3ASOB

Bovine heart cytochrome c oxidase in the fully oxidized state measured at 0.9 angstrom wavelength
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
226
structure length
226
Chain Sequence
AYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinguishing between Cl- and O2(2-) as the bridging element between Fe3+ and Cu2+ in resting-oxidized cytochrome c oxidase
pubmed doi rcsb
molecule keywords Cytochrome c oxidase subunit 1
molecule tags Oxidoreductase
total genus 67
structure length 226
sequence length 226
chains with identical sequence O
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3asoB01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3asoB02
1PNCA 3FQYA 3FU8A 3FYEB 1AANA 2YAQA 1EZLA 1JZGA 5AZUA 4GXFA 3QJRB 1AS8A 3AG2B 4A2GA 1BYPA 1R1CA 2TSBA 3OMNB 4GP8B 1F56A 1AG6A 2YXWA 4KO5A 2DV6A 5AFAA 2ZWNA 3X1GA 2YXVA 5I6NA 1SDDA 2IDSA 3FSZA 2HXAA 3IE9A 3CG8A 4HCIA 4N4YB 1A4AA 1RCYA 2FNWA 4BWTA 4BK5C 2Q5BA 3SBRA 2VM4A 4G7SB 2UXFA 3X2QB 1SHXA 5PCYA 1NIFA 1OCOB 3ASNB 3ABGA 3S8FB 4CSZA 1ASOA 3NJGA 4X4KA 5F7BA 2MTAA 3PLYA 1DYZA 1L9OA 2VSKB 4HIPA 1GW0A 2UX6A 2XVBA 2WSDA 4E9SA 1BAWA 1OCRB 6PCYA 2VN3A 2Y1AA 3JTBA 4NAJA 4WKXA 4A2FA 1ET5A 1PZAA 2XLLA 2EILB 2IAAC 4KO9A 3QQXA 1PLAA 4A2EA 2N0MA 2OJ1A 2IH8A 3ABKB 1URIA 1L9PA 1SFHA 3CDZA 4G7QB 2AVFA 2ZONA 5B1AB 3T71A 3DIVA 2BWDA 1M56B 3GYRA 3AG1B 3EH3B 4HHWA 2AFNA 4YSEA 7PCYA 1ASPA 2PP9A 3HEIB 3OMAB 3AZUA 1ID2A 2HX8A 3FU9A 4DP1X 2VW4A 1ZDQA 4FAAB 1N68A 1SHWA 3NP3A 2UXGA 2J56A 1JXDA 1TU2A 1SDDB 3X1EA 4KOBA 4ZK8A 3SBQA 1E67A 1JXGA 2I7OA 3IN2A 1GS8A 3FU7A 1X9RA 5TK4A 1XB3A 3V9CA 4UANA 1BEXA 1KBWA 1IUZA 1ETJA 1GY1A 1ZIBA 3UAEA 4YSSA 4KNTA 2EIJB 3EH5B 1A65A 4DPBX 3NJFA 1SF3A 1QNIA 2YAFA 4DP9X 1W8EA 3AG4B 4TXVB 4HZ1A 4WTQA 3OD3A 2HRGA 2IDTA 2XXGA 3T9WA 2XYBA 1JZHA 3NJLA 1NDTA 2GIMA 2R7EB 1SJMA 3NSCA 4KNUA 1KDJA 2H3XC 3BVDB 1A3ZA 3H4HA 3ERXA 2MRYA 2Q9OA 1XMEB 4JHVA 4E9YA 2UXVA 4YSOA 5I26A 2AZUA 1E5YA 4G70B 2BO0A 3FSAA 2P80A 4JHUA 2VSMB 2IDUA 3CVCA 1KCBA 4EF3A 4DPCX 5D4IA 2HZHA 5PAZA 1AG0A 1OOWA 4GP4B 4HAKA 3ZX1A 2VM3A 5I28A 3AY2A 2OV0A 4G72B 5I6PA 4F7KA 4N8UA 4AKPA 4BWUA 2PPCA 3NSFA 3SBPA 2Y69B 3T6ZA 2J55A 3FSWA 3WIAA 1FA4A 2DYSB 4CSPA 4E9RA 3BQVA 3WNIA 3AW5A 2IWKA 1NIBA 4MFHA 4DP6X 4E9TA 1AZRA 1PNDA 4QLWA 4KNSA 5I6OA 2FQDA 3CVDA 1KGYE 1V10A 4YSCA 1JVOA 2BW5A 2TSAA 2IDQA 4YSRA 3QJVB 5B1KA 3T6WA 4E9QA 3DTUB 2QPEB 3PAUA 5D4HA 3S8GB 2GSMB 4HALA 2H47C 1XB8A 4DPAX 1E5ZA 3TA4D 3ZBMA 3FPXA 1PCSA 4YL4A 1BQRA 2QT6A 2EIKB 1JZFA 1J5CA 4YVUA 1BXAA 2YEVB 3MX0B 5D4JA 1JVLA 1BXVA 4P5RA 1IBZA 4QKTA 3SQRA 3NJNA 3PAZA 3TBCA 1NICA 1PF3A 1NIEA 1BXUA 4BXSV 1WAEA 2PP8A 2PPAA 2WO2B 2XXFA 2B3IA 4DP0X 1ILUA 2GBAA 3RYMA 2FQEA 2DYRB 5B7MA 4P5SA 1NWOA 2J57A 2CAKA 5B1JA 1KDIA 3FSVA 2XUWA 3NT0A 3X1BA 3OMIB 5B3SB 1WA0X 2NRDA 1KV7A 1W6LA 2W88A 4L0PB 1PLCA 1NPNA 2CUAA 2PPDA 4ENZA 3H56A 3PCYA 2FJSA 3S3DB 3HB3B 2BP8A 3ABLB 1OV8A 1ZDSA 2HRHA 3L45A 8PAZA 1RKRA 1WS7A 1L9SA 1BQ5A 3QJQB 4BXVA 3NYKA 1A4CA 1NINA 6PAZA 3UAAA 3FQ2A 1ZV2A 2VMJA 2HLEB 2YAHA 3MBWB 3NSYA 1RZPA 1AZNA 2BHFA 3QPKA 4NERA 4FA7B 2BWIA 2YAMA 2FQFA 3N55A 5B1JC 2AZAA 1EHKB 1CYWA 4AZUA 1WA2X 2LLNA 1AS7A 2QPDB 3PPSA 1CYXA 2GC4C 1PZCA 5ANHA 1AAJA 1AZCA 4YSTA 2QDVA 5I5JA 1GYCA 2QDWA 2BZ7A 3T6VA 1NIDA 1TEFA 2X87A 4A67A 1AS6A 5EHFA 3IEAA 5FC9A 1L9QA 3EF4A 1V54B 4HCGA 4F2FA 2XV3A 1X9UA 2BP0A 2FT7A 3OM3B 1SF5A 2OCCB 2E86A 1SNRA 2JFCA 4YSUA 2IH9A 1ZIAA 4HHGA 1AIZA 1JZIA 2BP8B 2XX0A 3UGEA 3QJTB 3CDZB 2FT8A 1PLBA 1PZBA 2IWEA 1PMYA 3PXLA 2EINB 2YAEA 4M4RB 3EHBB 1OE2A 4G71B 1DZ0A 1KCWA 3T6XA 5A7EA 4KO7A 1M57B 4AI7A 2HX7A 4YSQA 2RACA 4Q8BA 2W8CA 1J9QA 4A68A 2PCFA 3NJIA 3GDCA 1J9SA 4E9WA 4BDVA 2YARA 4DP8X 1VLXA 3FU7B 1GS6X 1NPJA 1L9RA 1RZQA 1B3IA 1JOIA 2HX9A 5B7FA 4KOCA 7PAZA 2X88A 1AACA 4M3HA 2JXMA 3FYIB 1TKWA 2PPEA 3NJJA 4HCFA 3IN0A 1HAUA 2YAPA 2XV2A 3QJUB 1WS8A 2B08A 4K9JA 4YSDA 3V9EA 4AKQA 3UABA 2P80D 1M9WA 1ILSA 1T5KA 3S3BB 3C75A 1N70A 2I85A 3NJHA 1J9TA 4DP7X 1AQ8A 1KBVA 2CBPA 1UATA 2XV0A 5B1BB 2XU9A 2DY2A 4UF7C 1ET8A 2VW7A 3PAVA 5I6KA 1JXFA 5F7AA 1GS7A 3U25A 2UX7A 1E30A 1CURA 1MDAA 1FWXA 1TEGA 4DP2X 2PLTA 1L9TA 4KO6A 2ZOOA 1BQKA 3N2JA 2GC7C 1QLEB 1OCZB 2PCYA 2BZCA 4BDVB 1A8ZA 1NZRA 1OE3A 2IWFA 2ZXWB 3S3CB 2DWSA 1HAWA 3WKQA 2XX1A 4GY4A 4YSPA 2EIMB 1IKOP 2XWZA 2J5WA 5I6MA 2DWTA 3FQ1A 3H4FA 4W1TA 3IBOA 3TBBA 3ZIYA 4G7RB 3WNJA 1ET7A 3FT0A 1OF0A 4E9VA 2CALA 2FWLB 2PPFA 3WKPA 3JT2A 2CJ3A 3CZUB 5LDUA 1GR7A 1AZUA 4E9XA 1MG2C 2UXTA 1BYOA 5E9NA 1WA1X 1ADWA 1V55B 2A3TA 3GXUB 3KW7A 4NB7A 1OE1A 2GB2A 1SFDA 1NIAA 1IC0A 2CCWA 1J5DA 4JKNA 4AKOA 4A2DA 9PCYA 1FFTB 1ASQA 2WO3B 1AZBA 3NJMA 1CC3A 3TU6A 3D12B 4A66A 3NP4A 3ZDWA 4BWWA 4RH4A 3G5WA 1HFUA 2R7EA 4Q89A 1E65A 1JZJA 4DP4X 4GYBA 1JZEA 1QHQA 3WI9A 4F2EA 2GHZA 4PAZA 2YQBA 5B7EA 1A4BA 1JERA 2PP7A 4YVNA 5I5IA 5TK2A 4AX3A 3ABMB 3WG7B 1PY0A 4DP5X 1AR1B 3QJSB 1NWPA 1GY2A 1W6WA 1NTDA 2JKWA 2GI0A 2FTAA 2I7SA 2YAOA 1MG3C 3UACA 3EH4B 2H5UA 1MZYA 1AOZA 4YSAA 2IDFA 1ZPUA 1KYAA 4A2HA 1YLBB 3AG3B 3KW8A 5I5MA 1IBYA 2AANA 2BW4A 2FT6A 3TASA 1CUOA 5AKRA 1OCCB 1PAZA 4UAHA 3NSDA 5I6LA 1I53A 3FPYA 3CVBA 3OQRA 3ASOB 3DKHA 5IY5B 3X1FA 4W9ZA 3UADA 4PCYA 2BP0B 1J9RA 3NJKA 4GP5B 3X1NA 1GSKA 1XB6A 3FS9A 2VW6A 1MZZA 2FQGA
chains in the Genus database with same CATH superfamily
3LPWA 3FQYA 3VDBA 2YXYA 1MHHB 1K4CA 2YAQA 3EYQD 3DOHA 3MNZA 5F7EH 4M43L 4A2GA 3GM8A 5E2TL 4GP8B 1SXNA 1XF4B 4RMUA 5ADPH 4NXMO 3BXNB 1UKTA 3MDJA 3BE1H 2ZWNA 5D7LB 2CTPA 3SIKA 4U6HB 3HKZA 4YXHH 1SJVA 1KQSU 4S2SA 3U0PB 1Z0MA 4QJFB 3QA3B 5FLUA 1IAKB 3C9NB 4YDJB 4G5AA 2VDNB 5L9DL 4G83A 3ZRWA 4P23D 5B1OA 4PJ8C 5FUOH 2F53E 5LBSL 3WY1A 2A74B 2PABA 2QDOA 4CMHB 3IDXL 4P04A 2DE0X 4GRWE 3IU4L 3HKBB 5F1NB 2C3HA 4HPYH 4U3SB 3OKNA 2LU3A 1N0XL 3O2DA 4QHLA 1GJIA 2Z5UA 1JPTH 4NQDA 4XCNB 2ESVD 2ICEB 3VRIB 5I30L 4GX0A 2WSDA 1M90W 3TFKD 3ETEA 4XP9H 4XNXL 2IAAC 1FNSL 4WNQB 3I6LD 3F62A 5FEBA 4EI0A 1L9PA 4L37B 2WZAA 5F44A 2BHYA 2FIKB 3CTTA 2AVFA 3SE4A 3W1ZA 5FO8B 1GZPA 1QVOA 2ZONA 3D09A 2MPAH 3T71A 3L1GA 5ITZA 1INEL 3KJ4C 5FYLE 1TZHB 3D1MC 4OCSH 3NFSL 4RUFA 3VGFA 2JEXA 3IRCA 5DI8A 4F57H 1A6WH 1TUPA 1FJGB 5KSAA 3ZRCC 1MJUL 2ZCHL 1WG3A 2M6YA 2RBLA 3IFPB 4RDQG 1I5YA 2QGEA 2VW4A 1TO4A 3RJQB 4J41A 1UJ3B 3WDJA 3KCPA 4NXNB 3QWRD 3F12B 4NKOA 3GI8L 4QHUB 1JRHH 4FXGA 1E9OA 3SJVE 2EE2A 3MDSA 2BSSA 4ZK8A 2L35A 3RN4A 1UPGA 4YXLL 3LKRA 2I60L 4UANA 1BEXA 5DF0A 1NQBA 1VEMA 3MRNA 3PP3H 5C07E 3H1HH 4ZOLB 2NT0A 5HYQA 3RZCD 2VDLB 5IHBA 4YBLB 3QUYA 2GQHA 3FNKA 4GKZA 5CJOL 2XXGA 3RX5A 1CXIA 3P0GB 2XYBA 1MWAB 3QIWB 4NNYA 4K0OA 2BVQA 2E7DA 2JS3A 3GLEA 4BRJA 4CU8A 4EI5D 5IHWA 5C3LD 1NKRA 4FLTA 4Z7UB 5GHWH 5HHVL 2MNUA 2VAAB 3KPRE 4JZGA 2OMZA 2Z31A 3EGDA 3KPNA 5FOBA 2AZUA 5DSCB 3OJDB 1GYAA 3TXQA 4AL8H 2Y69C 2BO0A 4N24A 4ANXA 3GM0A 3NPSC 1BWMA 4XB8A 1KPUA 3KVQA 1PD6A 4K5LA 4KXBA 2HLAB 4FQLL 4I55B 1K7DA 4HMDA 5DS1A 3ZMSA 1PPJH 1P7KB 3HR5B 4XZUB 5I0XA 1IBLO 1U8LA 3HHSB 4MS2A 4U0RB 1A3LH 3EO0B 4HWNA 2X09A 1JWMB 4XWGL 3VH8G 5GRJH 3T0EE 4G9DA 3FSWA 4JAMA 4J8RB 3GSUA 3AW5A 3GEWB 3BPCA 1AHWB 4R4BA 3C09C 3QFDA 3GC3A 1TEYA 3CHRA 4LSPH 4ZTEA 3ZE2F 1HHHB 3U6XS 5IROD 5DJ2B 2TSAA 4HXAL 3SOBH 3MAWA 1G7PB 1DQLH 3UJTH 1UXSB 3LSOB 2I69A 5DMYA 1HDMA 2KBGA 3QIBC 2J2ZB 1QABA 3QXDB 3PUUA 2OMUB 5E2UL 3ECVA 2XPGA 2WXLA 2PF4E 3FPXA 2IU3A 4OFDA 3LD8C 3MBWA 4GXVL 4C57C 1LHZA 4PMEA 3RIFF 4LCWA 1WFNA 3QORC 2HT3D 1KGCE 3MR9B 3NQKA 3R4DA 4NEHB 5AG8A 4EDXA 4QKTA 4C47A 4OUUA 1J1OL 5CA0B 3FC8A 1XVSA 3G6DL 5FK9B 4MKTA 3MRQB 1RZ7L 1CIDA 1LDPH 1BD2A 2GUOB 2Y7MA 4BZ2A 3ECBB 4L9LB 5D1XB 2R29L 1FFNA 1EERB 4MJ6B 4YHMH 3N1PC 3D0LA 1U92A 4ZBJA 5AW0B 2BRQA 2NY4B 1AGEA 2AQPA 5B3SB 4ONOA 5FW8A 4GKKB 2ZYRA 2XN9E 3VGHA 4FNLL 3RPIA 2A6IB 4ZMPA 3FZUD 3GSNL 2VISA 3PYCA 2UU9B 3KDMB 3D0VB 1UUSA 3GSWA 2R1XB 4YIQB 4NUGL 5HFLA 2ZKOA 5K9OB 4GKOA 3CNKA 1MCQA 1ZDSA 3CRRA 2J3SA 2O1AA 2PR4H 4GI8A 4NO5B 5D70L 1EO8H 3ULAB 4I0PC 3UBXI 8PAZA 1AI6A 1FNGA 5D96C 3BHBB 4UOW0 5HGAB 1OHQA 1JYVA 2VJ8A 1EJ6A 2VZ3A 3DLQR 3NZHL 1U8CA 4X7EC 3V7AE 1ZV2A 3HG3A 4JREB 2XN0A 3GHEL 2DQHH 4S1RL 3UAJD 1TQBC 3GB7C 4R7CA 1X59A 1VFOA 2DMGA 4PBWD 4XVTL 3GBNH 4OQTH 1F4XH 4S2SB 4WW1A 5ICUA 3BZFA 3ZJAA 1WJZA 4H1LG 3GNMH 2YAMA 2FQFA 2XFXA 3JQOB 1CYWA 2Y4SA 5E4IA 5I19L 1YEEH 3E2HC 3VG9C 4JRFA 4NDMB 5DFVC 4YIOA 3S3WA 4GI6A 4C8XA 3ZT6A 4XVSL 4N22A 5T3XD 2D9CA 3OKNB 4QD2E 4XDKA 1QP1A 2BSRB 1TEFA 3X17A 4LH6A 1AS6A 4QHLB 5GRVK 5LBQA 5EORL 3L16A 4FNQA 1UFUA 2LABA 3M45A 5F9JA 3OR7C 3U1SL 4TWKA 2E5LO 1R46A 5DN6G 12E8L 4XPBH 7FABL 2R1YB 2XV3A 1FXKB 3QJOA 1KN4L 3FU6A 4UDTB 4YK4B 3RYHB 2EACA 4QAMB 1VGKB 4XO9A 4ABWA 5JHBA 2BP8B 3E8HA 4H8HA 4JKPL 3QO0A 3E22A 1TJHL 4G6AC 3TZVA 1VERA 3M99B 4LWSA 3QJTB 3UGEA 4ACTA 4DO2A 2JJSA 5EO1A 5EU3A 4PR5A 1YXBA 3RU8L 4M6NL 1ED3A 1OE2A 4TUJA 1Y6MR 3C8KA 2C3VB 1W72L 5A7EA 2ZQKA 3B4NA 3OVUB 4O5LH 2VZUA 4I3SL 5D93C 5KSAB 1TTBA 3I6KA 4A04A 4AC4A 2B59B 3OLDA 5DWPA 4JI6B 1KCVL 1LUVA 3KCPB 3SKOA 1MCOH 4NKOB 4AQZA 1E9OB 2XTJD 5I8KL 1T7ZA 5GQBA 1UOWA 3ARGC 3BRCA 1NH2D 3K6OA 4NQVA 1XD1A 4A1RA 4KHPB 5LMNO 1J8SA 2CO4A 3BN9D 2DTML 3H2WA 3NK3A 3FO9A 3H3KA 5TQ2H 1WFMA 4KZEH 2BNRD 5KANI 3S5ZA 5GZOD 2XTAA 1ERNA 4XXDA 4MMXC 2R83A 3QUYB 2AXWA 3MV01 1QQDA 4XXWA 1IZKA 1MCWM 1H6EA 2K4WA 1MY7A 1NBZB 2UUAO 4NQSA 4NO3A 2BVQB 4LSVH 1SQ2N 5DO8A 2ADJA 1OAKL 4K9JA 5CFHA 3KPNB 4GI9A 5JTWA 2Z31B 1WBZA 5FOBB 3EGDB 1T5KA 2PZSA 5CB4A 3MV8A 4JFPA 3FHQA 1S3KH 5FNVA 1T0OA 3EIFA 1PL0A 4U6VH 3FAVB 3BP5A 4FNRA 3PL6D 5KWYC 1KPUB 5F89A 5CJQL 2NZIA 4HF5H 4HKJA 3PP3K 4I2XB 4WV1C 5GONB 3RFRA 1YMMA 1K9TA 1U8LB 3QQ9D 5F7AA 1A5FH 1YN7A 2P8MA 3MLZL 5GGSB 1R3LA 3ARED 4RWHA 2KUTA 3E83A 2E74B 2I9LA 2FX8L 5GJSH 5C0AB 3RFZC 4A63A 5AD0A 1Q1PA 3QFGA 2ZCKH 1W2KT 2K1EA 3PABA 4FLQA 4TTGA 2F61A 2EE3A 1BBDL 3Q9PA 4FULA 1AO7A 1D2PA 3O0RH 2LHAA 4HGKC 1PW3A 4XPTL 3BGMB 1UZ8A 3BEVA 3C60D 4UT9H 5EC1B 4M1DL 1HDMB 3GXIA 4KK8C 1FVEA 2GDSA 3L3IB 2FEJA 3SGEH 5HJDA 3KLAA 2KH2B 4LNUA 5MEQA 1SOKA 4CL7A 2Q9LA 1Z5LB 2Q2EB 5IVXE 2XBDA 3ZE1B 3ZIYA 3FFOA 4KHXH 3ZHTA 4V1DA 4XRCA 5BJTA 5KVGL 3VD9A 2X1PA 4K7PX 5LGTA 1AI1H 1PG7H 4I50A 3D4CA 2ED9A 4FZ1A 3ETDA 3LPGA 1T0MB 1ZXQA 3PWPB 4XMKH 3ZTNH 3BHPA 1II4E 2QJ1A 5DD1H 1V55B 4E2LA 3FH8A 4XMPL 2Z8VC 3QHZH 1I1FA 4AKOA 1FQ9C 3V6OA 4ZO7A 3FB6C 1JNNH 1FFNB 5F7FA 4MD5A 2Y2TA 4NGHL 4DGIL 4DV4O 4DV1O 3D0LB 3FRUA 1U92B 5C8YB 2VZOA 3NRPA 5AVVB 2MKLC 5F6IC 4HDIB 1AGEB 3WNMA 2WLHA 3GLZA 3ABMC 3MRDB 5JPNC 4QPJA 3DMMA 3QXAA 2RDCA 4F80A 4PY7A 3DVNA 3FMGH 3BI9X 4IW4C 1P2CA 2NW2B 2R69A 4DTGL 4E68A 1E65A 2X1QA 3QK0A 4NJ9L 4WJKB 2I5YL 3U6RA 1JZEA 4Y9FA 2BSKA 2VXSL 5I73C 2Q4PA 2JIXA 1MCLA 1SQBH 4I9WA 4QRFA 2COVD 2VE6A 4JI8B 4YXWG 1FNGB 2F66C 4MMYB 1IXBA 4OZHB 4WTXA 5K33A 3UTZA 1D5XB 3IAPA 4UZGA 3V5KA 2LGNA 4XP4L 1W2BU 2YZ8A 4JM2D 5BMVA 1VGEL 5HDWA 3SOTA 1NTDA 1U8CB 1LGVA 4XVUC 1MABG 2UZIL 4FQXB 4DKTA 3UACA 4W93A 3UYPB 2ZIMA 2DM4A 4JFDD 5F1IA 4FADA 3L95A 4OUOA 2NSXA 3UTTE 1NFDA 3BZFB 5KVGE 2CHWA 2UY6A 3R66A 1OTSD 1T1YB 4NIKB 3EF7A 4HUMB 4L3AA 5C08A 1KWGA 4FI7A 2NY1B 3A2FA 5L6YL 5D7KD 1M5IA 2XTJC 2OTUA 2ZXDA 4M4PA 4QHNB 4X0KA 1KXVA 1TJGL 5AW5B 1T7VA 1TQTA 4TOYL 4ODSH 2YWZA 4HG4K 4U1JA 4N21A 5FGBA 4BFIA 3KEDA 3QI9D 2ILLA 1FIEA 1I1AC 1VFAA 1YPZF 2A0LA 2W80C 4RMSA 4YS4A 3UJIL 2IQAA 4O2CA 5CU5A 5G55A 3OKDB 1LO2L 4FLVA 3BD5A 2NCEA 2UVFA 2OWOA 2GJZA 1HQ4A 5DD3H 3B7YA 5JQGA 2GAZA 5E4OA 1BOGA 4ONGL 3ETTA 2XQYA 3U83A 3E22B 3TZVB 4NXSA 4LWSB 3AG2B 2UUCO 1J05A 2VL5A 5AEAA 1LM8V 4P9HC 4F3FA 1AG6A 5I0WA 3JWDL 3DBXA 3MLYL 1DZBA 4KV5F 4XNBA 3OTFA 1ED3B 4MXWL 2OW7A 4IIQC 4ATTA 2JIZG 4TQHA 3QVNA 3SBWA 1INQA 4XNAA 3FKUS 1ZD6A 3DIFA 4CNIA 2YS4A 3QQ9C 2JKNA 3SKOB 1HE7A 2ZUYA 4M7LT 3FD9A 4KJPC 4BQ6A 3SJVB 4LLAA 1PP9H 2XZCH 3FHEA 4P59H 5H2BA 5M95B 1LLAA 4P9ML 1QASA 1P5UC 4QTIH 4WJ5A 1AD9A 4Z1VA 5AOKA 4P46D 3LVTA 3H9VA 1HINL 2NNRA 2OLDA 3FO9B 5IB3B 5KHHA 1KYOJ 4NM8H 1M56C 4QXVA 1BAWA 6PCYA 2VN3A 2IF7A 4GSRA 4XXDB 4HUUA 4W9IC 5D7SL 5ERWA 2EXWC 3QPXL 4H26B 2X89D 2FWOA 4P3DB 4MZ3A 1H3VA 4NO3B 1L0QA 5IFHL 1QLRB 4M61B 3QUKA 4ODUA 1DJYA 1QRNE 4HJTA 2Y23A 2ZG1A 1WBZB 4L3CA 3LNMB 1XIWC 1S8DB 4QXWA 1I0HA 4XN4A 5CB4B 4PLJD 4JFPB 1ZUQA 1XNQO 1GGCH 5ALCH 2VRZA 3BP5B 3K72B 1NBMG 2OXGB 1KTBA 2NSMA 1OD9A 2YI9A 2N56A 4M7JH 4HKJB 3GKWL 4R83A 2X2YA 4LDLB 3VFUA 3CCSV 1SQGA 4Q0XH 3MLPA 3AEIA 2NR6A 5F7HA 3UZEA 1YN7B 2BNQA 2WLYA 4NZTL 2VR7A 2QADD 5H8DA 1U21A 1UD2A 3EJJX 1J8HE 3DSNA 3UP1A 1S72V 2C9UA 2G3ZA 3RGHA 4LMQE 5AD0B 4GW5A 1EXUA 4MJHA 4G1EB 1QO3A 1A4KB 4FFZL 1T7YA 2EDQA 3PABB 4KKAD 4L8DB 4FOMA 4JLRB 3IGAC 2E7MA 3L9RA 2IPTL 1FLRH 4P2QE 3QZMA 2YIHA 3L74H 3ZKND 1O6SA 1S5JA 2LAAA 2YS8A 1FVEB 3VGEA 2VR3A 1UB5A 4UVCA 1A0QL 4N5UA 3SPGA 3GLDA 3O6LL 3KLAB 4LNUB 2A4CA 4PJGF 3QDMD 5MEQB 1FI8C 3P02A 3MRIA 5FCUL 3WNKA 3O6MH 3CHPA 4G6JL 2YSUB 4KZCA 3FSAA 3CXDH 3EYVB 3FUIA 5BJTB 3LXAA 3MNVA 1OT1A 4XC1H 4JFYA 1R3IC 4HT1H 4O2AA 4MA1C 2OMXB 1U2HA 3U0WH 5DO2D 3RTLA 5TE7L 1L5GA 3AY2A 1A14H 3HRPA 4LHUG 4DUXA 4Z7AA 2WJ5A 2PPCA 3K9SA 1DVFC 4UTAL 1I1FB 1N67A 2YD6A 5B66Z 1I8KA 3HKEA 2ZG3A 4JS7A 1NFIB 3WNIA 4DEWA 1F3DH 3W39B 4E9RA 4MW8A 1E7UA 2AGJH 4GT7A 4OF0A 1F41A 1MW0A 5E94B 3WJJA 4JFUA 4OIIH 2EDXA 4KK5C 5ICYB 3CWBH 4JF3A 4JO2L 1DQQB 3LB6C 1CL7H 4A2LA 4FFYL 3KLHC 3DMMB 3MCKA 3T6WA 3BPOB 2E5EA 3BP6B 1XBDA 3K5LA 3DVNB 2A9NL 4RZCB 3TBSB 4F33B 2GSMB 4L3EE 4PDVA 2HH0L 4PELA 1PIGA 2BSKB 1OGAD 3BH4A 4F15B 1U4EA 4UT6L 5KYXA 4WGVB 4I3RH 1AGDA 3SY0B 1SC5B 5I1AA 5KVDH 4JB9L 2VE6B 3FTZA 4G7VH 4YZWA 4UCFA 5D71H 5F70A 3BAJA 1FNEA 2RH0A 3F7LA 4HV8A 1NU1H 1UHVA 3AWEA 1UXMA 1QLEH 4LLUB 4XPFH 2R23B 3QW9A 3IS1X 5EEXA 3NA9H 3KJ6H 1YEJL 1YUHB 5F1IB 4MVBD 1GM9A 1ND0B 5DFTA 4I1RA 4LO9A 3SGJC 5C0CD 4NJAL 1T0NB 1CFTA 4QHKJ 3TBTB 2Y4UA 2UY6B 1SM3H 4RX4A 4YQXL 3TT1L 1K3EA 5K9JL 5E8NA 1LEIA 2CAKA 1RUKL 4M62L 2OCFD 4NPYA 3UC0L 3MREB 1VJSA 1HJCA 4X2UA 2EICA 4FDWA 5HVHC 4N85A 3TCXA 3BWZA 1GGUA 2GTZA 3VGAC 2CTQA 3EFFB 3BEHA 2WLNA 4NP9A 4I77H 3LNGA 3OLGA 1TIUA 1EXHA 2ZE5A 4U1JB 4BFIB 4H20L 4FJZA 2G75A 3AQYA 3G6JA 4B7IA 2HRHA 3MTRA 3MV7E 5BRPA 3ARUA 3BSZL 2GJZB 1HQ4B 1IBKO 1BJ1J 2P42B 4MNGE 1RKRA 5JQGB 4IL6Z 4WI7A 1S7SA 3HZKA 5I15H 1YN6B 2Q6WA 1WWAX 4Z7WA 1EJOL 3VQYA 3EADA 3NCFB 2FSEB 4CH4A 3UYRL 1J05B 1EXGA 4BV1A 4LP5A 3IK2A 5TD4A 2WMPA 4D0DA 3SE6A 3L4TA 5CD3A 2ICWJ 1HW7A 2P5ED 5J1AA 3U2SB 2HA1A 1B9ZA 2J6WA 2Q7YB 3DK2A 1BHAA 4Z7IA 3EBHA 5C2UB 2Z64C 3SKUD 2B77A 4M5ZL 4KX8A 1MFDL 2QV2A 3BUQA 1MIML 1YQVL 4WFFA 2JEUA 3FT4A 1E4XH 1INQB 3GI9H 2O61A 5DFWH 4C55A 4PRDA 4LLWA 2AITA 1PZCA 4DESA 4KNQA 2OCCC 4EN3B 1D5ZB 5HDBF 1S76D 2HT4D 2BOBC 3JWOL 3LZPA 3RILA 5CP7A 2ZP9A 1NIDA 3MRKA 1DTUA 4HLZG 4XMXA 5H2BB 3LZQA 3RKDD 1A7RH 1KN2H 1WO2A 4TNFA 5FC9A 3VM7A 4XN2A 1QI3A 1HWHB 3DSFL 2X4PA 4OLYL 5T3XL 4X83A 2FGZA 2D8KA 1EHXA 1I8MB 4WUUE 5CILH 2FWOB 3O3AA 4G8GA 4LNVA 4KX7A 4C4KT 4D0BB 1KIPA 5SWQB 1T6VN 5D7IF 2YC1A 2XPYA 1X5JA 3IKCB 3BDXA 4Z18A 3GEFA 2EJRA 2HTLD 4HBCL 3QUKB 1BFVL 4AEHH 2NTFA 1NFDF 3CFKA 4UIMA 4M7KL 4TUOA 4NENA 2EVJA 1Q8MA 1HSAA 3SDCD 4QYOA 4L23A 4GLRI 2WA4A 3QRLA 1MFAH 1NMCC 2RACA 4Z3IA 2EH7L 1H2LA 4PD4K 1UM6H 1WHOA 4FFWC 3OZ9H 4DGYL 3VFUB 1CFQB 1Q94A 2VMDA 5GRYA 3ZE0E 6TAAA 3M8OL 1JV2B 2ZWSA 3VB8A 2VDPB 1YDPA 3WSQH 4NWUL 3JVFC 2D7TL 3QS2A 2ZUWA 1D6EB 4APQD 2ZAIA 4ZJ9A 5JR1H 5LVEA 5LHIA 4DKEH 3BKYH 3CSYA 4WWKB 4ESKA 4FKHA 3V10A 1EO7A 1RP8A 1EXUB 1EAOA 4AG4H 1QO3B 1IM9A 2H1PL 3PUCA 4XCEB 3L3KB 3S88H 1I9IH 1R47A 3IFXA 2P26A 3BPNC 3Q8BA 2M1KA 2OZ4H 5K9QI 1YJDL 2A9HA 3DJRA 1EFXD 3VXSE 3VU2A 1KZQA 1O6SB 2D0HA 2WANA 4JY5L 3MLRL 5JW3L 1CZ8L 3SDXF 5AALA 1OT2A 1UB5B 3ZRSA 4GBXB 5DMIH 2V2TA 1ZTXH 3QJUB 1X6NA 4PJCE 1PFOA 5T5NG 3W5MA 4MCZA 1R5IB 4G27B 2H6PB 5DJAA 1GGBL 3U4EA 5DC0A 3C75A 4PGCA 4DEUA 1T6WA 4JRYA 4HXBH 3N41F 4PRID 3CZLA 2D7QA 1CLZH 3WFVA 2VNCA 4F9PA 1TVBA 3WFHA 4P9HL 1RY7B 1N6QH 5A2BA 1IAOA 1DUYA 2DY2A 4Y4FA 3SGDI 1MJ8H 4OPAA 3VA6A 4BR6A 3RJOA 2FBRA 3NMEA 1PKQA 2DQFB 1QEXA 3QEQA 4OQTA 1QFUH 2YRLA 1B0IA 3K6IA 3QCVL 2YOCA 4S1SH 4D9RE 4ERSL 4GKJB 4ORGB 3P73B 2FX9H 4GAYB 4KO6A 2KKQA 2YJLA 1MCHA 3OAUH 5HDLA 1ZS2A 4ADGA 4Y1AA 1B4LA 1F1DA 4RO2A 1O7DC 1NZRA 2IFGA 3RY6C 2H3NB 3MCKB 1SJHA 4PA9A 4F6RA 4J7JA 3AMKA 4EKJA 1AE6L 3CN0A 5ITFA 3LKPA 4L4VD 2JDIG 1FPTL 2HRLA 4TVUA 2IIJA 4GY4A 1JI1A 1B0RA 5KYXB 2W0FA 3CBRA 1YY8A 1JZ3A 3WY2A 5IFAL 4XHQA 2ZF9A 1OF0A 4A7UA 5CCHE 3RGVA 5B5EZ 4ZUSA 1H9DA 3IJHA 4HV8B 4FLYA 2CLZB 4IOIB 4K94C 3WHXA 3VQ1C 3VBBA 3X13B 4DR7B 4AUUA 4R7LA 2YKLL 3ZMZA 1XH1A 2KYIA 3THMH 4AYMC 4MNHB 4S1QH 4X65O 1A6VL 2F54D 2XZAL 5IMLB 4O51B 3JASB 4IBZA 4QXGL 1URLA 3I9IA 2QELA 3BUDA 5F1SA 2ZOKA 1MCPL 5JLZB 5EOQL 2OL3H 4N2GA 2VLRD 1PNMA 4NPYB 3BWUF 1WRFA 4BHUA 3IS0X 3NN8B 2C7UA 2FX7L 3EJTA 4BKLB 1VESA 2BDNL 3QT2A 2GK2A 5BMFL 1HFUA 5BR8O 4ZS6C 2Q2LA 1JPEA 1YZBA 2VR9A 4TVPL 3V4VH 1U6AL 2HB0A 3C6LB 1ZXKA 2WP3O 1YTFD 2V1DA 5E1GA 3T2QA 4BWAA 4GMSL 5B7EA 1I85A 3A0OA 4QWWD 1QSEE 2LOEA 4KY1H 1MSPA 2CLVA 3O11A 3LMJH 1S7SB 3HZKB 3X14A 4HWBA 3HI6H 3DVFA 3QJSB 3II2A 1CS6A 3LKSB 1EH9A 1RJYA 2YPLB 4PB0H 3T0AA 4K8RC 1ZJAA 1G9MC 2PWGA 2WMPB 4UNIA 1AZVA 5CD3B 4GUOA 4P9OA 1WD8A 1P4RA 2ZPKL 5LB1A 4FTVD 1OCCC 1XMOB 2FJHA 2QVIA 2Z0BA 3APMA 3HC3L 4AJYV 4MTFA 3UO1L 4B3MO 1AOZA 5LQBH 1CR9L 4DR2B 2IDFA 4QUOA 3FT4B 4JI4B 3GT6A 3HI1B 3MOAH 4OJDH 1CE1H 4F2MA 4LCVA 4V11A 2VXVH 3NACH 4O58L 1GKFA 3MLUH 2W0LA 2AGAA 3CFEA 4NKMA 4JHZA 2HRPH 4PRDB 1A66A 1PSKL 1QUPA 5I1IH 5I75C 5CP7B 3LKNA 3NPSB 2WB7A 4O4HA 1O9ZA 2VERN 5D2LA 5DEGB 4JZOB 1BFSA 3TCUA 4ACPA 3SE9L 1G9NC 3RVUC 3WKML 5F6HJ 2X4PB 2IGFL 2WXNA 3E1ZA 3DOSB 3MGTA 2P28B 1KTJA 4KMTL 3RYIA 4FQQB 4M43H 4AH2B 5E2TH 3W56A 1MI5D 2X4NA 1KMGA 3C5ZD 4NUJA 4G8GB 4UT9A 3OD4A 3OE7G 3M7FB 4B9JA 4B9ZA 3CFDA 2CR6A 3HG0A 2H26B 4TVPE 2HR3A 4FJ6A 4MWFB 2YD2A 2VC2L 3CFKB 1JR9A 2ZZUT 1AXTL 4TUOB 4HISA 3T4DA 2CO6B 4NENB 4RGMB 3PHOB 1QBLH 2F7OA 2W5PA 5HHOA 3VQVA 4J6IA 3NGBB 3IDXH 3LHAA 4QYOB 3JAMN 2WXIA 3HPJA 1XMQO 4WUKH 3IU4H 4J3OC 5BUGA 1P9MC 3LYRA 3QUZC 4QHPA 2F1MA 4FMTA 1N0XH 4KKLD 2VM4A 3CU7A 4LFBB 1B6DA 5DUJA 3N04A 5I30H 3P3UA 4FQHB 4JGSA 3S8FB 1KJVA 2ZXEB 4PJHA 2NXZD 3G6JF 4X4KA 2JLLA 3RWEB 4HIJA 4XNXH 1L9OA 1F6FB 4PWIA 4QYAA 3GSQA 1A9VA 2W60A 4Z7WF 4YJ3A 3G6BA 1QPPA 3BDYL 2P48B 2YPVL 5I18L 5C0JB 2NY6C 3J7HA 1U30A 2DQ0A 5GGRB 4ONFL 2KDGA 3NFSH 4DQOL 1PY4A 2WIIA 4UQ2B 5K93A 2UYLA 2V2TB 4JI5B 1I94O 1TO5A 1KT2A 4HK0A 4KJQD 1MJUH 3V95A 2ZCHH 1XGTB 4P2OD 3T3MF 5FKPA 2WBWB 2HKFL 2EC8A 5DJAB 3N1FC 3AG1B 2HVJA 5KSVA 3GMNA 4YSEA 3GI8H 3D30A 1WWWX 3HEIB 3TFBA 1TVBB 1F3JA 5DDHA 3L70H 3WFHB 3H1LH 1T1XB 1IAOB 1DUYB 3G04A 3P54A 4S11A 2X4TA 4Y4FB 4Y5VB 1C8QA 2IJJA 2J56A 4QF1B 4YXLH 2WTOA 4DGWC 3JD4A 1NC2D 1P84K 3P3TA 4AEIH 4UQ3B 1LE9A 1OAZL 2JE8A 3SDDC 4DO5A 5LMUO 4E4EA 4CILA 4HETA 4PRPE 1P7GA 4FM0A 1GY1A 2NY0C 5CJOH 3AJ7A 3UAEA 4A2MA 3A0BZ 2OYKA 4DRXA 3NJFA 4GAGL 4XVOA 3M8AA 2CUGA 2CXGA 3WDHA 5IUSA 3T4AA 1SA0A 3BGFC 5EUKB 1ANUA 4QXUL 3VI4A 4Z3JA 2WGXA 5F72S 5BRZE 4OZIA 1UT1A 5HHVH 3SPHA 3GSRB 3LKPB 1MEXL 4UV7L 3WTSA 2APXA 5FYJE 3LDCA 3DVGA 2HUHA 5L2KA 2O6PA 1K72A 1B0RB 3F7VC 1FL6B 2NPLX 3QG6B 2W0FB 3AVEA 1YY8B 2WTRB 5DM6V 4J27A 1P1ZA 2VAJA 3SYQA 3FTXA 5EWIL 4Z76A 3C08H 1UXWA 2DYSC 5GTHZ 4RGOH 3K9AA 4OFYA 3R8QA 2WUCL 1GGTA 3RGVB 4U1MA 4HUVA 5I1LB 3IJHB 2VLME 3CSTA 2X7RB 1FNFA 1JWUA 4WI8A 4ZMYA 3ZT7A 1MLBB 2ED7A 3VXTB 4MTXA 1TZGH 4KQ4L 3P4LA 1GZQA 3MLSL 4N0RA 1T22B 4NQEA 5IBLD 1JZ4A 1DVXA 1FZMA 5DJDB 4BFBD 3QULA 1JJOA 2ZOKB 3MLXH 4AUJA 2IADA 1FFXB 2VH5L 3V4UL 3BD3A 5J1TC 2N04A 2FJGA 5FB8A 1UH4A 4JI1O 2C7UB 2Q86B 5KHJA 1SLXA 2EUWA 1N3NA 5MHSE 5CSBA 2F2HA 5MEND 2RAMA 2AV1A 1AIFA 3P4OB 1T5XA 3GSXB 4P06A 5E2UH 3K6SA 5AVWB 1ZLDA 5CHNB 3QJXA 4J3WA 3DO3A 4BIKA 2YGNA 5SWZA 3V6ZA 3D2UB 3V55A 1BYNA 5DURB 3EO9L 3MV7B 3NIGF 4U6XB 1DVQA 1JPSL 2DMXA 2CLVB 1HL5A 4MNGB 1R6TA 2QZQA 4G1MA 4IDJL 1J1OH 3FN9A 1BIHA 3G6DH 3CX2A 4JVPA 1ZHKB 1RZ7H 2MQ0A 2P6JA 4PRHA 3WKYA 4WNSA 2WB1A 1MXGA 4XO3A 1INDL 4O2EA 4AJ0A 1B0GB 1F4MA 3WB2A 3PNWB 3QZWB 1SYVB 4L5FH 4OIAA 2R29H 3UXFA 4IRSA 3MYJA 4JHWL 3TA3C 3BDBA 3ZW3A 4F2MB 4DR4B 3IU3A 4X6CA 1QX1A 1Q90A 3BAWA 4P57B 1SMAA 3AXLA 4ZMXA 4FNLH 3DVIA 2GEQA 5T1LD 3CFEB 4NKMB 4UILH 3ECWA 4XDLA 1MCCA 4KRPB 3VX1A 4UYPA 3OAYH 1QYGH 4NUGH 2YD5A 4KKRA 1WPCA 4OZGE 3MXWH 5JPMC 3H56A 2FR4A 3FQTB 5D70H 3MGAA 3RRQA 5E1AB 4X5XA 5C0BE 2VQFB 3FUMA 1LE5A 1S78C 4X62B 2J1KA 1T2XA 3L2LA 2W9EL 5HGDA 4G9FA 5I0YA 4P8QA 1TFPA 5EUOE 1FUNA 4OT1L 3EOTL 3GHEH 4S1RH 2N1KA 1ZS8A 4FP8H 4X6BA 1Z5VA 3CFDB 4GKLA 3ESUF 2XNDG 4XVTH 1CD9B 3RIKA 3WN6A 4HFWB 5CLXA 2ITCC 5ENWB 5KYUA 4FX5A 3TN0B 3L9BA 2AQ1A 4L29B 5C0IB 4HQQH 2MW2B 1M9NA 5EIQA 5TDOA 1VPOL 4PGJA 5AW3B 4BZ1A 3M6DA 3MROA 4XZ4A 3D3VD 5IW1B 1WA2X 5KYNA 3O6FA 3QUXA 4XVSH 3EYSH 2ENYA 4Z7QF 5KBKA 2WAMA 1BJMA 2B2XL 3P40A 5EORH 3VXUD 2F58L 3D08A 3RG1C 5TGBA 3GMLA 1D7CA 12E8H 5LNGA 4NQDD 1KJVB 3MBEA 4PJHB 3K08A 4A67A 3Q9QA 4MQXD 2P4KA 1KN4H 3S4SA 2K9PA 3VXMD 1O6TA 2OSLA 3L81A 1RM1B 1CD8A 3BKCL 3WYRA 5FS5A 4JKPH 3HE7A 4M8QB 2BP0A 43CAA 1TJHH 5SV4A 1C8PA 4ABUA 2LV4A 1RP9A 1E3XA 1SNRA 2RQ6A 4X1IB 1J5EB 2DF3A 5IKCA 3L7FA 2AHYA 3RU8H 3HPLA 4M6NH 3E8GA 1ES0A 2WIIB 4WFEA 1W72H 2UYLB 2QMJA 3PXLA 3SDAB 3FK3A 4PJCB 3QRGL 1H2MA 3N5AA 4KXZI 4ZTPL 3FCGA 3SKJL 3HLAA 4G8EA 2WA3A 1O7DE 2W07B 5FKPB 2EDLA 3ZKXC 5CBAB 4G71B 3X3GL 5H35A 4NN5B 4FQCL 2FD6L 3CMOH 4AV4A 4Z7VF 5KSVB 1GRWA 2ZE6A 1IURA 3OHXA 1XEDA 4GSDH 5I8KH 2WNGA 4K8RL 4LOEA 4KXDA 1E43A 1G9ML 2JNZA 5DDHB 1KC5H 3UZQA 3QO5A 3KVPA 5D2LF 2IH3C 3GDCA 3S96B 4Y2DC 2YARA 2DTMH 1V3LA 3ENEA 1MAMH 1NSNL 4GMTL 1C7TA 3L1OL 4KZ0A 1A1NB 1BQSA 4LRNL 1GH7A 5HGGS 1JK8A 1I7TA 1YA5A 5KAFZ 1PZSA 4KTEL 3VWJC 4EBQH 1KIQA 1RZFL 2X88A 1KULA 1EBAA 3QPQC 2OYLA 3RWHA 3T4AB 4DV6B 4WFBV 3K04A 1AQMA 5IG7B 4DGVL 3QWNA 1OAKH 2XOTA 3KYKL 1HEJC 1BM7A 5B1BC 4NC0B 4S1DD 5TJWK 1OD7A 2O26U 1BMWA 1COBA 2A7BA 2WPDG 5E6IA 1SRDA 8CGTA 5CJQH 2NY3C 2JTDA 3B2UD 2IMNA 2JS5A 4N2LA 5BV7C 1N70A 2EABA 1EEQA 1VQ5V 1BQHA 1RFDL 1UXWB 2ZTBA 3QXUA 1WLHA 5KUKA 3EJPA 2P22C 3O9WA 3MLZH 3HZMA 1UWFA 3K71A 4HUVB 4UOQA 3RPKA 1TTUA 4R6ZA 4HPHA 1U3HA 2LVCA 3V0WL 1AD0B 3INUH 2G4EA 5JW4M 3GMOA 4DN4H 2GI7A 3TBWA 4IIZA 4WNJA 1J5IA 1WGVA 1BBDH 4LIQL 2ENPA 5JHLL 1FZMB 3AWFA 2GC7C 2PXYD 3QQDA 3CC4V 5FF6A 3O3DA 4J11A 1FYTD 2FJGB 4YHPB 2BFGA 5CBGA 5FB8B 4LAJH 4Y5XA 5C0GB 3GIVA 4IIQB 4MDIA 3ZDYF 1XGYL 2ICES 2AV1B 1AIFB 3TXSA 1RH8A 2VDRH 3AT9A 5FLXN 4YDKL 5GJTL 4AXWA 5CUSL 5SWZB 1ZLZA 3V6ZB 1ODUA 1RUAL 3I74A 1I75A 3WTVA 4YY3B 1KCLA 5TE4L 1QSEB 2ODHA 3B2EE 4OX9B 1J88A 3MLVH 4Y19B 5JMRA 1JFFA 1DBAL 3VMOA 1ZAUA 3D85D 2D3VA 5KHGA 1FVCA 2CALA 3CVIL 1ZVHA 1TNMA 4N2EA 4PRHB 4Z5RA 4AGLA 2FLRT 3TGXA 3RWRD 2PWFA 1PL4A 3FQWA 3O0LA 4O2EB 2FSDA 3FKSG 1JPFA 2OSWA 3TO4D 5KN5B 1BD2D 3T0BA 3ULUD 1NEZA 2H2SD 3MYJB 2XKNA 3DYMA 4NGHH 5J6SA 4B41A 4DGIH 5DHYA 3ARSA 3C5JA 1WA8A 1HL4A 2ZOLB 4ODWA 5IMMB 1Q43A 3PQYA 1FNAA 4LLMA 3VI4F 1BG1A 1QA9B 4PJ5E 5F0LB 5M94B 5EC2C 4F7EA 3B2DC 4DTGH 1AZBA 4OZIF 5EK0A 1RK0B 4G42A 4MBOA 4NJ9H 4OKVB 1CC3A 4B0MM 2I5YH 4J4PD 3WEOA 1WCBB 2WVTA 3NP4A 2VXSH 4JFFE 3CH1A 5D9SA 3TPKA 3QEHB 1DQVA 2IXQA 3KHQA 5AWNL 4LIQE 1IKFL 3N43F 3TNMA 1LE5B 2JGDA 1QHQA 2BNUA 3M46A 4PJEA 2VLKD 3G08B 2BVYA 4ODXB 4OSUH 3RL1B 2QWRB 1S7VA 4G9FB 2MCPL 1AGBA 1JERA 1FNLA 3HAEG 3JV0A 3T1HO 1VGEH 3DV4A 1FNHA 4WSGA 3ZHDA 3IPFA 2UZIH 1NOFA 2DBJA 1PQZA 4X6BB 3S34L 2E7CA 2DDQL 2ICWI 3ILQD 5EIVA 3JATB 3D18B 5DZ9A 5KYUB 2DQGL 3JYBA 2YAOA 2XNAA 5EBLC 2DM3A 5CINL 3OAYK 4KK9C 3JV6A 4B60A 5L6YH 3FB7A 1FZOB 1MNNA 3MROB 1TJGH 3PWVA 2R0WL 3O6FB 3QUXB 2DMHA 3AS2A 1SKVA 4TOYH 2KT6A 2NNAA 4JPSA 4IRZH 3GWKC 2BTOA 1AJNA 2CHDA 5DJYB 3TH2T 4AYBA 2HJFC 4HYOA 2C1PA 4ZX5A 5TGBB 3OTOB 4YBQD 1KFAL 5IF0A 4AQ1B 5G4NA 3EDEA 4OFQA 4UM9A 3B6SA 3G9AB 3DKHA 3DJZA 4FEIA 3RWCA 3A6BL 4ZMWA 2Q76B 4PCYA 3SR2C 1I82A 1JNHB 2BP0B 3HE7B 4RAVB 3Q1SL 5EFIA 1TUEB 43CAB 3MACL 4LVNB 4OCWL 1SF9A 2O5ZL 3CSGA 1I08A 3RLSA 5IKCB 3JWDH 1JZGA 1ZTMA 3MLYH 5JQ6H 1E3FA 4W6WB 2BTQA 4MXWH 1XCXA 2MQGA 4H33A 4U3JA 5GW7A 2Q0AA 1H6UA 3HHMA 4G6FB 3F7KA 4TTDD 5IOKA 4FG2A 3P1VA 2R51A 4MX7B 5H35B 5LAXB 3VXOB 3BFQG 3CE1A 5J2UB 3UT5A 5E6RB 4X6CF 4HCIA 3OHXB 2VR8A 4HJ0D 4P4RA 1AILA 2GVYA 3UZQB 2X41A 5J13C 4BUGA 4PRBA 1KYDA 4WHYG 3FW6A 3I50H 4F9LC 3W82A 4KMLB 1HINH 5CD5D 2FEEI 5EBWA 3CDGB 5IFJB 2EC9T 2APVA 3UTSA 2HKHL 3LIZH 3BT2H 4GIPD 3WTWA 1JK8B 4HA1A 4PRPB 3QPXH 2OL3A 4PI0A 4PJ9C 2FUQA 1SXZA 4BCZA 5J2TA 1GW0A 3OPZL 5LDSA 3ZL1A 1KIQB 2Z7ZA 2VZTA 3EJSA 3RWHB 5IFHH 3ARBC 2BINA 4TQFA 5BRZB 5IR1A 2HEPA 3GIZL 2QPUA 1NCWL 5H4YA 3N40P 2IAMB 4ZNCD 3V4VA 2KLRA 1MCEA 4M3JA 3OAAG 2KZBA 5B1AB 4UCTA 3VX0A 4O02L 4UB0L 1R17A 4I5BA 3GKWH 4FJCC 5D72L 2G9HA 3TCTA 1Q8IA 5CIPB 5LNEA 2R2BA 1ASPA 3TVMC 3O9WB 2CDEB 1S7WA 3HZMB 4NZTH 4JFEA 2B5IB 3ULUC 4AGOA 1E28B 1TSRA 1U3HB 3CCJV 1AHMA 2APWA 1SDDB 2Z93A 2AV7B 3GMOB 1KPVA 5KZCD 1GVIA 3SN6N 2LT9A 4RMRA 3CSFA 4FFZH 4V2CB 4X7TB 4Y16D 4EAEA 3H42L 1KCSL 2E9IA 2IPTH 1R3KA 5CJ8A 5AKTA 3D05A 3GBMH 3BEWB 4YSSA 4RCAA 3O3DB 5DQJA 1AO7D 3IJ8A 5FO9A 3QDJA 4RNRA 4LCYA 1QNIA 1FPOA 4J4PC 4R97C 5IWLA 4Y5XB 1TYJA 3GIVB 4HEPA 4PV1C 4ZQKB 2BVPB 4D8PA 3AC0A 3O6LH 3DSQA 2DPKA 2ARJB 4WTZG 1E9QA 1LTXA 1H5BC 2G5UA 3R65A 1EAPB 3JARB 4K3GA 4QRPA 1XSOA 4G6JH 4LKCA 1EPFA 5ECGA 3V4PB 2WNWA 2WAQA 3H9HB 5CMUA 2LTQB 4IYKA 4Q6IC 4UAOC 3RVYA 3IDMB 4MCYA 5H9CA 2UXVA 5KTEL 5B8CA 3DC6A 1T7XA 5I16A 3OXSA 1LD9A 1DQJA 4WLCA 1SOXA 5E8DL 1EMTH 1FVCB 1IGJB 1MVUA 5TE7H 4BK8A 5ISZE 2XDHA 2Z8WC 1JGDA 1GAXA 4NQCA 4RA0C 4UTAH 5JOFB 1DBBL 1KGWA 4HUNB 3WFZA 4L8JA 3L3OC 4ZO9A 5L3BA 3H9ZA 1NC4A 1XGPA 2J1ZA 3CN2A 5F88A 5CA3A 5FM5O 3C5JB 3HN3A 2G2NA 3H9SA 4JO2H 4CS2A 3S5LB 4DR1B 3F58L 1HR0B 4LLMB 1YEHL 4X98A 2YD0A 1GYVA 2BVUA 2H32H 2K6YA 2KHAA 1ITBB 4F7EB 2FYUH 3CVDA 4G42B 3DRQA 4X89A 5I2IA 1OT4A 2HH0H 4UMSA 4WEEA 5D9SB 3SKNA 4BFEA 3FQNA 2EYTA 4GX2A 1IL1A 2W38A 3JD0A 2DWEB 2W95A 2JIXD 4JB9H 1KP2A 2YXMA 5BZWA 5C0BB 4JDVA 4XOEA 1SMDA 4BIUA 3TNMB 4Z8FL 1WN7A 4I9WD 1DN0B 3R19A 1S7VB 2CKBB 5AVYB 1KU9A 5EU4B 1AGBB 3SE3A 4YL4A 1A1MB 3O6KL 4KVCL 2IFFH 2ZKMX 1YEJH 1T4KA 2ITDA 1PQZB 5D1QC 3GXTA 4JDTH 1BL8A 4ZZFA 5DJXA 3T0EA 1QPKA 3VFPA 4URTB 5LYJB 2QR0B 2HUEA 3W0WA 1BF8A 4P5TD 4NBXB 4Z7OB 3TT1H 4HOWA 2XNAB 3STLC 5K9JH 4N1EA 4ADIA 2XN2A 1RUKH 4M62H 3UC0H 5F9WC 4N25A 1X7TA 3HG1D 1MH5B 2WO2B 4QRSB 3FB7B 2XXFA 2VXUL 3CN1A 3JT0A 1LO5A 3QP3A 1U95B 1A7QL 1NUFA 2ADIB 3P11L 2GJJA 1WA0X 1A7PL 4W4OA 5BS0D 1F58L 4U1NA 1ZWIC 5K1PA 4UM9B 1JDDA 3FQXB 1J95A 5F7LB 2GITA 5AG9A 4JFWA 1RK1A 3JV4A 2XWJB 1ZVNA 1BM3L 2F9BT 4IRJB 3UYRH 3ZXAC 3VCLA 1OAQL 5DHDA 5JNYB 4TNVK 2G2RA 5I23A 1OALA 4HJEA 3DXRB 2XQBL 5EDXA 4XNZB 4YPGA 5F9AC 4L4TE 4W9CC 4N20A 4ZUTB 5E9DD 4Z3EA 1NINA 2UXNA 4DXWA 5FGCB 4LFHG 1MFDH 2ATPA 3FQ2A 5AVSB 1CGTA 1MIMH 1YQVH 4PS4L 3DIDA 2OM5A 1RUML 1A1OB 1QWHA 1ZA3A 2NSQA 3UT5B 3BH9A 3V9FA 3EH2A 4B53A 1QKZL 4U7MA 1KC8W 2Z1KA 4KKCC 1DJWA 3OEEG 2CDGA 3JWOH 3KLQA 5GS0C 2QGDA 3MZGB 2OIGA 3UTPE 2VQEB 5HHPA 4DR6O 4LGPB 3DSFH 5I1CL 1NGXB 5EBWB 4Y16C 4PJEF 2VLJE 4OLYH 5T3XH 1D9KA 1P84F 1V54B 3F65A 2OMYA 4JANB 1NJIW 5A3ID 1Q4NX 3FU3A 2Z65C 3UBHA 4J7ZA 3NCYP 3BQUB 1BVKB 4XCCH 4FYRA 3FONA 4Q9CA 2R15A 3UBXA 2E86A 3CIAA 2RB8A 4HIEB 1HXYB 4I4TB 2EBOA 4Z23A 2EDTA 4JPVL 4YDLC 3ALPA 1HEZB 5LGJB 2VDOL 4WI9A 3SGDH 4FKKA 1OAXL 3CC5A 4OFPA 4POZD 4KJYA 2EH7H 1LP9A 5J6GA 3ULSB 4I5BB 4WCEV 1DZ0A 5SWSA 4AT6A 1S7RA 2G9HB 3T6XA 1IBBA 4DGYH 2B1GA 4YO0A 5DVMA 3RYCA 1Q5OA 2R2BB 5D7JA 2K78A 4WAFA 3CS5A 3MA9L 4NWUH 4FNSA 2D7TH 2NR6D 4X9GA 2BNQD 3PF2A 1CF8L 2R29A 4XN1A 4E9WA 4BDVA 4OU3A 2ERJB 2P5OA 3CDCA 1VLXA 4NQXB 3QGVA 3D3QA 1A6TA 2VN6A 4RQQB 1NPJA 2RD0A 1SVZA 4QPKA 1KOAA 1ZVSB 2I9TA 5AB1A 2N3JA 1YJDH 3KR3L 5EO9A 2C9AA 1RSFA 4FERA 3NCMA 3K5NA 4TPRL 3QDJB 4E41A 5G4MA 4AIEA 1G7MB 1WEJL 1CZ8H 1MW3A 3KM1A 5JW3H 2I27N 4XOCA 2WBJC 4D8PB 1UACL 2JXMA 2R9HC 2CCVA 5FYLD 2MOVA 2CIKA 4PCSA 1IM3A 5C0ND 3DYPA 3L4YA 1GGBH 2XTSA 4LKCB 4QRPB 3WFBL 4QRRE 3ZYIA 2XV2A 4J3VA 4QT5A 3HCVB 5KJRH 3VI3A 5LGHL 2V7HB 1M9WA 1ILSA 4P9HH 5L3FA 5I16B 5I75B 3OXSB 1LD9B 1DQJB 1XH2A 1R0AL 1HZKA 4MNQA 2YMXL 4H25B 5FFGA 2UWEE 2OK0L 1QEWB 1JGDB 4RRPG 3K2MC 2XU9A 2MMXA 3QCVH 4KY2A 4NQCB 3Q6GL 1Q3EA 4ERSH 5GISL 3UOAB 4AGNA 4MB4A 5L4MA 1HYSC 3FH7A 5CR1A 4ZMVA 4AQAB 2R4SL 3B9KD 2UX7A 5FM5M 4L9DA 5GRUL 2YR3A 1HE8A 2AJ3A 5F88B 3HN8A 3D39A 3BAKA 2YIDA 1MDAA 1FWXA 1TEGA 3H9SB 2NLJC 5K9KA 5HYSB 2WK2A 4GRLD 2JJVA 2OMVA 3OGCC 4L8SA 4X98B 2OTLV 1AE6H 1QATA 1S5HB 3A6OA 3CMAV 4NR1A 3GINA 4H8WL 4PJ5B 4X9FA 5IP4A 2QWNB 5I2IB 2WWOA 1FPTH 5IEKB 1HWYA 2QKIA 3DJSA 1FFOA 3KXFD 5CS7A 2PO6C 3C2AL 5AOIA 3U46A 4MAYA 1KLGA 4U1LA 2CTRA 1IX2A 4KU1A 3V52L 2XA3A 1DP0A 5IFAH 5H37G 1LO4H 4PW4A 2FZ3A 3GUFA 3HFFA 2HG5A 4GRWF 5KBLA 3QIUA 3WGVB 3HZVA 1GIGL 4RMVA 2PTVA 2DWTA 3MJ7B 3QUGA 3RDTB 4PG9A 3WNJA 3KPPB 4ZXBA 2YKLH 3LQZA 1T4KB 2ITDB 3SQOL 5HVFB 1CLYL 3P3NA 1A6VH 1ROCA 1W72A 2BJMH 2XZAH 3GSOB 4ZS7L 1SQVH 1I8LA 1YRKA 4QJ5B 2PYEE 3W0WB 5LDUA 1T04B 5DRNB 3O8XA 4UINL 1MCPH 2JJTC 3CQPA 5E9NA 3VQXA 5EOQH 1X4YA 1K5QA 1NGYB 4RX4D 1HEHC 1FSKB 1ADWA 3D9AL 1LO0L 1JJ2U 4JRXE 1PNLA 2FX7H 2CRMA 4B9PA 4PDMA 6FABL 3NSXA 1LO5B 5BMFH 1FGNL 3ULUL 3C2SA 1FORL 1RJLA 1D6VL 2H1LM 2WO3B 1LR1A 4IHJB 1LNQA 2V9UA 2VB5A 1QWNA 4TVPH 2OMTA 1U6AH 3U82B 3U4AA 2V5SA 4F1SA 2DBLL 3CC1A 3JVGC 4U1NB 4X6DA 4GMSH 1RQ5A 3F5WC 5IT2H 1BZ9A 4OH2A 4PBVC 2L6LA 2X6CA 1ESOA 2V2XB 2GITB 1WF5A 3LH8A 1HKFA 4ZI7A 2J1XA 3EHBD 4FHBD 1KFGA 2OSXA 2QVMA 1OP3H 1EIBA 4GSXA 1NL0L 4KAQL 3O4OB 3VCLB 1ZHBA 2G2RB 1NKGA 4E0RA 2J72A 1NLDL 1BE3H 1VADA 2ZPKH 3B77A 1JZDC 1NGQH 4G8FB 3I6LE 4IS6A 4M03A 4YN3A 3HC3H 3TGUH 4HPOH 3SPVA 3UO1H 4I4WB 3T4YA 3K2IA 1UWYA 3T1FA 3CZNA 4O58H 4OM0L 1BQLL 1I7UA 2H5UA 5F8RC 2LQRA 1X5GA 3BH9B 5JHDA 2FO1A 2BOCB 2EIZB 4C83A 4FI6A 1PSKH 1WIOA 2CDGB 4PWHA 2X9XA 1ACCA 1YLBB 3BVUA 4PJ8A 4DUYB 1CUOA 1JUFA 1J0IA 1QW9A 2IGFH 4KMTH 5AKRA 4ABVA 5AW2B 3JD1A 3PWUA 5T1KA 5IQ7L 3NSDA 1N8ZB 1I53A 3FPYA 1FE8L 1QHPA 3K81A 5CBFA 5ABDE 2WXKA 1TZIA 2N05A 2GJ6E 2OMYB 3IM1A 4W9ZA 4PJXE 4OY9A 1CXZB 1OCWH 3LOWA 1WGOA 2WXGA 4GP5B 3WUZA 4M02A 3FONB 4URKA 4K5OA 1WAAE 3BLPX 3LEVL 1R6VA 2VC2H 2X6UA 2V7QG 4HAGA 5C0NC 1J18A 1AXTH 3WFEL 3VFNA 2A83B 1NCAL 2WLIA 4MA7L 5EYPA 1Y1DA 4H13B 5K1JA 3CC5B 5IQ9A 1IXMA 4QRQB 3RTQA 1OCOC 1XWVA 3CLEL 5ID1A 2H8PC 5SWSB 5I6NA 1S7RB 2IDSA 3FL7A 2VXTL 3JWNG 3L5HA 4YO0B 3N44B 1XUQA 3ARDC 5MI0C 4FLZA 2Y4TA 5GIRA 4FKEA 5I8EA 1OCRC 5I71B 1IRAY 1U58A 2Q67A 4G7SB 3GFUA 3P0VL 5IB1A 4LL9A 2LW1A 1H3UA 3C90A 2HFFA 1T66C 1P53A 4U0QB 2IJHA 1A6TB 4MLIA 4YFDB 4MS8D 3PDOB 5TPWL 1N6UA 5I18H 2AJYL 1IM9D 2I9TB 1AYOA 4UTBL 3I9PA 1BVNT 3S6CA 5EO9B 4ONFH 4F37K 2A38A 4DQOH 4E41B 2QQLL 2B1AH 3VXPA 1SJEA 1YJ9V 4FHKA 3ABTA 2CIKB 2D0FA 3ABKB 4MBRA 2HKFH 4LQFL 2AZ0A 1SFHA 1JGUL 3CCRV 1TVKA 1Q9WA 4LCUA 4QT5B 4ABQA 1NANI 4LKXB 4AVIA 3VI3B 4JRYD 1E6OL 1KBPA 4H44C 1YEIL 2P8PB 3HE6C 5HHXH 4NXMB 3MAQA 1KCKA 4XWOC 4RA3A 2QV4A 2Y07H 4BFOA 1EDYA 5IW6A 1ID2A 2HX8A 1MN4A 2X4OA 4XP1H 4YNYA 1OAZH 2CH7A 3V0EA 2A6KB 1N68A 5CA1A 4QCIA 5H6RA 3QEQD 1TJMA 3FN3A 4XC3H 1NEUA 3X1EA 3HUJA 5IYDO 1E67A 1FDLL 1JMXA 4GAGH 1OQXA 4PLKD 5D1QE 5GS0L 4OJAA 2Y3NA 4QXUH 4X6EA 3JUZA 3WY4A 1E5CA 1UFIA 4X50A 4PJDB 2EIJB 2OCJA 4IRZA 4KTDH 4UV7H 3RNKA 4TXVB 1AR1D 2RCSL 2OP4L 5FR3A 1GZHC 1CU4L 3UIYA 3NFNA 2GIMA 4ZI8A 4UZSA 4MAYB 4U1LB 1Z9LA 1OKEA 1LP9F 2F8VA 5DZPA 1Y18B 3RPBA 1PD3A 4NHUA 3DX6B 4B3TO 2FZ3B 5HPMA 4NKIL 5JCOC 2WUCH 3QIBA 4WSKA 4GKNA 1G7QB 3OW2U 3QIUB 1L7IL 1QUNA 1GN2A 2CHXA 4JHUA 2OI9C 1IGTA 4ZXBB 2A9CA 2IDUA 3ALWA 2DMBA 2EDJA 3RWGB 5KG9B 3RYFA 4HZLA 4KQ4H 3QORA 4ELME 3HBGA 2ZUQC 1UA7A 3QYCA 3K2UL 3O8XB 4PS7A 1Q81W 1JHLL 2VH5H 5I6PA 4F7KA 3CJHB 2K3HA 4AGQA 3GZOA 4IIJA 1R24A 2J55A 3ZMEA 4KRMB 1F00I 4HJUA 3G9VA 5E2VL 1RJLB 2HJLB 5I6OA 3K80A 1W0WA 1HXMB 3CPLA 4U1HA 5F96L 5IJ0A 5CEZL 2EIKC 3KHOA 1KGYE 4Y4HC 2BW5A 4KKPA 4UOZA 1X7QB 4PV8A 4X6DB 2ATKA 4KK6D 2H6UA 2EKSA 3LIZA 3EO9H 3TYGH 4XN8A 1AQKL 1CI3M 2B4CC 4J3XA 1WBXA 4ABMA 4IDJH 1OF2A 2ESVA 4XBGA 3UH8A 2J8UA 4XNUL 2MCAA 3IMRA 1R1BA 2IAND 5LL6Y 5DJCB 4XMZA 5K39A 3ZBMA 4AGPA 4GUNA 4KUZL 1INDH 1J5CA 1MAJA 4E0RB 4I0PA 3APCA 5HJBA 5D4JA 3MX0B 2HWZL 4BSJA 2GFBA 4P4KD 3SPVB 2JCCE 4YR6A 4U2YA 4EDWL 4PMFA 4AV5A 1TQUA 3CEIA 1KV3A 3OB0H 4FEMA 1OAUH 3T1FB 1I7UB 1IBLB 4HGWA 3OC5A 1WAEA 2VRKA 1Y74A 2OQJA 4TSCL 1TJXA 4EKXA 4N2HA 1CDIA 3QF7A 3HVNA 4EPSA 1N0LA 4OVUA 1UD5A 2GSIA 1Q0YH 5C7XL 4LEXL 2J20A 4QOKE 1SEQL 1OP3K 1E2WA 3QWRA 4GUCA 3EYUL 2WXFA 2NRDA 5BV7B 3FTSA 3A22A 1IT9L 4FFZA 4OF5A 2VGLM 5L4JA 4AEFA 1LWRA 4R2GC 3F7RA 4Y8DC 1TZIB 2DLGA 5DD0L 3EOTH 2APSA 4KXZH 1VF7A 3WFDL 5IEHB 1Y76A 2OXHA 4UYQA 5AOJA 3ESNA 1A22B 4JL1A 2E76B 3FQRA 1A2YA 4N1HB 1WS7A 2VDRB 1JP5A 2AXHA 2QVFB 4IU3A 5JDSB 4RETB 5ACLA 3G71V 4JRLA 3AU1B 4AY0A 4F7CA 3VFNB 2DQJL 1SN2A 2G9KA 3ARQA 3NYKA 5A2CA 2J71A 2YD3A 1DBMH 1DO5A 2Q0OC 5EYPB 4LF9O 1HOEA 4M5TA 4NO0B 2DWDC 4YE0A 5HHOD 1VP7A 4B5ZA 5IQ9B 3BWAA 3RTQB 5L2JA 3ARFC 3QPKA 2WCPA 2FEDC 4HJ1A 2DWYA 3Q2VA 3FO1B 2B2XH 3WEXA 2F58H 1E4WL 2VRAA 1PJWA 5GIRB 4OLEA 4UTAA 4WWID 3KYNA 3TPUB 4JJ5A 5HHMB 5IVXF 4H0GA 4FXKB 2EZOA 1V3JA 3BKCH 2CK0L 5KSUB 2EX3A 2ZIDA 3PHQB 4RQEA 2ZDIA 2FBJL 1MAKA 3TJPA 1IEBA 4I18C 2EO9A 4WBNA 5GGVH 3STZC 1VIBA 1JYWA 1SXAA 2H32A 1MQKL 1EZVY 2XV6B 3B2MA 4YHYC 3NEXA 1KENH 2BMKA 2UXXA 1CICC 4UM8B 4CBPA 3D25A 1XMWA 1ECYA 2JFCA 3QRGH 4MMXA 4ZTPH 2AI0H 4UB8Z 3EGSA 1PL3A 4JI3B 1OSYA 4Y4KB 5GZND 3OKMA 3X3GH 3NZ8A 4FQCH 2FD6H 4H8PA 2FT8A 3H3BC 1PZBA 1JFQL 1Q9WB 4LCUB 4QGTA 1OPGL 4JDEB 4QRRB 3TYFA 3HS0C 4M56A 1EGJH 2WO4A 2DQUH 1IBGH 1G9MH 1VF5B 3NIFE 2B15A 4TSAL 4YDNA 2DEXX 4M1GL 2XVLA 1YY9D 3HNSL 4AC2A 4BELD 2P46B 4AI7A 4OAWA 1NSNH 3ICXA 2O5XL 4GMTH 4XXCC 4XN5A 1LNUB 2JK5B 3IMSA 2JB6A 3L1OH 4GW1A 3AABA 1HSBB 4PLOB 2CH7B 2A1WL 4O00A 4YNYB 5KVFL 5CA1B 5ICZB 2BSTB 5F93C 1CD1B 4AMKL 2CLRA 4WV1A 5DJZA 3ZUCA 4KTEH 1XGRB 2H0PA 1X4TA 4NFDA 5ESQA 1HILA 2E56A 4TLUA 4KQ3L 1Z3RA 2CQVA 1CDYA 1JOIA 4KMQA 4WUUA 5JIHA 4DGVH 2NUPA 3P0YL 5IMOB 2ADYA 2HFGL 4BUQA 2MKWA 4GUPB 4OB5L 4XCFL 5CGYC 2E5LB 3BLBA 3IAYA 4JBSA 2EVIA 4UFZA 5E5RB 2DLTA 3CFNA 3FYIB 2ZM6O 3HZ3A 3PV7A 4DUWA 5L2KD 4XO4A 2X4UA 2XXMB 3KL3A 1UZGA 1PYWB 1ZANH 3W7SA 1QVFU 4AKQA 1V27A 5HPMB 1EAQA 4IGBC 2GT9A 2ZXCA 4J1UA 4WKZA 2BFVL 4OFYD 4QO1A 3KGTA 1F6AB 2WWWA 4OGAD 3V0WH 1T0PB 2R0ZL 4N28A 1ODAA 3DX1A 2Y1ZA 3QE5A 4P4KC 2BSBA 3LDBB 1CMOA 3IMVA 1J1PH 3KGUA 3T3PF 2JKTM 3RYFB 2K8QA 1G5GA 3EG9A 4OVVA 4UF7C 1JGVH 4J3OH 4H1LH 4MDRA 1GM8A 4AZ8B 2PYEB 3OAWA 4TLTA 5JHLH 3TF7C 1JXFA 2N01B 4WW2B 5DMKA 4HOMA 4NQED 5DXWA 4GPVA 1FO0L 3JAWA 3HB3D 4IIJB 5FM8A 2ETWA 2KKWA 1XGYH 1UM5L 4P23B 2ODIA 4TSFG 2CDFA 2EIMC 2C9QA 2Y0PA 3FB6A 4R5VA 5T1MA 1BJ1H 4YDKH 3CPLB 5CBEA 4RAUA 5IJ0B 2VKXA 1EEYA 3S35H 5J8OA 2LU5A 1AC6A 1RUAH 1K4DC 2ARHA 4PV8B 2ATKB 3HNVL 1KPRA 5FGSA 5E95B 5TE4H 2EXYC 4G80B 2IO5A 1DBAH 1K85A 3VD3A 2UUAB 4LL1A 2ESVB 3VWKB 2XQ0A 2J8UB 1JZ2A 3IDJA 3VD1A 4D7SA 1IKOP 3RB5A 3TNNA 5CM1A 5K39B 1BCCH 4PRAA 1S0VA 3CX5F 1IGIL 3AAZA 3GJEB 3H4FA 4MSWC 4YHHO 2C4FT 1XREA 4X5WB 1A6AB 2Y7SA 1KELH 4GQQA 5E99L 5JZ7C 3K3WA 3HUJF 2WVSA 4DV7O 2BS9A 2Y7LA 2Z4QA 4JK0D 1QBAA 3Q5OA 5AOZA 2UXTA 3ARBB 1MF2H 4FLWA 3I2CL 4XMLL 5CEYA 1BIIB 2ENSA 2V5TA 3B5TA 3W9EA 2LE9A 3KWVA 2DQTH 3A4EA 2MFNA 3BW9B 1WUNT 1W80A 4IJ3C 2GSIB 4R4ND 1T83A 3PWLA 2VMFA 1IKFH 1NAML 2WWMC 1SXSA 3ZKQD 5KAQF 1UVQB 3N2GA 2B39A 3PDGA 2XQYG 4RGND 1BZKA 1NGWA 4RH4A 2MCPH 1LMKA 2XY1A 2B5UA 1S9WB 2CJUL 4M1CC 3HS9A 4LSUL 3ZL4L 4ENEC 4EZMA 3FO2B 4XX5A 3LN4A 2WYTA 2BNRA 3RZCB 2DDQH 5HYJD 4LRIC 5HI3D 1X5IA 4IU3B 2DQGH 3GF8A 5FHAH 4WK0B 1KYOK 5CINH 1RZ8A 1SYSA 2CGRL 3WENA 1AYRA 5CSGA 1NCGA 5IHUL 1PZUB 2ZD9A 4EI5B 3RWFA 4OF8A 4R97B 1YNKL 2I7SA 5I1KH 3BWAB 2R0WH 2BHZA 5L2JB 2V2WB 3JALA 1DQDH 9CGTA 5BO1H 4LF8O 1SY6L 1I8AA 1TG8A 2JRIA 3EJYD 3WFCL 2JKSA 1EDHA 3QSKB 5EBMC 2P5WE 4P49A 1KFAH 1QBML 4ZMOA 3Q2CA 4BA0A 3AG3B 1XR9B 3MBED 4JJ5B 2W65B 3KYOA 1YAZA 3GMRA 4UIKL 5EN2B 1N10A 4LVNC 3PIQB 5B3JE 2ZX5A 4AYFA 1AQDA 4KJWC 3Q1SH 1EZUA 1K8AW 5JHAA 1BPVA 3AREA 1R33A 3MACH 5DRXB 4OCWH 4JQVA 2O5ZH 5KSBA 1X5FA 2H32B 3CXHJ 4WU5A 2J44A 4P5KA 4APXA 4XO5A 3L3OB 5JW5A 4TNGA 4EEQA 3TO2A 5IUCA 3MCLL 2OCHA 3D25B 3KH4A 3MRPA 3FFDB 3WLBB 5BZZA 1AANA 2NR5A 5AZUA 3TH4T 4BGDA 2B4CL 4Z3TA 1UA6L 3OKMB 4GW4A 1IE5A 3WJMB 4K7FA 2TSBA 4OQ1A 1RD6A 4CMHC 2CRIA 1CPYA 1I3GL 4N1CA 2AKRB 4K3HA 3LZLA 4ICWA 1HHKA 4JKKA 3QDME 4N5EC 4BFJA 3S3JA 2XJLA 3B34A 1XCQB 3P3SA 4XVJL 2DAVA 5EO0B 3NAAL 4JI0O 1ZLEA 2ICEC 5J11B 4OAWB 4XNQA 2QFRA 4GW1B 1NOLA 1IEAB 2H2PC 1DCLA 5E4EB 1U93A 1OGTA 4PPTA 2AMGA 5K5YA 1NTMH 3WE6B 5FPIA 4YBHA 2CLRB 5F0MB 3I55V 3GQFA 3GRBA 5IGXL 4CBCA 1OK0A 1JIBA 3ABGA 2EYRB 3NA4A 2ZX8A 3OPZH 1HILB 4OZ4A 1U8QA 3BUPA 5D1QB 5DJ0A 4UUJA 5DRZA 5CLWA 4ZYKB 3RBZA 2NUPB 4I48A 2VSKB 5GGUA 3VSQA 3QUML 4Q52A 3D8CA 3GIZH 3NFPB 1HQRA 1GGIL 1NCWH 1TETH 1ZA6A 4LPWA 4X4XB 1IGML 4PJAE 3V4LA 2QSAA 1CBVH 1UWEL 1QTYT 5DMJB 2V6HA 1TTAA 3Q5YA 3IGAA 4AQEA 4IMKC 2L7QA 1URIA 2EJ1A 4O02H 3CUPB 5D2NA 1KXQA 4N90D 5BXFA 5E6ID 2X4UB 3DURA 1UJ3C 1Z1WA 3CXFA 1XF5A 5FA3A 5L8KB 1G6RL 1WZLA 5EN3A 2GT9B 3E6HA 4WKZB 3ILPA 3SSGA 4IU2B 5FW6A 4JPIB 2DTSA 4JI2O 3IJSA 4MRBA 1E27A 5B4MD 1U8IB 1V9PA 2P49B 2UUBO 4XODA 3EG9B 5KUMA 3KPOA 4JM2A 2UXGA 1EDQA 3H42H 3HG4A 4LCCB 4YBLC 1KCSH 4PDLA 1HWGB 1TU2A 2WTPA 1N5YL 2EDEA 3ELQA 1D2DA 4TV3A 1P69B 5DMKB 5DCCA 4CC4C 2ZT9B 1M7UA 3QIWC 4FLOA 3JAWB 3BUYA 3IRZA 1EK3A 4DR5B 3KWUA 1JYXA 2MCG1 2NN4A 1AHKA 2NDFA 4XB3A 3GJFH 2YGVA 4HU8A 1W8EA 5LJYH 1EEYB 4PG2C 3OD3A 2ZUSA 4CRPA 1I31A 1IAIM 1IAIL 2CE6A 3PY9A 3NJLA 2F74B 4KBPA 4ODVL 1CXHA 4JO4L 2VDQL 5J12B 2AEPL 5E8DH 1AVMA 1THAA 4DH2A 4ICGA 1CCZA 4U0RC 3OKEB 2GEEA 1DDHA 3Q6FA 5ANME 3CFCL 2VUOA 3TLRA 1ZLSL 2EVFA 1S5LZ 5T5FL 1NCUA 1AHWC 2EYSA 2FLMA 4Y9CA 1XNQB 1R19A 2JCCB 4RMWA 4OZFH 2WBKA 4L1LA 3L72H 1YEDA 5DK2A 4AQ8C 3LZFH 2WZ5A 2ZQMA 2PYFA 3HR6A 4Z0XA 5KMGA 3B1UA 1RZIB 4D8OA 4MXVE 3PQYD 1PVHA 3W9EB 2H9GA 2Z8SA 2V3EA 5L4FA 2DM7A 4G8IA 3BQVA 1PEWA 4R7DA 3W9DA 1DHKA 4GXUM 1QR1B 2D2OA 1NGZA 4Y7MA 4OM1H 4IK6A 5CSZA 3P9LB 2ZXBA 3A4FA 4JHAL 4Z8FH 4YSCA 3N2GB 4OCNC 2WXPA 4NKDA 1NGWB 3DTUB 2YBRA 3EFOA 3O6KH 5FYKD 3RWDB 1QFWM 4HALA 1QFWL 3FAWA 3TJHD 4WFHE 4HUWA 5L7XL 1IAII 4B7EA 4RFNB 3ZE0F 1E5ZA 2YQ2A 3DX7A 3OB8A 1FZKB 2BNRB 3C8DA 2G0KA 2PMZA 3CFBB 4GQ9L 2MOQA 1FJGO 1ZT7A 1DQML 2V4LA 4L9LC 4XAKD 4CU6A 2X89A 2E4FA 2WNXA 5D1XC 2QWOB 1SYSB 2CUIA 3OT7A 4BJLA 2NY4C 2VXUH 1VF6A 2XG4A 4R90L 5B3SC 3JTTA 1B4JL 1A6UH 2BIQA 3JALB 1HDJA 2XPZA 4PJ7A 3T0WA 5A2QN 1J8KA 1J87A 1A7QH 3D4ZA 4OLZH 5JJJB 2P24A 3P11H 4LHQB 5KS9A 1KJMA 2Q5ZA 1A7PH 3F00A 3PL6B 1CFSB 1F58H 1QLFA 1WC7B 3IGLA 3H1KH 3LY6A 3VA2C 3BYTA 1AB3A 3KYOB 1M3IA 3GMRB 1RI8A 3VFVA 3HA0A 3LHPH 4DJMA 4DOHE 3BSHA 1LK3L 1G1XB 1NPNA 4KKBD 4KZDL 1BM3H 2G0LA 3S3DB 1XF2A 5EZLB 3DUHA 2B1IA 3ZK0A 1F1GA 4CSSA 3VFGL 5KSBB 3MA7B 3JYCA 4KTYA 1JDCA 4JREC 3MV9E 4LPUA 4WU5B 3QDGA 4P5KB 2IOIA 1SDYA 2LLGA 4KGLA 3L6FA 5JW5B 1QFWI 2DJMA 3VSVA 3MRPB 2R9AA 1NBVL 4PS4H 4F37F 3K0DA 3RWIA 1RUMH 3RVTC 1XEUA 3C60B 3DPBB 4K7FB 1XCTA 2NYKA 3UAAA 1QKZH 1J48A 2ZWYA 2DKUA 4IOSD 4QTHA 4MVRA 2HLEB 1HHKB 2BHFA 3JSNA 2AJXL 2DW5A 1C12B 4KP4A 4POYA 3P2DA 1AR2A 1RV6X 1AP6A 4UV4L 5I1CH 5I1EL 2PWEA 4LSQL 2LLNA 4XNQB 5AQ0A 4OZGA 5EIBC 3K5MA 1FXKC 4OD2A 5E5MB 4LFAO 4YK4C 2WD0A 4NBYB 3NPZB 5DK0B 5EB9A 3UTSD 3ZR5A 2QDVA 2CAZC 3DGGA 3T6VA 4I3GA 4C59B 5CLZA 5FO2A 1B90A 4UUJB 4D0CB 3REWA 1X4ZA 5GGUB 4I48B 3IFLL 1J86A 5F7YC 1SVCP 5KHIA 1NCHA 2XVGA 4EJ1C 1HQRB 3GVMA 1ZA6B 4YJ2A 2BWQA 3H7BA 4L05A 1MWOA 1JN6A 1S7TA 4JPVH 4GFXA 2N7BA 4X7DC 3MJWA 3D52A 1OAXH 4LLVB 4X6FB 3SCMD 5KSAC 1IBKB 1SBSH 2RMKB 3ZRVA 1NMAL 2YLKA 5D2NB 4HJSA 3DURB 2F53D 4PV9A 2N59A 2L7JA 4PGBB 1OGAA 2YAEA 1UKSA 4AHCA 4UV8A 5I1HL 2KL6A 4IEFA 2NY2D 3ILPB 3GBEA 5KVEH 3RX7A 5CO1A 3IJSB 4NZUL 1DF4A 3JWNC 4X80H 4JUSA 4P0DA 4BGLA 4W4NA 1VQ4V 3KPOB 2YQGA 2XRAL 4HYTB 4JM2B 4A55A 2E7HA 2NYYC 4HHAA 3H1ZA 3TJTA 1J1XL 3IXAA 3K74B 3QUYC 1T80A 4GKKO 3RL2A 3KR3H 4JFDB 4TPRH 5KW9H 4RISH 2LFRA 5C0CA 1WEJH 2GTWB 4FZEL 3WHE1 2QTOA 2UU9O 4N0UB 2F1EA 3VXRA 2ITEA 3E3QC 1UACH 1ORSB 5L8LB 3DXAE 5IBUB 2Y9RT 3UZVA 2Z31C 2R0LH 4FQJL 5LKNA 2LW7A 3TCLA 3KPSA 3WFBH 1DL7L 4J6RL 1ZEAH 1DBJL 4B6ZA 3VD7A 4JN2A 1WFJA 1TZ8A 3RY6A 4HCFA 3ULVC 3R0NA 2YMTA 2DYRC 2YAPA 1EFRG 3P30L 5H2FZ 2HHHO 3O4LE 1NI8A 1PJ9A 3QI9B 5F71A 1G7JB 3DTXA 3WIIL 2QSCL 2YMXH 2QSQA 4WI2A 3AT0A 4R26L 1IC7L 4GB9A 4K55A 1D5MA 4GIAA 2CPCA 1DDHB 3SJVD 1RMFL 1P49A 5DMGC 1J9TA 1J10A 1OO2A 2E74C 5IYBO 2FAUA 3O45A 4HK3J 3MJ8A 5AW4B 3WEAA 2FWSA 2EYSB 4MJ5B 3BC9A 43C9B 5GRUH 4FABL 4FFVC 4IM8A 5C07D 4ES9A 2BY2A 3OF6A 4JYAO 2P5EA 3T77A 2RA1A 4H8WH 1S7XA 5EC1C 4U6YA 4HKBA 4G8IB 1ZE3C 2RJMA 3N2JA 3VH8A 1SOQA 1NGZB 2BCMA 3C2AH 3T6QC 3RVVD 1DR9A 3K4DA 3KPRD 3V52H 1WIPA 4G59C 1MCJA 3UGXA 4EB6A 4YDVB 1OE3A 5CZVL 1HH6B 2FUTA 4BKSC 4TL4A 2GY7B 3S3CB 1E4JA 2BVOA 4BA8A 4P46B 4PI2A 5DTFA 4N6QA 5LHGA 2ZR3A 1VSCA 4XP5L 4TRPL 4P2RE 3CPWU 4RFOL 1V55C 3FQ1A 4ZS7H 3TBBA 4CKQA 5E8OB