3AT8A

Crystal structure of the kir3.2 cytoplasmic domain (na+-free crystal soaked in 10 mm barium chloride)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
199
structure length
196
Chain Sequence
IQRYVRKDGKCNVHHGNVRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium inwardly-rectifying channel, subfamily J, member 6
publication title Interactions of cations with the cytoplasmic pores of inward rectifier K(+) channels in the closed state
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 37
structure length 196
sequence length 199
ec nomenclature
pdb deposition date 2010-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3at8A00
2WLKA 2WLIA 3ATFA 4LP8A 2X6CA 1N9PA 1U4EA 3ATBA 2WLMA 5KUKA 2WLHA 2GIXA 3SPJA 2QKSA 1U4FA 2WLLB 3VSQA 2X6BA 1XL4A 3AGWA 1P7BA 3JYCA 3SYOA 2WLNA 5KUMA 3AT8A 4KFMA 2WLJA 2WLIB 3SPIA 2WLLA 1XL6A 3ATDA 2X6AA 3AT9A 3K6NA 3AUWB 3SPCA 3SYPA 3ATAA 3SPGA 3SYCA 3ZRSA 2E4FA 3SYAA 3SPHA 3SYQA 3ATEA
chains in the Genus database with same CATH superfamily
3MLRH 4FLRA 5BCAA 4BSVB 3OKOB 2IQAA 2XRAH 2H6OA 1PSKH 1MIEL 1RERA 3BH9B 2BSTB 4AM0Q 3ARTA 4F7MB 2LLLA 4WENB 4CC4C 4TQEH 4OCXH 1IEAA 4ZMTA 1M3JA 3JWNC 3J27A 3HB3C 2NY0D 3PIQA 2XPGB 2A9MH 5BZZA 2IAAC 3LQZA 1MCPH 2GK2A 1ED3B 5GS0L 3ARVA 1IGYA 2CMRH 3MUHL 5EOQL 1HH6A 4XO3A 3L5WA 5JOEA 3GUTA 3IJ7A 5E8PB 2YGVA 3GSXB 3QIBD 4L9LB 3L3GB 5PAZA 4XMTA 5I1GH 3QUXB 4ZUTA 4WFFE 2X9YA 4PMFA 4Y4HA 4UIMB 2BP5M 4CVXB 4MDIB 1HCVA 4JRYD 5ESQA 3FBQA 4M6NL 4I18C 1LE5A 2G5UA 2DQHL 2YWZA 2WQUA 4IK7A 3U4BH 2QSCH 2X2IA 1A8ZA 4G2AA 4HIQA 1JPFA 2BDNH 5I26A 4ALAL 2JV6A 5JYLA 3LPWA 5F21B 5AW2B 2YSSB 4MMXB 2V3DA 5IQOA 2ZQKA 4JL2A 3D51A 1ML0A 1MQKL 3ETTA 4PJCB 4M8VA 4Y4KA 5MEQA 1NQBA 2QHRL 3MLUL 3QUGA 3MLXL 4YEFA 1PZ5B 1VGKA 1NFIA 3O8XA 2DJ4A 4W68A 2VLRA 2VMEA 3HFFA 3Q2NA 4GLRI 5E1IA 3G6JA 4DTGL 2IBZY 5E8OB 5CGMA 2YMTA 2N0KA 2P52A 3WIHH 1TFPA 1YN6A 4RAVB 2YAMA 3BIAX 4OT1L 3U1SL 4JZJA 3HI1B 1KFAL 2VYRE 3BSZL 5GZNA 1U8KB 15C8H 3HCVA 5DJAB 5T5NG 3SKMB 3IJSB 3JV4A 3VGDA 4BFJA 4JFDD 2CM5A 3WFDH 1JNJA 5JLZA 1Z5HA 3KLKA 1AQMA 1QFWM 2HWZL 2HX8A 2VO8A 2AJVL 4WJ5B 3STBA 4OSUH 4P48A 3ZT7A 2PETA 5EFIA 5GGUA 1Q0EA 2OJ1A 2E0PA 2XWTB 5C6TH 2RQ8A 2WLZA 3H3PL 2APTA 4QKTA 5DK2B 3RWHB 4LLUA 3TM6A 4WCYH 3TA3B 1IBGL 2D7TH 3MREB 3ZE0E 2WXLA 3IGLA 3W3BA 1HXMB 3W57A 1AI1L 1RK1B 3VRJA 3O2DH 5AAMC 1S5HA 3ZKXB 3UMTA 3SKNB 1BZQK 4IKNA 3WFBL 2I7OA 5BO1L 2Y3AA 1MVUA 3II2A 2ZSVA 4KRNA 2V0AA 1VKXA 1DJZA 3VM7A 2PYED 1I7ZA 2ROYA 5KBLA 1PS3A 5D5MA 3QB7C 3BESR 5C09D 1NAMH 3BVNB 4RGOL 3O6FB 1YYLL 3MRRA 4YLCA 1U95B 4IK6A 5C7ZA 1QNZH 4JJHA 1SXZA 2EDJA 2IV8A 5D4IA 3BFOA 2DYPA 2YRLA 1F56A 4Y19E 1U36A 3GJFH 3GZQA 3MC0A 1S7RB 4XVJL 2VMJA 4KU1A 3C87A 4Q9QH 1FG9C 3CVHB 5IHBA 2AJ3B 1KGXA 1MF2L 5ES4B 2ESVB 1KCWA 3H42H 5EBMA 3NVQA 2ZOLB 5J1TC 3ZW3A 3GMNA 5IW6B 2WLJA 2ADGB 3C5JA 1LDSA 1FHNA 1PJ9A 1OAZL 4Z18A 2AK4A 1PZ3A 2BNRE 1AP2A 1YY9C 2V2WA 5I1IH 4G8FA 4ZFZA 1EZSA 1YQVL 1YG9A 4RQQA 2H3NA 2FJHA 5E8DL 5JDJA 1ASPA 4RMBA 4GMSH 1UZ6E 2YQ3A 3GI8L 1SLWA 3OZ9L 1CGTA 1U4EA 3LN9A 5F6HJ 5EU7E 2R0WH 4KY1H 3HNTH 3T4AA 4NN5C 4NQEA 2YS4A 3NJLA 1U8QB 3EGSA 1UKTA 2J4WL 1LILA 8FABB 2BZCA 5HJBA 1YN7A 1AD9A 5DHXB 3MX0B 1YYML 3CZSA 3WIFB 2WP3O 2XZQL 4PJIA 1H0DA 3MV7B 4HW6A 5JDSA 5SWZB 2AXGB 3PGCA 3GRWL 3U0PA 5AYUL 1HQRB 2JWYA 2NXZB 5LGJB 3R7QA 4BYHA 2FJFB 2ORBL 3BVWA 3PDDA 3VXTA 2CUIA 1R6VA 3MVSA 4N8VB 1J0HA 2I69A 1IKOP 5TK4A 1CLZL 2X10A 4EN3A 3KS0H 1W0VA 4YDIH 1EJFA 5JQHC 3QZBA 5FYKH 2HN7A 3N6YA 2ARWA 3RPKA 1GH7A 1NCAH 2ZYIA 1OIOA 2YJQA 5ICYA 4HUWA 2D73A 4YSRA 3DOSB 2DQIL 7TAAA 2DDQL 2F19H 1KBVA 1FE8H 2VRAA 3MGTA 3VI4E 5C3TA 3VWJA 4L4TD 5DI8A 1T66C 3K6SA 1GTFA 4N0CD 3W1ZA 4M6MH 3ULVD 2HLFD 3DJTA 3UAEA 3VXQB 2Y6TE 4PJHA 1PFCA 2W07B 1BAWA 2CLZA 4R0LB 5T8IA 1G9MC 3O41A 3VXOA 1UD8A 3OZLA 2VDPB 5TE6L 2IFFH 1GL4B 5F6IC 1F11A 4QRPD 4XN4A 4J4PA 5KYYA 3ML9A 3UZVA 3IDGA 2VZ1A 1F4XL 3HUJA 3MKKA 5ICXA 4B9PA 4NM4H 1KTBA 4Q58C 2QGBA 4OGQC 1SN5A 3GIZL 5E95B 2GG1A 5ID1B 5IWLC 3CDFA 3EGXA 4X9BA 4PQXA 4BQ9A 1I9IL 2ZJSL 4HH9B 2Q76A 2Q8AH 4U0RB 1XVSA 1NJ9B 2NSMA 2DQEH 4XWGH 1WV7T 1HDMA 3I50H 1S7SA 2QQNH 1L6PA 2E9IA 4AH2B 3B2PA 5DVKA 5DHVA 5KW9L 1H19A 1HI6A 2KHAA 3O6LL 4NBXB 3UTPD 1MHCB 1HXYB 1DBJL 4YHMH 2D4DA 2EQDA 1F18A 5JHAA 4HDIA 4CBZA 1MRFL 1XHHA 1UM6L 1MY7A 1AYOA 2F61A 1J86A 3RURA 4BKTC 2HKHL 4OV5B 1Z66A 4WI5A 1QAWA 4YWGH 5IBTH 3G5XA 2VXUL 1WS7A 1CL7H 3VFPB 5C6WH 5IQNA 4KO7A 3H9YA 3PWJA 1EEYB 3HE7A 3N44F 4ZUWB 1W72H 4G7QB 5F3HA 5J3HC 5KSBF 3QXAB 4Z7UA 4CU6A 5KVFL 1I1YA 2WBJD 4RGMC 4LZKA 1PZBA 3CN0A 1GPOH 1P4LA 1NOFA 1T2XA 1DQML 4A67A 5IVNA 3DECA 4LLDB 3SJVD 4M1CC 2Z31C 3SBRA 1A6WL 2IH3B 3EH3B 1ZE3C 4U1MA 4F2MB 2RD0A 4NAMA 1DBML 2Y5TB 3H8NA 1H5BC 3ZL1A 2P5WE 4FQXD 5AVXB 1QEXA 4QCIA 1AFVL 3V55A 1SFHA 2J1WA 3AAZB 1ID2A 3CQQA 3RDTB 2K7QA 5IESL 1LMIA 3VD2A 2YAHA 4K9EC 1H8OA 1EDHA 3MV8D 5LLIC 1AO7A 4B96A 1CGWA 2BRRL 4POYA 2YPLD 3LAFA 2B3IA 2N7AA 1FDLH 4RISL 4WO4A 3L7FA 3MJ7A 4LBEB 2WSKA 1CG9B 3FBKA 1QWUA 3KVQA 3MR9B 4JNXA 3QIUB 1IKNC 1FNSH 2DMKA 2NY5C 3Q8EA 5GSRA 4H26A 4U1KA 3VVWA 4FXGB 4Z8FL 3GZPA 3H9SA 2I60H 1VZHA 1DQDL 1WZMA 2F7QA 1MLBB 1R24A 2AQQA 4ZO7A 1YY8B 2Y24A 1JAEA 35C8H 3X1EA 4IIZA 2OSYA 1N2RA 4JBSA 2CDFB 5E6RB 4C56E 4HD9A 4I0PC 5D71H 3HS0C 1A6VL 1IO4C 2VR9A 4R2GD 1C8QA 3JTBA 1AKJA 2MFNA 3CAFA 4OD2A 3P9LA 3FTZA 3GD1C 2NYKA 4L4VA 2DZEA 4BFBD 3CLEL 1AY1L 2GSGA 3RFRA 4FFYA 3SPGA 4LDOB 3E8VA 1LEKB 5DD3H 1DANT 4JCLA 1KYOJ 4NKOB 2UWEE 3T09A 2Q3AA 2HPOA 1NCHA 1YNLL 1P7KA 2PWEA 2UXGA 3QRFM 1TYJA 4NS0A 1IQDB 4DZBA 1ZV9A 3JXAA 1YZZA 3QUYA 5AVZB 3HZVA 1OM9A 3ZZQA 3C8HA 4ACTA 3O2VL 1AXTL 3KGSA 4X80L 3LMJL 5D70L 4NUGH 3PWLB 2JK5A 3QC5X 2DWDA 2F53A 1MHEB 2P49B 1P4UA 1IL1A 1QBLH 3Q8FA 4OCLC 1H6FA 3AROA 4RGND 1B9ZA 3V7MA 5E4IA 1M7XA 3IKKA 4I8DA 4XO9A 4ZW6A 1J8HD 1IGML 4Q4IA 3IMBA 3D05A 3MDJA 3QFJA 4UTAA 5MHSE 1IC7L 2FJGA 2BM3A 3T0EA 3FYEB 1G5GA 4N0UA 4JHWL 1D5RA 3VWKD 1QZ1A 5ANHA 5B4MD 3CFJA 5DUJA 3IB4A 1HS6A 4KFMA 4OFYD 1UEYA 4Y9CA 3UYRH 4DPBX 1JD9A 2J1YA 3SDCC 2ZT9C 5JXAH 2PTTB 4LLAA 5HYJA 2MCPH 1QNIA 4JFFE 3AQDA 4AVKA 5DZNA 1NCDH 3UGEA 1M7IB 3VQ2C 2JCWA 3GBNH 4AK2A 1BOYA 2OI9B 3D12B 3KLHD 4ECNA 2BY0A 4IIQB 4WJKB 2GYSA 3HNSH 1Q72H 3Q7JA 2CJUL 5KVEE 3OR7A 5DQDL 2B1HH 4QRFA 4XMPL 3FO1A 3MGOB 2HFTA 3NZHH 4NZTL 4ZPVA 3V5KA 2AF2A 3QA3A 1BX2A 4PJFB 3RG1C 3HG1D 4NN6B 4K23H 4OF3A 4LLVA 1CXHA 2WLIB 2N1KA 1I75A 1JF1B 4N20A 1MCOH 4PRDB 1ET7A 1AOHA 4ZYKB 3FRPB 3DX4A 4UAHA 3U2IA 1T3FB 3M8OH 4MQ7A 3L1OL 1BZOA 4XMLH 3OKDA 3SPHA 3UYPA 4PTUB 4YHLH 1F6FB 4YHOL 4UZSA 5C71A 3HNVL 3QDGE 3TEZA 2MMXA 3TV3L 4NRXB 2KZWA 2IXQB 2UZPA 4HSCX 1NA8A 1DSFL 1TKWA 5EH1A 4ELKB 4NWTL 2AFNA 2TRHA 4KTYA 1I3GH 2AMUA 3PNRB 1SMAA 2A73A 1YRKA 4G3YL 1FF5A 4Y5XA 1GYWA 3P4NA 2YPKB 4FQLH 4P59L 1S4IA 5JPNC 3I9PA 1F3DJ 4MB1A 4ZMQA 1RUAL 1HSAB 4CSTA 4M7ZB 1S78C 4EI6A 1RZKC 4JKNA 3VXUD 4HS8L 3ZE1E 1GVIA 3E8UH 2J57A 4MQTB 4K7PL 4R8WH 1R5IA 2ZXWB 4N2NA 1RZ7L 5D9SB 3AB0C 2IAND 3MLVH 5JXEA 3C6SA 4P5TC 1S3KH 3KLQA 2WLHA 4ZS7L 1HH9A 3MJ9L 5AKVA 3VSTA 1E9OA 3SKJL 4FFZL 4GSDH 1UOLA 1VA9A 2CJSA 4NYLB 3DO3A 3TJEH 4HIPA 2J8UF 4R4BA 5AEAA 3C5ZC 5DJ0A 4N1EA 5E4OA 4JFZH 1BQKA 1XZWA 2AABH 4NKIL 2CJ3A 5HD8C 1GGCH 2ZX9A 4XP5H 4XOCA 4PJDE 2OPCA 3Q48A 2DWTA 3FFCB 1WBYA 4BKLA 5LXGH 1XF2B 4PRIA 4YNYA 3TF7C 1MCCA 5ECJE 1U42A 3DJZA 3VO0A 1TJMA 4DVRH 3QRGH 3QNZA 4GRWH 4BQBA 1RKRA 3VSQA 4H0GA 1C7TA 3ASWA 1JYWA 3KWUA 1PLBA 3G5ZB 4XVOA 1KJVA 5HJ3B 5I76A 4NAQA 3S36L 4OCMC 2APBA 3T6VA 1KF9B 1DEDA 1EQWA 2QLVB 3FCBA 4R97B 5GS1C 5BV7C 1MAKA 3S3JA 1CICD 3KHQA 5I1KH 3WIHA 4P2QD 3RL2B 1S3RA 2OMUA 5DRXA 5ETUB 3R0MA 4MAYD 3W2DL 4G6JH 4M3KB 2BNQA 2D9QB 5IJBC 1P5VA 2W81C 5IBLC 1T1YA 2ITEA 2OCJA 2H26B 2A6IA 4NUPA 3T2PA 3GYRA 1TEYA 3EDEA 1MAMH 4OVUA 2PO6A 1UT2A 2HG5A 4ODSH 5D7KD 4JQIH 3U48A 3VG9B 3RWFA 1VEMA 2FH6A 2ZXGA 5K1JA 4TXVB 4GBXA 5LNDA 4HEME 5I8KH 4LVEA 3RLSA 5EZLB 1P84J 2EVFA 4UZGA 1I8KB 4BWTA 4QD2E 3MRGB 2P5EB 5JW5B 3RA7L 1RSYA 1Q9OB 1GW6A 4OAWB 3CLFL 1P9MC 2ZOTA 5DFAA 4B95C 3T0XA 3QZMA 4OLUL 1BBDH 4M43H 1CFNB 3QUZC 5A6IA 3BP4B 1A64A 2BJMH 3CXHJ 2Y7QA 3HC4H 2G75A 1EERB 3RL1B 4ZAKC 1ZRUA 3TFBA 2R0ZL 1QUNA 4K73A 2XJLA 3ZTCC 3O2DA 2Y06L 3NPSB 3ZDZE 5I1HL 3S9DB 5AQ0A 4BRJA 3GPEA 4NQCA 3ZJAA 5KJ7E 1XIWC 4S10A 4AIOA 3DXAE 4UV7L 5C0CE 3IPEA 5T1KA 3JV6B 3QQ3A 3WMPA 4HHAA 2EH8H 2HFEB 4JG0H 3DSNB 3T6XA 1QASA 1LGVA 1I7RB 2YC1B 4R7XA 5DJYB 1NAMA 2XTLA 2VDQH 4FG0A 1NGZA 4MJJA 1NGPL 4NPKA 1FA4A 3C8KA 5JO5B 4HGMA 1EUUA 1RHHA 4J6RH 2ADFH 2ZNWA 3WNPA 4PWHA 2EVIA 3PFUA 4RDBA 1CT8A 3S4SB 4WDIB 3GJFA 4OZ4A 4F7EB 2NY1B 5KZCB 1MHPH 2DM2A 1A4JB 3D39E 3P2TA 5F89A 4QRUB 1X5HA 3RVVC 1E7VA 4F1SA 1KY6A 1HEZA 3P0YL 3TZVC 3U7AA 3BQUC 2G3ZA 2Z92A 1MCNA 4ACPA 2YD4A 5J7CC 2OYMA 2ZKYA 1SGKA 2Y6SD 5IB1A 1ORSB 1JWSA 5C07A 3AW5A 1REIA 1LLAA 5JIKA 4UM8B 1AANA 1LK2A 4LK4A 1VHPA 5DHYA 4QTHA 2A77H 2RIKA 3HEIB 3N50A 3AS2A 2FX8L 1E6OL 2JQMA 4IU3B 5HGBB 5I1CH 3VI3B 4QWWD 1H6UA 3ZYOA 3DSFH 1S8DB 3SQBA 4XI5D 3VG0H 5F7YC 5T3XL 3U9PL 5F7UA 5HYIA 3TCTA 4P23A 4IRSC 4P4KB 3WO3B 2QADB 2HTLD 2VLJD 4HIIB 3BUYA 5D7JA 4H8WC 4IRZH 2BVQA 1AIZA 5DTFB 4WI7A 2TSBA 3S48A 3CH1B 5T5FH 4D9LH 2UY7B 2ZE0A 3EYVB 5ERWA 4WTWA 3ZU8A 4C4KO 1XB8A 4I48A 3HBQA 2RA1A 4UT9H 1GS7A 2PPDA 4MJID 2F5AL 2R51A 5KSAD 4GAJH 4GUOA 1QFWL 3TA3D 5BZXA 1KJ2L 4QRAA 4ZNCD 5C0FA 2KQMA 3V4LA 1T0PB 1OGTA 4WAFA 4MJ5B 3TEUA 1Y0LB 3KBFA 2R39A 1ANUA 2FAUA 3BH8A 2DKMA 3OMZA 1L6XA 4GYBA 3TIEB 2X87A 3EUDA 4D0BB 1XSJA 1HL5A 4G5ZL 2YBRA 3VD1A 3A4DA 3I85A 3IETA 4AXWA 4FLSA 5DVMA 4KKPA 2P48B 4IOFD 1OQOA 5EU3B 4AM0B 2FR4B 4MCZA 1GIGL 4X6FB 3QWRD 4N86A 3IDIB 3IXTB 3ARPA 3D06A 5IHWA 5C0RL 3G6JE 3UTTA 3K71B 4FNLL 5AVVB 3IPBA 4RNRA 3ROOA 3O6FD 3W5NA 3BZEA 4HUMB 1ITCA 2XFGB 4JMNA 5I0ZA 1UFUA 1QSEA 2O5NA 1SVCP 5B8CB 2K7PA 1JZ8A 3ARFC 3FMGL 3L1EA 1DBKH 3ZTDC 4RDQG 1ID5I 5FOBB 25C8H 3UAAA 1J0JA 1TJGH 2ESVD 4JPQA 1FRGL 2C4FT 2FCBA 3BWUF 3TBTB 2XN0A 1IGIH 1TDQA 1F6LL 4QXGL 3B9EA 3CBJB 2IOIA 4P3DB 4JFHD 5I17A 3IFLH 1EJ8A 2J8UB 4K9JA 2F1BA 3NCMA 1P84K 2XT1B 3CFCL 3CFBA 1KZYA 4JRFA 2WVUA 3DUSB 4Q6IC 2CKBL 3DETC 2GSIB 4GG8B 5C08E 5ABDE 3QQDB 4YIQA 5D7EA 3CK0L 3UAJD 4HT1H 4Z7QF 4YAQA 1AAJA 1KPRA 3CBRA 4UILH 2VABB 3EBIA 3MCKB 5T3ZE 4LPYA 1KCSL 2ZPKL 1N4XH 1HSBA 1W72A 4YHZH 1R3HB 3DO4A 2PPAA 4APQC 1D7CA 4WFHD 3ZE2F 1WCBA 2JCCE 5SWZD 5M7QA 2F7OA 4M1GH 1W8EA 4F7CA 5KVDH 2NXZD 2SODB 3DPBB 3UDWC 5I1LA 4E5XG 4AQAA 1K5NB 4Z3JA 4HEPA 3VGAB 3VDBA 4O2EB 1BV8A 4QAWA 5IVXF 5LNEA 1JF6A 4M93B 4JO3H 4PGEB 2A1WH 3U82B 4XCYA 4AL8L 1SEQH 4V1DA 3H9HB 2R2BA 5IQ9B 5D93B 2VOTA 4UNVA 1KB5A 2F15A 4HCGA 3HIZA 3AM8A 4HSAC 2BNUA 4FQCH 4Z7WA 4OZGB 4QHPA 1IFRA 3CCHA 2A6JA 5I6MA 3CFUA 5DS8B 1FFPA 3G3LA 4M7LH 4O2CB 3E6FA 1NEZB 1BZEA 1QW9A 5L6YH 1BA9A 3DURB 5DO8A 3O3AB 3VFVA 4ZUSB 4R3SA 2HVJB 1DVXA 1FH5H 2AK4E 2R0LH 3BPCB 1QPKA 3VYNA 5BVJB 4KJQC 5BVPH 3FS9A 4EF3A 5JMRA 2JSFA 2W65A 1A1OA 2IADB 2Z0UA 1UJ3B 2AV7B 3KPPB 4L8DA 1BBJA 1OZUA 3HZYB 1V55B 1JXDA 3KBPA 4P2RB 3VXMA 2CCVA 1XF1A 4ETQA 4BFOA 1OHZA 2H3KA 4RWYH 3VFUA 5ABAA 2C3WA 1IKFH 1NAKH 2PNDA 5EBGA 4PV8B 5GGSB 3RZCC 4PJ8D 4CVWA 4X7SL 3MUGB 5JHDA 1TO4A 2C1PA 2ERJC 5TQ0L 3IDMA 3Q44A 5ITFA 4PJ5B 5JPMB 4IMLA 1IC4L 3QI9B 1RMFL 4LLWA 4CW1A 3VB8A 2NY0C 1MHHA 5TDNA 3GMQA 3LZNA 4A68A 3GMOA 4OZIE 4BELD 4KJYB 2MKWA 5HI5D 2OJZH 1GZQB 3BP6B 1KDIA 3QARA 5E0FA 3KW7A 4B5EA 4D8PA 4Q9CA 3QIBC 5I19L 1QW8A 2YRPA 4TSBH 2JIXA 4HXAL 4TSAL 4OFKA 3LH9A 1ZK5A 5CP3H 3OHXA 3LKOA 3MOAH 2VC2B 4XNQA 4YSAA 2WLLA 5AALA 3VFTA 1ET5A 3OGOE 5EF3A 2JLLA 4R7DB 3GF8A 3QP3A 3LPFA 5I30H 3POHA 3WAKA 2V5TA 2WP3T 4HUVB 1Q1JL 1MW3A 3V0FA 4PTTB 5CS7A 3KR3H 2YD7A 4ZOCA 3UG3A 1VSCA 5FM5M 1JRHL 4I4WB 4AC2A 3N55A 5D72H 1YECH 3HUJE 1A7NL 1AS7A 3JWOH 5F6HI 3QNXB 1NLDH 4JFEE 3OAYH 3NCCB 2VXVH 4KVNL 2GTQA 3RDTD 5IR1A 3PJSA 1NWOA 4OIIH 3NSYA 2HX9A 3SQRA 4N6RA 4IKLA 4NDMA 4MYPA 3EADA 3X11A 1M1SA 3WTUA 2ZAHA 1TQWA 5EMYA 4JM2B 3SPJA 3ECWA 1JVLA 1EZLA 3R06B 5K5YA 5C0IB 5HDQL 3QIUD 1SLUA 4DEWA 4TL5A 1LQSR 4XCCH 4LCCC 3TNNB 3FOLB 5I16A 1L7TL 2WIIB 2PCXA 4Z3FA 1Y6NR 1DVQA 4N9OB 1AYRA 1MDAA 4Z7VF 1TSRA 3GBLA 2QVMA 2B2XL 3WHXB 1O6TA 5F8RC 3M17A 2I07B 3PWVA 1UD5A 2Q2LA 3S37H 3VQMA 3GXPA 2NMSA 1J1OL 2B8OT 2VITA 3MRDA 4Z7UE 3RJDA 3P0GB 2LLGA 3INUH 2KZKA 2H41A 4LSSH 2F1EA 1I9EA 5FYLE 5IB3A 3O2WL 3B9KD 4DO5A 1U8PB 4MA8H 3FQXA 3U2JA 3KPSD 1MFUA 1MH5B 2D4FA 5BMFH 5JYMA 1XR9B 4XBPA 2J73A 1EK3A 2DW5A 2ZUWA 3LOWA 1ORQA 4FMKA 1MG3C 4G8EA 2IPKB 4B9KC 4HZAA 4JFXB 1G87A 4U1SA 3ZYZA 2ZCHL 3MJ6A 3BC9A 4HKJB 4LF3B 4MD4B 1L9MA 3SDDC 4E68A 3JWNG 4NZJA 3BO8A 4M56A 1ZANH 1J9CT 4XPGH 3EOTL 4IOSA 5CEZD 4A7SA 1ZVSA 4Q14A 2P8MB 1LWJA 3A23A 4XNZB 1AO7E 2G9HB 3DIFA 4DN3H 4YSPA 3VRIB 2VDNL 1SYVA 1ZHNB 1UWGL 3Q6FA 2WKOA 3AT8A 1F58H 4NKMA 4IGBB 3WNLA 1YNTF 5IJKC 3CSBA 3OR6A 1PG7W 4S1QH 3WY4A 1IVTA 2XZCL 3D9AL 3P4MB 5H37H 1HJCA 3HMWH 2V3EA 1SXSA 1PBYA 1U6AH 3LNFA 2GUOA 2AXHA 3A3YB 4OM0H 4FDWA 3L08A 4DFIA 1LD9B 1EXUA 1ODAA 4UQCA 3WDJA 1XH0A 4TVUA 4Z7QB 5EIVA 2UZIL 3L48A 3ZDYB 1FN4B 3T6WA 4F9LA 2EADA 4G9FA 3BYTA 1ZPLA 5AOIA 3MGAA 2DQGL 3G6DL 2KLTA 2X1QA 4QI3A 4AEIL 4MHHI 1QEWA 1EO8L 3ZE2B 2FZ3B 4F93B 1XBDA 1BQHB 4Y16D 5AUMA 4LCYA 1NCJA 4L4VE 5IROA 2IG2H 5CWSB 3MOBL 3PAVA 5GS2H 2VW4A 1MJJA 5HGHA 5HYSB 3LDBC 3NFPA 4PLNC 3IU4L 5IMKB 2WC7A 3DKHA 4N2HA 4WTZG 5DJ2A 5GISL 3KLHC 4DVBA 4DEUA 4MD5A 4BZ2H 2B59B 4HWUA 4NENB 2H0EA 2VAAA 4CC1A 2UZYB 4HXBL 1S7QA 2AVFA 1PG7X 5C1MB 4I87A 1HHKB 1WAAE 1OT2A 4JQIA 1UB6B 5IGXH 1JZ6A 1G7JA 4YXKL 4PJ7B 3IJ9A 4WSJA 4ZUVB 3MBEA 5IOPB 1RV6X 2DQUL 4LKXA 2Q7YA 5K9JH 2DTML 2ATAA 1MFNA 2DLIA 2OP4L 4OIFA 3KE0A 5K9QI 1DEEB 5F9AC 5C0GB 3QFJE 4KC3B 3UZQA 2Q20A 1CU4H 5CLZA 4N0CC 3H0TB 4UT6H 4IBZA 1BZ7B 3P9MB 3ULVC 4NC0B 3T0VA 2W0FA 2HLFC 5F3FA 3T0EE 2YD8A 4QAMB 43C9B 3UP6A 2FIKB 3Q8BA 4TTGA 1UJTA 4CADA 4JS7A 3IMSA 2O5YL 2E7MA 3LIZH 5HYJE 1TU2A 4FS0A 4JDZA 4JLRB 1JL8A 2EZ0D 1XCTB 5GGRB 3MHZA 4IMKC 1QTYT 2ZG1A 4X7EC 5ICZB 4PRNB 1UD4A 4PN6A 3V0VB 5C0EA 2NY2B 4L8CB 3CFMA 4EI5A 2K45A 4WI2A 4WU7A 4BH7B 4W9IC 5DRNB 4XC3H 1QUPA 4PPTA 1ADWA 4R4FL 2WTPA 4DO4A 4KTEL 3MRCB 3WFHB 1A1NB 3S3DB 4WV1A 3TBYB 2MOVA 5KOMC 3OLGA 5K9OA 3PQYA 3HPJB 3MMEA 4P5KA 2GJ6E 5T1LA 3FFCD 3T8VA 1KCVH 4KZEL 3UX9B 1LXMA 3W0WD 3HZMB 2K78A 4XNXL 5K69A 3HC3H 2NNFA 5E00A 3IDYC 5DFVD 1GR7A 4IKJA 1KT2B 5GRVL 2NR6A 5GZOA 3L2LA 4DAGH 5ELIA 2CAKA 4YX2L 3NIDE 4ONFH 4YSUA 4LNRA 3DHJA 3TVMB 2FE0A 1RIUH 2WBJC 4NUMA 4E9WA 4N0RA 1MRCL 1PZSA 4JPWH 4DN4L 1YQ2A 3N40P 2P8LA 1N3NB 1OSZB 1S46A 4RLDA 5H2BA 1U3HA 1AHMA 2KLSA 1YEEH 4IS6A 4ZX3A 4NHCH 1OQXA 2ZWSA 3Q8CA 4OKDA 5ESAA 5TE7H 3SCMA 1IAKB 2GCYA 4LSQL 1KLUA 4DW2L 4BDVA 3AY4A 3X3FH 3T3PF 5DVNA 5ILTL 3AXLB 4KMLB 4FQXC 3L4WA 3QZPA 4IRZA 3X13A 1CYGA 2FGZA 3P3SA 4XAKD 2ADYA 4EJ1C 1JN6A 4YDVB 2EKJA 3KXFE 3GEFA 5T5FA 5TH2B 5F7NC 4CKVX 1WG3A 5CBAA 1ZPUA 4ETYA 5HYEA 2DEWX 3HS9A 3WTYA 2AHIA 2WO4A 4UT9A 5A3ID 2XXCB 4WNQA 3T77B 4FXKC 5J11C 3T0BA 12E8L 1EFXB 3PWNA 4PJ6A 1YEWA 3QNYA 3IS1X 5GRXG 3CMOH 3LHPL 2YK1H 4NZRL 4NQXA 2JKRM 2DL9A 4U1JA 4B0MB 2VDPH 3GHBH 2YEZA 3ZQXA 3U46B 4WW2B 3P2DA 4FG2A 2V6HA 1A6ZA 4OB5H 5EU6A 1CN4A 5FA3A 3D3VA 4ZX6A 1V8HA 5D2NC 3I6GA 1UHVA 2GJPA 4K8RL 2BP3A 4G9DA 1ZHKA 2EEBA 1P7QB 2ARJQ 3QDJA 5IMOB 3MLTB 1KXTB 1LM8V 3LQAL 3BUTA 1WUNT 4GXUN 2JI2A 5CZKA 3ALWA 4X7DC 4R2GC 3IGUA 4CMMA 3WNOA 1KENH 4PP2B 2JKWA 2HAZA 5C97A 4YR6B 5F7LB 1IFHH 1C08B 2RMNA 2CWRA 3V4VB 2JJTA 2BW4A 5T1MB 4EDWH 3WI9A 2EDDA 4LKCA 2IO5A 3L9EA 5KZCD 4D3CL 4F37F 1TFHA 4ZXBB 1UACH 3MLYL 3R8QA 3K91A 1QSFA 1KCKA 4LP5A 3RPIA 3B2UD 4JO2L 4KPHL 1VFAB 4PJAA 5SX5K 4MWFB 4DP5X 1KIQA 2E3VA 4XGZB 3T0AA 2FSEB 1DBAL 5AOKA 1Q9KB 3EYFB 1KYAA 2P80D 1TETL 1L9TA 2BOBB 1LO0L 4RGNC 2BP8B 3TX4A 1VAHA 1X5FA 2OW7A 5GGTL 4JRXA 4KI5D 2OMYA 3L4ZA 2NX5B 4AT6B 4LGSB 5IB2B 2YKLL 4XMWA 5FFOA 4Y1AB 4DKDC 4OVVA 3BH4A 4NQCE 2IAMB 4Q7DA 5HHOE 1FNGA 2F6AA 4UQ3B 4G8GA 1MW1A 4QOKD 2Q8BH 4P4KD 4AG4H 4MD0B 5FO7A 1M7DB 4HF5H 4OD3L 5EC2B 3VWKC 2QVTA 4DP2X 4UMGA 3TYGL 5B4MC 3LKRB 4XP6L 3RGVA 4JM4H 1A21A 2YQGA 3QJHA 4ZMNA 4P9HC 3T4YB 5F1KC 2MQ0A 5JIDA 1P2CB 5B39B 1I8AA 4OW6A 5LAXB 1LEGA 2LV4A 3AT0A 4R5VA 4X9YA 2NY6B 1W8OA 2X7LA 2FH8A 1HIML 1OT1A 3GKZA 4G43A 3FQYA 3UTSD 3PWPA 4LL4A 4MYWB 4ODWA 5D1QA 1ZA6A 1A3QA 4S0TD 1VFBB 3TYFB 1C9SA 5B38G 5I18L 4FTVA 2VLKB 4HPOH 1EXGA 4HLZH 3IF1A 1T1ZA 1IM9B 2IOMA 4ZODA 4MCYB 2CE6A 4Q2ZA 3FN0H 1QLEB 5F7EL 1T0NA 4UQ2B 1FVEB 5I1AA 4S0SD 4X6CF 3UZEC 4HWNA 1B0IA 1OD7A 1HXKA 3IU3B 1T04A 4MLIA 4OJAA 3OVUB 4MNQD 4AI7A 2VDLL 1V10A 4P5MB 4UM9D 4WTZA 3OQ3B 1AQDA 1A4BA 1XXDC 1TT6A 4M4PA 1SYSA 3HMXH 3JSSA 2PWDA 4GSQA 3DRTB 5MENB 3KNBB 4EBQL 4NCDA 3D33A 4ZFOL 3KM1A 4Y88A 4LVHB 4FNPA 1XWVA 2K3HA 9PCYA 5CSZB 2V9RA 4M6OH 4FEMA 1J88A 1D6VL 3GLAA 2CR6A 4YDKL 4Z0XA 3MU3A 2EUZA 3H1ZA 3KYOA 1D5XB 1VERA 1FGNH 2F0CA 1J5OL 3P4OA 4ESKA 3MXWH 5F88A 4Y2DA 3QJUB 1N7MH 2AP2A 1LEIA 1ZSDA 2BXZA 5IB5A 5FYKE 5I66B 1CGVA 3RBGA 2AMGA 1NFDF 3N3EA 5ADOH 5CP3A 1ZEAH 4YSDA 4JM0A 5AKRA 1E3ZA 2XYBA 2WGXA 4IBSA 3ZHDA 1O9WA 5TQ2H 4QY8A 3Q2WA 3VJ6B 5LGYA 3MRJB 1UXWA 1Q4NX 9CGTA 3TONA 3TO4A 4OCRL 4BCZA 1CF1A 4U6HA 4JRLA 4PR5A 5AAMA 1HTYA 2JI1A 4U05A 4N3TA 1ZY9A 1YMME 1QZNA 5IP4A 5D1ZB 5CJQL 2PABA 1FBIL 1LO5A 3D09A 1FVDB 2XA8L 3FTGA 1V54B 1FNHA 1KV3A 1PZDA 4LOFA 5D7IA 3RJOA 1IEBB 2V9TA 1L3NA 1T7VA 4GRLB 3RYMA 2X4SA 3UTTE 4ZFFB 4QTIL 2EXTA 3IFPA 1B3JA 4Z78B 1RUPL 2WYHA 3V6FB 3VFNA 4AENB 1MG2C 4RSYA 1WEJH 5F1SA 4WWPA 4ZUUB 4AUYA 1NMCB 1H15A 3SDAD 2BIIA 2NY4B 4HUUA 3SDXA 3W81A 3BKJL 5AB9A 2Q3XA 5IMMB 1X4ZA 4EIUA 3WHE0 2VRQA 5H4YA 2JB5H 4JQXC 3FU8A 1CICC 1GSMA 1KN4H 2DICA 4PJ9A 5LCVH 5I24A 5KVEL 4L0ZA 2I24N 4GP8B 4MAYC 3WJLC 1BQ5A 5DQJA 1FYHB 1PPIA 5IJVA 4QJ5B 2HT4D 1QHPA 4QDGA 1WP6A 4TUOA 5CSGA 4H5SA 1BAFL 2V2TB 1YJDC 4MNGB 4PD4K 4NO3A 4FZ8H 3B3IA 4HOXA 1J7VR 5I8CB 5L0QB 2Z35B 5HJGA 4P2AA 3IGFA 3GGWB 5C0AB 3ROLA 4PJEF 4P2RD 4OCSL 1V7ML 1YA5A 5I23A 3PF2A 3WNNA 4BSVA 1JDDA 4G6MH 2V9QA 3BH9A 3CFEB 2BSTA 3TIDB 5CHNB 1NC4A 4F7MA 5LDSA 1T6VN 3QDMB 4LRIA 3CSYA 4XVUD 3VCLA 4DP1X 4LCIL 2DMCA 4MTMA 4QJ3B 4DGIL 1J1XL 3ARGC 4H20L 4NPJA 5I1JH 5IZ7A 1ED3A 1LWHA 4XXDA 2MCG1 3BIKB 3AS0A 1JMXA 1TCRB 3HR6A 4X5QA 2XWBA 3L45A 5E8PA 4I85A 1E40A 2B08A 1QLRB 3QORB 4L9LA 4ZD3L 1SY6L 2EIZB 3F00A 1JYXA 3L3GA 1G9NC 3U25A 4DPCX 3QUXA 2EDXA 5F70A 2E74C 4AVJA 4LCWE 4CVXA 2ZCZA 4KRPD 1QSZA 4Z77A 2WLNA 4LQFH 4Z76A 3MNVB 4X42A 4N2FA 3QULB 2PCYA 5CAYB 4LEEA 4M1DH 2MHAB 4ICWA 3DGCR 1S9YA 5C6PB 2BY1A 5CILL 5TTRA 3H7BB 1PLGL 4HCIA 1K8IB 2QKIB 3IWVA 1JXJA 3LEXB 5AZ2H 1T22B 1XTMA 4NBZB 2ZCKH 4EIBA 2YSSA 4MMXA 1RAMA 4L37B 4E41E 1FL3A 3CLWA 4OR1A 2BCMA 1E8ZA 3DBXB 4PJCA 4PCTA 4G7YH 5B7EA 3W9EB 2AAAA 3VXME 3EOAB 1BFOB 4XPBH 1E30A 5DRWB 2C3VB 1BXAA 1JG9A 4M7KH 3UO1H 3Q1SL 1H3XA 1AR1B 3SGEH 2KUTA 1CGSL 2Y6SC 1GY2A 2CGYA 4HS3A 4L1SA 4HLZG 4FFVD 5E8OA 1T83A 4WFED 1W80A 3GBMH 1DUZA 3GSNB 3RTQB 4I77L 3ZDXF 4KXBA 3SY0A 2BVEA 3HI1A 3UBXB 1XB3A 2Y2TA 1A14H 2VN3A 1U8KA 3BP7B 3B56A 4QWWC 2NXYB 4UIKH 3IJSA 5DJAA 2YFNA 2XQBL 4XI5C 3MACL 3PAYA 5E2VH 3V4UH 1L6ZA 5J6GB 1K72A 2HTLC 1QLFB 4PBWD 3BZDA 1X44A 1NSNH 5FGCB 1A2YB 5ALCH 3ZYJA 2BZDA 4AV4A 3MODH 3VU2A 4YDNA 4JRYE 2XWTA 3CSTA 4O2FB 1MEXH 4FKKA 4TRPL 2HFFB 5F97E 1GGTA 5DZ9A 2BOCA 2WXPA 5KSAC 1LHZA 5HGGS 3S8FB 2X9WA 4JO4H 2A38A 2Q1EA 1YC7A 3WEMA 1JWUB 4PVBA 2LHAA 4H7VA 4HWEL 4ODHL 2GHWB 5C2BH 1RK1A 4UT7H 1MQ8A 1Q94B 3O11B 2XXFA 2KZBA 5I6NA 3SKNA 2EDKA 1ZGLB 4UT6A 4JPKL 3J7HA 3QHTC 2VDML 4J8QA 4XPTH 3QUML 2HXAA 3BSGA 4IOFC 4QHKJ 3BWAB 3VX0A 1BVLB 3RUGE 2FGWH 4J8RB 1G7PB 1C1EL 2QGDA 2DN7A 3U4EA 5BUGA 3LIZA 4NNXA 3ARBB 4PIRF 3ZGIA 1U95A 5EBLA 3NEXA 3LZQA 4JQVC 3AU1A 4L1HA 1QQDB 1A4CA 2CDGB 4TUUA 1S7RA 1R3KB 3NA4A 4DK5A 2Q87A 4XPHH 2BHYA 4IGBD 4A1RA 4BUQA 4BIKA 1UXSB 5DD5H 2ATKB 4KBPA 3P77A 4U3CA 5DWUL 2AJ3A 1JMZA 2BMKA 2EDMA 2X09A 3K1DA 2RBLA 1G6RB 4UAOB 2WXIA 1MVYA 3KCWA 1MJ7H 4GKZA 1T6BX 1RZGA 1TSHA 3D0AA 1BZ8A 3FU5A 5DEGA 3IDXH 6FABL 3FKUS 1TEFA 3J2PA 1U8HA 4TVPD 3V4PB 1A7OH 1PCSA 4X5WB 4YFLI 1KEML 1O75A 3ABLB 4PRPD 3BVVA 3UABA 2X05A 2BSSA 4XH2B 5DU7A 4AY0A 4MZ2A 2RB8A 3UAJC 3FT0A 4NQVA 2ZSWB 2G2RB 4PGZA 2VKXA 1U8QA 2WNWA 4GUPB 8FABA 2CBPA 4WLCA 3ARQA 1HCYA 1RZPA 5K39A 3Q1EA 4HJTA 4PS3A 3VW3L 1S7VB 3MV7A 1GGIL 3OL2A 5JW4R 1L7IH 1KYFA 3D7PA 1HQRA 2PYEE 5LGJA 3S5LG 1JGVL 3BN9D 1U58B 2L4OA 2NXZC 2FJFA 1DVTA 5EZIL 4BA0A 4PI2A 3U2SB 2DD8L 4P46B 4H1LG 4U1HB 3LKPB 3WXVH 2BSRB 4HZ1A 3EJSA 5A2CA 4JUTA 1F3JB 3ZK0A 5EIIG 3BW9A 3UYOD 5MEPA 5J0BA 5FYJH 3WFEH 4GI6A 4AKQA 1Z0MA 3I3DA 3ATAA 2Y2WA 5LHDA 4L3CB 3KAAA 4BJLA 2BERA 2VISA 4F57L 1JVKA 2XKSA 4X0KA 3DOSA 3MUUA 3FO9B 4BD4A 4PYHA 3ATFA 2QZQA 3O6MH 5TGBB 2WVTA 3I9AA 4P57A 3UMNA 3F7VA 1BPVA 3G9VA 3NIGF 3NSFA 2BVTA 2FWUA 3V8OA 2MPAH 1OW0C 3VXQA 2W07A 4R0LA 1M42A 3NFNB 4G9FE 4DKTA 4R6UA 3QO0B 1OAXL 4KI5F 1ONQA 3GZOA 1K2DB 4GRWE 4D0DB 2X4QB 3EYQD 2OXHB 5ALBH 5SV3A 1TQBC 4YC2C 2ZUVA 4GAYA 4A6YL 3MQIA 1C5DB 1CE1H 3EDKA 4NRYB 4X0NA 5F0PB 3TOPA 2ALWA 4G80B 3OKEB 4PJ8C 1ZLVH 5ID1A 1RZ8B 4LSPL 4HH9A 3CXDL 3ME0A 1NJ9A 4U0RC 3C2AL 5CN1A 4L8SC 1V3LA 2R69L 4AQ1B 2R56L 1L3WA 5E4EB 3RFZC 4AVHA 3RVTD 1COBA 2VW7A 1VENA 3K74B 5IB4B 3LZRA 4OZHB 1UQSB 4U1NA 4WFFD 2WZPA 4A38A 1I9RH 3VFWB 2D2OA 5HI5C 2OS7A 4NO5B 1S9KC 1E4XL 1IAOA 1YEDA 3PV7A 3BZ4B 5CNHA 2VWEC 5FUCE 4B53A 4YUEL 1F2QA 1TENA 1CGYA 5DJXA 4CSZA 4DQOH 4HX1B 1KCBA 2NUPA 2ZTBA 5C9KA 1X7SA 3NP3A 2FX9H 4N28A 4QYOB 5HPMA 2XC8A 3AG4B 4L4TE 1AZCA 5DEFB 3TVMD 1L0XA 3NCBB 5TF0A 4PJXB 4K3EH 3ULVE 4GFXA 4H4NA 4B3VA 5DEJA 3RIAK 4KKNA 3FF8A 1WISA 3WMQA 2GC7C 4LLDA 4MMZA 1R3LB 2VXQL 2IQAB 4PJBF 1OSYA 5HDBB 4Z7AA 1S5IH 2IH3A 5I5MA 4QRPE 2C3HA 4XN8A 5FV1L 4F2MA 1ZAGA 3BT2L 4S1SH 4FJYA 2CM6A 4OCWL 1IEAB 4F9PC 4ANWA 1XF4A 2UX7A 4WIQA 2BW5A 3CUPA 3PP4L 1AQKH 1N19A 3LQZB 1HINL 5A43C 2DBLH 1LO2H 4RFEB 3RDTC 3RI5F 3SPVA 3IBOA 1IGYB 3VH8B 1MDTA 3GUTB 3HE6B 1VEPA 1MFEL 4JHAL 4ZUTB 1M6OA 4B9ZA 1USZA 2VLLB 4PW4A 3UTPE 1FO0L 3PQYE 4MDRA 5J1AB 2PP8A 3MR9A 5ESQB 1BECA 1XXFC 3OSVA 3SE9H 1LE5B 2EDLA 4JG5A 4PU2A 3BN3B 3ESNA 3U4KA 1CD1B 1H3GA 1RIHH 1IMHC 3T3ME 3FONA 5D1XA 1WZKA 3OKMA 1T2QL 1Z1WA 3KG5A 3PDOA 1FH2A 1HWHB 3ILQD 3U0WH 1BZ9B 4X98B 2CDFA 5KS9F 5EPMB 4L3EB 1EHXA 4QGTA 1NL0L 4KQ4L 4UQDA 4ZNEE 2H8PB 5GS1A 5F7FA 3B9KC 1G0XA 5JA9A 3SJVE 3FH8A 2A74C 1VGKB 1G1KA 1NFIB 2F54A 2O5XL 3MLWH 3O8XB 3UJJH 4HULB 2P28B 2VLRB 1NOAA 3HMXA 4JG1L 5F9WB 5DMIH 4NKOA 4GQPH 2OAAA 3ARRA 3L5IA 3VFGH 1YN6B 5KVGH 5CCGE 1HZKA 1TQTA 3OSKA 4IHBA 4QHMB 3P2BA 2HLEB 3NT0A 4W9HC 4Y19D 1XMWA 3HCVB 3JV4B 2VC2H 3CBKB 3KLSA 3D85B 3NCXA 3RVWD 3UEQA 4GFTB 2KH2B 1YEFL 3L95B 3M46A 2YPLE 3UJTL 3PWLA 2ICWJ 5DD0H 2CRIA 2NY7L 2OMNA 2GC4C 2QLYA 5EO0A 1UENA 2ZWNA 3REVA 3IDJB 4EOWL 4LARH 8CGTA 3HTLX 2EUXA 1WFOA 1WH0A 4U1GC 2FB4L 2APXA 1TQVA 5BW7A 2Y7NA 2VLME 2NX5D 2W9LA 1TTBA 2QPEB 4NNPL 3RWJB 4F27A 2E6JA 4ODBD 5LBGA 3CSPA 3S5ZA 3HG5A 1YPZF 3D3VE 3EFDH 4YGVA 1XIWA 3TXAA 5T5NF 2YGPA 4Z8FH 1GYUA 1S5HB 3D25A 3PJLA 2J7LA 5CJXC 2X88A 4AKOA 2PTTA 1RH8A 2N01B 5ESVB 4ONGH 1GZHA 5CR1A 1IJ9A 3ZIMA 1DP0A 5JOPE 4HJGA 4Y16C 3UJIL 1HHJA 2OMBA 3DI3B 2OTWB 5D5MB 4M61A 4IKKA 4MQXD 1IBYA 4Z6AT 2B5IB 4IIQC 3MRRB 3RJQB 4GNKB 5KG9B 5FCUH 1I9JL 3SQOL 5CD5D 3TN0B 4F1ZA 5LCVA 3JTSA 3L3DB 5AZUA 2VLKD 1KGYE 1AGFB 4WUKH 4EZKA 4PJFA 5FGBA 1TF4A 5L4MA 1QFOA 1GYCA 3EYOA 1HHGB 1JF1A 2MH4A 3K7UA 4OD1H 5E8EB 5EBMB 4WSGA 1T3FA 1EEUA 3VD0A 4PTUA 1RFDL 4FYSA 4O9HH 1BF5A 3NIGB 3NCWA 1EBPA 3PYCA 5IHUL 2FWSA 5LG6A 1WA1X 5FYLL 4B9FA 5I73B 3DO7A 2N7BA 4NRXA 2CXKA 4ZFZB 3OWRA 4Y2OB 4P2OD 4IDJH 2QSTA 3HBZA 2MTPA 3O0RL 1G84A 3MYZA 1XF5A 3DLQR 4H1LA 4BHUA 3NN8B 1N0LB 3L16A 5MEND 4L3AA 5DT1L 2ZKMX 4ES9A 1K9TA 3GTVA 4G8GE 3T4AB 2YPKA 4NQEB 2ARJB 3FW6A 4K8RD 1T4WA 3PUCA 3NQKA 2I5YH 3V6BR 4K9EL 4M7ZC 4PJIB 1N6QL 1CXIA 5JDSB 1D7BA 4B7IA 3DROB 2EZ0C 3U0PB 4HWBH 1JFQH 2W94A 5D55A 1TTCA 3CZGA 2CK0H 2I32A 1CXFA 1PD0A 2GABA 1VFUA 3CFIC 1G7IA 3VXTB 4BCYA 1M56B 5D1QE 4TNFA 1FZOA 4EN3B 2NY5L 1W0VB 5FF6B 3L3IA 2QSQA 3AXIA 3N2JA 3HG1E 4LHQB 4PW9A 1CDGA 1DL7H 3PAUA 2YOCA 3FXIC 4KNTA 4ZOEA 3TBVB 1JZ3A 1XF2A 2BS71 5D1ZD 4TLSA 3OAWA 4KNUA 5DA0B 1NMBL 5KSBA 4LSRH 2MOGA 1NCCL 3LS4L 2VM4A 4GRLD 5DFVC 1F8TL 5KSVA 4HC1L 4P9ML 3ISRA 4PJHB 5HHVH 4UANA 3G5ZA 2CLZB 4FF9A 3ZZLA 3O41B 3OJMB 3SGKA 3VXOB 5B3NA 1X9QA 4H44C 2J21A 5A16B 3WIAA 1HWGB 4M5TA 1CYWA 1F11B 1RJYA 3QS2A 1C5BL 4NUQA 3ABMB 5KYYB 3LZLA 4AYMC 5E6ZA 4R97C 5DRZA 3OF6A 1NGYA 4EUPG 3F6LA 5E03A 3RL2A 1MNUL 5J4MA 4HAGA 5DJZB 2PW1B 4AJYV 2YD5A 2XQ0A 5C9JA 1BD2B 1BF8A 1A5FH 4WWKA 1B2WL 4UTBL 1DJSA 1X3DA 4CJ0A 3QEQA 2IANE 2RAMA 2E4TA 4K7FB 5ACMA 1L9SA 4XO5A 3ZMNA 3PAZA 4AYID 1OWRM 4OLYL 1KELH 4HIXH 3VG9C 1ZT7A 3ZXAC 3V0DA 1I8KA 5DHVB 1IUZA 3QR0A 5AKSA 1HI6B 5DJ8A 3SE4A 3MRGA 2Z0BA 2P5EA 5AAWA 5JW5A 3LNGA 2X0VA 5GRUH 4Q9RL 2LLNA 3EYUH 3SE8H 4OAWA 2OMTA 1WIOA 4LO9A 5A3IC 1T7YA 1LO3L 2C7FA 1X5YA 4J5VA 4MAUH 4RFOH 3HHMA 4KOCA 3G5XB 1E3FA 3V10A 4DKEH 1GJUA 3DK0A 2C9QA 3L5XL 3C60B 3GSOA 5IEKA 3MCG1 3QDMD 2Z8SA 3PWJB 3V0HA 1Z6JT 3HE7B 4GAGL 4IBTA 2VTFA 5F3HB 1S9XA 4OI7A 4ZRGA 1YSOA 2NZ1A 3J8F7 1WDAA 4C56D 5CEXA 1I1FA 3FO2B 3NPSC 1JGLH 1MWAH 4HS6B 4NJ9L 4ONHA 2PXYC 1JFHA 3TCLB 5AYQA 1ROWA 3QW9A 3S88H 3JV6A 4CN4A 3QORD 1BHGA 2HFEA 5EZOH 5FHAL 5DUMH 1P0SE 2OZ4L 1BEXA 2JQAA 4NXSA 4K7PX 4U1MB 5IQMA 1I7RA 1YEKL 3BPLB 3STLA 4F8TA 5I75B 3I9GH 2ENQA 3QE5A 4P2QE 2YWYA 5L4FA 5JO5A 2B9AA 1PNDA 2XWRA 3QQ4A 4KTGA 3NCFB 4QCIB 1QBBA 3LZFL 4ZW7A 4ZQTA 3S4SA 2KMWA 4WDIA 5I8EB 1GW0A 1VPOL 1FJ1A 4F7EA 1DJYA 3PV6B 3L54A 3DV6A 1AHWB 1BW8A 2E27H 1KBWA 3N1FC 5L88L 1KCUL 4QRUA 5LBSL 5EORL 1FC1A 4WO4B 1N0XH 2CK2A 2ED9A 4QF1B 1YDPB 3B2UC 1I8LC 2IQ9H 3BEWA 3KL3A 3OC5A 3HHSB 4YXHL 2Q3ZA 4H26B 2K4AA 4U1KB 3H9SB 4Z95L 1HHIA 3DX8B 3RZCA 2J8HA 4ZTPH 4YDLB 3FQUB 3OGCA 1CTMA 1R24B 4FXTA 4UM8A 5HDOA 3K2UH 3U7YL 3VDAA 3S35X 1OT4A 4OCXL 1J0IA 3S36X 2E7BA 5DD6B 5E2JA 4QXVA 2D7MA 2R4RH 1XCQA 3MXVL 3EG9B 4IU3A 2XV3A 4KI5C 4PS8A 3VI3A 5J8OA 1RZKL 1S8DA 2NDGA 3RQ3A 2NXYD 5EUKB 1AE6H 2MQGA 1EEZB 2VCOA 2AEQL 2X4NB 2XX1A 3P9LB 1LK3L 4JFFD 4P4KC 4HIIA 2FWOB 4TUKH 5KJRH 2V7HA 1BJMA 3ZHNA 3US9A 5DTFA 1WUZA 2LTQB 2HX7A 2WQSA 4RMRA 2J8OA 2XWEA 1P7KB 4B27A 1LDPH 4WFGE 4YHIA 4Y5VA 2FECI 1FLRH 5EN3A 5JW4Q 1WC7B 5C0BB 4E0RA 3K3QA 3HZ3A 5I71B 2ILLA 1V27A 3BDYH 3QJZA 4MJ5A 1Y0LA 2VR5A 2DWDB 1NTDA 2F53B 3LQMA 5JOFA 4ZSOA 2WBKA 5KBMA 1A02N 2QV2A 1MXDA 4PJCE 3TIEA 3HRPA 5D7LA 5JQ6H 1CI3M 1VADB 1DZ0A 4D0BA 1MKFA 2XWJA 2VXSH 3TV8A 4D0CB 4U33A 4ZMPA 1G0YR 3QDGD 4PP1D 4AYGA 3K6NA 5EU3A 3Q01A 3UP1A 3JT0A 2DQTH 4XVSH 1CXLA 5JA8B 3IDIA 4HPYH 1UXLA 1JHKL 2OCCB 3ESPA 5A2FA 5BV7L 2FJGB 2FD6L 3BI9X 2DBJA 3ARBD 4N0UB 1NMAH 3NPZB 5EA0L 5IREA 1UADC 3V4VH 3CFJB 4PG2C 3C5SB 5B8CA 2IV9A 2JNZA 2WYIA 3A67H 3KVDD 3RWEB 1AZUA 3I2CL 4NIKB 5J56B 5FOBA 2IBBA 3EBAA 2X5PA 1TXKA 1X9RA 3OD3A 4G1EB 3TT1H 5DMGD 3TBTA 4OSUL 2G60L 1E5CA 5JHLL 5D2LB 4KRLB 1DSWA 3FCSA 2J8UA 3ATEA 5AVRB 2H1PH 3M1OA 1C12B 2WLKA 3X3GL 3FO1B 4BE5A 1IGFH 2WSPA 2Y4SA 3IXAA 4DCQA 3QA3B 4X5XA 2ZUYA 4CGTA 2AXWA 1RPKA 3GMLB 4GG8A 4LLVB 4BM7A 3QQDA 1CVRA 4ZS6D 1RUQL 5DLMH 3U4AA 5B1AB 3W5MA 4H88H 4A2FA 4MQ7B 4XNUH 5B3JE 1MCLA 5J13B 2WWOA 3KPMB 2YGOA 3RVXD 5F1OB 5E94A 2HFGL 5I1EH 1AHKA 1D9KB 3GMMA 1KYUA 2WCSA 4M02A 3BVTA 3NRFA 5AWNL 3THMH 2VZSA 2X6CA 2DIAA 3SDDA 1K5NA 3BKYL 4Y5XB 5KUKA 2YAOA 4O2EA 1OLLA 3VGAC 1SJVA 3R1GH 4M93C 2IDCA 3QXWA 2DRUA 2VIRA 3SDAC 4XPFH 4EI6B 1RSFA 5D93C 4PRHB 3O3BB 2LVEA 3LNDA 1XX9C 2B77A 2W60B 1E6JH 5LGKA 5IJKA 4QIRA 2JTDA 3BFWA 2ESVE 4RETB 2EDTA 3OMNB 4ELMF 4AMKH 1QX1A 5EUOB 3LH2L 4RVBA 1HH9B 1NEZA 1RVFL 3RY6C 4WEBH 1E9OB 4BFFA 5SWSA 4QEGA 1QLEH 4ZUSA 1FFOA 2HVJA 1OCWL 4JFHE 4NNYA 2GJRA 2HT4C 3ESUF 3BPCA 3OKNB 5ADPH 5JTWA 5DJ0B 2H2SD 5E5LA 5A40E 3N91A 1YNKH 1SOXA 1NC2D 4BQCA 2IADA 3RIKA 4PGJA 1UJ3C 4F58H 4PV9B 3IPFA 5M95B 4URTB 2NYYD 2PWHA 1X5AA 1WBYB 3N42B 3ETSA 1UZ6F 3PY9A 3UBFA 3UC2A 2R0WL 4PRIB 4Z0BH 2XZAH 4NFBA 1X5XA 2YLKA 4GW4A 1PY0A 1ECZA 3LEYH 3QDHA 2X2UA 1EHLH 4RMSA 2BH0A 3MUGA 4B6ZA 1AGCA 4AQ8C 4HG4K 4NJAH 3MV7E 3DHPA 4D94A 2GSMB 4PJ5A 4Y7MA 5AW8B 5SWZE 3QI9A 5JPMA 1KJVB 4HIEB 2EECA 1OPGH 5C0CD 4NFCA 3V9CA 3GTTA 4H8WL 5FKPB 1K6QH 3D2UA 4KY2A 5I76B 1RI8A 1KXQA 3D4YA 3DA0A 4QHKI 4ES8A 2AERT 2IMMA 2M8XA 5FEBA 4HUXA 3BP6A 5HDWA 3D50A 3A6BH 2Q5BA 2YD2A 1TZ8A 2OMUB 4ICXA 1JV2B 4U4BA 2X12A 4MS6A 4WTXA 2XQYG 2BNQB 5FYKL 1P5VB 1EVUA 2A6IB 1NCAL 2FX7H 4KRPC 3N06B 2PO6B 2B20A 2HG5B 3EJYD 2QVFB 1I7UA 3B83A 4PS4L 3ZDWA 4UF7C 3MFFA 1HE8A 1G7LA 4A2GA 3VI4F 4WUUA 3NTCH 4KK9D 2CJTA 2Y5QA 2DS4A 2EC9U 4KRMB 4PTTA 5I6PA 5IY5B 5I0DA 3F85A 2HCZX 5SWQA 2ZP0T 1E9QA 2YPVL 3IDNB 1MIEH 4E9LA 2O6CA 2PKDA 3NDZE 3FB7A 3MRQA 5IVZB 5EBWA 1AZNA 2G75B 1RZIB 3S8GB 5FS5A 5BUPA 5HVFB 3I6SA 3KJ6L 4NM4L 1QUNB 3B5TA 5DK0B 4POUB 4YHKL 1S7WA 1YUKB 3DVGB 3CZUB 2ZOKB 5GS0H 5E2TH 3T71A 4FFVC 5EOQH 5L9DL 5EV7A 5CU9A 4AMWA 3QQ3B 4R96A 1ZTXL 4HHAB 5BNXD 3CFDB 2EDOA 4JM2A 3SBWC 1IBBA 1M7UA 4JREC 4I13B 3HI5L 1EJ6A 1NAMB 4Y4HD 5C0IA 1NGZB 3MN8A 3SYCA 2YD6A 3C8KB 4K5OA 1RZJC 4M6NH 4O58L 3KWVA 2DQHH 2OK0L 1EMTH 4AL8C 2WIIA 3GJFB 4FZEL 2VDNB 3ILDA 4FG6D 4OZ4B 2OTPA 4EPSA 4KROB 1NGQL 5GJTL 4NCC2 3M6DA 1EH9A 3QRBA 1RJZB 4ALAH 1CZ8L 4GSRA 1UC6A 4BCXA 4XE0A 3QQ9D 4NLAA 3C08L 3NSXA 5FGSA 4NN7C 4XN9A 4Y4KD 2XVKA 4S1DD 1BWWA 2QHRH 3MLUH 3VYPA 2Z92B 2EEAA 3M45A 3MLXH 5HP5A 3O8XD 1XR9A 3MBXL 3MLPA 2OTUA 2VLRD 3SYQA 5IB1B 5C07B 1JDCA 4F2ME 2CA4A 2DPKA 3B37A 4HUNB 3TESA 1OAYL 1LK2B 2FIRT 2FDBP 4DTGH 4QTHB 5F9OL 3VGBA 5LNGA 1ES0A 1SJMA 2QBWA 4OT1H 1MW2A 3U1SH 3T5WA 5JW4N 1H6TA 4W9GC 4HKJA 4MD4A 3DX9A 1EPFA 3BSZH 4JKMA 5FFLA 5GZND 2NCEA 1PQZB 2A9NL 4DUWA 1JS4A 1NEPA 1YEIL 1HESA 2G9HA 4LVOC 4XNZC 2HWZH 2L04A 4HWBA 2AJVH 3VRIA 5C0ND 4G6AD 2WK2A 2O5ZL 4IGBC 2CUHA 5CEYA 1QWNA 4M6AA 2HKFL 3H3PH 3P4MA 1FNSL 2D8KA 5M94B 4PIBA 5E7BA 4UTCA 2EICA 1HHHA 1UZ8B 1TPXB 1XDTT 2HRLA 1IBGH 4LPUA 1UUSA 5C08D 1IE4A 2W59A 1FN4A 2HUEA 3VXRB 2JKJA 1AI1H 5T3ZD 1CK0L 1OEZW 1ZXKA 2Q7NA 1HOCB 3WFBH 1E5YA 1ACCA 1NIBA 2FZ3A 1K8DA 1I3RB 2N56A 4MCZB 5CWSA 1O9ZA 1SOQA 5LN8A 5AW5B 1GKOA 4EQ2A 4XNMB 5HYSA 3ROOB 5DD3L 3GRBA 2GJZB 3EF7A 4LHUA 2H6PA 4RGOH 1YYLH 5IVXA 2H4EA 1CB4A 3BZEB 5A7BA 4CJ1A 2UWEF 2DYPD 1QSEB 1F4YL 4M9OA 3BN9C 3E0GA 4NENA 2DF3A 2VE6B 2FLBT 1LNUA 2XICA 4XVJH 5CEZE 2IIJA 4BZ1L 1HHKA 4XB3A 3MUZ1 1OCCB 1KCLA 3ZUNC 3E2HB 1E5UI 1MF2H 2GUYA 2XACC 4ELMB 3GTNA 3MRNA 1BXUA 1JPST 4PB9L 2UY6B 2XY1A 3JV0A 1UB6A 3WDHA 2BSEA 1BGXL 3R4DA 4PJ7A 1NEUA 1XCWA 2O61A 1U8MB 2EE6A 5I17B 2W5PA 1OAZH 2AK4D 4ZUVA 5IOPA 3BGFB 3CFBB 3IE9A 1YQVH 2XN2A 1N10A 1MCQA 2F8IA 5E8DH 1DEEA 5C0GA 2HPTA 4DP4X 3GI8H 3OZ9H 3H0TA 2Z93B 3P9MA 2I27N 3SZKC 1KPRB 3GXTA 4TUJB 4YSTA 3WUZA 3KWWA 4NQED 5CSBA 3HN3A 3DUUA 1INEH 3KVPA 3N1PC 1S9WA 3ESOA 2J4WH 3T6QC 1NCWL 4RA0C 4HV8B 4N8PA 1YYMH 3MV9B 1OP4A 3EJJX 1T80A 2XZQH 4YSEA 3WLBA 1MWAA 4AZ8A 1WCBB 2O72A 1BJ8A 2Z7YA 2AJXL 5SV4A 4DEPC 3EYQC 5AYUH 4AQAB 2ORBH 2R29H 4JY5L 3VXPB 2R9HD 4L8CA 3CZEA 1CLZH 3OXSB 4EN3D 5IMLB 2XWCA 1Q72L 5DRNA 5KYNA 4XCYB 2WKLA 3DARA 4V1DB 1WFIA 4Z3IA 5L2JA 2R2BB 1D5BB 1ETB1 2VDOL 4PJFE 1A1NA 1KB5B 3RVTC 3TBYA 2BNUB 1H9VA 4Z7WB 4JFVA 3CCHB 2A6JB 4HZLA 1FFPB 4QYAA 2DQIH 3I84A 3E6FB 2DDQH 3VWJD 2DIJA 4X83A 4E2OA 2ICWI 2AQRA 3VFVB 2D3JA 4R3SB 3FOMA 5I5JA 2B1OA 3AVEA 3TBCA 3IGAB 4XHJD 4GO9A 4IBYA 4XOAA 2YA0A 4I5BA 4JFOA 5AW9B 1ZLWK 5TE6H 3TVMC 4W4OC 1FFTB 1BBJB 2OL3L 3OXRA 4XB8A 4J4PD 4J3OD 4K55A 4GKLA 5TK2A 4GKOA 2YHGA 1F4XH 1N3NA 1OSZA 4KJPD 2XQYA 1O6SA 3DX6B 3U7WL 2WXQA 3CHPA 3VFUB 3UBGA 3UPAA 1X4YA 4KFZC 3V0JA 1JZ7A 3GIZH 4Z7OB 4WY7L 2JJSC 5JHDB 1IM3B 2C1PB 3DRQA 1I9IH 2ZJSH 3IDMB 2JKXA 4IMLB 1HCFX 1WVZA 3E8UL 1X6NA 2GBUA 4CW1B 2X1WL 3ZE1F 4CGUB 1PX8A 4DK6A 3AXLA 1G43A 3GMQB 4OUUA 3MLVL 5T33L 3E80A 5A2IH 2IWGA 3GMOB 4YDVA 5KW9H 3CFQA 3O6LH 1E4HA 4I2XB 1DBJH 5F7BA 5IG7B 5D1ZI 2ZX8A 1F4HA 4N8VG 4FP8L 1MRFH 1N9PA 2YBGA 3BVXA 5C3LD 4OBRA 2ZCLL 3T77A 3D87B 2HKHH 3OHXB 2AQNA 1EFXA 1PW3A 3ILPA 4Z7VA 5JHBA 2VXUH 1BVNP 4XNBA 1NUFA 3FFCE 4YHYB 4XBGA 2HH0L 1EX0A 3QJFA 4PJDF 3ZMRA 1QSVA 1OGAB 3HE7D 3KBHE 4L1DA 5C92A 4WW2A 1NBVL 3RVUD 5KVFH 1JGEA 1XT5A 4DVRL 2OCFD 2WV3A 2DLTA 1D5MA 5I8OL 1ILSA 1DQMH 5C7XL 3ILQC 1P7QA 3NUKA 1A6WH 3MLTA 1KXTA 3D18A 3GSRA 1A6TB 2JB6B 1U33A 5FO9B 3HLKA 2P5PA 1IGCH 5CJBA 3DX2A 4FLQA 4MJ4A 3EBHA 2C9VA 1A6AB 4YR6A 5HY9B 3FCGA 1UM4H 3BUDA 4A7TA 1JZ4A 4F91B 1B6UA 3V4VA 1AFVH 1KXVA 4QRBA 1VCAA 5IESH 5T1MA 2AJUL 2DIEA 3AQYA 4GQQA 3NIFB 3CG8A 1IILE 2A99A 4N6RB 1XH3A 2FBJL 4NDMB 1AO7D 1NCOA 2XG5B 3O45B 2BRRH 3SO3C 3X11B 5IKCA 4JGUA 4XAKE 4ODSL 4QRQB 5FIEA 1Y07A 1E50A 4ZXBA 1ZHLA 2EXYD 3CX5K 2OQJB 5IJCC 4WO4D 1BEYL 4RISH 4CNIA 1JNLL 1QP1A 1OE1A 1KBKA 2P5EE 1EUTA 1OK0A 1W15A 2HVBA 4XMUA 3APDA 1PG7L 3RVWC 3ULUD 4XGZA 2N1TE 3HBGA 5I16B 3FTXA 4MFHA 2IEPA 1N8OE 3H9SD 4J23A 4R7VA 2L0DA 4RMWA 1VB9A 1J0ZA 1DQDH 2BOBA 3ULVL 1QHQA 1WAPA 5I74C 3HPLB 3AZUA 1AH1A 4GIPD 1AJ7H 1BBDL 3D4GA 1Z3GL 3PWVB 4LSTL 2VZVA 2VITB 3FRUA 4EN2A 3MRDB 5CN2A 3ARGA 5IB3B 3MRMB 1RK7A 4LAQL 3FSZA 4Y1AA 1A6VH 2K0RA 1A4AA 2VDLB 3EIFA 2V2XB 1U8LB 3GHEL 1IC5L 2HUHA 2IAMA 4PGDB 1AKJD 3FQXB 4UQ3A 2QELA 6CGTA 3LPOA 4JY6A 3ZDZF 4MD0A 2V5YA 1P5UA 1M7DA 4AYSA 2AXFA 2DMBA 4L4VD 5EC2A 3MNDA 3CLEH 1AY1H 4FQPA 1ORQB 5MI0C 3LKRA 1OCZB 2QGEA 2X28A 4P2CG 1NUDA 1MCDA 4YVNA 3GJEA 1YNLH 3F64A 1IIKA 1J5CA 3QUYD 4J6RL 3QAQA 4CN6A 2OULB 3BO8B 4MQXC 2XCMC 2EABA 3OB0K 1I8MA 2E7LC 4NQQA 3C9NB 3QG7L 1XB6A 2WNGA 2B0SL 4LASL 4JDVA 2VN6A 3L81A 3O2VH 2LU4A 1AXTH 4FLHA 4X80H 3LMJH 5D70H 1Q0XL 3DWTA 5CD5C 2F53D 1SYVB 1OGPA 3GXDA 1MCSA 2Q0ZX 4KKBD 1IM9A 3DUHA 5IUCA 1ZDSA 1IGJA 4UQ2A 2WTRB 4YBLC 4AE1A 1CDYA 1HEJC 2G4EA 3X1NA 1Z9NA 4QHNA 3QDAA 2BO0A 2HRPL 2Z3FA 3IU3A 1IGMH 5E5UB 2GUOB 4M8RA 1PMYA 3QFJD 4P5MA 3UBXI 5CN3A 3MRHA 1EXUB 1IC7H 2P44B 2APVA 4GI8A 1P1ZB 3T0ED 3S3SA 2ATPB 1T1XA 2N7SA 1T89A 4JHWH 4P2OC 4K15A 3RU8L 3VI3E 4JPVH 4XXCA 1BP3B 1F1DA 4QNPE 4X7CC 4AC4A 1QTSA 3HRZA 4AGQA 5HYJD 3WXWL 1CFQA 5AUMB 4LVHC 2UYLA 2EYRB 4K8RC 3MNZB 4GS7B 1CFBA 1NM9A 2PLTA 3NFPB 5AG8A 4DKFL 3ZRSA 2CJUH 1Z9LA 4K7PY 4LCVA 5DJ2B 2FO4A 4OZFG 5DQDH 3WD5L 3WS6C 3MJWA 1ZGLP 3ARDA 4XMPH 1CXKA 4UT9L 4NZTH 5I66A 5FYJE 4G11A 5JZ7D 4GAJL 5KSAA 4BKSC 3V52L 3OWEA 2J2ZB 3WIIL 1DVZA 3VJ6A 3L1OH 4TNGA 3T2NL 1G7JB 4YHOH 2WJ7A 3HNVH 2VDRL 1DDTA 3MBEB 1GC1C 1WT5A 2E9GA 4X9FA 3TV3H 2Y1YA 5JUEL 4E5XB 1II4E 1FVDA 1DSFH 5D1ZC 4HH8A 3UPRA 4NWTH 5AL8A 5LG1A 3SSGA 1NDMB 4XP4L 3L3KA 1M53A 1BLIA 1PCXA 4ZFFA 2A6DA 2DI8A 4GRLC 4Z78A 2W0FB 3V6FA 1OM3L 4P3WA 5GIRB 1WHOA 1FAKT 4P59H 5L8KB 3UG5A 3HC2A 1NCBL 4ZQKB 2YZ8A 1RUAH 4A7VA 1AC0A 1MCFA 4D7BA 4HS8H 4KNSA 1ZLWH 1UD6A 3DV4A 4K7PH 4WNSA 4F92B 3AFLA 4TF4A 1RZ7H 2WZAA 3BZ5A 4ZS7H 2FQGA 5ABZA 3MJ9H 3MRBA 5C0EB 3SKJH 2CGRL 4EI5B 1IGIL 1CLYH 2J8UE 2FEEI 2WXOA 2C9AA 3IFLL 2V2TA 1A47A 3A6OA 3U9WA 3LRHA 4MNGA 1E4KC 4JJOA 4WV1B 4BSJA 5K9OB 2KPWA 2Z35A 2OXGB 3MMEB 3A4AA 4P5KB 5L2KA 5L0QC 1AQHA 2ICEA 3UH8A 3B7RL 4YJZL 4PRID 4UILL 2IDTA 3RE0A 1CDJA 2PTUA 2NTSP 5CHNA 2VMCA 4KDVA 4OJEH 3FRPG 3GK8H 4Z7IA 2YA2A 5EC1A 3M1CA 3QIWB 3NGBB 4Y9BA 3S34L 1TR7A 2BWIA 4XP1L 2JCCF 2M83A 4Y2LA 3S36H 4HIJB 2FEDD 3AU0A 3LN5B 1CDIA 2GEQA 5A1AA 5EEWA 3EH2A 1RK0A 1BMZA 2P8LB 5H2BB 1U3HB 3CZFA 4JO3L 1QLRA 2A1WL 3QORC 2O1AA 3W2DH 5EEVA 4LIQE 2BNQD 3BSZA 1MFVA 4DSYA 5MERB 3SGJC 4OZGE 3NZSA 3FB6A 2PO6D 3QULA 2WXGA 4D8OA 1PZ2A 2N4IA 4M7LL 3JWDC 2MHAA 3FB8A 4GBXD 4W9FC 3H7BA 4HIHA 4FQ2L 1K8IA 4QKXB 4KDTC 1T22A 2R0LL 2QKIC 4AGLA 5JIMA 3EJTA 3RA7H 3BAYA 3IRZA 1GOGA 4L37A 2I9TB 3TTSA 1DFXA 3CLFH 1N26A 2K1MA 1XSIA 5HVHB 3CSGA 3WEOA 3EDFA 4M8UA 4OLUH 4P2RE 1GGUA 4KTDL 4NPYA 1HZLA 4YE4L 5DRWA 2C3VA 2R23B 2BXYA 3ARXA 4U1JB 3S96B 2YEZB 4YPJA 2R0ZH 2R8SL 2AQ1A 2UX6A 3MJ8B 3O3EB 5KN5B 4TSCL 1A6ZB 5DD1L 2E6PA 5EU6B 3PHQB 3BPOB 1U3NA 4PJ5E 4NQCD 1JGDB 1E67A 5FA3B 5I1HH 3IGKA 4AKPA 2YGNA 3KS0J 5T1KD 2ZOUA 4XPAL 4G9DB 1ZHKB 5C0DA 3RTQA 2VDMB 3ILEA 2K8QA 3QDJB 1KXQE 4GB9A 3RFZA 3KPRB 3B2MA 2G5BB 4F5CA 2DQCL 2FNWA 4CMMB 5CKAA 5CJOL 5J6GA 4OZIF 5KVGE 1NGPH 3FULA 5HTSA 4X50A 1AZBA 1QLFA 1UOVA 3NDYE 2OYLA 2ZXDA 1A2YA 2FATL 4KROD 1SZNA 4LKCB 3RB5A 2WB1A 4O2FA 3F6IA 3F12A 2APFA 2W9DL 5A6LA 2HFFA 1PIFA 1KEGL 4PHXA 4HLEA 2ZG3A 2GIXA 3RILA 1MNNA 3SE3A 1K5WA 1GS8A 3WE1A 1QSFB 3FTWA 2XZZA 4PJAB 5F1IB 4LGRB 3L3OC 3T1WA 3P0YH 2WD0A 1KIQB 2FK9A 3OB0H 4EEEA 3OC8A 3QCVL 3GXIA 1R3JA 2N59A 5HHPB 1HL4A 2FUQA 3OJDA 2RJMA 3NACL 5C07D 2Z65C 3HVNA 4FNRA 2LFGA 1ZGLA 5D72L 4PP1C 1ACZA 5CFAA 2A2QT 1NDGA 1W0WA 4JRXB 2GKIA 3HB3B 3HUJF 2FX8H 1E6OH 4A39A 3BWAA 5BQ7A 5E6SB 1DN0B 1G7PA 4H0HB 1R47A 1BM7A 5T3XH 3ARBC 4P23D 2QQLH 4IOIA 3N1QC 5D7JD 3GRWA 1MRDL 3H53A 3RGVB 5BS0E 3LTVA 5BOPA 4Z9KB 3SYAA 1BDYA 2OV0A 3V5HB 1UXSA 1MXGA 1YJDL 1FIGL 3WAJA 1LEGB 4DIXA 2JKNA 5L4JA 2F5AH 5FYKD 1QFWH 1NFDA 2X7LB 4UAOC 1IU1A 5DMGC 3PWPB 2BVPA 3WE6B 5IM7B 4FQ1L 3FB5A 4KHXL 4NHUB 1TQCC 3FQNB 4FTVB 2FWLB 2TSAA 3IF1B 4X5WA 4M5YL 4MXWL 1T0NB 4E9RA 2R4SH 5I0YA 4Z7UF 4XH2A 4G5ZH 3DDGA 4ZS6C 4UCFA 5E6IA 4GKNA 2G2RA 1EA9C 4LPTA 1WZAA 1T04B 4GUPA 1GIGH 5BMFL 4LSUL 4YH6A 3NRQA 3RVXC 3LSOA 3ATBA 3UTTD 5C0RH 2OBGA 4FNLH 4IBQA 4RAUB 5DR5L 1S7VA 3SD5A 2P1YA 4ZMLA 5IHZA 2XYCA 4I89A 1SYSB 1KACB 1F1GA 1G9NL 1U58A 4Y5YC 3QO1B 3U2SA 4U1HA 1J5HA 3FMGH 2BSRA 4PJGB 1NH6A 4Z3HA 4MX7A 7PAZA 2MQ3A 1FRGH 4Z0XB 2WJ5A 1FQ9C 1Z2KA 3KYOB 4L3CA 1MVFA 1F58L 4AEFA 4QXGH 5F7AA 2LAGB 4F15B 3TLRA 4LPXA 1KOAA 3CFCH 3FO9A 1G7QA 5IB5B 1KN2L 2CKBH 5TGBA 5AFAA 1CFVL 2Q9OA 1OL0A 5EEUA 4I3RL 1CD9B 4OM0L 5BRZA 1U0QA 5H4ZA 2J5LB 3OPZH 1DVSA 4YK4B 3CK0H 1SUJA 3CFTA 3ZDYE 2X6AA 3ARYA 4NQDA 1YLBB 2H2SC 2VR7A 3QYNA 3NFNA 1I1AA 3ZX1A 4XN1A 4PRPE 1KCSH 3QO0A 2H6UA 3GEWB 4PR5B 4CC0A 3D48R 1R5WB 5SX4H 3K8KA 1K2DA 3DMMA 2VXTH 4DWHA 2NYZA 2VL5A 3FTGB 1LO5B 3PXJA 1KBPA 5D7IB 4UUJA 1X9LA 1C5DA 3A6CL 2HT2D 3NABL 3PS6A 2X4SB 4G80A 4NRYA 3U79A 1RZ8A 3RIFK 3IFPB 4WI0B 1E8XA 3QJTB 1HILB 3O4LA 3DYMA 4AQ1C 4HUUB 3SDXB 4FX5A 4V1DD 4BZ2L 5ISZB 1G94A 4NKQB 4JGNA 3LKNA 4X8XA 3KLAA 1JBJA 1ZJAA 2A7BA 4YDMA 5IJDC 3BZ4A 1WAAF 4PRAB 5ACLA 4JPSA 1QBAA 5DQJB 4N0FA 3JVGA 4CMHC 4PJ7E 1HYRC 3ZHKA 3LRSA 4XWOD 2IDSA 3OBAA 3L1GA 5IGXL 5IJVB 1FO0B 3ZUCA 5F7WC 1P1VA 2LT9A 3GIVA 4QYOA 4R4ND 5F96L 3EJYC 1RZFL 4DT2A 4R9HA 3B3IB 4LVNC 3EXJA 1IBHA 1XGQB 2DMGA 3KEHA 4KK9C 4XT1C 1KG0A 3VXMD 4G71B 2XHNA 4FULA 4NN5B 3ET9F 3F01A 1R3LA 2QR0A 3VXSB 1UA3A 2JKIS 4Z5RA 1RL1A 2R59A 3FH5A 1NC4B 4X7SH 5JHDD 1PU0A 1P4IL 2QQQA 5DYOB 3CSYB 1NFKA 3VCLB 3HN8A 1IC4H 3QEGL 1RMFH 3MI6A 1IAII 4MMYB 3FT2B 3FT9A 2BY2A 4GEJA 4RFEA 4XO8A 3US1A 4X4KA 3HC0A 4XXDB 3VH8A 3CVHL 3HE6A 2XWBB 1BYPA 4UV4L 5AG9A 2HG0A 3UG4A 5I19H 4TN9A 1B4RA 5GRVK 1DVUA 2JIXD 2VLLA 4HXAH 4TSAH 1J18A 5J1AA 4Z77B 4Y4HC 3E6HA 3L5JA 4FQJL 4Z76B 5IFAL 1MY5A 1DHKA 1OCRB 1KCVL 1S9YB 1CD1A 5CMAA 4FG6C 4AWJC 1Q1JH 5FC9A 4ERSL 4DFHA 1CDUA 1MFDH 4FJ6A 3QQ9C 1JZJA 1FL3B 1BZ9A 1MSPA 3K6OA 4OLZL 4X98A 4L3EA 2NQ3A 2IDFA 5EPMA 3NIDF 5F6IB 5D96B 4N2DA 1JGUL 4Y4KC 4C58B 2H8PA 4S1DC 2MKLC 2VQ4A 4DNLA 5HJDA 1A7NH 2AXJA 2XFXB 5AW0B 4DPRA 3EHBD 3FK3A 1GKEA 5FO8B 1ADQL 3O8XC 1KTLA 1SUHA 3TS8A 1LTXA 4KVNH 4S1RL 1G1CA 4GP5B 4HS3B 5F9WC 4TYUA 1BQLL 2F7RA 1O9VA 5G5DA 1DUZB 5HHQB 3H54A 4QHMA 3SY0B 4JZJC 2YN3A 4OFIA 1QFHA 4WWID 4ADJA 4AUJA 4OLWL 2CO4A 5IKCB 4FI6A 5GZNC 3D85A 4TV3A 4TQHA 3APMA 1INDH 2CQVA 3L95A 4L0PB 3HG3A 2AAVA 1CO1A 3DVNB 3QAZC 1A3LH 5C0NC 1L7TH 2Y36L 3UC0L 2ZAIA 3OKYA 4YHPA 4G6AC 5DWPA 1QR1B 3MZGB 5I9QB 3MLZL 3IDJA 5EWIH 1AR2A 2B2XH 4BK4A 4QRRB 1NKOA 3QJSB 2BOCB 2Y7SA 2YK1L 4K71C 4PBVC 5INCA 1J1OH 2J3SA 4KXZH 3RWJA 1CF8L 4GP4B 3LN4A 1QO3A 3O2WH 1E5ZA 4OB5L 1A66A 3KJ4C 2A83B 2PXYA 2V17L 1WYJA 3F65A 2Z31B 5F0LB 4WGKA 3GPSA 1NKRA 3IM1A 3SDYL 1R0AH 1JV5B 1M2VA 2CCWA 3MCYA 5ESVA 2X6BA 1S7UA 2UXTA 1P7BA 4CN1A 4AQOA 1ZWIB 4NKDB 4OJFL 3LX9A 2ZCHH 1OY3B 2OTWA 1HAUA 1IFHL 3OLIA 5D6CA 3SPIA 1ILUA 3ZTJG 5B38B 1CXEA 3U4EB 1D3CA 4NNXB 4IOSD 3EOTH 5F9DC 3APNA 4M48L 2JTYA 5EBLB 5KG9A 3P0VL 3AU1B 4HU2A 3TN0A 5FA4A 1T7WA 5J6HA 3L3DA 1AGFA 2VDNH 1UWGH 4WNJA 3MJ9A 3TYFA 3EOYG 1RJLA 4FFZA 3P77B 2G4GA 3GMPB 3KZ8A 1HHGA 4BUGA 2BMKB 2CALA 3IMUA 4XNYL 2XZCH 3D9AH 5E8EA 3X14A 1JPEA 4X5LA 1IBFA 2EXWD 2QPSA 3BAIA 2C1OB 4GKZB 1FUNA 1RZGB 1PNCA 4FGMA 3WJMA 5DEGB 4JJ5A 1OSPL 4YHNA 1U8HB 2UZIH 4Y2OA 3KPLA 3CMGA 2DB8A 4S2SB 5GRYA 3ZRFC 2NX5E 3VGGA 4G9FD 3QZWG 3B43A 4QHUA 3NN8A 4Y1AE 4I0PB 1N0LA 4JZOA 3HS0B 2RGSA 2BSSB 4H0LC 5DMJB 2JKTM 4AEIH 5AW3B 1EO8H 4NQVB 2ARJA 3BKCL 4JGMA 3T4AC 4Z7NB 1AMXA 4NX0A 2OX5A 5HYQA 5IROD 3MOBH 3B3BA 1THCA 2IGLA 5K39B 4K94L 5KUMA 3WU1A 4GG6B 3IU4H 2NUTB 1OOWA 3DROA 4XMZA 3MA7B 5DZLA 3N41B 4EO5A 4TNEA 5GISH 2FLRT 5GSVB 3SIKA 4HXBH 2R9HC 3LXUX 4EN3C 5FF6A 1BVOA 2VLKE 3BW9B 5MEPB 4S11A 1I3UA 2QTVA 4YZWA 1FC2D 2EYSB 3FU9A 4YXKH 2VISB 4DESA 1URIA 4IM8A 4X0KB 3TBVA 4C57C 3MBED 3HAEG 3VM5A 2WWKO 3D8MA 1ICTA 2DQUH 1LP9F 2X1XR 3O3UN 2DTMH 2CLVB 2OP4H 4N90D 1TZGL 3VWJC 4P57B 3G6AA 3F7VB 4BXSV 1E27A 2JMRA 4LPCA 4FFTA 1VESA 2R1WB 1U3YA 3R0NA 4JFQB 4XHJC 3BRFA 1DJHA 1L4IA 4PJBA