3ASZA

Cmp-complex structure of uridine kinase from thermus thermophilus hb8
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
203
structure length
203
Chain Sequence
KPFVIGIAGGTASGKTTLAQALARTLGERVALLPMDHYYKDLGHLPLEERLRVNYDHPDAFDLALYLEHAQALLRGLPVEMPVYDFRAYTRSPRRTPVRPAPVVILEGILVLYPKELRDLMDLKVFVDADADERFIRRLKRDVLERGRSLEGVVAQYLEQVKPMHLHFVEPTKRYADVIVPRGGQNPVALEMLAAKALARLAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Single Amino Acid Limits the Substrate Specificity of Thermus thermophilus Uridine-Cytidine Kinase to Cytidine
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords Uridine kinase
total genus 67
structure length 203
sequence length 203
chains with identical sequence B
ec nomenclature ec 2.7.1.48: Uridine kinase.
pdb deposition date 2010-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00485 PRK Phosphoribulokinase / Uridine kinase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3aszA00
4BE7B 4JBXA 4Q1EA 2IYTA 2J0QA 1VIAA 3I5YA 2QAGA 1OH7A 2VHQA 4R9UC 3OF5A 1ZIOA 2GXQA 5EE5B 1OV4A 4Q4HB 1KSFX 2GETA 4DSNA 2VL7A 1OKKD 1XPOA 1E3MA 4Q1FA 2WWGA 4MGKR 1HT1E 4DZZA 3BB3A 3A4NA 1E2KA 2ZVPX 1E96A 1N5JA 2WJGA 3SDZA 5BQ5A 4DIDA 1XB2A 5FL3A 2W83A 4OJQA 1GM5A 1U81A 2VIIA 1FUKA 2GXSA 1P4SA 3VR2A 1ZC3A 1Q1EA 2KWIA 4R2IA 2W00A 1OF1A 1OIVA 2GZDA 2OEPA 3GJ4A 4M1OA 4URWR 1ZU4A 1OFTA 1WDTA 2B8WA 2OAQ1 3QKSB 4CEHA 3VKGA 4IOJA 4DSTA 3RNLA 4US1R 1VG9B 4A4DA 1XJCA 5D3MA 1G64A 3ZH9B 1YR9A 3SOPA 3WYFA 3ICEA 2G1KA 4L5BA 4TL7A 4DLSA 1HV8A 4H1VA 4WAUA 2NQ2C 4EJSA 2XB2A 2XZLA 3C16C 2JLQA 3K0EA 1RRCA 3ZJYA 1GDDA 4HAVA 4LUCA 1UBGA 3CUEF 1G19A 1XWIA 5KSPA 2P6RA 2FWRA 2ZRNA 3TQFA 2PL3A 1SHZA 4A0RA 2AHOA 4NYJR 4D4LA 2XTZA 5FPKA 1FPMA 3NC0C 3GLIB 2RGGA 3AF0A 1ONBA 3DEFA 2O8DA 3WYGA 4HAZA 3VKWA 1BKDR 1T0HB 5KTYA 1E1QD 2F7SA 2C96A 2P65A 3W6PA 3TR0A 2WOOA 3ZVNA 1ZAKA 2WJYA 1GRNA 5CK4A 5UKDA 3TK1A 3TQCA 1W4RA 2FSFA 3B1XA 4OHWA 4IEEA 5G53C 1F2UB 1TUIA 3DM5A 4PPNA 4ESVA 1SKYB 3D3QA 1WB9A 4Q19A 121PA 5KYKA 1G4AE 3MSXA 1NN5A 1X8KA 4CEIB 3WBJA 5KPJA 5DI3B 1OH8A 2GJ8A 4TTPA 3C7KA 1G7TA 2BM1A 2ZIAA 5IDVA 4ZDJA 2IYSA 3NBZC 4DWJA 5TVKA 4A82A 5JS8A 3DL0A 3ZYCA 1EFUA 3A1TA 4F91B 2XJ4A 1D2EA 1UBCA 5TMPA 1YR8A 1KMQA 3SU8A 3AVWA 2ASEA 2OSBA 4G5SA 4DLXA 1GL9B 4CT4B 4W5HA 1Z07A 4RZUA 4Q66C 4JLOA 3RS4A 4KXFB 1EX7A 1N6NA 4DLVA 1T4GA 4AI6A 1W5TA 5F2EA 4BLRA 3QF4B 3CWZA 5L8VA 2BCJQ 4Q4LA 1OXSC 2IS4A 3SYNA 1AQUA 2ERXA 4DJTA 1G8PA 2AWNA 3I3SR 1OB5A 3GLGB 2WKRA 4JLJA 3OIUA 4B2IA 1YZUA 3IBYA 3K0AA 4AYXA 1GG2A 3E1SA 2FN4A 3TW4A 3AVYA 4KFSA 5SZHB 1VCOA 1Q3HA 1G41A 2F9LA 2QL6A 2EVWX 1C1YA 2FG5A 3P27A 3KQLA 4E09A 3CRMA 4US2R 4WA7A 2QAGB 2EFGA 1JAIA 4L9SA 1CR4A 2R8RA 1SVLA 2ZJ5A 1HYQA 5EZ6B 1N5LA 4P0TA 4LBZA 3N70A 4QBHA 1KGDA 4HUQA 3PG5A 2EFDB 3X1XA 1FL9A 1QHHA 2GZAA 4U5XA 1VCNA 2ZRJA 2BC9A 4NKRA 4W5JA 1ETUA 3SBDA 3QI2A 4I1SA 3FMOB 2JATA 3MWYW 3DMNA 2XNDD 2IX3A 3EA0A 3CH4B 3KUCA 1IY0A 1ZW6A 2V55B 4D6PA 1GRRA 2J7KA 3U3JA 2QQEA 3KKMA 1PLJA 3G5UA 2BEKA 3IDQA 3NC1C 5FBRB 3GQBA 3RSLA 1N25A 3SFZA 1N5KA 1K6MA 1XU4A 1LF5A 5BWMA 5FR1A 2YKGA 2EWWA 2YV5A 4WZ6A 5JZVA 4KLZA 4Q1AA 5JMTA 2NOAA 3PITA 3W6NA 1G6HA 1YJ5A 4YMWA 2VTKA 4RD3A 3RAPR 4QGHA 3U61B 1ZD8A 2YHSA 2YWEA 3CH5A 5FTMA 3HYTA 4E03A 4EJSC 3B1VA 4F4CA 4B33A 3V9PA 2RGBA 1FP6A 2XZPA 1OB2A 1XTJA 1VKJA 4JLMA 4WVFA 4HZUB 3Q7QA 5LBIA 2OLJA 1B0UA 3CPEA 4XSHA 1DAEA 1RRPA 2V8OA 4IOMA 2KSQA 3LA6A 1N6RA 1MR3F 5F9HA 3U3OA 4D4MA 2MSEB 2X19A 4WXPA 5KU1A 4CVNA 2QT0A 3AP2A 4DCTA 2H7VA 3I73A 3THOA 1XD9A 4M9XA 3CONA 1GZSA 4QKQA 1KI2A 4KBGA 3ETLA 4A0HA 5FOVA 3UMFA 3PCRB 1A2KC 4FMDF 2QRNA 1QG4A 4RZ2A 1UBFA 2H18A 1P62B 1YRAA 3AF1A 2DY1A 5HCNA 3CM0A 4ZIRB 2VA8A 4FN5A 3K09C 1PUIA 2WHXA 1ESMA 4MYCA 2PT5A 2VRWA 2IUTA 1H8EA 3IBGA 3AVXA 1AA9A 5IRCD 1LF0A 3VKHA 5EJEA 1FZQA 2YNMA 1WQ1R 2RCNA 3AH8A 4GP6A 4NE2A 4QHSA 3FKSA 3TKLA 4DCNA 4DUGD 2IWHA 4I1UA 3WMFA 2IT1A 4CIDA 3J81k 2ODNA 2K5UA 2EU8A 1F6BA 4AK9A 4YMVA 1ZJ6A 3AF2A 5FL7A 5CLQA 2O8CB 1PVOA 1LFDB 1XEWY 1W1WA 4IVPA 4RD6A 1G16A 3HU3A 4RD4A 4IHQA 3KB1A 2WV9A 4M1TA 1HH4A 5TDHA 2QP4A 4OL0A 4XIGS 3GEEA 2QAJA 4NU0A 2OBLA 4XWKA 2FSGA 2WMOB 4C0QC 4Q4AB 1QBKC 4RFSA 4OHXA 5G41A 1IBRA 4B6FA 5KOYA 4A0FA 1L8QA 2Z4SA 4TYQA 3CWQA 3VNUA 5GJCA 1A1VA 4LGMA 5KDDA 1M6NA 4HYYA 4UNPA 5AJXA 2O8FB 3PV0A 3CZQA 2DHRA 5FTNA 4EPRA 1WA5A 5L3QA 4YC7A 1CP2A 4M53A 2B21A 1Z2CA 1S8FA 3GLHA 2IS1A 1E9FA 1S9DA 1CJVC 3RS2A 1AJEA 2ZUCA 1BYUA 1GILA 2L0XA 5HE8A 4A6XA 3ZD6A 1EESA 1AM4D 1AN0A 4RFSB 5J4HA 1QZXA 1WBBA 1N2CE 3FYHA 1DVRA 5A4JA 2G77B 5AUQA 1FFHA 5FTLA 1KI9A 3B13B 4Y0VA 1FX0B 3O8RA 1E79D 4TLEA 2CCGA 2CL7X 4KCGA 2GILA 4HEJA 3IPXA 3NBFA 5J4LA 2NPFA 1GKYA 2D4HA 2RGNA 2VHUA 1GL7A 4DT1B 1GKUB 3OE7A 2QAGC 1E1RD 2G83A 2IYZA 3P32A 3TJZA 2OBNA 1W44A 1CKEA 1AKYA 1E9RA 2E9SA 1DS6A 3GJ6A 3Q5EA 4I99A 3Q8XB 3K9GA 5DH9A 5EP1A 1KDRA 2OXRA 5LB4A 2GA8A 2AFIE 3CF6R 4LBWA 1F2UA 1KI6A 1KYIA 1G21E 4Q5IA 1W7AA 2WMNB 1JQLB 1D8TA 2ZI7A 1CBUA 3KKNA 4TMKA 5JCPA 3ASYA 1ZUHA 2QM8A 1TEXA 4GDFA 2P5SA 3CRQA 3KTAB 4KVGA 4IJMA 3BFXA 1RKBA 2ODBA 3KB2A 4X8LA 4LJAA 2OT3B 2B7BA 4PC2A 3W8RA 1N6IA 4EQ6A 1Q20A 4JZKA 5F9FA 4URXR 1EFRA 2W6ID 3VAAA 4TLAA 2PZEA 1S9HA 4QG7A 1R0ZA 3FMFA 3THYB 3PUZA 2A2ZA 4H1UA 3SNHA 1BOFA 1CJMA 1NSTA 2FJUA 3AVTA 1XBTA 1L7VC 1MH1A 3UPUA 4GI7A 5HZHA 3A1SA 1ZCBA 2AL7A 3MFYA 5CLLA 3WHKA 1R10A 4NCIA 4D4KA 4XD7D 3LWNA 1TAGA 4YXWA 3REFA 3C4JA 4Q01A 3UK6A 4AG6A 2P2LA 4I1OA 4DSOA 2MSCB 3L82B 3NIBA 1DEKA 2OV2A 3W6OA 3FTQA 1CR1A 1GKIA 2QQ0A 1MOZA 1SQ5A 2ZRGA 3B85A 4AKIA 2CK3A 3QKUA 3B5JA 2KI5A 3CO5A 3QQ5A 3SN6A 5KHOC 3KXKA 3PUYA 1HA3A 3AKEA 4BLOA 1G7RA 5DNYB 1KDTA 2V4ZA 5HKKD 3WHLA 2GAOA 2R6CA 3CX6A 2C9OA 1OXTA 3NHAA 2HYIC 4XTRA 1F3OA 4LZZA 5M04A 2HF9A 3W3AA 5FUYA 4JLPA 1TTTA 1YZGA 3WXMA 1Z47A 2WSSD 1E2MA 3UG7A 2O52A 3C5CA 1R2QA 3MWLA 5JHGB 3DHWC 3MRSA 3VNVA 4LJ4A 3D8BA 1NIJA 3A58B 2HJVA 1E1RA 1S96A 1T91A 4KI0A 4NONA 2D7CA 2QU8A 2X77A 1Z29A 4IDNA 4D0LB 3CW2A 5JCZA 2Q9CA 2HDNB 2W2XA 5AJWA 4MKIA 4NMMA 1G3IA 1FP7A 1N6KA 3C8UA 3IEUA 3VU9B 3CBQA 2BMJA 2V1XA 4B2LA 1E9SA 3N5CA 4Q1BA 1BYIA 2X1VA 3QVVA 4J0QA 1ZIPA 4PQRA 1OYYA 3I8SA 2LKDA 1I2MA 3R9IA 2XGJA 3ND9A 2ZE7A 3IIJA 1II0A 1MABA 3MUFA 3HPRA 3T06B 3C5HA 2WIBA 3ZIAA 3K0CC 3CNLA 3ONWA 1RJ9A 2B92A 4JSYA 1OXVA 1KZGB 4DLZA 5LPNA 4OI2A 3G0HA 1AIPA 4QNMA 3EZFA 2XOKD 2YOGA 3BS4A 3PXGA 5CDFA 3QKRA 3TAUA 3QPVA 3BB4A 2IHBA 4DDWA 2ZI9A 4KLNA 3VR6A 1J8MF 2AR7A 1T6NA 4TT3A 1I4DD 3QKTA 1Q1BA 1ZUNB 1Q12A 2WKQA 4XWAA 1VHTA 2YINC 3LBIA 5AJYA 4OHZA 5KDOA 2ZS8A 1MV5A 1DELA 2GCOA 4RD0A 3ZDQA 3ADCA 4F4IA 4IDOA 1JXOA 4ZI2A 3NTUA 2WWXA 4XH9B 3H1TA 1L4YA 3BB1A 3QXXA 2FPMA 5DE3A 4BLPA 1DPFA 1HQCA 4G5QA 4LHYA 4P32A 4TMTA 4G0NA 4V0KA 4ACAA 1ZM9A 1HTWA 2QTVB 2PMKA 3DKVA 2OILA 2PCJA 3K0CA 4M0LA 5DYGA 3VX3A 1DE0A 2VBCA 3QKRB 4H9GA 4RZ3A 3SEAA 3ZLJA 3KJGA 1AK2A 1KTVA 2R62A 3VTKA 3OFNA 1LV7A 1RIFA 4AYWA 1X1RA 2OUKA 4TYWA 3LXXA 2CLDX 5DGXA 3T1TA 4R2HA 4XVUA 3AM1A 4GPTA 5G40A 2ZETA 4PZZA 2QTHA 2X2EA 5DN6A 2FA9A 1M2OB 3FDIA 4YMUA 3NVAA 3CNOA 1R0YA 2WBLC 1CR0A 4JLDA 2ZJBA 4AKHA 3PEUA 4ACBA 2QI9C 4OHYA 4BZPA 1DAFA 5FI0B 5HR5A 1BO6A 3QNUA 4B32A 5EE1A 4RVCA 3IEVA 2HCBA 3CZPA 2BWJA 2WPDD 3CR7A 1II8A 1SXJD 2AX4A 3H4MA 3NH6A 3RRMA 4IOKA 1UEJA 2QA5A 1XMIA 1IY2A 3K9LA 2HLDD 3OFND 3L43A 4DXAA 3LW7A 1VCMA 3SS8A 3AVOA 4A15A 2YC4C 2O8BB 1W49A 3I8XA 5CYPA 1X3SA 2WKPA 1KY3A 1OFIA 2QMEA 4M9ZA 2BDTA 1TL7C 3QKSA 1IAQA 3CF2A 3ZQ6A 4XSGA 4TMVA 2EYUA 1E0KA 3U44B 4TLBA 2QY9A 5K8TA 1NSFA 2JASA 3MLEA 4QJ4A 4ZDKA 1H8HA 2FNAA 521PA 1SXJB 3N2EA 1CU1A 2J0SA 3VR3A 4EJSB 3UKDA 1KIMA 6Q21A 1NBME 3HJNA 5J5CA 1GNRA 2ECKA 2Q3HA 4Q00A 2ZITA 2XXAA 2O8EA 3A37A 2Q9AA 1Q1ZA 5FOWA 2PBRA 4DB2A 2RB4A 3T61A 3O47A 2BM0A 4FMCF 4ZV4A 4BFTA 1J99A 2REBA 4LYJA 4TT3D 1P9RA 3D7MA 3MWKA 2GDJA 2YWGA 3D31A 4X8MA 4Y0AA 2GJ9A 5CM8B 2NMVA 1WRBA 2ZJOA 4GFDA 1L4UA 1OXUA 1T0JB 1VTKA 4M1SA 4Q7KA 1UEIA 4TYNA 2J46A 5FPTA 4EPTA 4K46A 1DO0A 3CPJB 1UDWA 1UKZA 3RS0A 1UADA 3R9WA 1QHHB 3ZVLA 4DLWA 2CXXA 5HE9A 3BIFA 1VYVA 2PX3A 3IO3A 4RSGA 1ZNYA 1F2TB 3T15A 1XXHE 5J4YA 1G7SA 2HUPA 1B23P 3P26A 4MDEA 2C2HA 3KDSE 3BAFA 2EYQA 1CXZA 4PTLA 4QBIA 4Q7MB 1KZ7B 4G5RA 4NHOA 2ZI6A 3SHWA 1TMKA 2WWWA 2ZSBA 4AURA 1E98A 3TLXA 1F48A 1LS1A 5BYJA 2OO7A 3T5DA 3TNFA 2H16A 4JVMA 4MGYR 3RRZA 1P5ZB 1XEXA 3AKCA 2CHVA 2IW3A 2QM7A 1RVDA 2WAYA 1UKVY 2ZE5A 4CT5A 1E2GA 2QNRA 3AKYA 3QBVA 1E2HA 1U0JA 3FE2A 3H84A 4FW9A 2ZJ8A 1XTQA 4JBYA 5H70A 2Z5FA 1G5PA 1A82A 4ABYA 2OCYC 1S1MA 1WE2A 1Q22A 2CVFA 2IYUA 1TNDA 2FV8A 4V0ME 4DLRA 4KAXA 4QM7A 3VHXA 2E87A 4AKEA 5HKKA 4B75A 5JSZA 2ORIA 4DKXA 1YRBA 2BBWA 3I72A 2EQBA 4GZMA 5DO9A 4A1FA 3THXA 1DAIA 5AUPB 2LCFA 1ZC4A 2FU5C 3B1ZA 3QXJA 4LBYA 4OBEA 4QGFA 4M9QA 2OBMA 2Q0HA 4B34A 4PAMA 5ANRB 1OSNA 4UJ5A 3OHMA 2C78A 2YWFA 1XX6A 3HPQA 2IS2A 4OJKA 1XMSA 4TMWA 1VYUA 5J47A 2WAXA 1LVGA 2ZR7A 1VDZA 3LQQA 1RPZA 2GJKA 3EC1A 3WNCA 2IEYA 4FCTA 2PZGA 3I61A 1MKYA 4JYCA 2IWRA 4JLAA 1EFRD 2GESA 1TPZA 3BWDD 3NDBB 1CRPA 1SZPA 1YQTA 1KO7A 4ZDIA 1R5NA 4ZKEA 2ORVA 4A2WA 2F43A 3VX4A 1F5NA 1SXJE 3B7GA 3E70C 5AJZA 1U0HC 3BH0A 4BEJA 2EFHB 3K9NA 1QRAA 3GJ7A 2ZQ5A 1CJKC 3CIOA 1BIFA 3KFXA 4V03A 1VPLA 3LVQE 4C0BA 2FEMA 1HEIA 1SXJC 3GJ5A 1G9XA 2Q21A 4EDHA 3U44A 5KSYA 4BASA 2VPPA 2V54A 3NKVA 1M1YE 5C4MA 1XTRA 2XSZD 4QNRA 2O5VA 4UJ3A 4QHYA 5H1YA 1J8YF 2X2FA 4K81B 4Q4AA 4LJ7A 3GEHA 4LJYA 3W8NA 2AKYA 2PLRA 3HU2A 5C1BA 4RKEA 2BV3A 2CL0X 4B2PA 3QE0A 4EKDA 1FTSA 1RJ9B 1IN7A 3KKOA 4WZAE 1DO2A 4NDZA 1NRJB 4B48A 5FBLB 2IYVA 3DPUA 3F3YA 3QVUA 5JI3E 1ELOA 2OCPA 5FBWB 2AKAB 2ZE8A 5JEDA 1E9DA 4NL4H 4Q4JA 2ONKA 1CF4A 4LC1A 5L3QB 3SI7A 1LNZA 1G8FA 2BEJA 2DBYA 3BERA 3EW9A 4F92B 2ZRDA 4JLBA 4TWZA 2NZJA 3EPKA 5B58C 5JS7A 4L15A 1JJ7A 5FBVB 1VIYA 5FBQB 3I62A 1GNQA 3PVSA 4YQFA 4OK6A 2BCGY 3HU1A 3IIKA 2VP0A 4V02A 3ZZ0A 4O2LA 2J41A 4DLTA 2ZRBA 3OIWA 4UNNA 1U2RA 1XD2A 4C0KA 3QUSA 2FE4A 2WM9B 5EUQB 1P72A 4Q47A 4HLDA 2DYKA 1KJZA 4BECA 1U94A 2EWVA 4LWZA 1JR6A 5KNCA 3PEWA 3AV0B 1D2NA 1ZM3A 4OQMA 3MGCA 4KFRA 4B3FX 1NN3A 5G3YA 3DZ8A 3X1DA 4TSFA 1SKYE 4CF7A 2XZOA 2AK2A 5FTKA 4EPXA 2FPLA 5LDDC 3AB3A 3NEYA 4KITB 2MMGA 1OIXA 1RYFA 3PQCA 4PC1A 3EIQA 2BBOA 5CJPA 1OXXK 1XNJA 3QENA 1D2MA 2BVNA 3DO6A 5DISB 2DB3A 2IA5A 2WJIA 4QL3A 1U8ZA 3MJRA 3GJ3A 1ANKA 4KHZA 2VHCA 2AFHE 4Q03A 4MRRA 3KX2A 2F1JA 3FMIA 3GLFB 1ZYUA 4ZI3A 3K8YA 1JB1A 1QHSA 3UWKA 1SVWA 2ZAMA 3WRXC 2ATVA 2CK3D 2IC5A 2OAP1 1YVDA 3CB4A 1IQPA 3SYKA 5FOTA 3TVDA 4JSTA 221PA 2Z83A 3WNBA 1AS3A 2DFNA 2OE2A 4BFZA 1W0JA 2A9KA 3VFDA 1OH5A 3MD0A 2JIZA 3IPYA 2RGEA 3GJ8A 4FMBB 4O25A 1W4CA 1M7BA 3SFVA 3AQ4A 2XXAB 1IN8A 2ZS7A 4Z51A 2CJWA 4AY2A 1D5CA 4DCSA 3UMSA 1OHHD 4ILEA 4AC9A 4X8HA 3EC2A 1Z0JA 3GLFA 1JAHA 3CRRA 2F43B 5EXTA 1FTNA 2RGDA 2IXGA 2KBFA 4DLUA 5DHFA 1MRNA 1N6OA 3MMPA 4HAYA 4U00A 3PR1A 5P21A 2PZFA 1QHGA 5JI2E 1P9WA 1ZM2A 3IGFA 2GF9A 4Q21A 1NJGA 3AUYA 3KQHA 2F1HA 5D3MB 3OAAA 5DI9A 5JWOA 1O3YA 2G0TA 2V6IA 3FFAA 4POAA 4EFNA 4HB0A 3LQRA 5K8IA 1KDPA 3PUXA 3U3RA 3QXSA 5FOSA 1BS1A 1KNQA 1QVRA 3U3MA 1ZCAA 3FVQA 3X1ZA 5L3RA 2GCPA 4C30A 1H65A 1JI0A 1MO3A 2TMKA 2XEXA 4HAWA 1G18A 1AZTA 3RYTC 4EPVA 2IYWA 1GL6A 1IM2A 3OE7D 4QJ3A 1TQ2A 1XJQA 3EPHA 4CEJA 1RFLA 2JLSA 4DBLC 4K8OA 3Q7PA 4GOXA 2GVDC 5JRJA 5JJLA 5A5GA 3GFPA 4URVR 4GZLA 1FMJA 5IK2A 4IVQA 3SJCA 3I5XA 4W9MC 1OFHA 2XNDA 1T5IA 3BOSA 2J0VA 4BEBA 1OT3A 3TVTA 1CIPA 1LTQA 1WMSA 3GJXC 2YVUA 1OLOA 1Z0DA 4RFVA 1NN0A 5FTJA 3RRNA 4BFSA 2J0UB 1N6PA 5DYIA 1NVVQ 1NLZA 3VR5A 3GEIA 1KOFA 2G1JA 2GZHA 2KB0A 3BFVA 3EAQA 3FWYA 2FEOA 1KJWA 1Z22A 4D4JA 5FH9A 1XP8A 1QHNA 2HYDA 3IIMA 4FMCB 5EZ5A 3AP3A 3WBKA 4YMSA 3THXB 1EFHA 1SVMA 1ZD9A 1ZNXA 3RS5A 5AWFC 3QIAA 1Z63A 2YZ2A 3KJIA 1N6HA 1BH2A 1LY1A 3SZRA 3TSWA 4MDFA 1Z2AA 4CZ2A 4WW0A 2W58A 3WMEA 1KKLA 2BKEA 2RHMA 1WP9A 2ZREA 4DHEA 1IY1A 1SVKA 2XITA 4QC2A 1U90A 2I3BA 2WSSA 2HT1A 2HF8A 5AUOB 1A5TA 1NVXQ 2WJHA 2ZAOA 4PHHA 3R8CA 1DAGA 4C9BA 4ZIRA 1JPNA 4LV6A 1RRFA 1C9KA 4V0OA 4HB3A 2GVZC 3OAAD 1I4LD 2DPXA 1Z5ZA 4MKHA 2C04A 4NYIQ 3U4QB 5FPSA 2CE7A 1SULA 1W4BA 3X1WA 2QEQA 1DAHA 2A7QA 4IFEA 5EP4A 2QBYA 4PPQA 4JVNA 3OEHD 3U6BA 3T5GA 3EPJA 3ADBA 1NI3A 1NKSA 1XCMA 2RH5A 2VHTA 1JR3E 3K70C 1MO5A 4Q9JA 4ARZA 3NG1A 2NO6A 2RAPA 4MKGA 3B1WA 2VO1A 5FUWA 4TYPA 4C0AC 4DCUA 2GCNA 3TMKA 4AKGA 4GL2A 1W0JD 4NBSA 4OQLA 1II9A 2CE2X 4KU4A 2D7DA 5TXGA 4A8JB 5DN6D 2BKUA 2R6FA 1UJ2A 3V00A 2IYRA 2O8BA 2ZVQX 1KO8A 2O0KA 1KI4A 5JWHA 3F0TA 1Z6TA 5EUMA 4P4SA 1QG2A 4EUNA 3EZ6A 2J1LA 2OFXA 1GNPA 4Q9HA 4HDQB 3I4LA 4NYMR 3C41J 4RCZA 2B8TA 2REXB 4C2UA 3GLHB 2VEDA 4L4UA 1KI8A 1E2PA 2O0JA 2ODEA 4AG5A 4IKEA 3K0FA 4B3CA 2C8VA 4E22A 1XEFA 3FGNA 4I4LA 3M6AA 1EWRA 3P20A 1PUJA 4OQFA 3P4YA 2CLSA 2JEOA 1U99A 2W0MA 4M21A 1KAGA 4JKIA 3ND8A 4PANA 5LD2B 4OYHA 1S2MA 2GJAA 4L8GA 2CL6X 821PA 1D9XA 2ZRLA 2IEZA 1E79A 3QEJA 2FZ4A 4DEYA 4IDHA 1JEEA 1BMFA 3BH7A 2Z6VA 2Q9BA 4M22A 1CJUC 4RJLA 1MO4A 3NBXX 2Q3MA 3VR1A 4UXJA 3Q9LA 3TSZA 3T1QA 1UKEA 1XDBA 3HR7A 4ZCLA 3EWSA 1VG0B 5DIFA 4OKSA 1K5GA 4TL9A 2ZUBA 3TRFA 2A30A 5JBQA 3AGPA 4B3GA 1CRQA 3TE6A 4ASUD 3THWB 1ZBDA 1VHLA 4M1YA 3SQXA 1F60A 2IL1A 4LPSA 4ZPXA 3GLGA 4LBVA 5GJBA 5KO2A 1E2DA 2OCBA 2CDNA 4Q02A 1KI7A 4LYFA 1BMFD 2GJSA 2ZYUX 1FW6A 2AK3A 2X8AA 2WZQA 3MJHA 4EQ6B 3ZS9A 1G4UR 1PV4A 3AF3A 4KSCA 4N3NA 1V5WA 3LO5A 1FUUA 2A5FA 2E1RA 2ODWA 5JLJA 5HTKA 1NG9A 4NYJQ 3DMDA 5TARA 2FX3A 5FOXA 3W5JA 3THWA 1W4AA 1J2JA 3R7WB 2C77A 3RHFA 1G8YA 2N42A 5LD2C 2QUZA 1R0WA 5DI3A 2ZJAA 1WXQA 4S2EA 3UWOA 1G1MA 1X8LA 3EASA 2H1LA 4WXRA 1M8PA 5BN4A 3BC1A 3FHCB 4RKFA 4D26A 4WIAA 4JL6A 3U4QA 2GKSA 3RANA 3R8FA 4MRVA 2QPTA 3RDPA 4DIEA 1ZM4A 2FFAA 2IYLD 1PLKA 4RCYA 4PQYA 5IHPA 2QN6A 2V9PA 4DDVA 3AVPA 1JEDA 3JVUA 3TIFA 4M8NE 3QG1A 3MCAA 4QBFA 3GMTA 4YXWD 5JEEA 3EZ2A 3WP0A 4XD7A 1YE8A 4PPFA 1SGWA 4PHFA 4B74A 1EG7A 4IW3B 1E2EA 4I1VA 3CPHA 3JVVA 4UNSA 3GD7A 3AVQA 1ESNA 3QPWA 2R9VA 2CVHA 5EP3A 3AGQA 3FKQA 4WBSA 4DSUA 3U60B 4RD2A 3B8HA 1F2TA 1G5TA 1G3MA 2ANCA 1GIAA 1XZPA 4CYMA 3NEJA 2ZANA 4FIDA 4C4PA 3W90A 4D81A 2ZUDA 4P33A 1G5RA 1K5DA 2GRJA 4A0GA 1S1CA 3I32A 3D6TB 4UXHA 2FFQA 1KHTA 1XCPA 3IKJA 4CEHB 4MA4A 2PJZA 4JL8A 2JLUA 3A36A 1IJFA 1E9BA 1YU9A 1Z6YA 2WICA 1QVAA 1YKSA 3SE0A 4QGGA 3A1UA 2ANBA 4Q1DA 1G3QA 3LX8A 4DT1A 4O2RA 2FSHA 1I4TD 3TUJC 2AWOA 2JJ2D 3BGWA 4OQXA 1NNEA 2ZRIA 4UXIA 2NO7A 1E2JA 2ZRCA 4URZR 5IT5A 5FI1B 2VSFA 2FGKA 3EX7C 5SZIA 3EZ7A 4Q18A 1NL3A 1T9HA 4HAUA 4R7ZA 5H68A 3GLIA 3CNNA 2CMKA 5A0FA 2PMDA 1X6VA 3Q72A 3ADDA 5GVRA 1KNXA 3GLGE 4MKFA 2REOA 1Z6AA 3QEOA 1P6XA 1Q44A 2B7CA 1AS0A 2NG1A 3IHWA 4GBMA 4TQAA 4TQUS 2JAQA 2LKCA 4CGZA 1DARA 4IOLA 2O0HA 4BLSA 2HXYA 2PX0A 2ZRAA 1S0UA 2HXSA 2DWQA 4G01B 4U02A 1X86B 1XZQA 2FMXA 3TH5A 2KBEA 3RLFA 4OI1A 2AXPA 5SZKB 1T8UA 2IHYA 1W46A 4JMPA 1TQ6A 4TMZA 1OKKA 2PEYA 2ZI5A 3LV8A 5FOUA 4OK5A 2VSXA 3NBYC 3HR8A 4JJZA 5TV2A 3FMPB 1XJ0A 3KJHA 2ZSAA 4GMDA 2SHKA 2DFTA 3SR0A 3SJBA 3JZAA 3L0IB 3B1YA 5BN5A 621PA 3RABA 1VG8A 2CNWA 5FPHA 3OEED 4EIWA 1Q3TA 1JALA 5BW8A 3FHOA 1GUAA 1N0UA 4BLTA 4HDOB 3U7EB 2ZJZA 4KBFA 4FD2A 3VQTA 4A6PA 3LLMA 5FFMA 4BFYA 2Q6TA 4BGDA 3GP8A 4PAOA 1QHYA 1P2SA 3F8TA 4ARZB 5KUTA 4EAQA 2F55A 1EX6A 2N1BA 4Q9KA 2QP9X 2VP2A 1PZNA 1DAMA 3IO5A 1ZMXA 1JR3D 2WIAA 1R6BX 1UKYA 3DOEA 3DZDA 1H8HD 3LBNA 4TQ9A 2A5GA 1I2DA 2FSIA 2C5LA 4Q1CA 4NPHA 3BJIC 4GNKA 5JJKA 3L8ZA 4B43A 1R7RA 1Y3AA 3GCGA 2QGZA 4WOPA 4F4JA 2ERYA 4BFWA 3B78A 5L3VA 1VG1A 2FF7A 4A8JA 3ZVRA 2XNSA 5CK5A 1IXRC 4XVRA 2OXCA 3IUYA 2JLYA 4KFUA 3KQNA 2XJ9A 2ZTSA 1SHKA 1KKMA 4TTQA 3O8CA 4UKDA 3LDAA 2FFHA 3WRYC 3FKSD 4NP6A 5H8WA 2P0EA 1XD8A 1OHHA 2HLDA 1ZUIA 2G6BA 3TBKA 2I4IA 1Z08A 3K70B 1ZRHA 2ONJA 4LYAA 5GADl 2YOHA 2ZI4A 1TADA 2DFLA 3W34A 1P2UA 4CW7A 3V4RA 3CRVA 1E9CA 1E9AA 1UM8A 2G88A 1G3RA 4S35A 3K0FB 4HLQB 4ON9A 1AQYA 4BFUA 5EP2A 1E1QA 4M9SA 3KXIA 3ASZA 2YC2C 3LVRE 4KJZA 3AF4A 4LSGA 2FZLA 2CHGA 2W0SA 1WBDA 1XCGB 3OIVA 5AUNB 2GEDA 4ESHA 4KSBA 3GLIE 1PJRA 2F1RA 4IVRA 5C4GB 3TSOA 2F9MA 4LJ5A 2CBZA 3EARA 2FFBA 1IHUA 1U8YA 4TLCA 1FNNA 2I1VB 2IXFA 2ZSEA 3H2YA 4EFMA 2F3RA 5B57C 2FGJA 2GXAA 1J90A 4PPGA 3T12A 4DDTA 2EW1A 2GEUA 1T3LA 2IYXA 4C2TA 5EXSA 2J59A 1NJFA 1UDXA 2C9YA 4AWXA 2GAAA 1XRJA 2VLIA 1M7GA 4B44A 2GBLC 3WNDA 5DLQC 4BRUA 2BJVA 1DTSA 2OM2A 1E0AA 2GXUA 3AEZA 4W7SA 4ERNA 1Q0UA 1TF2A 1FQKA 4C0SA 1XMVA 1Z6GA 2A5DA 3NHBA 2CCKA 1XPUA 2KE5A 4PX9A 1CR2A 2W2VA 2QENA 3B6EA 3KXLA 1EFTA 3LXRA 1HY3A 2QE7D 5DSZA 2XX3A 1KY2A 2IF0A 1E94E 3LW8A 3A1VA 1IONA 3FHTA 3HP1A 1W5SA 2BMDA 3SJAA 1OFUX 2A78A 4QOSA 3A4MA 4ZCIA 4GOKA 1JJVA 4AYTA 2V6JA 4P4TA 4PO1A 1E2FA 4F38A 2D2FA 2F6RA 1R8SA 2QE7A 4KYIB 4EPYA 1IXZA 1P2VA 5AR1A 2C99A 1SVOA 5BYKA 1NMXA 1D9ZA 2IXEA 4MITA 3W9YA 3K70D 3NDPA 1EGAA 4M4SA 2JJ1A 3OIYA 1DG1G 1NY5A 2QG6A 2VP6A 4LX0A 5JWRA 1T3SA 2QROA 4UNRA 1YZLA 3B9PA 3C14C 3GLHE 1OE0A 3RS7A 3NH9A 4U7DA 1KO5A 4N0EA 3B2EA 4QXAA 2IK8A 5IF9A 1MO6A 2BOVA 4OI4A 1FNMA 2H8KA 5TB5A 4MQBA 2FPKA 1E69A 4XOIA 3KKPA 4M1MA 3A1WA 4DEXA 2ZRFA 3NWJA 3DOFA 3CR8A 4C7OA 1TF5A 3O8BA 4BLQA 1GTVA 4YLGA 5KNBA 3PEVA 3KZ1E 1US8A 2W6JA 4FWTA 2OHFA 1GSIA 1E6CA 3OZXA 2ZU6A 4OHVA 1TUEA 2XAUA 1S3GA 3EIHA 1JBKA 2CHQA 4R71A 2V1UA 5KDLA 1W36C 3K9HA 2QSYA 4LHXA 4TZ6A 5LB2A 4JLNA 1HQYE 2DCUA 1NKTA 3SBEA 3S1AA 2VHJA 1IXSB 3DVLA 4LK2A 4D2IA 421PA 4US0R 1SKQA 2J9RA 3TW8B 2WOJA 4AD8A 3WYAA 2WTUA 2R6GA 1C4OA 4IXNA 1FMLA 2GBLA 4M1WA 2IBMA 1O87A 4A92A 2C03A 2QPOA 1R5BA 3GLFE 1NP6A 2RKOA 1R4AA 1UAAA 1G3UA 4F7WA 2GCOB 2QRZA 4Q7LA 3R9XA 1KJYA 2OFWA 4JL5A 5F98A 4D82A 2J0UA 1HE1C 4YONB 4C0JA 1COWD 2ZI3A 4MYUA 4G5GA 3T34A 2QP3A 3U7FB 4Q9LA 1XTSA 5L3SB 5JECA 1UF9A 5GJWC 4V0LA 3M4YA 1IOZA 2IYYA 3S1AB 1KK1A 4QHTA 2QMOA 4C3ZA 4B73A 4LJ8A 3HWSA 1NVUQ 3L2OB 1VCIA 2J7PD 3ZZTA 2YJTD 4CDGA 1TQDA 3ICQB 2HV8A 4ITRC 1RYHA 3VR4A 3M1IA 2WSMA 2R65A 1QF9A 2XTMA 1TQ4A 4PSAA 4TYYA 3NXSA 3EZ9A 3QG5A 3RWMB 4MRNA 2WWFA 4P31A 3HDTA 1KMHB 2NO0A 1HE8B 1M74A 1XMJA 4LHVA 4Q7JB 3QXHA 3LAWA 5HPYB 1KDOA 3RVBA 4IEIA 2V7QD 3UG6A 4WZBE 4MYHA 2P6NA 4RZXA 3T35A 4RD1A 3KQUA 1E99A 2C95A 4G5OA 5CB6A 2D3WA 5KPDA 1EXMA 3L0SA 1SVSA 5CB8A 2ZXUA 2CNWD 4QRHA 1YR7A 4KO8A 1KAOA 2OG2A 2Q3FA 3IQWA 4A9AA 5JFGA 3CX7A 1V43A 3VMFA 1NY6A 3N2IA 721PA 2QBYB 1HUQA 1Z28A 1CLUA 2O8CA 2BBTA 4TL8A 1Z8FA 2KJQA 2NZ8A 2J45A 4OK3A 1DBSA 2MMCA 3FOZA 3TGPA 1FQJA 1NBMA 1XTKA 2JDID 5B2ZA 2JGNA 4LJ9A 4NCKA 1KO1A 1PLLA 5BXQC 4LRWA 5HCIA 2PJRA 2WVJA 2W2TA 2QMHA 4BQSA 2ZM5A 2JLXA 1OH6A 3ADKA 4DLYA 4II7A 4JT4A 2Z43A 2ZSDA 4BPBA 1UPTA 3LH5A 1AGRA 4C0HA 4P4SB 1T8TA 3BRWD 3TAHA 5KSZA 1A4RA 4C7OB 2Y8EA 3QF4A 1Q1QA 1RZ3A 1ZINA 2A5YB 2IYQA 3GFTA 2HCJB 4LYHA 4HUTA 4LY6A 4W5WA 3ZVMA 4LJ6A 2BMFA 3BXZA 4JLKA 4MGZR 2NPIA 4UNQA 4NCJA 3K0AB 1Z0IA 4DRZA 3IQXA 4D0NA 4BZQA 3V4FA 1G291 1XXHA 1YZTA 5K8UA 4PC7A 2F3TA 4BFXA 4AIIA 4EPWA 2IUSA 1NG1A 1RW4A 2CEAA 3FPAA 2N46A 2O8DB 1KSGA 4A2QA 4Q4JB 4LV5B 3Q85A 3SJZA 3AKDA 1E2IA 3PJRA 4D0GA 4TTRA 4IFBA 1RE0A 3LFUA 3MG9A 1TF7A 4O0MA 3UIEA 4DCVA 1SXJA 2ZRKA 4YMTA 3QPUA 4LHZA 1M7HA 4RY2A 2GHIA 4FXPA 4PC3A 3UXMA 1P2TA 1MABB 1J70A 2LWIA 2AD1A 2J5XA 2P3SA 1P3JA 1QHXA 2JIZD 4JT2A 2P67A 4PO9A 2QZ4A 3E2IA 1GAJA 1KI6B 3EA5A 1XXHB 1T3HA 3ZGXA 1N5IA 4PZYA 5C46F 3SYLA 4LV8B 4NTZA 4PR0A 1NN1A 3DDCA 1G17A 4EFLA 4CEJB 1U8AA 2NO1A 1NMZA 3K53A 5CIWA 3T1OA 3UATA 3LBHA 4B6EA 1Z0AA 1U9IA 3DKPA 1R8QA 3EXAA 1P61B 1VYTA 2RGXA 3LY5A 5EXXA 3LX5A 1N0VC 1E0SA 3LLUA 4XVQA 1W2HA 1VECA 3PENA 4ZO4A 4Z54A 3SHFA 2ZYVX 3BD9A 3K09A 2G3YA 2EFEB 1KMHA 3A4LA 4MUAA 3CRW1 3RC8A 5E95A 1IN6A 2BHRA 2QSZA 1Q57A 2VF7A 2FOLA 4TSFD 1E2LA 2PEZA 4MRSA 1IN4A 1XTIA 2GWHA 4PZLA 3AVUA 4NZYA 1GWNA 1YZKA 2Z0MA 3IILA 4D25A 1YZQA 1W0KA 5HZKA 3ZS8A 4PHGA 3U6KA 1XFAA 4X8OA 3VHLB 1S3SA 1LB1B 1LW7A 2WJVA 1ZNZA 2JJ1D 5BN3A 5JJIA 2R6AA 2XOKA 1KSHA 4Z8YA 4DDUA 1G6OA 4B3BA 3A8TA 1GOTA 4TMXA 1TU3A 2PCLA 1KK3A 4P3YA 3KUDA 3ZIAD 3PIRA 2BBSA 2JDIA 4V0MA 1AS2A 1NBMD 4ASUA 2CLCX 1ZM7A 5CITA 4FI3C 4BZXA 2WWYA 2CCJA 4FMDB 4HUQB 3BK7A 5EQTA 2HEIA 2FDCA 1CEEA 3AP1A 4A8JC 2JA1A 4M1KA 4N1AA 1II8B 1GFIA 1CTQA 4G3XA 5J4VA 1SVIA 1W47A 2UZ3A 3L0OA 4B71A 3KL4A 2PT7A 3QF7A 4QJ5A 1R5OA 1N0WA 1AGPA 3RC3A 4CRWB 2PLFA 3BBPA 2VQSA 5FR2A 2RGCA 4B47A 2ZR9A 1T5LA 4FWIB 1NVWQ 2VP4A 1GVNB 1Z3IX 3U3KA 2C98A 4ZCMA 1XF9A 4Z1MD 5C18A 4HB4A 4GRAA 4A36A 1JECA 2DFKB 4FCVA 3KKQA 3QJYA 2WWHA 5EE0A 3BFKA 1RRGA 3EIEA 4Q4HA 1CS4C 4N0DA 2ZJYA 2A3RA 4BWYA 1OYWA 5FUXA 1AKEA 2XSZA 4HLCA 4PHTA 4KYUA 1JPJA 5FPYA 1NMYA 2O8EB 3X1YA 5B64A 2GF0A 1E9EA 1G7CA 4V0NA 5J4KA 2R2AA 3CLVA 1W36B 3OESA 1ZP6A 1VMAA 5L3SA 1IN5A 4MUBA 3K0SA 1HT2E 2JLWA 2RGAA 1ZNWA 5ELXA 1TU4A 3REGA 3B60A 1K8RA 2JLVA 4M2LA 4JJKA 2JLRA 4B3XA 2ZU0C 1W2GA 4QFMA 2ZS9A 1NLYA 1U98A 2J7PA 2WWIA 3CX8A 3LD9A 2H5EA 3U7GA 1CJTC 4L16A 4LOAA 2OZEA 3F5FA 2GK6A 3PEYA 3BH6A 1JQJC 2A5JA 3TUIC 1KSJA 3B9QA 4HSEA 3TUZC 4GP7A 3RWOA 2BIFA 2FH5B 4LHWA 2JLZA 1OW3B 3AUXA 4TL6A 4DC9A 5CIQA 2ORWA 1E0JA 4HB2A 4BUJA 4LI0A 4BFVA 1COWA 8OHMA 2UKDA 3H0KA 1E4VA 5GVSA 2Z4RA 4JS0A 4Q48A 2W6IA 5C2JB 3I1FA 2V3CC 3OEHA 3R20A 1Q21A 1KI3A 4IRUB 5F3WB 4Q9IA 4TN1A 2XTNA 4XTCS 2QORA 3U7HB 3ECCA 1QHIA 4XWOA 2NTYC 4JVSB 3A6PC 4FINA 4GOJA 1XEXB 3LRPA 1ZVQA 1GP2A 2DR3A 2QGNA 4QBGB 4YDHB 1W36D 2RGNC 1UBEA 2VP5A 1OJLA 1DG3A 4HLUC 3W3ZB 2NGRA 3E5HA 2QPAA 2VYFA 3LNCA 3T1VA 3H86A 4ZKDA 5JRZA 2GTPA 3QY0A 1R0XA 2ZRPA 4QGAA 2D06A 3ZZUA 2H17A 4O3MA 5E7IA 5E3HA 2BMEA 2ATXA 2F1IA 2H57A 2W6JD 2HJGA 4CEIA 2NIPA 2IS6A 5JSZB 2J87A 4PAQA 2C9CA 2CJWB 5JHHB 2GNOA 3KTAA 3OEEA 1A2BA 2HT6A 4OI0A 2RHDA 3MAAC 1ODFA 1Z0FA 4Z1MA 1W48A 3Q5DA 3DM9B 4BRWA 1A7JA 4OQNA 2O8FA 4DB4A 2G9NA 1D6JA 1OPXA 1P73A 3IHLA 4GMXA 3ZD7A 2ZPTX 3PUWA 4HLUA 4D80A 1QDEA 4IDQA 1S4QA 1KI1A 4QM6A 3QOFA 1XEWX 2GEVA 3CF0A 3G82C 5E7JA 4E5UA 3KQKA 1XPRA 3RS3A 3W5IA 3O8DA 3P1JA 5J40A 1UFQA 1E2NA 3R7WA 3QBTA 4ZDWA 2YWHA 3FFBA 1AZSC 1KK2A 1NF3A 3HYRA 3PUVA 2D62A 1KK0A 2J3EA 4URUR 4KVAA 3WMGA 1DAKA 4GT1A 3GJ0A 4IDPA 1NIPA 1NVVR 2ZYTX 1LS6A 4YDSA 2I1QA 5IK2D 2AN9A 4HAXA 3TR5A 5B30A 1IJEA 4C0LA 1FX0A 3JZMA 2R44A 3UANA 4PFSA 3AVVA 4PSKA 1W0KD 2OCAA 3GPLA 4MH0R 3SQWA 2VF8A 1TEVA 2V7QA 3BE4A 3U2QA 4PQFA 3C15C 1E4YA 3CKLA 2OLKA 3I92A 2PH1A 5E7MA 1Y63A 4G1UC 1WCV1 2DWPA 2ZYWX 4B3DA 5K8LA 5CDFE 3L8YA 1RC8A 4HI0E 1MT0A 4JLVA 4LC0A 5KSOA 2P6UA 4NCNA 4HDCA 2JJ2A 4GSYA 1Z6XA 4KFTA 3WY9A 3EPLA 3B82A 2GK7A 1YHNA 5D3QA 4DVGA 2YYZA 2MSDB 1NLFA 4JVLA 5FUVA 5AK0A 2DWOA 3GFOA 2RMKA 3RSOA 2ZR0A 1EWQA 5FL7D 4E07A 5EE9A 3WP1B 2OFOA 1TX4B 5AJVB 2ZEJA 4TLDA 2OESA 4B76A 1EFCA 1ZU5A 3K1JA 4NYMQ 4DUGA 5TY0A 3ZQJA 2BJWA 1P7CA 2QT1A 4JBWA 4NYIR 1M34E 5SZJA 1H8ED 1N3BA 4I81A 1MRSA 4UQOA 2JJ8A 2WPDA 2ZJ2A 2QTFA 2ZRHA 1J7KA 2B6HA 2ZSFA 3FB4A 3Q3JB 4JIMA 4KODA 3THYA 1GRQA 5CM9C 3RRYA 5CYOA 1YR6A 2VH5R 4FCWA 3MWJA 4NH0A 3M0EA 1KO4A 1WF3A 4MYTA 4B35A 1OIWA 5GJVC 1G8HA 2UZIR 2H92A 3EG5A 1DADA 1GITA 1N6LA 3L0PA 4HZUA 2NO9A 2AXNA 1XD2B 1ZD1A 4TZ0A 3X2SA 2R6DA 3PFIA 5EE3A 4HZIA 1X1SA 4PXAA 2VP9A 3U5ZB 1G20E 4F93B 1L2TA 1JXMA 2IUUA 2YOFA 4MGIR 1X8JA 5CJ2A 1JNYA 4JYBA 1EK0A 3EWAA 5G3ZA 1E32A 2D74A 4L9WA 4PC6A 2WJJA 2P5TB 4P4UA 1FOEB 1Z0KA 4Z8XA 3BORA 4HATA 5KNDA 4URYR 4R98A 4PSVA 4LPKA 1JR3A 2ZE6A 3KFVA 1P60A 2AD5A 2VSOA 1US8B 2G0NA 2ZRMA 5E4FA 1U0LA 3QSYA 4PO8A 1P9NA 2UVQA 1E2QA 5EXPA 2IF2A 2D2EA 1G8GA 2ZROA 1CULC 3QXCA 1HURA 1P75A 1Z06A 2JCSA 3P4XA 5DHAA 3SC3A 4NCHA 1U9IC 4LCBA 1YZNA 4IXMA 2EFCB 1Z83A 2XB4A 4XJXA 4MRPA 1DOAA 3KJEA 4KV9A 4LDJA 3VU9A 3UMRA 4A2PA 4JKYA 2QMUA
chains in the Genus database with same CATH superfamily
1HDGO 4CF3A 1TW3A 1RI4A 2FJPA 2UU9B 3AL2A 4OCZA 5B1SA 3KQOA 1H22A 2B4KA 3DFFA 3P9NA 5B4TA 4J0JA 2GXQA 3KZKA 2X6TA 1QMPA 1T6XA 2HIGA 1QTNA 2GETA 4BNNA 4FGJA 1A9XB 1C7ZA 4HDNB 4PX2A 1OKKD 1Y33E 4QXOA 4XGQA 4Y9UA 1E0DA 3RSCA 1KQGA 1JEOA 1DRJA 1VB3A 1TVCA 3D0RA 3O74A 4MGKR 3BB3A 1GPNA 3SQLA 3AR2A 3NYRA 4X24A 3PIDA 1Q5PA 5BQ5A 3T41A 3OQNA 4GEKA 3UH1A 4OJQA 4YUVA 3QUAA 2CDCA 4YAWA 1FUKA 2GXSA 3RJ9A 2JAXA 4BX9A 3VR2A 3FF4A 1ZC3A 4NQZA 2HY7A 5LA6F 4EKNB 1Q1EA 4WT7A 3C7CB 3GJ4A 1OF1A 4M1OA 5ALGA 2WPNA 4K86A 5JU6A 4CEHA 3NVKI 2Y9PB 4AJ2A 4KACA 1E92A 4LFAB 4IOJA 1VLHA 4L3WA 2GD0A 1I4OA 2BEUB 2D0OB 2P30A 3D2CA 4A4DA 1SC1A 5D3MA 5JCJD 3VO8A 1G64A 2RGWA 3WYFA 3ICEA 1SVUA 2FLKA 4YDRA 1IBCA 1HV8A 1OZFA 4WAUA 3DGFC 2NQ2C 4NFSA 2NU6A 3DE1X 1W9MA 2DOKA 4WQMA 2JLQA 1RRCA 4PHCA 3ZJYA 1JGTA 8GPBA 1I9GA 1YK1A 4I66A 4I50F 5D84A 3R7AA 2ATCA 3ORHA 4GI5A 2P4QA 2ZRNA 4WLUA 4ZPJA 4CMIB 2HM7A 1NJ5A 2YRWA 3AR9A 2CW5A 3F4BA 3U4CA 4D98A 1V95A 5FPKA 3NC0C 1CY4A 2FR1A 2P6PA 2RGGA 4PZ9A 3GWZA 3VR4D 4D92A 1W5EA 5A5VA 3AF0A 3RB8A 4TKLA 3DEFA 2O8DA 3WYGA 3FZEA 1GSOA 3PFWO 1W4ZA 2PPLA 1WW8A 4ENPA 3VKWA 5B1IA 1ONPA 2ZJ1A 4WOCA 1WZUA 1A0OA 1A7UA 1E1QD 1DRUA 2NX2A 3PRHA 4M0PA 1RQ7A 3H2GA 4X7MA 1TUBB 3LO8A 1M3SA 1ZAKA 2WJYA 4G0VA 2CNLA 3JPYA 4KQIA 4MA0A 5AKKA 1UUFA 2CC2A 1PZFA 2F8LA 3HMQA 3GV0A 3I9JA 3OQBA 5DRYA 5KCMA 1LSJA 4ZAXA 4UASA 3RVDA 4BMSA 3RSQA 4PPNA 4MUFA 1E2BA 3D3QA 4LXQA 1AD2A 4Q19A 4LJRA 1G4AE 1X80A 3K05A 4B4WA 1SOMA 1NN5A 3R5FA 4OHFA 2UV8A 5FV4A 1S2OA 4AZWA 5BVHB 3RSHA 1OH8A 1Z2OX 3F2IA 4BE9A 4ZDJA 3I2GA 4TS3A 1GGHA 4CPDA 1JG3A 1FXWA 4UHKA 5DIZA 4AWAA 1D1QA 3SEFA 3M1YA 2QLJA 2XJ4A 5ALXA 4MV9A 2O2EA 1KDVA 4AJNA 1W25A 2IYEA 4BGEA 1ZK1A 4RDHA 1GL9B 1MJHA 4CT4B 4DLXA 2ZSJA 4W5HA 3IQGX 5SYNA 4CV2A 1YQGA 3AEYA 1ORRA 4JLOA 3URKA 4DNPA 3LL7A 5I3CA 4LRYA 3UYLA 1GARA 2IX9A 1N6NA 2GNAA 4KGXA 1E18A 2Y68A 2G36A 3QF4B 3FFTA 3VU1A 4Q4LA 5L8VA 4IF4A 2X5OA 5LLDA 2IS4A 3SYNA 4O1HA 1EZ1A 1D04A 1K8XB 1O97D 2LNDA 1G8PA 3CH6A 4RX1A 3N2NA 4JJEA 4UEKA 5JCZA 2VDPB 4YUXA 1J0XO 3DXYA 3OCXA 3HJGA 1YZUA 1UAGA 3TDNA 1YH3A 3C3DA 4C0WA 3E1SA 4S05A 2A59A 2NPOA 4LNUA 4LRUA 5COAA 4AM8A 5CDYA 1HL3A 5FA8A 2QX4A 2F9LA 1G8JA 2EVWX 3EGXA 4R5MA 1C1YA 2GZ3A 4CU2A 5AW9A 3KQLA 3OX4A 3QX3A 3OZVA 1OZ0A 3DG9A 4OBXA 4B4DA 3L4BA 5HQTA 4I55B 1OTXA 1RAHA 2BZSA 4WA7A 5C53B 5KQMA 5GZ3A 1NHWA 4O2BF 2HRBA 2ZJ5A 4Z7NB 4E5SA 2H2WA 3W9UA 4QBHA 5DLDA 4R68A 4UVEA 1VRVA 3X43A 2PYDA 1RYDA 1H69A 1PU2A 2DZDA 4ND2A 1HT0A 4P83A 4RQTA 3RTEA 4YCBA 3ZW7A 3AJRA 2JCXA 3OU6A 4I1SA 5F3RA 5IKXA 5U1PA 1OC4A 2P9YA 2OGSA 2WF8A 4Y1RA 3IXMA 5LQUA 2IX3A 3H5TA 3Q7SA 4FE7A 4IF6A 5HRAA 3KUCA 2V5UA 4I2NA 2AXEA 2J7KA 4UEOA 2A1UB 1T2VA 1HLDA 1SU8A 2DSTA 5EFZA 3W5UA 4D9MA 1Y8RB 3KKMA 3PR2B 2BEKA 5CLGA 5EPEA 3OZCA 3GVCA 4OA5A 4G36A 3RSLA 4DLAA 1N25A 1PJLA 1P1RA 3SFZA 1SHJA 1XU4A 4BWFB 5BWMA 3GRZA 4M87A 2EWWA 4V0QA 5FR1A 4XYLA 4E15A 1JX6A 1MD9A 4Q1AA 3DHYA 4B45A 5JMTA 2HAEA 4G1VA 3WGTA 2DUMA 5CFLA 1Y6GA 1T13A 3O3OB 1J0DA 3AY3A 3ZH2A 2A35A 4CKWB 1U63A 3F8SA 3U7QA 2VTKA 2A9JA 3C8ZA 2D2IA 1J0CA 4QGHA 3EEQA 3ANSA 3L1HA 5LUBA 2CYBA 1YA4A 3BMNB 3CH5A 3HKDA 4JI1B 4EJSC 3LPNA 3QH4A 4L4RA 4E03A 1UOQA 2EHDA 3Q9UA 4K40A 4QUGA 3V9PA 5BORA 5KNDD 1ULAA 4K8RB 4DA7A 2KYRA 4CIBA 1XTJA 1V96A 1U5AA 1VKJA 4W1SA 4PLTA 1GUYA 3FOBA 3RRJA 4FHEA 4HPWA 4KQWA 4AXBA 4BJ5A 4ZOCA 1JE1A 2K7FA 2UVPA 4E5MA 4BWVA 4WZZA 2XXJA 1RRPA 2V8OA 2W6QA 3NC4A 1OILA 4IOMA 4CEJA 1YCGA 1N6RA 5IDYA 1LV8A 3YASA 4D4MA 4DCOA 1A5AB 1S8OA 5IUJC 5D1NA 4ICIA 4CLOB 2X19A 5CA0F 2SKDA 3W6ZA 4ZYXA 4QX6A 3I73A 3PGVA 5AYVA 3EDOA 1XD9A 1T8WA 2DVMA 1RBYA 3ES9A 3L1KA 3ETLA 3GPDG 4A0HA 3HP7A 3C4VA 1WW2A 1YDEA 3HUEA 3JZIA 2QRNA 1QG4A 4FMDF 4RZ2A 4C6HA 4UEQA 4F5EA 2PKQP 4OGLA 3BCHA 3VYUB 3A2NA 4WZBA 3Q7EA 4UU8A 3TTVA 3S70A 2IEGA 3WB0A 4ZIRB 3K09C 2BGLA 3OHPA 2B99A 1ETHA 1BXGA 4S04A 1KRXA 1T0UA 3B3JA 4FGKA 3IBGA 1NMSA 1WNTA 2BMAA 2FJ0A 3JTEA 4CQLA 3VTFA 5IRCD 4B7ZA 1ZK0A 1NF9A 3UGQA 3JD3A 2PRJA 2YNMA 1WQ1R 2RCNA 2NUTA 1GYRA 2A9VA 3BXEA 3LZDA 3UTCA 1PEKE 2UVDA 2FPGA 2JCVA 2ZIXA 5AD1A 2IWHA 4CKZA 4Y3UA 4BQOA 4X6UA 3OTOB 2IZZA 2ODNA 3WGMA 1WKCA 2OM6A 4RHFA 3R77A 4XGIA 4D02A 3VPGA 2O8CB 2HDHA 2VYQA 1J07A 1LFDB 2XOEA 7REQB 1GZ6A 3ZJVA 4C89A 4RD6A 4YQZA 1G16A 3EFOB 2R8OA 3KB1A 3AEKA 1P1FA 1HETA 1UJ6A 3BKWA 2H0AA 5TDHA 1P2FA 2QRVA 3D0QA 5C5DA 4GKJB 4XIGS 4I4IA 1TE2A 1CE8A 2BFAA 4NU0A 1LA2A 1IUOA 1UBMS 3PHCA 1A1SA 1EHYA 2WMOB 4HX9A 4Q4AB 1QBKC 1OFGA 4WKCA 5KOYA 4OSEA 4A0FA 1FNCA 2Z4SA 2YIDA 4ZV7A 1JDNA 1WCWA 4WE3A 5AK6A 1U2ZA 1JI3A 3VNUA 1U7PA 2C57A 2GOYA 2PBLA 4N54A 4F72A 2ZVDA 3P9KA 5DKFA 4HYYA 3NHWA 4REMA 1PG0A 6REQA 2H2HA 3ETJA 2UZ1B 3CZQA 3DOIA 2DHRA 2YXNA 4EPRA 4ETNA 3KQWA 1YS6A 3HB7A 3HXKA 4L5AA 1P4JA 4DR3B 2BLLA 1X7WA 3T7TA 4QICA 1ZQ1A 1QXSA 4H7DA 2ZB4A 3LCVB 5HYVA 1Z2CA 2HA3A 4EM6A 1L7NA 3ENVA 2AXQA 2HSGA 4K9KA 5J1SB 1X9GA 4BKQA 4EW3A 4K1XA 2L0XA 5HE8A 4A6XA 4LOLA 1RM4A 1KFCB 1NT4A 1USWA 4OHOA 4RFSB 1YTUA 2OY0A 4W8GA 3OQHA 4QAJA 4DBZA 1FFHA 4NOKA 4CF4A 1KI9A 1JA0A 2ZIFA 1ZOIA 1YWGO 2DBZA 2HKIA 3B13B 5CFNA 1WCIB 1UINA 3O8RA 2PKQO 3FWPA 2QR2A 3P2OA 3OT4A 5F12A 1PL7A 5JJCA 2TRSB 3JYQA 2M32A 4LSMA 1GKYA 2VHUA 2JBAB 2DPHA 3GFGA 1FXWF 1GKUB 4N7RA 1H5UA 5JO9A 1E1RD 1H4TA 4CGYA 5FYDA 2OBNA 2QVCA 4AMZA 4AJ4A 4IRXA 2E9SA 3BL8A 1DS6A 1NVAA 1KEVA 2ID4A 2I7VA 3GJ6A 3Q5EA 3GN1A 4X1YB 3TTTA 5CA1A 3DE6X 5DH9A 1SURA 4XR9A 4ZA2A 3R6DA 2GA8A 3TWOA 1F2UA 3ORSA 3DO8A 1SCJA 4PG4A 1KYIA 1X7YA 4X61A 2CNDA 1G9TA 1Q3KA 5T4BA 3D02A 1SN7A 2MJLA 3RUFA 4AJLA 3I3OA 3RNOA 3ZY4A 2GBFA 2XCSB 1ZGZA 1GJRA 2QTLA 3KTAB 5BMVA 1J0BA 1RKBA 3GJRA 4BO9A 4ENTA 4LJAA 1PJCA 3TPZA 1RCUA 1KYQA 2XRYA 2WVAA 5KOIA 4GXNA 1GUZA 3G2MA 3SM3A 5KWJA 3HSSA 3OPXA 4R7GA 4L3VA 3RE1A 1Q20A 1G42A 5GZ1A 2Q50A 3AL3A 3OQIB 1PFYA 4IR7A 2W6ID 4TLAA 1D0SA 3HRIA 1KEZA 1G5FA 1Q7GA 1R0ZA 1UKBA 2Q7XA 2VJDA 1TW2A 1UK6A 1SY7A 2H1WA 3FMFA 4FFBB 4G07A 4H1UA 3SNHA 3TCKA 2QTNA 2FJUA 2F3SA 3HB9A 4AIRA 4TKZA 2VH2A 3L07A 1CUHA 5IH7A 3UPUA 1QQ7A 3G68A 3HKCB 3A1SA 2ZWVA 3G23A 4AAYA 3G1TA 4PYOA 5TQ0A 3U3ZA 4F7DA 4HR7A 3CGGA 1YULA 4KREA 3L7OA 2RHRA 1JPVA 3LWNA 4YXWA 4NZOA 1MJ5A 1T2CA 4C1NA 3SE7A 4I5EA 3NIBA 1DEKA 2OV2A 3GGOA 4FDMA 3UQZA 1ZWLA 3ZJTA 1FMTA 2QQ0A 5AVQA 1GPMA 1XN4A 2ZRGA 4AKIA 2GS9A 3JR7A 3QKUA 4OLFA 5FPQA 1KE1A 3QQ5A 5KHOC 4QEDA 2EGGA 3KXKA 1HA3A 5JSHA 2X9LA 2IXTA 1G7RA 5DM1A 3R76A 4H6PA 2GAOA 4L74A 1ZD4A 2FPXA 3E48A 4A8TA 4DEVA 1OXTA 2X4IA 2HYIC 2AZTA 4XTRA 1F3OA 2R47A 4DZRA 2C8JA 4TXLA 1GCUA 4C4SA 5ECDA 5JAZA 5T4FA 4E31A 4YIHA 2WSSD 4OQYA 3E9EA 3C5CA 3MWLA 4MX8A 1BJRE 5JHGB 4K6FA 4XIIA 2OFFA 2Q3LA 1S96A 1LTKA 1T91A 1JAZA 4EELA 2J6BA 2XYHA 4MS4B 4QYSA 5AJWA 1PGQA 3UA4A 2WABA 3RYHB 3WMXA 1A3CA 3IP1A 1L4KA 4Y2TA 3JX9A 3H5NA 5FBHA 3A7EA 3P45A 5GONA 2AFVA 1Q16A 1OOEA 1R88A 2QTGA 2V1XA 3HCBA 3DE4X 3AEQB 1GFZA 3KLOA 1E9SA 2P8SA 4LZLA 3V7YA 3N5CA 3GELA 5CDHA 3EHDA 3RKSA 1YJAA 1BYIA 2X1VA 3QVVA 4FYXA 2BONA 4RW0A 4UBKA 3MUNA 1H23A 2DFPA 3R9IA 3I05A 3NUZA 4MQFB 2OKCA 3WL8A 5K51A 5CHYA 4TRRA 3K1AA 1MABA 3AEXA 2R1TA 2FEKA 5DTMA 4Y67A 1RWKA 3T06B 2AOXA 2J32A 3KT3A 2Q4TA 1H6CA 3WGNA 3M83A 2GTIA 4MWOA 3BSFA 1OXVA 2YWDA 2ODTX 1AIPA 3EZFA 2YOGA 4FQ5A 1C3XA 3PXGA 2VAMA 3EMDA 4MIYA 2XYVA 3WWYA 2KLHA 3VU9A 3GMIA 1XTBA 1PYGA 5AW8A 3OM1A 5I7RA 4BO8A 2ZI9A 4P3PA 1GZVA 3QRWA 1X13A 2AR7A 1DP4A 1T6NA 3RREA 4K0KB 4WBXC 1Q1BA 1Q12A 1G6Q1 5AJYA 3LBIA 2ZS8A 1U04A 3GRKA 3EVTA 1HNNA 2IELA 2GCOA 2W6ZA 3IELA 4XVCA 3W04A 4F4IA 3ADCA 4KE6A 3JPWA 4IDOA 1DGQA 3RBZA 5MGBA 2JW5A 1HF3A 3NTUA 1JXQA 3O2JA 2XF2A 2YHUA 3PDIA 3RVKA 3QXXA 5DE3A 3FYUB 3FSGA 3G9UA 1DPFA 3I2JA 2W6PA 4HQNA 4LHYA 5CCEA 4CT0A 1NPYA 1ST3A 2OC4A 2DUUA 4BMDA 4M0LA 5DYGA 4Z9XA 3VX3A 2VBCA 2V7VA 4H9GA 4PY2A 2FTKE 2DAPA 2PRIA 4O33A 5J2UF 4RZ3A 1MEOA 3W4KA 1JDZA 5LN1A 4H7IA 1E8MA 5BRNA 3ZBQA 3ZXXA 3WIBA 5KWSA 4ITVA 2PKXA 2ZUWA 1FYVA 1FDWA 1VE1A 4GIBA 4FB5A 3SG0A 3LXXA 1PD0A 5DNCA 2G8NA 4XVUA 3AM1A 4GPTA 3GNQA 5G40A 1WS6A 3R0XA 3H6HA 4K9LA 1MC8A 2AI1A 5DN6A 5LQDA 3TTYA 3OTGA 3NVAA 2G40A 3CNOA 3T3PB 1B6SA 1XZCA 5CPFA 2XD4A 3LQYA 4J8PA 3VC3A 2QI9C 2ODQA 1R6VA 3BM5A 3U9SA 3BCSA 5FI0B 3NHZA 4K7JA 4KK3A 5HR5A 5KQRA 3HU5A 1MLDA 3FSEA 4B32A 2RCYA 1H9AA 3INTA 2O8EA 4YRBA 2ZJ7A 1U7ZA 2WPDD 3CR7A 3WJ7A 4BTVA 5IJZA 1SXJD 2X8BA 3H4MA 3ITEA 3NH6A 4PLYA 3RRMA 4KPEC 1MAAA 1MQ9A 4UDOA 4UHFA 4C01A 2BFFB 5KYGA 5LZ7A 1L7XA 3OFND 3L43A 2N47A 3O31A 1HPLA 3MRXA 2UUCB 2XR1A 3H3XA 1VCMA 5E3IA 5EIBD 3AVOA 5EJ8A 3VAZA 2O8BB 2O0MA 1U2GA 1NQXA 1PS9A 2Z4TA 3NJRA 3CZ5A 1EGVB 2QMEA 2VCEA 3MTBA 4TV9F 4WK4B 2BDTA 3QKSA 5CVVA 4ZQIA 1VKZA 3CF2A 1EDBA 1EK6A 2C2OA 1SCKA 3D6MA 4RKYA 4TMVA 5I7VA 1G55A 3ACCA 4AZ0B 4TLBA 2Q2VA 4DLPA 1NSFA 2OO3A 4J2HA 1X8XA 4IQ4A 2NTJA 1UJ4A 1VGVA 2J0SA 1SXJB 5BSHA 2NP6A 3VR3A 1WWKA 2OGWA 5FUQA 2YQ4A 1KIMA 2PMCA 3R1IA 4C29A 2P9EA 3PUJA 3DL2A 3W2HA 1T0PA 2ZITA 1E1KA 2WILA 2ZAGA 4CCAA 3WAJA 2RB4A 5IARA 4C43A 5CA1F 4GS5A 4M0UA 3AMVA 3WYCA 3QX8A 4OAOA 2CYAA 3KHSA 3R3SA 4FMCF 3IALA 4PV7A 3VGJA 2VDNB 4BFTA 1CYDA 3MUEA 4DJ5X 4EW1A 5KVAA 4NOLA 3MIZA 1GGVA 1GTG1 2GDJA 4AULA 5LOVA 3X44A 1ZUD1 2PWYA 2VJCA 1WXFA 4JJFA 4JLSA 3BHIA 3R3VA 3GYGA 3T1HB 2UXBB 1WRBA 4JBLA 3DLTA 2BGRA 1G66A 3PFGA 4Y6RA 4RH3A 4BQEA 1L4UA 5TS3A 2A1TR 1VTKA 2ZBDA 4M1SA 3WSVA 5THKA 5E1MA 4PICA 3SEQA 1JIVA 1W19A 5GV7A 5HM6A 2EFJA 1DO0A 2W7TA 3CPJB 1T9BA 1XZAA 2II6A 2WQZA 1LDMA 2DU8A 5DHPA 1UKZA 2FZWA 3R9WA 4Q9NA 1QHHB 1MIOB 1HDZA 1QCZA 3NP7A 4QA9A 2DM6A 4YASA 3KQYA 2HGSA 4TTVA 4XWGA 5HE9A 1BKSB 1VYVA 2O4UX 3IOEA 4FW8A 2HUPA 3P26A 4CM9D 4BOYA 1W5FA 3HN6A 3MWDB 3ICVA 1VBMA 4LMBA 4HPJB 4Q7MB 1JFRA 3ASUA 2ZI6A 3DBOB 1KA9H 4FX2A 4NHOA 1BROA 1QVWA 3DE7X 2X0DA 5LQRA 2DECA 4AURA 1UM9A 1DQSA 1U2TA 1MQAA 1F48A 4FMPA 2FSVA 1VKHA 3N7TA 2QRQA 3PXAA 4HD8A 5LVAA 4F86A 1U2QA 3I4FA 4OU4A 1XG5A 4KUHA 4MGYR 4DE5A 4RADA 2ZP1A 4WCFA 2P9BA 1YT5A 1A9QA 3LC1O 5INTA 1RVDA 2YBDA 4IZ6A 4CT5A 2QNRA 3QBVA 2I78A 3AKYA 1U0JA 4Q3LA 4FW9A 4IX1A 5H70A 4J94A 3ZE6A 4P4GA 5ISMA 1A82A 1C0LA 2AVDA 3JQGB 5I4BA 1P0IA 3D8TA 3NWEA 4IJ5A 3W3AD 4V3CA 2PFSA 4OYYA 4Q16A 2A0KA 1XMQB 4HN2A 4KAXA 3QPBA 4ZQBA 2GYVA 1Z6ZA 4J4BA 4FZ3A 2YHAA 2ZRQA 2ZUUA 5HKKA 3NIGB 3CJTA 2Q45A 1Q2XA 2HO5A 2ORIA 3NCTA 2RC6A 4I5DA 5WRFA 3WTBA 4A1FA 4PZDA 1AC5A 1W87A 3LI2A 1DAIA 5AUPB 2OL4A 2X3YA 4PLCA 2CUZA 2HK6A 1UEXC 4UOZA 3RC7A 3OC6A 3GI1A 2Z56A 4WH0A 2YRFA 1F6WA 2QTZA 2MINA 2XCRB 2WT4A 4P0PB 4B34A 4C06A 4CM4B 4NDAA 4AO6A 2YYYA 3LNTA 1O94C 3RHTA 1ORTA 1AK1A 2N0SA 3IEXA 3QELA 1XVIA 4RHEA 1WR8A 4OJKA 1RBZA 2QR3A 1SUCA 4J9UE 4C88A 1PTKA 1VYUA 2W4QA 2XD9A 5AJUA 5J47A 1LVGA 1BDBA 1SCAA 3LQQA 1EUDA 1JLSA 4GPZA 3CMCO 3EC1A 4FCTA 5JNTA 1I51A 2PZGA 2WYWA 1PFKA 4BN4A 1GVHA 1EFRD 2VF2A 1B6TA 3WLKX 3QMVA 4A5OA 2NU7A 3UJ6A 1YQTA 1KO7A 2QUAA 4FZ5A 4RU1A 4ZDIA 1R5NA 1Q7TA 3IT3A 3OZDA 2OBYA 1T5TA 1YD7A 4Q7QA 4GPBA 2GZRA 1L5LA 2G07A 3VX4A 1GFWA 1SXJE 3B7GA 3FI0A 3E70C 2ZZKA 1USVA 1WUTA 3JSXA 4BEJA 1XNQB 1QRAA 4Q6BA 1F7UA 5DP1A 3KFXA 4V03A 4HTFB 3LVQE 3QU4A 1IULA 4HEHA 1G9XA 1QV7A 2QD1A 3U44A 3LM8A 3JWIA 2QB5A 2PH3A 2ST1A 2VPPA 3LCUA 4E3ZA 1OV6A 3F46A 5ADVA 2AJLI 1XTRA 1Q77A 2XSZD 5FNZA 1J21A 1WHTA 5CVUA 3TZCA 1KWGA 4QNRA 1TAHA 1N9ZA 5GONF 2HNBA 4QHYA 1HDIA 2ZTHA 3C8HA 5GGXA 3I6ZA 2X2FA 2R1TB 4Z0HO 3GEHA 4LJYA 2AKYA 4MLCA 1F1BA 3OE4A 1ISIA 1GTJ1 1FYEA 1IMJA 2E4WA 2CL0X 1PBTA 1RJ9B 2WE7A 2GT1A 3UWPA 4B2PA 5I8WA 1NRJB 3H99A 1KC3A 2IYVA 1ZN9A 1O95A 3DWIA 1FSGA 3F3YA 1ELOA 4FFRA 4NATA 4CE6A 5BOSB 5JI3E 1A7AA 2OCPA 4J0DA 4JITA 4FZRA 4G4JA 2FWPA 2F1OA 3PCXA 4NL4H 5AKYA 1BX0A 4GZ6A 1MB9A 1CF4A 5L3QB 5LOVB 4R0NA 4R4JA 4PZUA 3SI7A 2Y1FA 1ZX1A 1G8FA 5K03A 1CUFA 4V24A 2O4CA 1EXVA 4WLOA 2ZRDA 3S55A 1O8CA 3ZU3A 2NZJA 1FRFS 1GQSA 1KJJA 2C5EA 1SXGA 2XF8A 5AVKA 3LVBA 4F6RB 5LQCA 3TTXA 3ZHSA 4ZOAA 1TB4A 1Q6YA 4M99A 1V11B 1EQ2A 1GNQA 2H1SA 1QQ5A 2OZLA 3GD5A 5DYWA 3RUPA 3PVSA 3WC4A 3FI9A 4J1NA 4YQFA 5B6PA 2JD2A 4OK6A 3DV0B 4RS3A 4DR6B 2BCGY 1ESEA 1OI3A 2Q6IA 1GXSA 1QNFA 2BEVA 3OLZA 3P97A 3ZZ0A 3LIIA 2QUBA 1E4OA 1O5OA 2OO5A 1Z26A 2BGGA 1ZGHA 1UMCB 1ZGJA 2QVGA 3DLCA 4UNNA 2R6JA 3Q8KA 1ML4A 4WI1A 1H2RS 2JIBA 3PRKE 3OC0A 4FE4A 4CQMB 3UT6A 3FTPA 1JIQA 2AA3A 2EWVA 2W2KB 4BECA 4DQDA 4ZHQF 4RTPA 4NE7A 1AK9A 5DBIA 4OQMA 3DEYX 3B3AA 4X94A 4B3FX 3DZ8A 3X1DA 3GFFA 1Q7EA 1JDJA 1SOVA 2F3QA 4EPXA 2PS1A 3MJCA 5LDDC 2QTAA 1BJKA 4KITB 2MHCA 3EVFA 1OIXA 3T4EA 1Y6FA 3S8EA 3EIQA 2BBOA 3RTBA 3M49A 5FBZA 4WEOA 1D2MA 5ALHA 3DO6A 1X19A 3K32A 3SGLA 2DB3A 3F6PA 2IA5A 2WJIA 1ANKA 2YHIB 4LQLA 5DX0A 4EHBA 4KHZA 5KQPA 4Q03A 4EQZA 1G8AA 5LA6A 4W63A 5DEOA 4OP2A 2NWQA 2CWWA 3WRXC 1VIDA 5JQGF 3A6EA 5BT8A 1MIHA 1Y89A 3OOYA 4C5BA 4JJIA 1M5UA 3RJZA 1XZJA 4JSTA 1DIOB 2Y1LA 1M0EA 3W5HA 2IPLA 5CNMA 1Y80A 3UXEA 3WNBA 4Q3AA 1ZJWA 4RUKA 1U6IA 2AOWA 3GDWA 3G0GA 3LUCA 2VYVD 3MT7A 1GPH1 4WJLA 3LDGA 3NM5A 3R3YA 5HFAA 5AH0A 1TVEA 5B3JA 5C1IA 4CDNA 2JA2A 4O25A 1W4CA 5CT4A 4UARA 1M7BA 3WFIA 2P35A 1H0SA 1IN1A 1AUXA 3GLTA 4B85A 2OSVA 1L9XA 1IBKB 3AQ4A 5D7BA 3O9ZA 2MYUA 3MPOA 1IN8A 4LRSB 4A1OA 5DFAA 2B1JA 4AY2A 2EF1A 1E3WA 1D5CA 1M2GA 3GEDA 3MBOA 5DHUA 4DCSA 3E8XA 5FJIA 1JAHA 2F43B 3BWMA 4CG0A 1F7VA 1F06A 4C05A 3RLIA 4DLUA 2HWYA 4LVOA 3UJHA 4ALNA 4ZJZA 1NJSA 2AT1A 1VHWA 3CVYA 4HAYA 1M1NA 3NBQA 4JGIA 4J2TA 4U00A 5HBRA 2VYCA 2ZUFA 3KR9A 1QHGA 3HDJA 5JI2E 4O0LA 1P9WA 1NYQA 1AZWA 4JX8A 4TVKA 1NJGA 1RPTA 1O9BA 1HYEA 1Y7TA 3KQHA 2F1HA 5D3MB 3OAAA 5DI9A 4BATA 4XIJA 4NBNA 3NM6B 5EL0A 4D3DA 3M9XA 3WLTA 1JQBA 4EG0A 5JWOA 4HB0A 2HA7A 1IWOA 3BWEA 4X1IA 1NQAO 1Z35A 2O3RA 3PUXA 4EJ0A 2H4YA 1BS1A 5FOSA 1PGPA 3U3MA 1ZCAA 3FVQA 5FDFA 3SP1A 4DA4A 1CEXA 1Y34E 3JCZA 4C30A 1H65A 1JI0A 1MO3A 4WKBA 1WPGA 3VPXA 4IG4A 1WCYA 1E66A 1X92A 3TR6A 4FBMA 4L8WB 3U17A 3O9VA 2H4HA 2XEXA 3JD0A 4BJ3A 5A04A 2Z09A 5CT8A 3KQPA 2HMTA 2Z2XA 1W581 4YAJA 4QJ3A 3P96A 1RFLA 1LDGA 4DBLC 4K8OA 3Q7PA 3QHAA 5LYJF 5JRJA 3DMHA 3NB0A 4FOPA 3WB9A 3GFPA 1ECCA 5CAEA 5IK2A 3SF8B 1T9GR 4XCQA 4X3OA 1E3QA 4FOTA 4W9MC 4IX9A 2C4KA 5HZMA 2XNDA 3BMCA 3PIIA 5KVQA 2O2SA 3QYPA 4BO4A 1HC7A 4G8CA 3RRXA 2HWUA 3WLSA 3ML1A 2YVUA 2GN0A 4NBWA 1QP8A 1XRRA 4RA9B 4LDZA 5FTJA 4BFSA 3R9XB 2J0UB 1N6PA 1L4NA 1YIDA 3I45A 4HN9A 4HNGA 2NAFA 4LMRA 4NVRA 5IS2A 2MIIA 5CXSA 2V7UA 3I12A 1FJXA 1NLZA 3K0BA 1ZZGA 3GGDA 5E4JA 2GYWA 4OV6B 4FLFA 1TJNA 2GZHA 2XYRA 2OZVA 3BFVA 2C3MA 1TLFA 2Q1XA 3FDZA 4R2MA 3VO9A 4BZZA 5I7EA 1Z22A 4BJ6A 1WCXA 1XP8A 2QYHA 4MAFA 3W78A 3BT7A 4OP1A 5I7WA 1N8NA 1YFLA 3D3JA 3K5IA 2G76A 1HLFA 1SHLA 3KHKA 1A69A 1SVMA 1Q15A 3C7TA 4GRDA 3QIAA 4V38A 2QTTA 1NVEA 1N6HA 4O02B 1BH2A 1LY1A 3Q40A 2C54A 1QR2A 4ARBA 4CDMA 3K4PA 1H93A 1G20B 2QM0A 2OB1A 3F6BX 2XGOA 1Z5GA 2X1HA 4O2AF 3MRVA 4CNBA 1HDYA 1NUTA 2FW6A 4RPHA 3RIGA 1WP9A 4XYBA 4G89A 1SVKA 4XARA 2GHRA 2WMYA 3ANYB 3SM9A 2WSSA 4UPVA 3KKEA 1A5TA 1NVXQ 2ZAOA 2DQZA 2BUAA 3DH0A 2HD4A 4KIUA 1H6BA 1YRQA 2QAIA 5HFJA 1IYZA 1M2KA 1SUPA 2WD7A 1VJ5A 1GD1O 4GMKA 3CRNA 3FUUA 4OFWA 3UT5B 1IIRA 1PG5A 3I09A 5G0SA 1YNSA 4JMLA 4LZNA 4A3SA 4TVBA 3FDFA 1Z5ZA 1CB0A 3IJEB 4LE1A 1DXOA 4KIWA 3TD2A 3AINA 2G25A 4MCAA 1RJGA 2RI1A 1RQPA 5HUJA 1AHIA 2QEQA 4IFEA 3RIMA 3M34A 1YU6A 3U6BA 3CSDA 3PGA1 3KTFA 2OQ2A 2QRPA 3EPJA 4DMGA 1RZVA 1E3SA 1XCMA 1XTVA 3QFCA 4R1MA 3K70C 1X1DA 4R1NA 1MO5A 4TV8F 3TIIA 4ZFNA 1YVRA 1ZR2A 2VT6A 1JDBB 3BA1A 5AM0A 5DBOA 1OAAA 2NO6A 2ON6A 1JIXA 1WTAA 4M49A 2RAPA 3WHPA 2FP3A 5FAXA 3KYDA 2DLCX 2BKLA 2FEWB 4ZV9A 3NFRA 4P2GA 3WWOA 3M4JA 1CUWA 3RU3A 2HMUA 1P9LA 4KUGA 4NZZA 3AJ9A 2I9KA 3I0NA 4Y1RB 2C9MA 1CQJB 4KU4A 4A8JB 3ZVKA 3DKKA 3T0GA 3HDQA 3KWJA 3IBTA 3GIWA 5HSGA 3VZRA 3AFNA 1KYYA 1KO8A 1C2TA 3N0TA 2X2OA 1KI4A 3EK2A 4RORA 5DV9A 5JWHA 4JV5B 2VVTA 3HUUA 2ZWAA 4YRPA 1QG2A 3LK6A 1MOSA 1W35A 2EKBA 3G3EA 5BNIA 2QSJA 3I4LA 4ZOLA 1YL7A 1G5IA 3MTAA 3T9DA 2ZQZA 3KWLA 4KN8A 2FUEA 3GT0A 2VEDA 4ZCQA 2BGNA 4QDXA 5G0UA 3ZE1B 1RZRD 4TQGA 2IHNA 3T7CA 3W5VA 3AETA 1V11A 3L6CA 1QFZA 5KTOA 2H2FA 1PUJA 2JRLA 2HWWA 3DTTA 2CLSA 1Z7YA 3L1UA 3L06A 2QTBA 3PNVA 5CCDA 2EZTA 1QUFA 3ZNQA 4ATNA 3R5KA 1E5LA 1U99A 4EVQA 2J3DA 4L1KA 4M21A 4PANA 4ZEMA 2XRFA 1P39A 3MZ0A 4L8GA 1D9XA 1HE4A 1Q1AA 3ESAA 3LMKA 2FZ4A 2VJAA 4FU0A 1E63A 3JASB 2FEPA 2PS3A 4KXXA 1WXXA 1BMFA 2WUDA 3ORFA 4H4EA 4XLZA 5DP2A 4IYRA 4AKTA 2J09A 4E6EA 3HVKA 3I9NA 1THGA 4LVCA 3QE9Y 3GRAA 3SC6A 4EF4A 4GZ5A 1KWKA 1M2OA 3HR7A 4U6SA 5IXSA 3A0RB 3B1KA 5DIFA 1ULHA 2VDKB 6ADHA 5IBRA 4OKSA 3VHQA 1K5GA 2ZUBA 5LBTA 4LI3X 3HC7A 4WZBB 3ZY3A 1KQ3A 3QLTA 4O4HF 4E1VA 3I4CA 1VHLA 2INGX 4FYJA 1UXGA 2PXAA 3M1LA 1J00A 5LU9A 4QRDA 2Q9UA 4D0RA 1CF9A 1TD1A 1W75A 3R0JA 4ZPXA 1IWBB 5K45A 4DV0B 4NZ9A 2Z6AA 5GJBA 3HVIA 3ICOA 4CKEA 1E2DA 4IGIA 5C9ZA 1GNVA 1BA3A 2Q07A 1UWKA 2GN8A 1AVTA 1FW6A 4ZO6A 1NVKA 2PL5A 2X8AA 3VGPA 4AMUA 2YJ6A 3JQAA 1XCOA 5HF6A 3JV7A 1LTHR 4CI0B 3IESA 5ITZA 4XFJA 5KVCA 2VQFB 4ZTUB 4YCJA 5FB3A 1J2UA 3EZGA 2C1XA 1O95D 1ZLXA 2HU5A 3EDCA 4B7AA 3H9GA 3BMOA 4KSCA 4N3NA 3TQIA 3LPCA 2FK7A 1FUUA 4Q3EA 4XDGA 1USUA 3GUUA 1E6WA 2HPHA 4WCFC 3L4KA 1QS0B 1YXMA 2WYOA 1HRDA 3DMDA 4NYJQ 1V7QA 2FX3A 3QU2A 5EWLA 5TARA 5LR6A 1CYEA 4S1WA 3BXXA 1P4AA 5KVSA 2HDOA 5H1YA 1H2EA 3R7WB 1GQRA 2C77A 3B53X 4K1LA 3HNRA 4ZT2A 1R0WA 1Z13A 2PUFA 2ZJAA 2XCTB 1G1MA 1C50A 1ACLA 4KAFA 1C4KA 4RKFA 4ARIA 4XX1A 4ZAGA 3VPHA 3CXRA 2QRHA 2F67A 2YX1A 2HPAA 3JD1A 1RR6A 4DIEA 1ZM4A 2FFAA 3CJRA 4P35A 1WL8A 2QN6A 4NEHB 5TF4A 3UOAB 4DDVA 3LHKA 4M8NE 3EE6A 5HOQA 3C1UA 2PSJA 3MHPA 5IJ0B 1CDDA 1AXRA 1TZKA 3EZ2A 1DEOA 1LJLA 4QSMA 1O5TA 1ZOLA 4PHFA 3EBLA 2QL7A 1GA4A 2BFBB 1VLVA 1ZQ9A 1LK0A 4N18A 4DMKA 4YRIA 1KAHA 2ID9A 3JVVA 3GD7A 4LY0A 4HDNA 3GVXA 3AVQA 4YCAA 2BFCA 1KRWA 5D2CA 1BN7A 1HDCA 3QPWA 1TA4A 3T3NA 4QJIA 2CVHA 2VZ8A 3PE3A 4F56A 4OAQA 3AGQA 5K2MA 1DEXA 5IDQA 3JWEA 1PFGA 1HG0A 3DPSA 2IBTA 1F2TA 1SCBA 1G3MA 2ANCA 2Q0SA 3UHPA 2LE0A 2ZTVA 3D4BA 4ZT3A 2ZANA 3NX4A 3TD6A 4BX0A 1JJAA 4A0GA 4JB8A 3I32A 2GAJA