQB 2AV1B 1H8EG 2YD5A 4DN3H 5A2IH 3LTVA 4PTUA 4DR3O 3PUUA 2BW4A 4GFXA 1E4HA 3CH1A 2BINA 2FX7L 2NRDA 5EN2B 3KPPA 2DIAA 1MRCH 2OMVA 3OGCA 4ZOCA 3HKBB 2ADGA 4PGZA 2NR6A 4BWWA 2NZ1A 3N44B 4H8UA 4UQ2B 5CBEB 3NOIA 5DFAA 4HGWA 5JIHA 2WLMA 3P0GB 3VMNA 3FU3A 5FCUH 5JJEB 2CNYA 2ESVA 3LNEA 3MGOB 4JK0D 3AG3B 2GUOB 2QZ5A 3QNXA 2UUBB 5MEOA 2CBMA 3UTZA 5GGVH 3N2KB 1YEDB 3HRZA 1A7RH 5FUZL 5CZKA 3H3BC 3AZUA 5FW8A 3MV9A 4AC4A 4LLMB 4DGVH 3ULUE 2DYSB 2LU7A 4BCXA 2ZXCA 3SCMC 1XH1A 3D2UB 4HAFA 4HIHA 4G6KL 1OSPL 3HHRB 2R8SH 2NY1D 3OAYK 3OKNB 4R2GC 1O6TA 4HJ0C 2YD1A 1A7NL 4BFIB 4FF9A 3K6IA 2WNXA 4KU1A 4WNJA 4KUZH 3MOQA 1MFAL 3DV6B 1ESOA 4IBZA 2C9QA 3FD9A 1TQBC 4UVAA 2HT2D 3B2VH 4WUUA 5K1JA 5KHHA 4EKJA 3F83A 1KYOK 3MRCA 3MJ7A 2Z7YA 3AT8A 2BSSB 4LLDA 2HT2C 3QZLA 3HC4L 4HPOL 2FGWL 5ITZB 4P4RB 3L1OL 3E2HB 2FR4B 4QTHA 5EOCJ 4ZDHB 5CBFA 1G5GA 2QFRA 5EFIA 2ZSWA 1NM9A 3P9MB 1P5VB 4DKTA 2V8LA 3ISWA 2A0LD 2AHYA 2VR6A 3T4AA 3V5KB 4HU2A 3WB1A 1FL3B 2VMEA 3SPVA 4YZWA 2A0LC 3TFKC 3MV8B 1YEKH 2H0EA 3BKMH 4P2OC 3RY4A 5HPMA 1LEKA 3AK2A 2FO8A 2EDKA 3ILDA 4QOKE 1Z9SA 1SETA 3O6FB 1ET7A 4OCRH 5EC1A 3BP6A 4WY7L 4X2UA 5E1IA 3HI1B 2JRIA 1SEBA 5AZEH 3TJHD 1SA0A 1RIVH 3M1BB 3STZC 4JFOA 4CL7A 1RZ8A 1YNKH 2WSPA 4YHNB 3WU2Z 4CC5A 4O4LB 2VS0A 2D0FA 2Q8VA 4I89A 4LSSL 3U7WH 1PKOA 3LQZB 1GGCH 1RK0B 3LV3A 3OAZH 1INEH 3MN8A 1S7QA 2L4OA 4JFPB 3TH4T 1FIEA 3UAJA 2B5IB 4CW1B 4JANA 2G5RA 3BP4B 3VDCA 2UXTA 4PRIE 3VXRA 5EBLA 4XTRC 5I8KL 2W65B 5AVTB 1W16A 4P04A 1VPOL 4ZZKA 4IBLT 4BIUA 4G28B 4NN6B 3WS3A 1M42A 1MHPL 4LSRL 3WS6A 2MQCA 5DHDA 2VITA 2HEPA 4N26A 5F8RC 4ZFGL 2QADD 2FBRA 1WT5C 1T2XA 1WAAF 2E86A 1J8SA 2Z0AA 4RMTA 3WIIH 3KWVA 4X4MA 1NDGB 3OAUH 1EH9A 1YC8A 5LQBH 4GXUN 3P2TA 1ZSHA 2W1NA 1ZSDA 1R24B 1JF5A 1K2DB 3MSPA 3CCVV 4XNAA 1Q9KB 5B4MC 3DO7B 1NAKL 1FG2B 3WV0A 5KLVH 4KZEL 3KYOB 4AH2A 4NTYA 1HINL 3N41F 1BBDL 2F23A 1COWG 1JTOA 4K55A 2DBLH 4N0UA 3J07A 4R96A 4P9HH 4OIFA 4TUOA 4A7SA 5EWIL 4HJJH 4WIQA 5CBAB 3Q43A 3AAZB 2A79B 2IWGA 5L4MA 5ESAB 1XUQA 1INDL 2Q0OC 4PJHF 1P84F 1J8RA 3BPZA 1JP5A 1HH9A 2VDNH 2ZWNA 1J88A 3M6DA 4KJPD 3C08H 5H6QA 4UTAA 1CFVH 2JJTC 1SKVA 3S4SA 3LXCA 5GS2D 3F2LA 4FMVA 4GXVL 5FB8B 2Q20A 1CLYH 3ERXA 3NJKA 3P40A 2WLLB 1SOQA 4OBRA 3UO1L 5IWAO 4UM9B 3F7LA 3C60C 4FXKA 1E2WA 3CHPA 3FFCB 1BQSA 5KS9A 1LUVA 2DKMA 4PRHD 1XOUA 3CEIA 1TCMA 1G9NC 4PRPE 5HI3D 4PRDB 1RERA 5F93C 4GUNA 2WXMA 4DFHA 4L4VA 4MMXA 1YJDH 5F7BA 1F3JB 4KDTC 2ZE6A 4PWGA 1P9MC 4LVHB 1LP9A 1XFPA 4ILDA 4XCFL 1S7TA 5AUMB 4LF7O 3JCZA 4CVUA 3K6SB 4LBAA 4TUUA 4Z7UA 5JHLA 1FORL 4OLYL 1K8IA 3HG1D 3T2NL 4G7VH 2YXFA 4XDLA 5F3BA 1OV9A 3GLZA 1PG7H 4I2XA 2AEWA 1R46A 2N05A 2NCEA 1NR1A 3UTSE 2GJ6D 2DL9A 2LLNA 3L2MA 3EGDA 5JUEL 3WFDH 4B96A 2BE3A 4BV1A 4Y4FB 1L0NH 1D2PA 1FPTH 2DWDA 4L5FE 5FK9B 1CFTA 2Q0ZX 3LSSA 3ZZ1A 1I82A 1OCZB 4ATWA 2XTJD 2BY0A 4GFTB 2LTQB 4BRVA 3H55A 5IQ9B 4RA0C 3TP4A 2HFTA 3EYSH 1NAMB 4WW2C 3T77A 1H3UA 4UMGA 2BP5M 1I1FB 4MVBC 1WAEA 1GMGA 5L8KB 4WFGD 4X1IA 1RFDL 5F1OB 3NIDB 1VIWA 3U46A 4KP4A 1WGVA 2CKNA 1MJUL 3MCKB 3SO5A 4PJFA 4WWKD 3SKOA 1I7UA 3P4MA 3A67L 3WENA 3BZEA 4R83A 1S5HA 4L4TB 3ZTJG 4YSPA 3NSYA 5I1JH 4OV6F 5IVXE 1K6QL 4ZW7A 3U1SL 4YR6A 4ZHQA 3E8VA 1YAZA 3T6QC 3UYRH 1I3UA 4NQDB 1A6TA 5LHHA 1VQMV 2YJLA 3NCXA 1NGQL 2J8UA 4J1UA 4AIXA 1LEIB 3S4SG 2UX6A 1QBLL 2F2HA 3CFBB 5A2LH 3GZPA 4UVBA 4HS6A 3WKML 3W38A 2ODIA 3DYMA 4U3SA 5DJZA 4KQ0A 4ODHL 3Q06A 4ZOLB 3SYOA 4XP4H 2J5WA 3P0YH 3MRRB 2XN9A 2OCFD 3ALPA 3D8MA 4KJWD 3BHBA 5DZOA 3VFSB 5BJTA 3ECUA 4FHJA 2AI0H 2BSEA 4NC1C 3BPLB 1I3RB 2ED9A 1TR7A 4ZODA 1KXTA 3ZE2E 5DFVD 3M1CA 4KJWC 1JHTB 3KPNA 1XT5A 4CS4A 1K5WA 1RZJH 1DK1A 4GQQA 1HHGA 4F3FB 3ARTA 3QRLA 4C47A 1J1XH 1RPOA 1CT8A 3F12B 3MAWA 4I0KA 4KRMB 1P7QA 3NJIA 3ZLQC 2JIXA 3ATDA 4OCMC 4EBQL 4HS8L 2MEJB 1TUBB 5F7LB 3KYMB 1FO0B 4NHCL 3BZ5A 3KJ4C 4ZBJA 5GGVY 3SBPA 5IR1A 4GMSH 4F7PB 4WO0A 3N0PB 4P4KC 2YGVA 1UUNA 2LVCA 5I8OH 3VMPA 2R1XB 3CUPB 1NSNL 2R70A 4XH2B 3QR2A 5B3JE 1NCUA 2B9AA 4J3SA 5IW3A 2WM0A 3VI3B 5E2WH 1MCKA 3TTYA 1A7OL 4ALAH 1W8EA 1OVZA 1XMOB 4J3TA 3TA3A 1WIUA 1A4CA 4OKVB 1JF1B 3PJSB 3HAEA 1LEGA 2MSPA 1NTZH 3P30L 3TZVD 2UU9O 3BYTA 5DRZA 3VWJB 1WAZA 3DTXA 1OF2A 1BZ9A 1TEYA 2IQ9H 3MYZA 3LXAA 4JFFA 3VFTB 3W0WE 1AQKH 4D9LH 4ZMLA 4M8QA 5HGAA 1KTBA 3RWHB 3IE9A 4ZMTA 2OQJA 3MZGB 3NP4A 4HZLA 2EULA 2VXSH 2A6IA 4IOFD 4MJJA 2ENSA 1GZPB 2V17L 3QQ9C 3ULVF 2P8PB 3JALB 5AKTA 4LRNL 1WA0X 3K5OA 5C7XH 5CM1A 5E99L 1KPRA 1D5IL 3RPKA 5KJRH 1QX1A 1EBOA 2F18A 5H35A 2EC9T 2AK1L 5LGNA 4NO3B 3OKOB 3PNRB 5ENWB 5I26A 2DWXA 2HJLB 1YYLH 5CD5D 3OC8A 3H54A 4Y89A 1CBVH 1IKOP 3VFNA 4CVWA 4P5RA 5I71B 2WYIA 4BXSV 3K0WA 1XZ0B 3CN4A 4OCLC 1KG0A 5F6IB 4JDZA 4FTVA 3DNKA 4OLWL 4GQZA 3ABLB 3FQXB 2A74A 1QUPA 1ROCA 4A68A 3HPJB 5GXBB 3U2SB 4P9HC 5SWZB 4K5NA 1VQOV 4KQ3L 3SJVA 1N70A 3P3NA 1WPCA 3I75A 3QUMH 4WFAV 2DJVA 1QFWL 1HYSC 4HJGA 4PMFA 3SDCA 4TF4A 4TRPL 5TE6L 1M7DB 3QXTA 1H5BC 3HB3C 4DGUA 4BBWA 1PS3A 5EBWC 4BQCA 2H8PC 2HLFC 2ED8A 4YL4A 4XNDA 4W70A 1YMMA 2NY7H 3SE4A 2XAFA 4E5XA 5MEPA 3Q4HA 2I9LB 6CGTA 1O9HA 4OZFB 3CZFA 1AFVH 1LK3L 3SPGA 5CR8A 1H3VA 4IGGA 3IFLL 4U3JB 2JGDB 1UH4A 4CA4A 5J11B 3D3VE 4F7EB 2QZQA 4NWTL 4BH8A 5HDLA 1GM9A 5C08E 2UZPA 3LS4H 3MLVH 3HR5A 3OV6A 3P0VL 4ZMQA 1A7PH 3QWOB 3QDGB 4KDVA 2XV3A 4AK2A 1A1MB 1WBZB 3GGWB 4MA8L 1MCOL 4G8GA 3K6NA 4LL1A 5CJ8A 5A2JH 5HVHC 1YJDC 2XT1B 3HAEG 3WYRA 1L9NA 5LCVA 5IHZA 1FP5A 4NM8H 4PTTA 4PDLA 2D3JA 4WFEA 1JCVA 2ITEA 4Y2NA 4I77H 4ZI7B 1Q7YW 1VCAA 4JJ5B 3ZSTA 5BOZG 3P4OA 1RUQL 2FLBT 1SERA 3L54A 2XZCL 1A8ZA 1IM3D 1NMCC 1ZV5A 3P3PA 4HIIA 4DKFH 3DGGA 3MO1A 3QRBA 5DEGB 3T2PA 3TBSA 1BAWA 4AQAA 1UENA 4NVPA 1M53A 1H3PH 1WISA 2R0KL 2QGEA 3H7BB 3HR6A 4A2DA 3BZ4B 3WFHB 3RUGB 5FEBA 5SWQB 1FFNB 4EF3A 2AVGA 1NMAH 1NBMG 3NIFF 4GI6A 3Q8AA 2W60A 3ZE0B 3CXCU 1GZHC 2X42A 1MOFA 1SYSB 2C1OA 4YHZH 5J06A 5DO2C 5DLLA 2WWKT 3SDXB 5CO1A 2X10A 3RZCD 1ACYH 3BAYA 4L48A 1RMFL 2E59A 3RFZA 4YVUA 5CB4A 3JT0A 1AGCB 1CDUA 4LCCC 2H6OA 1Z2KA 2FH6A 1FVDB 1B0RA 4JZJB 3NIGE 4K71B 3FKSG 4FZ8L 2VIRB 3FO1B 1ZA6B 2D8KA 4MMYB 2NTFB 4DR2B 4YBQD 3SODB 4QJ4B 3DV4B 1XCTA 5I6XB 1NKRA 4B3SB 5T1LA 1T6BX 1WJ3A 1PU0A 2XQBH 5FYJE 5A1AA 1P2CA 5E5UB 5EORL 3T09A 4PYHA 3LSOA 4D7PA 1AD0A 5E9DB 2RJZA 5EIIB 4FG0A 4TKWA 1BOYA 8PAZA 1LO4L 4MDJA 4YC2C 3CC4V 2BVPB 1JFFB 4HD9A 5EIVA 4WDIA 4GRLA 3RYFB 2QWQB 4L87A 3E2EA 4DGIL 4AE1A 1S9KC 3NTCH 4KMQA 4E5XG 4KZCA 1KBVA 4JN2B 5B3SC 4RWUA 5F7WC 3NJGA 1EDQA 5AG2A 1N0XL 1OTTC 2HHHB 2PI5A 1K9TA 2YD7A 2HG5C 4O51B 1EXHA 3N27A 1A4KA 2NXZC 2LLLA 5CNHA 2PUSA 3ECWA 4JI4B 1KY6A 4JW3A 2NNRA 1HNZO 3FCSB 4GT1A 2ZOKB 2E74C 5BXZA 2QHRL 3PHSA 4FNSA 4E41D 5C0BB 2UUAO 2YMXH 1QSZA 2FVNA 3VWKA 1RZJC 4NN5B 3TO4A 3U83A 4S2SB 4HF5L 1JUFB 4HUNB 4QGTA 5D72H 2OSWA 3VD0A 1ZPUA 1EZLA 4N0RA 2J8OA 1TETH 4M3HA 3L5IA 3RDTD 4H0IA 4UAHA 1DN2A 3RL1B 2H1XA 2P80A 4YOKA 3U6RA 5H6RA 5GTHZ 1QA9B 1KYFA 1SEQH 4PJ9C 1U8LA 3CFCL 3QORC 2EQDA 2IOMA 5I15L 1UXLA 4J23A 2NDGA 4KHPB 4TSCL 4ALAC 1B2YA 4LSTL 4ORGB 1R6KA 1HZHH 4FERA 4UT6H 3VXSD 2EJ1A 5HJ3B 4RZCB 2ZIOA 2FTKA 3HC3H 3MLUL 3VG9C 4HLEA 1K7DA 4NJ9H 5HHQB 4HETA 1KBBA 3VCLB 3HJEA 5TH2B 2CH7A 1BX2B 4PJAE 4QRSA 1I7TB 3LRLA 4P0DA 1UM5H 3RVTD 4F1SA 5IBLD 1WP7A 3FUDA 1PNKA 4H25A 3UCSC 1FDLH 2VQFO 1D6VL 2R2CA 1T5WB 3NRQA 5DVMA 4MXQC 1CE1H 1PZ5A 4GT0A 3N40F 4BFNA 3ISRA 2EDTA 4PB0H 4AENA 1SVBA 5I5JA 4X6FB 4O2FA 3LKRA 5BW7C 5BVPH 1A9EA 1LMKA 3ARDD 1BIIB 4APQD 5AYTA 3DLQR 3G6AA 1PCSA 3ZHLA 3ZT6A 5KTEL 4UQDA 3IPFA 3K8LA 2GPZA 4QTIH 4ZMWA 1OWRM 3WO4C 1DDHA 4HSAC 4M6MH 1VQLV 1RUAH 4QRPA 2FYVA 4JDTL 1CB4A 4JO2H 1YCIA 1D6EA 2BY1A 3UMTA 5AAMC 4GX2A 3DXAA 2XASA 5BY1A 3F5WB 4K9EH 4JAVA 4E0RB 3SPIA 3HLKA 4AW7A 4KFMA 3WHE0 3M8AA 5D8JH 1TVKB 1VMGA 2ZE0A 4NCC2 4K3EL 3VGEA 3EBAA 3KYNB 1BQ5A 2FEDD 1TSHA 2J5LC 3DGDA 1RPUA 4U0RC 1CJYA 2AITA 4MCMA 3F7KA 5EO9A 3RVZA 3BPCA 4F27A 2ITCB 3KGRA 3KNBB 1NCAH 5B7EA 4KZDL 5D55A 4XPBL 1DVFD 1B2WL 4LLVA 4GW1A 1ZK5A 2AJXL 2OWOA 4JYAO 3D85D 3ML8A 1XCQB 3UJIL 5K39B 3EGXB 4LCYB 1FNAA 2O30A 2YIBA 1T1ZB 4FKEA 1CD8A 4N25A 4PV1C 4XX1G 1VADA 3V79C 2OTJV 4H5SB 5EF3A 5CS7A 4AZ8A 1T7ZA 3GBNH 3QXAB 2YI9A 3L3OC 5E5MB 4ANVA 3BSGA 4CADA 2ITDB 4H8WL 3DVGA 4FLSA 4WI2A 2AZAA 3QDJB 1NVPD 4XP1H 1JK8B 4FQCL 2I07A 1D2OA 4ABQA 1BMZA 3L75H 3VFRA 3WU1A 2C7UA 4UFZA 2J1KA 4NZRL 1U4EA 2OMTA 5GONA 4WI8A 1R17A 4IIJB 2HVJC 2NLJA 1KYOF 5I2IB 3X1EA 5EO0A 5GGTH 3T3PE 4PSPA 3RWFB 3V95A 5J6HB 1WZ1L 2QFPA 4HBNA 1SFHA 5IHUL 5L6YH 2PTUA 1TUPA 4H20L 4NYLB 1N5AA 1XXFC 4DR3B 2V5MA 2X4QA 4F1ZA 4F5CE 1R1CA 5EMYA 4Q2ZB 1BSMA 3GMMB 3KVDD 4POYA 3EYQC 3OUFA 4FI6A 5AVWB 1R0AL 1BYNA 3LDDA 2BNUA 2VZ1A 1A4JA 1I1CA 2G60L 4FFWD 2XKUA 3LKOA 3TNMA 1T3FA 4ELMF 1XB8A 3HG1E 2VMJA 2KS0A 3VA2C 1F4XL 5TPWH 1JYNA 4CVZA 3QEQB 3T4YB 3ASWA 4R26H 5AZ2L 3VQMA 5KVFH 2AJSL 2BC4B 4TVPL 3BPOC 2GJ6E 5JDJA 4UCOA 1V05A 1NC2A 1VDGA 1RJYB 1J1OH 1DQIA 5A6MA 3TT3L 1YEIH 3A8TA 2X70A 4O4YH 5CZVL 2XTJE 2D7PA 2Y36L 2LE9A 1NBZB 3AROA 3D39B 3IDYB 1GS7A 3FUNA 3BSZA 1U92B 3CVHH 2V7HA 4JAAA 1OTSD 3O45B 4FMKA 4J4PC 4WFGE 3RAJL 2ZKXA 1FLRH 3MDSA 1TJIH 1YJWV 4H1LG 1HCFX 1ZSPA 1MELA 3GMQA 4M6OH 2EO7A 4K8RL 5JHLL 1U2HA 3K79A 2M6YA 4X8XA 5FGBA 1A6AA 3F85A 5I2IA 4AM0A 1JZEA 2DQFB 2MPVA 3FH5A 1MFUA 2NTSP 4Y4HB 2IO5A 2PPCA 1ZS2A 3QQ3B 5SV4A 2XWDA 5JR1H 4GX1A 4AJYV 3L9YA 3BHPA 4NWUL 1IKNC 4OCXH 5C0IA 3U1PA 1XSJA 4Y2DC 2IU0A 1GK9A 5IMKB 3MLXH 4KBPA 4M4RB 4XHJC 4HC1A 3FN9A 4M7ZB 5DK2B 2ZR2A 4Y4KA 5FYKD 4KH9A 1CGSH 1SHSA 3QJUB 3EFDL 2WPGA 5CP7A 3E83A 4BKSC 2VSDA 3UZVB 4MW8A 1GJIA 2H94A 1P4RA 1XF4B 2C4XA 3RPIB 3ZMUA 4JRYA 1YEHL 4EN3D 3HZVB 4QLRA 2A77H 1F3DJ 1LMIA 1Q94A 2IV9A 4LHUD 1JGVH 2IGFH 5LXGH 2QR0B 3BXNA 5I1AA 2XNAA 3RYHA 4NZTH 1MG3C 4NFCA 3BEVB 4OZHF 1CO1A 2Q76A 1XH3B 1M7UA 3OJMB 1OXYA 1ZGLA 2YAHA 3VI4F 2PCPA 1ORSA 3ILQD 1AGDA 1F18A 3BUQA 3JWNE 4AQ1A 3K80A 4AEHH 3F7PC 1MXGA 3IU3A 3OL2A 4BRJA 4EE2A 3QFJA 4PIRF 1A4AA 4HK3N 4X6CB 3HBZA 1DR9A 2Y7OA 2AGJH 1DQJB 4HDIB 3ZDZF 4FLVA 1LWHA 2YSSB 3OQ3B 4NO5B 1CLOH 2X2JA 3NK3A 4F80A 3QQDA 4JQXA 4DR5O 2LFGA 2OCCB 2NY2C 1L9MA 4IOSD 1E8WA 1JN6B 3VQVA 4NRXA 3VNZA 2ZUXA 3VXQB 4JGNA 1OGAD 3CQPA 3L9RB 5C2BH 3DOSA 4YE0A 3O8XB 1A3ZA 1KENH 1OD7A 1SM3L 1SMDA 2KHAA 5F1IA 4QHLA 3GO1L 3K6DA 5DI8A 3ARWA 3ARXA 4K9EC 1CFMA 2D03L 3AC0A 3PWUA 2OJEA 3GI8L 4H88L 1G4RA 2VQUA 2D31A 5KVEL 3CH1B 4R0LC 1JE6A 3EYVA 1RUPH 2V9UA 3WHE1 2UXFA 1W72A 1GYAA 4TUJB 3OGCB 2OMVB 4LCIL 4FFTA 2CIKA 2ADGB 1VARA 4IS6A 3G9VA 3H4FA 5I8CB 4HGWB 4LF8O 4FFZH 5IWAB 3H01A 3O9WC 2ESVB 1F51A 1KPUA 2YWZA 1FCCA 4FXTA 3BT2L 3QNXB 4HUWA 3BQUD 1JZ2A 3AITA 3UTZB 3HRZB 2NW2A 1MKFA 4NUGL 3MV9B 3BQUC 4JQIH 3QULB 3Q8CA 5ANME 4XMPH 2XKSA 1S3JA 5HBBA 3LIZH 3QS3A 3ILPA 2IH3A 2P52A 3VXMD 2BCCH 1HHHA 1WAPA 4LF7B 1YSOA 1UOWA 1RIUH 4I0PC 1ZTMA 3UO8B 2E9JA 1H19A 3WDIA 2ZG3A 2E3VA 4B60A 3AQXA 1KWKA 2BOCC 3MRCB 1WBXB 5IB1A 4WI5A 3S5LA 4C56A 3UP1A 2P8MA 3E8BA 3EOTL 3RKDD 4JFDA 3E3QC 3X14A 3RYCB 5F3FA 3V4VH 5D5MF 4QTHB 4HZ3A 3GUTB 1YHPA 4RRPM 4F15B 1Y67A 1LDSA 1XEUA 2ZSWB 2WVVB 1Q1JL 4PLKD 3MGTB 3ESPA 3G3LA 2OI9C 3T4AB 4RESB 5CUSL 2BVQA 4F37F 4FNLL 2VR9A 3L3DA 4PLKC 5JYLA 2EXSA 2WTRA 1QUNB 2XBDA 3EO0B 4GRMA 4XO3A 3TCUA 5FGCB 5HPMB 1LEKB 2P24A 1F8TH 3FSVA 1Z9SB 4NRZA 5EC1B 5EOCL 3BP6B 4K7FA 1NTDA 1SEBB 1SA0B 5AW5B 2EBOA 4JFOB 4S1SH 1DE4A 3OSKA 1RZ8B 1T1XA 1E3XA 4EI5B 1AO7B 2ZOTA 3WL9A 2QWNB 3LV3B 1KKCA 1QRNA 1S7QB 1UWGH 4ODSL 2E5EA 4ZPVA 2G75A 4JANB 1OCRB 3JVGC 1NFDB 3VRLE 3ETBF 1QOKA 2OZNA 5LCVL 5EB9A 5JXAH 3OGOE 3WS3B 1FNSH 4XP6H 5IFAH 4P5KB 4A2HA 5MHSD 3APOA 1J5EO 1J18A 3DBSA 5D4IA 5DD1L 5J12C 1Y76A 2VITB 3INUH 5FA4A 3QUHA 1QWNA 1PKXA 3ZXAC 1F02I 5EA0H 1A3RL 3REVA 2JEXA 2P5WD 4H44B 3HUJA 4XNYH 2ZDIC 1TYRA 4DW1A 4WGVB 1BXAA 1RZGA 1AJNA 2GAZA 1QFUL 3P32A 2YEVA 1ZSDB 4C58B 2HKFH 4FCHA 1OAUL 5ILTL 2CR6A 4C4UA 1B6UA 2AERT 1AB3A 5B8CC 1USZA 2AKRA 4AH2B 4UZSA 4NENA 5E4IA 1J0ZA 3FB6A 4NKQB 3JCUZ 4DZBA 1KJVA 4LU5L 1KGWA 4NLAA 3CC1A 2Q9OA 3HKEB 4TUOB 2FYUH 4MMZB 4RBPH 2YD4A 1TQWA 4AIOA 3MRNB 2B1GA 2E6JA 3UMNA 3QEGL 4QYOA 1OY3B 5GRJL 3S5LG 4S1DD 2Y6SD 4AI8A 4X9HA 5LB1A 1HH9B 1Y0LA 2H41A 5IJVA 4P57A 2Q7HA 3C5ZD 4LSQL 2XCMC 2EILB 4GO8A 2UU9B 2QQKL 2Y6SC 4A7GF 2FO1A 1ZLVH 2IXQB 1AH1A 5DD6B 1M4KA 3C5ZC 3ESNA 3ZL4H 5E7BA 1YEJL 1N4CA 5JPMB 4DV1O 5KX5A 2IADB 3N04A 5DS2A 4F57L 3B77A 5DWUH 1TNNA 2E6PA 2B7DT 5KS9B 4CH6A 2WO2B 3AG4B 1YY8A 2GC4C 4IYKA 3BT0A 1TJXA 2IDQA 1SN5A 3SKUD 3PN1A 1FN4A 2VLKD 4L4VB 4NUJA 5FGRA 4MVRA 2E0PA 3VXSE 4MMXB 2IVFC 1ZJBA 3F6JA 4OCSH 4LPYA 4YN3A 1O6SA 5DM6V 1HNWO 4KC3B 5FLUA 4O58H 2J1XA 1ZLUH 4KXDA 1S7TB 3NRFA 5FLXN 4PUBL 3DIFA 1U0QA 4ZG1A 4L2YA 2VYRE 4Z7UB 5EF0A 1CVRA 1UA6H 1MJ7H 2G5BB 4JO3L 2QTOA 3C8HA 2ILMA 5F3BB 4B9PA 2L3BA 4KK9C 4CH4A 4P46D 2NY6D 4I2XB 4X9FA 4IHJA 5HGGS 1BVNT 1QW9A 4BIKA 1X5ZA 2ZUYA 4F92B 2FQDA 2F7IA 3IS1X 5D5QA 4X5PA 1LE5A 3D4ZA 3UC0H 2NZ9C 4HFUH 2QM8A 2HP8A 2DWDB 1IRAY 2XVLA 3FB8A 2VW4A 4NS0A 4YBLB 2NQCA 1CFTB 4A5UB 3EO1A 4KTYA 1VERA 2CR0A 2Q10A 1RP8A 4KKCC 5E6RB 4YHYB 4K3AA 4M1GH 1XF3A 1JDAA 3RLSA 2XN2A 3B7TA 1DVQA 4MNQD 3T77B 4OFIA 5IV2A 2PYJA 4X7SL 4ZAKD 3DMMB 4X1IB 3VGFA 4NOFA 4Z7VF 5JW4R 1FJ1A 4V1DA 4M3JA 2QSQA 2CTWA 3SKOB 2XQ0A 2J57A 1I7UB 2CK3G 3LHPL 5TISZ 4FNUA 1S5HB 3U1QA 4Z3IA 2J21A 2DS4A 2AW9A 4YR6B 4QE7A 4ZHQB 1AIZA 4U1NA 1M1XA 2EIKB 1CL7H 1CYWA 3GRWA 3MRLA 3NZUA 2OMZB 2YXMA 3UGEA 2XNDG 4FZ1A 1HXKA 2J8UB 4J1UB 4L9LB 2HT3D 3ATFA 3EXLA 5BRZD 2PXYA 4DTGL 3EO9H 5DJZB 9CGTA 1U3HA 2XN9B 1YECH 2XLLA 2QEXV 4LOEA 5EZOL 2YAFA 3CFMA 4AV0A 4EIBA 5I75C 1KXTB 4DP9X 1AZVA 5TGBA 3KPNB 3OC5A 1HHGB 3MV01 3QP3A 1KFAL 3DC5A 1P7QB 1EBAA 1FH5H 2FEEL 1CF8L 2JH2A 3KCYA 5B1BC 1A21A 5D93B 2IU3A 1N4XH 1FFTB 3VU2A 2WWMC 1MCCA 5IR1B 1W2KT 3PP4H 4I3RL 2X4RA 2OKMA 2DTMH 2WQUA 5LP6C 1TITA 4M62L 3GI9L 2YRBA 4AEIL 3S6CA 1S3KL 2DDQL 5EC2C 4K7PX 4YGVB 4IM8A 3TA3B 2IFGA 3LVEA 2YIAA 3QUZD 1LEGB 5HYFA 2CGRH 3KLAA 5DRZB 3DTXB 5E79Z 1BZ9B 4I55A 1DCLA 4MT8A 1OF2B 4JFFB 3ZR5A 2BNQD 3BFRA 3RDJA 3T5WA 1FL6A 4M8QB 3TWCH 1WWBX 1Z9NA 3AK1A 1C8QA 4HZLB 2A6IB 3GWOA 2JNZA 5F2VO 4JI6O 4XODA 3B1UA 3QPXH 5DT1L 4LC1A 2VLLA 1NS1A 3TJPA 2XAGA 1X7TA 2VR3A 1HNZB 4LIQE 4LQFL 2Q7GA 3FB7C 4N68A 3JV4A 1Q6HA 2CE6A 1BZ8A 2UUAB 1UWXH 3WEOA 1N6UA 3ABZA 3OKLB 3L5XH 1U91B 3IDGA 4WNQA 3BGMA 5MP6H 4OJDH 1Q9WB 3MRBA 3VB8A 3VFNB 4DKEH 2IBGA 4KGJA 3S98A 1KG0B 4JDZB 4FTVB 5IZ7A 1G6RH 2Q5ZA 1PY9A 1FIGH 2GVYA 1ILSA 1IC5L 1OT1A 2Y07H 3OLIA 2AMUA 4U6XB 4RMRA 4RGMB 1SF9A 3BKCL 5IW6A 4WSJA 4PBDA 1BZQK 2ATPA 3V0VB 4I1NB 4PRPA 3ZMRA 1B0WA 2IPKA 3RI5K 3SDCB 1SQPH 1NAMH 1VA9A 5E56A 2OA9A 2P4VA 3DURA 5FWQA 4M8VA 4Y8AA 2QMJA 4KV5E 3PWPB 1KJ3L 4OZ4B 3TYGH 3R0NA 3NA9H 1T5KA 3QDHA 3DJSA 1TGOA 4Q9BA 3AG3C 2YFNA 4Z23A 2JB6A 1YMMB 5MEPB 4E5XB 4NP9A 1FLTX 3B7YA 1IIKA 2VQFB 1M71A 1UJ3C 1JPSL 3CZFB 4H7VA 3KG5A 3AGVA 4H2CA 3D2UD 1Q6UA 5E4EB 5C0GB 1SBSL 4BH8B 5BQ7B 1IURA 4ICWA 4PBXA 2ZCKH 5JLZA 4XO9A 2C8NA 3SY0A 2VN6A 3HR5B 1MIML 3UTSA 2YXWA 3M1OA 3CZLA 2R69A 5ERWA 2R2BA 1SQXH 2ZT9B 4BWTA 3KR3L 5GHWH 1JNHA 4RFEA 2UY7A 3D51A 5IHZB 2VTFA 3FTGA 5CLTA 3ZK0A 2B1IA 5B38A 5J57B 3P4OB 3WSQL 3K0YA 2L7UA 2B20A 3F65A 4LMQI 1CZ8H 4LSDA 4XN1A 5FKAA 4HC1L 1ADQA 3TBSB 4UBDD 1UGNA 2FGZA 3G6JE 3D4YA 5CGBA 5IVXA 2A7WA 2R51A 4PJGF 1FO0H 1NEZA 2NPLX 3LRKA 3MV8D 2C1OB 1MZFA 2XTSA 2VDLH 4MTFA 3O6FD 4D0DA 3DECA 3MR9A 2Z6FA 4LFAO 1I31A 2CD0A 4APXB 3ZN0A 4JYAB 3DUHA 1UJWB 3GSOA 1OGAE 4NI6A 4AQEA 3RFZB 5CB4B 3HZYB 1E9PA 2WQRA 3W2DH 3O6FC 3LEXA 4RWYL 3JWOL 2IBBA 4RDQG 1UM6L 4M5ZH 3S8FB 3Q2NA 3QXWA 4LE8A 1OCCC 4P3CH 4ZD3H 5LGHL 5H94B 3P54A 1K4DC 1AR1C 1Q0YL 2ZPKL 3EIFA 4ONOA 1IVLA 4Y2OA 1XCTB 3N43F 3NACH 3QXDA 5DLML 1P2CB 4CBPA 2R23B 2XWJA 1W80A 4IMLA 4JZOB 5JDSB 3OPZH 4MDJB 1OKEA 1OTUD 5E24E 2X4PA 2EXTA 4NN6C 4RCAA 2ALWA 4N2KA 4WDIB 1BBJA 4QY8A 1EK3A 2FAUA 4GRLB 3K6OA 4XMLH 1OD9A 2Z1PA 4HCRA 4KK6D 4MCYA 4O02H 4PJCF 5GZOD 3B40A 4N8VB 1LTXA 3AY2A 1MAMH 1OARL 4KVNL 1I5XA 2APVA 4YHIA 4NFDA 3U2IA 1T6VN 5E08H 3TPKA 3SD2A 1XGYH 4Q9QL 1H2MA 4A38A 1IBDA 3WD5H 4CSTA 3VXME 4D0CA 1RURL 5I6PA 1SHXA 4A7TA 1BF2A 3VWKB 1GYVA 1SLVA 1VQ5V 3TO4B 3W0WA 4DR4O 4JAUA 4G11A 4KRLB 4M9PA 1HXMA 1AJPA 5F9AC 1AANA 3FTSA 4RSYA 3TVMC 2UXCO 5B38G 2CO2A 3E3QE 3KVQA 1D5MA 1JJUA 4YMPA 5G5DB 1LM8V 3U6RB 1U8LB 3B2XA 4G7YL 1U3JA 2C7FA 4TLKA 1XXDC 2Q9LA 2HKOA 2YAEA 4ENZA 2Z31A 5JQ6H 1P5UB 1UEYA 4OIIL 3KBFA 3IMSA 2G3NA 4UM9D 4OZFH 4YDVA 2IAMB 2YXVA 2HVKA 3FFCD 4UQ9A 2DN7A 1NEZG 1SNRA 4JASA 4WY7H 2CH7B 5DHVH 4QRSB 3TBYA 3QUYC 4QRAA 3DSFL 2DQCL 2ZCHH 4LPTA 6FABH 5IM7A 4QCIB 3N1PC 5KVFE 3HTLX 3L2NA 4H25B 1IZ3A 4OCNC 2B2XL 2Z7UA 3PDOA 4ZFFA 5D7SH 3BJ91 3LN4A 2ZD0A 4K4KA 1JGUL 4GAGL 3V0EA 5CGYD 4O2AA 4PGCA 2AXJA 2ZUQC 1MFCH 2VKWA 4WV1C 5KUKA 1KC5H 3IFOA 4AENB 3PWNB 2UWEA 1MCNA 5BO1L 4O2FB 3LKRB 2F58L 1XL4A 1N5YL 3T1YO 1C1EH 5C07E 3S36X 1QYGL 4KRPB 1YYMH 3G6AB 4GSDL 1WFOA 2FHFA 1D7BA 3EDDA 4YK4B 4X80L 4ZFGH 5E9NA 5DURB 4FQ1H 1DDHB 1Z5HA 4CNIB 1XB6A 3OXSB 3AK3A 4OFYD 1RJLA 3HE7B 5MHSE 2DIBA 4Y4FD 4JM2F 5J4MA 4MA3A 4BH7A 1A0QL 5HDBE 3DXAB 3HS8A 4X9IA 2IMMA 3D3VA 4F6RB 2C2AA 4GQ9L 3TX4A 5C08A 3TEUA 1OPGL 2XFXA 3ZX6A 2H0JA 4C55A 3IE4A 4MS8D 3JV5A 3H1KH 5DC2A 1QPPA 4W4KA 2JK5C 5EO9B 2M83A 3HS9A 3SDAC 3IGAC 4NC2B 3X3FL 4XMWA 4XN4A 4GS7C 4ZUSA 3CHOA 4L4TD 4LLVB 4GW1B 4DGYH 4ZNCD 4HIQA 1BAGA 5GS1B 3JZYA 3BP5A 4H13C 2V0AA 3RGVA 1VADB 3ARPA 3FQUA 4JVWA 4NQDD 1J5HA 1O9GA 4XBFA 2IPUK 1R3JA 2Z7ZA 1ITCA 3OG6B 3ARYA 5AG9A 5B3NA 3HRPA 4A67A 4CADB 2EDDA 2ZXAA 3F7YA 3SQBB 3TS8A 4U1JA 4MGXA 4PJXF 3DVGB 1QPXA 1R3HA 1I94O 2KQMA 1BD2A 3ZHKA 4DR5B 5I6NA 5FCSH 3CZUB 2C7UB 2OMTB 3RWCA 2D9CA 1OCOB 4AUYA 3E9UA 2BXZA 3UYOD 5IY5B 4X5WB 4DVRL 5EO0B 3GK8H 1MREL 3TPUA 4PVBA 4MYPA 3CX5K 3U48A 2O5XH 3LKQA 4UOJA 1MLCB 2PCFA 2DB8A 4OF7A 2UVFA 5J8OA 1T7YA 1ONQA 3I9IA 5KEZA 1N5AB 4YHOL 2WA4A 5IJ9B 1E4KC 2X4QB 4YEEA 3GDBA 4XDKA 1M05B 1E4WL 2VLKE 5F6HJ 4LP4A 1JVMA 2L04A 4OLYH 3DHUA 5I8EA 3T2NH 1DQLH 2A99A 1WCQA 4KO6A 1OM3L 3IJ4A 3V0HA 2OFQA 2QKIC 2PPDA 4JHBA 4S0TD 2BNUB 4UU9B 1A4JB 4FTDA 4OJAA 4MVUA 4LF8B 1WNSA 1YEGH 5FYJU 3RIKA 1HWYA 2N1KA 1MFMA 3IDMA 4GO6B 3S37H 2XUMA 3TNMB 1T3FB 3IAPA 4LARH 2QR4A 4CVZB 4G42A 1U97A 2LW1A 2YD9A 3CCJV 1FZOA 5HGBB 3VWJD 1Z9MA 3AS1A 4GH7B 3BZFA 4C4KO 3VGAC 1MPAH 5DJDB 2RB8A 1KF9B 4R4FL 4R7DB 3QFDA 2VQ1A 5F97E 2X70B 2WZPD 5HDQL 4FDWA 4KO5A 2DW4A 4BIOA 3SO3C 2SEBA 5CZXC 3JAKA 4GX0A 3GINA 5EBMC 1CG9A 3FUHA 4YL9A 4MNQE 3ZE1F 2Y23A 2V7HB 4N3UA 5E8NA 1Q81W 4LOVA 5INCB 5K1NA 2WXGA 3GJFK 4NN7C 1K6QH 2LFEA 4FLUA 1N64L 3GMQB 5CJBA 3J8F7 1NKGA 3WY4A 1IE4A 4KKPA 2R56H 2TAAA 4N23A 3T08A 3D69A 4JHUA 4R8WL 3RY5A 5HHOB 1NGQH 2H0PA 3ZKMC 2ZKHH 1BEXA 4Z0XB 2AQRA 3ZRSA 4FFVD 4OM0H 3SQOH 1N8ZA 4AM0B 4E9SA 3GTVA 4ZO9A 2W81C 4MKMA 4MTXA 3UYPA 4NPKA 2J55A 3GJEA 5DMKB 5SWZD 4JUSA 2A0LA 1G7QA 4H8QA 4I18C 1W2BU 3Q6GL 4P2OA 5KAQG 2ZE5A 2EE0A 2GHYA 2Z5UA 5C0IB 4PJAA 5BRZE 5E94A 4YXKL 2VWKA 5FDYA 2QJ1A 3I6LD 1O75A 4FM1A 2FJGB 3CFDB 2E27H 3SYCA 4XBGA 5E00B 3QG7H 4Y4KB 2B59A 2YMOA 2K8MA 4YDMA 3STZA 1JWUA 3T1WA 1JXGA 1X59A 1GR7A 1NH6A 4RH4A 2HZHA 4P2RE 1N6VA 5CP7B 5IVOA 2XPZA 1JGLH 4I3SL 3C75A 1BECA 4HS8H 5KJ7E 4NHCH 1VFOA 4JRYB 4AYGA 3WNKA 4LEOA 1NCBH 1Q94B 3PGDA 3T65B 3CDGA 1EHKB 3WXWH 5BUGA 2QSVA 3SE9L 3OF6A 2XNAB 5I1AB 3GMPA 3EJQA 4HNAA 1M56C 1SN0A 4H0LC 3QDGD 1NPNA 3AG7A 1WT5A 1J5EB 3G08A 3CXHK 2K1EA 1ZGLB 3TCLA 2PCPB 1ORSB 3L9DA 1FSKB 3OPUA 4B53A 1E79G 4YHHO 2N56A 1ASQA 1FHNA 2RFXA 1ZX3A 3HI6L 2AFNA 3IU3B 4DETA 3JD4A 4R4BA 3QFJB 2OIEA 3JD0A 4LHJB 1PW3A 3V5DA 2JJ1G 1G4YB 5J2TB 3L45A 1A9BA 3QXVA 4P9ML 2VLJA 4R3SA 5F7DA 2CSPA 5F7EH 4JREB 1FA4A 2WXRA 4PVNA 2HTLD 3OWRA 3F00A 3QQDB 3EBGA 3DUSB 2WXJA 2WBKA 5IP4A 2G3XA 3IGKA 4PJ8C 1MXDA 2R59A 3LZQA 3OBAA 4KROB 3VFVB 3IPBA 1AQDB 3VFUA 3ZHVA 2C9VA 2O26U 3DOSB 3JATB 3FHAA 4OIBA 1GXEA 3UKMA 3FNKA 1BL8A 5DI8B 3TK1A 1L9SA 1FGVH 1LL1A 3FO9B 3OB0K 4AYEC 3PWUB 2OJEB 4OZIE 4UIMA 4ONGL 3BUYA 2JJTA 2D31B 1CPUA 4GSQA 4N2IA 3VM7A 5BZBA 1VQ8V 3EYVB 4HSQA 4LCWE 3TBVA 4G7SB 1WA2X 4MVMA 1PG7W 2WOBA 4UCSA 3B43A 3CNKA 4YDJA 1MHHA 3PWLA 1TZGL 2EDQA 3C60A 4JZJC 4ANKA 4DV1B 1H6EA 3EG9A 1WF5A 2ZX9A 1QFWH 1TMQA 2WVSA 4JFZL 4R4ND 1KPUB 4HUWB 4CAGA 5TE6H 2NY3B 4PJBB 1F1GA 5E9DD 5I6XC 1N32O 4OQ1A 3KPRA 5AKSA 4N2HA 3R19A 3SBWC 2NW2B 1PIGA 2WYZA 3PAUA 2WK2A 2PCYA 4KDTA 3V52H 3MCG1 4F5CA 1P9MA 4UT9A 3AACA 1SLWA 4XOAA 1J9QA 2VN7A 4TTGA 5F89A 4ORZC 3ILPB 1HNWB 4DK3A 3IFLH 2FIKA 5C0ND 2BIQA 4NWTH 1XCXA 1PZAA 4F20A 1JRHH 5C0NC 3PV6A 5IJBC 3DOHA 5AQ0A 1Y6XA 2D7MA 3B4NA 1T4WA 3HG1A 5C0BD 1CXKA 3Q1SH 3VJ6A 5IB1B 2DMCA 2E9WA 4WI9A 5DQDL 4C56B 2P8MB 2GJ6A 4IRZH 4HOWA 3E35A 4JFDB 4M7JL 4LFHG 1ZLWK 3GBML 3QAZB 3V5HB 4WW2A 2XZCH 4BJLA 1YEFH 1X7SA 4OCWL 3TT1L 1AILA 2R0KH 4TVUA 3TASA 2BVQB 3GNMH 3HA0A 3MV7A 3L3DB 3QPKA 2ZIDA 4UI2A 2QKSA 4WFGA 2CXKA 4YHLH 2WTRB 4X6DA 3ELAT 4GRMB 1J87A 1FAKT 3L13A 2P24B 1L9OA 3NJJA 4WWKA 1S4IA 3AY4C 2I25N 4OT1H 4YO0A 1I85C 2WO3B 4JDEA 1DE4B 2BOLA 4ZUUB 4D3CL 2QDOA 4PA4A 3RQ3A 1X7QA 3HS0C 3MV8E 5BUPA 4NZDA 4OLUH 4B08A 4XI5C 1JCKA 2R69L 1DVZA 3QRGL 1J5OH 1MFEH 4L18A 4ZMOA 1QRNB 4TQIA 1I7RB 1RU9H 2CUIA 2G75B 2V2TA 1EV2E 2DM2A 1MWAH 1Y7VA 1E4JA 2ERJC 1GVIA 4TOYL 3BOVA 2QGNA 1FRGL 2A2QT 1GSKA 1A4BA 2FLMA 3VD5A 3PS6A 1KIUB 1PG7X 1WWWX 5D70H 4L3EE 2XBTA 1Y76B 4X1YA 4K94L 5FA4B 4PJ7F 4PJEA 2V3DA 3BH4A 1LO4H 3IETA 3EXJA 3REVB 1IQWL 1ADQL 3MLTB 2ZINA 2AEQL 3F58H 3G5XA 3B8NA 2OL3H 1KTCA 4JI1O 1KLUA 3HUJB 4KJQD 5CN2A 4TLTA 3ZHFA 4WJG3 4DGIH 3KPLB 1RHHA 1NDTA 1AZRA 2GAZB 2YEVB 2YGQA 4TUKL 2ZXDA 3BN9C 4NI3A 4X9BA 1JV5A 3QVNA 3STLC 4G71B 4NCDA 5HVGB 5T1DL 3ZDYF 4P4KA 2AKRB 1KCBA 2VM4A 3FB6B 2K78A 4WFFD 4DZBB 1KJVB 4YFDB 2H1LM 5IYCO 4K07A 1G6VK 4WSGA 3LNGA 4GXFA 4NQUA 1SYVA 3RVXC 3FOLA 5FV1L 3WUZA 4N2EA 2GCYB 4KXAA 1U8CB 3CSYB 4MB5A 3L1EA 5E9AA 4QYOB 5ACZB 5A43C 5KYXA 1OB0A 3AG2C 1Z3RA 2MMXA 4HF5H 4XC3L 3S2CA 2F7PA 1E6JL 1YXBA 2EJRA 1Y0LB 3L4ZA 5IJVB 1TA8A 1KN2L 1NGWB 4YSDA 4PGJA 1NCJA 1EXGA 1DVTA 1F90L 4Y88A 2JS5A 3ZCCA 4DAGL 2BFGA 1HIML 5FC9A 3WLWC 2PPEA 4MNGB 3ZGHA 4Z7QB 2LV4A 1BS3A 1OHZA 2XBZA 3PWVB 4JI6B 1A3LL 2UZYB 4Y5YC 5KX5B 4HAGA 3S35H 4LSTH 3FN0H 3QDJD 4HCRL 4YHKH 1X9LA 1KMIZ 4GKJO 1TQTA 4FL4C 5AVXB 3LJ3A 4PR5B 1M6OA 3UBHA 1FN4B 3WKPA 4NUJB 5JYMA 2OYKA 1C5BH 3IF1A 4YBHA 3FFCE 1D6VH 2M1KA 2CPCA 5EH1A 3NGBC 1O6SB 4M6AA 2E9IA 4I88A 4UAOC 2VXTH 4HMCA 3NT0A 3VFPA 2QV2A 4IRJC 4DPBX 5L3CA 3EJPA 3G80A 2F1MA 4NYKA 3TJTA 1CXIA 2IF7A 3GIZL 4JO1L 2P7TC 4NC0B 4P05A 2AW2A 4NBYB 3A6CH 3F62A 4ES8A 5CCKL 5KTEH 1H5BA 2QJDA 4WHTB 1K8DB 2YBGA 1JL8A 1YN6A 5BZXA 3HVDA 5EBWA 1LE5B 2H8PA 4XVJL 5ANMA 2XPGA 2YD2A 1T0MA 3FW6A 3FU0A 1K4CB 3QEQD 4LKCA 1CXFA 3EO1B 4K35A 4ENEC 3OTFA 3ARUA 3UC2A 5IV2B 4O4HB 4B9CA 2HG0A 4X9QA 4MFHA 3SKJL 1X5FA 1JMZA 1S5IL 4P5TB 4V1DB 4LOUC 4AUUA 3CB2A 1Q5OA 1ZANL 3D39D 2JF1A 5I24A 3VFGL 3CC5A 5DGQA 2ZSVA 3LB6D 3EUDA 3JWNG 1VSCA 3VD1A 2QKAA 4IQHA 1CFBA 4F58L 3FHQA 4Y0GA 3LKNA 3MA9L 5DUBA 4IJ3B 1JVOA 3F84A 3MFGB 3NIDE 4U6HA 3LB6C 4U1NB 1M1XB 3MRLB 1BXVA 5E6IB 2OMUA 2OK0L 3D05A 3L48A 3OWEA 3AREB 4IIQC 4L4TE 3FTXA 3R1GH 1UUSA 3WKQA 1A1NA 1OP3K 1KGCD 1Z5LB 3QNYA 2YMTA 2EUXA 2ZXBA 4Y4HD 1IM3A 1RV6X 4PJIE 1U3HB 4NQDE 4QKTA 4UUJC 2X3CA 2QA4V 1CC3A 4JL1A 1PD3A 3ABKC 3I9PA 1GZHA 3IGUA 5CAYB 4IMKC 4NZRH 4EZMA 1VFUA 4MB3A 4X7DC 1R75A 1GKFA 2QPFA 5TGBB 2DMKA 3L3JA 1N0LA 2LU3A 1UFGA 5I1EH 2UYLA 2IV8A 4BXVA 4F8OA 3MLZL 4LFAB 2F54E 3OZKA 3OR6C 4LCCA 3BW9A 5CSGA 2BSRA 2DWSA 2YJQA 1VHPA 4LCUC 2G4GA 3WFZA 5L4JA 2GTAA 2X4RB 1IGCL 3L8QA 5INDB 4Q0XL 2OXHA 1JWSA 3KWXA 3LVTA 2XVBA 2W5PA 4Y5XA 4LXFA 4LBEC 3CCQV 2P8LA 1Y6KR 5T33H 4J9ZB 1Z9PA 1TSRA 2YR3A 1E4XL 2IFFL 5CMAB 1GGBH 1UOKA 5KBKA 3S9DB 3L7FA 5EZYA 1O9ZA 5DVKA 3EDEA 4GUQA 3VXNA 5JHMA 4I55B 4AGPA 2EIMC 2IG2L 4X98A 1EHNA 3V6ZA 4PJDF 2V7NA 1MHCA 2WIIA 4XMKL 3W82A 3W7WA 2HG5A 5FOJA 1GC1L 4TMPA 2X9YA 3TCTA 4ZXBC 3PP3K 5FHBL 2GTWA 2VLLB 2BDNL 1JPST 4FQIL 4X5QA 5KZCB 1FNEA 4XOCA 2D7QA 4F8PA 2R7EA 4M02A 1JXFA 3O8XD 1JGEA 3ZJAA 3TL5A 3DSNB 4MTOA 1UACH 1IUZA 1LNQA 4K5MA 4JHAL 4XPTL 4LASL 5FYJL 1E1QG 3IDGB 3EVKA 3BGMB 4WNQB 3EXAA 4DR4B 1OAKH 3MRBB 3QTCA 3VXOA 1H8OA 5I66A 3H2WA 1HH6A 4J11A 4FQXC 3ZHNA 3DVIA 5FHAL 1EWHA 2XIDA 4PJ9A 2X6VA 4YAQB 2UXCB 3AS3A 3M7MX 3VI3F 1LDPL 1JPEA 1WBYB 1J12A 4MBOA 4FQJL 5F9OH 3V0WH 3FFOA 1PBYA 2VXUL 4LAQH 1B9ZA 4RGOL 1PMYA 2NR6D 4CU7A 3TNNA 2Y3AA 1GH7A 2IPKB 3EDJA 1TT6A 4IK6A 4J8RA 2ESVD 1MQKL 1N7ML 2AXFA 2XV0A 2GJJA 3KBPA 4L0YA 5SWZE 4DEUA 1VF5B 1BFTA 5KBNC 1NA8A 3CRMA 4Z95H 1UCBL 2JB6B 3MV9D 2D73A 2VKXA 2CGZA 1M71B 2BVYA 5T1JA 1YCSA 2DBJA 2X6AA 2BLFA 4ZQKA 4Q9RH 5A7BA 1II4E 1W91A 2ITFA 5J3HD 3KG2A 5BW7A 5JLZB 3TIDA 5IREA 1NIEA 3SY0B 4K0KO 3UTSB 3S3SA 1QQDA 7FABL 2WV3A 3TONA 3T1YB 1T03L 5ERWB 3DROA 3E8FA 2R2BB 3LZRA 1PYWB 2O72A 1ZWIC 4X8GA 4NAQA 1TENA 4PVLA 4CS2A 1JNHB 2E56A 3FPXA 4G8IB 2UY7B 5DHMC 3L4VA 4K5PA 2Y7LA 3FCGA 5AAMA 3ML0A 3CX5F 3QDGE 1K72A 2AJZB 4WENB 5B38B 1GAFH 1K5QA 3K9SA 2ILLA 3ICXA 3JARA 3GS4A 4OH2A 4LVNB 5FKAB 4LP8A 3QUMA 4QMEA 4ZFQA 4JG0L 1B4JL 1OHHG 1JD9A 4A6YL 1OAQH 1NL0H 3H9HA 1R4XA 4WI4A 3IJSA 4XNZC 1NEZB 2Y7QA 1MRDH 2KG7A 1ZVSA 3Q5OA 3GO1H 4GLRI 5JOEA 4D0DB 2QPUA 43C9A 5BXFA 3MR9B 1QG3A 4D0BA 2D03H 3GSOB 4XPFH 3D85A 4AQEB 1Z0NA 1N34O 1E9PB 2FJHA 4N2BA 1NGPH 3LEXB 3ZE0E 4EI5D 3CLEL 2V5RA 3N5AA 1AO7D 1NBVL 2QL1A 3N1QC 1MSPA 1IFGA 3L3OA 3L2LA 3PAZA 2EZOA 4ABMA 3SDXE 4Y2OB 5D7IF 3CFJA 3ZE2B 2VZOA 3SOBL 4K15A 4OQTL 1I94B 2VR5A 1ZOXA 4POZC 2Z4QA 2XZAL 4PP2A 2XWJB 4IMLB 1BFVH 2ZNWA 4WWPA 4EIZC 2HRLA 2X4PB 2NCMA 2Q7AA 5GJSL 4HHWA 3HE6C 5E2TL 4TN9A 2GG1A 3P3UA 1K3ZA 3HNTH 1I8KA 3E8UH 1K34A 1RQ5A 3BSHA 4MCYB 5E9DE 2YI8A 5FL7G 1BWWA 5T1KB 2OP4L 3NJNA 3K57A 5C09E 3RUGF 3MUZ1 1YY9C 2H5UA 3C8KA 1KPVA 1A7QL 1QKZL 1EUTA 2IJKA 2P48B 3ABGA 3FFQA 4UNTA 4YHIB 1A22B 2N7BA 2YPLE 5JMOC 1Q9OA 4JM0A 2X2IA 1VGKA 1NIDA 5IFHH 1QP1A 1AR4A 1NCCH 4D0CB 1V54C 2VN4A 4RWHA 1BF5A 3RX8A 2WKOA 4ODTL 3UJTH 4WEBH 2ADQB 3KD4A 3CU7A 4JKPH 4M1DL 3DJRA 3W0WB 1JYVA 3TV3H 1WEJH 3A6BH 1KT2A 4K23L 4MMZC 4R90L 3PIQA 1IBMO 4UINH 1HXMB 2BFVL 2X87A 5C0BE 4FFBB 2BVTA 3KGTA 5K9KA 2B08A 4ICGA 1S7VA 3A24A 1RIHL 1D5MB 3U7AA 1G9NL 3DC6A 2EXYC 3O11A 1S6NA 4OSUL 2PETA 5KN5B 1XR9A 2J4WL 2VH5L 3IEAA 3KPQA 3CXDL 4LGSB 4S1RH 1BDYA 1MAJA 3PPSA 4U1HB 4W9CC 3B8YA 1ED3B 5DF0A 3CJHA 3U6XA 2HN7A 4UT9L 1AMYA 2Z0UA 1CFQA 3AW5A 1S0VA 4DPCX 4TVPD 2D7OA 4YDVB 4XWGH 2HVKB 1JD7A 4J4PA 4LLYA 5F7UA 4R6ZA 1JHLH 1XF1A 5JPMC 3V7MA 1MNNA 3E8HA 2AJ3A 3EJYC 3CXHF 2VN3A 3O6LH 2ZKMX 3ME0A 4V2CB 4L4VD 2J71A 1IBGH 4QDGA 2MTAA 4AY0A 1PFCA 2IBZX 3I2CL 3MFFA 3PDOB 3RTQC 2PWFA 4MCNA 3WTVA 4YJ2A 2B4CC 2CLZA 3MQIA 4U3XA 2E6QA 3KGUA 3UAFA 2JQMA 3IJ7A 5IIEA 1IAII 2UWEB 4FG6C 2DTSA 5FA3A 3FMGL 4K8RD 1B0GA 1EZVX 1IKNA 4EDWH 5AB9A 1MRCL 2PYEA 5DD1H 1ZIAA 4Y2DA 4ZK8A 4IIZA 2FJFA 5I1HH 1FL5A 5HD8D 2FWOA 5LO7A 1E42A 4NQQA 5IG7B 4BQ8A 2HSIA 4XOEA 1EXUA 3AFLA 5FLVA 4BUHA 5FCUL 4QNPF 3DJ9A 4JTDB 4QXUH 2IDTA 3W3BA 3M45A 2HTKD 1QFUH 2BIIA 1HP8A 2I7SA 3QZPA 1IAIM 1J05B 2JQAA 3CFQA 3D3VB 1A7RL 3ZKNC 2R4SH 3EF7A 5C9JA 2AXGA 3KKYA 1RSYA 2XFXB 3AUVA 4KK8D 5C08B 3M07A 3GLDA 4UT6A 4YBLC 4DGVL 3QWRA 4ZUWB 2A9HA 1AP2A 2QPEB 3DMMD 3WHXA 4F7TA 4XVTH 3EJZD 1CURA 2HLAB 2BTQB 2DL2A 4YSEA 5TJWK 1ZAGA 3D7PA 3KDMA 4ZUSB 5DQJA 4WFFE 3QEGH 5FPOA 4JFXA 5I1LB 4G6FB 3B2VL 1HL9A 3CVIH 3DJZA 5E6SB 3BP5B 4YHHB 4LSQH 1SJVA 3RGVB 2BP0B 1XSKA 3FQUB 4LL9A 2DQUH 3ARFC 3ZGIA 1R3JB 3POCA 1IFHH 5C9KA 4FP8H 3MXVH 1LVEA 3G6JA 2J73A 3QIWC 3F7YB 5GSRB 3WFCH 5EZPA 1SUHA 1YEJH 4FLRA 4W9IC 2VM3A 3UBXI 4U1JB 5C70A 3RW0A 4JM2C 4JN1H 1QR8A 4L9LC 4M7LH 1D7DA 1BD2B 1T5XA 4EXKA 5DJ6A 2XN9D 2ADFH 1W6WA 3QJSB 1YRKA 4JQVC 4WI6A 2BSED 4Z9KB 3LPGA 4Q20A 3RWCB 2GIYA 2ZD9A 1OGAA 2N7AA 5D7JC 2YKLH 4W68A 5EUOA 3C5SA 1LNUA 4TQ8A 4MYWB 5DJ8A 4ZJ9A 3TPUB 3BKML 1HNFA 1D3CA 3QI9C 5TE4H 5JIQA 3LKQB 5JW4M 3NIGB 4KX8A 4QJ3B 3SDLA 2F1EA 1P7QD 1AJQA 2YEZA 5AZEL 1ONQB 2D0GA 4DP7X 1X5KA 4FI7A 1YNKL 5F7MC 4Z3GA 2B14A 4PUBH 1FFQA 4LFBO 3U7WL 1OCWL 5JIKA 3K3QA 5I8EB 1INEL 5D93C 5IBTH 4S1QH 2E75C 3O9WA 4GG6F 2Y4SA 3OJDA 1J0IA 5ESVA 4AJ0A 3BFQG 2OSLA 2CG9X 1Y6NR 3IDMB 4UM8B 2Z8VC 1KU9A 1NU1H 3TA3D 2PYFB 1IX2A 2J2ZA 3BKYH 4L0PB 1B04A 1N32B 1QZ1A 3BQUA 3OQRA 4G42B 1UYWL 1PQZA 4F4LA 4QI3A 3L3KB 3QAQA 2KLRA 2WTPA 4JFFD