3ASOH

Bovine heart cytochrome c oxidase in the fully oxidized state measured at 0.9 angstrom wavelength
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
b'KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Distinguishing between Cl- and O2(2-) as the bridging element between Fe3+ and Cu2+ in resting-oxidized cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 27
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3asoH00
3WG7H 2ZXWH 5IY5H 1OCCH 3AG3H 2DYRH 3AG2H 3ASOH 5B1BH 1V54H 2EIJH 3X2QH 2DYSH 3ABLH 3AG4H 2EIKH 5B3SH 1V55H 2EILH 1OCRH 3ABKH 3ASNH 2EINH 3ABMH 5B1AH 1OCZH 1OCOH 2OCCH 2EIMH 2Y69H 3AG1H
chains in the Genus database with same CATH superfamily
1XPXA 1SD5A 3KLOA 4ZDLA 1J59A 4JQFA 3HC7A 2L3DA 3ROUA 4XLEA 4QSHA 1QPMA 4NC8A 1X4OA 1K61A 1ERDA 3LSIA 3MAJA 3BR1A 3KEQA 2BW3A 2YX4A 3LFUA 4P55A 3B6CA 2X1CA 2R5ZA 2VJIA 3GFMA 1U9OA 1WH5A 3ZCOA 2M4KA 2KIQA 2ZXHA 4HX8A 1HW5A 5C4XJ 3GTLJ 3EUKL 3E6DA 4CYCB 3JCUC 2P8TA 2JPBA 1MJ9A 1I3QJ 3UNGC 3G1LA 4NC7A 4ESBA 3SHFA 4L5IA 2R7XA 2L5QA 4A6DA 3Q0UA 2ISYA 2XGDA 1ACIA 1HQCA 1USTA 1QVUA 2RREA 2P7VB 4XLNF 4HF0A 2DA3A 4A3FJ 4G8XA 3G6EI 1H89C 5CVVA 1JHFA 1XDSA 2XSJC 4L0YB 3GEZA 2K40A 1MNDA 5ICEA 1FYMA 2KISA 2BZTA 3CCVI 1S3JA 2YU3A 2KQRA 3VB2A 1W5SA 4NBQA 4A3CJ 2CSOA 1A6IA 4V2FA 4JBAA 3HRMA 3R61A 1XG1A 1TQPA 2WAFA 1MMSA 2E2IJ 1P2FA 1EH6A 1YQAA 5DTDA 2BEOA 3I4PA 5CQEA 2UUZA 3V8LA 2K9LA 4HRIA 1VNDA 3ZN1A 5K1YA 3PFIA 5FKNA 2CQKA 3I54A 3ECOA 4X0GA 3H1CA 2F4OB 2HYGD 3WTSC 1ZG5A 2DT6A 2VJ4A 3Q9SA 4XLHA 1YJNI 2ZXWH 2ZNZA 3S1RJ 1A04A 4IQ4A 1BI2A 3K1MA 3OS0A 4FQGA 3B02A 1MZBA 1EJ9A 4ZH4F 1LUJB 1Z77A 4GFBA 3WTTC 1FMVA 3ZOBA 2RKHA 3NRVA 3TOBA 3OYMA 3W2VA 3CUQA 5HS8A 1PUFB 3L09A 3O8GA 1O3TA 4J19A 3ESWB 4OIRF 1P92A 2VBYA 3PO3J 1XGSA 2AQEA 4HF1A 1CGPA 1GXPA 3JAMZ 1T0FC 2CO5A 5LGNA 1FT9A 2CWEA 3CLOA 3L9FA 2EQRA 1MD0A 3CTAA 1K6YA 3CMMA 2ZSHB 2PMUA 3E3VA 3GTKJ 2VN2A 4BNCA 3BG3A 1B4AA 2KPMA 2QQ9A 5ICCA 1N77A 2LTPA 4DZPA 3BROA 3FISA 4Y52J 3O8HA 2IP2A 3V7RA 2MH9A 2H8WA 3K0LA 5CJ9A 2M8GX 1J7KA 3OYEA 5E17F 3NWSA 2NOJB 1Y1WJ 2VONA 2L9NA 1I27A 3NARA 3ZQQA 4Y13A 2X51A 3PFYA 2JWTA 3CCQI 1TNTA 4U7BA 2BXYA 2ZMEC 2W57A 4PJNA 1FMWA 2LKSA 3V8JA 3A2KA 2W85A 2ESNA 4NDLA 3HRTA 4EV0A 4HLYA 4WXCA 1ZRDA 1S5LC 5FKOA 3F0CA 2XV4S 4FISA 2G0EA 2RGVA 3MZHA 2I5UA 4G7OF 4YEJA 2KLOA 3FBNB 2VKHA 1N25A 4AC0A 3BC8A 1WGXA 3RPQA 5D4RA 4LG0A 2DQLA 3X2QH 5LRSA 2K85A 3CD6I 3HYIA 3SYTA 2K5CA 3FMSA 1H88C 2H6BA 4AYBN 1BC8C 3F8NA 2ADUA 4HPQA 1BIBA 3QYBA 2CMPA 1ULYA 4XICA 3DWLE 3GFLA 2E5ZA 4FX4A 1RI7A 2QGUA 2H27A 1FIAA 2BXZA 1B8IB 3EUAA 2Z3YA 2O5RA 1U2WA 3LAJA 4BY1J 4RM3A 3FXOA 4ZTFA 2M0CA 1GV5A 5AIQA 3CZ6A 3H36A 1T08B 2CS3A 2K02A 1IJWC 4BHBA 1YW8A 5GAEJ 4BE1A 4P1WA 5F6FA 2WBMA 1WJCA 2HI3A 2OUMA 2B7EA 2CQNA 4DJAA 1IN8A 4IHVA 2EFQA 1SVMA 4YIFA 1ODDA 1XSVA 2A68F 3LSMA 3H5RA 4LIUA 4Y17A 3MMYB 3S1QJ 5CLSA 4ZYGA 2M5WA 3E5QA 2P6SA 1MSFC 2HEOA 1FBSA 1ZTRA 3KYDB 4B4CA 2LBFA 2EA2A 2O03A 2DDBA 1LVKA 1JKPC 2VKVA 3BR2A 3CC7I 1IDZA 4EMSA 1EH8A 3BDDA 1T2KA 3LOCA 4U0VA 4IHTA 4C2UA 2DFIA 1R4NB 4AUXA 4BGDA 1XGOA 5TJJA 3NWTA 4ETSA 4BEHB 2KDOA 2CU7A 5CPRB 2DTRA 3DPLC 5DCFA 1Y0NA 4XN0A 4FCYA 2IAIA 2GBYA 2O8KA 3FMRA 3K1NA 1ETXA 4UUSB 2D1VA 2IGOA 3JRCA 1S7AA 1T0FA 3R6SA 2BHYA 4OMYA 1VQPI 1XX5A 3P9KA 2X9DA 3QPHA 1RR8C 4E7KA 3L2VA 2XGCA 2DFEA 4XIDA 1KU2A 2EIJH 4YFXF 1Z6TA 2FBHA 1IXRC 3KP4A 5M5WJ 3TDUC 2QF7A 3CDIA 2GIVA 1D0YA 2HXOA 2DMQA 1YX3A 1VZ0A 5CKTA 3RCOA 4KFCA 5HLGA 3OS2A 5J6XA 1JGGA 5JHFA 1O3RA 4ENKA 2R7WA 2HVSA 3CCUI 2FNAA 3PQJA 4UHTA 3OL4A 2D2WA 5DS9A 3CESA 1X2NA 1LFPA 3HSEA 5KNLA 4XLFA 1CF7A 3JRBA 2L7KA 2H1KA 2ZMEA 5LFAA 3RJPA 2RDPA 5IP7J 2F5EA 5J1UA 3ZN0A 1O3SA 1PP7U 5LEKA 2CUFA 1XDUA 3SEZA 4BHPA 3JAMK 2CG4A 3ASNH 1Y1VJ 4V2GA 2HQ5A 2Y30A 4IKFA 2H6CA 2L4MA 3VSKA 3DTKA 5EEAA 4EATA 4RA2A 5D8KB 2QKLB 1Y56A 2ZFWA 4KMFA 2XPVA 1D0ZA 1R1VA 5LEJA 4KT6A 1TWCJ 5F0HA 4NQWA 4CCJA 1FOXA 1LPQA 1ON2A 2ELHA 1MBGA 3D5LA 5JLXA 3DLLF 2LF8A 2HQAA 3BOQA 3S3OA 2A6EF 2XKPA 2UV1A 1BOBA 5B3SH 3S1NJ 1FYLA 4UUVA 3BR5A 3F21A 3RZDJ 3TL4X 3F8CA 1X3WB 4XBFA 2VI6A 3DF8A 2M9HA 2A05A 4NUBA 1SC7A 3I5UA 1IRXA 4XSXF 3BY6A 1WSUA 1MJBA 5BS6A 2EK5A 2VIXA 5FB2A 1R1TA 4CCOA 1HCRA 3OOPA 1HW1A 2E7WA 2XHKA 4PGHA 4Q4ZF 1W1WE 4BE0A 2LF7A 4II2A 2Z5UA 3QOEA 4RAGA 4M3BA 5EYRA 5IP6A 5EGOB 4FTHA 3CCRI 3MEXA 1I1SA 2BYVE 4BXUA 3FMQA 4QWQA 3SZPA 5LHIA 5FLXZ 1Z21A 4MFEA 4A93J 3FXLA 4HSRA 5B1AH 2IS1A 3M8FA 2ZJPF 2WB1N 4EJTA 4BQAA 4MIMA 3BLYA 2VODA 3K2AA 2YPRA 2FMYA 3F72A 2K86A 4CUGA 2EV6A 2IA2A 1WH7A 4F92B 1J9IA 2Z1DA 2OC6A 2HWVA 2VKEA 1GVDA 1Y39A 5FKKA 1IF1A 1PVEA 4FX0A 3T0YA 4QPQA 3ABKH 2HOSA 3PJRA 2L2OA 2RV8A 2RAEA 1X1PA 2XAGA 3VYTB 1YRNA 4EM0B 3BR0A 4QLCU 4LITA 4CA0A 1VTNC 2GA1A 3OYDA 1RIOH 4AYBA 1C0WA 4IPAA 3HJEA 9ANTA 1RESA 1XTAA 1ZKGA 3WGGA 1FSHA 5IY5H 3OSFA 2GOXB 1E17A 5F08A 5KVRA 1G4DA 1KQ9A 1RPWA 1XMKA 2Y0MA 2COMA 2XAFA 2CV1A 4S05A 3FIWA 2MLGA 3MZ8A 2O7OA 2ZJ2A 1VQ7I 5LRRA 3R0JA 2HQNA 3FWEA 1WWXA 3RKXA 1V3FA 3GTPJ 4M9ZA 2HU9A 2R7RA 2PN6A 2CFXA 2O0YA 2QQBA 3MN2A 2V6CA 1UHWA 2GLOA 4PZJA 2X1EA 2NXNB 3CCMI 1BJZA 4HNVA 1UCRA 4HA8A 3F8BA 4CYDA 4KICA 4C3IJ 5EZGA 2VT3A 3MKWB 2IVMA 1SAXA 4MTDA 2DJNA 4HV6A 3VEPA 2XF5A 3KPHA 3OR1C 3HM5A 1A5JA 1YW7A 3QYEA 4HX7A 4XRSG 4PJLA 1IUFA 3CO7C 3QQAA 1N78A 1WKMA 2M3AA 2EZHA 3L7WA 4CH7A 2QEXI 5E1XA 1ZHFA 2VC0A 1X1BA 1SFOJ 4Q48A 1G3SA 4E7ZA 4RBOA 4JX6A 2QUFA 3FXUA 2K9NA 5IT3A 3PUFA 3LSRA 3C1DA 4YFKF 1ZRCA 4P9UA 1BR4A 1FOYA 2XSDC 4IOCF 1BW5A 3PL8A 2NS7A 4IJAA 1QNTA 1G8XA 4XONA 1UG2A 5LD2C 3RQIA 3HUGA 2R7FA 2WADA 1X19A 4ZTJA 3NEUA 2DOAA 2Y0SN 3SQNA 2ZXJA 4BACA 5ICGA 4EGZA 2PMHA 2G7HA 2E2JJ 2QENA 2KRCA 3H9GA 2JVGA 2M4GA 5CYVA 3OL3A 3DU5A 4B43A 4ZYHA 1K4SA 1J2XA 2OJED 5J1YA 2RNGA 1J0RA 1FIPA 3FXKA 4HF2A 2P5VA 2M2EA 3SZTA 5BOXA 3ZR8X 4KIBA 1ZLJA 4KJZA 2Z16A 3U1KA 4F52A 3WTXC 2OZUA 3BCAA 3R4KA 2GM4A 2H8RA 1JT0A 3OYAA 3I58A 2V9PA 1QGPA 4MGRA 2EBIA 2E1OA 1XB4A 1LFUP 4K2EA 4CCKA 5DCMA 1SD4A 1MKMA 2QWWA 3OYLA 3HDDA 4MHGA 1MDMA 2ZNYA 2K7LA 3I4MJ 3AFHA 2IS2A 2XDVA 4LD5A 4BDYA 3QRFF 4YRVA 3E5XA 1ON1A 2GA2A 2YS9A 3CQZJ 2ZC2A 2IA0A 2IBDA 2JPCA 3G1MA 1O4XA 3E5UA 5GADJ 3LWFA 4DZJA 1WJAA 2FXAA 2PEXA 3I0TA 3VPRA 5K5RA 5HOOA 4HDVA 4ON0A 4O6JA 5HDKA 3A4CA 1W7PD 4FE7A 5LGUA 2ESHA 2HNHA 5FO5A 2PJRA 1Z1DA 4RAYA 2WAQN 5E20A 5JI6A 3I59A 3WU0A 4XK4A 2CQ7A 3GZNB 3BR6A 1HSJA 1N75A 4E6KG 4BBSJ 2VE9A 1APLC 3J7YJ 5FLXK 4XORA 1IDYA 1MH4A 1TW3A 2MA3A 4BJ6C 1YYVA 3MFKA 1HKTA 2MC4A 3HHGA 1ENHA 1AA7A 4LIVA 3M4OJ 1R7JA 4FT8A 1Z3XA 3FM3A 2GWRA 4X6AJ 2NOGA 3DKXA 4QIWN 4EJVA 3JRDA 3C18A 4ZYDA 3FBIB 4F93B 4HX4A 3ELKA 1JUSA 3DBLB 3A1YA 5BPDA 3DEUA 2EV0A 3EUHC 5F27A 3L2UA 2JA6J 3S14J 2Y2ZA 2CV0A 1D8KA 5KAFC 3VDXA 2XRLA 4GCVA 1K7AA 3MWMA 5DDGA 2F48A 4EGYA 2W00A 3MVPA 4KN4X 3JRIA 3TEDA 1GT0C 1K4TA 1B72B 2DPUA 5FRMA 2QA4I 2G7UA 3I53A 4BJ5C 4P96A 3GUDA 1A6QA 3MKLA 3LL7A 3QP5A 5F1RA 1YITI 3S1MJ 1MBFA 1HKQA 4E7JA 4UXNA 3JREA 5L3FA 2DA7A 3FKJA 2KL4A 4OAYA 3IRRA 3DPTA 4D0PA 2DO7A 2HZTA 3M8EA 4B48A 3CMEI 1TP4A 2GOMA 3U9GA 3JRFA 1B9NA 3AG4H 4XRFA 4L9VA 5AONA 4XMYA 2VJ5A 3GFIA 1QRYA 3MKZA 3F9KA 2OV7A 3WU2C 2R7OA 3CF5F 2HQRA 2KIUA 4L5EA 4RM2A 4BQNA 2V26A 1JTYA 2NVTJ 3GYHX 4KIFA 5CVUA 4I76A 4IQJA 2EIMH 2KP6A 1SD6A 1OCTC 2WY7Q 3LQQA 3J80Z 5GAHJ 2VB6A 2VQCA 2QLZA 3UKGA 3RKWA 3BWGA 2W24A 2K3FA 1RKTA 5C44J 2M1BA 4JP0A 1MBHA 4HSTA 3KLNA 3G1OA 4AIDA 4DYQA 2B9SA 4OIOF 4N4NB 3BTLA 3H9JA 4CCNA 2HDWA 1E3PA 3IP4B 4UV8A 1KZHA 3PQKA 3IL2A 1DDNA 3BQZA 3HRSA 2IA1A 3LSTA 2OU2A 1W7PA 4WCGA 1FWZA 2M8EA 1X4PA 3BCBA 4A5MA 1ETQA 4OWRB 3I9V2 3CCYA 1LJ9A 1DUXC 3CF2A 2W4SA 1RZ4A 2J5PA 1UMQA 2ZJRF 2J5OA 1KU7A 3HTSB 1AOYA 3HOYJ 3IAM2 1Y0UA 4A3JJ 1T98A 5FKMA 2VBZA 1OR7C 2DBBA 1I39A 2QVOA 4ABZA 1OFCX 1ETOA 3MD2A 1UHSA 4RGUA 3JTGA 1E2XA 1F5TA 4DBQA 3DFGA 3N97A 3GMEA 1QZZA 2CW0F 1D8JA 5E18F 1DQUA 1WQ2A 3C2HA 3PSFA 3HPHA 4N9HA 5J8CA 1SFKA 2V4JC 1EKEA 1PDNC 4PDKA 1ZELA 2Y0SA 2AS5F 1DGRM 2OA4A 1BM9A 1X1AA 2K4JA 3O6BB 3RIRA 3ZQGA 3F8MA 2F2EA 1R00A 2VQGA 3CUQB 4BE2A 2DOEA 3MQ0A 3RKQA 2HZDA 2V1DA 3OYCA 1AKHA 4C2TA 1KU3A 1LFBA 2FQ3A 1GVJA 1VQKI 5IPAA 3KP3A 2JMWA 4PJJA 2IEKA 2JRMA 4C3JJ 1F4KA 3HSRA 1IV8A 2VOPA 1ITYA 2B63J 3V42A 3GO5A 2XRNA 4M71A 2LDUA 3HHHA 4P5OA 3KZZA 2Q2EB 3JSPA 5HLHA 3EUHA 1T33A 5FKLA 3JSOA 4R8HA 4DGWB 2L7FP 1OYWA 3DKYA 2IGMA 2EA4A 1LNWA 1D1BA 1MMNA 4I09A 1PUFA 2MGQA 4F3QA 3GLLA 3P9CA 4EVIA 2Q1ZB 2K9MA 4A3MJ 3ONQA 5D5VB 4DQ2A 5J40A 1G3TA 4IF4A 2KFDA 4RLQA 2OCEA 1DP7P 3JTHA 1Z7LA 3LSHA 1SMYF 3T1BA 4WF2A 2XASA 3L2QA 4Q47A 4KDPA 1LB2A 4BXFA 2WAQA 4LG3A 2MH2A 2P6TA 2V1XA 1VQ9I 3K1PA 4B09A 5D5XB 4I01A 2CGPA 1VI0A 3U1DA 3V7CA 1FC3A 3CJQB 2CQQA 2EB7A 1R22A 1TW2A 2QSHX 2NRAC 2R7VA 4KITB 3LSJA 3K4NA 4I7HA 4XKVA 3LSKA 4M9XA 5TRDA 4LG0B 3ISPA 5K5OA 2C6YA 1JE8A 4O3MA 1IRGA 3IAS2 1MGTA 4LB6B 4BHCA 4M6XA 3IKTA 1XMXA 5GPCA 1DGWY 1BBYA 2VBWA 5BNGA 1WRJA 4LLLA 4I99C 5L3DA 2XROA 1QO0D 3OV8A 2WC2A 3SEQA 3ZQCA 2O61A 4EJOA 4HDUA 2A3SA 2QZ8A 2VE8A 3E1SA 3GW2A 4LFUA 3ABTA 4BS9A 4ANJA 2P81A 4XN3A 1YOVB 2BY3A 4NC6A 4C2MJ 5M5YJ 5FFXA 2K3PA 2CJJA 2DXIA 2Z33A 1KYWA 4E7LA 3N4MA 3AG2H 4AU7A 3NAUA 2TCTA 2GXGA 3E6CC 1OR7A 4HQMA 3WTVC 1EH7A 3J7ZI 1X1DA 2I8DA 3Q9VA 4D9JA 2DODA 1ZGJA 3ZRGA 3BZKA 3J80K 1SVLA 4LK0F 2OAZA 2DQRA 2STWA 4W97A 2E7XA 3OYIA 1TTYA 4PJ0C 2Y31A 3TP3A 2OTJI 4B3AA 2LKXA 1B8IA 3FK7A 5F0CA 3HGYA 3IWFA 2LBFB 3ABUA 4WX9A 2R7DA 5D8LB 3CMYA 3IH2A 1Q1VA 2MLKA 3G4SI 1RRJA 1S29A 2DU9A 4IHWA 2BE5F 4A3GJ 1EA3A 4V19K 2V1UA 2CYYA 2VASA 3U21A 3TGNA 2CV2A 5DM6F 4A69C 1LE8B 2CFOA 4HYEA 1BN5A 2HPMA 1O57A 3T8RA 2QM3A 3DTEA 3S3MA 4OMZA 1YW9A 1HOMA 2DA4A 4R1HA 2LY2A 2X4HA 3FF5A 4XM3A 1YHQI 2M30A 5HS9A 2QQ8A 2RC4A 3TQNA 4MEYF 3G3ZA 1K78A 2A5YB 4KNYA 2WV0A 5FJ8J 3M1EA 4H4KC 3H3UA 2P0WA 4MEXF 4UNOA 2KJBA 3KX2A 4IHYA 3EYYA 3H5AA 2UWMA 4U0YA 3A0BC 5DUKA 5CVRA 1FP1D 2LVSA 4XNFA 3S93A 2Z99A 4Q5SF 4XSZF 3G2BA 1TL8A 3ZMSA 2R0QC 1F1ZA 2JA5J 4GGGA 4KUMA 2ELKA 1M1EB 2DPDA 4MLOA 5IYBJ 2WY8Q 2ZFUA 1CF7B 3K4CA 4E4HA 2LP0A 2ACJA 2DYSH 2HYJA 1B1BA 4D5CA 3RTRA 5H6QA 2PFBA 3S2HJ 4DYRA 3IKVA 2PQ8A 2XUBA 1S8NA 3GVAA 3I71A 2XF6A 4OIQF 2I10A 1L0OC 1KGSA 1BA5A 4UVCA 2JUGA 3AL0B 1MW7A 4IEJA 5HDGA 3ZMZA 4C3HJ 4XRMA 4UVBA 1H8AC 3DU6A 5F04A 3CJTB 1IXSB 3KFWX 4YELA 3CCJI 1U8BA 1POGA 2K4BA 2LG4A 2OTLI 5HODA 1T38A 3CC4I 4AM3A 3P5JA 5KHDA 5E3NA 3OY9A 1TZLA 4HQEA 2EFOA 4BQOA 3M07A 2BY1A 3TOAA 2ZKZA 3U2RA 2EFPA 4TV7A 3PIPF 3IV5A 1JT6A 2DT5A 2XAQA 2LOOA 2BOLA 3K4LA 1UJ8A 2GIZA 1U5TC 4NHJA 2LRDA 3CDLA 3BJOA 4YG2F 3A01A 2R7UA 4LK1F 1ETKA 1QZYA 4M9SA 5IYCJ 2DA6A 4N0BA 3KZIC 2JQ7A 2BV6A 1WI3A 3L2RA 4ZYEA 1WI9A 3GLXA 1KU9A 5J3LA 2Q8KA 1JKQC 3ZQLA 1TC3C 1ZG3A 1R5ID 3HTUA 4RGRA 1MIJA 1T56A 1LDKB 2HTSA 2QSGX 1ZGWA 5DD8A 4DOZA 4BYYA 2A69F 3HOVJ 4F91B 2X6WA 1FP2A 3HRUA 4O5VA 2JSPA 5DM7F 3RI4A 2V1NA 2W7NA 4RB2C 3K7AJ 4S0HB 1W0UA 4MFDA 3CCSI 1I6XA 1XCVA 2DK5A 1S6LA 3TDZC 1IO2A 2X85A 2K27A 4UVAA 1WPKA 2N8GA 1X1CA 2ZJQF 1Y6IA 2V7FA 3DPUA 3SDBA 1FY7A 3ASOH 3VODA 3S3NA 2HFHA 3RPUD 1SFUA 1H9TA 2E1MC 4PGGA 3VYRB 2O8XA 5E3OA 3BZCA 2FD5A 3GXOA 4XL9A 4L18B 1YRNB 1LQ1A 5IT9Z 2X6YA 2X6XA 2MD5A 2JN6A 3H0DA 3NQOA 4PFOA 3EPZA 1WZ2A 5D6EA 3BPXA 2TDXA 4ENNA 3CCEI 2HTJA 3WTWC 1L3LA 4G12A 3R60A 2FEZA 4ENMA 2ETHA 3Q5FA 2CH0A 3HOUJ 2EZLA 3H3ZA 3ZQHA 3GTJJ 4IL6C 3ZMDA 2CUEA 1MBKA 1W5TA 5K7ZA 4FHTA 5EG0B 2EV5A 1TBXA 2FA5A 2W82A 2A5WA 3FK6A 2QYOA 4YIIA 5K7FA 4KT5C 2BVLA 4IX7A 2PMZN 4M6VA 4LB5A 2IRFG 3H92A 2RN7A 3BTIA 3N05A 3KYCB 3H35A 4P9FA 2NNYA 1HDDC 2KT0A 4ENJA 2ZO4A 1WJDA 3DBHB 5D4SA 2A07F 1X2MA 3P7NA 3TP0A 3HZJA 2JT1A 1HKSA 3EDPA 3IHUA 3DKWA 1HDPA 1P7IA 2AHQA 4R79A 1WVRA 2E5NA 4KISA 1XGMA 3A02A 1R49A 3ZQIA 2IGKA 1YE9A 2HDCA 2AQFA 2WAEA 5LGTA 5JVTA 2UXNA 1NTCA 2EPFA 1B59A 3MZYA 4IXAA 3W3CA 1VQ8I 2NYXA 2NS8A 4ZZDA 2LYCA 4CZCA 2L54A 4A12A 1FJLA 1I1GA 2R7SA 1TWGJ 3IH4A 1UELB 4BQQA 4I98B 1ETVA 2EIKH 4I2OA 5GTIC 2FUG2 3G73A 3ZMUA 3F23A 4C9YA 4Y15A 5E3MA 4U7DA 3HUGB 1U5TA 3GF2A 4KN7X 3WE2A 4Y3OA 2R5YB 5IP9J 3BTCA 2HKXA 3TMOA 3JW4A 3AG1H 3CMAI 2FQ4A 1RETA 1ZLKA 5H2FC 4MTEA 2NVXJ 1JI8A 1IN6A 3RPUA 3M8JA 4M74A 1U3EM 3B6AA 4L9JA 2DT7B 1Z91A 2KHMA 4B1RA 3PIOF 1LEBA 3W6JB 4PCQA 2PI0A 3TKYA 5C4JJ 2PX9A 1ZREA 1PYVA 3OOUA 1JJ8C 2X0LA 2W1OA 2HOEA 3ABLH 3MCZA 5CVJA 4G6QA 1QQIA 2F5VA 1W36C 1NK3P 2E60A 1YIOA 1LEAA 3L1PA 5EEGA 1FSEA 1T39A 4IZZA 1HA8A 3BG9A 3WGHA 5ILVA 3GTOJ 3I4NJ 3ML6A 2XAJA 2XGXA 2ICWG 1NK2P 2Z9OA 5DCMB 3Q0WA 1Z05A 5HLTA 4LJZF 4A3EJ 1MDMB 5JVGF 4Y33A 4A3LJ 3ZMTA 1R36A 3TW6A 2EFWA 4BXXJ 3K4MA 1F43A 2X1DA 3VSLA 2XAUA 3JR9A 4KYWA 4L0ZB 3CJNA 1TNSA 1VQMI 1LVAA 2L7MP 1W36D 3IRQA 2TRTA 1MNMC 2L7ZA 2Y9YA 2HGCA 3LSGA 3VYSB 5EDNA 1WHUA 2MABA 3CUOA 3FDYA 2FF4A 2MBFA 1HBXG 3FXMA 3I59B 3K4KA 1SFXA 5HDNA 1ZYRF 1SAUA 4OINF 3CO6C 2LK2A 5IOYA 1S72I 1UFMA 1FX7A 1I50J 3QYFA 3SZGA 1Z67A 1U0JA 3WTYC 2FOKA 3I56I 2XVCA 3H3VK 1QHGA 1IG7A 2QQAA 3H9QA 2P7CB 4HAMA 2GZWA 2EILH 4RLFA 5K5QA 4L5JA 2VPRA 5H6RA 2E71A 4LGWA 1RNLA 3VYUB 1YFHA 3ERED 2QCOA 2BVMA 1KQ0A 1IN5A 2HKOA 2V9KA 3H0GJ 3HSFA 1ZR2A 1GDTA 3RYRA 3FKIJ 3WG7H 4A0XA 2D5VA 2OD5A 5GP9A 1OQYA 2IS4A 4GO1A 5E1ZB 4RGXA 1DU6A 5IT9K 2FNPA 3BP8A 2OF7A 1TLHB 2DA1A 5D6FA 5ILUA 3LA3A 5ERIA 3K70C 2RNJA 2ZXIA 1IXCA 1FEXA 2EINH 1IN4A 2NVUB 1LKXA 1Q1HA 2OZ6A 2LY1A 3I55I 1R5GA 2OQGA 4YFNF 2OCCH 3KYLA 4D7MA 4MQVA 3T8TA 2HR3A 3HOWJ 2BY2A 3ECHA 2E1CA 3K69A 2VC1A 5HNFA 3I64A 3E6BA 4M3DA 4PJMA 3EETA 1QPIA 4QTRA 4UY8I 2JA2A 3M7GA 3HKZN 4DBRA 1BI1A 1R23A 4II3A 1OKRA 4F55A 3BR3A 2BW3B 5L3BA 1K6OA 1E3HA 2M45A 2Q0OA 4XOTA 2QBYA 1HF0A 4U88A 5KAIC 1IRFA 2R5ZB 2R3SA 1PUEE 3OIOA 3K70D 3V7SA 3FHZA 1D5YA 2ME6A 2CQXA 4JX5A 4CXFA 4A0ZA 3OR2C 1J09A 3CJRB 2PMZA 5LBQA 5L3CA 3K2ZA 4G94A 4Y7NJ 1A36A 5FGMA 4CICA 2O3FA 1UG0A 2DA2A 3A0HC 1U6GA 5KK1A 2XPUA 3OIPA 1OPCA 2DCEA 4KMUX 4XOPA 2XB5A 4CSWA 2V6EA 3IWZA 4OOIA 1MMAA 3HL2A 4CHUA 2STTA 2DDAA 2R7ZJ 1W7PB 4XLCA 1TWHJ 3C2GA 5EJCA 3S8PA 3F6OA 2HPIA 4D5FA 5F0FA 4CCMA 3W2AA 3TO6A 2E34A 4X1EA 2DLLA 2FSWA 4M3FA 1V5EA 4HNTA 1JUMA 4S04A 2DFFA 2WWYA 3COAC 2H94A 2L9SA 2KIMA 3TO9A 4A6EA 4RB1A 3OS1A 4G6TB 4B3XA 1XSXA 2YX7A 4BUPA 1XN7A 4CYCA 4NNJA 5FLMJ 4WK8F 1VF9A 2ME0A 2KRFA 1GV2A 1SVOA 1MH3A 3HG9A 2XC7A 1I5ZA 4EEFG 1HLVA 1JTXA 4A3IJ 4BBRJ 3FM5A 3PNTA 1WCMJ 2BHZA 1R71A 2NVYJ 2VL8A 1GUUA 1JJ6C 2EZIA 5J47A 3LMMA 2R92J 3ZMVA 4BKXA 3LSPA 2KKOA 1D3YA 1OCOH 2KRHA 3SJMA 3FZVA 1YS7A 1RR7A 4FE4A 1G3YA 2HS5A 2COBA 2DMPA 1USSA 4ZDPA 4RS8A 3KP5A 4GYIA 1MBEA 5B66C 5FLVA 1MJAA 2FBKA 3BT9A 2VT2A 3EQLF 4Z2YA 3B73A 5FFZA 1HXDA 2F6CA 2JZYA 1PP8F 1U9NA 3E0JB 3O2PE 3IH3A 1AKHB 2KMUA 3FXJA 2EWNA 3F8FA 4XR6A 4EQQA 4CCLA 1IW7F 1BOAA 3QAHA 3QPSA 4AD9A 5M5XJ 1VQ5I 4MO7A 1BI3A 2AO9A 2M7BA 1WJEA 2YR2A 4M73A 3LA7A 1R6RA 3HOXJ 3D1NI 3ZQ7A 1I3AA 2DOFA 3OYJA 1SMTA 1TT5B 2D1HA 3E7LA 1E3OC 5DV5A 1VQOI 5IOZA 3BQYA 2DMUA 2L01A 1Z9CA 4JYKA 2VQLA 1V4RA 3FHNA 3J81Z 3DBRB 2W84A 1U78A 3HPGA 4HG2A 5GPAA 3S17J 1FBQA 4CZZA 3KE2A 1WJBA 2QKMB 3L2WA 3EYIA 1CQTA 2PG4A 4G7ZF 3GTMJ 1ONVA 2UZKA 2FOWA 1DPUA 4I6ZA 5E79C 3D5RC 3CLQA 2H09A 2E1NA 3V8KA 5L3GA 5E3LA 1IN7A 1XD7A 2JA8J 5JR3A 3DV8A 3W6KB 5LHGA 1EF4A 4BJTA 2Q2EA 4IOAF 3DTIA 2KZGA 1HC8A 3J7AO 4KA4A 5HVQC 1TQMA 3S15J 3S2DJ 1REPC 1VFCA 1JUPA 2QSFX 1ZRFA 5EZHA 1U8RA 2EH3A 1OCZH 3SXYA 2GXBA 2NNNA 3W6VA 2VOOA 4PSXA 4CO8A 2ELJA 1WJFA 2PJPA 4L9NA 4ASNA 2VXDA 1FOWA 3M1CA 3QWLA 1D1CA 4B47A 3GBGA 2VUMJ 4F7ZA 1H0MA 4E7IA 4CDGA 2CUJA 2Y75A 1GLNA 4PK4A 3ABMH 3F6VA 3RSNA 4LOCA 2YSRA 4H0EA 2E2HJ 3LQRA 4XLPF 1FOKA 1O7FA 2YUSA 1XCBA 1JXSA 3RKYA 3AL0C 1UZCA 2VBXA 3GTQJ 1T6SA 5JLWA 4N4OB 3ZPLA 2HVQA 3ZXSA 1LDJA 4ZC3A 2P5KA 1OCCH 4G7HF 4CGZA 2L9VA 1P7JA 2IT0A 2Z2SB 5LHHA 1XMAA 1QHHD 2L4AA 2M34A 3GWZA 2CRGA 1DU0A 1Z7UA 1QBJA 2Y9ZA 1SANA 3K4BA 2DAOA 3PUBA 2NS0A 3F3XA 1XSDA 3HKZA 3DEWA 1Z3YA 2M7AA 1VQLI 2KDZA 2VJJA 3OYBA 2LR8A 1P9QC 1YLFA 2FU4A 4MQ9F 2GQQA 1B6AA 4HOBA 1D5VA 2DYRH 3A03A 4HZFA 4BAYA 4DNCA 5BPIA 2WA0A 3OIQA 2DFHA 3QPTA 3F22A 3BZ6A 4A2UA 1OCPA 4D1QA 1D0XA 1UB9A 1XGNA 4YIRX 1YI2I 2WV1A 2AXLA 2DN0A 5F64A 2DTZA 2GAUA 1SFEA 4Z6YA 4GDFA 2R7TA 1OJLA 4HLXA 2HVRA 2ZBKA 1X58A 5M3FJ 1UHMA 2IXSA 4DYCA 3WHCA 2LREA 3HBLA 3OYGA 1HSTA 2DK8A 2Y69H 2LD5A 1XS9A 4U87A 1K78B 3S16J 4RAFA 3RQ4A 4C30A 3LA2A 3HGGA 2XPWA 1R5HA 4AVZA 2FBIA 3C7JA 3JRGA 1S9HA 3I3LA 2PBIA 4B44A 1Z0XA 2HOTA 1H9GA 2CUZA 3HOSA 2GXAA 1F9NA 5FRNA 3LFKA 2DJIA 2NAZA 1LE8A 1Z6RA 1WJ5A 4BEHA 4HV5A 1A31A 2XGEA 4EM1A 3FXQA 1W5CC 3BG6A 5E1WA 4ZJZA 5L3EA 2XF7A 3GFJA 2JJ7A 3V4GA 4UUSA 1BIAA 1V5GA 3KEOA 1X3UA 4A0YA 5JFRA 1FNNA 2A6TA 2CW8A 2F5CA 1F36A 3BTJA 3DEEA 4XRSA 3GX4X 1BI0A 5D5WB 5A2QZ 3UR3C 3L00A 3HB9A 4GYGA 1XC5A 3M3YJ 4I0AA 1JHHA 2ZMEB 5DEQA 4J01A 3RDIA 2CW7A 3M9AA 1VQ6I 5FROA 4AWXB 1AHDP 3S32A 4U0WA 4EM2A 3MKYB 1TWAJ 3QU3A 4A3BJ 1ZARA 3HOTA 5ICFA 3G71I 2JA7J 4RB0A 1W4MA 2HOAA 5J4YA 2DMTA 1OMIA 5K7HA 1P4XA 1MMGA 4NQWB 3J81K 1O3QA 1YX5A 3AG3H 2EJRA 3KETA 4ZDOA 1QU3A 5TISC 3HXLA 5F1JA 3PNYA 3CDHA 1IUYA 1OYYA 4IO9F 3WG9A 1P4AA 3PM1A 4EJWA 5IYDJ 3A01B 5LLQA 5FD5A 4PFPA 3AAFA 2ZSIB 4FETA 2IJLA 3VOEA 2VKDA 4GXOA 4J00A 3PNVA 1O7LA 2R4GA 3QU6A 5HLIA 2A61A 1S7EA 5HS7A 1R1UA 1Y8QB 4ESJA 2VPLA 4I0BA 2L02A 4IRIA 3SFIA 3BJ6A 5TGTA 4A3KJ 4BY7J 1KYZA 5ILSA 2Y48A 3BG5A 3LAPA 1J75A 2RVCA 3KP7A 2HDDA 2X48A 2MW8A 3ZP5A 4RDUA 2RQPA 2ZCWA 3DP7A 1OCRH 3KIOA 3OYFA 5DUIA 2EZKA 1RC9A 1RKWA 2FJ1A 1ZN2A 3KCCA 1OYIA 4HEA2 1R4MB 1ETWA 4UB8C 3E97A 1ZR4A 3DCFA 1KONA 4BDZA 3Q3SA 1G2HA 2R7QA 3E6MA 4JK1X 1NH3A 4XQFA 5JHUA 3SDGA 2LY9A 2IGNA 1VQ4I 3OWTA 5FD6A 1V54H 4WXHA 1FBUA 3CCLI 2BY0A 1J5YA 2BGCA 2P4WA 3QOPA 3OSGA 1D1AA 2FRHA 3KP6A 3CC2I 4UV9A 2X6OA 1BR2A 2M87A 5EGOA 2OQRA 1TQIA 1DP3A 4LLNA 1BL0A 3VFZA 1BC7C 5C3EJ 1X3ZB 3QP6A 3ULQB 3K6GA 3KZYA 3OMYA 1YJWI 3S2WA 2ID6A 4OU0A 4G6DA 2OBPA 3DXJF 3BG7A 4NB5A 3KEYA 1MNEA 1UAAA 2ECBA 3CP2A 1SEUA 4Y4RA 1AU7A 4BH9A 3C3WA 4RAZA 2MC3A 1YTYA 4IHXA 2L0KA 3REOA 1ZQ3P 1FTTA 2JRTA 3CP8A 3TBIA 1PJRA 6PAXA 3K4JA 3WODF 2E35A 1FLIA 5J4VA 3WGIA 1ZH5A 5H20A 2OPTA 3C2BA 3RYPA 2H1LA 4OAZA 5BQTA 5BMZA 2LLKA 3H5NA 3DQVC 1MSEC 1P4WA 4LMYA 2R93J 2KZVA 4N9IA 1YG2A 1YS6A 3D0SA 1B9MA 2XAHA 1FZPB 5GTHC 2IS6A 2XKOA 2JSCA 2E36A 1YIJI 1EV7A 5EG0A 2F4IA 5KCMA 4JOMA 2DI3A 2MG4A 1BW6A 1ZAOA 4D7NA 1OISA 2ID3A 3HEFA 4I02A 4IVNA 2G9WA 1IZ1A 1QZEA 1MMDA 2DA5A 1GXQA 5HNHA 4IHSA 4HBLA 3OYKA 2JUCA 3OYHA 3BPVA 1R58A 2LC2A 1OLTA 2K9SA 1G3WA 1U5TB 2MFZA 3SFZA 3WU1B 3OYNA 3ERMA 1FPQA 2ECCA 1ZG1A 1TWFJ 1G59A 1IAWA 1QVTA 1S7OA 4UUTA 4M3EA 4A5NA 3K10A 5A2QK 2UXXA 2LH9A 1K79A 2KIFA 2B0LA 4AIKA 1HW2A 2DMNA 4OIPF 3IUOA 3Q0VA 3J7AY 2VXZA 1TT0A 5J8FA 1G6NA 2FE3A 4FASD 3LNQA 3BJAA 1SD7A 1ZGAA 3VWBA 1ETYA 2VQHA 4M3GA 3T5XA 3KP2A 5J1RA 4WWCA 2V9VA 2RQQA 2R5YA 2F5DA 1ZK8A 2O6GE 1JGSA 2LFBA 4QPOA 2W48A 1T95A 1YJ9I 4RB3C 1VQNI 5M3MJ 3QODA 1FYKA 2JTVA 3TO7A 4E70A 1W0TA 3FXRA 2E19A 4XKWA 1WFXA 4DW6A 3WE3A 5CVIA 3W2WA 3RZOJ 2E1MB 4WXDA 3FX3A 2DW4A 4RMNA 3K9TA 2FMLA 3GTGJ 2XIGA 5E8IA 4AIJA 4B8XA 1ORKA 2AXTC 4E7SA 2YU9J 1RUNA 4HW0A 4PUSA 1STZA 1AWCA 3WTUC 2P5LC 4RGSA 1IGNA 5D5UB 2O9LA 5ED4A 4XLAA 1T8IA 4E7HA 2LNBA 2IW5A 2K9QA 5GAGJ 2PJRB 2NVQJ 2M0MA 2W25A 3JRHA 2VLAA 4GRIA 1K83J 4IRHA 3O3KA 3AKZA 5B1BH 4EJUA 1YO5C 2V79A 3TW7A 1IV6A 3GZ6A 1FTZA 2BBYA 3P9IA 1V5FA 4XKBA 4HNUA 1DPRA 2XB0X 5EF6A 1KQ8A 3HOZJ 5E8GA 1I6HJ 4JX4A 5EEHA 3PSIA 1MBJA 2A6HF 5AIPA 4ZZLA 5CQGA 2PLYA 4ZYAA 1QA6A 2LMDA 3IC7A 1P6RA 5B5EC 3PO2J 4M6YA 1KA8A 2MD0A 1E0EA 1Y8RB 2KJCA 4G9YA 1NG7A 2LKPA 3JRAA 4AVPA 2ZB9A 3CUQC 1V55H 1JKRC 2WTEA 1GHCA 2ISZA 3DLAA 4W1UA 1R9TJ 4A3DJ 2IPQX 2MYSA 3ZQFA 3GZ5A 3ZGKA 4M72A 4LLGF 2FX0A 1NG6A 4IRGA 3HIFA 3WHBA 3R0AA 2WB1A 4KIGA 1BR1A 1NHAA 4L9TA 2JVHA 2MSYA 2F5FA 4MNUA 1BJAA 4XKCA 3WTZA 2D45A 4BL0B 2LSOA 5DYMA 4ESFA 4AIHA 1IC8A 1JKOC 2JK3A 2HXIA 2QBYB 3D5SC 3L2CA 4DIQA 3QPLA 1RUOA 2EFNA 3GCMA 4UB6C 4BU2A 4ITVA 1A35A 1B72A 5DD4A 4PSWA 2L9RA 2F4MB 1LDDA 1IRZA 2HYFA
chains in the Genus database with same CATH topology
3WG7H 2ZXWH 5IY5H 1OCCH 3AG3H 2DYRH 3AG2H 3ASOH 5B1BH 1V54H 2EIJH 3X2QH 2DYSH 3ABLH 3AG4H 2EIKH 5B3SH 1V55H 2EILH 1OCRH 3ABKH 3ASNH 2EINH 3ABMH 5B1AH 1OCZH 1OCOH 2OCCH 2EIMH 2Y69H 3AG1H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WG7 H;  2ZXW H;  5IY5 H;  1OCC H;  3AG3 H;  2DYR H;  3AG2 H;  3ASO H;  5B1B H;  1V54 H;  2EIJ H;  3X2Q H;  2DYS H;  3ABL H;  3AG4 H;  2EIK H;  5B3S H;  1V55 H;  2EIL H;  1OCR H;  3ABK H;  3ASN H;  2EIN H;  3ABM H;  5B1A H;  1OCZ H;  1OCO H;  2OCC H;  2EIM H;  2Y69 H;  3AG1 H; 
#chains in the Genus database with same CATH topology
 1XPX A;  1SD5 A;  3KLO A;  4ZDL A;  1J59 A;  4JQF A;  3HC7 A;  2L3D A;  3ROU A;  4XLE A;  4QSH A;  1QPM A;  4NC8 A;  1X4O A;  1K61 A;  1ERD A;  3LSI A;  3MAJ A;  3BR1 A;  3KEQ A;  2BW3 A;  2YX4 A;  3LFU A;  4P55 A;  3B6C A;  2X1C A;  2R5Z A;  2VJI A;  3GFM A;  1U9O A;  1WH5 A;  3ZCO A;  2M4K A;  2KIQ A;  2ZXH A;  4HX8 A;  1HW5 A;  5C4X J;  3GTL J;  3EUK L;  3E6D A;  4CYC B;  3JCU C;  2P8T A;  2JPB A;  1MJ9 A;  1I3Q J;  3UNG C;  3G1L A;  4NC7 A;  4ESB A;  3SHF A;  4L5I A;  2R7X A;  2L5Q A;  4A6D A;  3Q0U A;  2ISY A;  2XGD A;  1ACI A;  1HQC A;  1UST A;  1QVU A;  2RRE A;  2P7V B;  4XLN F;  4HF0 A;  2DA3 A;  4A3F J;  4G8X A;  3G6E I;  1H89 C;  5CVV A;  1JHF A;  1XDS A;  2XSJ C;  4L0Y B;  3GEZ A;  2K40 A;  1MND A;  5ICE A;  1FYM A;  2KIS A;  2BZT A;  3CCV I;  1S3J A;  2YU3 A;  2KQR A;  3VB2 A;  1W5S A;  4NBQ A;  4A3C J;  2CSO A;  1A6I A;  4V2F A;  4JBA A;  3HRM A;  3R61 A;  1XG1 A;  1TQP A;  2WAF A;  1MMS A;  2E2I J;  1P2F A;  1EH6 A;  1YQA A;  5DTD A;  2BEO A;  3I4P A;  5CQE A;  2UUZ A;  3V8L A;  2K9L A;  4HRI A;  1VND A;  3ZN1 A;  5K1Y A;  3PFI A;  5FKN A;  2CQK A;  3I54 A;  3ECO A;  4X0G A;  3H1C A;  2F4O B;  2HYG D;  3WTS C;  1ZG5 A;  2DT6 A;  2VJ4 A;  3Q9S A;  4XLH A;  1YJN I;  2ZXW H;  2ZNZ A;  3S1R J;  1A04 A;  4IQ4 A;  1BI2 A;  3K1M A;  3OS0 A;  4FQG A;  3B02 A;  1MZB A;  1EJ9 A;  4ZH4 F;  1LUJ B;  1Z77 A;  4GFB A;  3WTT C;  1FMV A;  3ZOB A;  2RKH A;  3NRV A;  3TOB A;  3OYM A;  3W2V A;  3CUQ A;  5HS8 A;  1PUF B;  3L09 A;  3O8G A;  1O3T A;  4J19 A;  3ESW B;  4OIR F;  1P92 A;  2VBY A;  3PO3 J;  1XGS A;  2AQE A;  4HF1 A;  1CGP A;  1GXP A;  3JAM Z;  1T0F C;  2CO5 A;  5LGN A;  1FT9 A;  2CWE A;  3CLO A;  3L9F A;  2EQR A;  1MD0 A;  3CTA A;  1K6Y A;  3CMM A;  2ZSH B;  2PMU A;  3E3V A;  3GTK J;  2VN2 A;  4BNC A;  3BG3 A;  1B4A A;  2KPM A;  2QQ9 A;  5ICC A;  1N77 A;  2LTP A;  4DZP A;  3BRO A;  3FIS A;  4Y52 J;  3O8H A;  2IP2 A;  3V7R A;  2MH9 A;  2H8W A;  3K0L A;  5CJ9 A;  2M8G X;  1J7K A;  3OYE A;  5E17 F;  3NWS A;  2NOJ B;  1Y1W J;  2VON A;  2L9N A;  1I27 A;  3NAR A;  3ZQQ A;  4Y13 A;  2X51 A;  3PFY A;  2JWT A;  3CCQ I;  1TNT A;  4U7B A;  2BXY A;  2ZME C;  2W57 A;  4PJN A;  1FMW A;  2LKS A;  3V8J A;  3A2K A;  2W85 A;  2ESN A;  4NDL A;  3HRT A;  4EV0 A;  4HLY A;  4WXC A;  1ZRD A;  1S5L C;  5FKO A;  3F0C A;  2XV4 S;  4FIS A;  2G0E A;  2RGV A;  3MZH A;  2I5U A;  4G7O F;  4YEJ A;  2KLO A;  3FBN B;  2VKH A;  1N25 A;  4AC0 A;  3BC8 A;  1WGX A;  3RPQ A;  5D4R A;  4LG0 A;  2DQL A;  3X2Q H;  5LRS A;  2K85 A;  3CD6 I;  3HYI A;  3SYT A;  2K5C A;  3FMS A;  1H88 C;  2H6B A;  4AYB N;  1BC8 C;  3F8N A;  2ADU A;  4HPQ A;  1BIB A;  3QYB A;  2CMP A;  1ULY A;  4XIC A;  3DWL E;  3GFL A;  2E5Z A;  4FX4 A;  1RI7 A;  2QGU A;  2H27 A;  1FIA A;  2BXZ A;  1B8I B;  3EUA A;  2Z3Y A;  2O5R A;  1U2W A;  3LAJ A;  4BY1 J;  4RM3 A;  3FXO A;  4ZTF A;  2M0C A;  1GV5 A;  5AIQ A;  3CZ6 A;  3H36 A;  1T08 B;  2CS3 A;  2K02 A;  1IJW C;  4BHB A;  1YW8 A;  5GAE J;  4BE1 A;  4P1W A;  5F6F A;  2WBM A;  1WJC A;  2HI3 A;  2OUM A;  2B7E A;  2CQN A;  4DJA A;  1IN8 A;  4IHV A;  2EFQ A;  1SVM A;  4YIF A;  1ODD A;  1XSV A;  2A68 F;  3LSM A;  3H5R A;  4LIU A;  4Y17 A;  3MMY B;  3S1Q J;  5CLS A;  4ZYG A;  2M5W A;  3E5Q A;  2P6S A;  1MSF C;  2HEO A;  1FBS A;  1ZTR A;  3KYD B;  4B4C A;  2LBF A;  2EA2 A;  2O03 A;  2DDB A;  1LVK A;  1JKP C;  2VKV A;  3BR2 A;  3CC7 I;  1IDZ A;  4EMS A;  1EH8 A;  3BDD A;  1T2K A;  3LOC A;  4U0V A;  4IHT A;  4C2U A;  2DFI A;  1R4N B;  4AUX A;  4BGD A;  1XGO A;  5TJJ A;  3NWT A;  4ETS A;  4BEH B;  2KDO A;  2CU7 A;  5CPR B;  2DTR A;  3DPL C;  5DCF A;  1Y0N A;  4XN0 A;  4FCY A;  2IAI A;  2GBY A;  2O8K A;  3FMR A;  3K1N A;  1ETX A;  4UUS B;  2D1V A;  2IGO A;  3JRC A;  1S7A A;  1T0F A;  3R6S A;  2BHY A;  4OMY A;  1VQP I;  1XX5 A;  3P9K A;  2X9D A;  3QPH A;  1RR8 C;  4E7K A;  3L2V A;  2XGC A;  2DFE A;  4XID A;  1KU2 A;  2EIJ H;  4YFX F;  1Z6T A;  2FBH A;  1IXR C;  3KP4 A;  5M5W J;  3TDU C;  2QF7 A;  3CDI A;  2GIV A;  1D0Y A;  2HXO A;  2DMQ A;  1YX3 A;  1VZ0 A;  5CKT A;  3RCO A;  4KFC A;  5HLG A;  3OS2 A;  5J6X A;  1JGG A;  5JHF A;  1O3R A;  4ENK A;  2R7W A;  2HVS A;  3CCU I;  2FNA A;  3PQJ A;  4UHT A;  3OL4 A;  2D2W A;  5DS9 A;  3CES A;  1X2N A;  1LFP A;  3HSE A;  5KNL A;  4XLF A;  1CF7 A;  3JRB A;  2L7K A;  2H1K A;  2ZME A;  5LFA A;  3RJP A;  2RDP A;  5IP7 J;  2F5E A;  5J1U A;  3ZN0 A;  1O3S A;  1PP7 U;  5LEK A;  2CUF A;  1XDU A;  3SEZ A;  4BHP A;  3JAM K;  2CG4 A;  3ASN H;  1Y1V J;  4V2G A;  2HQ5 A;  2Y30 A;  4IKF A;  2H6C A;  2L4M A;  3VSK A;  3DTK A;  5EEA A;  4EAT A;  4RA2 A;  5D8K B;  2QKL B;  1Y56 A;  2ZFW A;  4KMF A;  2XPV A;  1D0Z A;  1R1V A;  5LEJ A;  4KT6 A;  1TWC J;  5F0H A;  4NQW A;  4CCJ A;  1FOX A;  1LPQ A;  1ON2 A;  2ELH A;  1MBG A;  3D5L A;  5JLX A;  3DLL F;  2LF8 A;  2HQA A;  3BOQ A;  3S3O A;  2A6E F;  2XKP A;  2UV1 A;  1BOB A;  5B3S H;  3S1N J;  1FYL A;  4UUV A;  3BR5 A;  3F21 A;  3RZD J;  3TL4 X;  3F8C A;  1X3W B;  4XBF A;  2VI6 A;  3DF8 A;  2M9H A;  2A05 A;  4NUB A;  1SC7 A;  3I5U A;  1IRX A;  4XSX F;  3BY6 A;  1WSU A;  1MJB A;  5BS6 A;  2EK5 A;  2VIX A;  5FB2 A;  1R1T A;  4CCO A;  1HCR A;  3OOP A;  1HW1 A;  2E7W A;  2XHK A;  4PGH A;  4Q4Z F;  1W1W E;  4BE0 A;  2LF7 A;  4II2 A;  2Z5U A;  3QOE A;  4RAG A;  4M3B A;  5EYR A;  5IP6 A;  5EGO B;  4FTH A;  3CCR I;  3MEX A;  1I1S A;  2BYV E;  4BXU A;  3FMQ A;  4QWQ A;  3SZP A;  5LHI A;  5FLX Z;  1Z21 A;  4MFE A;  4A93 J;  3FXL A;  4HSR A;  5B1A H;  2IS1 A;  3M8F A;  2ZJP F;  2WB1 N;  4EJT A;  4BQA A;  4MIM A;  3BLY A;  2VOD A;  3K2A A;  2YPR A;  2FMY A;  3F72 A;  2K86 A;  4CUG A;  2EV6 A;  2IA2 A;  1WH7 A;  4F92 B;  1J9I A;  2Z1D A;  2OC6 A;  2HWV A;  2VKE A;  1GVD A;  1Y39 A;  5FKK A;  1IF1 A;  1PVE A;  4FX0 A;  3T0Y A;  4QPQ A;  3ABK H;  2HOS A;  3PJR A;  2L2O A;  2RV8 A;  2RAE A;  1X1P A;  2XAG A;  3VYT B;  1YRN A;  4EM0 B;  3BR0 A;  4QLC U;  4LIT A;  4CA0 A;  1VTN C;  2GA1 A;  3OYD A;  1RIO H;  4AYB A;  1C0W A;  4IPA A;  3HJE A;  9ANT A;  1RES A;  1XTA A;  1ZKG A;  3WGG A;  1FSH A;  5IY5 H;  3OSF A;  2GOX B;  1E17 A;  5F08 A;  5KVR A;  1G4D A;  1KQ9 A;  1RPW A;  1XMK A;  2Y0M A;  2COM A;  2XAF A;  2CV1 A;  4S05 A;  3FIW A;  2MLG A;  3MZ8 A;  2O7O A;  2ZJ2 A;  1VQ7 I;  5LRR A;  3R0J A;  2HQN A;  3FWE A;  1WWX A;  3RKX A;  1V3F A;  3GTP J;  4M9Z A;  2HU9 A;  2R7R A;  2PN6 A;  2CFX A;  2O0Y A;  2QQB A;  3MN2 A;  2V6C A;  1UHW A;  2GLO A;  4PZJ A;  2X1E A;  2NXN B;  3CCM I;  1BJZ A;  4HNV A;  1UCR A;  4HA8 A;  3F8B A;  4CYD A;  4KIC A;  4C3I J;  5EZG A;  2VT3 A;  3MKW B;  2IVM A;  1SAX A;  4MTD A;  2DJN A;  4HV6 A;  3VEP A;  2XF5 A;  3KPH A;  3OR1 C;  3HM5 A;  1A5J A;  1YW7 A;  3QYE A;  4HX7 A;  4XRS G;  4PJL A;  1IUF A;  3CO7 C;  3QQA A;  1N78 A;  1WKM A;  2M3A A;  2EZH A;  3L7W A;  4CH7 A;  2QEX I;  5E1X A;  1ZHF A;  2VC0 A;  1X1B A;  1SFO J;  4Q48 A;  1G3S A;  4E7Z A;  4RBO A;  4JX6 A;  2QUF A;  3FXU A;  2K9N A;  5IT3 A;  3PUF A;  3LSR A;  3C1D A;  4YFK F;  1ZRC A;  4P9U A;  1BR4 A;  1FOY A;  2XSD C;  4IOC F;  1BW5 A;  3PL8 A;  2NS7 A;  4IJA A;  1QNT A;  1G8X A;  4XON A;  1UG2 A;  5LD2 C;  3RQI A;  3HUG A;  2R7F A;  2WAD A;  1X19 A;  4ZTJ A;  3NEU A;  2DOA A;  2Y0S N;  3SQN A;  2ZXJ A;  4BAC A;  5ICG A;  4EGZ A;  2PMH A;  2G7H A;  2E2J J;  2QEN A;  2KRC A;  3H9G A;  2JVG A;  2M4G A;  5CYV A;  3OL3 A;  3DU5 A;  4B43 A;  4ZYH A;  1K4S A;  1J2X A;  2OJE D;  5J1Y A;  2RNG A;  1J0R A;  1FIP A;  3FXK A;  4HF2 A;  2P5V A;  2M2E A;  3SZT A;  5BOX A;  3ZR8 X;  4KIB A;  1ZLJ A;  4KJZ A;  2Z16 A;  3U1K A;  4F52 A;  3WTX C;  2OZU A;  3BCA A;  3R4K A;  2GM4 A;  2H8R A;  1JT0 A;  3OYA A;  3I58 A;  2V9P A;  1QGP A;  4MGR A;  2EBI A;  2E1O A;  1XB4 A;  1LFU P;  4K2E A;  4CCK A;  5DCM A;  1SD4 A;  1MKM A;  2QWW A;  3OYL A;  3HDD A;  4MHG A;  1MDM A;  2ZNY A;  2K7L A;  3I4M J;  3AFH A;  2IS2 A;  2XDV A;  4LD5 A;  4BDY A;  3QRF F;  4YRV A;  3E5X A;  1ON1 A;  2GA2 A;  2YS9 A;  3CQZ J;  2ZC2 A;  2IA0 A;  2IBD A;  2JPC A;  3G1M A;  1O4X A;  3E5U A;  5GAD J;  3LWF A;  4DZJ A;  1WJA A;  2FXA A;  2PEX A;  3I0T A;  3VPR A;  5K5R A;  5HOO A;  4HDV A;  4ON0 A;  4O6J A;  5HDK A;  3A4C A;  1W7P D;  4FE7 A;  5LGU A;  2ESH A;  2HNH A;  5FO5 A;  2PJR A;  1Z1D A;  4RAY A;  2WAQ N;  5E20 A;  5JI6 A;  3I59 A;  3WU0 A;  4XK4 A;  2CQ7 A;  3GZN B;  3BR6 A;  1HSJ A;  1N75 A;  4E6K G;  4BBS J;  2VE9 A;  1APL C;  3J7Y J;  5FLX K;  4XOR A;  1IDY A;  1MH4 A;  1TW3 A;  2MA3 A;  4BJ6 C;  1YYV A;  3MFK A;  1HKT A;  2MC4 A;  3HHG A;  1ENH A;  1AA7 A;  4LIV A;  3M4O J;  1R7J A;  4FT8 A;  1Z3X A;  3FM3 A;  2GWR A;  4X6A J;  2NOG A;  3DKX A;  4QIW N;  4EJV A;  3JRD A;  3C18 A;  4ZYD A;  3FBI B;  4F93 B;  4HX4 A;  3ELK A;  1JUS A;  3DBL B;  3A1Y A;  5BPD A;  3DEU A;  2EV0 A;  3EUH C;  5F27 A;  3L2U A;  2JA6 J;  3S14 J;  2Y2Z A;  2CV0 A;  1D8K A;  5KAF C;  3VDX A;  2XRL A;  4GCV A;  1K7A A;  3MWM A;  5DDG A;  2F48 A;  4EGY A;  2W00 A;  3MVP A;  4KN4 X;  3JRI A;  3TED A;  1GT0 C;  1K4T A;  1B72 B;  2DPU A;  5FRM A;  2QA4 I;  2G7U A;  3I53 A;  4BJ5 C;  4P96 A;  3GUD A;  1A6Q A;  3MKL A;  3LL7 A;  3QP5 A;  5F1R A;  1YIT I;  3S1M J;  1MBF A;  1HKQ A;  4E7J A;  4UXN A;  3JRE A;  5L3F A;  2DA7 A;  3FKJ A;  2KL4 A;  4OAY A;  3IRR A;  3DPT A;  4D0P A;  2DO7 A;  2HZT A;  3M8E A;  4B48 A;  3CME I;  1TP4 A;  2GOM A;  3U9G A;  3JRF A;  1B9N A;  3AG4 H;  4XRF A;  4L9V A;  5AON A;  4XMY A;  2VJ5 A;  3GFI A;  1QRY A;  3MKZ A;  3F9K A;  2OV7 A;  3WU2 C;  2R7O A;  3CF5 F;  2HQR A;  2KIU A;  4L5E A;  4RM2 A;  4BQN A;  2V26 A;  1JTY A;  2NVT J;  3GYH X;  4KIF A;  5CVU A;  4I76 A;  4IQJ A;  2EIM H;  2KP6 A;  1SD6 A;  1OCT C;  2WY7 Q;  3LQQ A;  3J80 Z;  5GAH J;  2VB6 A;  2VQC A;  2QLZ A;  3UKG A;  3RKW A;  3BWG A;  2W24 A;  2K3F A;  1RKT A;  5C44 J;  2M1B A;  4JP0 A;  1MBH A;  4HST A;  3KLN A;  3G1O A;  4AID A;  4DYQ A;  2B9S A;  4OIO F;  4N4N B;  3BTL A;  3H9J A;  4CCN A;  2HDW A;  1E3P A;  3IP4 B;  4UV8 A;  1KZH A;  3PQK A;  3IL2 A;  1DDN A;  3BQZ A;  3HRS A;  2IA1 A;  3LST A;  2OU2 A;  1W7P A;  4WCG A;  1FWZ A;  2M8E A;  1X4P A;  3BCB A;  4A5M A;  1ETQ A;  4OWR B;  3I9V 2;  3CCY A;  1LJ9 A;  1DUX C;  3CF2 A;  2W4S A;  1RZ4 A;  2J5P A;  1UMQ A;  2ZJR F;  2J5O A;  1KU7 A;  3HTS B;  1AOY A;  3HOY J;  3IAM 2;  1Y0U A;  4A3J J;  1T98 A;  5FKM A;  2VBZ A;  1OR7 C;  2DBB A;  1I39 A;  2QVO A;  4ABZ A;  1OFC X;  1ETO A;  3MD2 A;  1UHS A;  4RGU A;  3JTG A;  1E2X A;  1F5T A;  4DBQ A;  3DFG A;  3N97 A;  3GME A;  1QZZ A;  2CW0 F;  1D8J A;  5E18 F;  1DQU A;  1WQ2 A;  3C2H A;  3PSF A;  3HPH A;  4N9H A;  5J8C A;  1SFK A;  2V4J C;  1EKE A;  1PDN C;  4PDK A;  1ZEL A;  2Y0S A;  2AS5 F;  1DGR M;  2OA4 A;  1BM9 A;  1X1A A;  2K4J A;  3O6B B;  3RIR A;  3ZQG A;  3F8M A;  2F2E A;  1R00 A;  2VQG A;  3CUQ B;  4BE2 A;  2DOE A;  3MQ0 A;  3RKQ A;  2HZD A;  2V1D A;  3OYC A;  1AKH A;  4C2T A;  1KU3 A;  1LFB A;  2FQ3 A;  1GVJ A;  1VQK I;  5IPA A;  3KP3 A;  2JMW A;  4PJJ A;  2IEK A;  2JRM A;  4C3J J;  1F4K A;  3HSR A;  1IV8 A;  2VOP A;  1ITY A;  2B63 J;  3V42 A;  3GO5 A;  2XRN A;  4M71 A;  2LDU A;  3HHH A;  4P5O A;  3KZZ A;  2Q2E B;  3JSP A;  5HLH A;  3EUH A;  1T33 A;  5FKL A;  3JSO A;  4R8H A;  4DGW B;  2L7F P;  1OYW A;  3DKY A;  2IGM A;  2EA4 A;  1LNW A;  1D1B A;  1MMN A;  4I09 A;  1PUF A;  2MGQ A;  4F3Q A;  3GLL A;  3P9C A;  4EVI A;  2Q1Z B;  2K9M A;  4A3M J;  3ONQ A;  5D5V B;  4DQ2 A;  5J40 A;  1G3T A;  4IF4 A;  2KFD A;  4RLQ A;  2OCE A;  1DP7 P;  3JTH A;  1Z7L A;  3LSH A;  1SMY F;  3T1B A;  4WF2 A;  2XAS A;  3L2Q A;  4Q47 A;  4KDP A;  1LB2 A;  4BXF A;  2WAQ A;  4LG3 A;  2MH2 A;  2P6T A;  2V1X A;  1VQ9 I;  3K1P A;  4B09 A;  5D5X B;  4I01 A;  2CGP A;  1VI0 A;  3U1D A;  3V7C A;  1FC3 A;  3CJQ B;  2CQQ A;  2EB7 A;  1R22 A;  1TW2 A;  2QSH X;  2NRA C;  2R7V A;  4KIT B;  3LSJ A;  3K4N A;  4I7H A;  4XKV A;  3LSK A;  4M9X A;  5TRD A;  4LG0 B;  3ISP A;  5K5O A;  2C6Y A;  1JE8 A;  4O3M A;  1IRG A;  3IAS 2;  1MGT A;  4LB6 B;  4BHC A;  4M6X A;  3IKT A;  1XMX A;  5GPC A;  1DGW Y;  1BBY A;  2VBW A;  5BNG A;  1WRJ A;  4LLL A;  4I99 C;  5L3D A;  2XRO A;  1QO0 D;  3OV8 A;  2WC2 A;  3SEQ A;  3ZQC A;  2O61 A;  4EJO A;  4HDU A;  2A3S A;  2QZ8 A;  2VE8 A;  3E1S A;  3GW2 A;  4LFU A;  3ABT A;  4BS9 A;  4ANJ A;  2P81 A;  4XN3 A;  1YOV B;  2BY3 A;  4NC6 A;  4C2M J;  5M5Y J;  5FFX A;  2K3P A;  2CJJ A;  2DXI A;  2Z33 A;  1KYW A;  4E7L A;  3N4M A;  3AG2 H;  4AU7 A;  3NAU A;  2TCT A;  2GXG A;  3E6C C;  1OR7 A;  4HQM A;  3WTV C;  1EH7 A;  3J7Z I;  1X1D A;  2I8D A;  3Q9V A;  4D9J A;  2DOD A;  1ZGJ A;  3ZRG A;  3BZK A;  3J80 K;  1SVL A;  4LK0 F;  2OAZ A;  2DQR A;  2STW A;  4W97 A;  2E7X A;  3OYI A;  1TTY A;  4PJ0 C;  2Y31 A;  3TP3 A;  2OTJ I;  4B3A A;  2LKX A;  1B8I A;  3FK7 A;  5F0C A;  3HGY A;  3IWF A;  2LBF B;  3ABU A;  4WX9 A;  2R7D A;  5D8L B;  3CMY A;  3IH2 A;  1Q1V A;  2MLK A;  3G4S I;  1RRJ A;  1S29 A;  2DU9 A;  4IHW A;  2BE5 F;  4A3G J;  1EA3 A;  4V19 K;  2V1U A;  2CYY A;  2VAS A;  3U21 A;  3TGN A;  2CV2 A;  5DM6 F;  4A69 C;  1LE8 B;  2CFO A;  4HYE A;  1BN5 A;  2HPM A;  1O57 A;  3T8R A;  2QM3 A;  3DTE A;  3S3M A;  4OMZ A;  1YW9 A;  1HOM A;  2DA4 A;  4R1H A;  2LY2 A;  2X4H A;  3FF5 A;  4XM3 A;  1YHQ I;  2M30 A;  5HS9 A;  2QQ8 A;  2RC4 A;  3TQN A;  4MEY F;  3G3Z A;  1K78 A;  2A5Y B;  4KNY A;  2WV0 A;  5FJ8 J;  3M1E A;  4H4K C;  3H3U A;  2P0W A;  4MEX F;  4UNO A;  2KJB A;  3KX2 A;  4IHY A;  3EYY A;  3H5A A;  2UWM A;  4U0Y A;  3A0B C;  5DUK A;  5CVR A;  1FP1 D;  2LVS A;  4XNF A;  3S93 A;  2Z99 A;  4Q5S F;  4XSZ F;  3G2B A;  1TL8 A;  3ZMS A;  2R0Q C;  1F1Z A;  2JA5 J;  4GGG A;  4KUM A;  2ELK A;  1M1E B;  2DPD A;  4MLO A;  5IYB J;  2WY8 Q;  2ZFU A;  1CF7 B;  3K4C A;  4E4H A;  2LP0 A;  2ACJ A;  2DYS H;  2HYJ A;  1B1B A;  4D5C A;  3RTR A;  5H6Q A;  2PFB A;  3S2H J;  4DYR A;  3IKV A;  2PQ8 A;  2XUB A;  1S8N A;  3GVA A;  3I71 A;  2XF6 A;  4OIQ F;  2I10 A;  1L0O C;  1KGS A;  1BA5 A;  4UVC A;  2JUG A;  3AL0 B;  1MW7 A;  4IEJ A;  5HDG A;  3ZMZ A;  4C3H J;  4XRM A;  4UVB A;  1H8A C;  3DU6 A;  5F04 A;  3CJT B;  1IXS B;  3KFW X;  4YEL A;  3CCJ I;  1U8B A;  1POG A;  2K4B A;  2LG4 A;  2OTL I;  5HOD A;  1T38 A;  3CC4 I;  4AM3 A;  3P5J A;  5KHD A;  5E3N A;  3OY9 A;  1TZL A;  4HQE A;  2EFO A;  4BQO A;  3M07 A;  2BY1 A;  3TOA A;  2ZKZ A;  3U2R A;  2EFP A;  4TV7 A;  3PIP F;  3IV5 A;  1JT6 A;  2DT5 A;  2XAQ A;  2LOO A;  2BOL A;  3K4L A;  1UJ8 A;  2GIZ A;  1U5T C;  4NHJ A;  2LRD A;  3CDL A;  3BJO A;  4YG2 F;  3A01 A;  2R7U A;  4LK1 F;  1ETK A;  1QZY A;  4M9S A;  5IYC J;  2DA6 A;  4N0B A;  3KZI C;  2JQ7 A;  2BV6 A;  1WI3 A;  3L2R A;  4ZYE A;  1WI9 A;  3GLX A;  1KU9 A;  5J3L A;  2Q8K A;  1JKQ C;  3ZQL A;  1TC3 C;  1ZG3 A;  1R5I D;  3HTU A;  4RGR A;  1MIJ A;  1T56 A;  1LDK B;  2HTS A;  2QSG X;  1ZGW A;  5DD8 A;  4DOZ A;  4BYY A;  2A69 F;  3HOV J;  4F91 B;  2X6W A;  1FP2 A;  3HRU A;  4O5V A;  2JSP A;  5DM7 F;  3RI4 A;  2V1N A;  2W7N A;  4RB2 C;  3K7A J;  4S0H B;  1W0U A;  4MFD A;  3CCS I;  1I6X A;  1XCV A;  2DK5 A;  1S6L A;  3TDZ C;  1IO2 A;  2X85 A;  2K27 A;  4UVA A;  1WPK A;  2N8G A;  1X1C A;  2ZJQ F;  1Y6I A;  2V7F A;  3DPU A;  3SDB A;  1FY7 A;  3ASO H;  3VOD A;  3S3N A;  2HFH A;  3RPU D;  1SFU A;  1H9T A;  2E1M C;  4PGG A;  3VYR B;  2O8X A;  5E3O A;  3BZC A;  2FD5 A;  3GXO A;  4XL9 A;  4L18 B;  1YRN B;  1LQ1 A;  5IT9 Z;  2X6Y A;  2X6X A;  2MD5 A;  2JN6 A;  3H0D A;  3NQO A;  4PFO A;  3EPZ A;  1WZ2 A;  5D6E A;  3BPX A;  2TDX A;  4ENN A;  3CCE I;  2HTJ A;  3WTW C;  1L3L A;  4G12 A;  3R60 A;  2FEZ A;  4ENM A;  2ETH A;  3Q5F A;  2CH0 A;  3HOU J;  2EZL A;  3H3Z A;  3ZQH A;  3GTJ J;  4IL6 C;  3ZMD A;  2CUE A;  1MBK A;  1W5T A;  5K7Z A;  4FHT A;  5EG0 B;  2EV5 A;  1TBX A;  2FA5 A;  2W82 A;  2A5W A;  3FK6 A;  2QYO A;  4YII A;  5K7F A;  4KT5 C;  2BVL A;  4IX7 A;  2PMZ N;  4M6V A;  4LB5 A;  2IRF G;  3H92 A;  2RN7 A;  3BTI A;  3N05 A;  3KYC B;  3H35 A;  4P9F A;  2NNY A;  1HDD C;  2KT0 A;  4ENJ A;  2ZO4 A;  1WJD A;  3DBH B;  5D4S A;  2A07 F;  1X2M A;  3P7N A;  3TP0 A;  3HZJ A;  2JT1 A;  1HKS A;  3EDP A;  3IHU A;  3DKW A;  1HDP A;  1P7I A;  2AHQ A;  4R79 A;  1WVR A;  2E5N A;  4KIS A;  1XGM A;  3A02 A;  1R49 A;  3ZQI A;  2IGK A;  1YE9 A;  2HDC A;  2AQF A;  2WAE A;  5LGT A;  5JVT A;  2UXN A;  1NTC A;  2EPF A;  1B59 A;  3MZY A;  4IXA A;  3W3C A;  1VQ8 I;  2NYX A;  2NS8 A;  4ZZD A;  2LYC A;  4CZC A;  2L54 A;  4A12 A;  1FJL A;  1I1G A;  2R7S A;  1TWG J;  3IH4 A;  1UEL B;  4BQQ A;  4I98 B;  1ETV A;  2EIK H;  4I2O A;  5GTI C;  2FUG 2;  3G73 A;  3ZMU A;  3F23 A;  4C9Y A;  4Y15 A;  5E3M A;  4U7D A;  3HUG B;  1U5T A;  3GF2 A;  4KN7 X;  3WE2 A;  4Y3O A;  2R5Y B;  5IP9 J;  3BTC A;  2HKX A;  3TMO A;  3JW4 A;  3AG1 H;  3CMA I;  2FQ4 A;  1RET A;  1ZLK A;  5H2F C;  4MTE A;  2NVX J;  1JI8 A;  1IN6 A;  3RPU A;  3M8J A;  4M74 A;  1U3E M;  3B6A A;  4L9J A;  2DT7 B;  1Z91 A;  2KHM A;  4B1R A;  3PIO F;  1LEB A;  3W6J B;  4PCQ A;  2PI0 A;  3TKY A;  5C4J J;  2PX9 A;  1ZRE A;  1PYV A;  3OOU A;  1JJ8 C;  2X0L A;  2W1O A;  2HOE A;  3ABL H;  3MCZ A;  5CVJ A;  4G6Q A;  1QQI A;  2F5V A;  1W36 C;  1NK3 P;  2E60 A;  1YIO A;  1LEA A;  3L1P A;  5EEG A;  1FSE A;  1T39 A;  4IZZ A;  1HA8 A;  3BG9 A;  3WGH A;  5ILV A;  3GTO J;  3I4N J;  3ML6 A;  2XAJ A;  2XGX A;  2ICW G;  1NK2 P;  2Z9O A;  5DCM B;  3Q0W A;  1Z05 A;  5HLT A;  4LJZ F;  4A3E J;  1MDM B;  5JVG F;  4Y33 A;  4A3L J;  3ZMT A;  1R36 A;  3TW6 A;  2EFW A;  4BXX J;  3K4M A;  1F43 A;  2X1D A;  3VSL A;  2XAU A;  3JR9 A;  4KYW A;  4L0Z B;  3CJN A;  1TNS A;  1VQM I;  1LVA A;  2L7M P;  1W36 D;  3IRQ A;  2TRT A;  1MNM C;  2L7Z A;  2Y9Y A;  2HGC A;  3LSG A;  3VYS B;  5EDN A;  1WHU A;  2MAB A;  3CUO A;  3FDY A;  2FF4 A;  2MBF A;  1HBX G;  3FXM A;  3I59 B;  3K4K A;  1SFX A;  5HDN A;  1ZYR F;  1SAU A;  4OIN F;  3CO6 C;  2LK2 A;  5IOY A;  1S72 I;  1UFM A;  1FX7 A;  1I50 J;  3QYF A;  3SZG A;  1Z67 A;  1U0J A;  3WTY C;  2FOK A;  3I56 I;  2XVC A;  3H3V K;  1QHG A;  1IG7 A;  2QQA A;  3H9Q A;  2P7C B;  4HAM A;  2GZW A;  2EIL H;  4RLF A;  5K5Q A;  4L5J A;  2VPR A;  5H6R A;  2E71 A;  4LGW A;  1RNL A;  3VYU B;  1YFH A;  3ERE D;  2QCO A;  2BVM A;  1KQ0 A;  1IN5 A;  2HKO A;  2V9K A;  3H0G J;  3HSF A;  1ZR2 A;  1GDT A;  3RYR A;  3FKI J;  3WG7 H;  4A0X A;  2D5V A;  2OD5 A;  5GP9 A;  1OQY A;  2IS4 A;  4GO1 A;  5E1Z B;  4RGX A;  1DU6 A;  5IT9 K;  2FNP A;  3BP8 A;  2OF7 A;  1TLH B;  2DA1 A;  5D6F A;  5ILU A;  3LA3 A;  5ERI A;  3K70 C;  2RNJ A;  2ZXI A;  1IXC A;  1FEX A;  2EIN H;  1IN4 A;  2NVU B;  1LKX A;  1Q1H A;  2OZ6 A;  2LY1 A;  3I55 I;  1R5G A;  2OQG A;  4YFN F;  2OCC H;  3KYL A;  4D7M A;  4MQV A;  3T8T A;  2HR3 A;  3HOW J;  2BY2 A;  3ECH A;  2E1C A;  3K69 A;  2VC1 A;  5HNF A;  3I64 A;  3E6B A;  4M3D A;  4PJM A;  3EET A;  1QPI A;  4QTR A;  4UY8 I;  2JA2 A;  3M7G A;  3HKZ N;  4DBR A;  1BI1 A;  1R23 A;  4II3 A;  1OKR A;  4F55 A;  3BR3 A;  2BW3 B;  5L3B A;  1K6O A;  1E3H A;  2M45 A;  2Q0O A;  4XOT A;  2QBY A;  1HF0 A;  4U88 A;  5KAI C;  1IRF A;  2R5Z B;  2R3S A;  1PUE E;  3OIO A;  3K70 D;  3V7S A;  3FHZ A;  1D5Y A;  2ME6 A;  2CQX A;  4JX5 A;  4CXF A;  4A0Z A;  3OR2 C;  1J09 A;  3CJR B;  2PMZ A;  5LBQ A;  5L3C A;  3K2Z A;  4G94 A;  4Y7N J;  1A36 A;  5FGM A;  4CIC A;  2O3F A;  1UG0 A;  2DA2 A;  3A0H C;  1U6G A;  5KK1 A;  2XPU A;  3OIP A;  1OPC A;  2DCE A;  4KMU X;  4XOP A;  2XB5 A;  4CSW A;  2V6E A;  3IWZ A;  4OOI A;  1MMA A;  3HL2 A;  4CHU A;  2STT A;  2DDA A;  2R7Z J;  1W7P B;  4XLC A;  1TWH J;  3C2G A;  5EJC A;  3S8P A;  3F6O A;  2HPI A;  4D5F A;  5F0F A;  4CCM A;  3W2A A;  3TO6 A;  2E34 A;  4X1E A;  2DLL A;  2FSW A;  4M3F A;  1V5E A;  4HNT A;  1JUM A;  4S04 A;  2DFF A;  2WWY A;  3COA C;  2H94 A;  2L9S A;  2KIM A;  3TO9 A;  4A6E A;  4RB1 A;  3OS1 A;  4G6T B;  4B3X A;  1XSX A;  2YX7 A;  4BUP A;  1XN7 A;  4CYC A;  4NNJ A;  5FLM J;  4WK8 F;  1VF9 A;  2ME0 A;  2KRF A;  1GV2 A;  1SVO A;  1MH3 A;  3HG9 A;  2XC7 A;  1I5Z A;  4EEF G;  1HLV A;  1JTX A;  4A3I J;  4BBR J;  3FM5 A;  3PNT A;  1WCM J;  2BHZ A;  1R71 A;  2NVY J;  2VL8 A;  1GUU A;  1JJ6 C;  2EZI A;  5J47 A;  3LMM A;  2R92 J;  3ZMV A;  4BKX A;  3LSP A;  2KKO A;  1D3Y A;  1OCO H;  2KRH A;  3SJM A;  3FZV A;  1YS7 A;  1RR7 A;  4FE4 A;  1G3Y A;  2HS5 A;  2COB A;  2DMP A;  1USS A;  4ZDP A;  4RS8 A;  3KP5 A;  4GYI A;  1MBE A;  5B66 C;  5FLV A;  1MJA A;  2FBK A;  3BT9 A;  2VT2 A;  3EQL F;  4Z2Y A;  3B73 A;  5FFZ A;  1HXD A;  2F6C A;  2JZY A;  1PP8 F;  1U9N A;  3E0J B;  3O2P E;  3IH3 A;  1AKH B;  2KMU A;  3FXJ A;  2EWN A;  3F8F A;  4XR6 A;  4EQQ A;  4CCL A;  1IW7 F;  1BOA A;  3QAH A;  3QPS A;  4AD9 A;  5M5X J;  1VQ5 I;  4MO7 A;  1BI3 A;  2AO9 A;  2M7B A;  1WJE A;  2YR2 A;  4M73 A;  3LA7 A;  1R6R A;  3HOX J;  3D1N I;  3ZQ7 A;  1I3A A;  2DOF A;  3OYJ A;  1SMT A;  1TT5 B;  2D1H A;  3E7L A;  1E3O C;  5DV5 A;  1VQO I;  5IOZ A;  3BQY A;  2DMU A;  2L01 A;  1Z9C A;  4JYK A;  2VQL A;  1V4R A;  3FHN A;  3J81 Z;  3DBR B;  2W84 A;  1U78 A;  3HPG A;  4HG2 A;  5GPA A;  3S17 J;  1FBQ A;  4CZZ A;  3KE2 A;  1WJB A;  2QKM B;  3L2W A;  3EYI A;  1CQT A;  2PG4 A;  4G7Z F;  3GTM J;  1ONV A;  2UZK A;  2FOW A;  1DPU A;  4I6Z A;  5E79 C;  3D5R C;  3CLQ A;  2H09 A;  2E1N A;  3V8K A;  5L3G A;  5E3L A;  1IN7 A;  1XD7 A;  2JA8 J;  5JR3 A;  3DV8 A;  3W6K B;  5LHG A;  1EF4 A;  4BJT A;  2Q2E A;  4IOA F;  3DTI A;  2KZG A;  1HC8 A;  3J7A O;  4KA4 A;  5HVQ C;  1TQM A;  3S15 J;  3S2D J;  1REP C;  1VFC A;  1JUP A;  2QSF X;  1ZRF A;  5EZH A;  1U8R A;  2EH3 A;  1OCZ H;  3SXY A;  2GXB A;  2NNN A;  3W6V A;  2VOO A;  4PSX A;  4CO8 A;  2ELJ A;  1WJF A;  2PJP A;  4L9N A;  4ASN A;  2VXD A;  1FOW A;  3M1C A;  3QWL A;  1D1C A;  4B47 A;  3GBG A;  2VUM J;  4F7Z A;  1H0M A;  4E7I A;  4CDG A;  2CUJ A;  2Y75 A;  1GLN A;  4PK4 A;  3ABM H;  3F6V A;  3RSN A;  4LOC A;  2YSR A;  4H0E A;  2E2H J;  3LQR A;  4XLP F;  1FOK A;  1O7F A;  2YUS A;  1XCB A;  1JXS A;  3RKY A;  3AL0 C;  1UZC A;  2VBX A;  3GTQ J;  1T6S A;  5JLW A;  4N4O B;  3ZPL A;  2HVQ A;  3ZXS A;  1LDJ A;  4ZC3 A;  2P5K A;  1OCC H;  4G7H F;  4CGZ A;  2L9V A;  1P7J A;  2IT0 A;  2Z2S B;  5LHH A;  1XMA A;  1QHH D;  2L4A A;  2M34 A;  3GWZ A;  2CRG A;  1DU0 A;  1Z7U A;  1QBJ A;  2Y9Z A;  1SAN A;  3K4B A;  2DAO A;  3PUB A;  2NS0 A;  3F3X A;  1XSD A;  3HKZ A;  3DEW A;  1Z3Y A;  2M7A A;  1VQL I;  2KDZ A;  2VJJ A;  3OYB A;  2LR8 A;  1P9Q C;  1YLF A;  2FU4 A;  4MQ9 F;  2GQQ A;  1B6A A;  4HOB A;  1D5V A;  2DYR H;  3A03 A;  4HZF A;  4BAY A;  4DNC A;  5BPI A;  2WA0 A;  3OIQ A;  2DFH A;  3QPT A;  3F22 A;  3BZ6 A;  4A2U A;  1OCP A;  4D1Q A;  1D0X A;  1UB9 A;  1XGN A;  4YIR X;  1YI2 I;  2WV1 A;  2AXL A;  2DN0 A;  5F64 A;  2DTZ A;  2GAU A;  1SFE A;  4Z6Y A;  4GDF A;  2R7T A;  1OJL A;  4HLX A;  2HVR A;  2ZBK A;  1X58 A;  5M3F J;  1UHM A;  2IXS A;  4DYC A;  3WHC A;  2LRE A;  3HBL A;  3OYG A;  1HST A;  2DK8 A;  2Y69 H;  2LD5 A;  1XS9 A;  4U87 A;  1K78 B;  3S16 J;  4RAF A;  3RQ4 A;  4C30 A;  3LA2 A;  3HGG A;  2XPW A;  1R5H A;  4AVZ A;  2FBI A;  3C7J A;  3JRG A;  1S9H A;  3I3L A;  2PBI A;  4B44 A;  1Z0X A;  2HOT A;  1H9G A;  2CUZ A;  3HOS A;  2GXA A;  1F9N A;  5FRN A;  3LFK A;  2DJI A;  2NAZ A;  1LE8 A;  1Z6R A;  1WJ5 A;  4BEH A;  4HV5 A;  1A31 A;  2XGE A;  4EM1 A;  3FXQ A;  1W5C C;  3BG6 A;  5E1W A;  4ZJZ A;  5L3E A;  2XF7 A;  3GFJ A;  2JJ7 A;  3V4G A;  4UUS A;  1BIA A;  1V5G A;  3KEO A;  1X3U A;  4A0Y A;  5JFR A;  1FNN A;  2A6T A;  2CW8 A;  2F5C A;  1F36 A;  3BTJ A;  3DEE A;  4XRS A;  3GX4 X;  1BI0 A;  5D5W B;  5A2Q Z;  3UR3 C;  3L00 A;  3HB9 A;  4GYG A;  1XC5 A;  3M3Y J;  4I0A A;  1JHH A;  2ZME B;  5DEQ A;  4J01 A;  3RDI A;  2CW7 A;  3M9A A;  1VQ6 I;  5FRO A;  4AWX B;  1AHD P;  3S32 A;  4U0W A;  4EM2 A;  3MKY B;  1TWA J;  3QU3 A;  4A3B J;  1ZAR A;  3HOT A;  5ICF A;  3G71 I;  2JA7 J;  4RB0 A;  1W4M A;  2HOA A;  5J4Y A;  2DMT A;  1OMI A;  5K7H A;  1P4X A;  1MMG A;  4NQW B;  3J81 K;  1O3Q A;  1YX5 A;  3AG3 H;  2EJR A;  3KET A;  4ZDO A;  1QU3 A;  5TIS C;  3HXL A;  5F1J A;  3PNY A;  3CDH A;  1IUY A;  1OYY A;  4IO9 F;  3WG9 A;  1P4A A;  3PM1 A;  4EJW A;  5IYD J;  3A01 B;  5LLQ A;  5FD5 A;  4PFP A;  3AAF A;  2ZSI B;  4FET A;  2IJL A;  3VOE A;  2VKD A;  4GXO A;  4J00 A;  3PNV A;  1O7L A;  2R4G A;  3QU6 A;  5HLI A;  2A61 A;  1S7E A;  5HS7 A;  1R1U A;  1Y8Q B;  4ESJ A;  2VPL A;  4I0B A;  2L02 A;  4IRI A;  3SFI A;  3BJ6 A;  5TGT A;  4A3K J;  4BY7 J;  1KYZ A;  5ILS A;  2Y48 A;  3BG5 A;  3LAP A;  1J75 A;  2RVC A;  3KP7 A;  2HDD A;  2X48 A;  2MW8 A;  3ZP5 A;  4RDU A;  2RQP A;  2ZCW A;  3DP7 A;  1OCR H;  3KIO A;  3OYF A;  5DUI A;  2EZK A;  1RC9 A;  1RKW A;  2FJ1 A;  1ZN2 A;  3KCC A;  1OYI A;  4HEA 2;  1R4M B;  1ETW A;  4UB8 C;  3E97 A;  1ZR4 A;  3DCF A;  1KON A;  4BDZ A;  3Q3S A;  1G2H A;  2R7Q A;  3E6M A;  4JK1 X;  1NH3 A;  4XQF A;  5JHU A;  3SDG A;  2LY9 A;  2IGN A;  1VQ4 I;  3OWT A;  5FD6 A;  1V54 H;  4WXH A;  1FBU A;  3CCL I;  2BY0 A;  1J5Y A;  2BGC A;  2P4W A;  3QOP A;  3OSG A;  1D1A A;  2FRH A;  3KP6 A;  3CC2 I;  4UV9 A;  2X6O A;  1BR2 A;  2M87 A;  5EGO A;  2OQR A;  1TQI A;  1DP3 A;  4LLN A;  1BL0 A;  3VFZ A;  1BC7 C;  5C3E J;  1X3Z B;  3QP6 A;  3ULQ B;  3K6G A;  3KZY A;  3OMY A;  1YJW I;  3S2W A;  2ID6 A;  4OU0 A;  4G6D A;  2OBP A;  3DXJ F;  3BG7 A;  4NB5 A;  3KEY A;  1MNE A;  1UAA A;  2ECB A;  3CP2 A;  1SEU A;  4Y4R A;  1AU7 A;  4BH9 A;  3C3W A;  4RAZ A;  2MC3 A;  1YTY A;  4IHX A;  2L0K A;  3REO A;  1ZQ3 P;  1FTT A;  2JRT A;  3CP8 A;  3TBI A;  1PJR A;  6PAX A;  3K4J A;  3WOD F;  2E35 A;  1FLI A;  5J4V A;  3WGI A;  1ZH5 A;  5H20 A;  2OPT A;  3C2B A;  3RYP A;  2H1L A;  4OAZ A;  5BQT A;  5BMZ A;  2LLK A;  3H5N A;  3DQV C;  1MSE C;  1P4W A;  4LMY A;  2R93 J;  2KZV A;  4N9I A;  1YG2 A;  1YS6 A;  3D0S A;  1B9M A;  2XAH A;  1FZP B;  5GTH C;  2IS6 A;  2XKO A;  2JSC A;  2E36 A;  1YIJ I;  1EV7 A;  5EG0 A;  2F4I A;  5KCM A;  4JOM A;  2DI3 A;  2MG4 A;  1BW6 A;  1ZAO A;  4D7N A;  1OIS A;  2ID3 A;  3HEF A;  4I02 A;  4IVN A;  2G9W A;  1IZ1 A;  1QZE A;  1MMD A;  2DA5 A;  1GXQ A;  5HNH A;  4IHS A;  4HBL A;  3OYK A;  2JUC A;  3OYH A;  3BPV A;  1R58 A;  2LC2 A;  1OLT A;  2K9S A;  1G3W A;  1U5T B;  2MFZ A;  3SFZ A;  3WU1 B;  3OYN A;  3ERM A;  1FPQ A;  2ECC A;  1ZG1 A;  1TWF J;  1G59 A;  1IAW A;  1QVT A;  1S7O A;  4UUT A;  4M3E A;  4A5N A;  3K10 A;  5A2Q K;  2UXX A;  2LH9 A;  1K79 A;  2KIF A;  2B0L A;  4AIK A;  1HW2 A;  2DMN A;  4OIP F;  3IUO A;  3Q0V A;  3J7A Y;  2VXZ A;  1TT0 A;  5J8F A;  1G6N A;  2FE3 A;  4FAS D;  3LNQ A;  3BJA A;  1SD7 A;  1ZGA A;  3VWB A;  1ETY A;  2VQH A;  4M3G A;  3T5X A;  3KP2 A;  5J1R A;  4WWC A;  2V9V A;  2RQQ A;  2R5Y A;  2F5D A;  1ZK8 A;  2O6G E;  1JGS A;  2LFB A;  4QPO A;  2W48 A;  1T95 A;  1YJ9 I;  4RB3 C;  1VQN I;  5M3M J;  3QOD A;  1FYK A;  2JTV A;  3TO7 A;  4E70 A;  1W0T A;  3FXR A;  2E19 A;  4XKW A;  1WFX A;  4DW6 A;  3WE3 A;  5CVI A;  3W2W A;  3RZO J;  2E1M B;  4WXD A;  3FX3 A;  2DW4 A;  4RMN A;  3K9T A;  2FML A;  3GTG J;  2XIG A;  5E8I A;  4AIJ A;  4B8X A;  1ORK A;  2AXT C;  4E7S A;  2YU9 J;  1RUN A;  4HW0 A;  4PUS A;  1STZ A;  1AWC A;  3WTU C;  2P5L C;  4RGS A;  1IGN A;  5D5U B;  2O9L A;  5ED4 A;  4XLA A;  1T8I A;  4E7H A;  2LNB A;  2IW5 A;  2K9Q A;  5GAG J;  2PJR B;  2NVQ J;  2M0M A;  2W25 A;  3JRH A;  2VLA A;  4GRI A;  1K83 J;  4IRH A;  3O3K A;  3AKZ A;  5B1B H;  4EJU A;  1YO5 C;  2V79 A;  3TW7 A;  1IV6 A;  3GZ6 A;  1FTZ A;  2BBY A;  3P9I A;  1V5F A;  4XKB A;  4HNU A;  1DPR A;  2XB0 X;  5EF6 A;  1KQ8 A;  3HOZ J;  5E8G A;  1I6H J;  4JX4 A;  5EEH A;  3PSI A;  1MBJ A;  2A6H F;  5AIP A;  4ZZL A;  5CQG A;  2PLY A;  4ZYA A;  1QA6 A;  2LMD A;  3IC7 A;  1P6R A;  5B5E C;  3PO2 J;  4M6Y A;  1KA8 A;  2MD0 A;  1E0E A;  1Y8R B;  2KJC A;  4G9Y A;  1NG7 A;  2LKP A;  3JRA A;  4AVP A;  2ZB9 A;  3CUQ C;  1V55 H;  1JKR C;  2WTE A;  1GHC A;  2ISZ A;  3DLA A;  4W1U A;  1R9T J;  4A3D J;  2IPQ X;  2MYS A;  3ZQF A;  3GZ5 A;  3ZGK A;  4M72 A;  4LLG F;  2FX0 A;  1NG6 A;  4IRG A;  3HIF A;  3WHB A;  3R0A A;  2WB1 A;  4KIG A;  1BR1 A;  1NHA A;  4L9T A;  2JVH A;  2MSY A;  2F5F A;  4MNU A;  1BJA A;  4XKC A;  3WTZ A;  2D45 A;  4BL0 B;  2LSO A;  5DYM A;  4ESF A;  4AIH A;  1IC8 A;  1JKO C;  2JK3 A;  2HXI A;  2QBY B;  3D5S C;  3L2C A;  4DIQ A;  3QPL A;  1RUO A;  2EFN A;  3GCM A;  4UB6 C;  4BU2 A;  4ITV A;  1A35 A;  1B72 A;  5DD4 A;  4PSW A;  2L9R A;  2F4M B;  1LDD A;  1IRZ A;  2HYF A; 
#chains in the Genus database with same CATH homology
 3WG7 H;  2ZXW H;  5IY5 H;  1OCC H;  3AG3 H;  2DYR H;  3AG2 H;  3ASO H;  5B1B H;  1V54 H;  2EIJ H;  3X2Q H;  2DYS H;  3ABL H;  3AG4 H;  2EIK H;  5B3S H;  1V55 H;  2EIL H;  1OCR H;  3ABK H;  3ASN H;  2EIN H;  3ABM H;  5B1A H;  1OCZ H;  1OCO H;  2OCC H;  2EIM H;  2Y69 H;  3AG1 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...