3AT8A

Crystal structure of the kir3.2 cytoplasmic domain (na+-free crystal soaked in 10 mm barium chloride)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
199
structure length
196
Chain Sequence
b'IQRYVRKDGKCNVHHGNVRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium inwardly-rectifying channel, subfamily J, member 6
publication title Interactions of cations with the cytoplasmic pores of inward rectifier K(+) channels in the closed state
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 37
structure length 196
sequence length 199
ec nomenclature
pdb deposition date 2010-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3at8A00
3ATAA 2X6BA 3AT8A 5KUMA 3JYCA 1P7BA 2WLIA 2WLJA 3SYQA 2QKSA 2WLIB 1N9PA 2X6CA 3ATBA 3AUWB 3VSQA 3AT9A 2X6AA 4KFMA 2E4FA 2WLKA 5KUKA 3SYCA 3ZRSA 2WLNA 3SYAA 3SYOA 3ATEA 2WLLA 1U4EA 2GIXA 2WLHA 1U4FA 2WLLB 3SPIA 3AGWA 3SYPA 3SPHA 3SPJA 2WLMA 3ATDA 4LP8A 3ATFA 3K6NA 1XL6A 3SPCA 1XL4A 3SPGA
chains in the Genus database with same CATH superfamily
3GRGA 5KSAD 5F7HA 2FLRT 3BFWA 1AXTL 4WK2B 3FB8B 3S48A 3ZXAC 2R2BB 1HHIB 2OMYB 4KRLB 4OGQC 3L9RB 3RKDC 4IJ3C 4JGNA 5DJZB 4N8VB 4NN7C 2PR4H 1X5HA 2FWOB 3TO4A 1QA9B 3U4EA 4H88H 4GSDL 3TO4D 3VXUE 4AH2A 1MFUA 5H2BA 4ZX6A 2FEDC 4DKTA 4ZOBA 3CBJB 3DX9A 4L1SA 2VERA 4Y16B 3NCJL 3TJEH 3DSNA 2OXHA 5DC9B 2DQCL 4HS8L 2V5MA 1HAUA 4N0YL 4JPQA 2J8UB 1HL9A 2XXMB 3V0VB 4C56E 4HUVB 4ZZFA 2HG5B 3FFOA 5IJCC 3JV6B 4EKXA 2Q10A 4NZ8A 5G5DB 4L18A 5ID1A 1R5VA 3E3QC 3AB0B 2ROYA 4R5VA 1EMTH 3NACL 5B4MC 2ADGB 2VM3A 3ARYA 3MJ9H 5F3BA 4M6MH 2GBUA 5EUOA 3T65B 4ZW3A 4HUNB 2CGRH 5TE7H 4HA1A 1DUYA 1GJWA 4WEBL 3IVKA 2GHWB 2WINA 3N85L 2OI9B 4YHPB 1BZ8A 3C5XA 3DPBA 1I8UA 5DQJA 3W11D 3VD0A 2YAEA 2ID5A 2CHZA 1P4BH 1S9XB 4HK0B 3UYRH 2QSTA 2WQSA 1LQSR 4I4WA 4MSWA 1A0QL 3S6CA 3MODL 1DN2A 4H8WL 4YHZH 2IEPA 2NUPB 4PJEA 4YLBA 1AGEA 3ZY7A 2R1WA 3P4MB 5HVHC 3CQQA 2FJSA 4YX2H 3GTTA 1J9RA 4H20L 4YC2C 5ACZA 5GS2H 1TJHL 5IKCA 3ZO0A 3KPLA 4M6NH 1ESOA 3WIAA 1UCTA 1QR4A 3JWNG 5EU4A 3DIVA 5F7EL 3MUZ1 5EPMB 4XBPB 3I75A 5FB8B 3OKOB 1OTSD 2NT0A 1EFXD 1XGZA 2WZAA 1O7VA 5E2WH 1Q9WA 4N9OB 2XRAH 4PJXE 1CS6A 4AUYA 4RGMB 4LE8A 2JB6B 1RUML 3L1GA 4N0UA 3LKNB 3FO2B 3FHQA 3DRQB 2GCYB 3VFNA 3W56A 4RZKA 2WOYA 3F64A 4JFEA 3BWAA 3QJRB 2OYMA 5TQ2L 1E7VA 4JFED 2OK0L 3SDXF 1RZJH 4L8BB 1GOHA 1B2WL 4MTMA 4TRPL 5TK4A 3HR6A 5I6XC 1INQA 4PJGB 2V5RA 2X89A 4H26A 4DJMA 2ARWA 2X89D 1FAKT 3B5HA 3AG3B 3MGOB 4JZOA 1KV7A 6CGTA 1P5UA 4O2FB 5E6IC 4YO0A 4JFHE 3NZHH 2F58L 5LGHH 2EUVA 3QVAA 4TSBL 3U0TB 4ZW8A 5FO2A 1W0YT 2ADJA 1IT9L 3SCMD 5DK3A 3NZ8A 1BGXH 1YNTF 3CH1B 5CLTA 1CDHA 4YHMH 3W9DB 2XZAH 4K55A 1FG2B 5HY9A 1CLOH 1Y07A 5BQDA 4PTUB 4N9GA 5HGDA 2XKNA 1DL7L 2Y1AA 3D48R 3HNSL 1NL0L 2GJZA 4R96B 3S3BB 4DUXA 1TJIL 2ZJSL 3HCVA 4YNYA 3LJ3A 3WE1A 5A3ID 3OC8A 4JANB 5FLVA 3TCLB 1ORQA 2MCPH 5CU5A 3HG1B 3LCYA 3T0WA 3FN3A 3MBXH 4Y2LA 8PAZA 1I1RA 1MJUL 2BSCA 3ARDB 3H9ZA 2R4SH 4X5XB 3ULVC 2WNWA 2JVUA 1WBZA 4M7JH 1Q94B 4U7SA 3SGJC 4W1TA 5IFAL 2VZVA 5GS2D 4WUUE 1EZSA 1UWXH 2XY2A 2Z7YA 1WWCA 3LB6C 3MTRA 1BOGB 1JWSB 3V6ZA 3ES6B 4U6YA 5I8OH 5AZ2H 2XTJD 4QWWC 2DDQL 2IDQA 3BC9A 1V7NH 2C26A 3BDYH 3GMQB 4MZ2A 1KXTA 4U0QB 3J7HA 1S7WA 2NY7L 1IM3A 1BM3H 2GJ6E 3HG5A 3MJ8B 3PHOB 3OXRB 5DJ8A 1N0XL 1P1ZA 1Z32X 4YDZA 3VI3E 4NZUL 4HEPA 3OX8A 4YSTA 4JKPH 2QELA 4S0SD 5DRNB 5DA4A 2ODHA 2D0HA 4EI5C 1GOGA 2AJ3B 2BCMA 2ERJC 4L29B 5GZOC 3IRPX 3LKSB 1ZLEA 1EVTC 4Y5YB 5EOTB 1TG8A 5D7IF 3MRLA 2W95A 2A9NL 2APWA 2DMCA 3U0WH 3DJ9A 1YEEH 3WIIH 3LYRA 1HI6B 1BXVA 1S7VB 2Y1YA 3S35X 2WVVA 3HKZA 1RZ8A 1EX0A 4N3TA 4NCC1 2XQYK 2R9HD 3UBXI 2X9ZA 4P3DA 4FFWD 3HZVA 5D7SL 3BP4A 3KWWB 5IG7A 5I0DA 5FM8A 4MMXB 1O6VA 1YNKL 4NRZB 3ZRCC 4ZFOA 1N6VA 5FW8A 1S9VA 3KPRE 1Y0LA 3IE9A 3DMMC 2Z8VC 1I75A 3FU6A 4JVWA 4UINH 3S0PA 1TMQA 1KXQE 1UACL 4JCMA 5KANG 4UQ9A 1QG3A 3Q6GH 4J6RH 3Q1EA 3L5XL 5DJ6B 3VI3F 5JPMA 1NBCA 2EVFA 1CFTA 1HCVA 4X4MA 1KCUL 4MHHG 3UBXB 3G5ZB 5F9JB 1VAHA 2XG4B 1PDKA 2NYYC 2YUVA 3MV01 5CR1A 3TV3L 4MDIA 4W6WB 5CD5C 2HMID 1CZ8L 1A5FL 1FNEB 4DP4X 3BMVA 5JQ6H 5D70L 5ACMA 1WQVT 1Z9SA 4FYTA 4OZ4B 1HWGB 1K6QH 3GMOA 3QH3B 4HUKB 4K94H 4PSRA 4N6QA 5IK3A 1O6TA 5DFVD 5KSUA 4ONFL 3QJTB 4HUCA 3NFNB 3DX2A 1T1XB 4G7QB 1D5ZB 1DQDL 3RB5A 5ALCL 5EG6C 1JPEA 5ANHA 5FKAB 2HLEB 4JFZH 3CFBB 3W39A 4KVNL 5D8JL 4XWGH 3OHXB 1P2CB 5GSVB 3FN9A 1ROWA 1CFQA 4L3EE 5F71A 1YPZE 3UAFA 3KPPA 4KTGA 4LARL 4O2EA 5B1CA 1BYOA 4JGUA 1XEDA 4JHBA 1WWBX 3QPQD 4Y9BA 1JHLL 7CGTA 3EGXB 1F4YH 4JPIB 1GGBH 4KO5A 4JJ5B 2KZ1B 5JW4R 4PWFA 1G9NC 3OKYA 4H7VA 2Z1PA 3TNNB 3BXNA 4LSSH 2YD9A 4N22A 1EXGA 2ED6A 4IMKC 3QFGA 3FT9A 2WWKO 5H35B 2K70A 5LB1A 2H6PB 1HILB 4JEGB 4NT6A 3KM2A 2MOGA 2DEXX 1OE1A 4OCSL 2C1PB 4P2OB 4AKPA 1GHFH 4AX3A 2EIKB 2BIPA 3X3GH 2WQ8A 5IBLC 5AL0A 1JGIA 5JXEC 5JXAL 1LP9A 3QZPA 1OSPH 3H4HA 5EUOF 1M3JA 3V79C 1WHPA 3X3FH 4O58L 1JGDB 2AEWA 4MZIA 4KQ4L 4U7MA 3I2CL 4JLRB 4K3EL 3TYFB 1BMZA 4XPGL 2TAAA 3ATDA 1T21B 1XF5B 1KCSH 1YPZF 3UP1A 1XR8B 5E00B 1DCLA 4L4TA 1VJSA 1AO7B 1VZGA 4QHMB 1IFRA 2QBWA 1IFGA 3PHQA 3KD4A 4IRZA 4L4TD 1L0QA 4X4XA 4C83A 4NO0A 4LQFL 4JM4L 1JOIA 2OSYA 3B1TA 2I27N 4NO0D 2OS7A 4TNFA 3CBKB 4LLDB 3A47A 3WKQA 1XR9A 4D3CL 2Q5BA 5I6KA 4PI0A 1ZGLP 2OLDA 1G1OA 1I7RA 4X6FA 1CDYA 3D39A 2ZOUA 4JREC 5IVXE 4BD4A 4PJ7E 1DBML 3GBDA 3D39D 4XCFL 1Q9KA 3T0EA 3HZKB 3WS3B 2E6QA 1N67A 1I7ZB 2GC4C 2XICA 2ZOTA 3T0ED 4YPGB 5I9QC 2N7SA 3HC3H 4UIKL 1QR1A 4I77H 4XP5L 3MO1A 4ZSOA 3QP3A 3AM8A 5EZLA 5C9JB 5GRZA 4MD5B 2BX5A 4Z7UE 1FG9C 1IGYB 4Y2OA 1L9PA 1Q0EA 3FO0H 4UBDD 2KS0A 3L3HA 4ZFZA 2NLJB 4GUQA 5CN1A 2W0FB 4FA8A 1BFOA 2DWTA 4OM0L 3LY6A 3MFFB 4XN7A 4BUHA 4AMKL 2YS4A 4XI5D 1ZCRA 3W2DL 2PKDA 1UWGL 2VISA 1OLLA 1SEQH 3GC3A 5FM4A 3E6HA 3GMMB 1VLXA 4XRCB 3V4PA 5GSRB 2AC0A 4PY7A 4UQEA 2X4QA 1I1FA 2FNBA 5CUSL 3TH2T 3U2SB 5SX5H 2BIMA 4ZMAT 2F53A 2IXQB 3LIUA 1ZT1A 4AG4H 1C5CL 4U3SB 4JCLA 3AUVA 4MAZA 4NENB 2G0KA 4PJ7F 4I3GA 5AVYB 3KPMA 3Q05A 1MCNA 1S3KL 4BYHA 1UURA 2HFFB 1I9JH 1PF3A 3FQTB 1AMXA 4IQHA 4G8FA 1A9BA 3V6FA 1XAKA 1LE5B 3E8UH 4M62H 2B0SH 4FI8A 2FBJL 2JKNA 3IDUA 4HULB 4LRNH 4FKEA 4KKPA 4Z7UF 1P53A 3V6OE 4EVNA 1EHNA 1LM8V 1KJVB 2GTQA 1DTUA 4AQ1C 1RIUH 1WD8A 2NY2C 4GW4B 3NSJA 1W80A 1W91A 5AAWA 1DANU 2X4NA 4X9GA 3KYKL 1EDQA 2VUOA 2KERA 5KSVB 5EUKA 3SYAA 2Z3FA 4LDLB 4WEEA 5DZ9A 2F5BH 4HAKA 1B9ZA 3QNYB 4LDEB 5DHYB 3RIFK 3LD8B 3SDDC 3A21A 3ZT7A 3HS0C 1M7XA 3PDOB 5CR8A 8CGTA 2IAAC 4DIXA 3ARXA 2WNGA 1JPFA 2YPVH 4RDQF 1O9VA 5JORA 1A9VA 5AZUA 2R2BA 4ZMWA 5JLZA 2IGFH 2WZ0A 3UIYA 3ETBJ 3HI1B 3TF7C 3P2BA 1TVHB 3IDYC 2LHAA 4KROC 4ZNEA 2J12B 2JIXB 3UCQA 2Y9RT 1CT8B 3LQAC 2ZF9A 5AYUL 3SEPA 2MHAB 1R5IA 5JIHA 2AV7B 4EXKA 3BH8A 2Y2TA 4JFOA 4IOFC 3U83A 2GIMA 5KVFH 1ZA3B 3C60A 5GISH 3VW3L 3O2DH 3QUXB 5HI4C 3C60D 4Z95L 1PKOA 2BHZA 4KKCC 1MWAH 3CVCA 2A1WH 3FAXA 3WL9A 4CGTA 2NSXA 4KRMB 2GAZA 2CPCA 4N90E 2CM5A 5TGBB 3VO0A 4WO4A 1KLGA 1N4XH 1IZKA 4OQ1A 4FFYA 4U33A 3UPCA 2XWJA 5E1AA 3QUZA 4WO4D 2WIMA 3PABA 3D0LA 2YSTA 4WJ5B 5E8OB 1S5IH 3B9DA 3GUTB 4E9RA 2IOIA 1DBKH 5KS9B 3VH8B 1E4WL 5E1HB 2P8PA 4AM0A 3GRWL 2OMWB 4BV1A 1NQBA 1QTSA 3FPXA 3SBPA 3QO0B 4QHKI 4UUJA 3QJVB 2CKBB 3PIQB 1ET5A 1YEFH 2WO3B 3AWFA 4MAUH 4U3CA 5BRQA 1IQDA 3TEYA 1A6ZA 1RUAH 1NOFA 1UUSA 3P30H 4L8SA 4LESA 2WANA 1F11A 4MGXA 3WENA 1YEDB 3FUHA 3U36B 4I0PA 2AFNA 3G08A 2FJUB 1E5BA 3DXAB 2YPVA 1ZXQA 3NP4A 4NUMA 3S36H 2XNAA 2CRYA 2GY5A 4XWOD 3TNMB 5HSFA 3QQXA 1YG9A 4UWQB 2ZCHL 4RAHA 1XF4A 5FOBA 1Z9PA 1SLUA 4W9IC 2J57A 2VN5A 3QQDA 4LKXA 2E7LC 1K4CB 3AVEA 4ZMZA 2FBRA 4NWTH 4AKQA 3V0DA 3DPDA 1ONQA 1DQJA 2A6DA 4S1QH 3MCYA 2F8VA 1FZOA 5DC0A 2YQBA 3A24A 3CDYA 4JHUA 2VDPL 5DD5L 4U1JA 3ASOB 3O2DA 1DVFA 3CBRA 3CFCL 4L3FA 1C08B 1R3IH 1DVFD 4QCIB 4CN4A 3J8F7 4LGSB 3ARGC 1MWAA 1ZIBA 2W8CA 3CFQA 2Z35B 5DS2A 5HD8D 3SE8L 1U2HA 4XVUD 2A74C 4G72B 1FYTE 3UFIA 3VWJA 5GRJL 1OD7A 1SEBB 1AP2B 4MQ7B 5AW7B 3VWJD 1GIGL 2IJ0C 3QJZA 1PZUB 3O45B 2ATPA 4BHUI 1FH5H 1TQUA 4PUBH 4DEPC 5EIIG 3RTLA 3ZQXA 3IGAA 2KPNA 1KIUB 4FQQA 4ANWA 5LNEA 2IWFA 4UTBL 1TVBA 3IJSB 4ZTPH 4AL8L 5J5EA 2ZWSA 1WIPA 1QASA 1OAXL 5ECJE 5B3JF 2Y5EA 4AVIA 1J1PH 4K7PY 2PWEA 3FRUA 3RPIA 3HG1D 4O4YL 4FXLA 1QFWM 1Y6MR 4UOW0 4YHNA 4TL4A 1NEZG 5I5RA 1XBDA 4Z7VE 2HT3C 1A7PL 1I7UB 1K72A 3U46A 2XQYG 4PRNA 1RP9A 4LCWA 4F9LA 2AK4B 2O5XL 4OZFG 4NNXB 2R69A 3PL6C 5A43C 4LCWD 2ZCLH 1HQRB 5JIQA 4Y4HB 2OSLA 3BKCL 3LRSA 3QGVA 3QDJE 5D1XB 5LKNA 3MC0A 3W81A 1U58B 3HNTL 4ZUTA 4DFHA 2VR3A 3T3PB 3UZQA 5J1AB 2ZF8A 1KBGL 4GAYA 5JOPD 3ELAT 5IV2A 1UADC 1PLBA 3MXWL 2A6JB 3MRBA 3BEWA 4K9JA 4Y4KA 1F4AA 4JGJA 5I8CA 4P23A 5GGSB 3QI9C 3QZNA 4Y4KD 4BDVA 1QYGH 5D1QE 5DJXB 4G8GA 5IJKA 1XDTT 4P23D 2VYRE 1FLRH 1QBBA 4I88A 2AGJH 4G8GD 5CGYD 3CGTA 4N0FA 4JREB 4AVHA 1WVZA 4AQEB 3MRIA 4OCWH 5I1HL 4ZFQA 4PJBB 4N1HB 1H6FA 3EJPA 4LSPL 1VEMA 3GNML 5ENWA 3AS0A 1HCYA 3BIAX 4OIIL 1NCBH 3GMPB 4TVPD 1UWYA 2ZSVA 4Z5RA 4ZMXA 3MLRH 2UYLB 2VM4A 2DKUA 5D96C 3JWDC 1GC1H 4MA3B 4NRYB 1CFVL 3FOLB 2I60L 5BRZA 1ZK5A 2QV2A 4BM7A 5HHXL 5BRZD 5GS1A 4XHQA 1CLZL 2QVFB 3JV4A 2Y36L 3P77B 2ICWI 3FT2B 4DVRH 1BAFH 5KEZA 1NCAL 2DI9A 3B2VH 4PG2A 1YC8A 2GI7A 2JELL 3H7BA 1UGKA 2IANA 2V3FA 4FQ1L 4PRPE 1GPOH 5IHWA 1EHKB 3DIFB 2IAND 2J8UE 3WUWB 1JERA 3WXVH 1G1CA 4L23A 4CMHB 4IHOB 2QPUA 4HD5A 1WCBA 1E7UA 1L7IH 2W88A 3HJ0A 1RJCA 3WEAA 4F5CE 1FRGL 2OR9L 4XAWH 3QXUA 2D3JA 5FHBL 2ICWB 2XN9A 3JWNH 4HEMA 1N59B 3UZVA 1HVXA 3NCYS 2D03L 4JKMA 3IDXL 2QPFA 3KHQA 3X14A 3GJEA 4UNIA 5CKAA 5DJYA 2YARA 4HWUA 4JB9L 4NX0A 4OKVB 5LQBL 3KPNA 4OJAA 4PW3A 1HK6A 3C5SA 1XGUB 1CE1L 2J88H 1TFPA 3ILPA 4LCCA 3TBVA 2E7DA 1JVLA 3IYLW 1LEKA 4A2LA 5F6IC 1T04A 1EZVX 1ZLWH 3VI4A 2D8KA 4MD4B 3LIZH 1A6AA 3IDNB 1UENA 3WEXB 4ZO7A 2JKTM 2LLGA 2VDRL 3VFWA 1I3GH 5IT2L 4FHBD 1NWPA 3SDDB 3KLLA 4EOWL 1DEDA 2D4FA 4UYQA 4APXB 2F8XC 4GMSH 2MQ0A 5AW1B 4NZTH 3OJMB 3LH2L 4XVTH 4P2OA 3BUIA 4PYGA 4QHLB 4P2OD 4X5QA 1ITBB 4EF3A 2OJZH 3MRCB 5GS3A 4WK4B 4GW5A 1NCHA 2P48B 3HE6C 4PTTB 2D9QB 2FX9L 3H0TA 5IQMA 4AE0A 4Q4EA 4YHIA 4B3EA 3GMRB 4H25B 3LNFA 1YEHH 4P2RA 1HE8A 3ABMB 3GIVB 5TE4H 4BIKA 4YDVB 2WQVA 4HYTB 2FYYB 4P2RD 1CL7L 3IDGB 4RIRA 4MCYA 4PJGE 1ZA6A 3QWNA 2ISDA 4PJIB 3BLPX 5DC2A 1CLYL 1CIUA 4NO5A 2BVQA 1N5YL 3UEQA 2R15A 1MEXL 1ZHLA 1ZVNA 5E1QA 3OAZK 2AQPA 1MCOH 1OM9A 3AC0A 4UYPA 2GHZA 1AO7D 2R2CA 3FQUB 2N7AA 5SV4A 1ZY9A 3WY3A 1CN4A 4H0HB 2KDYA 1UXSA 4XX5A 4PJFB 1EA9C 1HAWA 2BZDA 1ZS8A 4LZKA 2WZ5A 4OT1L 3WKMH 4AUUA 1OF0A 2WXMA 2Z65C 4PV8A 3RL1B 1HX0A 1FC2D 2RBLA 1XGRB 4XNUL 2CLRB 3H3BC 4HGWB 3FT3B 2Y3NA 4BZ2L 2IALA 1XH0A 1TENA 4IBZA 5ANMA 4D0CB 2ZPKH 3K2UL 2GUYA 4HUWB 2FT6A 3CJJA 2VLKB 3IPEA 5I1AA 5K69A 3WIHH 2X6BA 2YD1A 3IJYA 1GZPB 2FH6A 1PTZA 4A6YL 4ETQB 1KPUB 5DD1L 4GP8B 1ZLVH 3C5ZB 1JVKA 3FSOA 5E5RB 2WZPA 4F8TA 4PJGF 3ET9F 2WVUA 4AGLA 4LNRB 1MFBH 1YY9D 2WZPD 4KXZH 4O2CA 5IEKA 5TDOA 3QARA 4BFIA 3GXTA 1BIHA 1DVSA 1O0VA 1WZ1L 1GGYA 2OV0A 3EJZC 3VXRA 3FTUA 4KKAD 1D5IH 3BVVA 5F6HJ 3RVUD 3W9EA 3VXRD 4QTIL 1A7NH 3P0GB 2F08A 3IPBA 1JZGA 3S2CA 4F8LA 3CSYB 3ARUA 3MMEA 1ZTXL 2AEPL 1BVNP 1U30A 5CILL 4BZ1H 1XGQA 1JCVA 2P45B 4B9FA 1ZJAA 4WI5A 2NXYD 3DVGB 2ZUTA 2X4RB 5DHXB 1FVCA 2J71A 1NBZA 3H1ZA 4PMEA 1EUTA 2YMXL 4UILL 3CVIL 1OTTC 3MDJA 5I1JL 3F58H 5DZVA 1DBJL 1MI5A 2A74B 5JHBA 4TVPE 1RY7B 1FI8C 1MI5D 5IQNA 3ROLA 1D7DA 1C8PA 2P9RA 1CD1B 4FX5A 4QTHB 4WWPA 3X2QB 4DN3L 3DSFL 4LOUC 2ITDB 4PW9A 1MF2L 5T1KA 3CIQA 4WGKA 3R06A 1JHTA 4DEPB 4HIIA 1M2OA 1U8QA 3O8XC 5EWIH 5T1KD 1M6OB 4MCZB 3S5LB 3OKEB 5EA0H 3SZ6A 4TTDC 3LZFL 5JUEL 1BMGA 3HAEB 1I1CA 2Z93B 4Y4FA 4D9RD 4Y4FD 2A4EA 1G0XA 4NP4L 4I0CC 3WIHA 5CJ5A 5E2TL 3FB6B 5GIRB 1KDIA 3NTCH 3QNFA 3ZTNH 1JK9B 1MUJB 2BM3A 4EI0A 2F68X 3GI9H 1MCQA 4X7CC 3GM0A 4Z0XB 2EIBA 4LB8A 3HMXH 5GJSL 2X6VA 2YPLA 3DX6B 12E8L 2VE6B 4K71B 5HDRA 4ZMQA 2NY0C 3H3PL 2FO4A 2WC7A 4F37F 2ARJQ 3QO1B 1YY8A 4OFQA 1JPSL 5IBUB 1GZQA 4PB9L 3EYQC 2BW4A 4FCAA 2GBVA 1UM5H 3KCPA 3QFDA 4X6DB 3MN8A 1HNFA 4L9DA 1XZWA 3V4VL 2F1AA 3SPCA 5LDSA 2R0WL 4G3YL 4TUJB 2HJKA 3VRIA 1T83C 3GSQA 3QK0A 4BZ1A 2KDGA 4DP6X 2XQBL 3I02A 1JNLL 3FTZA 1S7RB 4DZBB 1RK0A 3QJXA 1JZIA 2CUHA 2CDFA 5DUPL 4AOFA 1BZ7A 2DYPA 2WKLA 1SLXA 5J13C 1AE6L 4HFWA 4M56A 3EYOA 4AYFA 1F3DH 4XOAA 1RUQL 1E9PB 2OL3L 2MCAA 3UTQA 1S7XA 5G4NA 5FECA 2HA1A 1RZGB 3FQNA 1KCRL 3UIZA 1CDIA 4PGCA 4FQ2H 3WMQA 2OR8A 2XZCH 4FQJH 3LRHA 3SGKC 3SE6A 4Q9QH 5D96B 2GSIA 4NPYB 4ENZA 3LS5L 1KGJA 4A55A 4OJDH 3HC4H 4NQVA 5B22A 3MRFB 3GSVB 1V10A 4H0GA 1N6UA 1JTPA 1BJ1J 1BQLL 2FGWL 2UV3A 4OGZA 2HN7A 4EUPB 5JR1H 1ACYL 3ZDXB 5C0BA 4ZW6A 3CPUA 5AG9A 3DGDA 2DQIL 2VXUL 1NM4A 5D7KD 1IBHA 2DQFB 1XCQA 1AJ7L 3IKCA 5JW4M 5C0BD 1E28B 4NQCB 3CZKA 1IFHL 5KVDE 1QPXA 2PP8A 4DGVH 4ZUWA 3QT2A 1AO7E 3HMXA 4R4NC 5DC4B 3BN9C 4OFYA 3QCTH 4L4VA 3LXBA 4NIYE 5ISZA 3VI4F 1MCSA 5IQ7L 4XZUA 4OFYD 4L4VD 4C58B 5ISZD 4HHGA 4J27A 4XPAL 5FFOA 4BCYA 3FFCB 3TT1H 3MR9A 1VGEH 3EW3B 4Z1PA 2PYEA 4QRTB 4MNGB 4N24A 4L9LB 5EF2A 3KPOB 3KYMB 2ZKYA 5TK2A 1RLBA 2PYED 2YD6A 1BZDA 4WUKL 2PP9A 2X42A 4BFFA 3BI9X 5FYKD 4YHKL 3QORB 2B4CL 5F1NB 4XT1C 5DZPA 2OSXA 1BPLB 1JTOA 4FLSA 1MDAA 3FDWA 4OD3H 3BQUC 3CLWA 4ONGL 3RY6A 1RVFH 4CN6A 2NZ9C 4M7LT 2R0ZL 4UMGA 2EYTB 4LSQH 4RDBA 5F6IB 2B1HL 4FFVD 3AMKA 2BSRB 2B1AH 4R7NB 5D7LA 3HJEA 1FV1A 4GAJL 1MFDH 4TLTA 4OV5B 5CEXB 1MVUB 5D7LD 1C5BH 2CK0H 4HLZG 4PV9B 5I1GL 4IU2B 2NPLX 1GGTA 1KGIA 1J18A 2D7PA 3K8KA 4NS0A 2O5YL 1IBYA 3RWIB 1MCBA 5GGSY 4TUOB 4X6EA 1DSYA 4G7RB 3MVSA 1IKNA 2ITFA 3Q0HA 4B9CA 4AGPA 1HCFX 2BP0A 4CDHA 2FLMA 4B5EA 1P4UA 2B2XL 3JYCA 2WBXA 1AACA 2CHDA 2E9GA 3WSQH 5ICXA 5EF1A 5C08A 2BNRB 2W9LA 1SN0A 3I74A 5I15L 1MQKL 5C08D 1A3LL 2DMBA 3OKKA 3S98A 4FABH 1YC7A 1Q1JH 3WD5H 1NANI 1X5LA 3ARRA 3T1FB 1IQWH 1TO4A 5D1XD 2L04A 4ZX5A 3TTYA 3IAPA 3QEQA 2PCPA 3QDHA 2WK2A 4FYSA 3IMVA 3RP1A 2VJ0A 5FO8A 3QEQD 4Q9RH 4P46B 1BXXA 2AAVA 2CLZA 4JQIH 1LMKA 1FE8H 1MFNA 1LK2B 3TVMC 4XPTL 4QHNA 5B39G 5I6NA 3EHBD 2I9LB 2Y06H 2AEIT 3ZDZB 1UA3A 1E4XH 1E8YA 3I6KB 4XCYA 3KXFB 5IB2A 3O6LH 2WBWB 3CQPA 3GI8H 4OUUB 1PSKL 5FOJA 4IBQA 4U6VH 3L1FA 3O9WC 1X7TA 3W57A 3K8MA 3IN2A 3RY4A 1UJ3C 4NLHA 3TWCL 3BP6B 3GLAA 2YPKB 3GTNA 4Z9KB 3IU3A 4XO5A 1O7DE 1I1YA 3OKNA 3VFGH 4BEIA 4MQSB 5D4QA 3RDTA 3ULVE 1QFPA 1W72B 2DWDB 4X4KA 3V7AE 3C5JB 3GEFA 4FG0A 3RDTD 1XCTB 1S7QA 1EXUB 3QXTA 1J8RA 5F8RC 5KAQG 2O30A 3HS9A 5FFLA 4WEMB 4FNUA 2E8YA 5F0MB 1NFIA 4I48B 4UT6H 3I9IA 1XWVA 5ALBH 4M3HA 3UAJC 1WAEA 2ENQA 2H32H 3LNGA 4R3SB 2VUYA 1HHGA 3L3DA 4Q58C 3L4ZA 5HHQA 3DVIA 2ZICA 3H9SB 4EDXB 1XF2B 2EJ1A 2UWEA 1CTNA 2OJEB 2R39A 3MRQA 5CWSA 3WNLA 2BWQA 2FHFA 1VACA 1XZ0A 2XYCA 1IGFL 1S7SB 4POUB 3MGTB 4O51B 1F4XH 3KL0A 3TL5A 2YAOA 1FSKC 3V0WL 1URZA 3SPVB 4OCXH 2RTTA 3KGTA 2OMUB 4ZUSB 2X4UA 5ESAA 1ADQH 1GSKA 5AVVB 4A7VA 3HI5H 1CBVH 3MROB 1PL3A 4LCVA 4A2EA 5KS9E 2KZWA 4P4RB 2KKQA 2V8MA 3QYCA 2NW2A 2WXRA 3AQDA 3UP6A 4HT1H 4JQIA 2HTKC 3FZUC 4LF3B 1TZIA 3PWPA 2IMMA 4AV0A 4QY8B 3TIEA 1UVQB 3N41B 3PWPD 4XCNB 4F9PC 4ZNCD 1G7QA 2CA4A 4EDWH 4L0YA 2AQ3A 2VLMD 5A2LH 4WJG3 5GHWH 1KY7A 2EACA 3UC2A 3I6GB 2VSCA 3ME0A 4ZFGL 2H2PC 3HI6L 3FH7A 4S10A 4EI6A 3AY4C 4OI8A 5L88H 2NZ1A 4HJSA 4P57A 2EXYC 3UBGA 1CFNB 4XXWC 1UWEH 4CKVX 4KNQA 5DUBA 3DXAE 1ZEAL 4I3SL 4MNHA 3EJYC 4TN9A 5EORH 1ZGLA 1BXUA 1OT2A 3GBEA 1RMFL 4NC1E 4WFGD 1GZHA 3W0WA 1ASQA 3UMTA 4ESKA 3Q2CA 4U6XB 5L7XH 4OF6A 4DCQA 3I6LE 4Z76B 1NDGA 3KWUA 3SJVB 4M5TA 5I17B 1ECYA 4WO0A 1N64H 3I9GL 2VDMB 1IGJA 1FCCA 1USQA 4FTVA 4OLEA 2B5IC 4UNUA 4KI5C 3RX5A 1G7PB 4A37A 5JOEA 1S5HB 1JZ6A 2H32A 4FTVD 1X5GA 1KPVB 4OGXL 3QIBC 3NEOA 2BVOA 5LNGA 1TU2A 5DEGB 4FQXA 1J9SA 5I1LA 3RU8L 5I0VA 3UTTA 5IREA 3PUCA 4FQXD 1SMOA 2WJ7A 4H1LB 3UTTD 3HB3C 1G5AA 2IG2L 3QW9A 3TYGH 1A1NA 3ULUE 1NDMB 1TQTA 1L9RA 2V9TA 5IMLA 1CGVA 3KVQA 2DD8H 2MJWA 4OZFH 1ADQA 2X4SB 3F7PC 1N0LA 3HHSB 5IROC 2Y4SA 2QGEA 3FN0L 1AR2A 3IFOA 5IR1B 4EZKA 1D9KB 1DJSA 3BGFB 1X4XA 4Q6IA 2N3JA 4PU2A 1QZNA 4MRBA 1TQBB 3CDCA 4YR6B 1C1EH 4ZUUA 2PR4L 3GHBH 3QJUB 4WFFE 5A7EA 3HPLA 4H88L 3BAEH 4MBRA 4EKJA 2OMVB 2RD0A 2PXYA 3K4ZA 3ZTJG 1K2DB 4PGEB 3IJHA 2PXYD 1XVSA 3FJTA 2WSKA 4HJ0D 3TJEL 4AYBA 4DP1X 5HYSB 1R19A 4GRWF 3C5ZD 2AK4E 2XVKA 4JFFA 4YXLH 1N2RA 2BP5M 3V0FA 5MI0C 1S9WB 5D1XE 1CFMA 5IWLA 3KYAA 3IAQA 4JFFD 1CR9H 2VZTA 2YA2A 5IVZA 4XNMA 2YBGA 3LSOA 2ADYA 4NERA 4GIAA 1YEIL 5DJDA 4RMTA 4YBLC 2G75B 3RTQC 4MLSA 1G7HB 3STZB 3T3PE 3UJTH 2YEQA 1F00I 5EIIA 1E2WA 4FCHA 5TE7L 5T1MA 5EU6A 2A0LD 5DURD 3FHAA 5EU6D 3V5KA 4FAAB 1SLWA 3HG3A 4CUCA 4BBWA 1YEGH 2YD8A 3D33A 4GXVH 3HZYB 3IDJB 2QT6A 5IIEB 1JWMB 2W5PA 4JY6A 3L3KB 4BFJA 3WN5A 1DQLH 3FTGB 2X1OA 4FZEH 4PJBE 1I1AC 4LCIL 3IXAB 4LLUB 5GRXG 1L5GA 5C0CB 1NINA 3AU1B 1NEZA 4NCDA 1RHFA 4OGYH 3NJNA 5HGHA 3VTMA 3S8FB 35C8H 3WJJA 4OJEH 3DBSA 2K9FB 1JK8B 2RIKA 2XQYA 2EDJA 3BQUB 4UIMA 4M6NL 3U9PH 2BVYA 1Z3GL 2ARJB 2D3LA 4OZFA 5HGAB 2R29H 2OCFD 5AVUB 3OQ3B 4MXQC 1L9TA 2FUQA 2IFGA 1G6RL 3FW6A 3L4VA 1DVYA 4B5ZA 4ALAH 3AW5A 1XB3A 3K91A 5E2WL 5AQ0A 5ERWA 1KULA 2XRAL 3IF1A 2VAAA 4XN2A 1ASPA 4JDEA 5IW6A 4U1LA 5IHZA 1OCOB 4KK5D 4KK9D 1F3JA 4XZ4A 3T3PF 1J8HA 5DR5L 4IKKA 1S9KC 1J8HD 3ZIMA 1SMDA 5GGRB 2P47B 2OTWB 4M5SA 3PAUA 4ZW7A 3WHE0 1RZJL 4LVOC 2I9TA 1WYJA 4P5RA 4PJBF 1PYWA 1MRCL 1XMWA 3EH3B 1I4FA 1Y18A 1MFCL 2IBGA 2NY3D 5FUZH 1YNLH 4BQBA 1AYRA 5JHLH 8FABA 1H8OA 1L9NA 4ADIA 3U1SL 5HYFA 2HFEB 3RPBA 1XFPA 2X10A 1CF1A 4UT7L 5CIPH 5I73C 3FONB 1T80A 4WGWB 4HX1B 3MACH 4DERA 1CLOL 1FL3A 3BZEA 1U8KB 1J05A 3WMPA 1FFNB 1U8NA 3PRZA 4JBSA 2BK8A 5DQDH 4ZAKB 1INDL 3U7WH 1RL1A 3IMUA 3PQYB 1NJ9B 2PW2A 5A2BA 1OOWA 4H8WC 1E6OH 4JFSA 2MCPL 2NY5H 1T2QH 1FGVL 2FB4H 1L7TH 2Q9OA 4OF5A 3ZRSA 2XN1A 3OWRA 4G1EA 1BVLA 3EYVB 2VLJB 3SIKA 3UABA 1XSIA 2HP4A 4E9VA 4PRIA 3S37L 1UJ3B 3FAWA 3CHOA 4N2KA 4PRID 1MW2A 3VXOA 1PKQB 3HZMA 1ORSB 3G9VA 2EINB 3PFQA 1HEHC 3SE9H 1ZLDA 2NQ3A 3EH1A 1KGCE 4AENB 4CC1A 1EXHA 3VXNA 2GJRA 2VDNH 2Y7NA 3MRFA 1F1AA 3DETD 4UT9H 5L9DH 4JM0A 2O61B 4OM1L 3CHSA 3TFBA 4HG4J 2VQTA 4BQ9A 2Y3AA 1FNLA 3FUNA 5G2NA 1BMWA 3ILEA 4B97A 2VABA 3C6LB 3OB0H 4J4PD 3DI2B 2AHIA 1HC1A 4URKA 3JT2A 1A7OL 1PIGA 3PREA 1QBMH 4QHPA 4PJIE 4G8IA 3ZT6A 3ZSSA 1KWGA 3INOA 2JQZA 4Y1AB 4KJPD 2YAPA 4Y5VA 5JHAA 4IKJA 1BWMA 1HWWA 1W16A 4ORZC 4XC3H 2OXGB 1QHPA 1YDPA 4J8QA 4U2ZA 4XBEH 4XNXH 3U0WL 1OLZA 1PNCA 1W0VB 1URLA 4LIQH 2VC2B 2GTWB 3POCA 1FSKB 4PJFE 5CP7B 5D6DA 5DSCA 4HSAC 5HI5D 1ZHKA 4X8GA 5JHLA 2EE6A 3JTTB 4X7SL 1A6WH 1HZHH 4RAUB 5CF3A 3PCYA 1QFWI 4M00A 3CZNA 1F41A 5CIPA 3PWJA 1EPFA 4OLYH 3Q2VA 5CJOL 3TIDA 2IQ9L 4WU7B 2R1XA 5I26A 3G6JB 2J25A 5BV7H 1I8KA 2VLKE 2RFXB 2IMNA 2CIIA 4M1DH 3A22A 2V5YA 1TPXC 4ENED 7PCYA 3BLKA 3BP7B 2OTUA 1JGEB 4UINL 4WI4A 4OF7A 4RAVA 4K5NA 1KBPA 3Q6GL 4J6RL 2JKJA 9CGTA 4DTGH 4V1DA 1UH2A 1WDAA 1E67A 3RWHA 4V1DD 3OJDB 2Z34A 1X4ZA 1Y1DA 1HXYB 1DUZA 3BAJA 2VZOA 4TUOA 4IRZL 4CJ0A 3DDGA 4JZJA 4XAKD 5KVGE 4PGDA 1R5WA 4B9ZA 4ODTH 1K6QL 2QGBA 3A6CH 4FG2A 4K94L 2DTML 3VXSA 4WWID 4PJFF 1MWOA 2FJHA 3DO3A 4UT9A 3ZE0B 3L3JA 4XVJH 3JUYA 3GMLB 4OFPA 1F58H 1BQKA 2BY2A 2WLIB 2MOVA 1WEJL 4G1MB 5AW2B 1JNHB 5A40E 2ZUSA 3QIUB 2NR6A 3FOMB 3OSVA 3QUYB 2AS5M 3RX7A 4FYRA 4DUVA 2ZSWB 5BRPA 1A6VL 2AERT 1RJYB 3U1PA 1J5DA 1FIGL 5GRVK 1CB4A 3OAWA 1H5BC 4RFEB 4FLQA 4NB7A 3F05A 4P46D 1WFNA 1LE9A 3AGVA 2L8AA 4NUPA 5AALA 2XOTA 4Z7AA 2GABA 1RH8A 2MPVA 4Z78A 4DP9X 3DUSB 3T09A 4F58H 4L8CB 5FS5A 3UMNA 5DMGC 1UH3A 3QG6B 3V4PL 1HTYA 3K72A 3QZOA 3GINA 3S3SA 3X3GL 4ZFFB 4HKJA 3UX9B 5AZEH 5LGJB 2BIQA 4GG8B 1Y6KR 4NKIL 2Z31A 1UCBH 4PVMA 1U3NA 2Z31D 5JOFA 1OSYA 15C8L 2QTEA 3LXCA 1MZYA 3FQRB 4XP1H 4A63A 3Q43A 1AGDB 5AENA 5I75B 4HG4K 1SM3H 3ISWA 3H54A 1SJHA 4LLMA 2YD0A 1KG0A 1CVSC 1I8IA 1KCSL 3IAGC 2VMJA 3DURA 1JF1A 1G9MC 3P4NB 3SY0A 4GAAA 1KCVL 1CICA 4GMTL 3IJEA 2C7FA 2AJVH 1KCBA 2H7WA 1CICD 3Q8EA 4OLZL 5HJ3B 3RGVC 3VFSB 2R23A 4PLNC 4X6DE 3GYRA 3DX8A 2DRUA 4QXUL 2AKRB 3BSGA 4QO1B 4YBLB 2UXTA 4FFZA 3NIFB 2ICEA 2FL5B 4WI7A 4IRJC 4J2XA 4FMVA 4LLVA 1V27A 2JLLA 4NBYB 5ITBH 1CXFA 2VZ1A 4AK1A 2QQNH 1U8LB 4TNVK 5T5NG 1T66D 1DN0B 4I77L 5FF6A 5L2KA 2CUAA 3Q2NA 1I1AB 5TDPB 2WQWA 5I1DB 2PNDA 3UDWC 5L2KD 4U1MB 2AZUA 3BIKA 3NRQA 3UTZB 2A9DA 2NY4D 1G6VK 3BD4A 2G3XA 4OCNC 4P0DA 4RMVA 4I9WD 1KB5H 5C7ZA 4QOKB 2RJMA 4PP1C 3D50A 3ILQD 1YMMB 1TEFA 2YXVA 1XIWC 5IW1A 3QCUH 4XP6L 5E8EA 3JSSA 5F1KC 5GJTL 4MJ6B 1SOSA 3MRKA 3EBAA 4QHUA 3TZVC 4F91B 2WWMD 1DVUA 3K4DA 3N1PC 4K8RC 4K5MA 2DEWX 2W81C 4YLCA 5FGSA 3F7YB 3CLFL 3DX4A 3TLRA 1NC2B 5DQ9B 1F1GA 1F56A 1FZJB 3ML8A 4HPYH 4X6DF 1I3RB 5AB9A 3ZDXE 1T0PB 1E4KC 2PTTA 3BO8A 5EU3A 5L4JA 5EMYA 3RWFB 4NQCE 5T3ZH 1HKLL 2RR3A 4ZTOL 2D31B 2EDEA 4FFYL 2QQLH 2XVLA 2HRLA 4ZW5A 3QRGH 1I9JL 4JG1L 3D12B 1XL6A 4JX0A 4BK4A 4ES9A 1MLBA 5I17A 1LO0H 3L54A 2QKIB 3PAZA 4HIEA 2B0SL 3DTUB 4HLZH 1P7KB 4LLQB 3RKPA 3FFCE 4M5YH 2F7QA 1GGIH 4NZJA 1VFAB 4RQQB 4MNGE 1DYZA 4IEFA 5DRZA 2DY2A 2V2XA 2V7HB 4GG6B 3HE7B 5KYUB 2CR3A 3WFDL 1KELH 2X87A 4M1GH 4ZI8A 4Q2ZA 5DJ2B 5I73B 2W92A 5E8DH 3TO2A 4AYMC 3CDGB 2DV6A 4OW6A 5ESQA 2K6WA 2XACC 2C9SA 4JM2C 4LSTH 2CBPA 2E6JA 2XUWA 3FSVA 4AC4A 1OGTB 3HMWH 4PLKD 4X99B 1JP5A 4WI8A 1PX8A 5D4JA 2ZAIA 3ZDXF 2YPVL 3BHBB 1YYLL 4QYAA 4X8JA 1W9XA 3F12B 4IBYA 1D9KA 4TNWK 4BCXA 3WXWL 2IGFL 3F62A 3LN5A 5T3XH 2B16A 3WUWG 5JMOC 1D9KD 1CF8H 2K3TA 3LZRA 3QUGA 5EF3A 4WI3A 2ZOLB 5MERA 4HETA 4JPVH 3T0VA 3QWQB 5EOQH 1EHLL 2W91A 4LL9A 3RAJL 3FO1A 5DDHB 2I25N 2WLMA 4UANA 1PG7H 4RA0C 3QWOB 5IB3B 1TYJA 2AJZB 2N7BA 2FQFA 3GS7A 4H8HA 4KNTA 4A7UA 4FNLH 4KMLB 2BNRE 1KYAA 1NMBH 1LNUB 3R8QA 1M2VA 3QSKB 2R0LH 4KTEL 2OP4H 1AAJA 1ZHBA 1MWAL 2AW2A 3IK2A 4GI6A 4PCSA 1J11A 5DVNA 4RCAA 1FL5A 1MCWW 3IEAA 4GRMB 3EUDA 3GSOA 1N4XL 5EO9A 5T3ZD 4ORGB 4LPWA 4KPHL 3SDYH 4P9HH 4MX7A 4DWHA 5IVNA 1QPKA 5F88B 4X42A 2BS8A 1G1YA 2B8OT 4PRPA 1S5IL 2BNUA 3C8KA 4PS8A 4YFLI 3S4SG 4NQSA 4PLJD 5SX4I 3ZUCA 3L7EA 4QKXB 3JVGC 4YDIH 2A83A 1RPUA 5L6YH 4R97B 2JKRM 3AREC 2EDHA 3ZDZE 4NKMB 3FTGA 3LNEA 3KXFE 4KKBD 2ZOKB 1JJUA 2CGYA 4E9WA 1YEFL 5E8PB 5CBAB 4MAUL 3KMDA 3EGDB 1WJ3A 4IIQC 1F42A 4APQB 1GW0A 1WP6A 1QSVA 3MRJA 1YN7B 3ZVVA 3P30L 5BMFL 1TPXB 3SGDH 4JY4B 5AYQA 1T89A 1UASA 3JZ7A 1SDAB 2D9CA 4M3JA 3D3VB 2R69L 3S36L 4N2GA 5EV7A 3BAXA 4F1SA 3MNVB 1SHSA 2LAGB 3TBSB 3CVHH 4LCUA 3H55A 4EQ3A 4HUUB 1G7IA 5I76A 3B2UC 4PRDB 4NDMB 1OANA 3MRMA 2XV6B 3A4DA 5T3XD 1AD0A 1VSCA 1TUPA 2DYSB 5HHPB 2O6DA 3T6QC 2D3NA 5DK0A 1XD0A 1NKRA 2OTWA 5B39A 4NJ9H 1G9HA 3H9SE 2YBRB 4BH7A 3MRGA 2DM3A 1EEYA 4L1TA 5JNYB 2XCMC 1UZ8B 1OAZH 3EO1A 4Q52A 4UM8B 1IAIH 2H1XA 2ORBH 2A73A 4X7TB 1KN4L 5C8JA 2CRIA 1TSRA 1J0KA 4TVPL 5BS0A 3VWKC 1MJ8H 4JAMA 4XPBH 3WV0A 3FCTA 2HVBA 2VLRB 2X28A 5HDQL 2P8LA 5BS0D 5EZJA 5EOCL 1IGCL 2AVGA 3VNZA 4PUBL 4AMXA 4HHAA 2D2CC 1AZRA 1II4E 4TQIA 4HIHB 5DLML 1OGPA 1CYXA 4TV3A 1S78D 5K9QI 1S7TA 3QPXH 2X4TB 3NRFA 2EDYA 2W9EL 3MJ7A 4F2MA 2V2TB 3ZKXC 4QRUB 1JGUH 2NXZD 3K0WA 3HVNA 4AC2A 3DARA 3PWVA 1IZJA 4F24A 2IADB 5HTSA 5BJTB 4ODVH 3TFKD 1ULVA 1XGTB 3VAEA 2LU7A 1CCZA 3NESA 4HKBA 4BSWA 5J3HC 2VAJA 3AXIA 4Z77A 2AAAA 4YDJA 4YXHL 1ROCA 3DROA 3LVEA 4YAQA 5C0AB 2P44B 1UOVA 4CADA 4CW1B 3DJTA 1T3FB 3VMNA 2DQEH 1FJ1B 3G5WA 2Y24A 3BAWA 4NKOB 1LEIB 4POZD 3BZ4B 3P9WB 5FGRA 3CVHA 1A4KB 3SJVE 2UY6A 3P0VL 4WFED 3VFPB 2JJVA 4ZS7L 1FAIH 3V5DB 2QPEB 3EOBA 4L4JA 3GSXB 3CN0A 3EDEA 2X70B 3KPSA 4PWHA 2F2HA 3OMNB 4PJ9C 3VFOA 5ILTH 4CBPA 3N41F 3ZTJH 3EO9H 4JDVB 4WW1A 3KPSD 2JI1A 3N0PB 5DVMA 5EB9A 2AGJL 4OBRA 3CZFA 4X5WB 4MD0B 4Z7IA 1HIMH 5DK2B 4HZAA 5K9JH 1BV8A 3CX2A 3TJPA 2MTAA 5KJRH 3OKLA 2VMFA 2BCKB 2YK1H 1NCBL 2J6EH 2DM7A 2EKSA 2G60H 3L1OH 4TULH 3THMH 4DETA 3ZN6A 3MLRL 3VMOA 1YEJH 3O4LB 3IB4A 3P11H 4AL8C 3LQMA 1S9YB 1R47A 3WN6A 5IOPB 5ESVB 1IEBB 2VKWA 3LNHA 1CDJA 4DVRL 3LHPL 4I0KA 1U8IB 4I18A 3B2VL 4L5FE 2WSDA 5BZWB 2DBLH 1BLNB 2XC8A 2Q7YB 4JDTH 4I1PA 5IBUG 5KSBB 4KBPA 3WU1A 1V8HA 1TTGA 3QIWA 1TZHA 4ZDHA 2NUTB 4GO8A 1ZSDB 3GSRA 4F1ZA 1D6VH 3SE3C 1KCWA 3QIWD 2NW3B 4LPTA 5DZJA 1BG9A 5F9OH 1UKTA 5FHAH 4ZXBA 2FH8A 3MLVH 1FORL 3QEGL 3MRPA 5F1IB 4H2CA 2QVIA 4XAWL 4BKLA 1JGLH 2WLLA 3SDXE 2J56A 4HIJA 1WFTA 2BSSB 5AAMC 4ABWA 4CBZA 5EEYA 1OAYL 4OZIA 3QQ4B 5IBTH 4G8AC 4NUGL 2XN0A 3NT0A 3MUGA 4AT6A 5AOMA 1M4KA 4QRSB 1DVTA 4G83A 3F7KA 4PBVC 3REVA 3N1GC 1ASOA 3VDAA 2RH0A 5B38G 2C1OB 3IDMB 4ZPVB 3APFA 2FIRT 3B2XA 2AJUH 5D5MB 4U1HA 7TAAA 3ETBF 4FG6C 3LN4B 3QIUD 5LCVH 4KWUA 5C0CE 5MEPB 3QR0A 1SN2A 1DQQB 1OQXA 4KUZH 3GSWB 1UB6A 1IV8A 4OI9A 5DMJB 3HTLX 1U8CB 1T4KA 4N5EC 3SKJL 1U4FA 32C2B 3MBEC 1E40A 1NLBL 2EYRB 4J6IA 1JI1A 4P5TC 3TA3A 1X4YA 3VXQA 4JM2B 2HT4C 5JZ7C 2D7MA 3TA3D 1EEZA 1ZV5A 2OMXB 3DX1A 4DP2X 3BP5B 4GMSL 3TT3H 2J6EA 2C3WA 3OXSB 4XVTL 3AT8A 4N2OA 4EMZA 3FT4B 3U4KA 3GB7A 1HFUA 1DANT 2IC2A 1OF2A 1BBDL 3KH3A 4X7DC 4Z7NB 3KEHA 2WLKA 4NQDB 3QQ9C 1T0OA 4QJ5B 1WK0A 1H3VA 3KLHD 2BO0A 3LPOA 4K9EC 3MLYH 1QUNB 3FYIB 4JGMA 1R1CA 3Q13A 4M8VA 3WO3B 3F01A 3UTSB 2XXFA 3MRRA 4MB1A 4MJ5A 2EXWD 2UZYB 4RMSA 4KXDA 4GAFB 2EE3A 5FKPB 4RSVA 1ND0B 3W1ZA 3NCCB 1R17A 3NJMA 2DM2A 2NYKA 2VXVL 4D9QD 4AV5A 5CCKH 1TTRA 3N1FC 3VFVA 4J3OC 1GL4B 3UPRA 5T1DL 3QC6X 4KJWC 5F8QC 1BZ9A 3INUH 3QUHA 1D5MA 1MJ7H 1KIQA 1QWHA 3SOBH 2FR4A 2FEDD 3GHEH 3OWEA 3WFBL 4AMWA 2VRAA 3LPFA 1A6TB 3GO1L 1PJWA 2ZPKL 4D0BB 3PQYE 5K9OB 3QXAA 2NY6B 3ARBC 1MH5B 3C12A 1WIUA 4XX1E 5LCVA 5KOMC 3WIHL 2JKIS 3ULSB 2BP3A 5E7BA 3AG4B 2VLJE 2GFBB 2VL5A 3TBWB 1HEZA 4Z6AT 1GS6X 3F04A 4MB5A 1RKRA 5D1ZI 1SRDA 2J5LC 3RWEB 4E41B 3H2PA 1BX2A 1MFBL 1L0PA 1SF5A 1IIIA 2IDTA 3KBFA 1PKQE 3RPKA 2OW6A 1HE7A 3CTTA 3RI5K 4X6BA 3U7YH 5MENE 3Q6FB 1A3RH 3UPAA 4CL7A 3AAZB 1T1ZB 2YXFA 1BZOA 2BFGA 1AIZA 3LKPA 1ACXA 5HJGA 2VZSA 5HHVL 4XC1L 3D18B 3OKDB 1QO3A 4DPCX 4G6KL 3GBMH 4MQXC 1A7NL 5AUMB 2XVGA 3G3LA 4G6MH 3MV9B 4BXSV 4Q89A 2AITA 2CJTA 1D5BA 5DJAA 4MA8L 3ULVH 1BQHG 1QHQA 1K8IB 5D1ZB 5D7JB 3LKQA 4Y1AE 5AW8B 5EO1B 4BZ1L 2F54A 4CA4A 2E56A 4YWGH 1GKEA 2F54D 1FVEA 2PF6A 3HBQA 3WTWA 4R0LC 5E2UH 1QVOB 2BFVH 2H2SC 4FXGB 4HKZB 5GISL 5CBEA 4MS8C 3VM7A 4TLUA 3F58L 4YK4B 1Q72L 2NY1D 4G7YH 4X7FC 5CN2A 5DF0A 1SPDA 2XWXA 4UQ3A 3T4AA 4B7IA 4BE6A 5IW3A 3STBA 4YH6A 4KH2A 3O3AB 2K9UA 2ALAA 1HOEA 3VWKB 1E90A 4P5KB 2BSBA 4U1KB 4BK5C 1D6EB 1JRHH 4KDTC 4BSVB 3DYOA 5LBSH 2KLRA 1XCXA 3QAZC 4OF8A 2DLTA 3VGAC 3G6JE 5L2JA 3F5WB 2CALA 4KVCH 5EWIL 1AD9A 4KK6C 4QYOB 4XMKH 2E7CA 2I32A 4R4FH 3K71B 1MJJB 3K6OA 2CK2A 3QNZA 2OMTA 3QR1A 5E6IA 3JWOC 1PZ3A 4G6JL 3US1A 1G84A 3NTCL 4K3DH 4W6YB 3ZTNL 5KTEL 4G9FB 3T77A 3GI9L 2X40A 3KYOB 2FX8H 2CO7A 2BJMH 3UYOD 2CKBH 3HMXL 4ZMPA 5B1JC 3Q1SL 1H3UA 3QG7H 1U95B 3FU7A 2H1PH 1RJLB 2FZ3A 2IPTH 2JJSA 4XTRC 1W8EA 2HKFL 3WFCH 2WQXA 2Y5QA 1B6DA 3DHMA 4C4UA 4HLJA 4KC3B 2CUIA 3ZE0E 5JDSA 1GAFL 4JMNA 5FYKL 3V0IA 3NP3A 3CSBA 3KM1A 4H0IA 5AD0B 3SZKC 4HV8A 2GSGA 4TMPA 2VDPB 3SGJA 4C4KT 4E0RA 4FEIA 1I9EA 2E9JA 3G6DH 1OAQL 2WBKA 4MYWB 3O3DB 4KJYB 4AGMA 2WO2B 5GRUL 5FIEA 1HSBB 1NGWA 4ZMOA 5CZVH 5E95B 1GOFA 4KDWA 4LEBA 4WV1C 4ONHB 2XY1A 1MRFH 5CZXC 3UTOA 1BIIB 3L48A 2VR5A 2OKMA 4HIXL 4JZNB 2CZNA 2YKKA 3MYJA 4Q9BA 5E2VH 4ZUVB 3NVQA 5SWSA 3WUZA 5J1TC 3L3OC 3K1KC 1PLGH 2CPUA 3RL2A 4ZMNA 4WW2B 4FQ2L 2YSSB 1DJXA 4FQJL 4NUQA 4F7MB 2VDOH 4KOCA 4EI5A 2MSPA 3U48A 2ADIA 5GZOA 4UOZA 1TVDA 2KBGA 3M17B 1R33A 3HC4L 1ES0B 1V7MH 4QDGA 4B27A 3APMA 4R26L 4LAQH 1ET8A 3G7TA 4APQD 4AZ8A 4TTGA 4U6HB 1G9NH 3RWJB 3BH4A 4TSAH 5LBGA 3KYNB 3BOVA 3CFJB 4YZWA 1A9EB 4KRPC 2K4AA 4AK2A 2ESVB 3MRNB 3IGFA 4HUUA 1SHWA 4DGVL 1GXEA 1U8MA 4XVSH 1CGWA 4XPFH 4M48L 1VESA 4UDTB 4KTYA 4D9QE 2OMNA 1E0OB 4PJDA 4OF0A 2DZEA 4PJCA 3VTAA 3MLZH 2OZNA 2PWGA 5EBMB 3DMMA 3WLBA 3KDPB 1T0NB 3NIFE 2J44A 4P9MH 2WAQA 2PPAA 2MMXA 4FQLH 1RZPA 3N43F 4IS6A 3KLAB 5DFAA 1A4CA 1I82A 5C0GA 1LO3L 1TZGL 4JFPB 3L5IA 4M02A 1P1VA 2I85A 4IMLA 4JFXA 4QRRB 2ZXCA 2J73A 1MHEA 1TTFA 2Z8SA 1NFDA 1JNNL 2BMKA 5A6LA 5IESH 4LSQL 1XB6A 4N2BA 3D85A 1DBBH 3DTXA 2JH2A 3ELQA 4NI6A 2B1AL 2PO6C 1MFDL 1N19A 2ROXA 3D85D 3DVFA 2LT9A 3FB7B 3HOGA 3QZWA 4M9PA 3MBEB 4QOKE 1C5BL 3D2UB 1DZ0A 1YMME 1IGML 2CK0L 3GIZH 4OAWB 1OK0A 4YSPA 5E94A 5HYSG 4M43H 4OZHB 2YJLA 3LS4L 5SWQB 4PJ5A 3NUKA 2EH7L 4MVBC 3ZR6A 5LLIC 1KIPB 1K8DB 1SOQA 1OV8A 4PJ5D 1K4DB 4WCYH 3BPLC 1KNOB 3WY1A 5KN5B 1YEWA 3RFRA 3PGCB 3T04D 4WHTA 1F4HA 2WMPA 1TLMA 2EABA 4Y5XC 1PW3A 2XWTA 1QLRB 3CVBA 2ZWNA 1WFJA 3KR3H 4M7ZB 3BRGC 1SJXA 1OZUA 5J6GB 1XHHA 2NSMA 4ZQKA 3IKKA 3HLAB 5K1VA 3FT0A 4IMKA 1WICA 5GGVH 2C34A 4PJ8C 1Q9OB 1QSEA 4J1UA 2G5BB 2R27A 1ZD6A 4KKQA 4N1CA 4WTWA 1KEGH 4G9DA 4IOIA 3ZZ1A 1QSED 4Q9RL 5JXEA 4JPKH 1R3HB 3E1ZA 4JQIL 4BUQA 2R4RH 5TDNA 1WA0X 3PDDA 1BLIA 4ISVA 5TH2B 4EN2A 2Q6WB 4XVOA 5I74B 3ZE2F 5C2BH 5I8KH 5JXED 4GG6E 1JZEA 4K3HA 1AXSB 4HFUL 1NCOA 3WJMB 2DQJL 1JG9A 4CU7A 4AIOA 3TH4T 1ZJBA 2VZ3A 1S7UA 2YAMA 1BECA 1E4XL 2MPAH 3CHQA 3S96A 3O6LL 1PQZA 4NUJA 3GI8L 2JK5B 3DVNB 3FQ1A 2UY7B 1IAKA 4ZD3H 5F7DA 3OSKA 4FADA 1KFAL 4NAJA 2L4OA 1PCSA 2Y7QA 3C08H 4PRBB 1U93A 2BCKA 5DWPA 1VKXB 1EAPB 4G7SB 3LX9A 2WWKT 3IS0X 1EVUA 1WH0A 1I8MB 5HVWA 3S5ZA 5DD6A 1QI3A 5BOZG 2VDRB 3MA9H 1WZAA 5F3HB 4E5XB 4PGBA 3RURA 1CL7I 4D7BA 2J5LB 4P4KC 2J8HA 4PBWD 1E5CA 3NIGB 3TCTA 1UWXK 4J3BA 1HHKB 3MX0A 5MHSE 3FQXA 2FQGA 4NAMA 5DEFB 5LN8A 3E2HC 2YN3A 2IF7A 3FTXA 1AQDA 1FFPB 4X0KB 2W07A 1O9WA 4A04A 3I9PA 3F3HA 5C09A 4RVBA 2C7UA 3ABZA 1UZ6F 3VU2A 3X1EA 3RFZB 2DEYX 1IU1A 4JVPA 5C09D 5T1LA 4QXGL 1J0ZA 1VADA 2DL9A 2EDDA 1KB3A 5T1LD 1TETH 5CS7A 5C0EA 3P3TA 2Z64C 4UB0L 1KTCA 3LQAH 3T4YB 2IH3A 1ZT7B 3L3GB 5SV3A 2P1YA 1BD2B 1AGFB 1R3JA 2CHWA 3P0YH 3N42F 4TUKH 4RGOH 1VIWA 1JHKH 3HI5L 3NDZE 4R0LB 3ZUNC 3D25A 4XX1G 2H9GB 1HHJB 1AZUA 5FGBC 1U8OB 3SDAA 4A7TA 3SDAD 1R9FA 3KAAA 3B9KC 1OGAB 2ITEA 5GHWL 1J1OH 5DVKA 3DOHA 2AMGA 5IM7B 3IGLA 5EFIA 2VITB 4YL9A 3ZRFC 1DSFH 2DQHH 5A2KH 4JHAH 4YUEH 3IGUA 4JG9A 2WKOA 1UWEL 2WTOA 3D3VE 2BVUA 5C07B 2MNWA 43C9B 3UJJH 1LO5B 2WB1A 3L13A 3ZSTA 1GW6A 5E24E 3HRZC 4A6YB 4L1DA 4AQ1A 4HWEH 4GXUM 4HZ1A 1WUZA 5L7XL 4K2UL 3QEHA 2OX5A 3IXTB 3QQ3B 3GZQA 3S4SA 1OL0A 2F1BA 3ECBA 3U7AA 5KZCB 3HS0A 1UM4H 1VDGA 1EO8H 1LJMA 4G43A 5HHMD 3RWGB 4NYLA 5F21B 3QUMH 4JVUA 5JPNB 3OB8A 4P06A 5SWZB 1E27B 4ZPTB 5KVGH 3WGUB 4OUOA 2H8PB 5KSAC 4JPWH 3ZL4H 2VLRE 5KG9A 4A2FA 3R7QA 1QRNB 1R3KA 2JJTC 3NK4A 4P8QA 3RWDA 1BVKB 3FO9B 4W9GC 2LR4A 4WV1B 1ETZA 1BOYA 1M3IA 4GFTB 4WI2A 3BUYA 3IFPB 3HFMH 2V3EA 3V55A 5E1GA 5IEHB 5JIPA 3TO4C 4F2FA 3MLUH 5HI4D 3RWCB 4C8XA 2Z91B 3MXVH 4HUXB 1C1EL 3K2KA 5AW5B 3VGFA 5LHDA 2V0AA 1CXIA 2Z4QA 3L3OB 4KK8D 4JR9H 4JFQA 4KKCD 1HHHA 3BAEL 4HKXA 1QQDB 3PXHA 4IRSB 2BIIA 5EF0A 1DFBL 2BPBA 3VSQA 4PRAA 5AAPA 2HUHA 3OV6A 4QXWA 5C0AE 4K23H 1OAUH 1DJZA 3N1MC 4ELMA 1H8SA 2WSPA 4PCYA 4TLKA 4IOSA 1CR9L 2X6MA 2CQVA 1LO4H 2HVJA 2GTZB 2C4FT 1RIVH 1WCQA 4IOSD 5FV1L 1F18A 1JIBA 4XGZB 2N0KA 2FO8A 1T2JA 1QHOA 1TNMA 2AJXH 2WBJB 1F90H 3VVWA 3OR7A 2FWSA 1GYUA 1OCCB 1QZ1A 2YWYA 5HYEA 1CGSL 1KV3A 3RNKA 1NGYA 3MV9D 4J8RA 5BVJA 1K8IA 4UDUB 5K9KA 1TDQA 4XNYH 4UAHA 3GMNB 4QF1B 4R5TA 4WWOA 1RK1A 1JF6A 5EU7E 4YGVA 3V4VB 1ICTA 3C87A 5ABAA 4F8PA 1LEGB 4FZEL 1A6UH 3QUMA 2P5WA 4UU9B 2DM4A 2O4EA 4YE4L 4OGYL 5IJVB 3TS8A 2P5WD 4NNYA 4E42B 3T2NH 3OMAB 1JN6B 4NXSA 5DJCB 5E99L 2XZQH 2E7LA 3OR6A 1OTSC 3MHZA 5TPWL 4NQEB 5BVPH 3E6FB 3U9PL 3WNNA 4CVUA 1VPOH 3MV8B 3O4LE 2I07A 3VG0L 5CZRA 4MJIB 1EGJA 4GRLC 2C9VA 4MA7H 4ALAL 1IL1B 3KGSA 4QKTA 2OL3B 1U6AH 2JSFA 2Y7SA 4PS7A 4KJQD 3U6RB 3ARGA 3MCKB 1PZAA 1BQSA 4ODXA 1IBDA 2X3BA 3ARGD 1XTMA 3AACA 3RUGB 1ODUA 5KSBE 4QAWA 2N1KA 1AKJA 3BPLB 3PUUA 2DMGA 4WI6A 1Z9LA 2YRZA 1AKJD 2APFA 2QPDB 3LRKA 4K3JH 2YC1A 1LYQA 5SX5K 4XCCL 4Y5XB 1UATA 2GG1A 2J1KA 3JWDH 5EBLA 3X13A 3CK0L 4PWKA 4ODBD 4GI9A 4OD1H 5D2LA 2FEEL 4FMFA 4LSVH 1XTLA 3QRLA 2OSWA 3SCMC 1HINL 1WBXB 3K46A 1KXVC 1BJMA 4OZGA 4A7GF 5JHLL 4GOSA 4BUGA 2QZ5A 3K2IA 4JK0D 4PJ8B 1EBPA 2OBGA 4GAGH 5CN3A 4NKDB 4I7ZC 4R8WH 1ZKAA 4AEEA 4AIZA 3FFDB 2FEJA 3ABGA 7PAZA 1FPTL 3QEUA 2Q2EB 4P07A 2EVGA 3B7YA 3A4EA 5D5ME 1DVZA 5KUMA 4AYID 3AFLA 1ACZA 4R7DA 2FQEA 3G5VB 5DQDL 3T8XA 4UAOC 3U7WL 1FNGA 1PG7W 2JLPA 4UTAL 2R1YA 1E6OL 3PL6A 4KDVA 2NY5L 3J27A 3U0PB 3CCHA 3ZKND 3PL6D 3WTUA 3L7FB 2BOBB 5KSBF 4ICWA 5L8JB 2QQKL 4AW4A 4Y2DB 3UOAB 2WIIA 3BPCB 5IQ9B 2B59A 2OMZB 3NZUA 2XTJC 3ERXA 1M71A 1MCHA 1FL6B 3VFRB 5HJBA 1IUZA 4PP2B 1C7SA 2LU4A 2I5YL 5E4EC 3QI9A 4F92B 3RBSA 3SE9L 4Z7NE 3QDGE 1FFQA 3QI9D 3PWUA 4NQDE 3CZSA 4GBXA 4UT9L 5L9DL 3PF2A 4FL4C 4P4KB 3MNMA 4GBXD 4Z8FL 5A6MA 1JMXA 3IWVA 4NN5C 5B38A 5CLZA 3TN0A 4BE5A 5BW7C 4CJ1A 3CFKA 3DO7B 1TO5A 2XBDA 1WBYB 3UTSE 3WFHB 1QBML 2C3GA 4OLWL 3TN0D 5I6LA 3QDMA 3O3EB 1KN2L 2FBOJ 5I1IH 5BUGA 3QDMD 4HD9A 25C8H 2VDQH 5K39B 3X12A 4MAYC 2CU9A 3L4UA 1INEH 5F7UA 4FC3E 5I16B 3EOYG 4XBEL 3UGXA 4M61B 2R9HC 3BJLA 3NCEB 4BINA 2W0LA 1NKOA 1N12A 3MJ6A 4LIQL 3V6OC 2DWXA 3UTPD 4NFDA 2DL2A 4OTXH 4FYQA 4CU8A 4P59L 1JL8A 2JCWA 4GLRI 4N2IA 1SOXA 4G80B 4CVWA 3RG1C 4HGKC 3K6SA 2VN6A 5H37A 2GVYA 4Q0XL 1L4IA 5BV7L 3AS1A 4WSKA 2WQRA 4Z7NF 4M5ZL 4M1DL 5GS0D 5D7IB 5JW5B 5C0DB 1T20A 4AJWA 3B9KB 1UT9A 5CMAB 2EAEA 4NOBA 2HMIC 1X9LA 4LVNB 2BWDA 5B7EA 1W72L 5EU5A 4DTGL 2WYHA 3A6BL 1GSMA 3D34A 2MRYA 2XVBA 4K7PX 4Y19B 4E41E 2RMNA 2XWBB 1Q9LA 4LAJH 3ZYIA 4JMXA 4N0CC 1VFBB 4AVKA 1A2YA 1N10A 1A47A 4HJGA 1TQCB 1THCA 2X2YA 1IEAA 5DFVC 1ZRUA 1Y1UA 2EO7A 3EYFB 1E9QB 2HUEA 1OW0A 2WYIA 4FFZL 3OD3A 2A9AA 3MV9E 3E9UA 4FQIH 3B7UX 2DQGH 3P73B 5GQBA 2EDRA 4WKXA 1BPVA 2AABL 1FGNH 5BQ7B 2DW5A 4L1LA 4CILA 3U9UB 5HHOA 1F58L 2YGPA 4MB3A 4WHDA 1T1WA 5HHOD 3HR5A 4IU3A 1DE4A 5IB1B 2CRMA 5DUMH 4XMPL 2G5BA 1B0RB 5HPMA 4QRQB 3FU0A 3EFDH 5J6HA 1UZGA 2H6UA 3C75A 2YJQA 5LWYL 1WTGT 1M42A 5DCCA 3EH4B 3HE6A 1N26A 2FSEA 5FK9A 4WHYG 2WZ6A 2D73A 4BH8A 3M8OH 3KBEA 4YDLC 2YD5A 3TEXA 2JFCA 4UQIM 1WS7A 4AUJA 4C54A 3MLTA 4PLOB 3EOTH 1XGPA 4HZLA 4F58L 5CEZH 4MRCA 1MCWM 4HWBH 1YO4A 5EZOH 1RZFL 3TO4B 3U4EB 2Y7OA 3AABA 1CU4L 1HOCA 4OI7A 4IHBA 4Y9FA 1UCBL 1JZDC 1IC5L 4AH2B 1BQHA 5H2BB 4JRYA 1XEUA 3W82A 1E8ZA 2YWZA 5IMKA 4PS3A 4F7TA 2EVJA 1U3YA 3DSNB 2OXHB 1F6AA 4G9FE 3S8WA 2KI6A 4XP1L 5CJ8A 1ETJA 4DK5A 4HUMB 5DUJA 5C0JA 5K1NA 1AG0A 1AHKA 5EBGA 2AQRA 2A2QT 3O0RH 5ID1B 1B0GA 1R5VB 3X11A 1UFUA 4JRXA 4OD2A 1A4JA 1FNAA 4JRXD 5F3BB 5KYWA 5T5FA 3U2IA 3DRTA 4L48A 5DYOB 1QLFA 5EUOB 3U9WA 4KZEL 3SE4C 3IVKB 1DUYB 1MCRA 5EO0A 1HU8A 4MA1C 2WINB 4X7EC 1FLTX 4YHYC 4IYKA 3JQOB 3T0EC 1G87A 4KKRA 3WE6A 2IH9A 3DPBB 5DQJB 3IE4A 2YKLL 3MRDA 1M7UA 4OY9A 5JO5A 3T4YA 4MDJA 4I4WB 1PY4A 4MSWB 2QQNL 5IHBA 2VWEC 1SXBA 4D9LL 1AGCA 2VDMH 4Q4IA 3DI3B 4KO6A 3TJHD 3RGBA 4UBDC 2PUQT 4PJEB 1AGEB 4DPAX 2R1WB 2R2HA 3DUUA 4M7LL 3WTTA 5FEBA 5ACZB 4XI5C 2DWEA 2YXMA 2EUWA 5IKCB 5IJDC 2YAFA 3KPLB 3EFOA 2H0FA 3EJZD 1DEEA 1FUNA 1NAMA 2XWCA 5I18H 4RFNC 1PX3A 4M8QA 3II2A 4R4BA 5EU4B 2R8SH 4PAZA 3I75B 3MOAL 2JJWA 1MNUH 3QCUL 3UGEA 1WA1X 3T2PA 4DT2A 1P84J 2F7OA 4UM9A 1Q9WB 5HYQA 1JVOA 5IMOA 1T7VA 4UM9D 3D9AH 2TSBA 4HWBA 2PW1A 2XI9A 3L16A 4N0UB 4OZGF 5CEZD 4NNPH 1HT6A 4AM0Q 3FL7A 3VFNB 3BUTA 4MKMA 4W68A 3TH3T 4X4YA 4HW6A 2Q86A 4JFEB 3BWAB 1PS3A 2W80C 4Z0BL 1P7QA 3VUAA 4Q7DA 3CUPA 5C07D 4MMZC 5T3ZL 5JHDA 2CBOA 2ESVE 1MW1A 1P7QD 2SEBA 5JHDD 2ITCA 1INQB 3CZLA 4H26B 4U1GB 4HSCX 3QRGL 4XNZC 1SHMA 4NEHB 4ZO9A 5FYJH 2YZ8A 5GGQL 4L5FH 5CFHA 1QPPA 1IVLA 1U8PA 4JZOB 4LOUD 1F8TH 1P5UB 4WFHD 3O8XA 4J23A 4AITA 2DJMA 4YO0B 3U30B 1D7BA 4CGUB 1CGTA 1GGIL 4N2AA 1YLBB 2P80A 2ADJB 3IWUA 4RETB 1L6ZA 3MQIA 4WWKA 2VXQA 3NZ8B 1KELL 2P80D 2EEDA 1JXKA 4M1GL 5DRXA 4HJ1A 1ETB1 2AP2A 4WWKD 4WW2F 3VQ2C 5HY9B 4GSUA 4V11A 2QSCH 5E8DL 4N9GB 5HGDB 2XKNB 5CSZA 1KZQA 3QXDA 5IF0A 2GJZB 2X9WA 4PH8A 1U91A 4QRRE 3HCVB 4YNYB 4WRLA 4OLUH 4UAOB 2ZXGA 1ORQB 5FM5O 3HMWL 1WZMA 3VXTA 1QRND 1ZLWK 2NY0D 2J1XA 3MGAA 3UAEA 2HRPL 1Z0MA 1WBZB 2VLLA 1JUFA 2HSIA 4PJAA 5IQOA 5T3XL 3DJSA 4FDWA 4OZHE 1MVYA 4F33A 4JPVL 5EOQL 2N1TE 2EDLA 2XTJB 3V6ZB 5I19H 2BS9A 4GPVA 4U6YB 3V52H 2ZUXA 3L17A 2EH8H 1T83A 3DX0A 3C60C 3KCWA 4U3XA 5DO2D 1XO8A 3ZYZA 1PG7L 1RURH 3DDFA 7FABL 1KXTB 1N3NA 3MOQA 2W60A 1K85A 1S7WB 4IRSD 1IM3B 1U8HA 5DJ8B 2BXZA 1OAJA 1LXMA 3B9VA 1P1ZB 4NFCA 3T6ZA 3AB0C 2OP4L 1WV7T 3OX8B 5HGBA 1GA2A 5E03A 2ZYHA 2DPKA 3L9BA 4IBUA 4O00A 1MG3C 3SQOH 2WVSA 2K8MA 3SDYL 1RIHH 3L95A 3R1GH 2VRKA 4U0RB 1H0DA 5FYJD 3SGKA 1ID2A 2OI9C 2XWZA 4HS3A 1NCTA 2CMRH 4BJLA 2WVVB 4A7QA 4UDUA 1TJXA 5I1KH 3WIFA 1RZ8B 1GGCH 3JT0A 4H5SA 5CJXA 4P3DB 4HJJH 2NTFA 4EN3A 1BXAA 3V9CA 4YSQA 2KLTA 3CPLA 3N0AA 3HZVB 2ZUWA 3BP4B 1NFKA 5IG7B 4EN3D 2FATH 5IHLB 2ILLA 4OJFL 1UM6L 2M2DA 5AYTA 4NHCH 2QZQA 1AZZC 2RGSA 2QGCA 4ZFOB 1DBAH 1S9VB 4L8SC 1IC4L 1Y0LB 3ZTCC 3DO4A 4BXVA 1P84K 1X44A 5IGXL 3C09B 4F8NA 3ATFA 3APNA 4R4ND 4DK6A 1YMHA 2JCCA 3BN9D 5EZPA 4XWOC 3GLDA 2JF1A 3FRPG 1ZT4A 3O41A 5JPMB 1M53A 2RAMA 1CFTB 1QSFA 3QHTC 3L6FA 2X41A 5I6OA 4DGIH 4RGMC 1N6QH 1PDKB 4MDIB 1ZLVK 3CVHL 3H85A 5AW9B 1ZVYA 3NIGE 3NJVA 4FQCH 2CUMA 1J5HA 1B4JH 1AS6A 2Y5TA 1Z9SB 1GMIA 4D2NA 3GS4A 1NC4A 3GMOB 3RZWA 2Q3XA 4S1RH 3RZCA 5IK3B 1N5AA 1NC4D 3RZCD 5KSUB 4GKSA 1MFEH 3PJNA 3PP4L 1VZHA 2NZ9D 3NZSA 3W39B 2K78A 1IAIL 3IRZA 4ZYKA 1CFQB 4G6AD 5D9SA 3GJFK 3M45A 2VC2L 3Q8AA 3KPPB 3NEXA 4WKZA 1BD2E 3D69A 1CYWA 3W38A 4O2EB 2WAHA 4JFDA 1YUHA 2WXKA 3G04A 5E2JA 4OLVL 4E9QA 4JFDD 1VRSA 4NKDA 3CFUA 3MTXA 4ODHL 2LU5A 4N8UA 4O9HL 1LO2H 4CRPA 4AXWA 3ZU8A 4F3FA 2LLLA 4U1IA 2AEQH 5E7FA 2VMDA 3BXNB 2GIYA 4TQEH 1YEKH 4UOW1 1QBLH 2Q7AA 2WUBH 2XA8L 4NT6B 3KJ6H 1OGAE 1ZVSA 4MKTA 2P5EA 3QPXL 2EDKA 3NIGF 5DD0L 5TQ0L 3UYPA 1NEPA 3VG9C 2P5ED 3ARDC 1T03H 1LILA 1FF5A 2C3VA 1LP9B 5MP6H 1WD9A 5FDWA 4AEHH 2NQDA 3CXFA 2L0DA 5C07E 5EH1A 2V2WA 3DHPA 4HAFA 1KF9B 4GP5B 1KLFA 3TASA 3NA4A 1EZVY 3N9GH 2JI3A 4JKNA 3TVMA 1VCAA 3HBZA 4R84A 1FP5A 2DQEL 5C6TH 3TVMD 3AWEA 4L4TB 1UXMA 4XBGA 3B7SA 3PHQB 2DS4A 4U3HA 3SY6A 4X4XB 4C83B 1FAIL 2GSMB 4NO0B 3WFEH 2QLYA 2K7PA 2XV2A 4LP5A 3O9WA 4JG0H 5EIVA 1QFWH 5CGYC 1XR9B 3IDIB 3O9WD 3ZJAA 1QSZA 4Y5YC 5JQIB 4X80H 4X6FB 1FBIH 1I7RB 4YDMA 3D39B 2GEEA 2UZPA 5SWZE 3T2OA 4MA1B 1ZTXE 4XHJD 5J06A 2N01B 1Q9KB 4LASH 3T0EB 1CXHA 1XT5A 5MENA 3SKNA 1HIML 5TE6H 5DVLA 1MCKA 5I1CH 2MTPA 2E9BA 1QRNE 1QR1B 3CFEA 2EILB 5KJRL 3MO1B 5E0FA 4ZSOB 2EUZA 5EZLB 4PFEA 1SXNA 3EJCA 1BYPA 3VJ6A 4ANUA 1MCFA 2J6EL 5AWNH 2K1MA 5IB4A 2FLBT 4Y2OB 3UAJA 3HHRB 4DKEL 1U92A 3THML 1NSNH 1MCCA 3UAJD 3L3HB 4ZFZB 4I2XA 4LNVA 3GZKA 1BZQK 4QTFA 5CLWA 3LZOA 3TEWA 1IKFH 1JPTH 1WG3A 2CBMA 3BSZH 1T6VN 2VISB 3O6KL 4LSRH 1X9UA 5C0DA 3DGGA 4NWUL 3BLBA 2Z92A 3E6HB 3V4PB 2DBLL 1IGTA 4PY7B 2X4QB 1I1FB 1QNZL 2P8MA 3HN3A 3PGDA 4JDTL 3X1FA 2P49B 2GITA 1H9DA 2F53B 2UZIH 1TKWB 4IKIA 1ZT1B 3NGBB 4YSRA 1D6VL 2CWRA 1XB8A 4RGNB 2P24A 3KPMB 2XBZA 1V55B 2C3XA 2YFOA 4BGDA 2E9WA 5FA4A 1E9QA 1JGLL 1UXLA 3CFDA 2VW7A 4XNZB 5IBTL 4G8FB 1A9BB 3V6FB 3WBDA 1A8JH 2Q76A 3VFUA 4MLIA 2ZX8A 5FYLH 4B9PA 4XO8A 5CSGA 1IM9A 1QKZH 1KC5H 2HX9A 2H2PD 3EYUH 4LVEA 2XPGA 4EVNB 5HYIA 1IM9D 2W1NA 2YQGA 4PJAF 5ECGA 2BS71 4JFTA 3IMBA 4XXWA 4FQPA 4ABUA 3I84A 1AZBA 2X4NB 1A4BA 5LCVL 4KAQH 2FDBP 2FVNA 2EDFA 3SDCA 5EUKB 2VIRA 2A77H 3NEEA 3T3MF 2XSKA 2ZG3A 3CIAA 3NSXA 4FF9A 2H3XC 3SDCD 4G5ZL 1QNIA 1SBSL 4GNKB 2VDKL 4K73A 4NQEE 4U1NA 3T5WA 1RUPH 5I6PA 1AH1A 2ZT9C 3JYBA 2ADFH 1E3XA 2JV6A 3MV8E 4P2OC 1JPFB 4P99A 5JORB 2N0MA 4MJIE 4Z7WA 3TT3L 5JLZB 3P4OA 1IBGL 3NPZB 1RI8A 4JPSA 3GXNA 3HBGA 3K0YA 2H26A 3QIBA 4KI5D 4MXVE 4CSSA 2FD6L 3F84A 1DO5A 4CNIA 2FGZA 1B3JA 2F5AL 1IAMA 1CDGA 1R5IB 3BSZA 4HCRH 5LG6A 1TZ8A 3FPYA 1OHZA 1T6WA 3BH8B 3RUGE 4JFOB 1P4LA 4HLEA 3HB3D 3C60B 5F7NC 5F7BA 4HOXA 1XD1A 2P7TA 2RALA 4FNTA 2ATKA 4IBLT 1TXKA 3VTTA 3BVWA 5JA8B 4PRHE 5IROA 5ICUA 3T9WA 3WL9B 4TXVB 5IROD 2GAZB 1QACA 3OTTA 4OGAD 5C0RL 1TQSA 3C8HA 3R4DA 4WO4B 1KLGB 3CSFA 2HJFA 2XWJB 5E1AB 3QUZB 2WHVA 1UXWB 3NAAL 5DYOA 5CCKL 3PABB 3D0LB 5FYKU 2JCCF 3V9FA 4FJYA 4LP4A 4TSCH 3LNDA 4N0YH 3II1A 3SOBL 2HFTA 2P8PB 5FYLD 1PU0A 4AM0B 3QAQA 4WU5A 5KBMA 3BESR 2ZKWA 4MXVF 4L0ZA 3QB7C 1G7LB 1N68A 4UUJB 4XN9A 4ICXA 3SKOA 6FABH 2BH0A 3NACH 3CFTA 2ZYRA 3RVXC 1WZKA 1DJHA 2E74C 2BSDA 3RUGF 1IQDB 4JN1H 2DQTH 1A6ZB 4GS7B 2WNKA 3RTQA 4WEBH 4CDGC 4L8SB 1F11B 1XH3A 3RTQD 3MOBL 3IU4L 4I0PB 3EIFA 2ZP8A 3EF4A 3G08B 5F44A 3JBG7 2YD2A 4KKAC 2AJYH 2XNAB 4ZMLA 2VTFA 4JO1H 3U7YL 1AZVA 1XAUA 3MODH 3ZTEA 1XF4B 5FOBB 1MCJA 1WO2A 1ERNA 3QQDB 4H8WH 4LKXB 4TVUA 4NC2B 5I8EA 1ONQB 1PBYA 3O2VH 1DQJB 4G6ML 2A6DB 4M4RA 4UF7C 5INDA 1P69B 2UXFA 2Z7ZA 5F7FA 3BYYA 5I0YA 4X6CA 1FZOB 2NXYC 1EANA 5I30H 3PJSA 4U1JB 2JQAA 2YMOA 1B0WA 1DVFB 3FUJA 1WA2X 1X6NA 4J3OG 4RWYH 2ETWA 1NZRA 4N2NA 4QEGA 3FB5A 1J5IA 5FCUH 1MWAB 2QVTA 2BFVL 2ZG2A 5E2UL 5IQLA 1IGIH 4MXQD 4X98A 2RQ8A 3LRMA 3VWJB 4W81A 5GRWA 3MJ9A 1LWHA 4ZTEA 1RULH 3HPJA 1H3XA 2YRBA 2ATPB 2UUDH 4QGTA 1JRHL 3IGAB 3FK3A 1WC7B 4TRPH 4FQQB 5AOJA 1KYUA 5CHNA 1TVBB 4MJ2A 2UVEA 3LD8C 4KVCL 1TR7A 4Y4FC 3EFFA 4XMKL 1NUDA 4O02H 5D7IE 2NX5A 1COBA 3SN6N 3WKYA 4R4FL 2BOCA 3RYMA 2QADB 2HJLA 2BNQA 4NM4L 3FU5A 2YD4A 1MAMH 1MCPH 2NX5D 3EZJB 4CMMA 3MU3A 3FRUB 2BNQD 3MRHA 4PHZA 5E4IA 3RPIB 2E27H 1O7DC 3VG9B 4YHNB 1BQRA 2OZ4L 3CD4A 4Y19E 4B7LA 3KWTA 1MCDA 1W0WA 5A2JH 2BJML 3KG5A 3U46B 4PRNB 2MCG1 2CLVA 3QG7L 3OMZA 4LCWB 5KVEL 5F93C 4B96A 1DL7H 2IPTL 3HNSH 4NRXA 4WHYH 5A16A 2ZJSH 2OSLB 3LRSB 3WFCL 5I24A 3QUXC 3TURA 4F7PA 1M9SA 4ZUTB 5ICYA 3LEXA 3VD3A