3ATDA

Crystal structure of the kir3.2 cytoplasmic domain (na+-free crystal soaked in 10 mm gadolinium chloride and 10 mm magnesium chloride)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
199
structure length
196
Chain Sequence
b'IQRYVRKDGKCNVHHGNVRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium inwardly-rectifying channel, subfamily J, member 6
publication title Interactions of cations with the cytoplasmic pores of inward rectifier K(+) channels in the closed state
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 41
structure length 196
sequence length 199
ec nomenclature
pdb deposition date 2010-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3atdA00
3SPIA 3SPHA 2WLMA 2X6CA 4KFMA 3SYQA 2X6BA 3ATDA 3SYOA 2WLHA 2WLIB 2GIXA 2WLLB 2QKSA 1U4FA 1XL4A 1XL6A 3SYAA 3ZRSA 5KUKA 2E4FA 3AT9A 3ATEA 1N9PA 3VSQA 2WLNA 3JYCA 3AT8A 2WLIA 2WLKA 3K6NA 2WLLA 3SYPA 3ATFA 1U4EA 2X6AA 5KUMA 1P7BA 3SPGA 3ATBA 4LP8A 3SYCA 2WLJA 3AGWA 3AUWB 3SPJA 3ATAA 3SPCA
chains in the Genus database with same CATH superfamily
3U6XA 4PJGF 2CM6A 3CFBA 2EDNA 4KJWC 2Z8WC 2BNQD 4HJGA 4OFKA 4Z18A 5H35A 2DI8A 3DGGB 4FQPA 1MIML 4LLUB 4P4KA 1NCBH 4X8CA 1Q72H 3FH5A 3MRMB 3BUQA 3EG9B 1N8ZB 2ED8A 3DIFA 3JV5A 5HYJA 1FV1B 4YO0A 4PRID 4JFFA 2CJSA 1AHWB 2F6AA 3LD8B 3EYQD 2A77H 5F1IB 5AW9B 5T1KA 2CALA 5FHBL 1UM5L 3HC0A 3WHXB 1P7QB 2WCGA 3LPFA 5AAMC 4PJBA 3QJZA 5ES4B 4KPHL 3V6FA 4AZ8A 1RK1A 1R3IH 3MLXH 1AZRA 3NEEA 1DBBL 2W9DH 5DJZB 1OCRB 2GTWA 2QFRA 2RR3A 2WJ5A 1K6QH 5HYFA 1Y6MR 2NNAB 9CGTA 1QVOA 1JZFA 2R23B 3ILQD 3NCWA 4HZLA 2UY7B 4MRCA 3TO4D 1C12A 2X44D 5BVPH 3VE0A 4NJ9L 5B3JE 1MZZA 4QRRD 3BVDB 2I9TA 3TCLB 5LGKA 4NSKA 4KHXH 1I1AA 3MOBH 1T3FB 3MOAL 5JO5B 1MVUB 4X2UA 2R0LL 3ESMA 3DYMA 4O00A 3UTPE 5IVZA 1ZV5A 3SGJC 3K8MA 3MNDA 4GG6F 1OPGH 2EYTA 3ZKQD 5JMOC 2CO6B 3KR3L 1J0ZA 4X6BA 3T0EB 3JV0A 3LXUX 2EVIA 4XO8A 3BE1H 4N24A 2ADGA 3MJ8A 5CP3H 4AZUA 3JYBA 4DVBB 3X11A 4ZW3A 4NRYA 1I8KA 2NY7H 4HIEB 3BX7C 5FIEA 1KTDA 3TCTA 2FBJH 4NI3A 5CZXC 4YS4A 3HAEG 1NM9A 3IS1X 3PHOB 5FK9B 4QHMB 3T09A 2JKSA 5F70A 1KEGH 3BAKA 2A74C 4NUPA 2WBJC 2HA1A 3QJQB 1HVXA 3OSVA 4OAWA 5KS9F 2RD0A 4AVIA 3X1FA 1RJYA 3OR7B 4EXPX 2IFGA 3QQXA 1EIBA 5IUCA 4X4XA 1M71B 1WIPA 1NDGA 3WKYA 2Y2YA 2AK4E 2CIIB 3LN4B 2W60A 3NAAL 2WBWB 2AW2A 1QR1B 4JFDA 4JL1A 1T2XA 1CTOA 12E8L 4FERA 4X6CA 3SDAA 4X4YA 3MRNB 3EO9H 4W1TA 3NZ8B 2RH0A 4FYQA 4MDIA 4M7KH 3CMOL 3K4AA 3C60C 3GMLB 3OZ9H 2X6BA 4BFOA 3GHEH 4H44C 4QJ3B 1CICC 2NSMA 1ZT7A 2UXGA 1F4YL 2WNXA 2ESVA 3D69B 1D9KA 3U1QA 3M1BA 3TA4D 3U2SA 3U4KA 4BZ1A 5J11C 1CFVH 2XWEA 1UOVA 2VC2L 4YLCA 2XXCB 1U8PB 2WXGA 4QHKJ 2NCEA 3K2MC 3WE6B 4EAEA 4URKA 4B9GA 1LE5A 2B08A 1NCGA 2ZOLA 4HCRL 2ZWSA 1T1WA 3WEBA 2LAGB 1HXYB 5J8OA 1DJSA 1NMBH 2G60L 2QEJA 3FT3A 1ACCA 1LDPL 2P5ED 2BSSB 4IRJC 1GS6X 2OULB 4LKCA 3D87B 3MRDB 3U2IA 4FFZH 5C7XH 4DGVL 5I66A 5CSZB 4U49A 2PF6A 4AITA 1CR9H 2P26A 4H8UA 3UTQB 3GB7A 4TTDC 4N2NA 2PPDA 5DJ0B 4NKIH 2Q8BH 4PJCE 3KHQA 1QLRA 4FZ8H 3MV8E 3FCUB 2DB8A 4HHAB 5DVMA 2OMWA 5B1BB 3C9NB 4HJIA 4CSPA 4ZG1A 3I84A 4EZMA 1ZA3B 1UD4A 4JY6A 3IGFA 1HQ4A 4OT1L 2D8KA 3PWVB 4FTVE 4GH7B 2ZKWA 4PLJD 3G5ZB 2ZP8A 2XFXB 5D71L 4PV1C 4ZUVA 3CSTA 4N5UA 1NCIA 2CNZA 3HIZA 1OB0A 4TUKL 4HHWA 3K6NA 2F7IA 4A6YA 1NAKL 3H56A 3K72B 1IAIH 2MQ0A 4E9QA 5MERA 3SE8L 4XNMA 1A6VH 1F45A 1FIGH 1NGQH 1E0OB 2JELH 2BDNL 4LCCA 4Z7IA 4JY4A 2EIZA 2H41A 4M48L 1F3RB 4X7FC 5SX5K 5GRJL 4E9XA 4DUXA 4X0NA 2WIMA 4OJDH 5B8CB 5CBAA 4KI1A 4FQ1L 4YL9A 2Y07L 2YAFA 5GRYA 4UQEA 2J7LA 5EU6A 2P5WA 3DVNA 2VN6A 3WN5A 5DR5L 1ZLSH 4NKDB 2AERT 4QJ5B 4YSDA 1H19A 1ZE3C 2VABB 5J6HB 4FQXB 4Q0XL 5D4IA 5FOBA 4BFGA 2J8OA 4FFTA 3CH1B 2GT9A 2GJ6D 1DFBH 3IFPB 3RAJL 4F20A 3I75B 3MUUA 2DICA 1B4JL 1N5YH 4P23B 3HS0B 3FCBA 5FO7B 1YNTA 4HKJA 3S8GB 3GMNA 2W9EL 1J1OH 3D39B 2X6UA 4RNRA 5MEQB 2G9KA 4HJ0D 5BQ7B 2JIXA 5EU3B 4NZ8A 4CW1B 3RNKB 2ICWB 1UA7A 5BZWB 3X12B 5JXED 4YLQT 2QPDB 4KHTH 1A6TB 4Q6KA 1NDTA 1AGEA 5I24A 1WFJA 1R3KB 2X4NA 5B1KA 1GPOH 2QQNL 3P4LA 5HJ3A 1OM3H 3S5LB 3FO0L 4MXVF 3UTPD 4NDMB 1YJDC 4ZPVA 3JTTA 1QBMH 2VUKA 1TTUA 3VSVA 4U1SB 4O9HH 3GSOA 5EEXA 4J3BA 1R3LA 2XN1A 1E4HA 2YAQA 3ZKMD 5KSAB 1TR7A 2XRAL 3CD4A 2OX5A 4E2OA 5L4FA 1R5IB 3GC3A 4NWUL 4RWHA 5E1HB 4IIZA 3LEVH 1IEBB 5DLLA 3BC9A 3FPYA 4FYTA 1UKSA 3O2WH 5E00B 3CH8A 1SF5A 2WTRB 2NY2D 1BQ5A 4H20L 5F72S 2GSIA 3IAPA 4KY1H 2BHUA 1LK3H 2R7EB 4XO5A 5KVEH 4G1MB 1DQDL 2VT0A 5C0CE 3T8MA 3LVTA 4ODSL 3F7PC 5EORL 1EJ6A 2V2WB 2E9GA 3VB9A 4HWBL 3BZEB 5IQ7H 4HC1H 3OZLA 3HE7C 3BKCH 5DFWH 3VFPB 2XG4B 1T0OA 4GMSL 5DMGC 1YEEH 3TN0D 2P45B 5CBEB 3BPNC 1XH2A 4WFEE 1DN2A 1OWRM 2AJ3A 4QO1A 3EYFA 5CMAA 3QA3B 1B4TA 1J0KA 3HA0A 4N6RA 3V7AG 5DMIL 2CHNA 1IEHA 4UQBA 3EO0A 3ARBA 3MU3A 1HSAB 4BZ2L 2EDEA 1BJ1J 2ZOUA 4OLWH 4X7TA 3RFZB 4KDTC 3LN5B 2WLZA 1GOGA 5FYJE 2DJMA 5LWYH 1B0RB 2EDQA 3L2NA 5K39B 3SKNA 3ZYZA 1WWAX 2A5UA 3QH3B 3VXSB 5DUBB 2AXGA 2KL6A 2IXQA 3R8QA 1IQWL 2XV0A 5BW7A 4H0HB 4TUUA 4JZOB 2VRKA 5KVGH 4CBPA 2Y69B 4QXTA 5EUOE 2Y72A 5DK0A 4YHZH 1DVQA 4JKKA 3QQ4B 5I6NA 3C8DA 4TVPE 2AJUL 2WCPA 3QUZD 5C6PB 4P57A 2YQ2A 4N2DA 4BSJA 4Q97A 5BO0D 3BGAA 3T0VA 1IAOB 4OZHF 4LDLB 3SBWC 1J9RA 4J4PD 1CG9B 3OXSB 4TPRL 2FEDC 2ZWYA 4JFUA 1WZ1L 3EJQA 4S1RH 3NP4A 3GBML 4PJXE 2APVA 1MUJB 1C8QA 5CWSA 1GZPB 4PGDB 2P9RA 1K4CB 3DOSB 2A9ML 1S78C 3CU1A 1PAZA 3M8OH 4UAOB 3RY4A 4ERSH 2CO1A 2Z64C 3C6EA 3NTCL 3QDGE 2EIDA 4L9DA 3OXRA 3FONB 3LKSA 1HHIB 4WNJA 4ZXBD 3F12A 2GHWB 4XH2B 2BVYA 4Q14A 3NRFA 2VR9A 3VNYA 5AZEL 4L4JA 4Y1AB 4EF3A 5B3NA 3IFNH 4V1DA 2WLJA 1MLCA 3BSZA 3ZT7A 1QHOA 4NFCA 2IFFH 4NT6B 5B21A 2G5BA 4FTVD 5C0EB 3MLTA 4AGMA 3H0TB 3V4VL 2F74A 3WNIA 4JRYA 1BVLB 4OQTA 4QI3A 3DHUA 1NCAH 1NQBA 3S3JA 8PAZA 2MSPA 4E41B 3OB8A 4XPFL 4EIUA 4YPGA 4HDIB 5IMLA 1LEIA 1RZKH 1RJZB 5JHLA 2D7QA 4X4MA 2MNWA 1I85A 3HUJB 1MCDA 4OJEH 4NQCA 5AB2A 1RHFA 1QKZH 2ZTBA 4XO4A 2PP9A 2WV3A 3EZ8A 3T0AA 1ZIAA 1R3HB 3QBTB 4N0UA 3H2WA 2PCPA 4HK0A 5EU4A 5DT1H 3RGVB 2CBQA 3DX0A 3FOMB 1G7LB 5LJYH 2NT0A 3PWNA 4JO2L 5J89A 1R5WA 4G6FB 2I26N 4GW1A 4OZFH 3IB4A 4JZJA 1ZDQA 4FXKA 4P3CH 4R4BB 5B4MC 3ZSTA 3HMWH 2FWOA 4LSQL 3AG2B 2XI9A 3BMVA 2LFGA 1EXGA 5EDSA 4EIBA 4BH7A 1IBBA 4L05A 2MTPA 1FZJA 1PEWA 3GUFA 5AL0A 3CHPA 3S7GA 5HHPA 1JP5A 2FO4A 3P0YL 3SJVB 3FTUA 5T3ZL 3SPGA 4X42A 4OIIL 3ZUNC 5EPMA 1X9QA 1UD8A 5CUSL 2ERJB 5J56B 2R1WB 1WEJH 2ICWJ 4A7GF 3UO1H 3RE0A 1TJIL 1UH3A 3MKKA 4K8RC 1OOWA 5AAMA 4IKIA 5MENB 1MAKA 2A73B 4S0SD 4KROD 4WTXA 1IC4L 4HLZG 4HS6A 2BM3A 1A1NB 3DA0A 2B59B 3VRLE 5ABDE 4EI5D 4G6JH 4LGSB 3MMEA 2EUXA 3QNYA 5D5MF 4ADIA 4CRPA 4PCTA 1SY6H 4JFYB 4P2OD 2ENYA 2VDKL 1BOGA 4K3DH 2YD7A 2IBBA 3GJFK 2Z4QB 3KCWA 4LLDA 3QNFA 2RMNA 1XD1A 2PTVA 1X7QB 2VDPH 2QFPA 3CDYA 2KMWA 4HCGA 5IB3A 1ZV9A 1TTCA 3PPSA 4OM0L 1KELL 9PCYA 1A3QA 2NX5B 1U8QB 2X89D 3CLFL 3SGJA 2IH8A 2YFNA 3F01A 3QRBA 1TETL 3RTQB 3L2MA 3VH8A 2W07B 1XIWD 32C2B 5CEXA 2DQEH 2GCYA 4WK4B 3D9AH 4NYLA 4ODVL 3KL3A 4PVBA 5C0CD 5I6KA 1SMAA 2VLKE 4NQTA 1SFHA 1KV3A 5AOKA 4F58L 1QBLL 3UTSD 1MRFH 4L4TD 2MMXA 4MAYD 1ORSA 2Y22A 4JRXE 1BCIA 4WFED 5CU9A 4AVKA 5IEKA 4NCC1 2E47A 1HINL 2YA0A 3KPQA 3WFEH 3QO0B 3Q7JA 2X0WA 2BIIA 4MWFA 4E42A 2WWOA 4YDVB 2W8CA 5E2TL 1TNNA 5H37A 3ZE2F 1FGNH 2A74A 4GFTB 3D25B 2WBJA 5D7KE 1C7SA 5HYJE 4LLMA 4R7DB 4JFFE 5D4HA 3VXNB 3V0HA 3HBZA 5FYJD 3NGBC 1HK6A 4PJBE 1NPUA 3FQUA 5FWRA 1UJTA 4W93A 2YQGA 3AITA 3T65B 3Q44A 1PMYA 3ELQA 3VGGA 2BVUA 2I07A 2AXHA 4HJSA 1ML0A 1BBJB 4MAUH 1ZSDA 3QO1B 3GK8L 4YDLB 4KITB 2DTML 2FX8L 4B27A 1CL7L 3GDCA 5CKAA 1BPVA 2R69A 4DEWA 2DMKA 1CICA 4TVPD 2VDRH 4UIKH 3P4NB 4LARL 1AY1H 2IADA 4OKVA 1NSNH 4UV7H 4JS7A 4PRBB 3L13A 4KKBD 3TJEH 2PWHA 3MA9L 4O02H 2A6DA 4ONFL 4PJFB 2JKLA 4LQ1A 5EH1A 4D7BA 1AR1B 1HH9B 3WLWD 4QXGL 2B77A 2I32A 3GBNL 3WS6A 3QIWB 1B6DA 3QIBD 1KWGA 3HG1B 3CPLA 1W80A 4PRNB 1P0SE 2X9ZA 3ES6A 2HWZH 3FU7A 4ABQA 3MCLH 4WRLA 2B39A 4DJMA 1CVRA 2F61A 3OKKA 1FC1A 3FL7A 4D7PA 1XGUB 2VWEC 4WI0A 5IHUH 4BQ9A 3F6JA 3T8XB 4NAJA 4IRJA 5GS0H 3DO7B 3L7EB 4EIGB 3NIGB 1S7SB 5DD0H 3RKPA 4AM0A 3F7YB 4ZZFA 5DFTA 3AROA 4F1SA 1M2OA 3TA3B 4G8GE 1HJBC 5IR1B 4FFYA 1LO2L 2HJFB 5GSRA 4TLUA 4HMDA 2YMXH 5DZPA 1NLBH 3LS5H 1X7TA 3QS2A 2IBZY 4XMPL 5CEZL 2CDGA 3P2DA 3GZOA 4OLVL 3WUZA 2DKUA 4M8QA 3UJTL 1MIMH 4Q8BA 3VXOB 1FBIL 2X40A 5TDNA 4Z7QE 2AJXL 5I1HH 2B16A 4D8PA 5IQ9A 3NSDA 2Y2TA 4WY7L 3MODH 2WWKT 2R83A 3VXRB 3NJHA 5EF0A 1T0MB 2LU3A 3EXJA 4JFDE 4DP4X 4W9EC 5BJTA 1PLGH 1I75A 2ZCLL 4NQSB 3RVUD 2N7SA 4ODUB 1GYUA 1XVSA 1UHVA 3PDGA 1KG0B 4G8EB 4C47A 5JIIA 1DE4B 2JJTC 1S7UA 2VL5A 3SKMB 3VXQA 4MQ7A 5TQ2H 5KVFL 3EDKA 1R0AL 4X7EC 3BKJH 2TAAA 5C8JA 4U1MA 3KD4A 5TE6L 3RZCD 1S7XB 3AGWA 5CD5D 1RUAH 2R0LH 2WOYA 5LDUA 4GSRA 1JCKA 2NQDA 4FQ2L 4LVEA 3IFOA 1HXKA 4AKPA 1ZVHA 3QJFA 1K5NB 4Q6YA 4C4KO 5GZNC 4FKKA 4OBRA 3Q8AA 2XN2A 3FU9A 3P77B 1YMMB 2O5YL 1CTMA 2ZSWB 3C09C 3KR3H 3GRWL 3PHQA 3QHZL 2IMMA 5KSBF 1E7VA 2ZG3A 4FQIH 1ZT1B 1NC4B 4HUUA 2R39A 2IANA 4MQXC 1KJ2B 4OD2B 2P43B 2VDNB 4P5MA 2DMGA 4O58L 3EDFA 3LQAH 2NXZD 3PV6B 1AO7A 1NC2B 1SQ2N 1YY8B 4BDVB 4CDHA 3FFCA 1LO5A 1KIRB 3BDYL 3PG2A 3HAEA 5LN4A 1CYGA 2CXKA 4I4WA 5ADPL 4JFHD 2GK0B 2JK5B 3N1QC 2D7NA 1N0XH 2FJGB 3ME0A 3R19A 3VYNA 3ZJAA 5EEZA 3IU4L 2ZYIA 1WGOA 4KZEL 5FYKH 4UBDC 4BWWA 2Y36L 4ZS7L 1AGCA 3RGBA 2YQBA 1GKOA 1C5CH 4I2XA 2IALB 1WGVA 4F8LA 3MRPB 12E8H 4WWNA 2ADYA 1T22B 3OGCA 3BW9A 3VI3A 3VU2A 3ARGD 5IVXA 3LKRA 4JDZA 2XWDA 1MAJA 3CMOH 1H0DB 3SDXF 1MCBA 4I88A 5TDOA 1ZHLB 4YOKA 5BRQA 4DGIH 3GIVB 3O2DH 4P4KD 4QRFA 1J05B 2M1KA 4TKWA 3DV6A 3M88A 2YAEA 5D7KD 3MFFA 1A4JA 2XJKA 2QADC 3IGUA 1QNZH 2P5WE 1M7DB 1NGZB 2CGZA 1H5BB 2XBZA 4HAFA 2V0AA 3D85B 4JPKH 2F5AL 4K55A 4JFFD 3HE7A 5EBGA 4K5OA 5PAZA 1JBJA 3S3DB 5T1KD 1NCJA 1OAQH 4AUJA 1I4FB 5ID0A 4FFWD 5I5MA 2ICEC 5EFIA 1QEXA 2XKNA 4ZDHA 2V8LA 4IJ3C 5ILTL 5I1CH 5JOFA 2WLHA 1NJ9B 1QQDB 3CTTA 4JCMA 3WGVB 4DO4A 2IV9A 4OD3L 4E5XB 5I30H 3LH8A 5GS2H 3N41F 1R24A 3EH2A 4KDTA 3QUKA 4PJIA 3VFWB 3NK4A 2NY2B 4B9JA 2OV0A 1D5MB 1TEFA 2UWEF 4PI2A 3VFVB 1EWHA 5AVSB 5KSVA 5CGMA 1J0HA 1UC6A 4R4ND 3HHSB 5D1ZC 5F1NA 4ZFOB 1KB9J 4QXWA 1I1AD 2UYLA 2VE6A 4JLRA 2E7MA 2XLLA 3QUMB 1XSKA 2PPCA 2Z91B 1DVTA 3TN0B 2X2HA 2AK4B 5BRZA 5DZJA 3FQWB 2V5RA 2RCSL 3BGFB 2HG0A 1SJXA 3FUEA 3FFOA 4GKNB 5JDJA 4ORGA 2HFTA 2P8MA 2Y5EA 1FP5A 4G9DA 4N9GA 3SBWA 2YEQA 4HS3A 5FYLH 4ES8A 1LWHA 3U0TA 3A4AA 4AYSA 3D7PA 3MUZ1 2FECL 3J27A 5DEFB 3CVHH 5I76B 3X1EA 1Y18B 4PRAA 4DCQB 2JV6A 4OZ4A 3MBWB 2VXUL 4X0KB 5DJXB 4JMNA 3SE8H 3CHXA 1YMHA 2E27L 3FQNA 3EJPA 3G7TA 5K69A 3SPCA 1JNHA 3Q8FA 4Q89A 1EMTL 4AG4L 5I0XA 4XNZC 3FUDA 1GC1C 5FKPB 1P84J 3SSGA 3BFWA 2XQBH 1INDL 4Y19D 2EE6A 3FFDB 4WU5A 4HBCH 1TJHH 4WW2C 1IBHA 2PR4L 4KK9D 5K9OA 5DR5H 4JFVA 2DQHH 4Y8AA 3QFDA 2WZPA 4UDTA 3WO4C 1F4WH 4JFDD 2FL5B 3TXAA 2IG2L 4EN3C 2OI9B 2KDYA 2FSDA 3SDAD 1JFQH 2J44A 4YC2B 3ML8A 4BFEA 5I19H 1B4JH 3TJHC 1DQQB 4YAQA 2GK2A 4E9VA 4PJCB 4YSQA 3MV8B 3UZQA 4WV1C 2OMUB 2OMXB 4GUPA 1GZHC 4QAWA 4L3CA 1FO0H 1F41A 2ESVD 1Z1WA 3DX3A 5FUCC 4DPCX 1CXKA 3H7LA 5L2KE 4CVWA 3MTRA 4UANA 3WJMB 1JTPA 1P4BL 3EF7A 4ZBJA 3SGDI 4DIXA 4JQXC 5I1KH 1AHMA 4OLZH 2QQNH 2K8MA 3UIYA 4MD5B 4TUOB 3J07A 3BP5A 5E4EC 3BLBA 4Z7VA 3AAZA 3DROB 4PY7B 2EVFA 1E8YA 2GIMA 3UXFA 1QFWH 4Q9RL 1RP9A 5FECB 1PZCA 2P8LB 1X4YA 4RQQA 1LP9E 2VH5H 4WGKA 2Y5TB 1TSHA 3DC0A 4IHOA 4X50A 4G80B 3O0RL 1JYXA 2DM2A 2VZOA 3OR6B 3U36B 3QCUL 3UAFA 4JY5L 2ZAGA 4EMZA 2N7BA 4IDJH 1HWWA 5CKGA 3MO1B 4LBEB 2AAVA 3B2PA 1E7UA 1AXTL 4H20H 3STZB 3BWAB 3W0WA 1I8IB 4N25A 4XX5A 5IB5A 5L6YL 3QEGL 1HQRA 2DAVA 3BEVB 1UUSA 3KYMB 4V1DE 3GNMH 1AGDB 1MRCH 2O61A 2XQYK 5GRUL 2WXMA 3FO2A 2WXHA 4B9KC 4HWBH 2CNYA 3N43B 4K2UH 4QKXB 3C08L 1QI4A 4GMSH 4KQ4L 4DPRA 2C7UB 1NANH 4X7CC 3ULAB 1IFHH 1TLKA 2FJFB 1SRDA 3ZKSD 2XT1B 4NP9A 3IBOA 1TZIA 5HY9A 4BZ2H 1WFOA 2XPGA 1L6XA 3W39B 3VFMB 5DRWB 2Q76A 2BH0A 4P9HL 4WEEA 4E9LA 1IGYB 3B5TA 3L3DB 5IV2A 1AD9B 3QQ3B 1OARH 3W2DL 3HFMH 3T71A 1FJ1B 3LZFH 1KSRA 4MMZB 4GSDL 2LOEA 1MCIA 1P9MC 1UB6B 3QI9B 4XB7A 5EU6D 3UO8B 4BUGA 5J6GB 1ZGLB 2CRYA 1EDQA 3JT0A 3VWJC 5SX4I 4LSVL 1JXFA 2FT8A 2D7OA 2V3FA 4LLYA 4N8PA 1V3KA 1A0QL 2IAMC 4YDIL 3GO1H 4W4OC 2C9VA 4M43H 3CDFA 4UILH 3ZK0A 1HHGB 4P4RB 4HW6A 3OPUA 5AVQB 2BVTA 1BECA 4TPRH 1UOLA 4Y1TA 1WZ1H 4IS6A 2BRRH 2OQJA 4HGMA 3UGUA 2DWYA 5ITBH 4P5SA 5HHNB 2JIXD 4MNGA 1MCQA 2A9MH 5FDWA 4PLNC 3NTCH 4MDJB 2NUTA 4P59H 5DZLA 2AJZB 4L9LB 5E5UB 4ZD3H 3TESA 2AV7A 3RHWF 1WF5A 1A6UH 4MAYB 3P73A 4OGYH 2FYVA 2H26A 3ALWA 5DS1A 1DUYB 1S9XA 1HDMA 3PNWA 4K3EL 1BFTA 5IFHL 1SBBA 4TNWF 5I9QC 3ILPB 4L8DB 1TXKA 3T4YA 3EH3B 1TG8A 3D2TA 3ZRSA 5TTRA 2YWYA 1LD9B 1WIUA 4AQEA 4UQ2B 2VLRA 2HMIC 4XPFH 5EOQL 3S2CA 4DN3L 2G75B 2ZX5A 5KS9A 2ZAIA 4HAKA 4B97A 2DMCA 2EE2A 3IETB 5IIEB 3H1ZA 4M1GH 5F7HA 4PP2A 2JLPA 5CF3A 5IP4A 1G7IB 1KPUA 3CZLA 3RY5A 2VJXA 4GPVA 1A9EA 1G6RA 2K3HA 4WUKL 3UZEC 1WTLA 5HHME 4WHCA 3I3BA 4NZFA 3RNQB 3TF4A 4LESA 5HGAB 3T1WA 2O5ZL 1G7MB 2APBA 5EUOB 1WC7B 5D8JL 4M61A 4GLRI 2RTTA 1XB3A 5FGCE 1CIDA 3Q3GA 5ISZE 3IEAA 2EKSB 5AOZA 5D7IA 1YN7A 5A2FA 3DVGA 2WIIA 5IW1A 3FN0L 1F1GA 2HFFB 1BXAA 1DTUA 1QNIA 4LU5H 4FE9A 3I3DA 1GYWA 4GUQA 2J71A 5KN5A 5E4IA 4PJXB 3KLAB 4WFFE 1OPOA 4R26L 5DD5L 5IY5B 1V5JA 2HLAB 2O5XH 3ARBD 4RMQA 2EEFA 3QDGB 2VMEA 2Z1KA 2DBLH 3BP4A 4YXLL 1UVQB 3V8CA 3OJDA 4XI5C 3ELAT 4GXVL 4QTIH 1OK8A 2VLLB 5KYYB 1TJIH 4PGEA 5HYSA 3AXLB 1QSEA 4KVNL 3E6FA 3X2QB 4BZYA 1OCCB 3JVGC 4JDVB 2WZ6A 1YN6B 5JHMA 4M5SA 2DN7A 2PYEA 3S37H 1J5OL 4KQ0A 3ZHKA 1Z9PA 4M6OH 4TYUA 2JJTA 2CE6A 2ZPKL 1N59B 1RZIA 2VDKH 4Y4FD 5LBSA 4G5ZL 3RWDB 4OV5B 1EFXB 3U7WH 2IPKB 2CLVA 1MFEL 2DJUA 5D6CB 1JE6A 3N55A 3MGOB 3T6QC 1L3WA 2A6IB 2VMDA 4NC0B 1MFAL 1UCBL 4NS0A 1OAKL 2BWDA 1AQHA 3EOBA 4JFQB 4Z3EA 1SJVA 3V9FA 5LLIC 5CJOH 4EKJA 4KX9A 1K2DB 5B38B 1JI2A 3VG0H 2WVVB 3A4EA 5GZNA 2Y2WA 3KCPB 2AQTA 1DN0A 1EBPA 3AU1A 3KNBA 4NC1E 4ODXA 1CMOA 4WO0A 2FQGA 1FNLA 5AVUB 4JVWA 3UP6A 4S1SL 1KXTB 4CKVX 3UTTE 2UZIL 2UVFA 1Q9LA 2FB4H 4M4RA 4ICWA 4V1DD 4X5QA 4QUOA 1I9RH 2VKXA 4Z7UF 1DDTA 2BHYA 4X8JB 1HN1A 1G7PA 2PWFA 1IC1A 1UM6L 1FL6A 1WWBX 4LVHC 1AG0A 4K9EH 4M5YL 5LXVA 2EICA 4JRYD 5KVMC 1L9TA 3STLA 1XXDC 2CUHA 3M17A 4ZMPA 3RZCB 2AABL 2H1LM 2HTLD 2HVJB 1RZJC 3MX0B 1U3JA 4NQCD 3WY2A 1QFOA 4LCWB 5J6SA 1FORH 4UQDA 2W65A 2XWBA 5C07A 3L3HB 2OZ4A 5IEHA 1Q38A 2WSDA 3AJ7A 4HCIA 3MLVL 4BKSC 3ARTA 4LHJB 3FCSB 1RVFL 1PZ2A 4P5TC 3MTXA 2HKHL 3BZFA 3GSRB 3OMNB 5L7XL 1T7XA 2V37A 4WKZB 4F2ME 4L48A 2NXZB 5AW3B 1T03L 2PABA 1BZQK 1U2YA 2EEBA 4ZFQA 3NJNA 1H3WM 3LH9A 4NJAL 1CD8A 3SKOA 4KJWD 5TH2A 2EO9A 3U6RB 3PL6C 2JI1A 1RZFL 5H94A 4ZTPL 3GPSA 4DQOH 3R0NA 4WNSA 3D4YA 4NP4L 4U6XA 4G70B 4GNKB 3UAJC 2F8VA 3GSVB 1E2VA 2WD0A 3QPXL 1MWAH 4HKZA 4Z76A 1JYNA 3CQFA 3NIFF 5E6RB 4MD4B 2VDLH 2Q6WA 3GBNH 4XE0A 2UVEA 1LQSR 2VLKB 3NH7L 2E9IA 1U8NA 4XB8A 4KX8A 5MHSE 2Y23A 4KUCD 1TDQA 1E40A 4KDVA 2RQEA 4JJHA 2IQAA 2VN4A 2WAQA 4JRXB 4D9QD 2YPLE 4HJGB 2IANE 4N87A 5H35B 1OGTB 3WUWG 1UXWB 3FB8A 4JGUA 2FGWL 1GOHA 5CR8A 5D1ZA 4HV8A 1UJ3C 3FFCE 4H5SB 1LO2H 4MLSA 4RAUB 4Y0GA 2FDBP 2PO6B 4TNEA 3E1F1 5HYJB 1URZA 4WNQB 1P6WA 1CXLA 1A14H 1PZUB 3VG9C 2AS5M 3HC0B 5C6TH 4MNQB 1AP2A 4PJBB 2J4WL 3GMPB 5HHOA 3Q6GH 3WO3B 1F5WA 1QUNA 2TSBA 5INDB 3P9WB 3V6FB 5GHWH 3FU5A 2H0FA 1V3JA 2Z1PA 2ZWLT 1NIBA 5HYIA 4G8FA 3T08A 3L4UA 8FABB 3V4UL 5GRXG 4Z0XA 1FZOA 3T8VA 4P06A 3RWEA 3DX2A 2UZXB 1WAAA 2EDOA 1C12B 4YLBA 4U7MA 4K71B 4WFGD 4NBYB 2KZKA 5C0GA 3H8NA 4UQAA 2VZ3A 3UERA 5AVTB 1GKEA 5CZXD 4C4UA 4YSUA 5L4IA 3MFGB 2WVUA 3IT8D 4JPIA 4F7TA 4WFFD 2YGVA 4NERA 1LO3L 4CJ0A 5HHXH 4DVRH 3BVWA 3F65A 2WBJD 4M6MH 1G0YR 2H7WA 4WW2A 2EYTB 4FOMA 1U36A 3D06A 2IO5A 5TE6H 4QLWA 1OQOA 1MFNA 2CKBB 3IE9A 1T5KA 3SYQA 4X6BB 4N2OA 1ZXQA 2DQIH 4NZUL 4YBQD 3ZPDA 5KG9A 4I3GA 4MA1C 4EN3A 1WA1X 3EDEA 1DFXA 1TQCB 2R1YB 4G8GB 4J7RA 4NRYB 3C6LD 3GHBL 3GRWH 3C8HA 3QHZH 4ISVA 3A3YB 1C16A 1JGUH 5C0AA 4WV1A 5I8KL 4E0RA 1CICD 1OLLA 5FHAL 1GZHA 2VDQB 4LCYA 1BYOA 1BXUA 4NN5C 2W0PA 2UZYA 1XMEB 5D7EA 3GXFA 1KCRL 4JCWA 5ADPH 3II3A 4JQXA 3IMSA 4OAWB 5FCUH 3EGXA 2BVQA 1RJYB 3WFZA 5ACZA 4IHBA 4M6AA 2YUVA 3PCYA 3SIKA 4X4XB 5FXCH 3RU8L 1IKOP 2EDDA 1FRGL 4UT6A 4BA8A 3SDAB 4X4YB 3ZL4L 2ZNWA 4LP4A 1Z3GH 3GXMA 2Y36H 3DMMC 3KYKH 2NTFA 3ASOB 5C0IA 1E8XA 3QYCA 4A2DA 1D2PA 1EO8L 3LSOB 1ZT7B 1MSPA 4GAAA 4RBPH 5T1JA 5ICZB 3NJMA 4TTDD 1D9KB 2WN3A 1KIQA 4QRAA 1TNMA 5A40E 2CHDA 2XZQL 3DWTA 4F5CA 5AD0A 4XPGL 1FCGA 6FABL 1EUUA 3BKML 2ZOLB 3MPCA 5J5EA 1JDCA 4OZFG 5E1AA 3UABA 3FSZA 2O1AA 4RETB 5E9DA 3BIAX 3QUXC 4S2SA 1WZMA 3V8OA 3FT3B 5D1QE 4GJTB 1N64L 3PV7A 2Z9TA 3R1GL 4WWKC 3U1SH 2E4TA 2OSXA 1W0WA 3QZPA 4PBWD 5I66B 5JW5A 3KBFA 3B1TA 1I7UA 3OAWA 4GXUM 5ILTH 2ZX8A 3LRGA 1ZTXE 4FYSA 3IU3B 3TZVD 2BIQA 5EWIH 2R4RH 4MNHA 4W9LC 4OZGB 5FLVA 1HYRC 2O6PA 2AF2A 4CVZB 4JY6B 1P9MA 2ENSA 4WU7B 3FT1A 1WT5C 2LLLA 4NUJA 4QF1B 1H3GA 1SVBA 4IOFD 3EBAA 3GKWL 3O4OB 1WFUA 3VWJA 1JTOA 1BQSA 3P2BA 1CQKA 1FH5L 3SPIA 4ZUVB 2Z7WA 4PR5A 1PX3A 3S0PA 3H54A 5FR3A 4RGND 1G9NH 2IAMA 4W4OA 1PJ9A 1AAJA 3BAWA 3IGAB 5JQ6L 1D6EB 3MDJA 5MHSD 1BWMA 3ARYA 4C55A 4KJQC 5MERB 2CPUA 3K4DA 4UQ9A 4KK5C 4YK4B 4ZTEA 5E5MA 4XNMB 3WLBA 4D9LH 3CQPA 5BO1H 3WXWL 3RVWC 2AQ1A 4YHOL 3RWHB 2YOAA 5DO8A 4DF9A 4JY4B 1SBSL 2FYYA 2IAND 2X9WA 1QTYT 1HZHL 4NN6C 5BV7B 4M93B 3NCYS 5DJYB 3I2CL 1AO7D 4HXAL 5CBAB 3FFCD 5EU6B 2P5WB 3DVNB 4W4NA 2BSRB 2ZXDA 3LKNA 2O26U 1RIUH 4QRQB 4X6CF 3W0WE 4OFDA 4XMKH 3E38A 4FLOA 4I85A 5DURD 3U4BH 3WIHL 5FOBB 3FTXA 1L0QA 4GRMB 1QX1A 3KS0H 1A7QL 1FHNA 1UWYA 5HI4C 1U8LB 1U3HB 5IHZB 1YNTB 4HEPG 2AQNA 1ZD6A 1U8HB 3V7AE 5I18H 3T0WA 4EUPH 4RNRB 2LVCA 4LFHG 2IG2H 4OF3A 3D0VB 3H7BA 3PAUA 4ZYKA 4DO5A 2JIXB 4A38A 5I1IL 2EABA 1ZHNA 1PNCA 3F04A 1Q0EA 1IRAY 2FR4A 1AGEB 3PAYA 3NFSH 5HJ3B 2K70A 3GYRA 3IMVA 5DYOB 3VXPA 1BZ7B 3QC6X 1KTCA 4TNVK 5B3SB 1M7IA 3A6BH 3FB5A 3FUKA 4NO2A 1MEXL 4Q58C 3Q6FB 1A6PA 3V4PB 5IKCA 4PJ5B 3NSCA 3GSOB 5F9OH 3ATFA 3IJYA 3N40F 3HE7D 1R3LB 3NG5A 4XNAA 2K6WA 4QRPA 2VR3A 4N4YB 1BEYL 4GIOA 3US9A 3P0VH 1G1KA 1MLBB 4NQEA 3VRJA 1VKXB 1RZ7H 3N50A 4F8TA 5I8CA 2BC4A 5T1DH 3ET9F 1OCZB 5CM1A 1A25A 3Q06A 2DKMA 2YUZA 3Q2LA 2EXWC 1HI6A 4HQQL 4KMTL 4K5LA 3WI9A 4OFIA 2FLBT 2BZDA 3OSKA 3VQ2C 5DO2D 3FYEB 3CIQA 3O0RH 3QAZC 3MUJA 3D33A 2GSIB 3TWCL 5HGBA 2DL9A 1MJ8L 4PHZA 4FJZA 1IUZA 4AJ0A 5DJCA 3JVGA 3PGCB 4XP1L 1ES0B 4PRPA 1Y0LA 2O6FA 3VVWA 3U9WA 5TF0A 4KK8C 4HLJA 3CXDL 3QEGH 5C2BL 5F0MB 5BRZD 1S9VB 4KOBA 1HILB 2AJ3B 3EYFB 3SD5A 4EE2A 5GRUH 4N6RB 3BQUC 5TDPA 3ESOA 4O2CB 3O6MH 4DKEH 3BO8A 2EXTA 3EO0B 1QSFA 2FBRA 1X9LA 1JPTL 1DO6A 1SXZA 2FEDD 2XWTA 4X7TB 2J43A 2VLRE 5FYJH 3VVVA 1YEJL 3VNZA 3ZU8A 5IQMA 2CSPA 1F4HA 3BWUF 3ZYOA 2XKSA 4AENB 2VTFA 5DI8B 1S78D 2OR9L 2Y7OA 2Q86A 3NCJL 1SVZA 2IAAC 5L2KB 4WEUD 3T4AB 4G7YL 5DUMH 3TYGL 1L4IA 1YEGL 3MZTA 4P9HH 1MQKH 2FATL 2VWEE 3HMXA 5IB2B 4GINA 5L8LB 2NXYD 5DK0B 4GSDH 1EGJH 2CHZA 1JV5A 4QY8B 2BJMH 5GJSL 2OM5A 1L0PA 4D3CH 5GRWA 3GSQA 1IC7H 2WTOA 4NAMA 1ZCRA 4TM9A 3IAGC 2FX7L 3Q9PA 5F7DA 1LP9B 4LMQE 1SDDA 4XP6H 3SEPA 2WLLA 2WZPD 1YYML 2YUXA 4IKLA 5ITFA 3P9MA 2A2QT 3Q01A 15C8L 5DHMC 5ERWB 3GI9L 4R9HA 4DN4H 4NN7B 1ZT4A 1JI1A 1FNEA 5C0NC 3MC0A 5L88L 4QTHB 2QVIA 4Y2DB 2CJUL 2AVGA 3ARZA 3D8MA 1D3CA 4Z3IA 3LKSB 1H8LA 3ARQA 3F12B 2EE0A 7TAAA 4PJAB 1BQKA 3HZYB 4JO8A 2R4SH 4L8BB 4P5TA 1KJVA 1QSEE 1D5ZA 5GQBA 3PABB 1AIFA 4J6IA 3K7UA 1JTTA 4OM1H 2V33A 2MCPL 2G5BB 1YC7A 3KBEA 2Z92A 4ETYA 3CFNA 5B4MD 2F74B 3PE9A 3LN9A 4WHTB 4JM2B 2JWYA 4KXZI 3PL6A 4NI6A 3RI5K 1HEHC 4LRNH 2QGCA 2WLMA 4YPGB 4K3EH 4N3TA 5IMLB 1LEIB 3L5XH 3O45B 5MP6H 2WQVA 3FU8A 3UAJA 2A6JA 4R7NA 1DZBA 4NFDA 3P54A 1DVFB 2C8NA 5E2JA 5EZIL 2E46A 4G5AA 1JZ8A 3BIBX 2H2SC 3LIZA 4MCZA 4HIIB 3IDXH 2CA4A 5EOQH 1WCQA 3ZTEA 2PCPB 4K8RD 2N59A 2Y4SA 1Y1DA 1Q0YL 1R5WB 1KDIA 4LNRB 4JZJB 4KAQH 4KXAA 2BOCA 3ULVE 2AQ2A 3W0WD 4OCYH 4B96A 5D93B 4XP4L 4EZKA 4U33A 2YIHA 1FZJB 4I9XA 4GMTH 1WBZB 3B2VH 2E7CA 3CSGA 4L4VE 2OMVA 1SHSA 4H8PA 4XZ4A 2IWKA 3L3OB 3TIEB 1JWMB 2FT6A 5CJ5A 5IZ7A 1T6BX 1KLGB 1G1CA 2YOCA 4NKMB 4FXGB 2HT4C 1JF6A 2BOLA 2J8UA 3QZWB 3KXFA 1THCA 3Q1SH 5BS0B 4HSQA 1F86A 4HWEH 3IWUA 3D0LB 3BUBA 4HS6B 1OTSC 4UIMB 1Z5HA 5C07E 3S6CA 4EDXA 1DDHB 3BJLA 2D31A 1EPFA 1I3VA 1MFVA 3QNYB 2Z8VC 1GGCH 1GIGL 3ZZ1A 2Y7QB 4KVNH 2DIBA 2ISDA 1Z5LB 1BOGB 4ZAKC 4M6NL 3P3YA 4JFWA 4KQ3L 4R90L 3W9EA 3QDAA 1YNLH 2HLFC 3NPSC 4B0MB 2YRPA 2WLKA 3T2OA 2OP4L 3QUYC 1KUMA 2Z3FA 3G04A 1QSZA 5ANME 1B2YA 4CSZA 3F83A 3NEXA 2NZ9C 4FMFA 3LKOB 4AOFA 1NAMH 3LZRA 2VERA 3BH9A 5AW7B 4AQ1B 3WS3A 4ZJ9A 4J2QA 1SUJA 5E6YA 1CT8B 3FOLA 4FQHB 3CDCA 3FBQA 4TMPA 5FO2A 5HHMB 2ZXAA 3ZE0E 1BVKA 4NYLB 1IAKA 2NY1C 5EZPA 3S36H 4PJ8C 3S37X 5I1GL 1P5VA 4J6RL 5FGCB 2CG9X 3OKDA 5ISZB 2DWSA 2K78A 5HVWA 2IDFA 4M62L 4NUGL 3VW3H 3WAJA 2CR6A 3R8BB 5J57B 2G3MA 1HCFX 1ORSB 1EXHA 3ZMNA 4HUWB 4Y1SA 4DZBA 1A3LH 3KPQB 1SYSA 4TVSa 2YD8A 4YHYC 1J8HA 4MWFB 2CLZA 4M5YH 3LPOA 4P46C 5D2NC 3HC4L 1Q0XL 1FFNB 2CXGA 2J6EL 1HOCB 4K5PA 3PGDB 2WSKA 1T0PB 2VLRD 3VI4A 3VRIB 5DC4B 4FABL 2LTQC 3V10A 4IMKA 1LNUB 3QT2A 3FQUB 1MFBL 2IGFL 5HHOE 2B15A 1S7RB 1ACXA 5ETUA 2DQCH 5FO9B 1N5AA 2CU9A 3T3PE 2I07B 1ZVNA 3DMMA 3AS2A 1E28A 3MLVH 4M03A 4JHAL 3C60B 3KWXA 1N6UA 2Y3NA 3PY9A 1BM3H 1UOWA 2VQTA 4KO7A 3CCHA 3POCA 3REVA 5L7XH 2AXFA 3M07A 1P1VA 2DL2A 2IADB 4OKVB 3MN8A 5GRVL 1LO4L 4YBLC 5J11B 2IDCA 1J88A 4LF3A 3P2TA 4P48A 4U1KA 4M7JH 5AG8A 3WFCH 2JCWA 5I1DA 3VXME 2ODHA 3RDJA 1E8ZA 3QISA 3ROOA 4GW4B 2VCOA 3L9YA 4DHLA 1CF8L 3OAZK 4HJJH 2IQ9L 2QSCL 2DBJA 4GT7A 2JH2A 2NPLX 3QUXA 2W95A 4JUTA 1OM9A 4ONHA 2EUWA 2DM7A 1FN4A 4R8WH 1DVZA 3BHBB 4K7PY 5I1JH 3BD4A 4OCRL 4UOW0 3UTTB 2XVLA 1TZGH 2O72A 1BFOA 4IRJB 4WWKA 5D1XC 4PJEF 4NKQB 5E0FA 4GKZB 1QSED 3N44B 2EECA 1ESOA 1PNDA 2FEEL 3U0WH 1R9FA 1R3JB 2J12B 2P47B 4AEIH 4CGUB 3DV4B 4F7PA 2XWXA 3EDJA 4MJIE 3BUDA 2BMKA 2PYED 4C54A 1XF5A 1OD9A 2Q1EA 3GINA 3GPEA 4XE5B 3PGFL 5C0AE 4YSEA 2VDQH 2V2XA 4PY8I 3TEZA 3KLHC 3I6KB 3BEWB 1AKJA 5K5YA 5IMMB 4IU3A 5GGTL 1MVFA 2BIHA 1FPTH 4NB7A 1FGVL 2QHRH 1RZGB 4X6DE 2FGWH 4N85A 4P5RA 5DWUH 5FUCE 4DGYH 2V5YA 2XV6B 4C56D 1WT5A 4ECNA 1D5BA 1G7JA 1VGKB 4FQQB 4ZI8A 4XODA 2VMJA 1ZXKA 5IQ9B 1E90A 2FHBA 4AIZA 1IGML 3FCTA 1XF3A 4ZNEA 1CU4L 1KLUA 3UJJH 3VD4A 5GZND 4GBXC 5AYTA 4URTB 3G6AA 5DEZA 1M7XA 1HHKA 4XNUH 4ZK8A 1GGUA 5ABAA 4D0CA 5EC1B 4F2MB 2JQMA 4KNTA 5SWSE 5JHDE 4HAGA 3TEWA 2E9JA 3F7KA 2OL3L 4ACTA 1EEZA 4GI8A 5EG6C 3QXWA 2WB1A 3EJUA 3FQ4A 3V4UH 2FO1A 1PS3A 5AW4B 1YEFL 4MQXD 3MBXL 4I18B 3ZLQC 1OAJA 4LSSH 3KLKA 1KYOK 4CILA 4XVUC 1OAXH 5C8JB 1YUKB 3MNVB 4M3KB 4P9ML 3DIDA 5BVJA 2A6KA 4TQIA 1BG9A 4R5VA 5EOTB 4F5CE 1PEZA 1R46A 1DLHA 2Y7MA 4ZUSA 4WEBH 4KU1A 1LO3H 2CWRA 3DX6A 2X1XR 1O6VA 1F8TH 3NBNA 1TVBA 4HMEA 4JHVA 5C9KA 1N6QH 5C07D 1KJ2L 2ITDB 2VDNL 5DZAA 3KJ6H 4UBDD 4Y4KB 4D94A 3MRCB 3VGAC 4EI6B 2Y7NA 3L5JA 2X4PA 3CLEL 1DBMH 2GY5A 4BFBD 2YPLB 1IEAA 3RWCA 2ZXQA 5CEYA 3RIFK 3NSJA 4Z3GA 2R56L 1U30A 1UUNA 3IFLH 1R4XA 4H0LC 2BP8B 4P5MB 5C0DA 2VZVA 2VLJA 3ML9A 2ZONA 4UZUA 2Q3AA 3D12B 3D07A 3HAEB 5D7LB 4I4WB 4QGYA 2LQRA 2R27A 4WJKB 3S34H 3STBA 1XGYH 1S7QA 1KYAA 3E8UH 4AEHL 3LEYL 3ME0B 3KPLB 3I02B 2QADD 1E9OA 4XTRD 5I1LB 5L0QC 1SFDA 2WQUA 3QG6A 2VXSH 3OKMA 3TBCA 4P2QE 1AGFA 1SNRA 1YG9A 2XN0A 5TPWH 1MREL 1E5AA 1E5YA 4NM8L 4IRSC 5FFLA 1E4XL 4L8SB 5GIRA 4ELKA 4FA8A 4A6YH 2QKIA 3OGCB 3P69A 1AZZC 3ZL4H 4AV0A 3CV5A 1DJYA 2JI3A 3VXUB 4JREC 3LB6C 4PJGA 1ERNA 1KCKA 3SO3B 3WENA 3RVTC 2FQFA 3S3PA 2EJ1A 2Q20A 1QFUL 3C8KB 3OAUL 3RPKA 4RBPK 2O6EA 2BOBA 5TDOB 3LEXA 3M7FB 4YIQB 1FNGA 4P5KA 3C6SA 3WD5H 5D1ZD 2AEOA 3JT2A 3E2HB 3MFFB 1QLFB 3NSYA 5T3XE 2E0PA 5DRNB 2MFNA 3VCLA 3H9HB 2XZQH 3IPFA 3HE7B 4OCSH 4OZFA 3JV4B 3K8LA 2ZF8A 3D1MC 4W9GC 1ZJBA 4XPGH 3BKMH 1OF0A 5E2VL 1CZ8L 5I28A 3GZPA 4JVUA 1RSFA 5HHOD 1BW8A 5DU7A 2X2UA 1OB1B 4JFPA 4YE4L 3BQUA 4IRZL 5EFIB 3AS3A 5C0BA 4EPSA 1KBPA 4BJLA 2WUCH 4MJHA 4QKTA 3K5SA 5DXWA 1B2WL 4ZFOL 3BT2L 3BVNB 3R1GH 4ZW7A 1R24B 3QUML 4WJ5A 2CDEA 5E8OA 2W5PA 1YDPB 1Z9SB 5KSVB 2D3NA 3IPBA 3PRZA 4P3WA 4LKXA 5DZVA 2OCCB 2VN7A 1FLRL 4L8CA 3CSFA 1PYWA 4YR6B 1MI5E 3OWRA 1VEOA 1T20B 2BY1A 2HKAA 4B9FA 3CUPA 5KJ7E 3ATBA 4GG6A 2NY6C 2VXQA 2AI0L 1T1YA 1EEYA 1H3XA 2R1XA 2IPTH 1GGBH 1OLZA 2QR0A 4A04A 4BFRA 4DW2H 1BXXA 4Z95L 3V0AC 5DZNA 4EN3D 1Q4NX 3FQRA 2RBLA 1U8JA 4PRAB 2GFBB 4OZ4B 4PS7A 1UD5A 4HT1L 1EAQA 5HGGS 5FM5O 3TJHD 1IBZA 2DWDB 1HFUA 1YMHB 3HNVL 4RSVA 4ZOAA 4CN6A 5C0AD 2D3LA 4XBEL 4G8IA 3B9DA 1NINA 3GLEA 3S48A 1SBSH 4YSRA 4YSTA 2Q9OA 1P1ZA 3G6DH 5F8RC 3CXHJ 1MJ7L 3QDJB 4G43A 4WU5B 4YSCA 4P2CG 1NBYA 2VRAA 4NNYA 1F6AA 2N0MA 1UT1A 3GBLA 4PJHA 3E8VA 4PRPE 4XC3H 1H15A 3ZO0A 5K9OB 2X09A 3EGSB 5F3BA 2Y06L 5D1QB 1IAIM 4YNYA 3UBFA 3V6BR 3VI3F 5F6IC 4NZTH 1MJJA 5IVXF 1IGCL 2E7HA 3AFLA 4U1GB 3F7VA 4QHNA 2HRPL 3MRKA 1HHHA 1C5BL 2E3VA 3QARA 4R84A 3L3GA 5I0ZA 1QSFE 1RFDL 2BXZA 4MZRA 4F8PA 1ZDSA 4YAQB 2R8SL 1MZYA 3REWB 4ONGH 3V52L 1OGAA 4LPTA 3WE1A 5SWZA 2NZ1A 5I17A 1I7TB 3MV9B 5E99H 4ZFFB 1V7ML 3G08A 3NJLA 1CK0H 1MHCB 3VFOB 4XGZB 1HH6B 1INEH 3GJEA 4RMUA 1TPXB 3H6AA 3DYPA 1RY7B 3BRDA 3QRLA 4L0ZA 1O5DT 3JZ7A 3LY6A 3EH5B 4NNPL 1RZQA 1E4JA 1YSOA 3WKNA 3BP5B 3ESVF 3V0JA 5DQJA 1MEXH 5I15L 4X6EA 5E9DD 3TT3L 1KGCE 3FT2A 4AVJA 4N2HA 4PJIF 1MCOL 4KKZA 4OTXH 4RH4A 3K91A 5F7UA 5TE7H 2X6VA 4JUSA 4OGXH 5MEOA 4IGBA 2Q2LA 3V79C 1J0IA 4JHBA 1SGKA 4MB3A 4QRUA 2VGLM 4OU3A 2R2HA 3HC3H 4AIXA 4LVOC 2XWCA 5E1QA 4U1IA 3GSXA 4F8QA 1JGDB 1E50A 3ZUCA 1BD2E 4PW3A 2GC7C 3K4ZA 1YUHA 1HQRB 3EJCA 2QPFA 3BSZH 4Y2OB 1QWHA 3HG5A 2GJZA 4F2FA 3FO2B 3PIQA 2X4OB 3FTWA 1TEYA 4G9FE 2J5LB 4O5LL 3VWJD 3L1GA 3ZOAA 3K81A 4O51A 3QUYA 1D6VH 4UU9A 4YHKH 3CN1A 4XN8A 5JHLH 2CRMA 4XP9H 4KTDH 1Q1JL 5JIDA 2G2RB 2XZZA 1B0GB 4ZRGA 4IBLT 1JPTH 1OGPA 2VMFA 2FSEA 2YSSA 4LHUB 3HC2A 4QNPE 1MHPL 3SGDH 2WQSA 4XN1A 3NUKA 4M7LL 4PJ8A 2OPCA 2QPUA 3SPJA 1F1DA 3LJ3A 5T3XD 3SQBA 5BOZG 4GI9A 3KPPA 3UROR 2FATH 1KYUA 1DVXA 3GGWA 5ADOL 5KZCB 1ONQA 1PD1A 2ZUWA 1BAGA 2I5YL 1IAII 4JFXA 4L29A 1UZ6F 4WIQA 4P46A 2GC4C 2PTTA 1HKLL 1QASA 4D0BA 2F8XC 3R7RA 2HMID 3QNXA 4OKDA 1UXLA 1U8CB 3LHAA 2J8UE 4OIFA 2QV2A 3WSQH 3KXFE 3SPHA 4KBPA 5FUZL 2DMHA 4BBWA 4MA7L 4Z7VF 2EVJA 1KGYE 2AV7B 1P6FA 3SDYH 2QSTA 2ZWZA 2X41A 1I1YB 2A0LD 3P73B 4I0PC 3RB5A 1KJMB 2PKDA 2E8YA 1AIZA 4CU7A 1S9XB 1HDMB 3MCKA 1OAUL 3EHBB 2CO4A 5CR1A 4WI4A 3PPEA 3IDNA 2JJSC 4HYTB 5G4OA 5C09A 2F58L 1KB3A 2VDOH 4QRPD 3GMQA 1QBBA 1CGTA 2EH7H 4NQED 1S7TA 3MRQB 3DTXA 4NO3A 2VLRB 2EDWA 5EO1B 2VNCA 4JZNA 2Y1YA 1XTMA 5KTEH 5CLZA 4KZDH 1UZGA 2IBGA 1JHLH 4RRPG 2PCFA 3FRPG 5HI5D 1P5UC 1WS8A 3Q5TA 2GI0A 3BN3B 4XI5D 4YEEA 4ZO8A 5ID1B 5CZRA 2EIBA 3P3TA 4HPHA 3PJSA 1NL0H 1LEKB 2VDMB 1V27A 3CNKA 3LRSA 4HIXL 5D1XA 1BIIB 4M61B 1C5DB 5SX4H 4OFPA 1QLEB 1QHPA 3Q3GB 1DBJH 3RX8A 2YPVL 3DVGB 3GS0A 4PRPD 2WIIB 3HNSL 3ZRFC 3GMMA 1I8MB 1RI8A 3FUFA 4BK5C 2LVEA 4LAQL 3QULA 3QCVH 5CNHA 2QMKA 1OP5K 5KN5B 5IB1B 3VFNA 4X7SH 4PTUB 1A6AB 1WHOA 4H4NA 1AS8A 1QSFD 2NW2B 3LPPA 4MCYA 4PCSA 3U4EB 5I1EL 2VSCA 2MNUA 3VI4E 3OJDB 4JPQA 1R33A 3GKZA 1PFOA 2KC0A 5JA8B 2V3EA 4N1HB 5IREA 4FNLH 2DQUL 5GGSY 1VLXA 1HWGB 1S3KL 1QSEB 5DJ2B 4GBXA 3GSNB 3ZIMA 2C3VA 2X4TB 3RQ3A 1KLFA 4HCRA 3RL1A 4M9OA 2CBMA 1N67A 5FAAA 3WOVA 1JZ5A 5K9JH 2R69H 1CBVH 4Y7OC 2ZD0A 3BWZA 1UACH 3KPNA 5EN2A 1KGCD 1J10A 3P9LA 4R90H 1U95B 4OSUH 3IJSA 3MUGA 4OZHA 5IUSA 1SYVB 2OP4H 5CCJA 5EBLA 1KF9B 2YHGA 1IGIL 2ATPA 3TEXA 5CZVL 2G2PA 1AR2A 2Z65C 3F7LA 2G9HA 4MZ2A 5GGUA 1XF2A 5EZJB 4Z3JA 1W16A 1DN0B 3KNBB 7PAZA 5EU7C 4Y9BA 1P4IL 1U3YA 1ZS8B 4PJDF 2ODIA 2D03H 4LIQE 4P5TD 1I82A 4J6RH 3TS8A 5EEWA 1G7PB 1FL6B 4FFYH 4L4VB 3HLAB 4GG8A 1BJMA 5A16A 1MFCL 5CIPA 3F85A 3FTGB 3CVDA 3PL6D 5IM7B 2QDWA 1RD6A 2VITA 1VCAA 4U1HB 2HAZA 5I75C 3K71A 1DJXA 4WUUA 4JJ5A 4PJ9B 3S36X 3UAJD 2DY2A 1NFDE 5KVEE 3ECWA 4GP8B 4MTMA 4EDWH 4E68A 4F37K 2J6EH 3CFCL 4KVPA 1IBGH 5D7IF 3MACL 4FABH 2B1HL 4APXA 1NUGA 2VQUA 4KI5E 4K3JL 4ZNEE 4IRSA 3ZKMC 4XNQB 5J1AB 1XGRB 1WS7A 3B9AA 1WITA 4LRIC 3VXTB 1NM4A 1S9WB 4LP5A 4RX4A 3OV6A 2UZPA 3CFKB 4EUPG 1HE8A 1I7ZB 5T5NF 1WBXA 3OLGA 4Z7OE 2FRGP 1T2QH 2YZ1A 3U30C 5DSCA 1KB5L 3HRZA 2EXYD 5ANMB 2L8AA 5I74C 1W8OA 2HYMA 2WPGA 4XXWC 3VQMA 1T04A 3LZPA 1LO4H 2QADB 4E9TA 1GS8A 2CJTA 3SD2A 4Z76B 3MXVL 5FFOA 1IJNA 4A7GA 1ZVSA 4OJCA 1ZE3H 2WNWA 3IVKB 4ODHL 5DD1L 3EFDL 5KVGE 5EEYA 5T1LB 3Q8CA 2A83A 2IQ9H 4W9DC 4BHUI 2Q7YB 1AZNA 1Z9NA 2ICEB 4JG1L 2NY3C 5F21B 5HPMB 1JIBA 4B41A 2VAAB 1T1XA 4C8XA 4IJ3B 1O7VA 2GTZA 1U41A 1FI8C 2VISA 3DRTA 1O6SA 2IQAB 3QJSB 3BP6B 1GZQB 2EIMB 1HKFA 1MY7A 3I6LD 1YCSA 4J39A 4S1QL 3CFDA 3BFOA 1ZTMA 1TQSA 4RIRA 3L3JB 3V0WL 2VLJE 3CLWA 1D5XA 1ZIBA 3QORB 3FQXA 2BP0A 2KLSA 3O3AB 1C1EL 5TK2A 2DQ6A 1NBCA 2HT3D 4M4PA 1G87A 3TONA 1NGYA 2YAHA 4QRSA 2AKRB 1YJDH 1AGBA 2XIDA 2JKRM 4A55A 1FGVH 1AP2B 1OTTC 2QL1A 3U4EA 5HHOB 4LSUH 5B7EA 5IBLD 1IKFL 1XGQA 3O4LA 3T3PB 3BRGC 3QUZC 2BVOB 4LZKA 4HWBA 5LKNA 2DYPB 3K2KA 1S7WB 1KTRL 1OP3H 1IIIA 3O6LL 4RWYH 4MB4A 4YE0A 4NQVA 4MZ3A 2EEXA 3MR9B 4PJGE 4WEMB 4FA6A 1XH3A 1AQMA 2OL3H 1D7FA 5D7HA 4BZ2A 4Z77A 4A2GA 3O8XB 3MCG1 1A3RL 1YEFH 4XNZB 3VXMB 4ZXBC 1J8HD 2CKBL 2V7NB 3EFFB 3HI6L 25C8L 5E6ZA 1WV7T 4JHUA 2H1PL 1HHJA 3GLDA 4DAGL 1XMWA 4KUZL 2IPUK 4WW2B 2X70A 1ODAA 5DC2A 1JOIA 1KGWA 1FG9C 4JFEA 3WTWA 5DLMH 3MSPA 3WO4B 3QNZB 4HSAC 2F1EA 4TULL 4KWUA 2ZP0T 3BJ91 3JV6A 2XKUA 3EH1A 1M6OA 3MV7E 3WG7B 1DEDA 3U9PL 5J3HD 2WUBL 3DMMD 4XP5H 4MJIB 5B39G 1DSYA 4ISVB 4BRJA 2EKJA 3CLEH 5C0AB 3O6FB 4PM1A 4WV1B 4ES9A 3CFQA 2ZSVA 4P99A 4U1NB 3TP4A 3TIDB 3UACA 4MVBC 5JW3H 1TCRB 3G9VA 4X6DB 1I53A 1JWUA 5IG7B 1GW0A 4B50A 1EHAA 4AH2A 4K0OA 4AJYV 4WTZG 3EGXB 2BVQB 2XWRA 5J9PB 2AC0A 1W15A 5JOPE 1JDDA 1GAFH 3CXFA 1WA2X 5E4EB 1SN5A 4XCFH 5LNDA 3OWEA 2YK1L 2CBPA 4G82A 5EA0H 4GG6E 5AW1B 3QUXD 1RULL 2VSMB 2BS8A 4UNUA 2X53A 5DVKA 3RPIA 4ADGA 1JGVH 3BAJA 3D18B 4PWKA 5SWSB 5JHDB 2I9LB 5DRXB 3PJLA 3SCMC 3V4VA 1ANUA 1MREH 1A7NL 1XF4B 2ILLA 2X3BA 1IM3D 4WWKD 4YHIA 1TJGH 2ZX7A 4J2XA 1E4XH 3T6WA 1BJ8A 3TOPA 5D7JB 4BWTA 3NIDF 1K4DB 3F58L 5IROC 5HPOA 2XPZA 5L9DL 2HG5B 1VGEL 1AXSA 1AKJD 4FQJH 3O2VL 4NLHA 3WFBL 3BISA 3KDMA 2PXYB 4XB3A 2H6PB 4P2OC 4YUEH 1QATA 1PY4A 3VX0A 5KS9E 3KPSE 1WAAF 4F7CB 1J9SA 1I9IL 4MMXC 5DQDL 4QCIA 1WO2A 3VSUA 2EH8H 3DXAD 1L9MA 1QA9A 1CGSL 1MHHB 4YDKH 5GXBB 1OF2B 2OA9A 2PW1A 3P4MA 3SE9L 4YE4H 1U8MA 1WWCA 5T8IA 3UGEA 4KJQD 1WFNA 4WGVB 1I7UB 4KK5D 4MS6A 1TTAA 4GQQA 3JWOL 5IHHA 3RVWD 3FT4B 4Y5VB 1OGAE 2WINB 5FV1L 5SWZE 3OB0H 4HKXB 4DP2X 2BS9A 2COQA 2FLRT 1BZ8A 4HP5A 5HHVH 5LO7A 1MFUA 3VFSA 3PWJA 5FW6A 3APMA 5DYFA 4CNIA 4M00A 4BQ8A 4HG4J 4AGNA 1FLRH 4JKPH 3VWJB 3KPRE 2QPEB 4P2QB 2MKLC 4TTGA 4ZSOA 4HUXA 4PR5B 3DBSA 2D3VA 3BVVA 2IAMB 5DVPA 3GJFB 3M1OA 1JHKL 4ZFZB 2DW5A 2JXMA 3AMKA 3KDPB 1FLTX 5BV7L 3V5HB 2QGBA 2AI0H 2FGZA 3OJ2C 4MKTA 4NQUA 5HI4D 1A2YA 3CFUA 4TUJB 3LXAA 2IV8A 2OYKA 1OP4A 5A2BA 4JO4L 35C8L 4Z95H 3DX7A 4AYEC 4J3VA 3SGEH 2F53A 2GBAA 1UWEH 2FYYB 3QFJA 4K8RH 1AE6H 5FKAA 1MRDL 4NIKB 2XNAA 5EO9A 5HYEA 1T6VN 2Q8AL 2GAZA 1X4ZA 2XFGB 4PCKA 4HIHA 4PGCA 5SWQB 3IXAA 2AK1L 5JPMB 1CXFA 4HH9A 4FF9A 4I0PA 3DJZA 5DJAA 4P9HC 2JB5L 2PNDA 1OT2A 4AW4A 1RMFL 4GAFB 4O2EA 3ZN6A 2EILB 1I9EA 4IIQC 5JMRA 1WRFA 3MJ9L 1MJ7H 4LASH 2JJSA 1EANA 2CGRL 2OXHA 1EAOA 1NMAH 1JGEB 3B7TA 5J13C 3NCXA 1F97A 1V10A 4MJ6A 1RJLB 4Y4HB 1IGCH 5C86A 4KO9A 4F33A 5EMYA 3ARDB 3G9AB 3BH8B 4AQZA 4BINA 1F90L 4ZYKB 2ETWA 5I0VA 1KXVC 2GITA 2WQAA 4IEFB 1YPZF 2EXWD 1QEWB 1ZHNB 3QIBC 4H1LA 4WK2B 3V4PL 1PZBA 2YEVB 4HD9A 3SDXA 4ZX6A 1P5UA 2ITCA 5F9JB 3E3QC 4XNXH 1HS6A 1MI5B 4KFMA 4OGAC 1AI1H 3ABZA 1BAWA 2DWEB 3J7HA 2Q7AA 1JNNL 5BOJA 4J3SA 5IKCB 4AYMC 2WGXA 2WNKA 1B6UA 3EOAB 4KK8D 1UM4H 4ALAL 5GGRA 4BK5A 3JZYA 3H9SE 3TEYA 1VADA 1UYWH 4WFHE 5I8CB 3F3HA 4HGWA 2DF3A 3BQUD 2DTSA 5C0BD 4R3SB 4YQXL 5D2NE 2X4RB 4JDTL 5EF2A 2R2EA 1NGXB 4CC4C 2LGNA 5J12B 1HI6B 2R0KH 3GM0A 3WDHA 1IGTA 1XR9A 1C7TA 1UA3A 2Z6FA 1FVCA 3FHQA 1UB5A 2UWEA 1OCWH 5HGBB 3PWLA 3INUL 2DLGA 3W82A 4CADB 2Z8SA 3A6CL 4YGVA 1RUML 3NRQA 5E8EA 4QHPA 1XGTA 1OANA 1UWFA 4OF6A 4PRPB 1IB5A 3OHXB 3ZKND 1PZDA 1RH8A 5KVDL 4MXVE 3UG5A 3QEQE 1A5FL 5JNYA 1EDYA 1PCSA 3MRLB 2EC9T 3LKPA 2VL4A 3LDBB 3LS4L 5IK3A 3U7AA 1LK2A 4O5LH 1ZK5A 4ZMVA 3RUGA 4KTEH 3D48R 2Y1AA 1UADC 1WD9A 4PV9A 5E9AA 2WXOA 4G1EB 3NDYE 5I82A 1A9BA 4FNQA 3O3UN 3KYOA 4DPBX 1E27B 4HHGA 1SMOA 3D3VE 3LTVA 4FQCL 2HCZX 3GTVA 5I8OL 3EBIA 4PWJA 1N26A 1G6RH 2MCAA 2ED7A 3QEUB 1M3JA 2GJ6A 3NYKA 4XRCA 5FYKE 4ZO7A 4NKOB 3IF1B 1HEZA 5BQDA 4G6KL 2BCKA 3FUJA 3MRIA 3TV3H 5DEGB 1EX0A 1JV5B 1AQKH 2GUOA 1BVNP 2V5SA 3V0VA 5FUOL 1ASPA 4X9IA 5CN3A 4NQXB 4QRTA 4K94L 3LZQA 4UINH 3HZVB 3VFUA 4OZGF 1AFVL 2X4SA 3WEXA 4AT6A 3DSFH 4HKBA 2SODB 2YAOA 3FAXA 1HNGA 5EC2B 4PY8J 4ELMA 1FA4A 3WY4A 4U3SA 1KEMH 4M3HA 4PS4H 5BZDA 1RUQH 3B8YA 3G6JB 3A4DA 1JZ4A 2YJLA 3HE6C 2IPUG 4YVUA 4AV4A 1IVTA 1OGAD 4L0PB 5DK2B 3DLQR 5SWZD 4ZS6C 4AMKL 4Q2ZA 5FYKU 2H2SD 3F6LA 4ZUWB 1U58B 1BD2B 5AUMA 4HLZH 2A4ZA 1QW9A 1N0LB 4I1NB 3W1ZA 1PY0A 4P5TB 2FWLB 3RTLA 1KPVA 1A7RH 1D5ZB 5C0JB 4MA7H 2B2XL 2YZ8A 1BSIA 2TSAA 1EAPB 4LRIA 3ZHDA 5ALCH 4G9FB 2XA3A 2HH0H 3ORJA 4Z9KB 1PDKA 1L9QA 4HIJA 5I6XC 5LBSH 3ARGC 1DVSA 3GRWA 4PSPA 1QFHA 4GAGL 3G5XA 2AQSA 3MLZH 3I6GB 1ZRUA 3IJHA 3SDDD 4XXWA 5DK3A 5TF1H 4OZHE 3II1A 2PP7A 1XB6A 3ZT6A 3UJIL 3P4OB 4XWGH 1HSBA 4IGBD 4P2AA 4POUB 2OTUA 5K59F 1A1MA 4WCYH 1I1CA 2HT4D 3K1DA 1E6OL 2H47C 5HDBF 4XAKD 1Q94B 5B7MA 2BY0A 1DL7H 2XIBA 3C5ZB 3K1KC 2BHFA 4WI8A 4X98A 4RRPA 4EQ3A 4H40A 3ZL2A 1K8DB 3NABL 1OTSD 4JJOA 5DC9B 3ECBA 5PCYA 1FDLH 5E95B 3ZTJG 5IB4B 4H8QA 4X6FB 1DQLH 5LB1A 1KIUB 2MPVA 5TFSL 1BAFL 4HIXH 3MLUL 1X5ZA 5JIKA 1EVTC 1QFWI 5GSVB 4J5VA 3KJ4C 4OD1L 3HZMA 2HLFD 5AENA 3WFDH 1UJ3B 3IKKA 2XA8L 1H8NA 3QUYD 2D7MA 2Q0ZX 1P4LB 4UV4H 1I1AC 1J1XH 2DOCA 2NZ9D 1N7ML 2J8UB 4PBDA 5IW3A 4MKMA 3KXFB 5K1JA 1M1XA 4GKSA 3MLRH 3ZL1A 5C9JB 4N5EC 2OZ4H 2BP3A 5FA4A 2WXRA 1NKRA 4UNVA 1FC2D 3QUZA 5K1NA 4OVUA 1CLYL 3BAEH 5ICYA 3FK3A 1Y6NR 1SOXA 1ZJAA 3GXTA 4JO1L 4D9RE 1TZOA 2F8OA 1A3ZA 4PAZA 3B2MA 4PJ8D 1ZHBA 1QWUA 3HPJA 4M1DL 1XSJA 5B1AB 3C5SB 4IKNA 4L3FA 4XBPA 1A64A 1M05A 4ZMLA 4GRWF 2WLIB 4N8CL 3L6FA 1NANI 2CMRH 2R2BA 1JAEA 1KT2A 3K2UH 4PMFA 4AK1A 3VO0A 2OR7A 4ZXBA 2D7TL 3IJEB 2WMPA 1REIA 4P46D 1KBGH 2YC1B 3DIVA 3BPOC 3LD8C 4X5XA 2E6JA 5DRZA 4NO5A 2ZXGA 4JHZA 1DBAL 3FOLB 3B37A 3IDGA 3TTSA 3X1NA 3I3EA 2HB0A 1RU9H 2GJPA 3EYOA 3GMOA 4KK9C 5GGQH 1BVKB 4WWPA 1PG7H 5KYWA 2XVBA 3OLDA 4FLSA 4NENA 3T3MF 1P5VB 1AJ7H 3EYUH 3THMH 1ZLUH 3HR6A 4FI8A 3HZ3A 4QYAA 4PJ7A 3MJ7A 1BVOA 1JPFA 2TRYA 4Y5YC 5JPNC 5D5ME 5BNXD 2E6PA 5I1AA 5IFAL 1NEZG 1R47A 4HXBL 1QRNE 3MYJB 4Z7WA 1FF5A 1CFNA 3QXAA 2VSDA 4U6HB 2QQKL 2PCXA 3EIFA 1KZQA 1U3ZA 3H3BC 3CDZA 4NN5B 3BOVA 2X1WL 5C09D 2ZUXA 5JIMA 2VM4A 4OCXH 5IOPA 4YXHL 4OUUA 2YA2A 1S5IL 2MCG1 3VI4B 1JYVA 2LR4A 2DQTL 4DUVA 3L08A 1UQSB 4HFUH 2KQMA 3WELA 1YYLL 1RJCA 1UZ8A 3CXHK 2V5TA 3T0EC 2JCCF 3EO1A 3ZYIA 4FJYA 4LK4A 2CD0A 5C7ZA 3ULUL 4YHLH 5DUPH 3N04A 3SCMA 5D1XD 3CSBA 3E6HA 1BFSA 4YL4A 4AYID 4M8UA 1NLDH 3FUNA 5AVZB 4GO8A 3D30A 3FQTB 2LFEA 5IROA 43C9B 4PJAF 1IQDB 4OZIB 5E23A 1JV2B 1VPOH 2L04A 4LF3B 2ED6A 5C2UB 2J1KA 1KB5H 1GC1H 1INQA 2BNUA 5AW8B 1FYTE 3KLHD 1E67A 3ZE2E 3QR2A 4BSVB 1PLBA 2WOBA 3QUHA 4KK6D 4P2OA 2QGEA 3QUXB 4JM2F 2AJSL 2O5NA 1FN4B 3MROA 5FB8B 4JFEE 4BCXA 4K3GA 5DD3H 4I1PA 5DD1H 4WO4B 4PB0H 2C34A 4GBXD 2F54E 3ZE1F 3QIUB 1O75A 2YEZA 4IDLA 4UNIA 1VFAB 4JFZH 1FE8L 4NQDA 3LNHA 1I8UA 2IH3B 4U6YA 1BZEA 2H3NB 5EHFA 5EUKA 2ALWA 3M46A 4I13B 4XO3A 3WUWB 4BE6A 4BQBA 2V2XB 3QW9A 3N06B 3HKFA 1OEZW 4U4BA 1MCWM 43CAB 5I0WA 3N85H 2QDVA 1BZ9B 1SM3H 3PP3H 4GO6B 4ODTL 4XVUD 1NFDB 4X5WB 2GUYA 5JW4R 1D5BB 2D2CC 4NHUA 4S0TD 3T77A 3NCMA 2NDGA 1O7SA 2AJYL 3NJVA 4XMLL 4AIZB 6TAAA 3BWUC 3CMGA 4N0FB 3FCTB 3MRBB 2VUOA 4TQEH 1BQHA 1KLUB 5CP7B 4UT7L 1JVLA 4ILDA 4UT6H 3QPKA 1UG9A 2BNQE 2JFCA 4O2FA 1G0XA 1ORQA 3G6AB 3NACH 1SDAB 3RVVD 1CDIA 1IC5L 3VGFA 1IM9A 1FNSH 1R1CA 4MGXA 2VQ4A 4DTGL 1XDTT 3IDIB 1K3ZA 1JXJA 4LE8A 1CXEA 3MLWH 3SQOH 2Y0SA 1CGVA 1WE5A 3A4FA 4JKMA 5FEBA 3GUTB 3CN4A 4EKXA 4KJYA 1ETZA 2ZOOA 4XVTH 4B60A 1VFBA 5JUEH 5F3FA 2NYYC 2RB8A 1DLHB 4U7SA 1JF5A 4WUUD 1TVBB 3S3CB 3WV0A 4IIQA 4XC1H 1PKQA 2WXKA 1JMXA 1LJMA 2C9UA 3D6GA 5C0RL 3ABKB 4D9RD 4QRRE 3II2A 4ZO6A 4UQCA 1FZKB 1TZHA 4IRSD 3VDAA 5KJ4A 3CHOA 4TULH 5EEVA 3T0BA 4K9JA 3RWCB 4JBSA 1CLOL 2P48B 3B7UX 3I50L 5B39A 1KXVA 5EN3A 2VLJB 4RX4D 1JXKA 1M3IA 2AP2A 1OHQA 4PYGA 4YHNA 1E9PB 3LB6D 3FB6B 1YY9C 3RVTD 4C59B 2H4EA 5JXAL 5T3ZE 5LXGH 2C9AA 5ESAA 5G2NA 1KENL 1KY6A 2YFOA 3UYPB 1T80A 1JNLL 5I6OA 2J88H 5F7WC 3C75A 5IHLB 2IJ0C 4HJUA 4R2GB 1KCVL 3TNMA 3U7YL 3ZX1A 5BMFH 3TNNB 5E94B 4TS6A 5DMJB 1QABA 4FQXC 3HNTL 2UY6A 3F8UB 5JW4N 3OKMB 3AWFA 4LEXH 3O0LA 3N1FC 1MCPH 2MHAA 5AKTA 2V7HB 4JKLA 1VERA 2B4CL 1OIOA 4P23C 1DSFL 4NRZA 1H3PL 1CFTA 3HI1B 4X99B 1KCSH 2XWJA 3R4RA 2BLFA 1AD0B 1YQVL 3AM8C 3GSUB 4PUBH 5E2WH 5FOJA 4CC4A 2HVKB 3WKML 4PJGB 4D0DA 5KJRH 5KSBE 1IFGA 3X3FH 3V9EA 1A7NH 2K4AA 1IGFH 2B0SL 3AB0B 2LHAA 3QAZB 2VJ8A 3HB3B 4JHWH 1SJHA 4QPEA 2NUPA 3VH8G 5I5RA 4N2KA 1E6JL 1JPGA 2AV1B 3C6SB 3IMUA 5DA0B 4RRPM 5C3TA 5K9KA 1CDJA 4AKQA 3ZDYB 5DMKB 4XCYA 3VCLB 1A7OL 5E08L 3ESNA 3DUUB 2LABA 2FLMA 1EUTA 3B3IB 1RZ8B 3QR1A 2ZKYA 3D34A 3G5YA 3O2VH 4OZFB 5EU5B 3V2AR 4DFIA 1AOHA 5IJBC 2YD6A 4Q7DA 1JZJA 3APFA 3ULUF 4IMLB 3X1BA 1U92B 2BSTB 4CVXA 2NY6D 4Y4FC 5KSAC 3BQUB 3RX9A 3O4LD 1JF1A 3MV7B 1ZA6A 3ARFB 4KNSA 3B9VA 1NBZB 3WL9B 1IGJB 3DX9A 1O9VA 4O4YH 3RDTB 1J9CT 3U82B 3P40A 2BFVL 1HAUA 3OJVC 4BFJA 3JWOH 3OB0K 2EO7A 1PLAA 1XAKA 3SDXE 2TRHA 4K5NA 2YBRA 3LKQA 2P5EE 4MJ4A 1NBVH 4YZFF 1JK9A 4IW4C 4UT9L 5KEZA 4HUVB 3KE0A 4HK3J 4JE0A 4GG6B 1JN6A 2FCBA 4YDMA 2OSWA 4JFED 1ZLVK 4GEIA 4PU2A 4JDEA 2QR0B 5EV7A 3RA7L 1T6WA 1NCWL 5CHNB 4XPTH 1ECYA 2C26A 2DRUA 3RBSA 4M8RA 3FQRB 2VDPB 5LAXA 3RFZC 1KGJA 1U8JB 3H42L 5A7BA 3NA9L 5GISH 3QRFM 4K7PL 3S96B 3HE6A 4G7VH 3RZWA 1KTBA 35C8H 4ZX4A 5T5FL 3VM5A 4V2BA 3D0AA 4AEFA 1XEUA 1MRDH 2UWEE 3R06A 4JN2B 3LH2L 4U1JB 1UTDA 3TL5A 5DJ8A 4Z8FL 2AZUA 4G43B 5IT2L 2PYFA 3RWJA 1ADQL 4WTWA 3KPSB 3MJGX 3TFBA 2OMZA 1XEDA 3QQDB 4WI5A 4YNYB 4ANKA 3ARGA 1ZTXL 1NGPH 5DHXB 1YAZA 1A4KB 3F7VB 4QHNB 1E43A 2KBGA 3SBRA 2V17H 5LGYA 3QHTC 5L4MA 5F88A 4JPSA 1JGLL 4F7MB 3RLSA 1O6TA 4RFNB 4FNRA 5AB0A 2BERA 1XD0A 4UAOC 1CFQA 2C4XA 2WVSA 5GS1B 3FH7A 3IDYC 5CEZE 4G71B 1MDTA 2BNRA 2XZCH 4XNYH 2DD8H 1BX2A 4Y9CA 5HVFB 4ODWA 5EU7E 2ARJQ 2GJ6E 1C08A 5DGRA 2IBZX 3O81A 1TFHA 3HMXH 3KPRB 4FL4B 4GQ9L 1YRKA 4ZQKB 5DQJB 1RXLA 4NNXA 1NCDL 1I3RA 4EBQH 4NM4L 1GMEA 4QOKA 4GAYB 3NZSA 3QJUB 4Y16D 4WF7A 2VDRB 5HGDB 3PQYA 5GJTL 4DZ8B 3LQZA 5AOJA 4KXDA 2DMBA 3V7MA 3IDMB 3OQRA 5KBMA 1RZJH 2P7TB 3MRJA 4GRWH 3UPCA 4HLEA 4O02B 4YDJA 2R2HB 5ESVA 1JVKA 2UXTA 3IRPX 3OC5A 1SLWA 5I2IA 4U4IA 3DPBA 4XXDB 1A47A 1A8JH 5AVXB 3KGSA 5IMKA 3RGVC 3W11C 5T3ZD 4AL8L 1O7DE 3BD3A 4U1IB 2WQRA 2DDQL 3IXTA 1X44A 5AWNL 2OTWA 4WQOA 2HUHA 3FO1B 5HDRA 2CIKA 1NMCC 1W72L 3A6CH 3CSYB 2QSVA 4ZAKB 4L0YA 2DWTA 1VFOA 1RUMH 2E59A 4W9IC 4F57H 4M9PA 3NPSB 5FW7A 1MIEH 3DGGA 3IJ8A 4LSRL 3E1ZA 2DQGL 3CZFB 5KVDH 2L7EA 3MRMA 3RWGB 5E51A 2Z31C 4UU9B 3X3GH 1N3NA 4Z7NF 3IMBA 4KRPB 3LNIA 4YHML 3CHQA 2R15A 1FV1A 3IJ9A 3LS4H 2ERJC 1QTSA 4BWUA 4D8OA 4HPOL 3WHXA 4DEUA 4KVCL 1JD9A 3UZVA 1P7QA 4Y19A 2HRGA 1M42A 1KPRA 1DZ0A 3LIZH 3TBYA 1ZPLA 2F53D 2FSEB 3QFJD 4PJHF 4XVJL 2AITA 3L7FA 3NFNA 1FNHA 4W9JC 1KJ3H 3LOWA 2NY1B 3PP4H 5CINL 4MMYB 3FHAA 4G7QB 4LEOB 4YBQC 3IAQA 3SQBB 1S5HB 3F00A 4Y5YA 5JPNA 2R23A 3QXVA 2UY7A 4Y9FA 1OE1A 1S46A 4I0PD 3VFRB 3C6LC 4YDZA 3GGWB 1DQML 3H9SB 2FJHB 4ZFGL 3TCLA 4NRXA 4RFEB 1PZ5A 4JFXB 4Q9BA 4YHYB 4PREB 4L29B 3VD5A 4LBAA 4P46B 2B1AL 2PTTB 3HW7A 5D2NB 5TD4A 3LQMA 4D0BB 3K5RA 4YH6A 2WZAA 3QEHB 5CCKH 3QNXB 2QQLL 2VRQA 1RIHH 1BGXL 5CILL 2PW2A 4WI9A 1OOAA 3RTQC 3B7YA 4L3EA 2AVFA 3WS6C 1B9KA 1X5YA 4G6ML 1YEKH 1NKOA 2C5DC 1MAMH 3T0EA 3KH4A 3NJFA 4H8WL 4XNDA 3NJXA 4POYA 3HBQA 4AMKH 4J8QA 1N68A 4DVBA 4Q6IB 3DDGA 2OMTA 3QEQB 3IRCA 4XPAH 1MCCA 2B2XH 1XCTB 4LVNB 3DO3A 1ICTA 1CFSA 5FF6B 1MFDH 4E9WA 3DJSA 3PHOA 5FA3B 2PETA 1MCEA 3GMQB 1GYAA 2BP5M 4JB9H 3U1PA 3WTTA 3DTXB 4AGPA 2MEJB 1ZAGA 5D70L 3IWVA 3MLYL 4YSPA 1L9SA 2DQJH 2VDML 2X0UA 3D3VB 3EOTH 3OR7A 4OGQC 3ZSSA 1M71A 1ACYL 3KVQA 1QLEL 2OJZL 1JHTB 3LN4A 1QR1A 1FFOB 3NZHH 3VMPA 1E6OH 3CZEA 5F1OB 3MRNA 3PJSB 1X9UA 4J3OC 3MRHB 1DJZA 2ZUVA 1VFMA 1RURH 5KW9H 4APQC 3MJ6A 5TE4H 1M1SA 3GMLA 4NEHB 1I9JL 3LNDA 5E8PA 3D5OF 4JG0H 3GMMB 4RAVB 3WNPA 1CYXA 1JPSH 3D69A 1DQTA 4BH8B 3UC2A 1BAFH 4TOYH 2VZSA 2WO3B 4OB5L 1O0VA 4L5FL 3TZVC 1U8PA 1L7TH 1AR1C 3ZTNL 4YXKL 3WE6A 4DKFL 4KKCC 3QIWC 3GSNL 3GXDA 3VTAA 1F3JA 3OPZL 4XOEA 2VXTH 2ORBH 5D72L 4IOFC 2ZCHL 5A6MA 2XCMC 5CEZD 2ATAA 2VC2B 4NWTL 1WZLA 2QTVA 4U1LA 4F7EB 2ZYHA 1HXYA 3L1FA 5E8DL 3VUAA 4RGNC 1A4AA 4BUQA 4GBXB 3LMJL 1KLFB 5CSZA 1U91A 3K3QA 2Z0BA 4PCYA 4WDIA 1NCCH 4JO1H 3UTQA 3TA3C 5E0QA 1EJOH 3QS3A 1ZANL 1CDBA 3K0WA 3IJSB 4HHAA 4W6WB 4YSOA 3EKCA 3GSWA 4Z3TA 3C9NA 4H26B 4MBOA 5EZLB 1V3MA 5AW2B 5EBLB 2ATPB 3NJIA 4GFXA 5L2JB 5LGHL 2ZCKL 3T1FB 3UC0H 4HU2A 1IE5A 3ULVL 3G5ZA 2G9HB 2H3XC 2XFXA 2YN5A 4A39A 3DRQB 4NXKA 2FZ3B 2K0RA 1EHLH 4RGOL 1GR7A 4HG4K 1WCBB 1GYVA 3ZTCC 3VAEA 3OM3B