3ASOH

Bovine heart cytochrome c oxidase in the fully oxidized state measured at 0.9 angstrom wavelength
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title Distinguishing between Cl- and O2(2-) as the bridging element between Fe3+ and Cu2+ in resting-oxidized cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 27
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3asoH00
1OCOH 3AG4H 1V55H 2ZXWH 1OCRH 3ABMH 3WG7H 5IY5H 5B1AH 3ASNH 5B1BH 2Y69H 3ASOH 3ABLH 3X2QH 1OCZH 3AG2H 2EILH 3AG3H 2DYRH 2DYSH 1V54H 2OCCH 2EIJH 5B3SH 2EINH 1OCCH 3AG1H 3ABKH 2EIKH 2EIMH
chains in the Genus database with same CATH superfamily
2DT7B 4GDFA 2CQKA 5FLVA 3CP8A 1LEBA 3DU5A 3R61A 1BI2A 5D5XB 4HQEA 2OJED 1JKQC 3WG9A 3OIOA 1ZAOA 2A61A 4JYKA 4BQNA 3FXOA 2VT3A 3I0TA 1I5ZA 4I0BA 3F9KA 4HV6A 3CUOA 2LLKA 2VBYA 1TQIA 1ENHA 2KLOA 2XGEA 4EQQA 4HZFA 2Y75A 1SVOA 5DCFA 5CQGA 1OJLA 4UB6C 4EEFG 2UZKA 4H0EA 1YRNA 1X3UA 2R93J 1TC3C 1Y8QB 3CO6C 3ULQB 2XROA 2EJRA 3F23A 2B0LA 4XLAA 2PLYA 1DPUA 1WKMA 3IUOA 4YFXF 1ZHFA 3IP4B 2EFQA 5B66C 4L18B 2YR2A 2GXGA 2J5OA 4G6QA 3WE3A 4PCQA 3OS2A 3HUGB 1K78B 1T56A 4RB3C 3QP5A 2F5CA 3QYEA 5DUKA 4RGRA 1S3JA 3HOTA 4YELA 2K9LA 1OYWA 2MA3A 2L4MA 5JFRA 1WPKA 2WADA 3OOUA 1Z9CA 3EYYA 1LQ1A 5HLIA 1EV7A 2JUGA 2ZO4A 4IQ4A 2EZHA 4IXAA 1X4OA 2XV4S 1ZR4A 5IP6A 3JTHA 1LB2A 3LAJA 1HDPA 3QYBA 1X2NA 5CVVA 1FP1D 2BVMA 2Z3YA 5ED4A 2R0QC 3TO9A 1Y1WJ 2DA7A 4KISA 3K70D 2ECBA 1ZKGA 4Q48A 3LQQA 3U1KA 2A6EF 2F6CA 4BH9A 2R5ZB 3EDPA 4IHXA 2HS5A 3F22A 4RAYA 3WU0A 4N4NB 3ECHA 4CYDA 3AL0B 1SEUA 1Z0XA 3E6DA 1R71A 1RI7A 5ERIA 5CQEA 1S8NA 2K3PA 2YU3A 3BPXA 3FM3A 1K7AA 1FWZA 3G1LA 3Q9SA 3I58A 3OYKA 4B4CA 4E7JA 3H1CA 1J9IA 1F1ZA 1FPQA 2W24A 2XPWA 4J00A 5EJCA 4ZC3A 1YLFA 5LLQA 3VYSB 4S05A 3C18A 4DYCA 2RDPA 1VQ9I 3H35A 4DYQA 2QQAA 3E97A 1S72I 3CMYA 3HBLA 3AL0C 2Y0MA 3HTSB 4PK4A 5EEGA 1TTYA 4G94A 1WFXA 2O3FA 3FK6A 3IHUA 1KU2A 2RN7A 3H9GA 2E60A 2G0EA 3F3XA 4C2MJ 3WG7H 1WH5A 3F0CA 2CUEA 1REPC 1BC8C 4HF2A 1SD5A 3MCZA 3IKVA 4XLPF 3QPLA 4G7OF 1VQKI 2VE9A 2DBBA 2FUG2 2KJBA 4CCKA 4H4KC 4E7KA 1MKMA 2IA0A 1R23A 1FMVA 2DA5A 3J81Z 1DQUA 1MBKA 1P4AA 2MGQA 1SFEA 3H92A 3I64A 2DMNA 4Z6YA 3OYEA 3LSTA 1S6LA 1K78A 3DPUA 1QRYA 2KIUA 3HUGA 3K4KA 3QAHA 2BEOA 3RKYA 4O5VA 4XLHA 3ZQQA 3FWEA 3CJTB 4GGGA 3R6SA 2EFNA 2X9DA 3RKQA 2QF7A 3JRIA 1JHHA 5FRNA 3GVAA 3OSGA 2ID3A 2ADUA 3OL3A 4Y52J 2J5PA 4DBRA 3PSIA 1HKTA 4E7ZA 3I59B 3PUBA 3L00A 2GIVA 3KEOA 2WA0A 2JVHA 2LY1A 4LLLA 1I50J 2VXDA 3S2HJ 4F91B 3HRTA 3BZCA 3ML6A 4U7BA 3PO3J 2PMHA 3GFJA 4BY1J 5FD6A 1QZEA 5K7ZA 4YEJA 1T0FA 3IWZA 5GAGJ 2VIXA 2EZIA 3HDDA 2HDWA 3O3KA 3BR1A 3BWGA 4NBQA 1F4KA 5D4SA 2Y69H 4HLXA 3KP7A 5M5XJ 3H3UA 2L4AA 3AFHA 4EJVA 2VUMJ 3S93A 1JTXA 2NS0A 3QYFA 2N8GA 4EJOA 2KIFA 1QZYA 1ZARA 4HOBA 4L0ZB 4P9UA 3VSLA 4Y7NJ 3KLNA 3JREA 1UJ8A 3JRHA 3FXLA 1ZTRA 1RIOH 2ZBKA 1XMAA 2IRFG 5F0CA 2PG4A 2ZSHB 3BOQA 1VQ8I 1B4AA 3PL8A 3EUKL 3M07A 4NC7A 4GXOA 5J8FA 1YHQI 2ZFUA 4XKCA 2LR8A 4HNTA 5IYBJ 1U9OA 2HWVA 4WCGA 2DPUA 1HDDC 4EJTA 5D6FA 3V7RA 5FKOA 1OYIA 5DEQA 3CO7C 3OY9A 2HOTA 1YQAA 2WB1A 2FF4A 1R5ID 3K69A 1FBUA 3SEZA 1IXSB 1LDDA 2KRFA 5DM7F 5B5EC 1D1AA 1TWFJ 4BQQA 1BJZA 3QWLA 4A69C 2VQLA 4U7DA 2LTPA 3CUQC 1IF1A 2Q2EB 4CICA 1I27A 1XGSA 5M3MJ 3KP6A 3ISPA 3ZMUA 4KITB 4L9NA 2VPRA 3K7AJ 5D5VB 3AG2H 2DOEA 3F8MA 3U2RA 5E18F 4A3GJ 3CCUI 2GA2A 4HF1A 1V5GA 3SQNA 4HDUA 1D0XA 5GAEJ 4FHTA 2EH3A 1J2XA 3TEDA 2VBXA 3FX3A 4IRGA 2HXOA 5CVRA 1MBGA 2E7WA 1HA8A 4HBLA 4N9IA 1TWAJ 3HGYA 4OMZA 1M1EB 4LMYA 4J01A 4WX9A 3I59A 3DFGA 2EZKA 1MBJA 1UZCA 4AIJA 1H89C 4KFCA 3P9CA 1XTAA 1ZRCA 1B72B 5K7FA 2KIQA 3FXUA 3MQ0A 3CF5F 5HLHA 1ZG5A 3JRBA 2JK3A 1FYLA 2PMZA 3MFKA 3DLLF 1WJBA 4M72A 5DUIA 2M87A 1ZH5A 1PUFB 4P55A 4AWXB 2ZNYA 1IRXA 4DNCA 3VODA 1USTA 2KKOA 3KYDB 5LD2C 1XB4A 3E6BA 4IX7A 2BV6A 4TV7A 1D5YA 3L2WA 3W6VA 3ZRGA 2E1MB 3EUHA 1RRJA 2CGPA 5A2QZ 3MZHA 2Q1ZB 1WVRA 3DU6A 2AXLA 3LL7A 3TO6A 2QCOA 3ZQ7A 2CO5A 1ULYA 5HVQC 1D1BA 1OFCX 1W0TA 2V26A 4ZDPA 1MNMC 1GHCA 3SZTA 2CRGA 4RA2A 3GBGA 4YIFA 1U8RA 3C3WA 3QQAA 1XGOA 4GCVA 5D6EA 3VYRB 4XKBA 2EV6A 3Q9VA 1RR8C 4CDGA 1T38A 3NWTA 3S32A 4BXUA 4XRSG 4LK1F 1ZRDA 1ETKA 2E1MC 2YX4A 4XIDA 1IUYA 4ZDLA 2P7VB 2QZ8A 2DQLA 2NVUB 1X3ZB 5EG0A 3IH4A 4RM2A 3F8NA 3JAMK 3QOEA 4KJZA 5FJ8J 1FSHA 4U0YA 5JLXA 4MQVA 1NH3A 5K5QA 4XBFA 2GXAA 4RM3A 4YFKF 4UHTA 2ZXJA 1AHDP 2VN2A 3FXMA 4A12A 4IEJA 2RVCA 1ETWA 3BJOA 4P1WA 2CG4A 1J0RA 1TT5B 1E3OC 1WHUA 3P7NA 3OIPA 2FRHA 2JPCA 1WJDA 3WHCA 1HKQA 2JQ7A 1JJ6C 2ISZA 1DGWY 5ICCA 1R36A 3TW7A 5FB2A 4RAGA 3CJQB 4LJZF 5HLGA 2KMUA 3BQYA 1QHHD 4RGUA 4J19A 5LHIA 3TDUC 2QSHX 1DU0A 3O8HA 3ZMZA 4X1EA 1X1CA 4LG0B 5KK1A 2EZLA 4WF2A 3G71I 2DA3A 4Y15A 1YW7A 3BTIA 4D5CA 2IGKA 4LB5A 1FIAA 1B72A 1MIJA 2CWEA 3K4BA 2ZJPF 4KIFA 2XRLA 5E1XA 2L9RA 4OMYA 1F9NA 3I54A 1A36A 1Y0UA 2QVOA 1PUFA 2XKOA 4M3DA 3IH3A 3BTLA 3D5LA 2WB1N 2DT6A 1IUFA 4HG2A 4NB5A 4MEYF 2V4JC 4BQOA 1R4NB 6PAXA 2DDBA 3H9QA 2NNNA 3ZQFA 2MC3A 3V7CA 5H20A 4CCLA 1QNTA 1XDSA 3W2VA 3FKJA 4AD9A 1UHSA 2JMWA 1KU9A 4OIRF 5C4JJ 1E0EA 3RKXA 4XKWA 3HEFA 1MBHA 4LB6B 1SD6A 3H0GJ 4LG3A 1MH4A 1CF7A 3WTYC 2RC4A 2O7OA 2D1VA 3M8EA 2HPMA 1F5TA 3JSOA 4RLQA 1G4DA 3FXKA 4KICA 4KMUX 3DLAA 4NNJA 3ZMTA 3MKZA 2R7OA 4B3AA 2MD5A 5EZGA 4B43A 3UKGA 2MH9A 4LLNA 4I2OA 2DK5A 2IA2A 3FBIB 3BR0A 3BG3A 2ELHA 2QSGX 1MMNA 3K9TA 3I71A 5IOZA 4FASD 4LOCA 4IHWA 3E1SA 2CW0F 2OZUA 2FD5A 2HI3A 3Q0UA 2QKMB 5M3FJ 1POGA 1LVKA 4BAYA 1MBEA 3GEZA 5KAIC 2LDUA 4AYBA 2L3DA 4CCOA 1QHGA 3V8KA 1XSDA 2P81A 4XSZF 4CYCB 2M9HA 2R7RA 3KX2A 4A3EJ 1QVUA 1IRGA 5GPCA 1B8IA 2TCTA 2X6YA 5CVJA 4FETA 1K6OA 1P7IA 2VXZA 3MN2A 4E70A 2K02A 3BC8A 1HXDA 1R1TA 4ZYHA 2F4IA 3OYGA 4LLGF 3ZP5A 3HSRA 1XCVA 2GBYA 4I0AA 4I09A 4QWQA 4LG0A 3RTRA 4KNYA 1I1SA 1X58A 4PFOA 2QKLB 1E17A 5J6XA 3GTOJ 1IW7F 1C0WA 1U8BA 2CJJA 3CCMI 1D0YA 1JXSA 4II3A 1U0JA 4IOCF 2VASA 3O8GA 5LRRA 5AONA 1SAUA 2KDZA 1VI0A 1U2WA 2NOJB 1Z1DA 3I53A 5DCMB 3HOVJ 3FKIJ 3LSMA 2ZC2A 1TT0A 2KT0A 2EBIA 1FZPB 2IA1A 2G9WA 2DMUA 2QUFA 1R22A 2DFIA 3CLQA 4DOZA 2XB5A 4HX4A 4EVIA 3WGIA 3JRDA 3S3OA 2NS8A 3GCMA 3BZKA 4M6VA 4M3EA 2BY2A 1UHWA 3HOXJ 3A0BC 1FTZA 3HC7A 2O03A 2CUFA 3GZ6A 1IRFA 2ID6A 3O2PE 1MSEC 5HOOA 2WAQN 1U9NA 3R0AA 3TW6A 4XOTA 2M4GA 1YJWI 1WI9A 2R7FA 1Z7UA 2XPUA 3FK7A 1OMIA 3PQJA 1YO5C 2L9NA 4UXNA 1VQNI 1RR7A 1FBQA 3IV5A 3ELKA 1GUUA 4BXFA 1MMSA 1ZRFA 3JCUC 1R1VA 2W82A 2HZDA 4BQAA 1LFPA 4MTEA 1IGNA 1YW8A 4OOIA 3VWBA 3TOAA 3IL2A 4WK8F 1SC7A 3A4CA 3BPVA 1DDNA 5E3OA 1HSTA 2W1OA 2V9PA 4EMSA 2JRTA 3CCEI 3DTIA 3CMEI 4BHCA 1OCZH 3L09A 3S8PA 2K4JA 5K1YA 2V9VA 3TMOA 3M3YJ 2UWMA 5KVRA 2X1CA 1QVTA 5LHHA 2EIJH 4F7ZA 4C30A 4CYCA 4XNFA 3AG1H 3GTKJ 4M6YA 2BY1A 2EIKH 4XR6A 4QLCU 3W6KB 2DQRA 4BDYA 2HDCA 2EA2A 2JA6J 1S7OA 2VQHA 4NUBA 3DKWA 4XORA 1JI8A 1O57A 3FXJA 4C2UA 2ZJQF 2P6SA 3GXOA 2NOGA 2ACJA 2E2IJ 3JRCA 2Z9OA 2IPQX 3BLYA 2H27A 1AOYA 4KIBA 3NQOA 1UFMA 1YX3A 1ZYRF 2OPTA 1SVLA 3F8FA 4CA0A 3OYFA 3FDYA 5EGOB 3HZJA 3LNQA 4DBQA 2E1OA 1FMWA 3OWTA 4HA8A 1A5JA 5H6RA 3K6GA 1XG1A 4L9JA 4PDKA 1XC5A 3TDZC 4CO8A 3KETA 4HV5A 4IVNA 5DCMA 1TWGJ 4IHYA 1GLNA 1Z6RA 1TQPA 4HYEA 3C2HA 1OYYA 4DGWB 2COBA 3OYNA 3ASOH 1W1WE 3PM1A 3CJNA 3X2QH 5HODA 1WSUA 5F6FA 2JA5J 2BVLA 1KGSA 2LP0A 5AIQA 2XF6A 3S1MJ 4FX0A 4B09A 1HBXG 2VBWA 4A93J 4A6EA 5BPIA 1ZG3A 4R1HA 1I1GA 1QPIA 3IH2A 3GTQJ 2R7SA 1HW2A 4LIVA 1X2MA 4AYBN 1YW9A 2LKXA 2W84A 1SMTA 3HM5A 4AUXA 1W36D 1NHAA 3ONQA 2XVCA 5H6QA 4LITA 1ORKA 1VQ7I 1EH6A 1ZN2A 3N05A 1CQTA 1T33A 3OS1A 3DCFA 3V42A 3AG3H 2FQ4A 4EJWA 2DJIA 1VTNC 1IV8A 1LDKB 3R60A 1N75A 3K1NA 4P5OA 1XGNA 3HPHA 1MMAA 2BOLA 1LNWA 1V3FA 1FIPA 4F93B 3FMQA 4ZDOA 3PQKA 2H6CA 4E7SA 1GV2A 1R5HA 3DBRB 4ESJA 4OWRB 3GFIA 4AIKA 3HOZJ 3E5XA 3KP2A 2BHZA 3LWFA 2DA6A 3KZIC 1T98A 1WGXA 3BP8A 3COAC 5FO5A 1Z77A 1G8XA 1JTYA 2LMDA 4I02A 2XAHA 5E79C 2PBIA 4ZZLA 1LUJB 2GXBA 3WTWC 2OCCH 4BL0B 3SFIA 4NDLA 4M73A 2E35A 4C9YA 5BMZA 4XLNF 1RETA 2ME0A 4PJMA 5HS7A 3PNVA 3BJ6A 2QQ8A 3BDDA 3KFWX 2BW3B 2DJNA 4RB1A 5GTHC 1W0UA 1T0FC 3OYIA 4RMNA 2DT5A 3HPGA 4JP0A 2H94A 1BOBA 2XASA 3MVPA 5EGOA 3KPHA 3KZZA 3RYPA 4CZZA 1YJNI 2HOEA 3BT9A 2XF5A 4XRSA 2K9NA 5IT9K 4HPQA 2FQ3A 3HKZA 3RCOA 3VPRA 5LEKA 3H3ZA 5BPDA 4MO7A 2JSCA 5TRDA 1I6HJ 3JRAA 5J1YA 1YOVB 4G7ZF 1UB9A 3M9AA 2IS2A 1BW5A 1I3AA 2VC0A 3JW4A 4GYGA 3FXQA 2K4BA 2Z5UA 3QODA 1PJRA 3EETA 4I01A 1IDYA 2FEZA 3EUAA 5DYMA 4DIQA 3WTTC 3WTXC 2JA7J 4XRFA 4FT8A 5HS8A 2M5WA 4U88A 4B1RA 2ZJ2A 2QSFX 3HRUA 3JR9A 3SFZA 4BJ6C 1L0OC 2ZFWA 2LRDA 2JN6A 1MZBA 2JT1A 4GO1A 5F1JA 3W2WA 4KT6A 4R8HA 1IZ1A 3SJMA 1KU3A 2LOOA 3BG9A 2IT0A 4NHJA 1S7AA 1J75A 1Z05A 4JX6A 1TZLA 2FNPA 2F4OB 2LYCA 1N77A 5KNLA 4FE4A 4BY7J 4MFEA 1LDJA 4CZCA 2TRTA 4N0BA 2WY8Q 1ZGAA 2QQBA 4D5FA 2DA2A 1TW3A 2KDOA 4G8XA 3QU6A 1JT6A 3S2DJ 2XC7A 4BJTA 4BXXJ 2VODA 4FX4A 3JAMZ 4P9FA 1RZ4A 4IHSA 4OINF 2QEXI 1GVJA 5FLXZ 5E17F 2ECCA 2IGNA 2RGVA 4MQ9F 4D0PA 3K10A 1OCRH 2XB0X 1IJWC 1XSVA 4QTRA 1Y56A 1DP7P 4IL6C 1MMDA 4XICA 2O9LA 1BOAA 3UNGC 4A3JJ 5CLSA 2YX7A 2OV7A 1V5EA 1O3TA 3FISA 2KFDA 2P5KA 2WAFA 3A1YA 1VNDA 4BBRJ 4XMYA 4ZH4F 2CV1A 1STZA 2BXZA 4RGSA 1IRZA 1P7JA 3QP6A 2PMUA 5FGMA 1ZGJA 2BW3A 4CCJA 2TDXA 2VOOA 5DV5A 3ZMVA 2HOAA 3TQNA 3GTJJ 2PJRB 4JQFA 4B48A 9ANTA 1EH8A 2P5VA 1XX5A 4PGGA 4EV0A 3CCLI 2ZMEB 2V6CA 2E34A 2F5FA 2HU9A 3VYUB 3S1NJ 2HQNA 3RJPA 2Y48A 2RNGA 3BR6A 4L5JA 4YIIA 3I56I 3EYIA 4CGZA 4UV8A 5GP9A 3FMRA 1UCRA 4HW0A 1A35A 3EUHC 2L02A 3KLOA 3SEQA 4BKXA 4XRMA 4L5EA 1VQLI 1FOKA 2HQAA 4XKVA 4XQFA 5EG0B 1B9MA 2FBKA 2ICWG 3CCQI 1ZELA 2P8TA 2K5CA 2Y9YA 3HL2A 1W4MA 1RNLA 4KIGA 1X1AA 1W36C 2FNAA 4G6DA 4ITVA 2F5EA 3SYTA 4XLFA 2AQEA 4B44A 4DZJA 3RPUA 3KIOA 1T2KA 2BYVE 1AKHB 4YRVA 3A02A 4AVZA 1EJ9A 3HRMA 3L7WA 3REOA 3B02A 2V1DA 1QBJA 4I7HA 4HQMA 2OQGA 2OUMA 1N78A 4HAMA 1RC9A 3IAS2 1YJ9I 2BZTA 2CMPA 2M1BA 1K4SA 3MZ8A 3LOCA 2ESNA 1U5TB 1FNNA 2XUBA 1IN4A 3IRQA 3QPTA 2YPRA 2L9SA 2A07F 1U78A 3K2ZA 1UHMA 1SD4A 2H09A 4ZTJA 1HKSA 2LFBA 1FYMA 2RQQA 3CDHA 3J7YJ 3G3ZA 1FBSA 3V8LA 4DZPA 3E6MA 4ZYEA 4HNVA 1EA3A 3ZGKA 3MMYB 4HX8A 4AVPA 4BUPA 4U0WA 4C2TA 1MNDA 3DWLE 5J47A 2GOXB 1O7LA 2W00A 2XDVA 2R7ZJ 1O7FA 3HIFA 2ZXWH 3EQLF 4FCYA 3KE2A 5LRSA 1I3QJ 2QM3A 4A3DJ 1G6NA 4A5MA 2NS7A 2R7VA 2B63J 1Y1VJ 3HXLA 4B8XA 1ZR2A 2P6TA 2IS6A 3J7AY 3NRVA 2R7QA 4QPQA 3H0DA 2F2EA 1X19A 2PJRA 1CF7B 2ELKA 3NARA 2ZKZA 4AC0A 3Q0VA 2V1XA 2Q0OA 3WTUC 1W7PD 2R3SA 2L0KA 4ABZA 1K79A 2ZMEA 2VQCA 4Q47A 3LSGA 4NC6A 4HX7A 4B3XA 4RGXA 5IP7J 3S1RJ 2JVGA 4OIPF 1ZK8A 2EB7A 2LVSA 3W2AA 1WJEA 1KYWA 2GQQA 2OD5A 3K1MA 1OR7A 1DUXC 2O8KA 2XAGA 1LFBA 1G3TA 4BGDA 1J5YA 2HVQA 4P96A 1D3YA 1BR2A 5FKNA 1DP3A 2BE5F 1S7EA 4NC8A 5KAFC 2GAUA 4BE1A 3B6CA 4XONA 4EM0B 3H5AA 3WGHA 4E7LA 1X3WB 1AKHA 3C7JA 3H5RA 2G7UA 2M8EA 4M3BA 3OYDA 3M1CA 4GRIA 1FLIA 1U6GA 5KCMA 3GYHX 1H8AC 1GXQA 1B8IB 4UUSB 2VBZA 3BZ6A 2C6YA 1XMKA 2X6WA 2FA5A 1FY7A 3CCJI 5CPRB 2CSOA 3I55I 4S04A 1P92A 2UV1A 3OSFA 2OTJI 1KQ8A 1U5TA 2EIMH 2WV0A 4HSRA 4UVAA 2XSDC 4D1QA 3FHZA 2A3SA 2HZTA 2LSOA 2XPVA 2XGDA 4E6KG 1FC3A 3D0SA 4F52A 2X6OA 1G2HA 1PUEE 4JBAA 1P2FA 2CQ7A 2MABA 1HW1A 4XN0A 4S0HB 5ILUA 4E7IA 2R7WA 3GO5A 2HVRA 4ENMA 3Q5FA 1HC8A 2IW5A 2H8WA 2KRCA 4LIUA 1OPCA 3T8RA 3V4GA 4W97A 3VYTB 2W4SA 1L3LA 1NK2P 4U0VA 1MDMB 3FBNB 4Y33A 5EEHA 1MH3A 1BBYA 5C44J 3VB2A 1Y0NA 3KP3A 2V1NA 1SAXA 4I76A 3RDIA 3BCBA 4FTHA 2DU9A 3GTGJ 2ME6A 2M7AA 1F43A 2X0LA 3QPSA 3FIWA 2HTJA 1FEXA 2DO7A 1A31A 3Q3SA 3DKXA 3JRFA 3RZOJ 2JTVA 1ONVA 3L2VA 3S14J 3S17J 1O3QA 1Y8RB 2IEKA 1SFXA 3CCYA 3L9FA 2A68F 1VQOI 2F5DA 3A01B 1SFUA 2PJPA 1ITYA 1WZ2A 1XPXA 1BIBA 2FMYA 2DFFA 3SDBA 3LA7A 1I6XA 3RZDJ 1YS7A 3A03A 3K2AA 5D5UB 2B7EA 2CYYA 5D4RA 1BN5A 2K7LA 2MSYA 4YG2F 2AO9A 2DAOA 3KCCA 1XN7A 4XLEA 4GFBA 4KYWA 4M9ZA 1TBXA 3ZCOA 3F6OA 4JOMA 2Y0SA 1YE9A 4RB2C 2NXNB 2MLKA 2KISA 2QQ9A 3L1PA 5IP9J 3LA3A 2FX0A 5D8LB 4ENNA 1VQ4I 2PMZN 4EM2A 2HYJA 5FFZA 1VF9A 1LPQA 3E7LA 2XHKA 2E19A 2MFZA 1F36A 3CTAA 2V79A 3PNTA 3JTGA 4UUSA 1MJBA 1TWHJ 4EGYA 2L5QA 4PJJA 3MKYB 4A3KJ 2W85A 1W5CC 1JJ8C 4UV9A 1GXPA 2BY0A 3F72A 2MH2A 1XMXA 4Q4ZF 1MJAA 1UELB 5GPAA 3J7AO 2M0CA 1FYKA 4RLFA 3H9JA 1MGTA 4A3CJ 1W5SA 1GV5A 2L01A 2ZXIA 2XGCA 5E8GA 4BYYA 3DBLB 5JHFA 3GF2A 5F0FA 5J3LA 2HDDA 4RS8A 2IGMA 3GMEA 2VQGA 3SZGA 1ACIA 2LNBA 5IT3A 2VKEA 5J40A 2F5VA 1G59A 1Z3XA 4PFPA 4HNUA 1MDMA 3DQVC 2BGCA 4CXFA 4MEXF 3HHGA 1B9NA 4RAFA 2EV0A 4B47A 1S5LC 4UVBA 1YIOA 2HR3A 2FBIA 2LD5A 5BS6A 2DK8A 3C2BA 1Z7LA 4WXDA 3GX4X 1LKXA 2MG4A 1J59A 1TW2A 1R9TJ 2KQRA 4DJAA 1QQIA 2CUZA 3LSKA 5J4YA 4KMFA 3IRRA 2K9MA 2X48A 2Z2SB 2RREA 2HPIA 1EKEA 2L7ZA 5EF6A 2F4MB 3PIOF 1HCRA 3M8JA 4A3MJ 2DMTA 4BBSJ 2X1DA 2M2EA 3CC2I 4CCMA 2JRMA 4HDVA 5JR3A 3A01A 1ZG1A 2IXSA 3GWZA 3QPHA 3JRGA 2FJ1A 5IT9Z 2K85A 3OV8A 3OYAA 1QGPA 4K2EA 3OMYA 2WBMA 2ISYA 1R00A 1HOMA 2HNHA 3ZPLA 3AG4H 4L5IA 2Z1DA 3K4JA 5CYVA 1B1BA 3QU3A 4BNCA 3EPZA 3L2QA 3E3VA 2DTZA 2NVQJ 3RKWA 4ESFA 3M1EA 2V9KA 1IXCA 1XSXA 4F3QA 4U87A 3TP0A 2MLGA 1Z21A 3PSFA 1H9TA 3HHHA 2FE3A 1KU7A 1Y6IA 4CSWA 1YX5A 2VJJA 2W25A 2ZB9A 5TJJA 4IJAA 1H88C 4KN7X 5D5WB 3VFZA 1MD0A 5F04A 3BR3A 3LSJA 1TL8A 2L2OA 1TQMA 3CJRB 2Q8KA 2RAEA 4AIHA 4F55A 3SZPA 2DODA 3ZXSA 2D2WA 4IF4A 3CD6I 4PZJA 2EWNA 1Z91A 1UMQA 2X4HA 2K27A 1O4XA 2W7NA 2O0YA 3BROA 3LQRA 4L0YB 1H9GA 2IP2A 2LK2A 1T08B 2BBYA 2LY9A 3AKZA 4A3BJ 5GTIC 5DTDA 2AHQA 4N4OB 2O8XA 3Q0WA 4RAZA 4XN3A 5CKTA 1BL0A 1JKPC 2QBYA 5BNGA 3HOSA 4UUTA 2FMLA 1MJ9A 2A69F 3DBHB 1N25A 5C4XJ 2W48A 4KT5C 2KZVA 4RB0A 2GIZA 3F8BA 1KZHA 2H8RA 2ELJA 2OA4A 1JE8A 2Y0SN 4QPOA 2EINH 2KPMA 2YS9A 4IPAA 4RDUA 3S3NA 2GOMA 5TGTA 1AA7A 2L54A 2Z33A 1MW7A 3KEYA 1VQ6I 2DTRA 5JI6A 4BE0A 2IBDA 3L2RA 2KZGA 3G6EI 1SFKA 2P5LC 2FBHA 1ZGWA 1DGRM 3BCAA 3F21A 3H3VK 1ERDA 5LEJA 2NVXJ 1J09A 3MWMA 3CC4I 1OKRA 3HOUJ 4MFDA 1AU7A 3RIRA 5DD4A 1D1CA 3B73A 1BIAA 3QOPA 1HF0A 3MZYA 2WY7Q 2K9QA 2OF7A 1ZREA 1JHFA 3WHBA 3CCRI 4Y3OA 3ERMA 2EFPA 2XAJA 3M8FA 2XIGA 4L9VA 4HLYA 3DTKA 4G6TB 4IHTA 3G73A 3TL4X 2FOWA 3WGGA 4M3FA 2YSRA 2JWTA 3IKTA 1ZQ3P 1PVEA 3ZMDA 4GYIA 3PFYA 1QA6A 1QPMA 1E3HA 4M71A 5HDNA 1WJCA 5GADJ 3GTMJ 3R0JA 4IO9F 3U21A 2R5YA 2HVSA 3TBIA 1WRJA 2DMQA 5BQTA 1QO0D 2I10A 3S15J 3I4NJ 3MKLA 2K9SA 4DW6A 1BI0A 1BJAA 3S2WA 1HLVA 2ZCWA 4A3IJ 2K40A 3CQZJ 3IWFA 3L2CA 4A3FJ 1HW5A 2E5ZA 2VJIA 2V6EA 2KRHA 3ZN0A 1EH7A 3B6AA 5HDKA 1GVDA 1JKRC 1WWXA 3P5JA 4O3MA 1XCBA 3J80K 1UG2A 1OCCH 5JVTA 3T5XA 4DQ2A 2ZNZA 2PX9A 1BI3A 5LGNA 2KP6A 2DFEA 3M7GA 2OQRA 2Z99A 2H1LA 4QSHA 1TWCJ 2HTSA 4EM1A 3RSNA 4BE2A 3ZQCA 1K61A 2E36A 3BR5A 4KA4A 5IOYA 2Y31A 2EQRA 4PSWA 4OAZA 4I6ZA 2A6HF 1S9HA 4CUGA 1O3RA 2DN0A 2CV2A 4A0ZA 1IXRC 2MW8A 2CV0A 5E8IA 2O5RA 3BG5A 2OBPA 5DDGA 5L3FA 2EA4A 2P4WA 3T1BA 3CDLA 5J8CA 4IRIA 2VC1A 3HRSA 2CS3A 4V2GA 1JKOC 3ZMSA 2XAFA 2OAZA 4CHUA 1LEAA 2AXTC 5H2FC 1TNSA 5HS9A 1FTTA 4II2A 5M5WJ 3ZR8X 1QZZA 3SDGA 5M5YJ 1A04A 3FMSA 1ETQA 1LVAA 3CLOA 2K3FA 4YIRX 4X0GA 2EFOA 3G4SI 4PJNA 2CQXA 2E5NA 2PFBA 4MGRA 4JK1X 1KQ0A 5E3LA 5ILVA 2LH9A 3RYRA 3WTZA 3GLLA 3OL4A 2DDAA 4W1UA 4IRHA 2A5WA 5LGTA 1OCOH 2X6XA 2H6BA 1USSA 2XRNA 3CESA 4D7NA 3UR3C 3G1OA 4KUMA 4AU7A 1YG2A 4OIQF 5E20A 3ECOA 2BHYA 4NQWB 1VQMI 3VSKA 3HSEA 1JUMA 4R79A 3OOPA 3W3CA 3KP4A 5FKMA 2X85A 4E4HA 1PP8F 2XSJC 4M6XA 5DS9A 4AM3A 1WJ5A 2DOAA 1K4TA 1T95A 4IHVA 2KJCA 3PNYA 2JSPA 4IQJA 4ANJA 4C3HJ 2V7FA 2DFHA 3QRFF 1UG0A 2NAZA 3V7SA 1RKWA 1IN6A 3K4CA 3F8CA 3ZN1A 5K5OA 1YTYA 4KN4X 1Y39A 1P4XA 2LC2A 3TO7A 1G3YA 2R5ZA 4ENKA 1G3WA 3GLXA 3WODF 2R7UA 4MLOA 1IO2A 4LGWA 5GAHJ 3CCVI 2JUCA 5LBQA 2L7KA 3ERED 3FHNA 4V2FA 1YS6A 1BM9A 2FSWA 3CZ6A 3NAUA 4C3JJ 3ABTA 2JZYA 1WJFA 3LFUA 3W6JB 3S16J 1R4MB 4CCNA 1WJAA 2R92J 4XSXF 1ETOA 5IYCJ 3V8JA 3T8TA 4BJ5C 2DW4A 1J7KA 3BTJA 2KIMA 4XOPA 3ESWB 4ON0A 1FOXA 2VT2A 4WXCA 3KP5A 3TOBA 3I5UA 4BHBA 3CUQB 4MIMA 4A0XA 1YI2I 5J1UA 2ZMEC 3N97A 1FOYA 5J1RA 3HOWJ 3CMMA 1TLHB 5LFAA 3S1QJ 3BR2A 3VDXA 4M9XA 4O6JA 3PFIA 3NWSA 2LY2A 2XKPA 2RQPA 2RNJA 3G2BA 2UXXA 3BJAA 5DD8A 1OR7C 4I99C 3O6BB 2JA8J 2DA4A 1NK3P 2STWA 2UUZA 1DU6A 4JX5A 1P6RA 2QA4I 4DYRA 5C3EJ 1TNTA 5CJ9A 5HLTA 3M4OJ 5LGUA 1SFOJ 1Q1HA 1R58A 3F6VA 4FISA 4A6DA 4PSXA 2EFWA 1SMYF 2DA1A 5IPAA 3CP2A 4WXHA 3E6CC 5FD5A 3TP3A 1IN7A 2M0MA 3HG9A 3DKYA 2VJ5A 1RESA 5E3MA 4IKFA 3A2KA 2AQFA 3OYHA 4XL9A 3CCSI 2FOKA 1LE8B 3HKZN 1FJLA 4E7HA 4OU0A 2ZSIB 3R4KA 4C3IJ 1GDTA 1E3PA 1P4WA 5JLWA 3LSPA 1U5TC 4NQWA 3KYLA 1IG7A 2M7BA 1NG6A 3BTCA 1P9QC 4ASNA 4UNOA 2GM4A 3LMMA 1D5VA 3K70C 2VJ4A 2HKOA 5FKKA 1IN5A 3T0YA 1ZLKA 3LA2A 5IYDJ 2M4KA 4A2UA 3E5QA 2E7XA 4XK4A 2VI6A 3KZYA 3CDIA 5L3CA 4FE7A 3TGNA 2LF7A 2MC4A 3TKYA 4BU2A 1CGPA 5E3NA 5F08A 2NVTJ 3ZQLA 2LREA 3CF2A 1JGSA 4M9SA 1YIJI 3ABMH 1JGGA 5F0HA 5EEAA 3N4MA 1BA5A 3I3LA 1O3SA 1WCMJ 1NG7A 2VE8A 3VEPA 3ZQGA 3D1NI 2O6GE 4N9HA 1D8KA 1ZLJA 2M30A 2EK5A 1ON2A 3U9GA 3OYBA 1RPWA 4PGHA 1WI3A 5F64A 4BEHB 1T39A 2VOPA 5CVIA 4UUVA 3GFLA 2X1EA 1T8IA 2LKSA 3FM5A 1V54H 3J81K 1IV6A 3D5SC 3MD2A 3CUQA 1G3SA 2E71A 2XGXA 4IZZA 2VONA 1OISA 2GZWA 3WTVC 4I98B 3K0LA 2HFHA 2R7DA 4BHPA 3HB9A 4BACA 3D5RC 4BDZA 4AIDA 4UY8I 1D0ZA 2E1NA 3ASNH 3ZOBA 1I39A 3A0HC 3ABLH 5FRMA 3PO2J 4ZZDA 4IOAF 2OU2A 5JVGF 3CMAI 1A6IA 1LJ9A 5FLXK 2K86A 2Q2EA 2D1HA 1IC8A 1LFUP 3BG7A 3H36A 1IDZA 2IAIA 2CFXA 5DM6F 4KDPA 3E0JB 4CH7A 5L3EA 4ZTFA 1JT0A 1FX7A 2OCEA 2WAQA 4FQGA 4Y4RA 1U3EM 2DCEA 2NNYA 1JUSA 3K4NA 3RI4A 3LSIA 4L9TA 2E2JJ 4MNUA 2QENA 2FU4A 5TISC 3PIPF 2ZXHA 2KL4A 2HYGD 1PP7U 1R1UA 1ETXA 2LG4A 2Y2ZA 2Y9ZA 1LE8A 4V19K 4LD5A 1DPRA 4MHGA 3KYCB 2CQNA 1BC7C 2P0WA 2VL8A 1VQ5I 3WTSC 3DV8A 1BR1A 2GA1A 2HYFA 3JSPA 1B6AA 2M3AA 2H1KA 4A5NA 2XAUA 3DEUA 1JUPA 2L7MP 1FP2A 3ZQHA 2LBFB 2YUSA 4JX4A 1SVMA 2XF7A 2WAEA 3DEWA 1KQ9A 5FKLA 3HJEA 3I4PA 2RV8A 2HQ5A 1IN8A 2PEXA 5KHDA 1XD7A 2VPLA 1ON1A 2EILH 1NTCA 3IC7A 1FOWA 1WQ2A 1KA8A 3LSHA 2B9SA 4G7HF 1D8JA 1XDUA 1MBFA 1OLTA 2CW7A 2DOFA 4HEA2 3AAFA 5K5RA 2VKVA 1FSEA 2VB6A 4ZYAA 5L3DA 3OYLA 3ZQIA 1H0MA 2E1CA 2LF8A 1K83J 1IAWA 2HOSA 3FZVA 4G12A 2JA2A 4BEHA 1VFCA 2STTA 2QLZA 3DTEA 2MBFA 3DF8A 3BQZA 1RUNA 4Y17A 4EGZA 2HQRA 2VKHA 4ZYGA 2CFOA 1X1BA 3K4LA 5JHUA 2DI3A 5E1WA 5ICEA 4ZJZA 3P9IA 5ICGA 1E2XA 2X51A 4A3LJ 2COMA 4LK0F 2WWYA 3RQ4A 5FROA 2P7CB 3GFMA 1RUOA 3FXRA 1R6RA 2Z16A 2CU7A 1EF4A 4M74A 1APLC 2M45A 3G1MA 3WE2A 4ETSA 1PDNC 1UAAA 1TP4A 5B1AH 4WWCA 2ETHA 5ILSA 1S29A 4HRIA 2IS1A 3GUDA 5B1BH 2R4GA 4HSTA 3K1PA 3GW2A 4G9YA 3MKWB 1Z67A 1HSJA 2BY3A 2QYOA 2CW8A 2PI0A 3HTUA 1V4RA 2L9VA 2YU9J 2A5YB 1HQCA 2DYSH 1A6QA 5D8KB 4F92B 2DPDA 1T6SA 1V5FA 4PJ0C 5F1RA 2XAQA 5LHGA 2IJLA 1XGMA 2WC2A 2PN6A 2GLOA 2W57A 1SANA 2LKPA 1Z3YA 1W5TA 4X6AJ 1ETVA 2G7HA 3IAM2 5A2QK 2KHMA 3OR2C 2Y30A 4EATA 1WH7A 2GWRA 2E2HJ 1Q1VA 2UXNA 3I4MJ 2FXAA 2OZ6A 5E1ZB 2D5VA 2QBYB 3DEEA 3PJRA 5EYRA 2HKXA 5HDGA 5B3SH 3P9KA 2IVMA 1W7PB 2NVYJ 2LBFA 2O61A 4MTDA 2AS5F 4Q5SF 1OCPA 1RKTA 5L3BA 5L3GA 2WV1A 3LFKA 2DMPA 3L2UA 4OAYA 3RPQA 2I8DA 1R49A 1MMGA 3OYJA 5F27A 2JPBA 3VOEA 3DXJF 2M34A 3SXYA 4YFNF 2NRAC 4ESBA 3MAJA 4Y13A 1XS9A 4UB8C 1SD7A 2DYRH 3ROUA 5HNHA 2PQ8A 2JJ7A 4UVCA 1YFHA 2RKHA 2DXIA 1PYVA 3J80Z 2HEOA 5AIPA 1AWCA 2A6TA 3FF5A 2D45A 2EPFA 3OS0A 2CQQA 3BG6A 1YRNB 3DP7A 1OQYA 3HSFA 4HF0A 3C2GA 1GT0C 4XLCA 4LFUA 3I9V2 1VZ0A 5CVUA 2A05A 5FLMJ 3NEUA 2BXYA 2ZJRF 2QWWA 3E5UA 5ICFA 4ZYDA 2CH0A 3RPUD 1K6YA 2OTLI 2QGUA 2VKDA 4D9JA 2V1UA 3GTPJ 2DLLA 1BR4A 1YITI 4RBOA 4M3GA 3ABKH 4OIOF 3KEQA 4XM3A 3HYIA 3DPTA 3K4MA 2M8GX 2OC6A 1V55H 4D7MA 3SHFA 3LAPA 5FFXA 4PUSA 2R5YB 4ENJA 2MD0A 1X1PA 1ETYA 1FT9A 3OIQA 5EZHA 4EJUA 2VLAA 1Z6TA 3CC7I 2I5UA 5EDNA 3GZNB 3GTLJ 2IS4A 4PJLA 3MEXA 1MNEA 3S3MA 2R7TA 1OCTC 4QIWN 2F48A 2CUJA 3ABUA 4A0YA 5BOXA 1MSFC 2R7XA 1QU3A 1B59A 1KONA 5HNFA 5J4VA 1VQPI 2WTEA 3LSRA 3GZ5A 1R5GA 3H5NA 4Z2YA 2HGCA 2EV5A 1BI1A 5IY5H 3OYCA 3HGGA 3PUFA 3HOYJ 3WU1B 1BW6A 2HXIA 4BS9A 2L7FP 3DPLC 1ODDA 1X1DA 5K7HA 2NYXA 3OYMA 3RQIA 1W7PA 1X4PA 1R7JA 3BY6A 1YYVA 3U1DA 3J7ZI 1KYZA 2ESHA 2IGOA 3OR1C 3C1DA 3WU2C 2MYSA
chains in the Genus database with same CATH topology
1OCOH 3AG4H 1V55H 2ZXWH 1OCRH 3ABMH 3WG7H 5IY5H 5B1AH 3ASNH 5B1BH 2Y69H 3ASOH 3ABLH 3X2QH 1OCZH 3AG2H 2EILH 3AG3H 2DYRH 2DYSH 1V54H 2OCCH 2EIJH 5B3SH 2EINH 1OCCH 3AG1H 3ABKH 2EIKH 2EIMH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCO H;  3AG4 H;  1V55 H;  2ZXW H;  1OCR H;  3ABM H;  3WG7 H;  5IY5 H;  5B1A H;  3ASN H;  5B1B H;  2Y69 H;  3ASO H;  3ABL H;  3X2Q H;  1OCZ H;  3AG2 H;  2EIL H;  3AG3 H;  2DYR H;  2DYS H;  1V54 H;  2OCC H;  2EIJ H;  5B3S H;  2EIN H;  1OCC H;  3AG1 H;  3ABK H;  2EIK H;  2EIM H; 
#chains in the Genus database with same CATH topology
 2DT7 B;  4GDF A;  2CQK A;  5FLV A;  3CP8 A;  1LEB A;  3DU5 A;  3R61 A;  1BI2 A;  5D5X B;  4HQE A;  2OJE D;  1JKQ C;  3WG9 A;  3OIO A;  1ZAO A;  2A61 A;  4JYK A;  4BQN A;  3FXO A;  2VT3 A;  3I0T A;  1I5Z A;  4I0B A;  3F9K A;  4HV6 A;  3CUO A;  2LLK A;  2VBY A;  1TQI A;  1ENH A;  2KLO A;  2XGE A;  4EQQ A;  4HZF A;  2Y75 A;  1SVO A;  5DCF A;  5CQG A;  1OJL A;  4UB6 C;  4EEF G;  2UZK A;  4H0E A;  1YRN A;  1X3U A;  2R93 J;  1TC3 C;  1Y8Q B;  3CO6 C;  3ULQ B;  2XRO A;  2EJR A;  3F23 A;  2B0L A;  4XLA A;  2PLY A;  1DPU A;  1WKM A;  3IUO A;  4YFX F;  1ZHF A;  3IP4 B;  2EFQ A;  5B66 C;  4L18 B;  2YR2 A;  2GXG A;  2J5O A;  4G6Q A;  3WE3 A;  4PCQ A;  3OS2 A;  3HUG B;  1K78 B;  1T56 A;  4RB3 C;  3QP5 A;  2F5C A;  3QYE A;  5DUK A;  4RGR A;  1S3J A;  3HOT A;  4YEL A;  2K9L A;  1OYW A;  2MA3 A;  2L4M A;  5JFR A;  1WPK A;  2WAD A;  3OOU A;  1Z9C A;  3EYY A;  1LQ1 A;  5HLI A;  1EV7 A;  2JUG A;  2ZO4 A;  4IQ4 A;  2EZH A;  4IXA A;  1X4O A;  2XV4 S;  1ZR4 A;  5IP6 A;  3JTH A;  1LB2 A;  3LAJ A;  1HDP A;  3QYB A;  1X2N A;  5CVV A;  1FP1 D;  2BVM A;  2Z3Y A;  5ED4 A;  2R0Q C;  3TO9 A;  1Y1W J;  2DA7 A;  4KIS A;  3K70 D;  2ECB A;  1ZKG A;  4Q48 A;  3LQQ A;  3U1K A;  2A6E F;  2F6C A;  4BH9 A;  2R5Z B;  3EDP A;  4IHX A;  2HS5 A;  3F22 A;  4RAY A;  3WU0 A;  4N4N B;  3ECH A;  4CYD A;  3AL0 B;  1SEU A;  1Z0X A;  3E6D A;  1R71 A;  1RI7 A;  5ERI A;  5CQE A;  1S8N A;  2K3P A;  2YU3 A;  3BPX A;  3FM3 A;  1K7A A;  1FWZ A;  3G1L A;  3Q9S A;  3I58 A;  3OYK A;  4B4C A;  4E7J A;  3H1C A;  1J9I A;  1F1Z A;  1FPQ A;  2W24 A;  2XPW A;  4J00 A;  5EJC A;  4ZC3 A;  1YLF A;  5LLQ A;  3VYS B;  4S05 A;  3C18 A;  4DYC A;  2RDP A;  1VQ9 I;  3H35 A;  4DYQ A;  2QQA A;  3E97 A;  1S72 I;  3CMY A;  3HBL A;  3AL0 C;  2Y0M A;  3HTS B;  4PK4 A;  5EEG A;  1TTY A;  4G94 A;  1WFX A;  2O3F A;  3FK6 A;  3IHU A;  1KU2 A;  2RN7 A;  3H9G A;  2E60 A;  2G0E A;  3F3X A;  4C2M J;  3WG7 H;  1WH5 A;  3F0C A;  2CUE A;  1REP C;  1BC8 C;  4HF2 A;  1SD5 A;  3MCZ A;  3IKV A;  4XLP F;  3QPL A;  4G7O F;  1VQK I;  2VE9 A;  2DBB A;  2FUG 2;  2KJB A;  4CCK A;  4H4K C;  4E7K A;  1MKM A;  2IA0 A;  1R23 A;  1FMV A;  2DA5 A;  3J81 Z;  1DQU A;  1MBK A;  1P4A A;  2MGQ A;  1SFE A;  3H92 A;  3I64 A;  2DMN A;  4Z6Y A;  3OYE A;  3LST A;  1S6L A;  1K78 A;  3DPU A;  1QRY A;  2KIU A;  3HUG A;  3K4K A;  3QAH A;  2BEO A;  3RKY A;  4O5V A;  4XLH A;  3ZQQ A;  3FWE A;  3CJT B;  4GGG A;  3R6S A;  2EFN A;  2X9D A;  3RKQ A;  2QF7 A;  3JRI A;  1JHH A;  5FRN A;  3GVA A;  3OSG A;  2ID3 A;  2ADU A;  3OL3 A;  4Y52 J;  2J5P A;  4DBR A;  3PSI A;  1HKT A;  4E7Z A;  3I59 B;  3PUB A;  3L00 A;  2GIV A;  3KEO A;  2WA0 A;  2JVH A;  2LY1 A;  4LLL A;  1I50 J;  2VXD A;  3S2H J;  4F91 B;  3HRT A;  3BZC A;  3ML6 A;  4U7B A;  3PO3 J;  2PMH A;  3GFJ A;  4BY1 J;  5FD6 A;  1QZE A;  5K7Z A;  4YEJ A;  1T0F A;  3IWZ A;  5GAG J;  2VIX A;  2EZI A;  3HDD A;  2HDW A;  3O3K A;  3BR1 A;  3BWG A;  4NBQ A;  1F4K A;  5D4S A;  2Y69 H;  4HLX A;  3KP7 A;  5M5X J;  3H3U A;  2L4A A;  3AFH A;  4EJV A;  2VUM J;  3S93 A;  1JTX A;  2NS0 A;  3QYF A;  2N8G A;  4EJO A;  2KIF A;  1QZY A;  1ZAR A;  4HOB A;  4L0Z B;  4P9U A;  3VSL A;  4Y7N J;  3KLN A;  3JRE A;  1UJ8 A;  3JRH A;  3FXL A;  1ZTR A;  1RIO H;  2ZBK A;  1XMA A;  2IRF G;  5F0C A;  2PG4 A;  2ZSH B;  3BOQ A;  1VQ8 I;  1B4A A;  3PL8 A;  3EUK L;  3M07 A;  4NC7 A;  4GXO A;  5J8F A;  1YHQ I;  2ZFU A;  4XKC A;  2LR8 A;  4HNT A;  5IYB J;  1U9O A;  2HWV A;  4WCG A;  2DPU A;  1HDD C;  4EJT A;  5D6F A;  3V7R A;  5FKO A;  1OYI A;  5DEQ A;  3CO7 C;  3OY9 A;  2HOT A;  1YQA A;  2WB1 A;  2FF4 A;  1R5I D;  3K69 A;  1FBU A;  3SEZ A;  1IXS B;  1LDD A;  2KRF A;  5DM7 F;  5B5E C;  1D1A A;  1TWF J;  4BQQ A;  1BJZ A;  3QWL A;  4A69 C;  2VQL A;  4U7D A;  2LTP A;  3CUQ C;  1IF1 A;  2Q2E B;  4CIC A;  1I27 A;  1XGS A;  5M3M J;  3KP6 A;  3ISP A;  3ZMU A;  4KIT B;  4L9N A;  2VPR A;  3K7A J;  5D5V B;  3AG2 H;  2DOE A;  3F8M A;  3U2R A;  5E18 F;  4A3G J;  3CCU I;  2GA2 A;  4HF1 A;  1V5G A;  3SQN A;  4HDU A;  1D0X A;  5GAE J;  4FHT A;  2EH3 A;  1J2X A;  3TED A;  2VBX A;  3FX3 A;  4IRG A;  2HXO A;  5CVR A;  1MBG A;  2E7W A;  1HA8 A;  4HBL A;  4N9I A;  1TWA J;  3HGY A;  4OMZ A;  1M1E B;  4LMY A;  4J01 A;  4WX9 A;  3I59 A;  3DFG A;  2EZK A;  1MBJ A;  1UZC A;  4AIJ A;  1H89 C;  4KFC A;  3P9C A;  1XTA A;  1ZRC A;  1B72 B;  5K7F A;  2KIQ A;  3FXU A;  3MQ0 A;  3CF5 F;  5HLH A;  1ZG5 A;  3JRB A;  2JK3 A;  1FYL A;  2PMZ A;  3MFK A;  3DLL F;  1WJB A;  4M72 A;  5DUI A;  2M87 A;  1ZH5 A;  1PUF B;  4P55 A;  4AWX B;  2ZNY A;  1IRX A;  4DNC A;  3VOD A;  1UST A;  2KKO A;  3KYD B;  5LD2 C;  1XB4 A;  3E6B A;  4IX7 A;  2BV6 A;  4TV7 A;  1D5Y A;  3L2W A;  3W6V A;  3ZRG A;  2E1M B;  3EUH A;  1RRJ A;  2CGP A;  5A2Q Z;  3MZH A;  2Q1Z B;  1WVR A;  3DU6 A;  2AXL A;  3LL7 A;  3TO6 A;  2QCO A;  3ZQ7 A;  2CO5 A;  1ULY A;  5HVQ C;  1D1B A;  1OFC X;  1W0T A;  2V26 A;  4ZDP A;  1MNM C;  1GHC A;  3SZT A;  2CRG A;  4RA2 A;  3GBG A;  4YIF A;  1U8R A;  3C3W A;  3QQA A;  1XGO A;  4GCV A;  5D6E A;  3VYR B;  4XKB A;  2EV6 A;  3Q9V A;  1RR8 C;  4CDG A;  1T38 A;  3NWT A;  3S32 A;  4BXU A;  4XRS G;  4LK1 F;  1ZRD A;  1ETK A;  2E1M C;  2YX4 A;  4XID A;  1IUY A;  4ZDL A;  2P7V B;  2QZ8 A;  2DQL A;  2NVU B;  1X3Z B;  5EG0 A;  3IH4 A;  4RM2 A;  3F8N A;  3JAM K;  3QOE A;  4KJZ A;  5FJ8 J;  1FSH A;  4U0Y A;  5JLX A;  4MQV A;  1NH3 A;  5K5Q A;  4XBF A;  2GXA A;  4RM3 A;  4YFK F;  4UHT A;  2ZXJ A;  1AHD P;  2VN2 A;  3FXM A;  4A12 A;  4IEJ A;  2RVC A;  1ETW A;  3BJO A;  4P1W A;  2CG4 A;  1J0R A;  1TT5 B;  1E3O C;  1WHU A;  3P7N A;  3OIP A;  2FRH A;  2JPC A;  1WJD A;  3WHC A;  1HKQ A;  2JQ7 A;  1JJ6 C;  2ISZ A;  1DGW Y;  5ICC A;  1R36 A;  3TW7 A;  5FB2 A;  4RAG A;  3CJQ B;  4LJZ F;  5HLG A;  2KMU A;  3BQY A;  1QHH D;  4RGU A;  4J19 A;  5LHI A;  3TDU C;  2QSH X;  1DU0 A;  3O8H A;  3ZMZ A;  4X1E A;  1X1C A;  4LG0 B;  5KK1 A;  2EZL A;  4WF2 A;  3G71 I;  2DA3 A;  4Y15 A;  1YW7 A;  3BTI A;  4D5C A;  2IGK A;  4LB5 A;  1FIA A;  1B72 A;  1MIJ A;  2CWE A;  3K4B A;  2ZJP F;  4KIF A;  2XRL A;  5E1X A;  2L9R A;  4OMY A;  1F9N A;  3I54 A;  1A36 A;  1Y0U A;  2QVO A;  1PUF A;  2XKO A;  4M3D A;  3IH3 A;  3BTL A;  3D5L A;  2WB1 N;  2DT6 A;  1IUF A;  4HG2 A;  4NB5 A;  4MEY F;  2V4J C;  4BQO A;  1R4N B;  6PAX A;  2DDB A;  3H9Q A;  2NNN A;  3ZQF A;  2MC3 A;  3V7C A;  5H20 A;  4CCL A;  1QNT A;  1XDS A;  3W2V A;  3FKJ A;  4AD9 A;  1UHS A;  2JMW A;  1KU9 A;  4OIR F;  5C4J J;  1E0E A;  3RKX A;  4XKW A;  3HEF A;  1MBH A;  4LB6 B;  1SD6 A;  3H0G J;  4LG3 A;  1MH4 A;  1CF7 A;  3WTY C;  2RC4 A;  2O7O A;  2D1V A;  3M8E A;  2HPM A;  1F5T A;  3JSO A;  4RLQ A;  1G4D A;  3FXK A;  4KIC A;  4KMU X;  3DLA A;  4NNJ A;  3ZMT A;  3MKZ A;  2R7O A;  4B3A A;  2MD5 A;  5EZG A;  4B43 A;  3UKG A;  2MH9 A;  4LLN A;  4I2O A;  2DK5 A;  2IA2 A;  3FBI B;  3BR0 A;  3BG3 A;  2ELH A;  2QSG X;  1MMN A;  3K9T A;  3I71 A;  5IOZ A;  4FAS D;  4LOC A;  4IHW A;  3E1S A;  2CW0 F;  2OZU A;  2FD5 A;  2HI3 A;  3Q0U A;  2QKM B;  5M3F J;  1POG A;  1LVK A;  4BAY A;  1MBE A;  3GEZ A;  5KAI C;  2LDU A;  4AYB A;  2L3D A;  4CCO A;  1QHG A;  3V8K A;  1XSD A;  2P81 A;  4XSZ F;  4CYC B;  2M9H A;  2R7R A;  3KX2 A;  4A3E J;  1QVU A;  1IRG A;  5GPC A;  1B8I A;  2TCT A;  2X6Y A;  5CVJ A;  4FET A;  1K6O A;  1P7I A;  2VXZ A;  3MN2 A;  4E70 A;  2K02 A;  3BC8 A;  1HXD A;  1R1T A;  4ZYH A;  2F4I A;  3OYG A;  4LLG F;  3ZP5 A;  3HSR A;  1XCV A;  2GBY A;  4I0A A;  4I09 A;  4QWQ A;  4LG0 A;  3RTR A;  4KNY A;  1I1S A;  1X58 A;  4PFO A;  2QKL B;  1E17 A;  5J6X A;  3GTO J;  1IW7 F;  1C0W A;  1U8B A;  2CJJ A;  3CCM I;  1D0Y A;  1JXS A;  4II3 A;  1U0J A;  4IOC F;  2VAS A;  3O8G A;  5LRR A;  5AON A;  1SAU A;  2KDZ A;  1VI0 A;  1U2W A;  2NOJ B;  1Z1D A;  3I53 A;  5DCM B;  3HOV J;  3FKI J;  3LSM A;  2ZC2 A;  1TT0 A;  2KT0 A;  2EBI A;  1FZP B;  2IA1 A;  2G9W A;  2DMU A;  2QUF A;  1R22 A;  2DFI A;  3CLQ A;  4DOZ A;  2XB5 A;  4HX4 A;  4EVI A;  3WGI A;  3JRD A;  3S3O A;  2NS8 A;  3GCM A;  3BZK A;  4M6V A;  4M3E A;  2BY2 A;  1UHW A;  3HOX J;  3A0B C;  1FTZ A;  3HC7 A;  2O03 A;  2CUF A;  3GZ6 A;  1IRF A;  2ID6 A;  3O2P E;  1MSE C;  5HOO A;  2WAQ N;  1U9N A;  3R0A A;  3TW6 A;  4XOT A;  2M4G A;  1YJW I;  1WI9 A;  2R7F A;  1Z7U A;  2XPU A;  3FK7 A;  1OMI A;  3PQJ A;  1YO5 C;  2L9N A;  4UXN A;  1VQN I;  1RR7 A;  1FBQ A;  3IV5 A;  3ELK A;  1GUU A;  4BXF A;  1MMS A;  1ZRF A;  3JCU C;  1R1V A;  2W82 A;  2HZD A;  4BQA A;  1LFP A;  4MTE A;  1IGN A;  1YW8 A;  4OOI A;  3VWB A;  3TOA A;  3IL2 A;  4WK8 F;  1SC7 A;  3A4C A;  3BPV A;  1DDN A;  5E3O A;  1HST A;  2W1O A;  2V9P A;  4EMS A;  2JRT A;  3CCE I;  3DTI A;  3CME I;  4BHC A;  1OCZ H;  3L09 A;  3S8P A;  2K4J A;  5K1Y A;  2V9V A;  3TMO A;  3M3Y J;  2UWM A;  5KVR A;  2X1C A;  1QVT A;  5LHH A;  2EIJ H;  4F7Z A;  4C30 A;  4CYC A;  4XNF A;  3AG1 H;  3GTK J;  4M6Y A;  2BY1 A;  2EIK H;  4XR6 A;  4QLC U;  3W6K B;  2DQR A;  4BDY A;  2HDC A;  2EA2 A;  2JA6 J;  1S7O A;  2VQH A;  4NUB A;  3DKW A;  4XOR A;  1JI8 A;  1O57 A;  3FXJ A;  4C2U A;  2ZJQ F;  2P6S A;  3GXO A;  2NOG A;  2ACJ A;  2E2I J;  3JRC A;  2Z9O A;  2IPQ X;  3BLY A;  2H27 A;  1AOY A;  4KIB A;  3NQO A;  1UFM A;  1YX3 A;  1ZYR F;  2OPT A;  1SVL A;  3F8F A;  4CA0 A;  3OYF A;  3FDY A;  5EGO B;  3HZJ A;  3LNQ A;  4DBQ A;  2E1O A;  1FMW A;  3OWT A;  4HA8 A;  1A5J A;  5H6R A;  3K6G A;  1XG1 A;  4L9J A;  4PDK A;  1XC5 A;  3TDZ C;  4CO8 A;  3KET A;  4HV5 A;  4IVN A;  5DCM A;  1TWG J;  4IHY A;  1GLN A;  1Z6R A;  1TQP A;  4HYE A;  3C2H A;  1OYY A;  4DGW B;  2COB A;  3OYN A;  3ASO H;  1W1W E;  3PM1 A;  3CJN A;  3X2Q H;  5HOD A;  1WSU A;  5F6F A;  2JA5 J;  2BVL A;  1KGS A;  2LP0 A;  5AIQ A;  2XF6 A;  3S1M J;  4FX0 A;  4B09 A;  1HBX G;  2VBW A;  4A93 J;  4A6E A;  5BPI A;  1ZG3 A;  4R1H A;  1I1G A;  1QPI A;  3IH2 A;  3GTQ J;  2R7S A;  1HW2 A;  4LIV A;  1X2M A;  4AYB N;  1YW9 A;  2LKX A;  2W84 A;  1SMT A;  3HM5 A;  4AUX A;  1W36 D;  1NHA A;  3ONQ A;  2XVC A;  5H6Q A;  4LIT A;  1ORK A;  1VQ7 I;  1EH6 A;  1ZN2 A;  3N05 A;  1CQT A;  1T33 A;  3OS1 A;  3DCF A;  3V42 A;  3AG3 H;  2FQ4 A;  4EJW A;  2DJI A;  1VTN C;  1IV8 A;  1LDK B;  3R60 A;  1N75 A;  3K1N A;  4P5O A;  1XGN A;  3HPH A;  1MMA A;  2BOL A;  1LNW A;  1V3F A;  1FIP A;  4F93 B;  3FMQ A;  4ZDO A;  3PQK A;  2H6C A;  4E7S A;  1GV2 A;  1R5H A;  3DBR B;  4ESJ A;  4OWR B;  3GFI A;  4AIK A;  3HOZ J;  3E5X A;  3KP2 A;  2BHZ A;  3LWF A;  2DA6 A;  3KZI C;  1T98 A;  1WGX A;  3BP8 A;  3COA C;  5FO5 A;  1Z77 A;  1G8X A;  1JTY A;  2LMD A;  4I02 A;  2XAH A;  5E79 C;  2PBI A;  4ZZL A;  1LUJ B;  2GXB A;  3WTW C;  2OCC H;  4BL0 B;  3SFI A;  4NDL A;  4M73 A;  2E35 A;  4C9Y A;  5BMZ A;  4XLN F;  1RET A;  2ME0 A;  4PJM A;  5HS7 A;  3PNV A;  3BJ6 A;  2QQ8 A;  3BDD A;  3KFW X;  2BW3 B;  2DJN A;  4RB1 A;  5GTH C;  1W0U A;  1T0F C;  3OYI A;  4RMN A;  2DT5 A;  3HPG A;  4JP0 A;  2H94 A;  1BOB A;  2XAS A;  3MVP A;  5EGO A;  3KPH A;  3KZZ A;  3RYP A;  4CZZ A;  1YJN I;  2HOE A;  3BT9 A;  2XF5 A;  4XRS A;  2K9N A;  5IT9 K;  4HPQ A;  2FQ3 A;  3HKZ A;  3RCO A;  3VPR A;  5LEK A;  3H3Z A;  5BPD A;  4MO7 A;  2JSC A;  5TRD A;  1I6H J;  3JRA A;  5J1Y A;  1YOV B;  4G7Z F;  1UB9 A;  3M9A A;  2IS2 A;  1BW5 A;  1I3A A;  2VC0 A;  3JW4 A;  4GYG A;  3FXQ A;  2K4B A;  2Z5U A;  3QOD A;  1PJR A;  3EET A;  4I01 A;  1IDY A;  2FEZ A;  3EUA A;  5DYM A;  4DIQ A;  3WTT C;  3WTX C;  2JA7 J;  4XRF A;  4FT8 A;  5HS8 A;  2M5W A;  4U88 A;  4B1R A;  2ZJ2 A;  2QSF X;  3HRU A;  3JR9 A;  3SFZ A;  4BJ6 C;  1L0O C;  2ZFW A;  2LRD A;  2JN6 A;  1MZB A;  2JT1 A;  4GO1 A;  5F1J A;  3W2W A;  4KT6 A;  4R8H A;  1IZ1 A;  3SJM A;  1KU3 A;  2LOO A;  3BG9 A;  2IT0 A;  4NHJ A;  1S7A A;  1J75 A;  1Z05 A;  4JX6 A;  1TZL A;  2FNP A;  2F4O B;  2LYC A;  1N77 A;  5KNL A;  4FE4 A;  4BY7 J;  4MFE A;  1LDJ A;  4CZC A;  2TRT A;  4N0B A;  2WY8 Q;  1ZGA A;  2QQB A;  4D5F A;  2DA2 A;  1TW3 A;  2KDO A;  4G8X A;  3QU6 A;  1JT6 A;  3S2D J;  2XC7 A;  4BJT A;  4BXX J;  2VOD A;  4FX4 A;  3JAM Z;  4P9F A;  1RZ4 A;  4IHS A;  4OIN F;  2QEX I;  1GVJ A;  5FLX Z;  5E17 F;  2ECC A;  2IGN A;  2RGV A;  4MQ9 F;  4D0P A;  3K10 A;  1OCR H;  2XB0 X;  1IJW C;  1XSV A;  4QTR A;  1Y56 A;  1DP7 P;  4IL6 C;  1MMD A;  4XIC A;  2O9L A;  1BOA A;  3UNG C;  4A3J J;  5CLS A;  2YX7 A;  2OV7 A;  1V5E A;  1O3T A;  3FIS A;  2KFD A;  2P5K A;  2WAF A;  3A1Y A;  1VND A;  4BBR J;  4XMY A;  4ZH4 F;  2CV1 A;  1STZ A;  2BXZ A;  4RGS A;  1IRZ A;  1P7J A;  3QP6 A;  2PMU A;  5FGM A;  1ZGJ A;  2BW3 A;  4CCJ A;  2TDX A;  2VOO A;  5DV5 A;  3ZMV A;  2HOA A;  3TQN A;  3GTJ J;  2PJR B;  4JQF A;  4B48 A;  9ANT A;  1EH8 A;  2P5V A;  1XX5 A;  4PGG A;  4EV0 A;  3CCL I;  2ZME B;  2V6C A;  2E34 A;  2F5F A;  2HU9 A;  3VYU B;  3S1N J;  2HQN A;  3RJP A;  2Y48 A;  2RNG A;  3BR6 A;  4L5J A;  4YII A;  3I56 I;  3EYI A;  4CGZ A;  4UV8 A;  5GP9 A;  3FMR A;  1UCR A;  4HW0 A;  1A35 A;  3EUH C;  2L02 A;  3KLO A;  3SEQ A;  4BKX A;  4XRM A;  4L5E A;  1VQL I;  1FOK A;  2HQA A;  4XKV A;  4XQF A;  5EG0 B;  1B9M A;  2FBK A;  2ICW G;  3CCQ I;  1ZEL A;  2P8T A;  2K5C A;  2Y9Y A;  3HL2 A;  1W4M A;  1RNL A;  4KIG A;  1X1A A;  1W36 C;  2FNA A;  4G6D A;  4ITV A;  2F5E A;  3SYT A;  4XLF A;  2AQE A;  4B44 A;  4DZJ A;  3RPU A;  3KIO A;  1T2K A;  2BYV E;  1AKH B;  4YRV A;  3A02 A;  4AVZ A;  1EJ9 A;  3HRM A;  3L7W A;  3REO A;  3B02 A;  2V1D A;  1QBJ A;  4I7H A;  4HQM A;  2OQG A;  2OUM A;  1N78 A;  4HAM A;  1RC9 A;  3IAS 2;  1YJ9 I;  2BZT A;  2CMP A;  2M1B A;  1K4S A;  3MZ8 A;  3LOC A;  2ESN A;  1U5T B;  1FNN A;  2XUB A;  1IN4 A;  3IRQ A;  3QPT A;  2YPR A;  2L9S A;  2A07 F;  1U78 A;  3K2Z A;  1UHM A;  1SD4 A;  2H09 A;  4ZTJ A;  1HKS A;  2LFB A;  1FYM A;  2RQQ A;  3CDH A;  3J7Y J;  3G3Z A;  1FBS A;  3V8L A;  4DZP A;  3E6M A;  4ZYE A;  4HNV A;  1EA3 A;  3ZGK A;  3MMY B;  4HX8 A;  4AVP A;  4BUP A;  4U0W A;  4C2T A;  1MND A;  3DWL E;  5J47 A;  2GOX B;  1O7L A;  2W00 A;  2XDV A;  2R7Z J;  1O7F A;  3HIF A;  2ZXW H;  3EQL F;  4FCY A;  3KE2 A;  5LRS A;  1I3Q J;  2QM3 A;  4A3D J;  1G6N A;  4A5M A;  2NS7 A;  2R7V A;  2B63 J;  1Y1V J;  3HXL A;  4B8X A;  1ZR2 A;  2P6T A;  2IS6 A;  3J7A Y;  3NRV A;  2R7Q A;  4QPQ A;  3H0D A;  2F2E A;  1X19 A;  2PJR A;  1CF7 B;  2ELK A;  3NAR A;  2ZKZ A;  4AC0 A;  3Q0V A;  2V1X A;  2Q0O A;  3WTU C;  1W7P D;  2R3S A;  2L0K A;  4ABZ A;  1K79 A;  2ZME A;  2VQC A;  4Q47 A;  3LSG A;  4NC6 A;  4HX7 A;  4B3X A;  4RGX A;  5IP7 J;  3S1R J;  2JVG A;  4OIP F;  1ZK8 A;  2EB7 A;  2LVS A;  3W2A A;  1WJE A;  1KYW A;  2GQQ A;  2OD5 A;  3K1M A;  1OR7 A;  1DUX C;  2O8K A;  2XAG A;  1LFB A;  1G3T A;  4BGD A;  1J5Y A;  2HVQ A;  4P96 A;  1D3Y A;  1BR2 A;  5FKN A;  1DP3 A;  2BE5 F;  1S7E A;  4NC8 A;  5KAF C;  2GAU A;  4BE1 A;  3B6C A;  4XON A;  4EM0 B;  3H5A A;  3WGH A;  4E7L A;  1X3W B;  1AKH A;  3C7J A;  3H5R A;  2G7U A;  2M8E A;  4M3B A;  3OYD A;  3M1C A;  4GRI A;  1FLI A;  1U6G A;  5KCM A;  3GYH X;  1H8A C;  1GXQ A;  1B8I B;  4UUS B;  2VBZ A;  3BZ6 A;  2C6Y A;  1XMK A;  2X6W A;  2FA5 A;  1FY7 A;  3CCJ I;  5CPR B;  2CSO A;  3I55 I;  4S04 A;  1P92 A;  2UV1 A;  3OSF A;  2OTJ I;  1KQ8 A;  1U5T A;  2EIM H;  2WV0 A;  4HSR A;  4UVA A;  2XSD C;  4D1Q A;  3FHZ A;  2A3S A;  2HZT A;  2LSO A;  2XPV A;  2XGD A;  4E6K G;  1FC3 A;  3D0S A;  4F52 A;  2X6O A;  1G2H A;  1PUE E;  4JBA A;  1P2F A;  2CQ7 A;  2MAB A;  1HW1 A;  4XN0 A;  4S0H B;  5ILU A;  4E7I A;  2R7W A;  3GO5 A;  2HVR A;  4ENM A;  3Q5F A;  1HC8 A;  2IW5 A;  2H8W A;  2KRC A;  4LIU A;  1OPC A;  3T8R A;  3V4G A;  4W97 A;  3VYT B;  2W4S A;  1L3L A;  1NK2 P;  4U0V A;  1MDM B;  3FBN B;  4Y33 A;  5EEH A;  1MH3 A;  1BBY A;  5C44 J;  3VB2 A;  1Y0N A;  3KP3 A;  2V1N A;  1SAX A;  4I76 A;  3RDI A;  3BCB A;  4FTH A;  2DU9 A;  3GTG J;  2ME6 A;  2M7A A;  1F43 A;  2X0L A;  3QPS A;  3FIW A;  2HTJ A;  1FEX A;  2DO7 A;  1A31 A;  3Q3S A;  3DKX A;  3JRF A;  3RZO J;  2JTV A;  1ONV A;  3L2V A;  3S14 J;  3S17 J;  1O3Q A;  1Y8R B;  2IEK A;  1SFX A;  3CCY A;  3L9F A;  2A68 F;  1VQO I;  2F5D A;  3A01 B;  1SFU A;  2PJP A;  1ITY A;  1WZ2 A;  1XPX A;  1BIB A;  2FMY A;  2DFF A;  3SDB A;  3LA7 A;  1I6X A;  3RZD J;  1YS7 A;  3A03 A;  3K2A A;  5D5U B;  2B7E A;  2CYY A;  5D4R A;  1BN5 A;  2K7L A;  2MSY A;  4YG2 F;  2AO9 A;  2DAO A;  3KCC A;  1XN7 A;  4XLE A;  4GFB A;  4KYW A;  4M9Z A;  1TBX A;  3ZCO A;  3F6O A;  4JOM A;  2Y0S A;  1YE9 A;  4RB2 C;  2NXN B;  2MLK A;  2KIS A;  2QQ9 A;  3L1P A;  5IP9 J;  3LA3 A;  2FX0 A;  5D8L B;  4ENN A;  1VQ4 I;  2PMZ N;  4EM2 A;  2HYJ A;  5FFZ A;  1VF9 A;  1LPQ A;  3E7L A;  2XHK A;  2E19 A;  2MFZ A;  1F36 A;  3CTA A;  2V79 A;  3PNT A;  3JTG A;  4UUS A;  1MJB A;  1TWH J;  4EGY A;  2L5Q A;  4PJJ A;  3MKY B;  4A3K J;  2W85 A;  1W5C C;  1JJ8 C;  4UV9 A;  1GXP A;  2BY0 A;  3F72 A;  2MH2 A;  1XMX A;  4Q4Z F;  1MJA A;  1UEL B;  5GPA A;  3J7A O;  2M0C A;  1FYK A;  4RLF A;  3H9J A;  1MGT A;  4A3C J;  1W5S A;  1GV5 A;  2L01 A;  2ZXI A;  2XGC A;  5E8G A;  4BYY A;  3DBL B;  5JHF A;  3GF2 A;  5F0F A;  5J3L A;  2HDD A;  4RS8 A;  2IGM A;  3GME A;  2VQG A;  3SZG A;  1ACI A;  2LNB A;  5IT3 A;  2VKE A;  5J40 A;  2F5V A;  1G59 A;  1Z3X A;  4PFP A;  4HNU A;  1MDM A;  3DQV C;  2BGC A;  4CXF A;  4MEX F;  3HHG A;  1B9N A;  4RAF A;  2EV0 A;  4B47 A;  1S5L C;  4UVB A;  1YIO A;  2HR3 A;  2FBI A;  2LD5 A;  5BS6 A;  2DK8 A;  3C2B A;  1Z7L A;  4WXD A;  3GX4 X;  1LKX A;  2MG4 A;  1J59 A;  1TW2 A;  1R9T J;  2KQR A;  4DJA A;  1QQI A;  2CUZ A;  3LSK A;  5J4Y A;  4KMF A;  3IRR A;  2K9M A;  2X48 A;  2Z2S B;  2RRE A;  2HPI A;  1EKE A;  2L7Z A;  5EF6 A;  2F4M B;  3PIO F;  1HCR A;  3M8J A;  4A3M J;  2DMT A;  4BBS J;  2X1D A;  2M2E A;  3CC2 I;  4CCM A;  2JRM A;  4HDV A;  5JR3 A;  3A01 A;  1ZG1 A;  2IXS A;  3GWZ A;  3QPH A;  3JRG A;  2FJ1 A;  5IT9 Z;  2K85 A;  3OV8 A;  3OYA A;  1QGP A;  4K2E A;  3OMY A;  2WBM A;  2ISY A;  1R00 A;  1HOM A;  2HNH A;  3ZPL A;  3AG4 H;  4L5I A;  2Z1D A;  3K4J A;  5CYV A;  1B1B A;  3QU3 A;  4BNC A;  3EPZ A;  3L2Q A;  3E3V A;  2DTZ A;  2NVQ J;  3RKW A;  4ESF A;  3M1E A;  2V9K A;  1IXC A;  1XSX A;  4F3Q A;  4U87 A;  3TP0 A;  2MLG A;  1Z21 A;  3PSF A;  1H9T A;  3HHH A;  2FE3 A;  1KU7 A;  1Y6I A;  4CSW A;  1YX5 A;  2VJJ A;  2W25 A;  2ZB9 A;  5TJJ A;  4IJA A;  1H88 C;  4KN7 X;  5D5W B;  3VFZ A;  1MD0 A;  5F04 A;  3BR3 A;  3LSJ A;  1TL8 A;  2L2O A;  1TQM A;  3CJR B;  2Q8K A;  2RAE A;  4AIH A;  4F55 A;  3SZP A;  2DOD A;  3ZXS A;  2D2W A;  4IF4 A;  3CD6 I;  4PZJ A;  2EWN A;  1Z91 A;  1UMQ A;  2X4H A;  2K27 A;  1O4X A;  2W7N A;  2O0Y A;  3BRO A;  3LQR A;  4L0Y B;  1H9G A;  2IP2 A;  2LK2 A;  1T08 B;  2BBY A;  2LY9 A;  3AKZ A;  4A3B J;  5GTI C;  5DTD A;  2AHQ A;  4N4O B;  2O8X A;  3Q0W A;  4RAZ A;  4XN3 A;  5CKT A;  1BL0 A;  1JKP C;  2QBY A;  5BNG A;  3HOS A;  4UUT A;  2FML A;  1MJ9 A;  2A69 F;  3DBH B;  1N25 A;  5C4X J;  2W48 A;  4KT5 C;  2KZV A;  4RB0 A;  2GIZ A;  3F8B A;  1KZH A;  2H8R A;  2ELJ A;  2OA4 A;  1JE8 A;  2Y0S N;  4QPO A;  2EIN H;  2KPM A;  2YS9 A;  4IPA A;  4RDU A;  3S3N A;  2GOM A;  5TGT A;  1AA7 A;  2L54 A;  2Z33 A;  1MW7 A;  3KEY A;  1VQ6 I;  2DTR A;  5JI6 A;  4BE0 A;  2IBD A;  3L2R A;  2KZG A;  3G6E I;  1SFK A;  2P5L C;  2FBH A;  1ZGW A;  1DGR M;  3BCA A;  3F21 A;  3H3V K;  1ERD A;  5LEJ A;  2NVX J;  1J09 A;  3MWM A;  3CC4 I;  1OKR A;  3HOU J;  4MFD A;  1AU7 A;  3RIR A;  5DD4 A;  1D1C A;  3B73 A;  1BIA A;  3QOP A;  1HF0 A;  3MZY A;  2WY7 Q;  2K9Q A;  2OF7 A;  1ZRE A;  1JHF A;  3WHB A;  3CCR I;  4Y3O A;  3ERM A;  2EFP A;  2XAJ A;  3M8F A;  2XIG A;  4L9V A;  4HLY A;  3DTK A;  4G6T B;  4IHT A;  3G73 A;  3TL4 X;  2FOW A;  3WGG A;  4M3F A;  2YSR A;  2JWT A;  3IKT A;  1ZQ3 P;  1PVE A;  3ZMD A;  4GYI A;  3PFY A;  1QA6 A;  1QPM A;  1E3H A;  4M71 A;  5HDN A;  1WJC A;  5GAD J;  3GTM J;  3R0J A;  4IO9 F;  3U21 A;  2R5Y A;  2HVS A;  3TBI A;  1WRJ A;  2DMQ A;  5BQT A;  1QO0 D;  2I10 A;  3S15 J;  3I4N J;  3MKL A;  2K9S A;  4DW6 A;  1BI0 A;  1BJA A;  3S2W A;  1HLV A;  2ZCW A;  4A3I J;  2K40 A;  3CQZ J;  3IWF A;  3L2C A;  4A3F J;  1HW5 A;  2E5Z A;  2VJI A;  2V6E A;  2KRH A;  3ZN0 A;  1EH7 A;  3B6A A;  5HDK A;  1GVD A;  1JKR C;  1WWX A;  3P5J A;  4O3M A;  1XCB A;  3J80 K;  1UG2 A;  1OCC H;  5JVT A;  3T5X A;  4DQ2 A;  2ZNZ A;  2PX9 A;  1BI3 A;  5LGN A;  2KP6 A;  2DFE A;  3M7G A;  2OQR A;  2Z99 A;  2H1L A;  4QSH A;  1TWC J;  2HTS A;  4EM1 A;  3RSN A;  4BE2 A;  3ZQC A;  1K61 A;  2E36 A;  3BR5 A;  4KA4 A;  5IOY A;  2Y31 A;  2EQR A;  4PSW A;  4OAZ A;  4I6Z A;  2A6H F;  1S9H A;  4CUG A;  1O3R A;  2DN0 A;  2CV2 A;  4A0Z A;  1IXR C;  2MW8 A;  2CV0 A;  5E8I A;  2O5R A;  3BG5 A;  2OBP A;  5DDG A;  5L3F A;  2EA4 A;  2P4W A;  3T1B A;  3CDL A;  5J8C A;  4IRI A;  2VC1 A;  3HRS A;  2CS3 A;  4V2G A;  1JKO C;  3ZMS A;  2XAF A;  2OAZ A;  4CHU A;  1LEA A;  2AXT C;  5H2F C;  1TNS A;  5HS9 A;  1FTT A;  4II2 A;  5M5W J;  3ZR8 X;  1QZZ A;  3SDG A;  5M5Y J;  1A04 A;  3FMS A;  1ETQ A;  1LVA A;  3CLO A;  2K3F A;  4YIR X;  4X0G A;  2EFO A;  3G4S I;  4PJN A;  2CQX A;  2E5N A;  2PFB A;  4MGR A;  4JK1 X;  1KQ0 A;  5E3L A;  5ILV A;  2LH9 A;  3RYR A;  3WTZ A;  3GLL A;  3OL4 A;  2DDA A;  4W1U A;  4IRH A;  2A5W A;  5LGT A;  1OCO H;  2X6X A;  2H6B A;  1USS A;  2XRN A;  3CES A;  4D7N A;  3UR3 C;  3G1O A;  4KUM A;  4AU7 A;  1YG2 A;  4OIQ F;  5E20 A;  3ECO A;  2BHY A;  4NQW B;  1VQM I;  3VSK A;  3HSE A;  1JUM A;  4R79 A;  3OOP A;  3W3C A;  3KP4 A;  5FKM A;  2X85 A;  4E4H A;  1PP8 F;  2XSJ C;  4M6X A;  5DS9 A;  4AM3 A;  1WJ5 A;  2DOA A;  1K4T A;  1T95 A;  4IHV A;  2KJC A;  3PNY A;  2JSP A;  4IQJ A;  4ANJ A;  4C3H J;  2V7F A;  2DFH A;  3QRF F;  1UG0 A;  2NAZ A;  3V7S A;  1RKW A;  1IN6 A;  3K4C A;  3F8C A;  3ZN1 A;  5K5O A;  1YTY A;  4KN4 X;  1Y39 A;  1P4X A;  2LC2 A;  3TO7 A;  1G3Y A;  2R5Z A;  4ENK A;  1G3W A;  3GLX A;  3WOD F;  2R7U A;  4MLO A;  1IO2 A;  4LGW A;  5GAH J;  3CCV I;  2JUC A;  5LBQ A;  2L7K A;  3ERE D;  3FHN A;  4V2F A;  1YS6 A;  1BM9 A;  2FSW A;  3CZ6 A;  3NAU A;  4C3J J;  3ABT A;  2JZY A;  1WJF A;  3LFU A;  3W6J B;  3S16 J;  1R4M B;  4CCN A;  1WJA A;  2R92 J;  4XSX F;  1ETO A;  5IYC J;  3V8J A;  3T8T A;  4BJ5 C;  2DW4 A;  1J7K A;  3BTJ A;  2KIM A;  4XOP A;  3ESW B;  4ON0 A;  1FOX A;  2VT2 A;  4WXC A;  3KP5 A;  3TOB A;  3I5U A;  4BHB A;  3CUQ B;  4MIM A;  4A0X A;  1YI2 I;  5J1U A;  2ZME C;  3N97 A;  1FOY A;  5J1R A;  3HOW J;  3CMM A;  1TLH B;  5LFA A;  3S1Q J;  3BR2 A;  3VDX A;  4M9X A;  4O6J A;  3PFI A;  3NWS A;  2LY2 A;  2XKP A;  2RQP A;  2RNJ A;  3G2B A;  2UXX A;  3BJA A;  5DD8 A;  1OR7 C;  4I99 C;  3O6B B;  2JA8 J;  2DA4 A;  1NK3 P;  2STW A;  2UUZ A;  1DU6 A;  4JX5 A;  1P6R A;  2QA4 I;  4DYR A;  5C3E J;  1TNT A;  5CJ9 A;  5HLT A;  3M4O J;  5LGU A;  1SFO J;  1Q1H A;  1R58 A;  3F6V A;  4FIS A;  4A6D A;  4PSX A;  2EFW A;  1SMY F;  2DA1 A;  5IPA A;  3CP2 A;  4WXH A;  3E6C C;  5FD5 A;  3TP3 A;  1IN7 A;  2M0M A;  3HG9 A;  3DKY A;  2VJ5 A;  1RES A;  5E3M A;  4IKF A;  3A2K A;  2AQF A;  3OYH A;  4XL9 A;  3CCS I;  2FOK A;  1LE8 B;  3HKZ N;  1FJL A;  4E7H A;  4OU0 A;  2ZSI B;  3R4K A;  4C3I J;  1GDT A;  1E3P A;  1P4W A;  5JLW A;  3LSP A;  1U5T C;  4NQW A;  3KYL A;  1IG7 A;  2M7B A;  1NG6 A;  3BTC A;  1P9Q C;  4ASN A;  4UNO A;  2GM4 A;  3LMM A;  1D5V A;  3K70 C;  2VJ4 A;  2HKO A;  5FKK A;  1IN5 A;  3T0Y A;  1ZLK A;  3LA2 A;  5IYD J;  2M4K A;  4A2U A;  3E5Q A;  2E7X A;  4XK4 A;  2VI6 A;  3KZY A;  3CDI A;  5L3C A;  4FE7 A;  3TGN A;  2LF7 A;  2MC4 A;  3TKY A;  4BU2 A;  1CGP A;  5E3N A;  5F08 A;  2NVT J;  3ZQL A;  2LRE A;  3CF2 A;  1JGS A;  4M9S A;  1YIJ I;  3ABM H;  1JGG A;  5F0H A;  5EEA A;  3N4M A;  1BA5 A;  3I3L A;  1O3S A;  1WCM J;  1NG7 A;  2VE8 A;  3VEP A;  3ZQG A;  3D1N I;  2O6G E;  4N9H A;  1D8K A;  1ZLJ A;  2M30 A;  2EK5 A;  1ON2 A;  3U9G A;  3OYB A;  1RPW A;  4PGH A;  1WI3 A;  5F64 A;  4BEH B;  1T39 A;  2VOP A;  5CVI A;  4UUV A;  3GFL A;  2X1E A;  1T8I A;  2LKS A;  3FM5 A;  1V54 H;  3J81 K;  1IV6 A;  3D5S C;  3MD2 A;  3CUQ A;  1G3S A;  2E71 A;  2XGX A;  4IZZ A;  2VON A;  1OIS A;  2GZW A;  3WTV C;  4I98 B;  3K0L A;  2HFH A;  2R7D A;  4BHP A;  3HB9 A;  4BAC A;  3D5R C;  4BDZ A;  4AID A;  4UY8 I;  1D0Z A;  2E1N A;  3ASN H;  3ZOB A;  1I39 A;  3A0H C;  3ABL H;  5FRM A;  3PO2 J;  4ZZD A;  4IOA F;  2OU2 A;  5JVG F;  3CMA I;  1A6I A;  1LJ9 A;  5FLX K;  2K86 A;  2Q2E A;  2D1H A;  1IC8 A;  1LFU P;  3BG7 A;  3H36 A;  1IDZ A;  2IAI A;  2CFX A;  5DM6 F;  4KDP A;  3E0J B;  4CH7 A;  5L3E A;  4ZTF A;  1JT0 A;  1FX7 A;  2OCE A;  2WAQ A;  4FQG A;  4Y4R A;  1U3E M;  2DCE A;  2NNY A;  1JUS A;  3K4N A;  3RI4 A;  3LSI A;  4L9T A;  2E2J J;  4MNU A;  2QEN A;  2FU4 A;  5TIS C;  3PIP F;  2ZXH A;  2KL4 A;  2HYG D;  1PP7 U;  1R1U A;  1ETX A;  2LG4 A;  2Y2Z A;  2Y9Z A;  1LE8 A;  4V19 K;  4LD5 A;  1DPR A;  4MHG A;  3KYC B;  2CQN A;  1BC7 C;  2P0W A;  2VL8 A;  1VQ5 I;  3WTS C;  3DV8 A;  1BR1 A;  2GA1 A;  2HYF A;  3JSP A;  1B6A A;  2M3A A;  2H1K A;  4A5N A;  2XAU A;  3DEU A;  1JUP A;  2L7M P;  1FP2 A;  3ZQH A;  2LBF B;  2YUS A;  4JX4 A;  1SVM A;  2XF7 A;  2WAE A;  3DEW A;  1KQ9 A;  5FKL A;  3HJE A;  3I4P A;  2RV8 A;  2HQ5 A;  1IN8 A;  2PEX A;  5KHD A;  1XD7 A;  2VPL A;  1ON1 A;  2EIL H;  1NTC A;  3IC7 A;  1FOW A;  1WQ2 A;  1KA8 A;  3LSH A;  2B9S A;  4G7H F;  1D8J A;  1XDU A;  1MBF A;  1OLT A;  2CW7 A;  2DOF A;  4HEA 2;  3AAF A;  5K5R A;  2VKV A;  1FSE A;  2VB6 A;  4ZYA A;  5L3D A;  3OYL A;  3ZQI A;  1H0M A;  2E1C A;  2LF8 A;  1K83 J;  1IAW A;  2HOS A;  3FZV A;  4G12 A;  2JA2 A;  4BEH A;  1VFC A;  2STT A;  2QLZ A;  3DTE A;  2MBF A;  3DF8 A;  3BQZ A;  1RUN A;  4Y17 A;  4EGZ A;  2HQR A;  2VKH A;  4ZYG A;  2CFO A;  1X1B A;  3K4L A;  5JHU A;  2DI3 A;  5E1W A;  5ICE A;  4ZJZ A;  3P9I A;  5ICG A;  1E2X A;  2X51 A;  4A3L J;  2COM A;  4LK0 F;  2WWY A;  3RQ4 A;  5FRO A;  2P7C B;  3GFM A;  1RUO A;  3FXR A;  1R6R A;  2Z16 A;  2CU7 A;  1EF4 A;  4M74 A;  1APL C;  2M45 A;  3G1M A;  3WE2 A;  4ETS A;  1PDN C;  1UAA A;  1TP4 A;  5B1A H;  4WWC A;  2ETH A;  5ILS A;  1S29 A;  4HRI A;  2IS1 A;  3GUD A;  5B1B H;  2R4G A;  4HST A;  3K1P A;  3GW2 A;  4G9Y A;  3MKW B;  1Z67 A;  1HSJ A;  2BY3 A;  2QYO A;  2CW8 A;  2PI0 A;  3HTU A;  1V4R A;  2L9V A;  2YU9 J;  2A5Y B;  1HQC A;  2DYS H;  1A6Q A;  5D8K B;  4F92 B;  2DPD A;  1T6S A;  1V5F A;  4PJ0 C;  5F1R A;  2XAQ A;  5LHG A;  2IJL A;  1XGM A;  2WC2 A;  2PN6 A;  2GLO A;  2W57 A;  1SAN A;  2LKP A;  1Z3Y A;  1W5T A;  4X6A J;  1ETV A;  2G7H A;  3IAM 2;  5A2Q K;  2KHM A;  3OR2 C;  2Y30 A;  4EAT A;  1WH7 A;  2GWR A;  2E2H J;  1Q1V A;  2UXN A;  3I4M J;  2FXA A;  2OZ6 A;  5E1Z B;  2D5V A;  2QBY B;  3DEE A;  3PJR A;  5EYR A;  2HKX A;  5HDG A;  5B3S H;  3P9K A;  2IVM A;  1W7P B;  2NVY J;  2LBF A;  2O61 A;  4MTD A;  2AS5 F;  4Q5S F;  1OCP A;  1RKT A;  5L3B A;  5L3G A;  2WV1 A;  3LFK A;  2DMP A;  3L2U A;  4OAY A;  3RPQ A;  2I8D A;  1R49 A;  1MMG A;  3OYJ A;  5F27 A;  2JPB A;  3VOE A;  3DXJ F;  2M34 A;  3SXY A;  4YFN F;  2NRA C;  4ESB A;  3MAJ A;  4Y13 A;  1XS9 A;  4UB8 C;  1SD7 A;  2DYR H;  3ROU A;  5HNH A;  2PQ8 A;  2JJ7 A;  4UVC A;  1YFH A;  2RKH A;  2DXI A;  1PYV A;  3J80 Z;  2HEO A;  5AIP A;  1AWC A;  2A6T A;  3FF5 A;  2D45 A;  2EPF A;  3OS0 A;  2CQQ A;  3BG6 A;  1YRN B;  3DP7 A;  1OQY A;  3HSF A;  4HF0 A;  3C2G A;  1GT0 C;  4XLC A;  4LFU A;  3I9V 2;  1VZ0 A;  5CVU A;  2A05 A;  5FLM J;  3NEU A;  2BXY A;  2ZJR F;  2QWW A;  3E5U A;  5ICF A;  4ZYD A;  2CH0 A;  3RPU D;  1K6Y A;  2OTL I;  2QGU A;  2VKD A;  4D9J A;  2V1U A;  3GTP J;  2DLL A;  1BR4 A;  1YIT I;  4RBO A;  4M3G A;  3ABK H;  4OIO F;  3KEQ A;  4XM3 A;  3HYI A;  3DPT A;  3K4M A;  2M8G X;  2OC6 A;  1V55 H;  4D7M A;  3SHF A;  3LAP A;  5FFX A;  4PUS A;  2R5Y B;  4ENJ A;  2MD0 A;  1X1P A;  1ETY A;  1FT9 A;  3OIQ A;  5EZH A;  4EJU A;  2VLA A;  1Z6T A;  3CC7 I;  2I5U A;  5EDN A;  3GZN B;  3GTL J;  2IS4 A;  4PJL A;  3MEX A;  1MNE A;  3S3M A;  2R7T A;  1OCT C;  4QIW N;  2F48 A;  2CUJ A;  3ABU A;  4A0Y A;  5BOX A;  1MSF C;  2R7X A;  1QU3 A;  1B59 A;  1KON A;  5HNF A;  5J4V A;  1VQP I;  2WTE A;  3LSR A;  3GZ5 A;  1R5G A;  3H5N A;  4Z2Y A;  2HGC A;  2EV5 A;  1BI1 A;  5IY5 H;  3OYC A;  3HGG A;  3PUF A;  3HOY J;  3WU1 B;  1BW6 A;  2HXI A;  4BS9 A;  2L7F P;  3DPL C;  1ODD A;  1X1D A;  5K7H A;  2NYX A;  3OYM A;  3RQI A;  1W7P A;  1X4P A;  1R7J A;  3BY6 A;  1YYV A;  3U1D A;  3J7Z I;  1KYZ A;  2ESH A;  2IGO A;  3OR1 C;  3C1D A;  3WU2 C;  2MYS A; 
#chains in the Genus database with same CATH homology
 1OCO H;  3AG4 H;  1V55 H;  2ZXW H;  1OCR H;  3ABM H;  3WG7 H;  5IY5 H;  5B1A H;  3ASN H;  5B1B H;  2Y69 H;  3ASO H;  3ABL H;  3X2Q H;  1OCZ H;  3AG2 H;  2EIL H;  3AG3 H;  2DYR H;  2DYS H;  1V54 H;  2OCC H;  2EIJ H;  5B3S H;  2EIN H;  1OCC H;  3AG1 H;  3ABK H;  2EIK H;  2EIM H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...