3ASOB

Bovine heart cytochrome c oxidase in the fully oxidized state measured at 0.9 angstrom wavelength
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Distinguishing between Cl- and O2(2-) as the bridging element between Fe3+ and Cu2+ in resting-oxidized cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 67
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3asoB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3asoB02
1NWOA 4BDVB 4KO6A 3UAEA 2CBPA 4E9RA 4P5RA 1A4CA 2W8CA 3DTUB 5F7BA 3FPYA 5PCYA 4M4RB 1I53A 3FU9A 1R1CA 3TASA 2XX0A 2AFNA 2GC7C 3QJRB 1CC3A 3FQ1A 1XMEB 3FU7B 1SFHA 1DYZA 3ZX1A 2VM3A 3X2QB 4L0PB 3PLYA 1EHKB 3X1EA 2YAQA 3QJUB 4WKXA 3H56A 2GHZA 3X1BA 3IE9A 3FU8A 1QLEB 5PAZA 1X9UA 2IDQA 3HEIB 3IN0A 1KV7A 5I6LA 3OMAB 1ASOA 3FSZA 4HCFA 3ABKB 3NJLA 3MBWB 3QQXA 1RCYA 1HAUA 3AZUA 3EHBB 1L9TA 4AZUA 4A2GA 1AS6A 5B7FA 1T5KA 3OQRA 5AZUA 4G71B 2PPCA 2IDUA 1NIFA 1KCBA 3FPXA 1V10A 3NJHA 2VSMB 4Q8BA 4F2FA 1XB8A 1GW0A 3IBOA 1PCSA 3V9EA 2I7SA 5TK2A 2QPEB 2N0MA 2JKWA 3CG8A 1PY0A 2GIMA 3H4HA 1ZDSA 1IUZA 1BQKA 4GP5B 2XXFA 1OCRB 2PPAA 3UABA 2Q5BA 3NP3A 2FQGA 3T6XA 5I6MA 1V55B 3EH3B 4A2EA 2UXVA 3C75A 3FS9A 2CUAA 3UGEA 1SDDB 2PPEA 1WA1X 2IDTA 2BP8A 1IKOP 3WNJA 4YVUA 1JZGA 1L9PA 1NIDA 3U25A 1URIA 3WKPA 3GXUB 2PPDA 1NPJA 1AIZA 4BWUA 5I6PA 1M56B 5B1BB 4BK5C 1E65A 2H5UA 2AANA 2IWEA 2J56A 3JT2A 1ILSA 1IBYA 2MTAA 2RACA 4KOBA 2ZXWB 3OMNB 1HFUA 4BXVA 1CYXA 1JVOA 1OV8A 2QDVA 1BXUA 1N68A 1WS8A 3N55A 4DP8X 1JVLA 2B3IA 2XUWA 1VLXA 3NJIA 1OE1A 4G72B 1KGYE 1L9OA 4GY4A 3S3DB 1AZCA 5E9NA 1ET7A 4PAZA 5I6NA 5EHFA 3IN2A 2UX6A 1UATA 4A2DA 4DP1X 1X9RA 4YSPA 1QHQA 3T6WA 1GR7A 4A2FA 2IWKA 2XX1A 3OD3A 1GYCA 2HRHA 1M9WA 2P80A 1ID2A 2VW4A 2FNWA 1OOWA 1JZEA 1FWXA 1NICA 4AKQA 3WG7B 1A4AA 1KBVA 3NJGA 1NIAA 4UANA 8PAZA 3SBQA 2J57A 5B1JC 2I85A 3KW8A 1NIBA 2PP7A 4G7RB 1B3IA 1AS7A 2I7OA 3H4FA 5B7MA 4CSPA 1TKWA 1ASPA 3ABGA 1JERA 1CUOA 1WAEA 1A65A 4DP4X 2EINB 2CJ3A 3CVBA 1JXGA 2QT6A 4PCYA 2XU9A 4DP9X 3HB3B 3OM3B 2HXAA 2XVBA 4AX3A 9PCYA 3NSFA 1NTDA 2UXTA 2JFCA 3T6ZA 3FYIB 1W6LA 3AG1B 3AG4B 2VN3A 3RYMA 2EILB 3FT0A 2Y1AA 4KO9A 2WO2B 4E9TA 3KW7A 4DP5X 7PCYA 3DKHA 1EZLA 2FQEA 4AI7A 2R7EA 4JKNA 3ZIYA 1JOIA 2UXGA 2Y69B 4YSDA 1ZIAA 2GSMB 4P5SA 3S3BB 1PZBA 3SBRA 5B1KA 2PCYA 3NSYA 2ZOOA 4E9YA 1JZJA 1OE3A 2XV3A 2UX7A 3D12B 3WI9A 4HCGA 2PP8A 2DWTA 2H3XC 4M3HA 1FFTB 4ENZA 2EIKB 4YL4A 1J9SA 1SHXA 2FQDA 3AW5A 2YQBA 4WTQA 4CSZA 1J9RA 4YSUA 2DYSB 4F7KA 2H47C 4E9XA 2HZHA 1PMYA 4W1TA 2YAPA 1AQ8A 1AR1B 3BVDB 1YLBB 2PP9A 4HIPA 1PZAA 3SQRA 1A4BA 4DPCX 4UF7C 1NPNA 3TU6A 2LLNA 2WSDA 4YSCA 2DWSA 1GS7A 1AZRA 1RZPA 4YSEA 4YSTA 1JXDA 1RZQA 2GC4C 4BXSV 3PXLA 2FT8A 2VW6A 4QKTA 4W9ZA 2ZONA 2YAOA 5LDUA 3PAZA 1E30A 1XB6A 3ZDWA 1JZIA 1J9TA 1BQRA 2BP0A 1AG6A 2VSKB 5D4JA 2PCFA 2YXWA 4DP6X 2XV0A 1JZHA 2BZCA 1OCOB 1SJMA 1AZNA 2EIMB 1BYOA 3ASOB 2BP8B 2OV0A 4AKOA 3FSAA 3UACA 3NP4A 4QLWA 1J5CA 4YVNA 1L9SA 1SF5A 1FA4A 2BW4A 3NJMA 5I28A 5B1JA 3QJVB 3SBPA 2GI0A 1JXFA 3ABMB 2MRYA 3QJTB 2DY2A 2NRDA 3IEAA 4HHGA 4BWWA 3FSWA 5B1AB 1IBZA 1NINA 2VW7A 4DP7X 1BXAA 3X1GA 3AG2B 2P80D 3CDZA 4A2HA 1PLCA 2BHFA 2ZWNA 4KO5A 1QNIA 5AFAA 3CVCA 4RH4A 3T9WA 2FT7A 1HAWA 2DV6A 4X4KA 4TXVB 3AG3B 2FQFA 2HLEB 1BEXA 2DYRB 3CZUB 1RKRA 5I5MA 1AZUA 1OF0A 1PNDA 2XYBA 3FQ2A 4NB7A 1PF3A 4BDVA 2XV2A 1GS8A 1DZ0A 2Q9OA 3NJJA 4NAJA 1F56A 2IH8A 3G5WA 3UADA 1W8EA 2QPDB 5I26A 4HAKA 3MX0B 3UAAA 2B08A 2FT6A 3NJNA 1L9RA 1N70A 4FAAB 7PAZA 1OCCB 1SFDA 4GXFA 4YSOA 2IAAC 3WKQA 1SHWA 1PLAA 1XB3A 4E9WA 4A68A 2IDSA 6PCYA 2GB2A 4HHWA 3FU7A 1GY1A 2XXGA 3ASNB 2YARA 1BXVA 1ZIBA 1AAJA 1KDJA 4N4YB 5TK4A 2IH9A 1JZFA 5ANHA 4JHUA 2W88A 3WIAA 6PAZA 2EIJB 1J5DA 1ET8A 2YAHA 2J5WA 3EH4B 2PPFA 1ASQA 4BWTA 3TBBA 2J55A 3QJSB 2CAKA 4A67A 2WO3B 4HZ1A 3JTBA 2TSAA 5IY5B 1TEFA 3GDCA 4HCIA 2AVFA 4KOCA 1TU2A 1A3ZA 3NYKA 4YSRA 1AG0A 4DP2X 4E9VA 1MG2C 2VMJA 2BO0A 2E86A 2HRGA 3X1NA 3BQVA 2FTAA 3PAUA 4YSAA 4YSQA 3NSCA 2BWDA 1AACA 4HALA 1OE2A 4AKPA 1ETJA 2R7EB 2IDFA 1GS6X 3QPKA 2BW5A 2HX8A 1KDIA 2X88A 4MFHA 5FC9A 4A66A 1AOZA 4ZK8A 1OCZB 2BZ7A 5I5IA 4NERA 1BYPA 4YSSA 3FSVA 2XLLA 3AY2A 1ZV2A 4Q89A 1L9QA 4DP0X 2X87A 3TBCA 4JHVA 3TA4D 2QDWA 4G7QB 1E5YA 3ERXA 2YAMA 4KNUA 1M57B 1SDDA 1SF3A 2BWIA 2FJSA 1SNRA 5I6OA 1E5ZA 3WNIA 5A7EA 1AZBA 4GP8B 3ABLB 1CYWA 2JXMA 1ZPUA 5B3SB 4UAHA 1PNCA 2YAEA 1KYAA 1NZRA 3X1FA 1ZDQA 2YEVB 3S8FB 3S8GB 2XWZA 3T6VA 1V54B 3OMIB 4G7SB 3CVDA 1WS7A 4N8UA 2OCCB 3NT0A 2YXVA 1J9QA 3FYEB 2VM4A 2HX9A 3PCYA 2AZAA 4E9SA 3ZBMA 2HX7A 3NJFA 4FA7B 1GY2A 1MZYA 1MZZA 1ADWA 2OJ1A 3L45A 2IWFA 3GYRA 2CALA 4G70B 2BP0B 3PAVA 1ET5A 3NSDA 4F2EA 5I5JA 2PLTA 1ILUA 1GSKA 5F7AA 5I6KA 1MDAA 2A3TA 1WA0X 1PAZA 5D4IA 4E9QA 1IC0A 3EF4A 5D4HA 5AKRA 1AANA 2TSBA 1NIEA 1KBWA 4GYBA 1NDTA 4DPAX 1W6WA 3N2JA 1E67A 4GP4B 4K9JA 1A8ZA 1CURA 3T71A 3FQYA 3V9CA 2CCWA 3CDZB 2UXFA 1AS8A 3QJQB 2YAFA 4KO7A 4DPBX 3PPSA 2FWLB 5B7EA 4EF3A 1MG3C 1BAWA 1PLBA 3NJKA 4KNSA 3EH5B 4KNTA 1PZCA 3S3CB 3DIVA 2GBAA 1TEGA 1KCWA 1BQ5A 1NWPA 2AZUA 1WA2X
chains in the Genus database with same CATH superfamily
5LHDA 1S77D 4BDVB 3IBEA 1I3VA 2G3NA 1T1XB 4JBSA 1IKFL 5F1KC 4LK4A 2EE2A 1L0NH 1E6JH 1YY9D 3DXAB 4UTAH 2P8MB 2VLJB 3EHBD 4L4VB 3RWEB 5A16A 2MOVA 4HUXB 5CFAA 5LL6Y 2VMDA 4U05A 1CDIA 1IGYA 5DD1H 3GBEA 3NN8B 1F4NA 1W2KT 4HBNA 3DETC 4WEBH 4XODA 5GS1C 1JZ2A 2Z92B 4MMYA 5B4MD 1TMQA 5C0IA 2DPKA 1C8QA 1US6A 5KLVH 1ED3A 5DJZA 5SWSE 1H8SA 1FC2D 1UB5B 4KXCA 3ASWA 4PRDB 4U1NB 4U6YA 1JOYA 4WV1A 5D2LA 1RZIA 1QVGU 1WWCA 1HIMH 2XAJA 4DR6B 4X5WB 1T5WA 2O5XL 2X4PA 3F04A 4OZGB 3CC7V 2YPKB 1EHLH 4GRWE 3DRTB 3CCJV 2H0FA 1BQLH 3ESNA 3EHBB 3RVWD 1AS6A 3ARGB 4NN5B 2WBJC 1WG3A 3MTRA 3WTXA 3FOMA 3G6JE 1CDGA 1HH6B 1OTTC 1U3HB 3BRCA 1PV0A 4EB6B 4WWOA 1XMWA 3KBHE 2NYKA 2C9SA 4ATTA 4NQQA 1YEEH 2VUYA 1VRSA 3C09C 5DRNA 4PS7A 1UD5A 1H3PL 1N0LA 3BKJH 2ZSVA 3VU2A 1XF2A 3T2NL 5A6LA 2HT2C 5IYCO 1BM3L 2WIMA 3FMGL 3KYKH 3QDGD 2IXQB 3SE4C 5BRZE 1S7TB 3D9AH 2BY3A 5EU7E 5I18H 4FHKA 3KEDA 2PPAA 3JALB 3N85L 2ZG1A 3LNIA 3UPRA 3EH3B 2VH5H 3HBPA 1L7IH 5DJAA 3SGDI 4OZ4B 2XWJB 3G5XB 3HPJB 5D72H 4BSVB 1GGYA 1NPUA 1J7VR 2F53A 3TO4B 2R2HB 1QZ1A 4Z1MG 1BZ7B 3MNZA 4LCUA 2IMNA 2Y5TA 2PWHA 2Z91A 3G80A 3DUHA 3PGCA 4XMWA 3HZ3A 3G4SV 2LGNA 2Q3XA 4WK2B 4YVUA 1PIFA 2WKOF 1M4UA 1HCYA 4NWUH 2JKTM 4ABVA 2ATPA 1XGYL 1DQQB 5FFOA 4L4TE 4DGVL 4G6JH 5SX4I 1OD7A 3RPKA 3DLQR 1KBBA 1H2NA 5LXGL 1MEXH 2ZKYA 1T1YA 3LH2L 4L8SC 1SHMA 3RUGA 1R3JA 5CMUA 3DX9B 1UCTA 2ZOKA 1I1RA 3UERA 1CICA 1K2DB 1MY7A 4TNWK 1F3DJ 3M6DA 1X5YA 4FYSA 4EZLA 5CA1A 3VXSA 4K7PH 1ILSA 4L5FL 3ESUF 3QDGB 4EDXA 3MLTA 4PMFA 3HR0A 5DI8A 4F7TB 1BM7A 3FN9A 3RWGA 4OUUA 2GUZA 4PPTA 3QNXA 4A7VA 2PW1B 4J8RB 4JAMA 3SYPA 1KPRB 1ZS8A 4I9WD 4W70A 4Y2DC 4H13B 4XC1H 3K9SA 3S3DB 5IHBA 1I8IB 1BFOA 1T4KB 5E7BA 1TUBB 2OQJB 2VXQA 3UBXB 4YSPA 3VGFA 4BKLA 1TJHH 4FEMA 3CJJA 3HC4L 3IKCB 3OD3A 5D1ZD 5FUCC 3SD2A 5BQ7A 2IH1A 4AQ8C 3VXRE 5BVJB 4HPYH 5HDWA 4B3SO 1NCDL 3CZSA 1E42A 3FFQA 3SJQC 4PD4K 4AKQA 1FWXA 1Q0EA 2FMLA 3JAWB 1CP9A 2BE3A 3B2EE 4L8JA 1K73W 1NC2A 2V3EA 4QJ4B 2IOMA 3QDMD 3U4EB 4DFIA 4YDKL 3AITA 1CN4A 1G7JA 2PP7A 1EGJA 4G7RB 4UM8A 2VOTA 3V79C 1Q0YL 4KI5F 5DDHA 2R59A 3Q9QA 3ESVF 3E7JA 4P59L 4IU3B 4Z7UA 1U3JA 2BRRH 2E9IA 3QXWA 4TSAH 5EZPA 2L4OA 2AGJH 3V6ZA 3SGJA 2F1BA 3FO2A 5AW5B 2CJTA 2DTMH 3C9NA 4B0MM 3QC6X 4AX3A 1MFAH 4JRYB 3V6OC 1K8AW 1BAFL 1E79G 3T6ZA 4ZZFA 2VZ3A 1N33B 2WP3T 3U2JA 1UM4H 1Q72L 1D5IH 3LZNA 2XQYA 1KB9K 3DGCR 3RYMA 3L3DA 5FYKD 1EZVY 1BEYH 4JN2A 4NPYB 4DGIH 4Z1PA 2OTUB 1DVZA 2V9UA 2VKWA 5JYLA 3ARBD 3I6GB 1L4IA 1EN4A 1CK0H 3CPLA 4FG2A 3IDMA 3QDMB 1FFNB 5MP6L 1HWHB 4MCYA 1JPXA 1UOLA 3OJMB 4MJIE 5E1AA 2LU5A 3S3BB 5FO8B 4PLKC 4X5RA 2UXDO 1KJMA 4PUBL 3MJ9L 3QO8A 3VFMB 4TPRL 1Y74A 3KKYA 2YLHA 3LQAH 3LEYH 3OPZH 1KJVA 3AQDA 3R1GL 2DJVA 2JS5A 5EC1B 2JJ1G 1Q6HA 2H1XA 4JPVH 1BF8A 3Q4HB 3KPNB 3FB6B 4DR4O 4XI5C 1PG7L 5D55A 5DO2C 1E7UA 3D0VA 5DYOB 1QHOA 1K5NB 5C0RL 5KYNA 1HWYA 3KG5A 2Y06L 3PABB 4H20L 4ZFOB 3OKOA 3SEPA 4F7KA 3OZ9L 1IM9D 3BPCB 3O8XD 2RCSL 3E1ZA 4BH7A 3BVDB 2PP9A 5HYSA 1KOAA 4JDTH 4NT6B 5E94A 2HJDA 3VH8A 3OV6A 2AQ2A 1CU4H 1RZJL 1VCBC 2DYPA 2H9GA 2OXHB 5CJQL 4RMVA 3NSXA 1NSNL 3EHBC 2BMKA 4M5ZH 4LP8A 4O02B 4WJ5B 3ARGC 4NN5C 4XX5A 3R4DA 4U0QB 4ANXA 4DK5A 4WFEA 1EQWA 1T22B 1U3HC 4NVPA 1HYRC 1LUWA 2Z1KA 3E1F1 1QEWB 1FXHA 3APFA 4U6VH 2UUDK 4NUQA 4LNUA 2UUAO 2ODMA 1A3LL 4LVHB 4XP1L 2VERN 2W0FA 4AXWA 3MV7A 1OCOB 4DP6X 5CGMA 1NQBA 3PAYA 4CZZA 3WD5H 2E5LB 1CJYA 3LKRB 4I48A 2NTFB 1G7IA 2BVYA 3O8XB 3OR7A 3HKZA 3FSAA 2X1XR 2H94A 4FFBA 1VZHA 2V9RA 3CBKB 1L9SA 3CRMA 4JK0D 1VGKB 3M45A 2KLSA 1BW8A 1ROCA 3QJVB 3SDDB 1NCIA 5INDA 2FBRA 4BQ6A 1D9KA 2KZWA 3HJEA 2WA3A 4DVRH 5C2BL 3VD9A 3TO4C 3KYMB 1K33A 3K2IA 4MJ5B 4J9ZB 2ZCZA 3B2PA 1OGAD 4JY6B 1P7KB 4FQIH 1JWSB 4KKNA 2CJUL 5KMGB 3VI3A 4D7TA 3V4PB 3BAAA 2R69A 3LSQA 4MVRA 3CCLV 1XTLA 1RKRA 5CCKH 1H0DA 1XTMA 3AREC 3RWCB 2GJ6A 4X9FA 4CDGC 4P5KA 4Y88A 3ZSTA 1KCVH 2YMOA 5H35A 1WB8A 1Q90D 1E8YA 4PRPD 1DN0B 2XCMC 4GRWH 1BBDL 2YA0A 1CYGA 2UWEE 2X89A 3QUXB 3BH8B 4R97B 2WAHA 1YPZF 3D25A 4GXFA 4OQTA 2JEXA 5ITFB 2FATL 1F4AA 1SHWA 4U1JA 3WKQA 3LZRA 3LRKA 4WFGE 1IDSA 2IDSA 3IRZA 5GXBB 2XSKA 5IJVB 4S1QH 2G60L 2P45B 2K1EA 4H13C 4LLYB 2XICA 3VO0A 2XXGA 2FJFA 3KWTA 2ZUVA 2ZNXA 4FQQA 5CLWA 3JATB 3KR3L 1L7TH 2DDQL 2P4KA 3E3QC 5IESL 4EN3A 2VLLA 3K2UL 1LK3H 3E22B 1YYMH 3WTWA 5IFHL 2YS8A 2DH2A 4HJGB 5E99H 5IGXH 1UXSA 5DZOA 5ACZB 1IVLA 2DL2A 5TH2B 3CVIL 4P2OB 3F05A 2J55A 3OJ2C 2XVLA 3UJTL 1BREA 1NTMH 4WO4D 3D4YA 3GTVA 2HR3A 3FNKA 2XC8A 5CMAA 2WXFA 4R4FL 1D5BA 4WNSA 3TK1A 1XNQO 4PJXE 2VMEA 5IYBO 4PRPB 5IB5B 1MRCH 4G42B 2EUVA 5DEGA 1KELH 4BE5A 1I7ZB 1AG0A 3NR7A 2VMFA 2VC2L 1MABG 2BSTA 4RDQG 3NVQA 1EFRG 4MB5A 1RJZA 2DM2A 5CFHA 1JD9A 2CMRL 2IPTH 1HHGA 3W38A 2H3NA 2P5WE 2FTAA 3CSTA 4ODVL 5D6DC 3ULVD 5I23A 1IEAB 5KJ7E 2N0KA 3VU1A 3QIUB 1JYWA 3L74H 4E9LA 2VLKA 3VFSB 4X98B 1GYWA 1WIUA 3IMWA 2FZ3B 1WH0A 2LFEA 5F72S 5FC9A 1P84J 5CEZE 2BZ7A 1FPTH 5JXED 4KY1L 1XNRO 2QSCL 1EO8H 4FQ2L 3R7QA 1BHBA 3WMQA 4V1DE 4YN3A 1ZSDB 5GJTL 4MNGB 1CGUA 5IROC 4AWJC 4MVZA 1TVKB 4X7EC 4P2ZA 1NFIB 4BHUI 4F5CE 4RAIA 1T83A 4XPBL 2ARHA 4LF8O 4KDTA 3I50H 4Q6KA 2UXBB 3PNWB 1OP9A 3SDYH 1SETA 3WJLC 2CKNA 2FYVA 2V5MA 5D7JB 5EC1C 3EO9L 3TPUA 3BD4A 1PNCA 1QR4A 4M9OA 2QM7A 3ZRXA 3FONA 3IFLL 3FB6C 4OZFG 4Z7OB 4L8DB 3BD3A 4CUCA 4CN1A 3MLZL 3MI6A 4NNXA 2KLRA 3H1HH 3RZCA 1XGUA 2YXFA 4J27A 2EYTA 4G7SB 2W9DH 1YN6B 2BNRA 3LSOA 5B7EA 4TF4A 1XZ0B 4B9PA 3O3BB 4YR6B 1WBYA 1JUFA 1OP5H 2CCLA 5BZXA 3QUKB 4ORZC 2AXGA 2BWQA 3QEUA 4ZNEA 4JDZB 3FQTA 5T1LD 1VPOL 3F2LA 1EHAA 4UZSA 1ET5A 2CIIB 1WAPA 5CN0A 4RISH 4HEMA 1GIGL 1IMHC 2ZNJA 2ZX7A 3NH7H 5CILL 5I1HH 3WE6B 5ISZA 1D5ZB 4TVPD 3DMMA 4FZ8H 2WPGA 1BS3A 2DOSA 3K6NA 4G9FD 1UM6L 2YD1A 5HDBE 4PJ8D 4HT1H 4LBAA 2NXYC 3Q2WA 4U2ZA 1AHMA 2XZZA 1G9EA 4TSBL 4LVHC 1OCOC 4MMXB 4QRPD 4N5ED 4N8VG 4POZD 4KTDL 4M7KH 5T1MA 3MRKB 1BFVH 3N1FC 2PUQT 5IOPB 4WNJA 4HPHA 1TENA 3GVMA 3QG5A 1MFMA 2CCWA 3DOIA 1B3QA 3LD8B 5FKAB 1MREH 2OJEA 4R90L 2UU9O 3QUHA 4LGPB 1EUTA 2XA8H 3DBXB 5D70L 5ITBL 1VHPA 1B0GA 5LOVA 1A6AA 5T1LB 1T66C 4LQFL 1G0YR 4ZX4A 3K8LA 3SDDC 2BHYA 4OAWB 3SYCA 4UB0H 1FE8H 1FRGL 4WVRA 1F86A 4S11A 4NYLA 1WA2X 2Y7QA 2F54A 1AO7A 3CFCH 3JTSA 3KPSA 1ZAGA 1VEPA 1K8DB 5TE7L 3DC0A 4D0DA 4LKXA 3U1PA 1YMME 4G9FB 2FWOB 3I74A 4RMBA 2ZE8A 2CSPA 4PJ8B 3CRCA 2WQ8A 4Q58C 1FJGO 2W8CA 3IJYA 1HR0B 5CJ8A 4PJIE 5I1KL 4WO0A 1ZGLM 1MVFA 3G67A 1D6EB 2NCEA 4OCWL 4EZJA 2DQDL 4RFEA 4ZDHA 5E8NB 4IOIA 3FFCE 4V33A 4KK6C 3JCUZ 4ONGL 2VZSA 3FU7B 3FU6A 3QFJB 3NCCB 3B7YA 5LVEA 1U8PA 4F33A 4WUUE 3T1YO 1MAMH 4R97C 3QUXC 4JEGB 3NACL 4F15B 2GHZA 2DWYA 3DPDA 4Z8FL 5FCUL 1KTLB 4ASUG 1Z5HA 4EI6A 2AP2A 3RL1A 1TO4A 5J1AA 4P9OA 1WAAA 5KX5A 1JGVL 4FQPA 3WXVH 1JXKA 2IGTA 1WK0A 4UNIA 4YDIH 3EOAB 1CF1A 3GLZA 1B6DA 5AYUL 1M71A 2ZCKL 1MCOH 3JCZA 4I18A 4LAJH 3VACA 2AITA 3A4DA 1DO5A 4LSTL 5I1EH 3CZNA 4AENB 3E8UH 5F0JB 3V0VB 1LO0H 4UIMB 4MHHG 3L1OL 3E35A 1NEPA 2IV8A 4FFYH 1HILB 3UC0H 2XZAL 4W9JC 3QHFL 2KSDA 5F7MC 4P2OC 3A8TA 3CSPA 5I0VA 3ZE1E 1S7XA 4Y4FC 2MPVA 4AQAB 4PV9B 2MNWA 4X6EA 3FRPG 2ZE5A 2QDOA 1BVLA 1IC4H 1DVTA 4DH2A 3OBAA 1RH8A 2GIYA 4ODSH 5EZJA 5C0JB 1FO0H 4BK5A 2Z7UA 5FGBA 4Y7MA 3ZMZA 1UH2A 3H4HA 3T8MA 3CLEL 4BH8B 2EXYC 4O4HB 2EULA 3QORA 1NKDA 1QOKA 5EU5B 4HS3A 1NM4A 1RZ7H 4K9EC 1Z2GA 4NZUH 4Z3GA 3QIUC 4UMGA 4MLSA 3W0WE 5I6MA 1X7TA 2X9YA 4RIRA 3T8XA 3Q6FA 3VA2C 3Q13A 3SE9L 2PPEA 5J7CC 4F1ZA 1XI1A 2A6KB 2P3YA 5FB8A 1DLBA 4RO2A 3KYNB 4E2LA 5F89B 4Y1AD 4JRXE 3LQMA 2VZUA 1AGDB 1BOGB 5T1DL 1XAKA 3RILA 3WY3A 4F24A 1YEIL 3BAJA 3U25A 1NFAA 3FDWA 4ADIA 1C16A 4AYFB 2EDOA 2J20A 2HFEB 4NNPL 3QG6A 3NDZE 4NXNO 4DR2B 1LO3H 4I0CC 4PWEA 4JFEE 4ZMYA 3VFUA 4GMTL 5EBMA 5D7JC 1G94A 3O2WL 1SJXA 3U46B 1DQMH 3PP4L 3GEFA 3ULVC 1KD1W 1Q4NX 3S3SA 1MFCH 5AVZB 3EFFB 4OZGF 2R70A 3OKMB 2VDLH 2ZWKA 3P4MB 4ZI7A 4UQAA 2XHBA 4ONOA 1Z5VA 5DHVB 5KS9B 4LKCB 1VKXB 4XPGL 4M8QB 4XNXH 1WNSA 4IBQA 5GGSY 3S35X 1TTCA 1OE1A 3CXHJ 2DKSA 3QUZD 4HUWA 1ZGLP 3V7AG 1KZQA 1THCA 4NB5A 1HOCB 3QNZB 1GC1C 2PMZA 1UATA 3FT4A 1RULH 2P9RA 5D5QA 1DQJB 1H3TA 3HS0A 5KYUB 3MRLA 1OXYA 3UTTA 4C56E 4E42B 2HVJB 4EEEA 1RLBA 2VXQL 3FB7B 3HAEG 3L48A 2X05A 2ZX5A 3STZB 3JZYA 5I16B 2HKOA 4JG0L 1JZEA 1NGPH 2F19L 2JTDA 4OM1L 5H94A 1LYQA 1F90H 2VL5A 3MJ6A 32C2B 2QGCA 3O0LA 3BFRA 4F7MB 4O2EA 1FFRA 1B0WA 3CMOH 1QA9B 3VW3L 1AS7A 2FHBA 4J3OD 5EZYA 1EBPA 2OSLB 1TKWA 4YHOL 2W81C 5CEZH 2WKOA 3OLDA 1WAEA 3JSLA 4H0LC 1EGJL 1SVZA 2NSQA 3MAWA 2NY0D 3LD8C 2ZQKA 5EU6E 2VDQB 4OZFB 2P4VA 3HC3L 4HETA 3C5JB 4GUQA 1OKEA 3FT3B 4HU8A 1M93A 4ELMB 1MI5A 3CFQA 4GAGH 4JFQB 4E9TA 3QW9A 3GXDA 5LYJB 1VARA 3ZHDA 3GIVB 3ARFD 3V52H 5IKCA 4YUEL 2VDOB 4WI9A 1ZLSH 1GMEA 2B39A 3QCTL 1RMFH 4NM4L 1IARB 5KBMA 3AXLB 2OW7A 4PJ8C 2DWDA 1JG9A 4JPQA 4IM8A 3TBSB 4D0BB 5DMJB 3E86A 1QWNA 2BIPA 1OAJA 4I55B 2X0VA 3A3YB 3GMNB 4M8UA 4N5EC 3SZKC 3B4NA 5MERB 3CUPB 3RYIA 2AC0A 1F18A 4QPEA 4QE7A 5CBGA 2IFFH 3A23A 1SHXA 2ADIB 5C09A 4FPPA 2YQBA 3BAWA 3L5WA 4M1DH 4XWGH 2WXPA 4QHMA 1T21A 3J27A 4F15C 4YSUA 3KE0A 2E7BA 4N8VB 4K0KB 3HLAA 1Y6MR 5E2VH 4XN8A 2F7PA 4BW5A 5L6YH 1P4IH 4KKZA 3O11A 4R26H 4OD1H 1KXVA 4LNVA 4U1MA 3SQRA 5JHDA 3VDBA 4JY4B 2J1KA 2VXVL 1WAZA 1GGCH 4Y2LA 4TN9A 4ZUTB 2BK8A 3LKPB 3D8MA 5E5MB 1FFPB 1HL9A 4WJKB 5BMFH 1QSEB 2HN7A 3DV6A 2FT8A 3ZRWB 2J72A 2JB6B 5AW2B 4K3EL 1JGEB 3IDIA 5H2BB 1MZEA 1H8EG 4G5ZH 5E9DD 4XVOA 1DANU 3Q8BA 2YK1L 4ZAKD 3WLWD 1HKLL 3VQ1C 1KCRL 3QXTA 1ZEAH 2G38A 3EH1A 5DUJA 2R0WL 5CZKA 4L29B 4PR5A 1BYOA 4JM4H 3ELAT 1VADA 2VQEB 2QMJA 4ILDA 1T4WA 4Z3HA 5CD5D 2X4RB 2IG2L 2LE9A 4GKSB 2NX5D 2WINB 1INEH 3T0EE 3ZRVA 1KGWA 1XF4A 5ECJE 4HHGA 4Y5YB 4JCMA 3EG9A 1QPPA 3ARTA 5L4IA 1HZKA 3CK0H 3KXFD 1BXAA 1UOKA 2EDWA 1N36O 3F5WC 4APXB 4GXUM 1PLCA 5LA6A 3DX3A 1KN4H 1QNIA 4L87A 2QVIA 5JW3H 3APQA 1A2YB 3RYFA 4YLQT 2JQAA 1KEGL 4EEQA 4UVBA 5FAAA 2UUCO 1JHKL 3FAXA 5E9DB 2DV6A 5T3XL 4IS6B 4Z95H 3GO1L 3BZ5A 2HLEB 2ZKHH 2HFEC 1AI1L 2MKWA 3EO1B 2W38A 3TNMB 3V0JA 3CRAA 1EEUA 5FYLE 4BJLA 5DMGD 2XYBA 4HIXL 4FLYA 5JH7B 2ENJA 2MHAA 4ALAC 5FYJL 5F0LB 3VGDA 4HA1A 4IRSB 5C9KA 4JCLA 4FNLH 2OS7A 4N9OB 1I9IH 3TT1H 3RIAK 1RJLA 4H8VA 4WY7L 1PG7W 2H2SD 3L9DA 4P2AA 2V5TA 3ULSA 4JI7O 2QWRB 1CD8A 2WLYA 2NX5B 1JGDA 4HOXA 2LU7A 3G04A 3IFOB 3GKZA 4G7VL 4XXWA 2QELA 4M48H 1KB5H 4KJYB 5GS0D 4PJCE 4FXKC 3KXFB 5AG8A 3BZEA 1J8HA 2ARJQ 5LHHA 4N3TA 5I1AB 4IL6Z 4X66O 4JFTA 4BK4A 4OQTL 1CEZA 3SDXE 3TEWA 4NSKA 1PNMA 1XUQA 2F7RA 1EEZA 1FYJA 4CH6A 5IW1B 3CSXA 2J1ZA 4QRUA 4PRIE 4UIKL 5ANHA 5HJBA 3C6LA 2DKMA 3H53A 3I6LE 1NAMB 1Q5OA 1YJ9V 5KW9H 2HVJC 1NGYA 3STZC 5DJCB 3BN9D 4XOEA 4RBPK 5AG9A 2P43B 5HDQL 3W39A 2CR3A 4KRPC 2DM3A 4S2SB 1GXEA 5HHOD 4LE8A 4X5LA 1VQLV 3UCQA 4Y4KA 1GL4B 3X12A 2O57A 1DCLA 4MDJB 4MA1B 1DUYA 1MIMH 4BZYA 3EXAA 3OF6D 4NZJA 4AV5A 2MQCA 2RB8A 2NNUA 2VDNL 5CZVL 2E86A 5IFAH 3FUHA 3MRBB 2WYHA 1CDBA 2W07B 4FEIA 4HFUH 5DWUH 4S0HA 4U49A 5LAXB 4FJYA 3EYOB 4XC3H 2MNUA 5EUOA 1VEWA 2NY7L 4LT7A 1U6AL 2YD5A 3ARDA 1KDIA 3F58H 3J80N 1JPSL 5EO1A 1RJCA 5AB0A 5IJ0B 3V5KA 1QI3A 4XMXA 2FO4A 1K7DA 3MNWA 2Y07H 4X6CB 5I5IA 2CUHA 2XN0A 4YSSA 3D39E 2XT9A 3UO1L 1NBVH 4M02A 4MNHA 3CSGA 2ZYSA 2YUAA 5JPMA 1R5IA 1HQ4A 2Y6TE 4BFRA 4QNHB 1R3KA 1ZE3C 4KBPA 4D9RD 5HHOB 1X7QB 2B1IA 4MS2A 5I6OA 2X09A 3EJUA 2C1OB 3C6EA 3HAEB 1U8OA 2FO8A 5FFGA 3M8OH 3K81A 3U11A 2VDRL 4KZDH 1S3KH 2X4NB 5ACMA 1BVZA 4N2GA 2I60L 3LDEA 1DFBL 5KSAD 3UYRL 2G75A 3CVDA 4PW3A 4UOW0 5E56A 1WS7A 5BS0D 1ZK9A 2XG5A 1VMGA 5T5FH 3QDJE 1HZHL 2Q7YB 1KFAH 4I4WA 2HX7A 4J3UA 2F5BH 4FA7B 1I82A 1K9TA 1VERA 1RZGA 3OKDB 2OJ1A 5TE4L 4DUXA 1EXUA 3UYPA 3WIFA 3L3OB 3PJSK 1QO3B 4FFWC 1GAFL 1FCCA 1FGVH 1CF8L 3T1FA 4B7LA 2OXGB 5FWRA 1V8HA 2OMTB 1J1XH 1S46A 1TFPA 2H0EA 1HOEA 1ZTXL 4LPWA 1U58B 5D4HA 4Z76A 1WA8A 2DEYX 3IFPA 2AEWA 2BSKB 2J8UB 2VRAA 5I66B 2VR3A 1COWG 5EN3A 5TD4A 3LPPA 2BJML 2JCCB 2A9ML 4RAVA 5HJ3A 3LDCA 2AJVH 3HE6D 1QU7A 4HOMA 3ECQA 2AXWA 2ZXAA 4E41E 3LHPL 3ATFA 1MHHA 4XP9L 2H4EA 1NCTA 3CDZB 1AS8A 3MOAL 1XWVA 4UV4H 2ZYRA 1WHOA 4LLAA 1J48A 1FL5A 3MGTB 4CADB 4F3FB 5F71A 3QXUA 4PI0A 2BFVH 2WWWA 4MZ3A 1PQZA 3C2AH 4YHLL 3B9DA 1WCBA 4Y5YC 1ZS2A 2X6UA 4XCFH 2LU3A 3ZDZB 4DW1A 2YXHA 3MUY1 3NIGB 4Z7AA 4JFOB 2HG5A 1EBAA 2OYKA 1E6JL 4UTAL 4YDMA 1XVSA 5GRVL 4UV7H 4X65B 2YUWA 1AIFB 1Q9WA 4ZMLA 2KS0A 3ULVF 2Q20A 2NN4A 5HGHA 3A67H 4OZIE 4Z7OF 3DTUB 3X13B 3WLWC 5FEBA 3D3VB 4WSKA 2ITEA 5DRWA 4M4RB 5DD1L 3KPRE 3GRWH 2WBJA 4CDHA 1A1NB 4HULB 5LG6A 2WO4A 1XH3A 2CO1A 4LLWB 2F23A 2ADGA 4WEBL 4ZX5A 4LFBO 4R4ND 4Z1VA 3D5OF 3GB7A 1DYZA 2Z7ZA 4IRSC 3ULUL 3CC4V 3SSGA 4K0OA 1D7FA 2HJLB 3ZYIA 3CRQA 2UXNA 4NZ8A 1JFFA 2F2HA 3H56A 3RDJA 3TIEA 4F57H 2HCZX 5IV2A 3CCUV 3QDAA 2E9WA 1QSVA 2GG1A 1BJ1H 1HIML 5EU3B 5F2VO 3ZOAA 1J87A 1S3JA 1MF2H 5GONA 4GKLA 2ZG2A 1ZWIA 3AK1A 4Z3IA 4XMTA 4FFYA 1SA0A 4HCFA 1BQLL 1QWHA 4J9YB 4U6XB 2K8MA 1TZHA 3TCUA 2QADB 4U1IB 1Z0NA 1Z5LB 5K59E 1FL6B 3KVQA 3CD4A 5FM4A 3QUYB 2V2TA 1L0XA 2BOLA 2EILC 3D51A 3IETB 3IDGA 4Z5RA 1KGCD 2VQ1B 1YUHB 1FO0A 2FRGP 4CSSA 4MVBD 1BX2A 2CA4A 4XT1C 2D3LA 3II1A 4MAUH 3RHWF 3VFRA 4H26A 4AG4H 5AD0B 4GFTB 4NQEA 4Y7OC 3WKNA 3JAKB 4MA1C 4WHYH 4D8PB 4X1YA 1A14H 2YN5A 2W80C 4UQ2A 4L8SA 4RX4D 5EFIA 1QBZA 1KTRL 1UHVA 3B3IA 3WS3A 2HEPA 3UXFA 3D9AL 5I18L 1P84K 1YITV 2VDKH 2GIMA 2NY2B 4NKGB 1K5QA 1ZDSA 2E7DA 4MNQA 1L7IL 4NPJA 2G2NA 5D72L 2OMBA 4P2RD 3HZVB 1JV2B 3QBTB 4J42A 1IEBA 1CIDA 3F7YA 5HD8D 1Z0MA 3N43B 1IAOB 1OOAA 3V4VA 2B15A 4OPHA 2UWEA 5FYLH 4X6DB 5A2BA 3L17A 4Y2DA 4PJAB 5DZLA 3HUJB 1KLGA 2WUCH 3BN9C 2HPOA 4G6JL 1JCVA 4PJDE 4FJ6A 1URIA 1VF6A 1KNOB 3MXWH 2DEWX 2WCGA 4TVUA 3SKNA 3SE8L 1GZQA 4MQ7A 4NQDB 3LRGA 2UYLB 4P23D 3SO3C 4K7PL 4G28B 2WZ5A 1NCJA 3FQUA 2WWOA 3QE5A 1F42A 1OAZH 4DKFL 2Z35B 4ZMTA 2AS5M 4AJYV 4JYCA 5C0AA 3WENA 3VXOB 1QR1B 1IBYA 2X0UA 1KJ2A 3JVGC 4Z9KB 1LTXA 3H9YA 1QASA 2VDPB 3FUDA 5CHNB 1TZIA 1OV8A 1KPUA 1N68A 1F4WL 1QSFD 4XC1L 2A83B 3ZL1A 1HW7A 1OTUC 5CB4A 5B22A 4W93A 2IWGA 5GJSH 4X4YA 1LUVA 2P5WA 4X6BA 4OLYL 1M7DB 4Q9BA 3BIBX 5C6TH 5DGQA 4EXPX 5H37G 1IBLO 3L3OC 3ETGA 4L8BB 1S7WB 3O81A 2WAMA 2V7NB 1TZAA 1R33A 4B9IA 4EUPG 4LMQI 4P23B 5DWPA 1PM9A 4OCNC 1I94O 4IGBA 5GPRA 2MWCA 3QGVA 4G8IB 4G6FD 4UFZA 4ONHB 4GG6B 1T1XA 5DD3L 2BFGA 4OV5B 1NJ9A 4M6NL 2M6YA 2OYMA 3VD2A 5D7SH 3GSNB 1SY6H 3F65A 4I7ZB 4LCWB 4P2QA 2E7MA 2A6DB 3H4FA 3T09A 4AIOA 2J73A 2BRRL 2YZ8A 4AM0A 4F5CA 1PL0A 4N20A 2VTFA 4TSAL 4XNBA 4CSPA 2AGJL 3GSVA 3CXCU 4OLWH 2YRZA 5FM5M 2DTML 4R5VA 2EINB 5G4OA 3BP4B 1MFAL 5FHAL 3KLAB 4HJJH 3EGSA 3N3EA 2XFXB 3TFKC 2BIMA 3S98A 2Z92A 3MFGB 2XVBA 1FVCA 2QTSA 3LXCA 1FAIH 4DUYO 1UM4L 2UXTA 1D5IL 4DV5O 5KVEE 3OGCA 4BSWA 3AG1B 1BEYL 3MUUA 4DGIL 2XN9E 1ORQB 2B0SH 2VN3A 3BVNA 2Z31D 1NDMA 2IU3A 3O3EA 1D5MB 4U1NA 3VFVA 3WIIL 2UXDB 1OB1B 4NQCE 4OGXH 3TVMD 3ES6A 4LH7A 2FQEA 2R7EA 2XV6B 3ZIYA 1Q1PA 5DVKA 2P4AB 1KYDA 4P5SA 2H6OA 3WKMH 4NO2B 1DK1A 3LEYL 3ILQD 1A0QH 4Q9CA 3IGKA 3WXWL 2ADJB 3ARGA 4QOKE 1AXTH 4QRRD 4JPVL 2GUOA 3MRQB 5DK0A 2GTWB 4Z7NB 4O2AB 2XV3A 1U8LA 1U3HA 1FYTE 2VIRA 5KS9F 4RDQF 3WHXB 1AYOA 4EB6A 4HU2A 3RB7A 4M3HA 2V2WA 2QVMA 4OLVH 4FXTA 4EIZC 1YF2A 3E0GA 5EZOH 3L4ZA 4DUZB 4IKNA 4Q52A 2F9BT 5DCCA 5B3NA 3HKCB 1BVNT 1GN3A 2EDJA 2IMMA 1CE6A 1JVMA 5E0QA 2WKLA 4LLMA 2Y3NA 3IWVA 2OLDA 1KQSU 1T7WA 4IOSD 4W1TA 1CU4L 4HIPA 3NUKA 5LNDA 4CNIB 1ZVSB 4H2CA 4UF7C 1EJ8A 1NPNA 4J2QA 1MFBH 1N2RB 2VZ1A 4GBXC 4QXWA 3JALA 3MJGX 2QADC 5BY1A 1M1XA 4LASH 4YSEA 4AV0A 3QUYC 1JXDA 2DRUA 4OGQB 3G5XA 3PWLB 3BT2L 3TO4A 2Z4TA 1NFDB 5L4FA 2WVVB 5EEZA 3OD4A 1DDHB 4DV1B 1E30A 2BDNL 4GO8A 3O3DB 1FHNA 3X14B 5GGSB 5K9JH 2IPUK 1AG6A 1DQQA 1MPAH 1TVBA 1RHHB 3WD5L 3RY6C 3VXPB 4DO5A 2CLZA 3AREA 3QYCA 3O9WB 3J7AU 5DF0A 2EIMB 2BS9A 3TF4A 5EA0H 5HDOA 4ELMF 2F66C 2NY2C 2XWXA 4TTGA 1J0YA 4X8JA 2IJKA 1MZFA 3JTTA 5TQ2L 2K7QA 4DVRL 4M6OH 5JHLH 1R6KA 1R4XA 5LGYA 2PW1A 3ZHRA 1UWGH 3IDXH 4H88L 4WUUA 4KX8A 3FSWA 1DEDA 4HZLB 4XX1G 2EVFA 1KPRA 1XREA 1XOUA 4BELD 2P80D 4LESA 3H9HA 4FQIL 2ZWZA 1A6VL 2HPTA 4WFHE 4Z6AT 4K3GA 2AJXH 3AG3B 5CCKL 1HP8A 5IMMB 3OG4B 3CZUB 3IKCA 3UAJD 1AR2A 5BVJA 2AZ0A 2AJUH 5E8DH 4AQYB 4ZPTA 1JWMB 3D3QA 2KHAA 2VABA 3G5WA 3CXHK 4BFGA 1JQ0A 1LWHA 2W65B 2BIOA 4X8GA 3MYJA 5I26A 1P2CB 3RX8A 3U4EA 1ODUA 2QKIB 1H19A 3O6FD 5IG7A 1MFVA 4N6QA 4FAAB 2AJ3B 4S1QL 3AM8C 1WJ3A 4TUYA 1U8HB 1TTFA 4FP8L 3SGKC 2GB2A 5T1KB 1J11A 5ID1B 1DO6A 1IV8A 2HVKA 3FK3A 3EDKA 5TDOA 3ZKMD 4R7CA 4MRCA 3WFEH 1E9QB 4KXAA 5TF1H 1Z9OA 4JRYA 5IGXL 3T4YB 4D7PA 2AXFA 1K3ZA 1HQRB 2LW7A 4OLUH 1BAGA 1QNZH 2IH9A 4TYUA 4URTB 5D1QB 2H1PH 3T5WA 2D3OW 3M88A 1FV1B 3F7PC 3OC5A 4PIBA 3ML9A 2BP3A 1SYSA 4P23C 1U97A 3SOBL 3W0WA 5A2JH 1GKFA 1A6WL 2PPFA 4J1UB 2JTYA 2OTUA 4PJGB 3TBBA 2MCAA 1QLEL 2CAKA 4I3RH 4L3EE 4H8WC 1MRCL 1YECL 4M1GH 5IROA 1KELL 4OZHB 3ZTNH 2NW3B 4CSTA 4NO5A 4KOCA 1S72V 2WYZA 2XACC 4PG9A 2ZXQA 2G5BB 4JHAL 4I7ZC 4NTXA 3O6FB 4JRWA 4X89A 5D7LB 3DPBB 3K4ZA 1R5VA 3DX7A 3FUMA 4BIUA 1MUJB 4ODHL 3FO1B 1KIRB 2EINC 1T0NA 3QEQA 5C0CD 1MAJA 4HD5A 1D6VH 4UQDA 1RZKH 4JZGA 3GBLA 5FNVB 5DYOA 1FPTL 5C8YA 3AG1C 4ZFOA 1EO8L 4JFDB 3ZT7A 1BV8A 3EBIA 5KYXB 2B5IB 1E9PB 1SVCP 1RERA 3HG4A 1U2YA 4JASA 5IHWA 5IHHA 4B6ZA 3PGDB 1Z7JA 4LXFA 2OXHA 5HYFA 3I50L 1FZMB 4J6IA 1T7XA 3BGAA 3SDYL 3FU0A 1IB5A 2FJSA 5IFJB 3LIUA 4EUPB 4LP5A 4W4OA 1DQLL 2OMXB 5EPMA 5BVPH 4KQ3L 1MHCA 1GM7A 1QEWA 3FQXB 5IQ7H 4NXSA 4LRIA 5DRZB 4LLUB 5C0CB 4MJ4A 1CL7H 1LM8V 3DSFH 4FXGA 5DQJB 2L35A 4BCZA 1NUNB 3UZEC 2EVHA 3EH2A 4JCWA 3T77B 3CHQA 4YPGB 5J3HD 2NTFA 2XAHA 5LMNB 1SBSH 4O2FB 1RIUH 3UO3A 2DLEA 3ZKXB 1IGCL 5D2NB 2F4VB 2APFA 1XF3A 5DD6B 4HOZA 4RISL 2DJSA 35C8L 3NSDA 1M6OB 3SDDA 2DQIH 3NH7L 4JQIH 1G9NH 5EU6A 3FFOA 4OM0H 4MD0A 2X1QA 4Z7QE 2ICWA 4OGQC 4PTTA 4N0FB 4MX7B 1HJCA 4TNGA 1I85C 1VZGA 5E2UH 4LWSB 4MKTA 4NQXB 4DPAX 1N59B 5KVEH 2HLDG 3RPIB 2D7OA 1QFWH 3BA8A 3KWUA 1BIIB 5E23A 3RYCA 3FFDA 4P49A 3MRIA 4PRHE 1MREL 3O9WC 2OMYA 2EIMC 2XA8L 4G6MH 2ESVD 3ZDYE 3ZVVA 3SKUD 4PRAA 3IAYA 3DVNB 3KL0A 4X6CF 3A24A 3MLRH 4GW4B 1MW1A 2AHZA 5HFLA 3P0VH 4TV3A 4ZUUB 1FSKB 1CFVL 1FE8L 2FWLB 3LRSB 3RTQB 4CMMB 1J1PL 3PWPE 3BH8A 3KEHA 1AP2B 1L6PA 2Y7LA 4WU5A 3M1BB 4YHKH 3CFCL 2H8PA 4KJQD 2B3RA 3IXTB 4HSCX 4X1KB 4HKZB 4LFHG 4B9KC 3L13A 4K7FA 3GRWA 1IZ3A 2HJKB 3MV9D 3UBGA 4XBPB 1S5HB 3DROB 1DP0A 5HJDA 1CXHA 3OKKB 3E8VA 3AG3C 3CV5A 3K74B 5L2JA 4Y4HB 1X5MA 3BW9B 5F9AC 1T04A 2A9BA 1B6QA 1WFUA 1VQKV 1Z9NA 1C5BH 2O4EA 3QCVH 4HWNA 4WEEA 1JCHA 1KYOJ 3KPPB 5JDSA 3VXUD 3QZNA 4CVXB 4Y4FA 3OJVC 4FTVD 4N9GA 3KPOA 4QRFA 4WKXA 4XNQB 5IB5A 5EDXA 3L7FB 2CTPA 2QKIC 5ECGA 4IU2B 1G6RB 4RQQA 4XPTH 3SPVB 1NDGB 3CCQV 3WXVL 3UQ8A 1O7DC 1JK8B 1AY1L 3B77A 2RA1A 4OVVA 1IJ9A 4YDIL 4ZO7A 4F7EA 2ROXA 1MCOL 4K5PA 5CN1A 2G3MA 4TLKA 5DJ0B 5IVZA 5I1EL 1DDTA 3MV9B 2LR4A 1I5XA 1PZ2A 2JS3A 4MW3A 3I56V 1C08A 1WBZB 2BSEA 2VKXA 3E8UL 3DYMA 4HXBL 4Q56A 1LO0L 4W9DC 4OXSA 3MBWB 3KWWB 4H0HB 4FFYL 2J8UF 5D1QC 4IDJH 3UC0L 3VFSA 4NPKA 2BXYA 3UAJC 4AGMA 2JCCF 1Z3GH 3AWGA 3GNMH 1W72A 1RFDH 4MWFA 3T0EA 1QBAA 3I3DA 2YDEA 3ZY7A 3CVHH 3MOBH 3BCCH 2G5RA 1IC4L 1GW0A 1DBAL 1TVKA 4KX7A 4FTVB 1PIGA 2AVGA 2R2EA 2XPGB 3L3HB 4ODSL 1Q81W 1FO0L 5KVFE 4R7XA 2V0AA 3O6FC 5TK2A 5HHQB 3EO0A 4G11A 4R5TA 3PNWA 4EFEA 5JIDA 3EUDA 4G8EA 4R8CA 5GSVB 3VJ6B 4H4NA 3ZDZF 3NIGF 1MFNA 4GP5B 5EF1A 1KTDA 2APWA 2JJSC 2V17H 3P9LA 4L8DA 4X2UA 3UABA 1BMZA 1KSRA 3QR2A 4O51B 1P1VA 2BNQE 1KEML 2XN2A 4X9QA 5KYWA 1A6ZA 4JTAB 4H25B 4HKXA 5ICZB 1AGEB 1WFIA 1YN6A 5IW6B 3O3BA 1PLGH 1QEXA 6CGTA 4JO3H 3QSKB 3KBFA 1FI8C 1K4DA 2B5IC 3QUKA 4IMKA 1DUZB 2H32B 3P4NB 3CFJB 4RNRB 2F7IA 1L9PA 5B3JF 5LMUO 5HI5D 3MRFA 2GBUA 3GZPA 2XUMA 1I8MA 2O6EA 1BBJB 3SDXA 1JYVA 4PGEB 4DF9A 4PGDB 5I8KL 1UWXH 5IWLC 4K2UH 4P0DA 1M56B 2XTJB 1DQML 3WE6A 5KYYA 2GJPA 5HPMB 3VD4A 5IBTH 1DLHA 1MFCL 5FIEA 4MAYA 3KBPA 3SCMD 4CKVX 4QPJA 4AJVA 2QTOA 1Z5WA 2OMVB 2Q9LA 4KGJA 5AEAA 1IC7H 1RK1A 4XNXL 5JZ7D 1KJ2L 1EIBA 4KU1A 4XCEA 5HHVL 5HVGB 5I75C 2XWCA 1VLXA 3ZKXC 1RULL 2NQCA 3HRPA 4ZFGH 5D2NC 5LGKA 2ITCA 2XWTB 2D9CA 4PY8I 3IGUA 4LR3A 2ATKA 4JFPA 4KI1A 4QO1A 3V6BR 4F9LC 3OB0K 1GR7A 2R4RL 1VZIA 5ESVB 2YPLB 3N2KA 1P4LB 4RUFA 3G5YA 2Q2EB 3CMAV 1YEKL 2X1WL 1F90L 1TJGL 1YAZA 2FNWA 3RBZA 4UQ3A 3WFHA 1R6TA 2WQUA 4YBQD 3HJ0A 4J3TA 1HNZO 5FUCE 3UZQA 2CTQA 3FTGB 4F8NA 3CMOL 3SBQA 2OZ4A 3D39A 1GN2A 2QHLA 2I7OA 4JYBA 1K3IA 3U6XS 4MTMA 3I3EA 2J1YA 1MNNA 3MRMB 2FR4A 4U3JB 1MH5A 3N43F 1Q3EA 5J3HC 1SQPH 5A3ID 1LD9A 4X6DF 3DC6A 4PJAF 2VISB 3JSNA 3HUJF 4AMKH 1FSKC 9PCYA 3RTQC 4RRPA 2B20A 3RAJH 4MTXA 3BYYA 4PMEA 4EXKA 1OW0C 3PUCA 1SYVB 3NIFB 4XB8A 2DQFB 1RMFL 1EZLA 4AI7A 2B1AH 1M9SA 2Z7YA 5EEYA 1S5HC 2MW2B 4LF6O 1P4UA 4QHUA 4HUNB 5DK3A 2GTZA 4GX5A 4RETB 1WPXA 4Y4HC 2C1PB 4UIMA 1XGQB 1HL8A 1MCFA 3NSYA 4LFHD 2P5PA 1ZA6B 1GYVA 3A47A 3DXAE 1EJFA 2UX7A 4M8RA 4L4VE 4KKBD 3BWAB 3QQ3A 1WVZA 1J05A 1FFTB 4QNPF 3FHEA 3T0AA 2ZE6A 3OT7A 1AC6A 1J9SA 1MCLA 4AQAA 2P8PB 4GQPH 4L05A 3K71A 4N8CH 3N6YA 5E2VL 5MEPB 1CXKA 4GQ9L 2UZYB 1P4IL 5F88B 3L3JA 3C60A 4OCYL 5L6YL 3H8NA 4PY8J 2EICA 3VMNA 1IBKB 5J12B 4OLZH 1YEWA 3MBED 2FLMA 1OGTB 1TLMA 1CGSH 2LO1A 2MCG1 3O4OB 5BO0D 4NCC2 4BH8A 1BVKA 1RPKA 3LMJH 4BRVA 3VSQA 4E41A 3TU6A 3H9SD 4GINA 1QYGH 2GI7A 5HHPA 4GG6F 4NENB 4CS3A 2CDEB 5JW4R 4OFPA 1H8HG 3KPMB 4PDMA 2P46B 1W0WB 2GC4C 3L5IA 4OZGE 2ZPKH 3EYQC 3SB3A 4RFNB 2DD8H 4UQ9A 4N86A 2ZONA 4G5ZL 1Z6JT 3IC9A 2CH8A 2YAOA 3F5WA 4GKKO 2Y23A 3ESPA 1UWFA 2L6LA 1FYHB 2Y1ZA 2OTLV 3GC3A 2CGRH 2HJFA 3MCYA 1BQRA 1ZEAL 2VSKB 3CSYA 2Q8VA 1S9XB 4WWKA 3PXJA 1JZHA 2A79B 3BFWA 1BLNA 4JM4L 4ODWA 3TIDB 3HPLB 4NP4L 3OAYH 4Q74A 5DK2A 1XHZA 2C9RA 3MBEB 3FQNA 3UCRA 2X2IA 1B3JA 2PYFB 3MRDB 4QRAA 2D03H 4X7FC 4U7NA 3H9SB 4KUMA 3LIZA 1VENA 1PU0A 4JMXA 1HI6B 2DL9A 4P5TA 3FQWB 2JIXD 4X7SH 4UDUA 5IR1A 1NCGA 4FXKA 4W6WB 4NBZB 1NQTA 3M7MX 5C07A 3VGHA 4KO5A 5IDJA 2HHHB 2OMZA 2VLRD 3AROA 4Z7NF 4GRLD 4Z95L 5HVWA 2WMPA 3H1KH 1CFTB 1ND0B 4QJFB 4FQXD 4DR3B 1U4FA 4UM9A 3ULAB 1ACXA 1NMBH 1R3IC 3NCFB 2D3NA 4HX1A 1CFQB 3RA7H 4E42A 2EVJA 3UMNA 4F27A 1M56C 1ZLZA 4FNLL 2XTJC 1IT9H 3DHPA 1I9IL 4NNYB 2L7EA 2WV3A 3TT1L 4YS4A 2UUBO 5DTFA 3T65B 1COBA 2J2ZA 3RDTA 4ZSOE 4MBOA 3CU1A 1TOXA 1CI3M 2VITB 3FTYA 3WUWA 4PA6A 1DSYA 4KX9A 4CW1A 3HKDA 4X66B 4PBVC 3NJNA 3Q9PA 4U1KA 1OCCB 5F7YC 3QDGE 2CGOA 2HKHH 1GMGA 2K0RA 1G84A 3MR9B 2NCMA 3NCEB 3R66A 3J81N 2VWJA 2GK0A 5IHZB 3P4OA 4HFWB 1NFDF 3ASNB 3FT9A 3MODL 4O4IA 2WXOA 4CN6A 1R17A 4QGPA 4YEFA 1DVFB 4FQXB 3N44B 4JKPH 4WTZG 3C5JA 2E75B 1KTCA 1U36A 4JHUA 5KVFH 3TOPA 3DX2A 1VFAB 3NFNB 2EIJB 3HE7D 1ET8A 4LSQH 2CHDA 5FM5O 1KT2A 1F41A 1ASQA 4CGUB 2OK0H 5I5RA 4LO9A 2P6JA 3GIVA 3GGWA 4N2KA 1TEFA 3T3PB 3VRIA 1MIML 2JQMA 2UY6B 3G6AB 4XMPH 1DSFL 4P07A 3ZSSA 4XMLL 4AGPA 3TNNA 3AXLA 3B2VH 5J13B 1HSAB 4FXLA 4X5XB 2IBZX 4O2CA 1W91A 2GHWB 4QRSA 5IFAL 1XMOB 3GTNA 4D0BA 4XCCH 4OIBA 3RZWA 3MRNB 5DWUL 4DGWC 1FS0G 2YI9A 1I1FA 2AKRA 2DQHL 1FVDA 1H2GA 3M7FB 2OTJV 4XC3L 5B38A 3CJHB 2AABH 1KY6A 1HXMB 3CUPA 4IHJB 3IJ7A 4QWWC 3FTUA 4LZKA 1KV3A 2YRPA 3UJJL 2VAJA 3W9DB 3NA9H 2ADIA 4O58H 3A6CH 3TEUA 1X5GA 4LIQL 4I9WE 5JPNA 3AUVA 2Y0SA 3G08A 3N04A 2YJLA 2FB4H 1RP8A 1WT5A 2V6HA 3CFNA 1M7IB 5HGAA 5LCVH 1NBVL 3NAAL 5IEKA 3HBGA 4NERA 4PJEE 5DGRA 5LBQA 4ZPVA 5KG9B 1TF4A 4LOFA 3QWOA 4Q89A 1S7UA 1D3CA 3D0LB 3HHSB 2GQHA 4Z18A 1N6QL 1W0VA 4WKZA 1FFPA 3IFNH 4DXWA 1AGCB 4GFXA 4D0CB 3LX9A 4APQB 5J9PA 4I4TB 1KTBA 4JKKA 1S3KL 4LFAB 3QDME 1JZ4A 1HL4A 2JB6A 2ZX8A 3C6SA 3F7RA 3ABLB 2ZOUA 4H5SA 3WB2A 3EYSH 5ENWB 2ZP0T 3IDUA 3IMRA 3QXDA 5LBVA 4NAMA 5DC4B 4MKMA 5T5FL 4MSWB 1GA2A 4BR6A 3NT0A 3B9KA 4OY9A 4JQIA 1U91B 1YEDA 5J12C 5EIBC 1ZV9A 1NTKH 3GBMH 3U0TB 3C87A 2YD8A 2BVOA 2EECA 3O4OC 3B2UC 2DOCA 2GJJA 4PJGF 5D5MB 5EORH 3EVKA 1YEFH 4OF6A 2PCFB 4OZHF 3T1HB 2XQYK 4AQ1B 1SUHA 3K2MC 5JLZB 5AVSB 3VB8A 4BQ8A 5I6KA 1TA8A 2Q73A 4GKZB 4RFNC 4GCZA 4APXA 4LOUC 3TH2T 2XN9A 2I9TA 3IMSA 3AWFA 4QXGH 1QRNA 1XIWA 1VQNV 4KKBC 3HI1A 4AYBA 5IB1B 2F8XC 4I88A 3OTOB 3IU3A 5J2TA 1D7BA 1IKNA 3ZS8C 5FWQA 5AOMA 3BGFB 4K23H 3EO1A 2Z3YA 4TQEH 2B59A 2OP4H 5EBWA 5BJTB 3MHHC 4P9ML 3HPLC 4FOMA 4ACTA 4C83A 4Q9RL 4YXHL 3TJHC 2F6AA 2NW2A 2PXYD 3MBEC 4F7PA 5I8OH 2AGAA 3PRZA 4YMPA 4P4RB 3D7PA 3IDJA 5F6IC 2BFVL 1TTAA 1AP5A 4F2MB 2NQDA 3DO3A 4YFLI 2WLHA 2GV9A 1BAWA 5F9WB 2R29H 3VNZA 1HNYA 1T7ZA 1NWPA 4MTGA 3CFBB 2KERA 1S4IA 5AOKA 1CD1B 2FX7L 1R47A 3N40P 3DSNB 4C4BA 3IJSB 4KO6A 4U31A 3BE1H 4PEEA 4Y5VB 3A67L 2Y24A 2R23B 1VACA 2JI2A 3NESA 3GRWL 3OSKA 5IW1A 2H3KA 4R7VA 4MD5B 4QRQA 3FPYA 3T6QC 1GSMA 4DGUA 3RN4A 1NAMA 2ADFL 4ZD3H 2FEJA 3V0EA 1NH2D 5CEYA 5KUMA 4FMTA 5ETUB 2WLLB 3MLWH 3CNKA 2WPDG 3DHMA 1KMGA 4JR9L 5SWZD 1NMAH 3ZK0A 4X62O 4EI5C 2E74B 2D0HA 4BFNA 2EYRB 3QZBA 4BCXA 1MF2L 3WYRA 1OCCC 1XHHA 4XGZA 5JOFA 2AJSH 4D94A 5IMKA 3JV6A 4DO6A 1JPGB 3L9RA 4JPSA 1GJUA 3OAZH 1EV2E 2DQUH 3UTQA 1AVMA 3JD0A 1UC6A 2W07A 3ASNC 4K5MA 3FN3A 2VC2B 2DMBA 3CVHA 5EDSA 1DVFC 4HJEA 1WV7T 3QQXA 1RCYA 5B1OA 1NGXB 2E75C 2DJUA 1RVFH 5K5YA 2IF7A 3RWIA 2EIJC 1OGAE 3TYGH 4XCNA 3LPFA 3MRCB 1JZ8A 2IDUA 4WI4A 4MAUL 1NH2B 4AG4L 3DDGA 3Q44A 3D34A 5DD0H 4A7QA 1U92B 5BCAA 1W72L 1ZLUH 3W7SA 1JAEA 4MXVE 4NN6B 1UKTA 5SWZB 4AVKA 2VM9A 2WANA 2BS8A 1DTUA 1FHGA 4OJAA 5J13C 3MYZA 2CDYA 4HK3N 2COVD 4QXVA 1J86A 1FNSH 5CP7A 2QPEB 4ZI8A 4KKLD 3BUDA 1BMWA 2CUIA 2X4NA 1FFXA 3CHRA 2VRQA 2XXFA 3PXHA 5C0BD 3VE0A 2HP8A 4HNAA 5FYLL 3WL9B 4K8XA 4MTFA 4GUOA 4J80A 1B90A 2WUCL 3D33A 2CO7B 2DQ6A 2ZCLH 4NQUA 4ADJA 5L7XH 1URLA 4W9GC 2H6PA 1R6VA 2Q7YA 3EFDL 3VTAA 5FXCH 3MXWL 2ZM6B 1F4XL 4PSRA 4TRPL 2PYED 3WNJA 3OWEA 4U7SA 3FZUD 3RGVA 4JMNA 3MNVA 4P9PA 4YHHO 3LKNA 3MLSH 4POZC 1AIZA 4HCRA 1OVZA 5FV1L 4XO5A 1OAZL 4MNGE 4MVOA 4IRJB 4APQC 3FUEA 1TQBB 4ENEC 2XQYG 4RWUA 2OMTA 1RZJC 3ZMSA 1I1AD 3AAZA 3D1MC 3STBA 3WTYA 4JYAO 3O3AA 4MQXC 5AW6B 3ABLC 3SQBB 2ZQMA 3MA9H 3Q6GH 4R9HA 2ETWA 4HKBB 1UTDA 2OFQA 3FUFA 2WWMD 5E6ID 2J8UA 4GKJO 15C8H 5C0BB 4L3EA 4RZCA 4QUOA 1YEJL 4DTGH 4EZKA 2XBTA 2V5YA 4MSWC 5D71H 3V0HA 1YC8A 3QQDA 4JZOA 4PJFE 1F00I 2APXA 5GJSL 2XAFA 3BCFA 4FS0A 4G72B 1A4JA 1EZUA 2VLMD 5C6TL 4FM1A 1G0XA 4PAZA 2F7OA 2K3TA 5EO0B 2PYEB 2FUTA 5IWAB 2YFNA 3PWUB 4DP1X 5AVYB 1Y76A 2YN3A 2CHWA 1YJDH 3LAFA 1VEOA 5I1GL 1KLUA 4YAQA 5I30H 4QRTB 2HRHA 4YO0A 4EAEA 1NC4A 4JFOA 4Y9BA 1I1AB 1F58H 3WG7B 1A4AA 5HYSG 2UV3A 4DPRA 4GI9A 3IVKA 3VH8G 4H40A 4JQVA 2EDHA 1B2WH 5E6IB 4X5QA 4U4BA 4L1DA 3ZMNA 1NIBA 3BGFC 5BZZA 2IJ0C 3GJFA 4OLWL 4KVNH 2X70A 2OZ4L 2YQ2A 4RSVA 4PY7B 4HJJL 4LLWA 1CUOA 1N5AB 5CBFA 2HWZH 3IF1B 5KANI 3O2VL 1G5GA 2AHYA 4PJ5D 1U30A 4JAVA 2JJTC 3LTVA 3OM3B 4LF3A 1MJ8H 1A7NH 4ODBD 5GGVH 5BPPA 2B0SL 3NFPA 5F9WC 2ZE0A 4AIEA 1XBRA 3O4LA 5A16B 2PYJA 3RFZC 3FT0A 2AXHA 2XOKG 4OGXL 3RWDA 5D1XA 4DKDC 2DQGL 1JSYA 4HD9A 2K7PA 3DKHA 4O5LH 3ZYOA 2MTPA 4DVBA 4GBXA 1KYOK 1P5VB 3NG5A 5H2FZ 5DFWH 1FAFA 5B66Z 1AXTL 4GAJL 3EDDA 2FLRT 4ZRGA 4TVPE 1NANH 3GSUB 1WGOA 1ED3B 1P69B 5DJZB 1C5CH 3IETA 4WW2A 2IBZH 4G9FE 4WV1B 2RQEA 4ZYKA 2LP7A 4KTEH 4EVNA 3SKJH 1YUHA 4BK8A 1LJMA 1T5WB 4WF9V 1U9KA 3P2TA 5EZOL 1N0JA 2X4PB 4JO8A 4NQSA 4QRPE 4YL4A 1JPFA 1VF5C 4I0PA 4OTXH 2I07A 4J11A 2E74C 4MRBA 1CR9H 4PELA 5JUEL 3TO2A 3LRHA 1O6TA 2D7QA 1Q94A 1MFBL 4H37A 3KLQA 3QZWA 4JI8O 1CGWA 4L1BA 5ANME 3EXJA 1A4BA 3ZTEA 3ZR5A 4PRHA 1H5BB 2CXKA 4XVSL 3A6BL 4LF5O 3HS8A 2FHFA 4ZMVA 2OAAA 5GRVK 3HG1B 1KXHA 3KWVA 2QR4A 3I85A 5F7NC 4OX9O 3OQ3B 2DTSA 5DRNB 1JMXA 1UA6H 3PWPA 1N0LB 4OGYL 1CICD 4X6DA 2ZSVB 5HHMD 1XF2B 2DWEA 4PJAA 3HUJA 1MVYA 3VXSD 5K9JL 4P57B 1MPAL 2KPWA 3ZDWA 1HTYA 4AZ8B 1JL8A 3PP3K 4WRLA 4PS4L 4HK3J 3S34H 4NN6C 2JH2A 4PWHA 1T1WA 4P06A 3UPRB 4NQDA 2NUPA 2WWKO 5DJAB 2FYYA 2X2YA 4NRYA 2F53B 1SJMA 1NU1H 1NCAH 2Z4QB 3L73H 4WWNA 2M83A 3MNZB 4LCUB 2Y5TB 4OD3H 3UTSA 1FH2A 2HVBA 2Z91B 1JTPA 4FK5C 4IKIA 3WJJC 5JIHA 1TSRA 5FO7B 2P24A 4N2HA 5H9CA 1I3RA 3OC8A 2O30A 3NIFF 4M6OL 1FA4A 4QLRA 5CNHA 2ATPB 3IDXL 1IAIL 4MZRA 3CCRV 2CLVA 1L8DA 3AM8A 5KZCD 4KK8C 3RWRD 1PJWA 1T1YB 1IBZA 3C5ZB 4LPYA 5KAIZ 1WZ1H 3RUGB 3W56A 4DR1B 4GO6B 4DP7X 2ZOKB 3V55A 1CICB 5HHMB 3V4PH 3TLRA 3T2QA 4OIAA 1LO2H 5CA1B 4QPKA 5E9AA 3UP6A 2BZDA 5AFAA 2YMXH 1U96A 4Y9FA 5DJ2A 4EDXB 4YQXH 3MLTB 1REIA 3FUJA 3RNQA 5DI8B 1N7MH 2JI3A 3RWGB 4OUUB 2V33A 1HNXB 2GUZB 2AJUL 3QNXB 3BDBA 4ZG1A 1UD2A 4IRJC 4M7LH 3BP5B 4XP4H 2XTSA 1TQBC 3DBSA 4FYRA 1N8OE 3OG6B 4JAMB 1PF3A 3KCPA 1I9EA 1ZS8B 4E5XA 3APMA 3F7KA 2BSCA 5IW3A 4MJ6A 2LW3A 4LCIH 1BFOB 2QSTA 4OV5A 5HBBA 3BH4A 3QCUH 3GSNA 3CC1A 4JGNA 1USZA 2NY1D 2WBKA 4XN2A 4BKLB 4GW1A 2A6DA 3D4ZA 4RUEA 3G9AB 1XB3A 4GT1A 4A68A 5KZCB 4M4PA 2IH1B 4BA0A 3WFEL 3D36C 4FNRA 1WHPA 3BP4A 5TF1L 1SQBH 1FFOA 3VWJD 1NC2B 5KS9E 3SJVD 4OLUL 1BZQK 2H1PL 3OFNG 1AMYA 3FZUC 2XRAL 2AEOA 2K4WA 1XH1A 1GOHA 1G7JB 4Y1AE 3CZLA 2LLLA 4UM8B 3FOLB 1QX1A 3LPWA 3L4YA 3QTCA 2VWEE 5DDHB 5JOPD 1OZUA 3C3TA 4PTUA 2NZ1A 4M1GL 3LNNA 3REWA 4Z7UB 1OAXH 4HZ3A 3WG7C 1TT6A 3MRPA 5LNEA 2QM4A 4I1RA 1MCPL 3V6ZB 2DJMA 5D93B 3FO2B 4LLDA 3GDCA 4HCIA 1JF1A 1XEQA 2WWMC 3C9NB 4U7MA 3R8QA 3VXQA 5KSBB 2ZTBA 4HKJA 1NLBL 3HMXH 4OV6F 3VXME 2DIEA 4YSRA 1T89A 1MCJA 2ENQA 4HOWA 1F97A 2OM5A 5DZ9A 4PCSA 1VCAA 3JASA 2X3AA 3L3DB 4FF9A 5IIEA 2XKSA 4JN2B 5LCVA 3MBXH 4YSAA 4I2XE 4IRZA 1OT2A 1RZKL 1OE2A 4AKPA 3CPLB 3IDMB 3QPKA 1WD9A 2CUMA 1IXBA 4U0RB 2CIKA 2GTSA 2JGUA 1VGEH 2NNRA 4MCYB 1HHKA 2KKWA 2ALWA 3BKCH 5TGBA 2YKLH 4P3CH 1KJMB 4Z7VE 3K6FA 3LNDA 3HKCA 5LGHH 4NKQB 4NZTH 1AOZA 3IGFA 5EEVA 2BIQA 1Y74B 4GXVL 4WFED 3ZZ1A 5EIIA 4CC1A 4K8ZA 1OB0A 3HKEA 5J1TC 2R0KH 3ZU8A 2X87A 4DP0X 3TBCA 1JCKA 3K2KA 1NGZA 2PTTA 3GIZH 3C08H 4NRZA 1AB3A 2YAMA 3T2LA 5L3EA 1JJ2U 3D0VB 1W15A 1P6AB 1BGXH 3D18A 2XQ0A 3OKOB 2X4UA 2EQDA 3WNIA 5IQ7L 1PP9H 1UZ8A 2VAAA 1MHPH 1SM3L 2JLLA 2WVVA 4GP8B 4JVPA 4WV1C 1I85A 2JXMA 3WLBA 5HYSB 1CL7L 3QH3B 3VH8B 5E94B 1WB7A 1I9JH 4OW6A 5E2TL 2DYPB 2H9GB 2NY5C 1RHHA 1UZ6F 3BVWA 1IE4A 1D9KD 3ZO9A 4F9PA 3VXPA 4XHJC 3N44F 1SBSL 1A7RL 1RIUL 2BMKB 4LU5H 4WSGA 3FYEB 3O9WA 4TSCH 5E1HB 4JFVA 1OARH 4Y16D 2ICWI 5DVPA 3BVTA 3ZBMA 5ICXB 5EWIH 4CS4A 4PIRF 1H5BC 4PJ9D 2R8SH 1U42A 1MZZA 4JQIL 1DSWA 4OM0L 4DV2O 3ZE2E 5DMYA 4LNUB 1FNLA 5FYJD 3L5XH 2P5OA 3T3PF 3BLPX 4NO0D 5DQDH 5I1JH 4E0RB 1P7BA 1G8MA 2W0FB 4AXWB 3L6FB 3MV7B 4NZRL 2A6IA 3TPKA 4A2MA 2GJ6D 3RVVD 4DKTA 2CR6A 3CPUA 1G7IB 4Z2WA 4HWEH 3OR7B 4U7OA 1P1ZA 4FFBB 3CQFA 1I8AA 3CRRA 1P0SE 2C3XA 3G5ZA 5C0ND 5KVEL 1EAJA 1QFWL 2LTQB 1BQZA 4X8CA 2X89D 3HTLX 5C2UB 2QGNA 1E5CA 5AB2A 4TQDA 3T2MA 2Z8RA 3KLSA 4G6ML 4D9QD 3CN3A 4J7ZA 1P7QA 4ZXBA 3WEXA 3MLRL 2YD2A 5JXAL 4LCUC 3P0VL 1NCWH 4K07A 3CZJA 1SVBA 4Z23A 2R0ZL 3ZUCA 2RJZA 2X4TA 1J12A 5I0DA 3VAEA 1FLRH 4EN3D 2QKIA 1QBLL 2ETNA 2OR8A 4OF7A 4WDIA 4TVPH 3QR0A 3C5ZC 2IQ9L 1H0DB 4F6RA 5T1KA 1CICC 5ID1A 4P5KB 2EEDA 1IX9A 3WNPA 4E2OA 1HXKA 2QQKL 1AQKL 5F1NA 5JQ6H 3OX8B 1WZMA 3VG0H 2EEAA 3ZX6A 2CNZA 3T4YA 3A0BZ 1HQRA 4BSJA 5MEND 1LEGA 1C5BL 3QCVL 1N8ZA 3D6GA 3D25B 4GLRH 5E9DE 4U1JB 2W5PA 2PTUA 2WCSA 2KQMA 4PJGA 5IB4A 3W2DL 1KN2L 1V7MH 2FJFB 3JYBA 3TZVB 5EBGA 1LEIA 4FQQB 2ICWJ 4XPTL 3TTSA 2W0LA 1N34B 2FBOJ 2G5BA 3HBZA 1CFMA 3S88L 5D5MF 5DURD 4EN3B 1ZPLA 2VLLB 1EK3A 3DGDA 3LNGA 5D7LA 2XDHA 5PAZA 3DPBA 1UXSB 4UNTA 2EACA 2IH1C 1KV7A 4M43H 2X6MA 3OMAB 2NX5E 3CX5F 4FG0A 2ZSWA 1RP9A 4HAMA 2JJSA 2YGNA 5CMAB 3KXFE 2VDNB 3D85A 1XXFC 4UCOA 1YQ2A 4P48A 1GKEA 4JI5B 1Z3GL 3QISA 3DIDA 5DEGB 2GY7B 4UT9H 2IBGA 1SZNA 2BSTB 4JFDA 2WK2A 3BEWA 3CVHL 3MOBL 2DW4A 3DOSA 4PVLA 2D7TL 5KEZA 4JI4B 3GHBH 4GOSA 3PUUA 3OB8A 3IBOA 5D93C 3SGJC 3O6LL 1PCSA 3ECBA 4Y9EA 4YDNA 1MVUB 2I26N 5MHSD 3RZCD 3V9EA 1UEMA 2VLKB 5BR8B 1BQHA 1JNNH 2BOCA 2BNRD 3T4AA 4CC4C 5IWLA 5IQNA 1FH5H 4FLVA 5AVQB 5EEWA 1D2PA 4NOFA 3R19A 2ZOLA 1TVDA 3MRRA 5DS8A 2V17L 1ZJAA 3FQXA 2OPCA 1VESA 1YJNV 1SZTA 2X9WA 1G43A 4U0RC 2VDRB 2UXCO 5KWYC 1DJXA 5LMUB 3T77A 4XVJH 2K78A 4ADGA 4HIJA 4FC3E 4YPGA 4YHMH 3U1SL 5I1IL 1PD6A 1G7HA 1MHEA 4O2FA 4I85A 4PW9A 2FK9A 1SKVA 5FYKU 3TPUB 5D2NA 5DD6A 5IB2A 3FONB 5F44A 1OZ0A 2EXWC 4ALAH 1J5OH 1BVNP 1XH2A 5D9SB 4NNXB 4LHUA 4RA0C 4JHZA 2ZWLT 3RZCB 1XGUB 2EYTB 4B9JA 3R06B 3KPQA 1IBMB 4OBSA 3ZPDA 2DZEA 2IALA 3LSOB 5FUOH 3U2IA 5I17A 1WBYB 1JUFB 4FLOA 1CGYA 5HHOE 1QABA 4TQFA 1OO2A 3R8BB 3WELA 2RACA 5DHVH 3QEUB 3FQTB 1NR1A 3IJ8A 4HIEB 4MT8A 3VRLE 4BXVA 3S4SA 1QP1A 4NQXA 1E8WA 5DFVC 3N55A 1GZPA 2YZ1A 5K33A 2AK4B 3QXVA 3NJIA 4ZFGL 3ETEA 4IQHA 3SQOL 2VGLM 4JM2A 3NZHL 5ISZB 1BCCH 2QWPB 4POYA 1ET7A 2ZIDA 1ETB1 3DMMB 3ETSA 1KCUH 2WC7A 3LRSA 3RTQA 3ULUD 4KKQA 3T6WA 2ZT9C 4X20A 5BO1H 3H3PH 3PDOB 3BDYH 4XAKD 2E76B 2HKFH 5T1MB 4I9WA 2AEPL 2P5ED 2PR9A 1OW0A 2IBBA 2VW4A 2YOCA 4B41A 4D9RE 1NICA 2CZNA 3OR7C 4MXWH 4BFBD 5GS2D 1CGXA 4XBPA 2OJEB 3RVXD 3THOA 2J57A 2DS4A 3S9DB 4X64O 1B0GB 2LTQC 4FX5A 5LOVB 3IB4A 1A6AB 4XN5A 4D3CH 1W8OA 1VQPV 2EIZA 5D1ZA 4WFAV 4JUTA 5C97A 1OEZW 1YUKB 3IJ4A 1KWGA 2G3XA 2VDQH 1KLFA 5FECA 1OJHA 3ARPA 1VQ7V 4K73A 4NYLB 4AMKL 2F54B 1AO7B 3JTSB 2UUDH 1CB4A 3KPSB 4PCYA 3WNLA 1IL1A 5JHMA 4DP9X 2UZIH 1EEQA 5BS0E 4A37A 2HXAA 4D0DB 3TURA 2JI1A 5CZXD 3WFDH 3GHEH 1NTDA 4X0KB 1G6RA 3QF7A 1F4YH 3BOVA 2NUTA 3GUTA 3M7OA 4RFEB 1AR1D 4ZDHB 5KHGA 4IOIB 4JDEB 3IT8D 5DJ0A 4DP5X 4WCEV 3GMQA 4E68A 3CDYA 1B4JL 1RUML 3NZSA 3WY1A 3KCYA 1G7LA 3LKSB 2Q1EA 1SLXA 3P30H 4J3OH 2GSMB 1U8PB 4KZEH 3KWWA 4F33B 5LBGA 5A2KH 4LCYA 3ZEDA 5I74B 1UZGA 3VQ2C 1MJ7H 2KDYA 3CCHA 1GO3F 3DNKA 2CG9X 4EI6B 1HEJC 3RL1B 5IQLA 3ARBA 5J1AB 1ZTEA 5KX5B 1PFCA 2P8LA 4Y19D 7FABH 3ZN0A 4N8CL 3VFWA 4XZUA 2R9HC 3QORD 4ZTEA 2EDLA 3TZVC 3FRUA 4I18B 2PZSA 2YR3A 2IAMB 4EN3C 4OLZL 1EMTH 5BMVA 5E08H 1G7QA 3JUZA 3S3PA 1CGSL 1Q43A 1IGFH 1OAKH 4GSXA 3LMJL 1R34A 3I9GH 1AR1B 4U1LA 1QYGL 1OD9A 1XD0A 2ITDA 4GMSH 4IK7A 5GSVA 1HJBC 2LLNA 2F0CA 5D7EA 5IZ7A 5LXTA 1S7XB 1Q9LA 2DWSA 2FSDA 1AZRA 1X5XA 2ZPKL 3LNHA 4X6EB 3WDHA 5JIQA 1BVLB 2DD8L 1AGEA 1IM9A 5IW6A 1ROPA 3A2FA 4XVUC 1QKZH 1CBJA 4QI3A 4F7CA 3TJTA 5C6PB 2CGRL 2OL3H 3EZJB 1U8NA 1JZIA 4GQZA 4ZZKA 4NXMB 1IAII 3QORB 2BP0A 3P3UA 4MJ2A 1BBJA 1FNFA 4XBEL 2XV0A 1XQ8A 4PGEA 1BL8A 2BZCA 4OI8A 4RIRB 1PBYA 3T8XB 4OLEA 3SKOA 4A63A 1ID5I 5KSUB 4BYHA 5KTEL 2ED6A 3B9AA 5FB8B 2D03L 2A2QT 2XIBA 4XZ4A 5DJYA 3UACA 3M8AA 5JWPA 1TQUA 3KVPA 5MEQA 1O9HA 1YC7A 5HY9A 3BIAX 1JD7A 3NJMA 3F3HA 5AKVA 5I28A 2OIEA 3LDBB 4K8RC 1NJIW 3MA7A 4LDEB 2OMVA 4YJZL 1C16B 2DIJA 1GTFA 1JXFA 3PREA 1ZUQA 1T83C 2RAMA 3QG6B 3UTTD 2XNAA 4KITB 2PWDA 4KDTC 3KPLA 4NS0A 4QYAA 5AOLA 4IT5A 4KUZL 5I0WA 3VFUB 3VFNB 2BHFA 5EBMB 5M7QA 4ZFFA 1CG9A 1WFTA 1T1ZA 3RNKA 5GGRA 4X50A 4RESB 3RA7L 2FEDC 1KGCE 4ZFQA 4JKLA 5KJRH 3EJZC 1IT9L 3B5GA 1SRDA 5KBNC 4ZI7B 1EZVH 1O75A 1DLFH 1LMIA 3LS5H 2NXZB 2FECL 1GS8A 3AJ7A 3VI4A 4RFOH 1TVHA 3NJJA 3CZKA 1OGAA 1QATA 4UQIM 4HUWB 4JI3O 4NHCH 3L4WA 1W8EA 2LAGB 2QPDB 3GPSA 4KK9D 5FYJU 1UD3A 3P9WB 1N64H 3FT4B 2HKHL 3OHMB 3QNYA 3IGAA 4M56A 1THZA 3NPSB 5DO8A 5TQ0H 4L8CB 2B4CH 2IAAC 2P7TA 2OYQA 3MRLB 1HEZB 4FMKA 4H8UA 2E6QA 4M9PA 4S1DD 3BH9A 3UTTB 1AKJD 1MI5D 4XXDA 2DLTA 3C12A 4FLHA 5B1CA 4UU9A 4P2RE 4LB8A 1PDKA 5H94B 1TCRA 2GT9B 2F58H 4LSDA 3DMMC 2VL5B 4JKPL 3PL6C 4KKAD 2O6PA 1UXLA 5KBPA 5KVFL 2QSAA 1KDJA 2Z34A 4O2EB 4LSQL 1JPEA 2QA4V 1D5AA 3HMXA 2JB5L 3Q8FA 2E76C 5EZYB 2WB1A 4ZUWB 5FR3A 3AG7A 3LV3A 4XN1A 1JBJA 3E6FA 2XZQL 4XMPL 4HZ1A 1X5IA 4JW3A 2V8LA 3CHXA 2DQJL 2Q0OC 1QI5A 3B2VL 3VVVA 5GS0H 2EKSA 2AVFA 3S7GA 1A3ZA 1AD0B 3WFBH 1JRHL 4JV5O 3TP4A 3L3KA 4I1PA 1OSPH 1JF6A 2AABL 1YYLL 2BO0A 1MLBA 4LSUL 3IAGC 3H2PA 2BINA 3BWAA 3RUGF 3NA9L 5JHDD 2IANA 3A6CL 4RGND 3WN5A 5IKCB 4HJ0D 1QSFE 3F6JA 1TETH 3CS5A 2FWUA 3EXLA 5LCVL 4I3SH 5EOCL 3JZ7A 1H6TA 2DWDB 2UZYA 5F88A 1K9MW 3ULUC 5GRUH 4A66A 9CGTA 2JGDA 3V6FA 3KHQA 5AW9B 4PQXA 5K93A 4F37F 1CL7I 3IKKA 3FSVA 5E2JA 1PPJH 3D48R 2R0LH 3RYIB 4PJFA 2YA1A 3HFFA 4X6FA 3L54A 2YBRA 3BO8B 1HWWA 4JHVA 4AOFA 3TS8A 5C08D 1OAQH 5C09B 1NT2B 5GIRA 4FCHA 4PA3A 2FIKA 5E8PA 2PWEA 5J0BA 4QHMB 1T21B 3MKGA 5I74C 4YHNA 5JXEA