3ASOH

Bovine heart cytochrome c oxidase in the fully oxidized state measured at 0.9 angstrom wavelength
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
79
structure length
79
Chain Sequence
b'KIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
molecule tags Oxidoreductase
publication title Distinguishing between Cl- and O2(2-) as the bridging element between Fe3+ and Cu2+ in resting-oxidized cytochrome c oxidase
pubmed doi rcsb
total genus 27
structure length 79
sequence length 79
chains with identical sequence U
ec nomenclature
pdb deposition date 2010-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 3asoH00
2Y69H 3AG3H 2OCCH 5IY5H 5B1AH 3ABLH 3WG7H 5B1BH 3ABKH 2EIJH 1V54H 3ASNH 1OCRH 2EILH 3ABMH 1OCCH 2EINH 2ZXWH 3AG1H 2DYRH 1OCOH 3AG2H 3AG4H 1OCZH 3X2QH 5B3SH 2EIMH 1V55H 2DYSH 2EIKH 3ASOH
chains in the Genus database with same CATH superfamily
4DIQA 3OL4A 4CYCA 1X19A 2X85A 4KN7X 5KVRA 2NVUB 2BY1A 2IA0A 3BR0A 2ME6A 2CV1A 1MIJA 1H9GA 3B02A 2DFEA 2Y48A 5JHUA 2VQHA 4OIRF 3OV8A 2KT0A 1VQ6I 1FNNA 1QPMA 2BHZA 3T1BA 2ESHA 4HRIA 2DT6A 2D1HA 4FETA 4MTDA 2JA6J 2FBHA 5F0HA 1IXSB 3I56I 1YFHA 4XOTA 2DU9A 3BDDA 2M9HA 4MHGA 3CDLA 1B6AA 3IC7A 3OYEA 3EETA 2QWWA 3MKLA 3CLQA 1JUPA 4QLCU 5EYRA 3OYGA 5IP6A 3MFKA 3BG7A 4RAZA 1S6LA 1TQPA 4P9FA 1MMGA 3OS0A 3GTOJ 1UFMA 1I6XA 3Q0UA 3A0BC 4P96A 2VKEA 2LFBA 2NVYJ 4P5OA 4HSRA 5GADJ 1XGOA 2F5VA 4IO9F 3F8FA 4I02A 4EJWA 4D7MA 3WGIA 1RESA 4L18B 4GFBA 4M9ZA 4AYBA 3L1PA 5HLIA 4B43A 2Y69H 2XB0X 2Y0SA 5ERIA 2KPMA 1XD7A 5FRMA 3DKWA 5F0CA 2ZBKA 5FKOA 1W5SA 2IP2A 2CUZA 3OSGA 2LKPA 1I6HJ 5E3MA 4E4HA 1USTA 3ABMH 2GLOA 4CYDA 1UG0A 3KX2A 3KZZA 1SMTA 2W25A 4CGZA 2V1DA 4IHWA 4IHSA 1WI3A 2OAZA 2L3DA 4B3XA 3CCRI 3CUQC 1GVDA 5L3CA 5E1ZB 2VONA 1LDJA 5L3BA 3W2WA 3S2HJ 1S7AA 3A0HC 4XICA 1SD7A 2PLYA 4MNUA 2EV0A 3BLYA 4XKVA 4LLLA 2GZWA 3EYIA 2WAEA 1VQ8I 1IUYA 3M1CA 2E5NA 1IO2A 2HXOA 1WVRA 3CO6C 1ZKGA 2DTZA 5B1AH 1MBFA 3ZQFA 3TOAA 2RQPA 2K4JA 1WZ2A 5EDNA 1YOVB 1KA8A 1ON2A 1R36A 3HOVJ 5CQEA 4YIIA 3D1NI 1VQ5I 3AG2H 1ETOA 4HA8A 4KMFA 1O3SA 2FRHA 1GLNA 2DCEA 2IAIA 3GTMJ 2WB1A 4CCJA 3HTUA 1D1BA 1Y0NA 1YRNA 2XF7A 1YIJI 4IQ4A 2VBZA 4EJVA 2E1CA 3PSIA 2P7CB 3BY6A 1BR1A 3H9JA 3I71A 1I3QJ 1XGNA 4L9JA 3BG9A 4CICA 3RKQA 2ACJA 3VYTB 4EJTA 3BG5A 2VODA 2R3SA 1FIAA 3DEEA 1N78A 5L3GA 3HC7A 1RETA 3RPUD 3FBIB 3GLLA 1ZG3A 4F55A 1I3AA 3F3XA 4ENMA 1XB4A 5J1UA 2KIFA 2Q0OA 1P2FA 2RQQA 1OMIA 2HKXA 2M2EA 2EH3A 1WWXA 2CW8A 1ZGJA 1J59A 5FJ8J 1JE8A 4NC6A 2LH9A 3CJQB 4OIQF 3I4MJ 2UXNA 3JTGA 1BI3A 4OMZA 3W6KB 3S15J 2K3FA 3H36A 2W1OA 1YW8A 3JAMK 3U1KA 3FMQA 4B4CA 1SFUA 1JJ8C 3KFWX 2P5VA 3OL3A 4KYWA 2EBIA 3BWGA 4PZJA 3S32A 3IH4A 3FK6A 1Z3XA 2M0MA 4LG0A 4LB5A 1ZHFA 2K85A 2QKLB 5HOOA 3HM5A 2GAUA 1GXQA 2K40A 2M0CA 4XLCA 1ETQA 4Y15A 5C44J 3H0GJ 3SFZA 1A36A 2EILH 3MVPA 3PNTA 4WK8F 3KP6A 4ZYEA 3GFIA 4ABZA 2HYGD 2Z99A 2ISZA 3F8CA 3BR5A 4W1UA 2PG4A 5J1RA 1B1BA 3K4LA 3ZMUA 4XL9A 4LD5A 4DYCA 3VDXA 4HX7A 3Q0WA 4I98B 3I55I 4WWCA 4ZTJA 4G6QA 4EVIA 2ETHA 3CCJI 2EPFA 1A6QA 1V5FA 3QODA 1W1WE 3B73A 2M7BA 5E3LA 2X6XA 4RB2C 3I64A 1V3FA 2BXYA 4Y4RA 2EIJH 3O3KA 1F4KA 5EZGA 1FOYA 3J80Z 2MFZA 3HXLA 1MDMB 2E5ZA 3HHHA 3CCSI 4JK1X 5IP7J 2UWMA 2PEXA 4BQNA 4HV6A 2YR2A 3E5UA 4V2GA 2KRFA 2VIXA 2HVRA 4FX4A 1CF7B 2O7OA 4RDUA 5GPAA 2R7QA 2OCCH 4V19K 1TWGJ 3WTVC 3AL0B 1LFPA 1PUFB 3OMYA 2MLKA 3RYRA 1FOKA 3I0TA 3SZPA 2F5EA 3HGYA 1A31A 3GTQJ 2COBA 2P81A 5D6EA 2VC1A 5BQTA 5FLMJ 2AHQA 5EEHA 5GTHC 3S93A 2K9NA 4L0YB 1VQPI 2QQAA 5F04A 3VPRA 3FXOA 2PN6A 2H8RA 2GBYA 2WA0A 1OKRA 1VQNI 5DCFA 1FC3A 2AS5F 2EIKH 1EF4A 2IA2A 1NHAA 3GZNB 3S17J 2NS0A 1HQCA 3LWFA 3HJEA 2KJBA 2M4KA 4U0VA 3IH2A 2OPTA 1WJBA 3QP5A 1OCPA 2CYYA 4YIRX 2LYCA 1CF7A 2WBMA 1XMKA 3LSHA 3FF5A 3AAFA 4P9UA 4WCGA 3BROA 1C0WA 4ZDOA 4J19A 4RAFA 5DEQA 2DFIA 4MQ9F 5ILVA 4KUMA 5E1XA 3P9IA 4F7ZA 1RIOH 4G6DA 3GZ6A 4E7HA 3C2GA 1E0EA 3L2WA 2W48A 1QHHD 2R4GA 1QVTA 3HDDA 1XCBA 5D8KB 4MFEA 3JCUC 3F8MA 1R9TJ 5CVUA 1WH5A 1X3WB 3HOXJ 3MCZA 5E8IA 1U9NA 3DBRB 1ZQ3P 1NG7A 1XGMA 3RQIA 2CH0A 1GHCA 1ZRCA 3OYMA 1D5VA 2ZCWA 2VBWA 3MEXA 4EJUA 2Y0SN 2IEKA 4EATA 3HRTA 5KK1A 2V79A 4ZZDA 4RLFA 3LQRA 3O2PE 1I1SA 2HOEA 2XRLA 1VQ9I 1N25A 1XX5A 4IRHA 1BI1A 4Q4ZF 1IC8A 2H8WA 1A35A 3HOYJ 4HNVA 3E1SA 2M5WA 2ZFUA 2P5LC 2JSPA 3CQZJ 3KEYA 3PJRA 4Y7NJ 4BY7J 5JLXA 4O3MA 1LB2A 4LIVA 1T98A 5FD5A 4M3BA 1J2XA 2BOLA 1VQOI 4O5VA 4D5FA 3AG4H 2FNAA 4N9IA 1W0TA 2CUFA 3LA2A 4BXXJ 3IKVA 5KNLA 3F72A 3EUHA 4BU2A 2Y31A 2JJ7A 3HOWJ 2KRCA 4X6AJ 1K78A 4EM0B 2DMPA 3K1PA 2QCOA 2X1CA 2LK2A 3CUQB 3FWEA 4B1RA 3JR9A 1BR4A 2G7HA 3KLNA 3RKYA 3HB9A 3RPQA 3LAJA 2KDOA 2VBYA 2NRAC 5TGTA 2HOAA 3F9KA 2ZKZA 2CQQA 2ZB9A 4S05A 4HF0A 2VKHA 3JRAA 5GTIC 3CZ6A 4R8HA 1ONVA 1R4MB 5ILSA 2F4MB 1PP8F 2G7UA 2OCEA 3DPLC 1XDUA 2CQKA 4DOZA 1QZZA 4OMYA 3TOBA 1JUSA 3KYLA 5HDGA 1OYIA 4XLFA 4EJOA 3GMEA 3W2VA 2DT7B 1SFEA 3I4NJ 4C9YA 2LD5A 2LY1A 1FP1D 2BW3B 1VF9A 2V6CA 4UHTA 1ZRFA 5E1WA 3A4CA 2R92J 3LQQA 2DA7A 2E1MB 3SHFA 2DDBA 5F0FA 3CCUI 4BYYA 1HC8A 5M5XJ 1LUJB 4MIMA 1QVUA 1FY7A 5HDNA 1ZREA 3KCCA 3H35A 3SDBA 1WJCA 3FBNB 2V1NA 2GXGA 2K7LA 1Q1HA 2VJ5A 3DEWA 5B3SH 1WQ2A 3CP2A 2WTEA 4HOBA 3BCAA 4D7NA 2KMUA 5K5RA 3CO7C 3NEUA 2JK3A 1O7LA 2B9SA 3BR2A 1X2MA 2IXSA 2E1MC 2MG4A 1F36A 2FJ1A 4FCYA 5HDKA 4M71A 2FU4A 5DV5A 1QO0D 1VFCA 2DOAA 2XIGA 2K3PA 1MH4A 5FFZA 2HQAA 2RKHA 2R7WA 2NAZA 3DBHB 3R0AA 3G6EI 3I3LA 1HOMA 1GUUA 2LF8A 5ICFA 1S29A 3R60A 1T38A 2NVTJ 3V42A 5CKTA 2ZJQF 1ETWA 1AA7A 1BI2A 3SEQA 3G71I 1SD4A 4ZDPA 3DLLF 3BQYA 4AUXA 2BZTA 3ZR8X 2JRTA 3ZQIA 1MJBA 4BJ5C 3S1RJ 1U0JA 2P0WA 1RUOA 1OISA 5J8CA 1DU6A 3SJMA 2XGCA 5H2FC 2JRMA 1WI9A 3QOEA 3QYBA 2R7DA 2EZLA 2ID3A 1MJAA 2DN0A 3ZMDA 2HZDA 4IVNA 3C7JA 3RJPA 2HKOA 5K7FA 4AIJA 4I99C 3ZQGA 2FNPA 2ZXJA 4E7LA 4PFOA 4HQMA 4FT8A 5E17F 1IN6A 5HNHA 1A04A 3TP0A 1RR7A 3MZ8A 1YIOA 3C1DA 3HSFA 1WGXA 3RI4A 1UB9A 3GTPJ 3UR3C 1YYVA 2FOWA 1U78A 3V8KA 1Z91A 4R79A 3FX3A 1XS9A 2ME0A 4HLYA 1H88C 4XORA 5JFRA 2KLOA 3LA7A 5DUIA 2LLKA 2GA2A 3DTKA 3MKWB 4HF1A 5D5WB 2QF7A 5AIQA 5LRRA 3HUGA 1OJLA 3W2AA 1Q1VA 2LF7A 2X1EA 3EPZA 2DW4A 2O9LA 3M07A 1IN8A 1Y8RB 2JTVA 2FA5A 5EF6A 2F5CA 2L54A 4NQWB 2HU9A 3SZTA 4E7KA 3WTUC 2EFNA 2WY8Q 5JVGF 2R7TA 4RM2A 1SFKA 3I53A 1X1CA 1HDPA 2H6BA 3BT9A 4B48A 2RV8A 1MZBA 3QPHA 4BBSJ 1U3EM 3H0DA 1Z9CA 1YS7A 5LEJA 2JPCA 3EDPA 3WTYC 2R7SA 1B59A 4XN3A 4BJTA 5J3LA 4DYRA 4UY8I 4OIOF 3DKYA 4YFXF 3FXJA 3VFZA 2XGEA 2GA1A 2X6YA 5DS9A 3ISPA 1KQ9A 2LMDA 3KP2A 3TDZC 3CCEI 2QM3A 2MSYA 4UV8A 1MDMA 1V4RA 5LHIA 2YX7A 1JHFA 1RR8C 4I01A 2IVMA 5HLHA 4MTEA 2R7UA 4HNUA 3QWLA 5EG0B 1SD6A 2YU3A 3VOEA 2HQNA 2OJED 1ZRDA 1WJEA 1XDSA 2PJPA 4L9VA 3K2ZA 2E2IJ 3SZGA 3NWTA 4AYBN 2DJNA 1HSJA 3CCVI 2FOKA 2JA2A 4BUPA 3GBGA 3J7AY 2HTSA 2PFBA 4G12A 5D4RA 4UUSA 3M7GA 2KL4A 2HS5A 3LFUA 2V7FA 4LK0F 2XRNA 2ZO4A 1IN4A 1EH6A 1ZN2A 4LITA 1SVMA 2DAOA 2FQ4A 1KZHA 3KP3A 1HF0A 3GXOA 2QBYB 1WKMA 4HW0A 4N0BA 4HQEA 4AC0A 4HPQA 3ECOA 3ZGKA 3ZMTA 2M34A 3DFGA 3OIPA 3VEPA 3WTTC 3OYNA 3D5LA 3ERED 2JSCA 3DLAA 4C2MJ 4RBOA 1SAUA 4C3JJ 2DLLA 2UZKA 3AG1H 1QU3A 2BV6A 1P92A 3HG9A 5E3OA 2DTRA 4HBLA 5FLXK 4DYQA 2L2OA 2UXXA 3R6SA 2QENA 3I59B 2W4SA 4CHUA 5C4XJ 2ZMEA 1H9TA 3H9GA 4UUVA 1FZPB 1ORKA 4EMSA 4KIGA 2EK5A 3L2UA 2ZFWA 1QZEA 4HNTA 4RB3C 1TQMA 5FD6A 2VOOA 2BYVE 4YG2F 3O6BB 2FX0A 4AWXB 4A12A 2L4MA 4FISA 3Q3SA 3SXYA 2NOJB 1QZYA 2P7VB 4KIFA 2DOFA 1KONA 3PIPF 1MBEA 3FXKA 1ZR2A 4CCLA 1XPXA 4I09A 5AONA 4ASNA 1B4AA 2TRTA 1QA6A 5IOZA 1LKXA 2ELHA 3PUBA 2VUMJ 4LK1F 2IW5A 4BEHB 3PO3J 1DP7P 2QVOA 4DW6A 1IG7A 4OAYA 4IRIA 1SMYF 3I59A 4BE0A 1JKRC 4U0YA 4PJMA 1U5TC 3D5RC 3BJ6A 1D8KA 3CESA 2RREA 4UB6C 4PJJA 5K5QA 3A01B 2K02A 3TL4X 2L9SA 2FBIA 2KIMA 3CC4I 1ERDA 4II3A 5D5XB 1Y56A 3G1LA 4RGUA 3RSNA 3SYTA 4QPOA 2XGDA 4P55A 3GLXA 4B47A 1IN5A 2MABA 2HQRA 3ELKA 3DPTA 1HSTA 2FMLA 4C3HJ 3LSMA 2Y0MA 2NOGA 2BXZA 2LC2A 2XSDC 2VI6A 4B44A 2BEOA 1KU3A 4BEHA 1BIBA 2HNHA 4LG3A 4YRVA 4BDYA 2IA1A 2PBIA 3KP7A 3D0SA 3CMAI 3DF8A 1LFUP 3N4MA 1OYYA 3BTJA 4AD9A 3AFHA 3T0YA 1OFCX 2HVQA 5GAGJ 4NUBA 2EA2A 2DFHA 3GTGJ 2MC3A 5DCMA 4ANJA 2OA4A 5JI6A 4IKFA 3VWBA 3GEZA 2ZC2A 3BZ6A 4K2EA 2I5UA 2M30A 2EFOA 5KHDA 4B8XA 1T8IA 3L9FA 1J0RA 2EV6A 3BP8A 5E79C 1U8BA 1N75A 5D8LB 1X2NA 1HW1A 1X4PA 5FKKA 1XGSA 2Y9YA 5IOYA 4GO1A 4RGXA 2F4IA 1YJWI 3FHZA 2V9VA 2HEOA 4IXAA 5CQGA 1BR2A 3BPXA 1W7PA 2M8EA 1SFOJ 5BMZA 3DU6A 2L7MP 4DBQA 3F6VA 1SVOA 3G1MA 2F4OB 5M3MJ 5LRSA 3BZCA 4Q48A 2LNBA 3S2DJ 2CFOA 2ZNZA 2JVHA 2I8DA 1R5HA 5DCMB 1BC7C 1W0UA 2GXBA 1FSEA 2XKOA 2HFHA 2OU2A 3SDGA 1R00A 4CUGA 1XG1A 1M1EB 1X3UA 1OYWA 3ZN1A 3HZJA 3FK7A 2X6OA 1YW7A 2KIUA 1MKMA 3OR2C 2FF4A 1ODDA 1BL0A 1S7EA 1BIAA 4BKXA 1BJAA 1K79A 1IXCA 2IGOA 3U2RA 5LGNA 3F21A 3ZQLA 1FYKA 2K5CA 3ZMZA 3VSLA 2MD0A 2N8GA 2XAQA 1K6OA 2O03A 4WXCA 1T0FA 2L01A 4HLXA 5FKMA 5GPCA 1R7JA 2ELKA 4BS9A 4BNCA 3RZDJ 3CLOA 4V2FA 1B72A 3V8JA 3CP8A 1HKSA 1VTNC 2Q2EA 3QOPA 4M6VA 3G73A 1W5TA 1P4XA 1X4OA 2A6EF 2K86A 4A0XA 3HBLA 4ZC3A 4U0WA 1LEBA 4JX5A 4S04A 1R1UA 2K9QA 2HGCA 2B7EA 4ESJA 3PO2J 2R7XA 3RIRA 4LG0B 4CSWA 1IRFA 1BM9A 4II2A 3QU3A 4M74A 3LSTA 3GO5A 5IT9Z 5FRNA 3F8BA 3PNYA 2V26A 3TP3A 1OQYA 4ZYAA 3IP4B 3LSIA 1U5TB 3GW2A 3K4MA 2A6TA 4HX8A 3LFKA 1PYVA 2MBFA 3BPVA 1B72B 2W7NA 3QPLA 4HYEA 4XRFA 3B6AA 1WCMJ 1G3SA 2COMA 4GDFA 4IPAA 3DKXA 2PX9A 4BE1A 4MQVA 2JA7J 2JPBA 2BHYA 4ON0A 4BGDA 1DGWY 4BY1J 2KKOA 4YELA 3WGGA 4F52A 1T56A 2XAJA 3O8HA 2QLZA 1Z21A 1REPC 3OWTA 1D0YA 1Z0XA 2Z2SB 1TZLA 3HUGB 2HYJA 2L9RA 4LB6B 2TDXA 3BZKA 3WHBA 2KZGA 4Z2YA 1FTTA 3OOPA 1OLTA 4HEA2 4JBAA 4XRSG 3BTIA 4PFPA 4I0BA 2LSOA 5LHHA 1MW7A 2KJCA 2ZJRF 4XR6A 1JXSA 4U87A 5C4JJ 3PQKA 3A2KA 4KT5C 4JX4A 5CVJA 4XOPA 2R7FA 2NNNA 2WAQA 1BBYA 2L02A 3EQLF 2QQ8A 2X4HA 1J9IA 2H94A 2DA6A 2E7WA 2UV1A 5EEGA 1NG6A 1DPRA 3HKZA 5IYCJ 1OCCH 3PM1A 1X1PA 1V5GA 3PSFA 3JRDA 3CCMI 1S5LC 3H5AA 4ZDLA 1K7AA 4HF2A 2GOMA 2XUBA 2OQGA 2Z16A 2O61A 1BC8C 1IAWA 1LFBA 3A1YA 3U9GA 1FMVA 2F6CA 1SVLA 1MMDA 2DO7A 1MBJA 2DJIA 1P9QC 1X1DA 2M87A 4CCKA 2B63J 2VJ4A 2OD5A 2DFFA 3BOQA 1EH8A 3KLOA 2VASA 4BDZA 5HLTA 1MD0A 3TBIA 3TDUC 1D0XA 4XSZF 2GM4A 4XLEA 2X6WA 2CU7A 1HXDA 1OCZH 4BXFA 4OOIA 2A61A 3ZXSA 3IWZA 5D5UB 2PMUA 4FQGA 2IRFG 2MH9A 1IV8A 3ONQA 1ZYRF 2CWEA 1NH3A 3VYSB 3JRHA 3BCBA 5TISC 1MNDA 1S8NA 1VQ4I 4IHTA 4XLAA 4GYIA 1FYLA 2CMPA 2D5VA 3Q0VA 1W7PD 1AOYA 5IPAA 1XMAA 2NYXA 3DEUA 1APLC 4BHPA 1O3QA 4OAZA 2V9KA 1FOWA 2HDDA 2BY0A 2ZMEB 3L2RA 1WH7A 3S8PA 4EGYA 4ENKA 1LVKA 1RRJA 1BI0A 3H3VK 2OUMA 3GCMA 1Y1WJ 2WV1A 4KT6A 3C2BA 2VJIA 5FROA 3U1DA 1K4SA 1OCRH 4BQQA 1FSHA 3E3VA 4A3JJ 4XIDA 1AHDP 3WE2A 2HDWA 2RVCA 5FB2A 4AM3A 1DPUA 5IYDJ 1VZ0A 2XHKA 2Q1ZB 5HVQC 2IJLA 3EUKL 3S14J 5ICCA 3CUQA 1KU9A 2XPUA 3MZYA 3F23A 2VPRA 1A6IA 2A68F 4N4OB 2IS6A 1E3PA 3HOSA 1G3YA 4U7DA 3OYJA 4NHJA 1FBSA 3TEDA 1V54H 3VYRB 1QHGA 2XPVA 3K70C 4A3BJ 2OV7A 3CDIA 2IT0A 3MZHA 5M5YJ 1VQ7I 1LVAA 2CQXA 5GAHJ 2KIQA 1TTYA 3GF2A 1QQIA 4I0AA 4RS8A 4QSHA 1HLVA 2FMYA 2FXAA 2ZXHA 2ID6A 1R1TA 1Z3YA 3JSOA 3KEQA 1AKHB 5FGMA 3DP7A 4CCNA 2LG4A 3W3CA 4EV0A 2ECCA 4UVCA 1TWCJ 2LTPA 4Y17A 3EYYA 1VQKI 1HKQA 4L9NA 1DUXC 3WHCA 3WU2C 2QSHX 3TO7A 5L3DA 1LDDA 4UUTA 1RI7A 2K9LA 3K2AA 1MGTA 3JRGA 2K9SA 3KYDB 2DDAA 2WC2A 2XDVA 3H9QA 1WRJA 2VT2A 2LDUA 4FX0A 1HCRA 1YLFA 3FXLA 4Q47A 4KNYA 3OIQA 1R5GA 1IDZA 4L5JA 4IHVA 3OYDA 3FZVA 2H1LA 3ABLH 3VSKA 5M3FJ 2DXIA 2OBPA 2X51A 1F9NA 3OIOA 4I6ZA 2LRDA 3RPUA 2W84A 2O0YA 5HNFA 3BR6A 1YJNI 2A07F 2P8TA 2AQEA 1YJ9I 3MKYB 1UJ8A 1R1VA 4IHYA 4KICA 2D45A 3G4SI 1FBQA 1HW5A 5BNGA 3LSJA 5D5VB 3K0LA 3F0CA 2OTJI 2FEZA 2XAGA 1KU7A 1FJLA 1XSVA 2R5ZB 1S72I 2A5WA 4MFDA 1MJ9A 2XAFA 3TO6A 4ESBA 1WSUA 1TP4A 2XF6A 3TKYA 3HOZJ 3GTJJ 2XASA 3L09A 2EZIA 4CCOA 4XRMA 3QRFF 2DI3A 1SC7A 3OYBA 1MMNA 2L4AA 4XMYA 1OCOH 3ZCOA 4D5CA 3KZIC 5LD2C 1RNLA 3E7LA 3F8NA 3VB2A 3KZYA 3IV5A 1GVJA 4QTRA 2XC7A 2STWA 4JP0A 4L9TA 1Y39A 2QSGX 3PFYA 3IRRA 1TW2A 4C3IJ 2WB1N 3KYCB 4PUSA 2E60A 4RA2A 3WGHA 4A93J 2XF5A 5TJJA 1IW7F 4AVPA 2CGPA 3WG9A 2FUG2 1MNEA 3PFIA 2VXZA 5J8FA 2R5ZA 2XV4S 4BACA 1ZR4A 3L00A 2BVLA 3HSRA 2EFWA 2CSOA 1XCVA 4AVZA 4B3AA 3GZ5A 3D5SC 3EUAA 4NBQA 3PL8A 5FKNA 3KETA 2XROA 3HRMA 2AXTC 2MH2A 4L5EA 3ML6A 2DMQA 2PQ8A 1JKOC 2MYSA 4ZTFA 4IEJA 2V6EA 4DBRA 5FLVA 3BG6A 4HV5A 4G6TB 4M6YA 1UHWA 1DGRM 4A3MJ 3BJAA 2DQRA 2HTJA 1DP3A 3HHGA 3V7CA 3WU1B 4I76A 3I9V2 1T39A 1W4MA 1R71A 1G3TA 5FLXZ 1U5TA 4RB0A 3LSPA 2HXIA 2E71A 2KISA 5IT9K 3QPSA 1J5YA 1P7JA 3FHNA 5FKLA 1RUNA 2CO5A 3K4JA 4UV9A 3O8GA 1RKWA 3NQOA 1NK2P 1SANA 4G94A 2IPQX 1JKPC 1VNDA 4XBFA 3IL2A 3N97A 1EJ9A 2Z3YA 4A3FJ 2HZTA 2M1BA 4XM3A 1ZG5A 5DDGA 3P5JA 2VL8A 1XMXA 5J47A 3PUFA 4U88A 2VLAA 2EFQA 5BPDA 2WWYA 1JI8A 1E2XA 1WJAA 1WJDA 1P7IA 2NVQJ 5LHGA 1FX7A 2JZYA 3RCOA 1IXRC 2E7XA 2VQCA 3WU0A 1W36D 3LSGA 4M6XA 1AWCA 5LLQA 2GQQA 4XLPF 4JYKA 5EG0A 1Z7LA 4J00A 4M3DA 4KFCA 1GV5A 2P5KA 5EGOB 1VQLI 2LBFB 1EH7A 3DPUA 3FIWA 3DXJF 1V5EA 1R49A 3IWFA 1BW5A 1KYWA 3DTIA 5JR3A 1S9HA 3JW4A 3CC7I 3J7ZI 2AQFA 1Z6RA 1JUMA 1Y0UA 4JQFA 4UUSB 4E6KG 2H6CA 2M8GX 1O57A 2Z9OA 4RGSA 2LOOA 5HLGA 4HX4A 1KYZA 3K1NA 1PVEA 1S7OA 2JUGA 4ZYHA 3K10A 5ICEA 2E1OA 5IYBJ 1TL8A 2BGCA 3BJOA 3DV8A 3ROUA 2QBYA 2JT1A 4BH9A 3IRQA 2ZJPF 1SD5A 4EQQA 4PJ0C 5F1RA 1OCTC 1JTYA 3FXMA 5EGOA 2DA4A 5LFAA 2ZMEC 4XONA 2Q8KA 2DA1A 2CRGA 2V1UA 5E8GA 1ZH5A 3ZMVA 2XAUA 3LA3A 1S3JA 2EZKA 4YEJA 3C3WA 2WAFA 1J09A 2KP6A 2R5YB 2IS1A 2CG4A 1ETVA 3S16J 3H5RA 4PJLA 3RYPA 4AIKA 2W82A 2MC4A 4CCMA 3IAS2 2DODA 3HPHA 3OYLA 1ETXA 3JRBA 1RC9A 1U9OA 3MAJA 3OYHA 4HG2A 2L7ZA 1CQTA 2R7VA 5BS6A 5K5OA 3RTRA 1YITI 4LJZF 2CUEA 4BHCA 1RZ4A 2ZJ2A 5J1YA 1CGPA 2LY9A 3F6OA 4YFNF 5B5EC 1ACIA 4X0GA 4PDKA 4BE2A 2GOXB 5E3NA 4EM2A 3C2HA 5M5WJ 2PJRB 1IDYA 4M9XA 1HBXG 1T0FC 3U21A 3FXRA 2LKSA 3GTLJ 5ILUA 3DQVC 2JA8J 3ZN0A 1Y8QB 2A05A 3Q5FA 4ZZLA 2NNYA 4ENNA 1DDNA 3TMOA 3R4KA 3K6GA 1PJRA 3V8LA 3K4BA 4PSWA 2DMTA 2M45A 1WFXA 1YS6A 4XLHA 3BR3A 1SEUA 3QYEA 5L3FA 2ZSIB 4LMYA 1MSEC 2RC4A 3CDHA 3MQ0A 3A01A 2E35A 1MBGA 1E3OC 3JRFA 4NC8A 3QQAA 3BTCA 1TBXA 2YUSA 2K4BA 3IHUA 3P9CA 2AO9A 1A5JA 3ZMSA 4IZZA 1G2HA 1QGPA 1KQ8A 5F08A 5CVVA 3J80K 2X9DA 1HW2A 1ZARA 3K4CA 3ZQQA 2BW3A 4XKBA 1B8IB 4ETSA 4BXUA 4C30A 1EKEA 2ECBA 3CCLI 4X1EA 3J7AO 3WE3A 4IQJA 2Y30A 3QP6A 2HOTA 4EGZA 1SAXA 3MWMA 3NRVA 4A6EA 3CMYA 3VYUB 2V4JC 1LE8A 2EINH 1RKTA 3CC2I 3CCQI 1BJZA 2IS4A 4JOMA 2MGQA 3L7WA 3EUHC 4A0ZA 4QIWN 5IT3A 2Y9ZA 4BQOA 4A0YA 3CUOA 1XTAA 1H8AC 2WY7Q 1D8JA 1FBUA 3CF2A 1AKHA 1MBHA 4GYGA 4OWRB 3M3YJ 2DYSH 1ON1A 5BOXA 4Y52J 2EV5A 4OIPF 3H1CA 5JVTA 1O3RA 1K78B 2E2HJ 2A6HF 2ICWG 3WG7H 4FE4A 4ZJZA 5B66C 3GFLA 1LPQA 3ABKH 1AU7A 2DA3A 3J81K 2LR8A 4KA4A 2VKDA 2BE5F 1IV6A 4DQ2A 2GWRA 4ESFA 2BY3A 1R23A 2WADA 3B6CA 4LLGF 3WODF 4WXDA 2VBXA 4NC7A 4CDGA 3R61A 2CV0A 4G7HF 3UNGC 3S1NJ 5H6RA 2F48A 2LVSA 3M8FA 1TC3C 1Z77A 3DCFA 3LL7A 2E19A 2HPMA 2YX4A 1FP2A 4FE7A 2LKXA 1IUFA 2IGNA 4GGGA 1T33A 4RB1A 4XK4A 1PP7U 5GAEJ 1OR7A 2EJRA 3CJRB 1Y1VJ 1J75A 3P7NA 2A5YB 1NTCA 4KIBA 4UB8C 4CH7A 2VXDA 3CMEI 3BG3A 2O8XA 3GFMA 4MGRA 4RLQA 2F2EA 4ZYDA 3ZQCA 4UVAA 2VPLA 1IRXA 2DT5A 4DZJA 3HL2A 5F1JA 2HVSA 2GXAA 2MA3A 3C18A 3OYIA 1YRNB 1ETYA 1ZGAA 2DQLA 1UZCA 3S1MJ 1G4DA 1MSFC 2L9NA 1Z1DA 1WJFA 2Q2EB 3K4KA 3P9KA 1T2KA 1LEAA 4P1WA 3ASNH 2HI3A 3BQZA 1GV2A 5K7HA 2YSRA 2ADUA 4OINF 1UMQA 2ZSHB 4RGRA 1POGA 2JUCA 3S3OA 4IHXA 1K6YA 5LEKA 1IZ1A 2Z1DA 2DK5A 1E3HA 2VQLA 5JLWA 3K7AJ 4YFKF 3ZOBA 2IBDA 4A3GJ 2DBBA 3RZOJ 4M9SA 3OYAA 1O4XA 2HR3A 1RPWA 1G3WA 3S2WA 1ITYA 2RGVA 2X0LA 2DMNA 4IX7A 1I50J 5E20A 4NQWA 4AU7A 3K69A 5IY5H 4E7JA 4XKCA 1MH3A 1R5ID 4YIFA 2PMZN 4EM1A 2W00A 3BTLA 2LY2A 3OYKA 2G0EA 1NK3P 2XGXA 1LQ1A 1FPQA 1XC5A 2KQRA 4PSXA 4Y33A 3LNQA 4G7OF 4A3KJ 4GRIA 2EFPA 3JRCA 3F22A 4I2OA 1GDTA 1VI0A 3PIOF 2MLGA 3H5NA 3HGGA 3OYCA 2EQRA 3RKWA 2P6SA 3HTSB 1OR7C 2QA4I 2JN6A 2KZVA 2QKMB 4XLNF 4F3QA 4NDLA 2EWNA 1X3ZB 3CJTB 3ECHA 2W85A 2RN7A 4HDUA 3M9AA 4XN0A 4RAYA 3E97A 4A6DA 4PCQA 3MKZA 3M8JA 5CLSA 4G9YA 1BW6A 2Z33A 2DPDA 4XNFA 2VOPA 2WAQN 4DJAA 1B9MA 2YS9A 1L0OC 3ZP5A 3TO9A 5ICGA 4A3EJ 5C3EJ 2CQ7A 2LP0A 2TCTA 3IAM2 3E5QA 2RAEA 4L0ZB 5JHFA 4XQFA 4BHBA 2GIVA 1R6RA 2E1NA 1XSDA 1PUEE 5LGTA 2FD5A 3FISA 4LIUA 1BOBA 3ULQB 3LAPA 3JREA 3WTZA 4HZFA 3T8RA 2L7KA 4ITVA 1USSA 3FM3A 3I54A 2B0LA 5TRDA 1ZK8A 1FTZA 3E0JB 1IGNA 3K4NA 1FT9A 2XPWA 1YTYA 1TWAJ 3OS1A 2JA5J 4RM3A 4LGWA 3T8TA 4D9JA 4A2UA 2MW8A 2ISYA 5EZHA 2NVXJ 1QPIA 1JT6A 2CW0F 3E6CC 2HPIA 1JTXA 1JGSA 1GXPA 1D1CA 3HRSA 1TT5B 3G1OA 3R0JA 5H20A 4GCVA 4CZCA 5BPIA 2EB7A 2JWTA 4M72A 2JMWA 1WJ5A 2UUZA 2O3FA 3M1EA 1N77A 1K61A 2IGMA 2STTA 4UVBA 5F64A 2X48A 2QUFA 4IF4A 2QSFX 1F43A 1X1AA 2Y75A 2H09A 2JQ7A 1UHSA 5HS8A 4F92B 3OSFA 5GP9A 3HSEA 3TW6A 1XSXA 4LOCA 1TT0A 1D5YA 4ZYGA 1EA3A 1F1ZA 2BBYA 2M3AA 3A02A 2R5YA 1QRYA 2KFDA 4MEXF 1O3TA 3OY9A 4A3CJ 2CV2A 1V55H 3ASOH 1HDDC 3ABUA 3MN2A 3ERMA 3CJNA 5IP9J 2J5OA 3J7YJ 3DBLB 3IKTA 3HPGA 5K1YA 4A3LJ 1FYMA 1TWFJ 1ZTRA 1Z6TA 4E7SA 4OU0A 5CJ9A 1P6RA 3OYFA 3K1MA 4LFUA 5EJCA 3AKZA 1W5CC 1YX3A 5FO5A 1TNTA 2OTLI 2QZ8A 4QPQA 2R7ZJ 3FM5A 1Z67A 4DGWB 3G2BA 1ZAOA 3X2QH 3FDYA 3WTSC 4G8XA 3KPHA 4KITB 3JRIA 1L3LA 1I39A 1UCRA 4Y3OA 2CJJA 1KGSA 2ZNYA 3TQNA 2OQRA 2CUJA 4S0HB 1KU2A 2GIZA 4W97A 3HYIA 4EEFG 4KJZA 4XSXF 2L7FP 3IH3A 3S1QJ 1YX5A 3L2QA 2YU9J 1WHUA 3PQJA 2IGKA 3E6BA 2ZXWH 4D0PA 2D2WA 5LGUA 2PI0A 2V1XA 2CS3A 1DQUA 1TW3A 4TV7A 1B9NA 5CVRA 2VT3A 3CF5F 3NWSA 4CO8A 2V9PA 4N9HA 3W6JB 2HDCA 4M3GA 3GUDA 3MD2A 5J6XA 4KDPA 2DK8A 2RNGA 1OPCA 1TWHJ 4WF2A 3JTHA 4E70A 4I7HA 1B8IA 1G8XA 2P4WA 2QQBA 2RDPA 1ZGWA 2XB5A 4PJNA 1W7PB 4NNJA 5B1BH 1QBJA 1EV7A 4IJAA 4IOAF 1MMSA 1ZLJA 3W6VA 5FFXA 3CCYA 1LE8B 3QPTA 1YG2A 2X1DA 5HODA 5L3EA 3GYHX 1E17A 1KQ0A 4UXNA 2IS2A 3DWLE 3I4PA 1GT0C 1R58A 3FKJA 3RKXA 5E18F 5K7ZA 3HEFA 2F5DA 3LSRA 1JGGA 5DD4A 2E34A 2W24A 2J5PA 3KIOA 2Y2ZA 1D1AA 1YE9A 4Q5SF 4WX9A 1YHQI 4FASD 3CMMA 5H6QA 2PMHA 5AIPA 4E7IA 1BOAA 4A3IJ 2LREA 3G3ZA 1MNMC 2WV0A 3NARA 2VQGA 4A69C 4LLNA 3Q9VA 1FEXA 3RDIA 1WPKA 2OC6A 5CVIA 4A5NA 2H27A 1O7FA 4PK4A 1T6SA 2L9VA 4RMNA 1R22A 4PGGA 3BC8A 2FSWA 1G6NA 3Q9SA 4HAMA 2A69F 3H3UA 5DTDA 2OZ6A 1UAAA 2KHMA 3M8EA 2EA4A 9ANTA 2CQNA 2DYRH 2FQ3A 1U8RA 1HKTA 4M3EA 1BA5A 4HDVA 2QEXI 2DPUA 4UNOA 1ZELA 1STZA 1Z7UA 3GVAA 3OR1C 5F27A 5ED4A 1X1BA 4FHTA 4BAYA 2EIMH 2O6GE 2G9WA 3KE2A 4KISA 2R93J 2HYFA 1TNSA 3ZRGA 2VKVA 4IL6C 5DYMA 3WTWC 1VQMI 2MD5A 1YW9A 2XSJC 2OF7A 1IJWC 2M7AA 3H92A 2QYOA 4D1QA 3GTKJ 2DA5A 1ENHA 3S3MA 4H0EA 3KEOA 3A03A 1T95A 1LJ9A 3VODA 2YPRA 1T08B 2XKPA 5D6FA 3V7SA 1HA8A 2E2JJ 2HWVA 5J4VA 2P6TA 2VJJA 4F93B 1X58A 3LSKA 1P4WA 4FTHA 3ZPLA 1ZG1A 3HRUA 3NAUA 4MEYF 3V7RA 1I5ZA 4BJ6C 1K83J 4KN4X 2K9MA 3S3NA 1F5TA 3PNVA 2FE3A 4M3FA 3GFJA 3RQ4A 5DM6F 5LBQA 3L2CA 1D3YA 3L2VA 4G7ZF 2ESNA 4IRGA 2F5FA 3HOTA 3UKGA 2DA2A 1LDKB 3SFIA 2L0KA 4DZPA 2C6YA 2RNJA 3GX4X 3I5UA 2ELJA 2W57A 1I27A 1FLIA 3JAMZ 3GWZA 3M4OJ 4PGHA 4XRSA 1FOXA 3E5XA 2KDZA 4AIHA 5KAFC 2VE9A 2BY2A 5CYVA 2ZXIA 4A3DJ 3COAC 1IRGA 1W36C 2I10A 3TW7A 1P4AA 2QGUA 1FWZA 1UELB 3N05A 3BR1A 3SEZA 3KP4A 2HOSA 3DTEA 3ZQHA 4IOCF 2DOEA 4C2UA 2EZHA 2FBKA 5J4YA 2A3SA 4O6JA 3ZQ7A 2E36A 5KAIC 1JKQC 1J7KA 2Z5UA 3QAHA 4KMUX 2LBFA 1Z05A 5DD8A 3FKIJ 2L5QA 1BN5A 4AIDA 1TLHB 3J81Z 5HS9A 1PUFA 4CA0A 3E6MA 3I58A 1H0MA 4N4NB 1QNTA 4JX6A 2NS8A 1ETKA 1IN7A 1IRZA 1SFXA 3WTXC 3OOUA 2NXNB 1DU0A 5KCMA 2O8KA 3CD6I 4BBRJ 3FMRA 5CPRB 2O5RA 2VN2A 1XN7A 1JHHA 3SQNA 5HS7A 4J01A 2VB6A 3LOCA 1LNWA 4Y13A 3LMMA 4BQAA 4U7BA 1H89C 3HKZN 2H1KA 1MBKA 5DUKA 1I1GA 1TQIA 3FXQA 4L5IA 5D4SA 4ZH4F 2HQ5A 2R7RA 2OZUA 2R0QC 5DM7F 4QWQA 1PDNC 1Y6IA 3QYFA 1UG2A 3ESWB 2VE8A 4R1HA 5EEAA 3JSPA 3CTAA 4F91B 1FIPA 4C2TA 1UHMA 3TGNA 2PMZA 1R4NB 4WXHA 4XKWA 2NS7A 3KP5A 2XVCA 4B09A 4DNCA 3MMYB 4ENJA 4RAGA 6PAXA 3AL0C 2JVGA 3REOA 4GXOA 4CYCB 2XAHA 3FMSA 3OS2A 3HIFA 1G59A 2M4GA 5F6FA 1ZLKA 3ABTA 1JJ6C 3E6DA 3H3ZA 3AG3H 4A5MA 3T5XA 3IUOA 2CW7A 4M73A 3FXUA 1K4TA 3K9TA 3QU6A 1JT0A 2DMUA 2VC0A 4MLOA 4Z6YA 2AXLA 1YQAA 5A2QZ 2PJRA 1FMWA 2CFXA 2K27A 2R7OA 2D1VA 1YI2I 4MO7A 3DU5A 3HOUJ 1U6GA 4CXFA 4HSTA 3V4GA 2BVMA 4CZZA 1D0ZA 1YO5C 3K70D 4BL0B 1MMAA 5J40A 2QQ9A 1ULYA 4H4KC 4E7ZA 2KRHA 5A2QK 1U2WA 4NB5A 1IF1A
chains in the Genus database with same CATH topology
2Y69H 3AG3H 2OCCH 5IY5H 5B1AH 3ABLH 3WG7H 5B1BH 3ABKH 2EIJH 1V54H 3ASNH 1OCRH 2EILH 3ABMH 1OCCH 2EINH 2ZXWH 3AG1H 2DYRH 1OCOH 3AG2H 3AG4H 1OCZH 3X2QH 5B3SH 2EIMH 1V55H 2DYSH 2EIKH 3ASOH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y69 H;  3AG3 H;  2OCC H;  5IY5 H;  5B1A H;  3ABL H;  3WG7 H;  5B1B H;  3ABK H;  2EIJ H;  1V54 H;  3ASN H;  1OCR H;  2EIL H;  3ABM H;  1OCC H;  2EIN H;  2ZXW H;  3AG1 H;  2DYR H;  1OCO H;  3AG2 H;  3AG4 H;  1OCZ H;  3X2Q H;  5B3S H;  2EIM H;  1V55 H;  2DYS H;  2EIK H;  3ASO H; 
#chains in the Genus database with same CATH topology
 4DIQ A;  3OL4 A;  4CYC A;  1X19 A;  2X85 A;  4KN7 X;  5KVR A;  2NVU B;  2BY1 A;  2IA0 A;  3BR0 A;  2ME6 A;  2CV1 A;  1MIJ A;  1H9G A;  3B02 A;  2DFE A;  2Y48 A;  5JHU A;  2VQH A;  4OIR F;  3OV8 A;  2KT0 A;  1VQ6 I;  1FNN A;  1QPM A;  2BHZ A;  3T1B A;  2ESH A;  4HRI A;  2DT6 A;  2D1H A;  4FET A;  4MTD A;  2JA6 J;  2FBH A;  5F0H A;  1IXS B;  3I56 I;  1YFH A;  4XOT A;  2DU9 A;  3BDD A;  2M9H A;  4MHG A;  3CDL A;  1B6A A;  3IC7 A;  3OYE A;  3EET A;  2QWW A;  3MKL A;  3CLQ A;  1JUP A;  4QLC U;  5EYR A;  3OYG A;  5IP6 A;  3MFK A;  3BG7 A;  4RAZ A;  1S6L A;  1TQP A;  4P9F A;  1MMG A;  3OS0 A;  3GTO J;  1UFM A;  1I6X A;  3Q0U A;  3A0B C;  4P96 A;  2VKE A;  2LFB A;  2NVY J;  4P5O A;  4HSR A;  5GAD J;  1XGO A;  2F5V A;  4IO9 F;  3F8F A;  4I02 A;  4EJW A;  4D7M A;  3WGI A;  1RES A;  4L18 B;  4GFB A;  4M9Z A;  4AYB A;  3L1P A;  5HLI A;  4B43 A;  2Y69 H;  2XB0 X;  2Y0S A;  5ERI A;  2KPM A;  1XD7 A;  5FRM A;  3DKW A;  5F0C A;  2ZBK A;  5FKO A;  1W5S A;  2IP2 A;  2CUZ A;  3OSG A;  2LKP A;  1I6H J;  5E3M A;  4E4H A;  1UST A;  3ABM H;  2GLO A;  4CYD A;  1UG0 A;  3KX2 A;  3KZZ A;  1SMT A;  2W25 A;  4CGZ A;  2V1D A;  4IHW A;  4IHS A;  1WI3 A;  2OAZ A;  2L3D A;  4B3X A;  3CCR I;  3CUQ C;  1GVD A;  5L3C A;  5E1Z B;  2VON A;  1LDJ A;  5L3B A;  3W2W A;  3S2H J;  1S7A A;  3A0H C;  4XIC A;  1SD7 A;  2PLY A;  4MNU A;  2EV0 A;  3BLY A;  4XKV A;  4LLL A;  2GZW A;  3EYI A;  2WAE A;  1VQ8 I;  1IUY A;  3M1C A;  2E5N A;  1IO2 A;  2HXO A;  1WVR A;  3CO6 C;  1ZKG A;  2DTZ A;  5B1A H;  1MBF A;  3ZQF A;  3TOA A;  2RQP A;  2K4J A;  1WZ2 A;  5EDN A;  1YOV B;  1KA8 A;  1ON2 A;  1R36 A;  3HOV J;  5CQE A;  4YII A;  3D1N I;  1VQ5 I;  3AG2 H;  1ETO A;  4HA8 A;  4KMF A;  1O3S A;  2FRH A;  1GLN A;  2DCE A;  2IAI A;  3GTM J;  2WB1 A;  4CCJ A;  3HTU A;  1D1B A;  1Y0N A;  1YRN A;  2XF7 A;  1YIJ I;  4IQ4 A;  2VBZ A;  4EJV A;  2E1C A;  3PSI A;  2P7C B;  3BY6 A;  1BR1 A;  3H9J A;  3I71 A;  1I3Q J;  1XGN A;  4L9J A;  3BG9 A;  4CIC A;  3RKQ A;  2ACJ A;  3VYT B;  4EJT A;  3BG5 A;  2VOD A;  2R3S A;  1FIA A;  3DEE A;  1N78 A;  5L3G A;  3HC7 A;  1RET A;  3RPU D;  3FBI B;  3GLL A;  1ZG3 A;  4F55 A;  1I3A A;  3F3X A;  4ENM A;  1XB4 A;  5J1U A;  2KIF A;  2Q0O A;  1P2F A;  2RQQ A;  1OMI A;  2HKX A;  2M2E A;  2EH3 A;  1WWX A;  2CW8 A;  1ZGJ A;  1J59 A;  5FJ8 J;  1JE8 A;  4NC6 A;  2LH9 A;  3CJQ B;  4OIQ F;  3I4M J;  2UXN A;  3JTG A;  1BI3 A;  4OMZ A;  3W6K B;  3S15 J;  2K3F A;  3H36 A;  2W1O A;  1YW8 A;  3JAM K;  3U1K A;  3FMQ A;  4B4C A;  1SFU A;  1JJ8 C;  3KFW X;  2P5V A;  3OL3 A;  4KYW A;  2EBI A;  3BWG A;  4PZJ A;  3S32 A;  3IH4 A;  3FK6 A;  1Z3X A;  2M0M A;  4LG0 A;  4LB5 A;  1ZHF A;  2K85 A;  2QKL B;  5HOO A;  3HM5 A;  2GAU A;  1GXQ A;  2K40 A;  2M0C A;  4XLC A;  1ETQ A;  4Y15 A;  5C44 J;  3H0G J;  3SFZ A;  1A36 A;  2EIL H;  3MVP A;  3PNT A;  4WK8 F;  3KP6 A;  4ZYE A;  3GFI A;  4ABZ A;  2HYG D;  2Z99 A;  2ISZ A;  3F8C A;  3BR5 A;  4W1U A;  2PG4 A;  5J1R A;  1B1B A;  3K4L A;  3ZMU A;  4XL9 A;  4LD5 A;  4DYC A;  3VDX A;  4HX7 A;  3Q0W A;  4I98 B;  3I55 I;  4WWC A;  4ZTJ A;  4G6Q A;  4EVI A;  2ETH A;  3CCJ I;  2EPF A;  1A6Q A;  1V5F A;  3QOD A;  1W1W E;  3B73 A;  2M7B A;  5E3L A;  2X6X A;  4RB2 C;  3I64 A;  1V3F A;  2BXY A;  4Y4R A;  2EIJ H;  3O3K A;  1F4K A;  5EZG A;  1FOY A;  3J80 Z;  2MFZ A;  3HXL A;  1MDM B;  2E5Z A;  3HHH A;  3CCS I;  4JK1 X;  5IP7 J;  2UWM A;  2PEX A;  4BQN A;  4HV6 A;  2YR2 A;  3E5U A;  4V2G A;  2KRF A;  2VIX A;  2HVR A;  4FX4 A;  1CF7 B;  2O7O A;  4RDU A;  5GPA A;  2R7Q A;  2OCC H;  4V19 K;  1TWG J;  3WTV C;  3AL0 B;  1LFP A;  1PUF B;  3OMY A;  2MLK A;  3RYR A;  1FOK A;  3I0T A;  3SZP A;  2F5E A;  3HGY A;  1A31 A;  3GTQ J;  2COB A;  2P81 A;  5D6E A;  2VC1 A;  5BQT A;  5FLM J;  2AHQ A;  5EEH A;  5GTH C;  3S93 A;  2K9N A;  4L0Y B;  1VQP I;  2QQA A;  5F04 A;  3VPR A;  3FXO A;  2PN6 A;  2H8R A;  2GBY A;  2WA0 A;  1OKR A;  1VQN I;  5DCF A;  1FC3 A;  2AS5 F;  2EIK H;  1EF4 A;  2IA2 A;  1NHA A;  3GZN B;  3S17 J;  2NS0 A;  1HQC A;  3LWF A;  3HJE A;  2KJB A;  2M4K A;  4U0V A;  3IH2 A;  2OPT A;  1WJB A;  3QP5 A;  1OCP A;  2CYY A;  4YIR X;  2LYC A;  1CF7 A;  2WBM A;  1XMK A;  3LSH A;  3FF5 A;  3AAF A;  4P9U A;  4WCG A;  3BRO A;  1C0W A;  4ZDO A;  4J19 A;  4RAF A;  5DEQ A;  2DFI A;  4MQ9 F;  5ILV A;  4KUM A;  5E1X A;  3P9I A;  4F7Z A;  1RIO H;  4G6D A;  3GZ6 A;  4E7H A;  3C2G A;  1E0E A;  3L2W A;  2W48 A;  1QHH D;  2R4G A;  1QVT A;  3HDD A;  1XCB A;  5D8K B;  4MFE A;  3JCU C;  3F8M A;  1R9T J;  5CVU A;  1WH5 A;  1X3W B;  3HOX J;  3MCZ A;  5E8I A;  1U9N A;  3DBR B;  1ZQ3 P;  1NG7 A;  1XGM A;  3RQI A;  2CH0 A;  1GHC A;  1ZRC A;  3OYM A;  1D5V A;  2ZCW A;  2VBW A;  3MEX A;  4EJU A;  2Y0S N;  2IEK A;  4EAT A;  3HRT A;  5KK1 A;  2V79 A;  4ZZD A;  4RLF A;  3LQR A;  3O2P E;  1I1S A;  2HOE A;  2XRL A;  1VQ9 I;  1N25 A;  1XX5 A;  4IRH A;  1BI1 A;  4Q4Z F;  1IC8 A;  2H8W A;  1A35 A;  3HOY J;  4HNV A;  3E1S A;  2M5W A;  2ZFU A;  2P5L C;  2JSP A;  3CQZ J;  3KEY A;  3PJR A;  4Y7N J;  4BY7 J;  5JLX A;  4O3M A;  1LB2 A;  4LIV A;  1T98 A;  5FD5 A;  4M3B A;  1J2X A;  2BOL A;  1VQO I;  4O5V A;  4D5F A;  3AG4 H;  2FNA A;  4N9I A;  1W0T A;  2CUF A;  3LA2 A;  4BXX J;  3IKV A;  5KNL A;  3F72 A;  3EUH A;  4BU2 A;  2Y31 A;  2JJ7 A;  3HOW J;  2KRC A;  4X6A J;  1K78 A;  4EM0 B;  2DMP A;  3K1P A;  2QCO A;  2X1C A;  2LK2 A;  3CUQ B;  3FWE A;  4B1R A;  3JR9 A;  1BR4 A;  2G7H A;  3KLN A;  3RKY A;  3HB9 A;  3RPQ A;  3LAJ A;  2KDO A;  2VBY A;  2NRA C;  5TGT A;  2HOA A;  3F9K A;  2ZKZ A;  2CQQ A;  2ZB9 A;  4S05 A;  4HF0 A;  2VKH A;  3JRA A;  5GTI C;  3CZ6 A;  4R8H A;  1ONV A;  1R4M B;  5ILS A;  2F4M B;  1PP8 F;  2G7U A;  2OCE A;  3DPL C;  1XDU A;  2CQK A;  4DOZ A;  1QZZ A;  4OMY A;  3TOB A;  1JUS A;  3KYL A;  5HDG A;  1OYI A;  4XLF A;  4EJO A;  3GME A;  3W2V A;  2DT7 B;  1SFE A;  3I4N J;  4C9Y A;  2LD5 A;  2LY1 A;  1FP1 D;  2BW3 B;  1VF9 A;  2V6C A;  4UHT A;  1ZRF A;  5E1W A;  3A4C A;  2R92 J;  3LQQ A;  2DA7 A;  2E1M B;  3SHF A;  2DDB A;  5F0F A;  3CCU I;  4BYY A;  1HC8 A;  5M5X J;  1LUJ B;  4MIM A;  1QVU A;  1FY7 A;  5HDN A;  1ZRE A;  3KCC A;  3H35 A;  3SDB A;  1WJC A;  3FBN B;  2V1N A;  2GXG A;  2K7L A;  1Q1H A;  2VJ5 A;  3DEW A;  5B3S H;  1WQ2 A;  3CP2 A;  2WTE A;  4HOB A;  3BCA A;  4D7N A;  2KMU A;  5K5R A;  3CO7 C;  3NEU A;  2JK3 A;  1O7L A;  2B9S A;  3BR2 A;  1X2M A;  2IXS A;  2E1M C;  2MG4 A;  1F36 A;  2FJ1 A;  4FCY A;  5HDK A;  4M71 A;  2FU4 A;  5DV5 A;  1QO0 D;  1VFC A;  2DOA A;  2XIG A;  2K3P A;  1MH4 A;  5FFZ A;  2HQA A;  2RKH A;  2R7W A;  2NAZ A;  3DBH B;  3R0A A;  3G6E I;  3I3L A;  1HOM A;  1GUU A;  2LF8 A;  5ICF A;  1S29 A;  3R60 A;  1T38 A;  2NVT J;  3V42 A;  5CKT A;  2ZJQ F;  1ETW A;  1AA7 A;  1BI2 A;  3SEQ A;  3G71 I;  1SD4 A;  4ZDP A;  3DLL F;  3BQY A;  4AUX A;  2BZT A;  3ZR8 X;  2JRT A;  3ZQI A;  1MJB A;  4BJ5 C;  3S1R J;  1U0J A;  2P0W A;  1RUO A;  1OIS A;  5J8C A;  1DU6 A;  3SJM A;  2XGC A;  5H2F C;  2JRM A;  1WI9 A;  3QOE A;  3QYB A;  2R7D A;  2EZL A;  2ID3 A;  1MJA A;  2DN0 A;  3ZMD A;  2HZD A;  4IVN A;  3C7J A;  3RJP A;  2HKO A;  5K7F A;  4AIJ A;  4I99 C;  3ZQG A;  2FNP A;  2ZXJ A;  4E7L A;  4PFO A;  4HQM A;  4FT8 A;  5E17 F;  1IN6 A;  5HNH A;  1A04 A;  3TP0 A;  1RR7 A;  3MZ8 A;  1YIO A;  3C1D A;  3HSF A;  1WGX A;  3RI4 A;  1UB9 A;  3GTP J;  3UR3 C;  1YYV A;  2FOW A;  1U78 A;  3V8K A;  1Z91 A;  4R79 A;  3FX3 A;  1XS9 A;  2ME0 A;  4HLY A;  1H88 C;  4XOR A;  5JFR A;  2KLO A;  3LA7 A;  5DUI A;  2LLK A;  2GA2 A;  3DTK A;  3MKW B;  4HF1 A;  5D5W B;  2QF7 A;  5AIQ A;  5LRR A;  3HUG A;  1OJL A;  3W2A A;  1Q1V A;  2LF7 A;  2X1E A;  3EPZ A;  2DW4 A;  2O9L A;  3M07 A;  1IN8 A;  1Y8R B;  2JTV A;  2FA5 A;  5EF6 A;  2F5C A;  2L54 A;  4NQW B;  2HU9 A;  3SZT A;  4E7K A;  3WTU C;  2EFN A;  2WY8 Q;  5JVG F;  2R7T A;  4RM2 A;  1SFK A;  3I53 A;  1X1C A;  1HDP A;  2H6B A;  3BT9 A;  4B48 A;  2RV8 A;  1MZB A;  3QPH A;  4BBS J;  1U3E M;  3H0D A;  1Z9C A;  1YS7 A;  5LEJ A;  2JPC A;  3EDP A;  3WTY C;  2R7S A;  1B59 A;  4XN3 A;  4BJT A;  5J3L A;  4DYR A;  4UY8 I;  4OIO F;  3DKY A;  4YFX F;  3FXJ A;  3VFZ A;  2XGE A;  2GA1 A;  2X6Y A;  5DS9 A;  3ISP A;  1KQ9 A;  2LMD A;  3KP2 A;  3TDZ C;  3CCE I;  2QM3 A;  2MSY A;  4UV8 A;  1MDM A;  1V4R A;  5LHI A;  2YX7 A;  1JHF A;  1RR8 C;  4I01 A;  2IVM A;  5HLH A;  4MTE A;  2R7U A;  4HNU A;  3QWL A;  5EG0 B;  1SD6 A;  2YU3 A;  3VOE A;  2HQN A;  2OJE D;  1ZRD A;  1WJE A;  1XDS A;  2PJP A;  4L9V A;  3K2Z A;  2E2I J;  3SZG A;  3NWT A;  4AYB N;  2DJN A;  1HSJ A;  3CCV I;  2FOK A;  2JA2 A;  4BUP A;  3GBG A;  3J7A Y;  2HTS A;  2PFB A;  4G12 A;  5D4R A;  4UUS A;  3M7G A;  2KL4 A;  2HS5 A;  3LFU A;  2V7F A;  4LK0 F;  2XRN A;  2ZO4 A;  1IN4 A;  1EH6 A;  1ZN2 A;  4LIT A;  1SVM A;  2DAO A;  2FQ4 A;  1KZH A;  3KP3 A;  1HF0 A;  3GXO A;  2QBY B;  1WKM A;  4HW0 A;  4N0B A;  4HQE A;  4AC0 A;  4HPQ A;  3ECO A;  3ZGK A;  3ZMT A;  2M34 A;  3DFG A;  3OIP A;  3VEP A;  3WTT C;  3OYN A;  3D5L A;  3ERE D;  2JSC A;  3DLA A;  4C2M J;  4RBO A;  1SAU A;  4C3J J;  2DLL A;  2UZK A;  3AG1 H;  1QU3 A;  2BV6 A;  1P92 A;  3HG9 A;  5E3O A;  2DTR A;  4HBL A;  5FLX K;  4DYQ A;  2L2O A;  2UXX A;  3R6S A;  2QEN A;  3I59 B;  2W4S A;  4CHU A;  5C4X J;  2ZME A;  1H9T A;  3H9G A;  4UUV A;  1FZP B;  1ORK A;  4EMS A;  4KIG A;  2EK5 A;  3L2U A;  2ZFW A;  1QZE A;  4HNT A;  4RB3 C;  1TQM A;  5FD6 A;  2VOO A;  2BYV E;  4YG2 F;  3O6B B;  2FX0 A;  4AWX B;  4A12 A;  2L4M A;  4FIS A;  3Q3S A;  3SXY A;  2NOJ B;  1QZY A;  2P7V B;  4KIF A;  2DOF A;  1KON A;  3PIP F;  1MBE A;  3FXK A;  1ZR2 A;  4CCL A;  1XPX A;  4I09 A;  5AON A;  4ASN A;  1B4A A;  2TRT A;  1QA6 A;  5IOZ A;  1LKX A;  2ELH A;  3PUB A;  2VUM J;  4LK1 F;  2IW5 A;  4BEH B;  3PO3 J;  1DP7 P;  2QVO A;  4DW6 A;  1IG7 A;  4OAY A;  4IRI A;  1SMY F;  3I59 A;  4BE0 A;  1JKR C;  4U0Y A;  4PJM A;  1U5T C;  3D5R C;  3BJ6 A;  1D8K A;  3CES A;  2RRE A;  4UB6 C;  4PJJ A;  5K5Q A;  3A01 B;  2K02 A;  3TL4 X;  2L9S A;  2FBI A;  2KIM A;  3CC4 I;  1ERD A;  4II3 A;  5D5X B;  1Y56 A;  3G1L A;  4RGU A;  3RSN A;  3SYT A;  4QPO A;  2XGD A;  4P55 A;  3GLX A;  4B47 A;  1IN5 A;  2MAB A;  2HQR A;  3ELK A;  3DPT A;  1HST A;  2FML A;  4C3H J;  3LSM A;  2Y0M A;  2NOG A;  2BXZ A;  2LC2 A;  2XSD C;  2VI6 A;  4B44 A;  2BEO A;  1KU3 A;  4BEH A;  1BIB A;  2HNH A;  4LG3 A;  4YRV A;  4BDY A;  2IA1 A;  2PBI A;  3KP7 A;  3D0S A;  3CMA I;  3DF8 A;  1LFU P;  3N4M A;  1OYY A;  3BTJ A;  4AD9 A;  3AFH A;  3T0Y A;  1OFC X;  2HVQ A;  5GAG J;  4NUB A;  2EA2 A;  2DFH A;  3GTG J;  2MC3 A;  5DCM A;  4ANJ A;  2OA4 A;  5JI6 A;  4IKF A;  3VWB A;  3GEZ A;  2ZC2 A;  3BZ6 A;  4K2E A;  2I5U A;  2M30 A;  2EFO A;  5KHD A;  4B8X A;  1T8I A;  3L9F A;  1J0R A;  2EV6 A;  3BP8 A;  5E79 C;  1U8B A;  1N75 A;  5D8L B;  1X2N A;  1HW1 A;  1X4P A;  5FKK A;  1XGS A;  2Y9Y A;  5IOY A;  4GO1 A;  4RGX A;  2F4I A;  1YJW I;  3FHZ A;  2V9V A;  2HEO A;  4IXA A;  5CQG A;  1BR2 A;  3BPX A;  1W7P A;  2M8E A;  1SFO J;  5BMZ A;  3DU6 A;  2L7M P;  4DBQ A;  3F6V A;  1SVO A;  3G1M A;  2F4O B;  5M3M J;  5LRS A;  3BZC A;  4Q48 A;  2LNB A;  3S2D J;  2CFO A;  2ZNZ A;  2JVH A;  2I8D A;  1R5H A;  5DCM B;  1BC7 C;  1W0U A;  2GXB A;  1FSE A;  2XKO A;  2HFH A;  2OU2 A;  3SDG A;  1R00 A;  4CUG A;  1XG1 A;  1M1E B;  1X3U A;  1OYW A;  3ZN1 A;  3HZJ A;  3FK7 A;  2X6O A;  1YW7 A;  2KIU A;  1MKM A;  3OR2 C;  2FF4 A;  1ODD A;  1BL0 A;  1S7E A;  1BIA A;  4BKX A;  1BJA A;  1K79 A;  1IXC A;  2IGO A;  3U2R A;  5LGN A;  3F21 A;  3ZQL A;  1FYK A;  2K5C A;  3ZMZ A;  3VSL A;  2MD0 A;  2N8G A;  2XAQ A;  1K6O A;  2O03 A;  4WXC A;  1T0F A;  2L01 A;  4HLX A;  5FKM A;  5GPC A;  1R7J A;  2ELK A;  4BS9 A;  4BNC A;  3RZD J;  3CLO A;  4V2F A;  1B72 A;  3V8J A;  3CP8 A;  1HKS A;  1VTN C;  2Q2E A;  3QOP A;  4M6V A;  3G73 A;  1W5T A;  1P4X A;  1X4O A;  2A6E F;  2K86 A;  4A0X A;  3HBL A;  4ZC3 A;  4U0W A;  1LEB A;  4JX5 A;  4S04 A;  1R1U A;  2K9Q A;  2HGC A;  2B7E A;  4ESJ A;  3PO2 J;  2R7X A;  3RIR A;  4LG0 B;  4CSW A;  1IRF A;  1BM9 A;  4II2 A;  3QU3 A;  4M74 A;  3LST A;  3GO5 A;  5IT9 Z;  5FRN A;  3F8B A;  3PNY A;  2V26 A;  3TP3 A;  1OQY A;  4ZYA A;  3IP4 B;  3LSI A;  1U5T B;  3GW2 A;  3K4M A;  2A6T A;  4HX8 A;  3LFK A;  1PYV A;  2MBF A;  3BPV A;  1B72 B;  2W7N A;  3QPL A;  4HYE A;  4XRF A;  3B6A A;  1WCM J;  1G3S A;  2COM A;  4GDF A;  4IPA A;  3DKX A;  2PX9 A;  4BE1 A;  4MQV A;  2JA7 J;  2JPB A;  2BHY A;  4ON0 A;  4BGD A;  1DGW Y;  4BY1 J;  2KKO A;  4YEL A;  3WGG A;  4F52 A;  1T56 A;  2XAJ A;  3O8H A;  2QLZ A;  1Z21 A;  1REP C;  3OWT A;  1D0Y A;  1Z0X A;  2Z2S B;  1TZL A;  3HUG B;  2HYJ A;  2L9R A;  4LB6 B;  2TDX A;  3BZK A;  3WHB A;  2KZG A;  4Z2Y A;  1FTT A;  3OOP A;  1OLT A;  4HEA 2;  4JBA A;  4XRS G;  3BTI A;  4PFP A;  4I0B A;  2LSO A;  5LHH A;  1MW7 A;  2KJC A;  2ZJR F;  4XR6 A;  1JXS A;  4U87 A;  5C4J J;  3PQK A;  3A2K A;  4KT5 C;  4JX4 A;  5CVJ A;  4XOP A;  2R7F A;  2NNN A;  2WAQ A;  1BBY A;  2L02 A;  3EQL F;  2QQ8 A;  2X4H A;  1J9I A;  2H94 A;  2DA6 A;  2E7W A;  2UV1 A;  5EEG A;  1NG6 A;  1DPR A;  3HKZ A;  5IYC J;  1OCC H;  3PM1 A;  1X1P A;  1V5G A;  3PSF A;  3JRD A;  3CCM I;  1S5L C;  3H5A A;  4ZDL A;  1K7A A;  4HF2 A;  2GOM A;  2XUB A;  2OQG A;  2Z16 A;  2O61 A;  1BC8 C;  1IAW A;  1LFB A;  3A1Y A;  3U9G A;  1FMV A;  2F6C A;  1SVL A;  1MMD A;  2DO7 A;  1MBJ A;  2DJI A;  1P9Q C;  1X1D A;  2M87 A;  4CCK A;  2B63 J;  2VJ4 A;  2OD5 A;  2DFF A;  3BOQ A;  1EH8 A;  3KLO A;  2VAS A;  4BDZ A;  5HLT A;  1MD0 A;  3TBI A;  3TDU C;  1D0X A;  4XSZ F;  2GM4 A;  4XLE A;  2X6W A;  2CU7 A;  1HXD A;  1OCZ H;  4BXF A;  4OOI A;  2A61 A;  3ZXS A;  3IWZ A;  5D5U B;  2PMU A;  4FQG A;  2IRF G;  2MH9 A;  1IV8 A;  3ONQ A;  1ZYR F;  2CWE A;  1NH3 A;  3VYS B;  3JRH A;  3BCB A;  5TIS C;  1MND A;  1S8N A;  1VQ4 I;  4IHT A;  4XLA A;  4GYI A;  1FYL A;  2CMP A;  2D5V A;  3Q0V A;  1W7P D;  1AOY A;  5IPA A;  1XMA A;  2NYX A;  3DEU A;  1APL C;  4BHP A;  1O3Q A;  4OAZ A;  2V9K A;  1FOW A;  2HDD A;  2BY0 A;  2ZME B;  3L2R A;  1WH7 A;  3S8P A;  4EGY A;  4ENK A;  1LVK A;  1RRJ A;  1BI0 A;  3H3V K;  2OUM A;  3GCM A;  1Y1W J;  2WV1 A;  4KT6 A;  3C2B A;  2VJI A;  5FRO A;  3U1D A;  1K4S A;  1OCR H;  4BQQ A;  1FSH A;  3E3V A;  4A3J J;  4XID A;  1AHD P;  3WE2 A;  2HDW A;  2RVC A;  5FB2 A;  4AM3 A;  1DPU A;  5IYD J;  1VZ0 A;  2XHK A;  2Q1Z B;  5HVQ C;  2IJL A;  3EUK L;  3S14 J;  5ICC A;  3CUQ A;  1KU9 A;  2XPU A;  3MZY A;  3F23 A;  2VPR A;  1A6I A;  2A68 F;  4N4O B;  2IS6 A;  1E3P A;  3HOS A;  1G3Y A;  4U7D A;  3OYJ A;  4NHJ A;  1FBS A;  3TED A;  1V54 H;  3VYR B;  1QHG A;  2XPV A;  3K70 C;  4A3B J;  2OV7 A;  3CDI A;  2IT0 A;  3MZH A;  5M5Y J;  1VQ7 I;  1LVA A;  2CQX A;  5GAH J;  2KIQ A;  1TTY A;  3GF2 A;  1QQI A;  4I0A A;  4RS8 A;  4QSH A;  1HLV A;  2FMY A;  2FXA A;  2ZXH A;  2ID6 A;  1R1T A;  1Z3Y A;  3JSO A;  3KEQ A;  1AKH B;  5FGM A;  3DP7 A;  4CCN A;  2LG4 A;  3W3C A;  4EV0 A;  2ECC A;  4UVC A;  1TWC J;  2LTP A;  4Y17 A;  3EYY A;  1VQK I;  1HKQ A;  4L9N A;  1DUX C;  3WHC A;  3WU2 C;  2QSH X;  3TO7 A;  5L3D A;  1LDD A;  4UUT A;  1RI7 A;  2K9L A;  3K2A A;  1MGT A;  3JRG A;  2K9S A;  3KYD B;  2DDA A;  2WC2 A;  2XDV A;  3H9Q A;  1WRJ A;  2VT2 A;  2LDU A;  4FX0 A;  1HCR A;  1YLF A;  3FXL A;  4Q47 A;  4KNY A;  3OIQ A;  1R5G A;  1IDZ A;  4L5J A;  4IHV A;  3OYD A;  3FZV A;  2H1L A;  3ABL H;  3VSK A;  5M3F J;  2DXI A;  2OBP A;  2X51 A;  1F9N A;  3OIO A;  4I6Z A;  2LRD A;  3RPU A;  2W84 A;  2O0Y A;  5HNF A;  3BR6 A;  1YJN I;  2A07 F;  2P8T A;  2AQE A;  1YJ9 I;  3MKY B;  1UJ8 A;  1R1V A;  4IHY A;  4KIC A;  2D45 A;  3G4S I;  1FBQ A;  1HW5 A;  5BNG A;  3LSJ A;  5D5V B;  3K0L A;  3F0C A;  2OTJ I;  2FEZ A;  2XAG A;  1KU7 A;  1FJL A;  1XSV A;  2R5Z B;  1S72 I;  2A5W A;  4MFD A;  1MJ9 A;  2XAF A;  3TO6 A;  4ESB A;  1WSU A;  1TP4 A;  2XF6 A;  3TKY A;  3HOZ J;  3GTJ J;  2XAS A;  3L09 A;  2EZI A;  4CCO A;  4XRM A;  3QRF F;  2DI3 A;  1SC7 A;  3OYB A;  1MMN A;  2L4A A;  4XMY A;  1OCO H;  3ZCO A;  4D5C A;  3KZI C;  5LD2 C;  1RNL A;  3E7L A;  3F8N A;  3VB2 A;  3KZY A;  3IV5 A;  1GVJ A;  4QTR A;  2XC7 A;  2STW A;  4JP0 A;  4L9T A;  1Y39 A;  2QSG X;  3PFY A;  3IRR A;  1TW2 A;  4C3I J;  2WB1 N;  3KYC B;  4PUS A;  2E60 A;  4RA2 A;  3WGH A;  4A93 J;  2XF5 A;  5TJJ A;  1IW7 F;  4AVP A;  2CGP A;  3WG9 A;  2FUG 2;  1MNE A;  3PFI A;  2VXZ A;  5J8F A;  2R5Z A;  2XV4 S;  4BAC A;  1ZR4 A;  3L00 A;  2BVL A;  3HSR A;  2EFW A;  2CSO A;  1XCV A;  4AVZ A;  4B3A A;  3GZ5 A;  3D5S C;  3EUA A;  4NBQ A;  3PL8 A;  5FKN A;  3KET A;  2XRO A;  3HRM A;  2AXT C;  2MH2 A;  4L5E A;  3ML6 A;  2DMQ A;  2PQ8 A;  1JKO C;  2MYS A;  4ZTF A;  4IEJ A;  2V6E A;  4DBR A;  5FLV A;  3BG6 A;  4HV5 A;  4G6T B;  4M6Y A;  1UHW A;  1DGR M;  4A3M J;  3BJA A;  2DQR A;  2HTJ A;  1DP3 A;  3HHG A;  3V7C A;  3WU1 B;  4I76 A;  3I9V 2;  1T39 A;  1W4M A;  1R71 A;  1G3T A;  5FLX Z;  1U5T A;  4RB0 A;  3LSP A;  2HXI A;  2E71 A;  2KIS A;  5IT9 K;  3QPS A;  1J5Y A;  1P7J A;  3FHN A;  5FKL A;  1RUN A;  2CO5 A;  3K4J A;  4UV9 A;  3O8G A;  1RKW A;  3NQO A;  1NK2 P;  1SAN A;  4G94 A;  2IPQ X;  1JKP C;  1VND A;  4XBF A;  3IL2 A;  3N97 A;  1EJ9 A;  2Z3Y A;  4A3F J;  2HZT A;  2M1B A;  4XM3 A;  1ZG5 A;  5DDG A;  3P5J A;  2VL8 A;  1XMX A;  5J47 A;  3PUF A;  4U88 A;  2VLA A;  2EFQ A;  5BPD A;  2WWY A;  1JI8 A;  1E2X A;  1WJA A;  1WJD A;  1P7I A;  2NVQ J;  5LHG A;  1FX7 A;  2JZY A;  3RCO A;  1IXR C;  2E7X A;  2VQC A;  3WU0 A;  1W36 D;  3LSG A;  4M6X A;  1AWC A;  5LLQ A;  2GQQ A;  4XLP F;  4JYK A;  5EG0 A;  1Z7L A;  4J00 A;  4M3D A;  4KFC A;  1GV5 A;  2P5K A;  5EGO B;  1VQL I;  2LBF B;  1EH7 A;  3DPU A;  3FIW A;  3DXJ F;  1V5E A;  1R49 A;  3IWF A;  1BW5 A;  1KYW A;  3DTI A;  5JR3 A;  1S9H A;  3JW4 A;  3CC7 I;  3J7Z I;  2AQF A;  1Z6R A;  1JUM A;  1Y0U A;  4JQF A;  4UUS B;  4E6K G;  2H6C A;  2M8G X;  1O57 A;  2Z9O A;  4RGS A;  2LOO A;  5HLG A;  4HX4 A;  1KYZ A;  3K1N A;  1PVE A;  1S7O A;  2JUG A;  4ZYH A;  3K10 A;  5ICE A;  2E1O A;  5IYB J;  1TL8 A;  2BGC A;  3BJO A;  3DV8 A;  3ROU A;  2QBY A;  2JT1 A;  4BH9 A;  3IRQ A;  2ZJP F;  1SD5 A;  4EQQ A;  4PJ0 C;  5F1R A;  1OCT C;  1JTY A;  3FXM A;  5EGO A;  2DA4 A;  5LFA A;  2ZME C;  4XON A;  2Q8K A;  2DA1 A;  2CRG A;  2V1U A;  5E8G A;  1ZH5 A;  3ZMV A;  2XAU A;  3LA3 A;  1S3J A;  2EZK A;  4YEJ A;  3C3W A;  2WAF A;  1J09 A;  2KP6 A;  2R5Y B;  2IS1 A;  2CG4 A;  1ETV A;  3S16 J;  3H5R A;  4PJL A;  3RYP A;  4AIK A;  2W82 A;  2MC4 A;  4CCM A;  3IAS 2;  2DOD A;  3HPH A;  3OYL A;  1ETX A;  3JRB A;  1RC9 A;  1U9O A;  3MAJ A;  3OYH A;  4HG2 A;  2L7Z A;  1CQT A;  2R7V A;  5BS6 A;  5K5O A;  3RTR A;  1YIT I;  4LJZ F;  2CUE A;  4BHC A;  1RZ4 A;  2ZJ2 A;  5J1Y A;  1CGP A;  2LY9 A;  3F6O A;  4YFN F;  5B5E C;  1ACI A;  4X0G A;  4PDK A;  4BE2 A;  2GOX B;  5E3N A;  4EM2 A;  3C2H A;  5M5W J;  2PJR B;  1IDY A;  4M9X A;  1HBX G;  1T0F C;  3U21 A;  3FXR A;  2LKS A;  3GTL J;  5ILU A;  3DQV C;  2JA8 J;  3ZN0 A;  1Y8Q B;  2A05 A;  3Q5F A;  4ZZL A;  2NNY A;  4ENN A;  1DDN A;  3TMO A;  3R4K A;  3K6G A;  1PJR A;  3V8L A;  3K4B A;  4PSW A;  2DMT A;  2M45 A;  1WFX A;  1YS6 A;  4XLH A;  3BR3 A;  1SEU A;  3QYE A;  5L3F A;  2ZSI B;  4LMY A;  1MSE C;  2RC4 A;  3CDH A;  3MQ0 A;  3A01 A;  2E35 A;  1MBG A;  1E3O C;  3JRF A;  4NC8 A;  3QQA A;  3BTC A;  1TBX A;  2YUS A;  2K4B A;  3IHU A;  3P9C A;  2AO9 A;  1A5J A;  3ZMS A;  4IZZ A;  1G2H A;  1QGP A;  1KQ8 A;  5F08 A;  5CVV A;  3J80 K;  2X9D A;  1HW2 A;  1ZAR A;  3K4C A;  3ZQQ A;  2BW3 A;  4XKB A;  1B8I B;  4ETS A;  4BXU A;  4C30 A;  1EKE A;  2ECB A;  3CCL I;  4X1E A;  3J7A O;  3WE3 A;  4IQJ A;  2Y30 A;  3QP6 A;  2HOT A;  4EGZ A;  1SAX A;  3MWM A;  3NRV A;  4A6E A;  3CMY A;  3VYU B;  2V4J C;  1LE8 A;  2EIN H;  1RKT A;  3CC2 I;  3CCQ I;  1BJZ A;  2IS4 A;  4JOM A;  2MGQ A;  3L7W A;  3EUH C;  4A0Z A;  4QIW N;  5IT3 A;  2Y9Z A;  4BQO A;  4A0Y A;  3CUO A;  1XTA A;  1H8A C;  2WY7 Q;  1D8J A;  1FBU A;  3CF2 A;  1AKH A;  1MBH A;  4GYG A;  4OWR B;  3M3Y J;  2DYS H;  1ON1 A;  5BOX A;  4Y52 J;  2EV5 A;  4OIP F;  3H1C A;  5JVT A;  1O3R A;  1K78 B;  2E2H J;  2A6H F;  2ICW G;  3WG7 H;  4FE4 A;  4ZJZ A;  5B66 C;  3GFL A;  1LPQ A;  3ABK H;  1AU7 A;  2DA3 A;  3J81 K;  2LR8 A;  4KA4 A;  2VKD A;  2BE5 F;  1IV6 A;  4DQ2 A;  2GWR A;  4ESF A;  2BY3 A;  1R23 A;  2WAD A;  3B6C A;  4LLG F;  3WOD F;  4WXD A;  2VBX A;  4NC7 A;  4CDG A;  3R61 A;  2CV0 A;  4G7H F;  3UNG C;  3S1N J;  5H6R A;  2F48 A;  2LVS A;  3M8F A;  1TC3 C;  1Z77 A;  3DCF A;  3LL7 A;  2E19 A;  2HPM A;  2YX4 A;  1FP2 A;  4FE7 A;  2LKX A;  1IUF A;  2IGN A;  4GGG A;  1T33 A;  4RB1 A;  4XK4 A;  1PP7 U;  5GAE J;  1OR7 A;  2EJR A;  3CJR B;  1Y1V J;  1J75 A;  3P7N A;  2A5Y B;  1NTC A;  4KIB A;  4UB8 C;  4CH7 A;  2VXD A;  3CME I;  3BG3 A;  2O8X A;  3GFM A;  4MGR A;  4RLQ A;  2F2E A;  4ZYD A;  3ZQC A;  4UVA A;  2VPL A;  1IRX A;  2DT5 A;  4DZJ A;  3HL2 A;  5F1J A;  2HVS A;  2GXA A;  2MA3 A;  3C18 A;  3OYI A;  1YRN B;  1ETY A;  1ZGA A;  2DQL A;  1UZC A;  3S1M J;  1G4D A;  1MSF C;  2L9N A;  1Z1D A;  1WJF A;  2Q2E B;  3K4K A;  3P9K A;  1T2K A;  1LEA A;  4P1W A;  3ASN H;  2HI3 A;  3BQZ A;  1GV2 A;  5K7H A;  2YSR A;  2ADU A;  4OIN F;  1UMQ A;  2ZSH B;  4RGR A;  1POG A;  2JUC A;  3S3O A;  4IHX A;  1K6Y A;  5LEK A;  1IZ1 A;  2Z1D A;  2DK5 A;  1E3H A;  2VQL A;  5JLW A;  3K7A J;  4YFK F;  3ZOB A;  2IBD A;  4A3G J;  2DBB A;  3RZO J;  4M9S A;  3OYA A;  1O4X A;  2HR3 A;  1RPW A;  1G3W A;  3S2W A;  1ITY A;  2RGV A;  2X0L A;  2DMN A;  4IX7 A;  1I50 J;  5E20 A;  4NQW A;  4AU7 A;  3K69 A;  5IY5 H;  4E7J A;  4XKC A;  1MH3 A;  1R5I D;  4YIF A;  2PMZ N;  4EM1 A;  2W00 A;  3BTL A;  2LY2 A;  3OYK A;  2G0E A;  1NK3 P;  2XGX A;  1LQ1 A;  1FPQ A;  1XC5 A;  2KQR A;  4PSX A;  4Y33 A;  3LNQ A;  4G7O F;  4A3K J;  4GRI A;  2EFP A;  3JRC A;  3F22 A;  4I2O A;  1GDT A;  1VI0 A;  3PIO F;  2MLG A;  3H5N A;  3HGG A;  3OYC A;  2EQR A;  3RKW A;  2P6S A;  3HTS B;  1OR7 C;  2QA4 I;  2JN6 A;  2KZV A;  2QKM B;  4XLN F;  4F3Q A;  4NDL A;  2EWN A;  1X3Z B;  3CJT B;  3ECH A;  2W85 A;  2RN7 A;  4HDU A;  3M9A A;  4XN0 A;  4RAY A;  3E97 A;  4A6D A;  4PCQ A;  3MKZ A;  3M8J A;  5CLS A;  4G9Y A;  1BW6 A;  2Z33 A;  2DPD A;  4XNF A;  2VOP A;  2WAQ N;  4DJA A;  1B9M A;  2YS9 A;  1L0O C;  3ZP5 A;  3TO9 A;  5ICG A;  4A3E J;  5C3E J;  2CQ7 A;  2LP0 A;  2TCT A;  3IAM 2;  3E5Q A;  2RAE A;  4L0Z B;  5JHF A;  4XQF A;  4BHB A;  2GIV A;  1R6R A;  2E1N A;  1XSD A;  1PUE E;  5LGT A;  2FD5 A;  3FIS A;  4LIU A;  1BOB A;  3ULQ B;  3LAP A;  3JRE A;  3WTZ A;  4HZF A;  3T8R A;  2L7K A;  4ITV A;  1USS A;  3FM3 A;  3I54 A;  2B0L A;  5TRD A;  1ZK8 A;  1FTZ A;  3E0J B;  1IGN A;  3K4N A;  1FT9 A;  2XPW A;  1YTY A;  1TWA J;  3OS1 A;  2JA5 J;  4RM3 A;  4LGW A;  3T8T A;  4D9J A;  4A2U A;  2MW8 A;  2ISY A;  5EZH A;  2NVX J;  1QPI A;  1JT6 A;  2CW0 F;  3E6C C;  2HPI A;  1JTX A;  1JGS A;  1GXP A;  1D1C A;  3HRS A;  1TT5 B;  3G1O A;  3R0J A;  5H20 A;  4GCV A;  4CZC A;  5BPI A;  2EB7 A;  2JWT A;  4M72 A;  2JMW A;  1WJ5 A;  2UUZ A;  2O3F A;  3M1E A;  1N77 A;  1K61 A;  2IGM A;  2STT A;  4UVB A;  5F64 A;  2X48 A;  2QUF A;  4IF4 A;  2QSF X;  1F43 A;  1X1A A;  2Y75 A;  2H09 A;  2JQ7 A;  1UHS A;  5HS8 A;  4F92 B;  3OSF A;  5GP9 A;  3HSE A;  3TW6 A;  1XSX A;  4LOC A;  1TT0 A;  1D5Y A;  4ZYG A;  1EA3 A;  1F1Z A;  2BBY A;  2M3A A;  3A02 A;  2R5Y A;  1QRY A;  2KFD A;  4MEX F;  1O3T A;  3OY9 A;  4A3C J;  2CV2 A;  1V55 H;  3ASO H;  1HDD C;  3ABU A;  3MN2 A;  3ERM A;  3CJN A;  5IP9 J;  2J5O A;  3J7Y J;  3DBL B;  3IKT A;  3HPG A;  5K1Y A;  4A3L J;  1FYM A;  1TWF J;  1ZTR A;  1Z6T A;  4E7S A;  4OU0 A;  5CJ9 A;  1P6R A;  3OYF A;  3K1M A;  4LFU A;  5EJC A;  3AKZ A;  1W5C C;  1YX3 A;  5FO5 A;  1TNT A;  2OTL I;  2QZ8 A;  4QPQ A;  2R7Z J;  3FM5 A;  1Z67 A;  4DGW B;  3G2B A;  1ZAO A;  3X2Q H;  3FDY A;  3WTS C;  4G8X A;  3KPH A;  4KIT B;  3JRI A;  1L3L A;  1I39 A;  1UCR A;  4Y3O A;  2CJJ A;  1KGS A;  2ZNY A;  3TQN A;  2OQR A;  2CUJ A;  4S0H B;  1KU2 A;  2GIZ A;  4W97 A;  3HYI A;  4EEF G;  4KJZ A;  4XSX F;  2L7F P;  3IH3 A;  3S1Q J;  1YX5 A;  3L2Q A;  2YU9 J;  1WHU A;  3PQJ A;  2IGK A;  3E6B A;  2ZXW H;  4D0P A;  2D2W A;  5LGU A;  2PI0 A;  2V1X A;  2CS3 A;  1DQU A;  1TW3 A;  4TV7 A;  1B9N A;  5CVR A;  2VT3 A;  3CF5 F;  3NWS A;  4CO8 A;  2V9P A;  4N9H A;  3W6J B;  2HDC A;  4M3G A;  3GUD A;  3MD2 A;  5J6X A;  4KDP A;  2DK8 A;  2RNG A;  1OPC A;  1TWH J;  4WF2 A;  3JTH A;  4E70 A;  4I7H A;  1B8I A;  1G8X A;  2P4W A;  2QQB A;  2RDP A;  1ZGW A;  2XB5 A;  4PJN A;  1W7P B;  4NNJ A;  5B1B H;  1QBJ A;  1EV7 A;  4IJA A;  4IOA F;  1MMS A;  1ZLJ A;  3W6V A;  5FFX A;  3CCY A;  1LE8 B;  3QPT A;  1YG2 A;  2X1D A;  5HOD A;  5L3E A;  3GYH X;  1E17 A;  1KQ0 A;  4UXN A;  2IS2 A;  3DWL E;  3I4P A;  1GT0 C;  1R58 A;  3FKJ A;  3RKX A;  5E18 F;  5K7Z A;  3HEF A;  2F5D A;  3LSR A;  1JGG A;  5DD4 A;  2E34 A;  2W24 A;  2J5P A;  3KIO A;  2Y2Z A;  1D1A A;  1YE9 A;  4Q5S F;  4WX9 A;  1YHQ I;  4FAS D;  3CMM A;  5H6Q A;  2PMH A;  5AIP A;  4E7I A;  1BOA A;  4A3I J;  2LRE A;  3G3Z A;  1MNM C;  2WV0 A;  3NAR A;  2VQG A;  4A69 C;  4LLN A;  3Q9V A;  1FEX A;  3RDI A;  1WPK A;  2OC6 A;  5CVI A;  4A5N A;  2H27 A;  1O7F A;  4PK4 A;  1T6S A;  2L9V A;  4RMN A;  1R22 A;  4PGG A;  3BC8 A;  2FSW A;  1G6N A;  3Q9S A;  4HAM A;  2A69 F;  3H3U A;  5DTD A;  2OZ6 A;  1UAA A;  2KHM A;  3M8E A;  2EA4 A;  9ANT A;  2CQN A;  2DYR H;  2FQ3 A;  1U8R A;  1HKT A;  4M3E A;  1BA5 A;  4HDV A;  2QEX I;  2DPU A;  4UNO A;  1ZEL A;  1STZ A;  1Z7U A;  3GVA A;  3OR1 C;  5F27 A;  5ED4 A;  1X1B A;  4FHT A;  4BAY A;  2EIM H;  2O6G E;  2G9W A;  3KE2 A;  4KIS A;  2R93 J;  2HYF A;  1TNS A;  3ZRG A;  2VKV A;  4IL6 C;  5DYM A;  3WTW C;  1VQM I;  2MD5 A;  1YW9 A;  2XSJ C;  2OF7 A;  1IJW C;  2M7A A;  3H92 A;  2QYO A;  4D1Q A;  3GTK J;  2DA5 A;  1ENH A;  3S3M A;  4H0E A;  3KEO A;  3A03 A;  1T95 A;  1LJ9 A;  3VOD A;  2YPR A;  1T08 B;  2XKP A;  5D6F A;  3V7S A;  1HA8 A;  2E2J J;  2HWV A;  5J4V A;  2P6T A;  2VJJ A;  4F93 B;  1X58 A;  3LSK A;  1P4W A;  4FTH A;  3ZPL A;  1ZG1 A;  3HRU A;  3NAU A;  4MEY F;  3V7R A;  1I5Z A;  4BJ6 C;  1K83 J;  4KN4 X;  2K9M A;  3S3N A;  1F5T A;  3PNV A;  2FE3 A;  4M3F A;  3GFJ A;  3RQ4 A;  5DM6 F;  5LBQ A;  3L2C A;  1D3Y A;  3L2V A;  4G7Z F;  2ESN A;  4IRG A;  2F5F A;  3HOT A;  3UKG A;  2DA2 A;  1LDK B;  3SFI A;  2L0K A;  4DZP A;  2C6Y A;  2RNJ A;  3GX4 X;  3I5U A;  2ELJ A;  2W57 A;  1I27 A;  1FLI A;  3JAM Z;  3GWZ A;  3M4O J;  4PGH A;  4XRS A;  1FOX A;  3E5X A;  2KDZ A;  4AIH A;  5KAF C;  2VE9 A;  2BY2 A;  5CYV A;  2ZXI A;  4A3D J;  3COA C;  1IRG A;  1W36 C;  2I10 A;  3TW7 A;  1P4A A;  2QGU A;  1FWZ A;  1UEL B;  3N05 A;  3BR1 A;  3SEZ A;  3KP4 A;  2HOS A;  3DTE A;  3ZQH A;  4IOC F;  2DOE A;  4C2U A;  2EZH A;  2FBK A;  5J4Y A;  2A3S A;  4O6J A;  3ZQ7 A;  2E36 A;  5KAI C;  1JKQ C;  1J7K A;  2Z5U A;  3QAH A;  4KMU X;  2LBF A;  1Z05 A;  5DD8 A;  3FKI J;  2L5Q A;  1BN5 A;  4AID A;  1TLH B;  3J81 Z;  5HS9 A;  1PUF A;  4CA0 A;  3E6M A;  3I58 A;  1H0M A;  4N4N B;  1QNT A;  4JX6 A;  2NS8 A;  1ETK A;  1IN7 A;  1IRZ A;  1SFX A;  3WTX C;  3OOU A;  2NXN B;  1DU0 A;  5KCM A;  2O8K A;  3CD6 I;  4BBR J;  3FMR A;  5CPR B;  2O5R A;  2VN2 A;  1XN7 A;  1JHH A;  3SQN A;  5HS7 A;  4J01 A;  2VB6 A;  3LOC A;  1LNW A;  4Y13 A;  3LMM A;  4BQA A;  4U7B A;  1H89 C;  3HKZ N;  2H1K A;  1MBK A;  5DUK A;  1I1G A;  1TQI A;  3FXQ A;  4L5I A;  5D4S A;  4ZH4 F;  2HQ5 A;  2R7R A;  2OZU A;  2R0Q C;  5DM7 F;  4QWQ A;  1PDN C;  1Y6I A;  3QYF A;  1UG2 A;  3ESW B;  2VE8 A;  4R1H A;  5EEA A;  3JSP A;  3CTA A;  4F91 B;  1FIP A;  4C2T A;  1UHM A;  3TGN A;  2PMZ A;  1R4N B;  4WXH A;  4XKW A;  2NS7 A;  3KP5 A;  2XVC A;  4B09 A;  4DNC A;  3MMY B;  4ENJ A;  4RAG A;  6PAX A;  3AL0 C;  2JVG A;  3REO A;  4GXO A;  4CYC B;  2XAH A;  3FMS A;  3OS2 A;  3HIF A;  1G59 A;  2M4G A;  5F6F A;  1ZLK A;  3ABT A;  1JJ6 C;  3E6D A;  3H3Z A;  3AG3 H;  4A5M A;  3T5X A;  3IUO A;  2CW7 A;  4M73 A;  3FXU A;  1K4T A;  3K9T A;  3QU6 A;  1JT0 A;  2DMU A;  2VC0 A;  4MLO A;  4Z6Y A;  2AXL A;  1YQA A;  5A2Q Z;  2PJR A;  1FMW A;  2CFX A;  2K27 A;  2R7O A;  2D1V A;  1YI2 I;  4MO7 A;  3DU5 A;  3HOU J;  1U6G A;  4CXF A;  4HST A;  3V4G A;  2BVM A;  4CZZ A;  1D0Z A;  1YO5 C;  3K70 D;  4BL0 B;  1MMA A;  5J40 A;  2QQ9 A;  1ULY A;  4H4K C;  4E7Z A;  2KRH A;  5A2Q K;  1U2W A;  4NB5 A;  1IF1 A; 
#chains in the Genus database with same CATH homology
 2Y69 H;  3AG3 H;  2OCC H;  5IY5 H;  5B1A H;  3ABL H;  3WG7 H;  5B1B H;  3ABK H;  2EIJ H;  1V54 H;  3ASN H;  1OCR H;  2EIL H;  3ABM H;  1OCC H;  2EIN H;  2ZXW H;  3AG1 H;  2DYR H;  1OCO H;  3AG2 H;  3AG4 H;  1OCZ H;  3X2Q H;  5B3S H;  2EIM H;  1V55 H;  2DYS H;  2EIK H;  3ASO H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...