3ATDA

Crystal structure of the kir3.2 cytoplasmic domain (na+-free crystal soaked in 10 mm gadolinium chloride and 10 mm magnesium chloride)
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
199
structure length
196
Chain Sequence
IQRYVRKDGKCNVHHGNVRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium inwardly-rectifying channel, subfamily J, member 6
publication title Interactions of cations with the cytoplasmic pores of inward rectifier K(+) channels in the closed state
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 41
structure length 196
sequence length 199
ec nomenclature
pdb deposition date 2010-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3atdA00
2WLNA 3K6NA 5KUKA 3SPHA 2X6BA 1N9PA 3AGWA 2X6CA 4KFMA 2X6AA 3SYAA 3SYQA 1U4EA 3VSQA 2WLKA 3SPIA 2WLLA 5KUMA 3AT8A 3ATAA 4LP8A 2WLMA 1P7BA 3SPJA 3AUWB 3ATEA 1XL6A 2WLIB 3SPGA 3JYCA 3SYCA 3ZRSA 2E4FA 2WLHA 3ATFA 3ATBA 3SPCA 2GIXA 2WLJA 2QKSA 1U4FA 3ATDA 3SYPA 1XL4A 2WLLB 3AT9A 3SYOA 2WLIA
chains in the Genus database with same CATH superfamily
4GMSL 1GGIH 5TGBA 3E6FB 2AAAA 4PJAF 4QRBA 1T2JA 2WUBL 3DX0A 4G8EA 4G5ZL 1UURA 5GGVL 2NY3B 1S78D 2WBKA 3HB3D 4FTVA 3TX4A 5G5DB 1YEFL 1PF3A 1EAOA 3BISA 4Q6IA 3LH2L 1KYAA 2NDFA 2RAMA 3EJYC 4WIQA 2J88H 5FLVA 4YHYC 2BX5A 4NNXB 5DJDA 3I6GA 3QJSB 1GCFA 1A3RH 2Q2EB 1FNEA 1WITA 2XWCA 3DPBA 1CDYA 3T8MA 5D7JB 1I4FB 2DN7A 1TTCA 2NY3C 2EKSA 3NIDE 4HWZB 5CBAA 1BEYL 1UWXH 2YGNA 5I6LA 5ES4B 1GAFH 3KL5A 1CFQA 2YRPA 3H3BC 5E1GA 3WEXA 3MRGB 4CSPA 1TQVA 5CM1A 4HXAL 1MFBL 2E76C 3IFOB 3IGKA 4KX9A 4X7CC 2OYPA 5L7XH 1KMGA 1F4YH 5C9JB 1A7BA 4OCXH 4M4PA 4NQSB 2DEYX 2AQSA 2GY5A 3LRMA 3QO1B 3K71A 1YECL 4WHDA 3A6CL 5E70A 4HGWA 4KNQA 2UZIH 3P4OA 2V9QA 4ONHA 2C4FT 2OX5B 4OZFB 1V27A 3U46A 2XX0A 2C3XA 4WFED 5C0BA 1OTTC 3JWDL 3MHZA 3K72B 3VRLE 3ZL1A 4P3DB 3L16A 4DVBB 4XB7A 5ETUA 4OM1H 1IU1A 2YUWA 1YMME 4JO2L 3EBGA 1E27B 1AMXA 3DUUA 1CFVL 4NHUB 5F7AA 1A4BA 2D9CA 4TYUA 1IM3A 4ZO6A 3MJ6A 4JFHD 1FAIL 5AOLA 3F83A 3TBSA 2C34A 2P8LB 1I9IH 1DE4A 3FH5A 3G5XB 3KYMA 4PJIE 3W0WA 4W4NA 4XCYA 1CTNA 3L6FA 4JL2A 3IU4L 5IW6A 4AUYA 1UXWA 4BZYA 3EGXA 2MOVA 3LDBB 3VXTA 5K59E 1SYSB 1CS6A 1P0SE 3GLEA 1KELL 4X4ZA 4AVHA 4WUKH 4QTIH 3I9IA 3LV3A 3HNVH 4KWUA 4HUWB 4ZQKA 1ZCRA 2R2HA 1BFVL 1XB3A 2A73A 2XFGB 3LS4H 1N6QH 2VLRD 5ICYB 4BV1A 1NDGB 4N2KA 2NR6C 4HZ1A 1KCSH 3RILA 1FE8H 2IAAC 1K2DB 3UZVB 4KK6D 4NQUA 5KVFE 5ITFA 5MENE 2P5WB 4Z0BH 1QACA 5IVXF 3JT0A 3KDMB 5JNYA 2MCPL 1QBML 4HUCA 3QFJB 1D7BA 1PLGH 2MWCA 3FUFA 1U8HA 3P30H 3QHFL 5HHOA 3I84A 4XC1L 5DRNB 2ZCLL 1DQVA 3V0IA 4A38A 3DX6A 2IPTL 2G5BA 4NQQA 4YHML 4QOKB 5JO5A 3HC4L 3PGCB 3DBXA 4ZMQA 3BH9B 5I74B 4WHCA 3VXUE 3NJXA 4KK5D 4NLAA 5ICZB 4LARH 1KJ2B 2PYED 2GVYA 3GJFB 1A25A 3GJFK 3CQPA 4QD2E 3MCLH 3NABL 2Y5TA 1G84A 1AGCB 3ZIYA 4NUMA 5KSAD 1CB4A 5B3JE 2AXHA 3KLKA 4LRIC 2GYSA 1CE6A 5I74C 1JNLH 5DJ6A 2OL3B 3CZEA 4U1NA 4YEEA 2DICA 3EXLA 1M56B 5AAMC 2AXFB 2ITEA 3ZR5A 2HLAA 3NIDB 2B4CL 2Z8VC 5ICUA 4Z7VB 1G9NC 3QPQD 4JANB 5A2BA 1U92B 4MJIE 3PU7A 4DCQA 4X83A 3EADA 3R4RA 3WXVL 2XTJE 1W8OA 1JPGA 1PSKH 1ZOXA 1ZLUH 1ZTXH 3B7YA 1D5MB 3O8XB 2DQGL 4P49A 2X4NA 3B2DC 3TTSA 2BSEA 2LVEA 3IJ7A 5AAMA 3U4AA 1BJ1J 2H1XA 1A4AA 3CFCH 4OCYH 4JLRA 2JKTM 3VRLF 4P04A 1ITCA 5DMGC 2EDYA 2I25N 4A7GF 4LCYA 2EC9T 2AI0L 5AL0A 2V2WA 4CC0A 3MBWA 1JGDA 2RMNA 5CBEB 5I8EA 2GITA 2DKSA 2IDCA 3CFMA 2B0SL 3GIVB 3KPLB 2HTKC 2CCWA 2KZKA 3RJOA 1CBVH 3FT3B 1YQ2A 2YPVL 5E6RB 1E4JA 4L23A 2ZX9A 4I9WD 4PJIF 4TXVB 4UNUA 1OARH 1TR7A 3FUHA 4HT1H 4X6EB 4WFGD 3I6KB 2VSCA 1VDGA 1UD5A 1TQTA 3LVTA 4ODUB 4JFZL 2IAMD 1SJVA 3BQVA 4MJ6B 5J1TC 3BKJL 5K59F 3NT0A 4QHNB 3OHXB 5FF6A 3BP6A 3GJEA 5D5MA 2WNKA 4MD5B 1BYOA 3Q8CA 2DQEH 1AXIB 4NENA 4U1LB 3QGVA 1E8WA 4DGVL 3QUXD 5GJSL 2PWDA 2IADA 2LAGB 1UWFA 2QVIA 2RJMA 2X87A 3EO1B 3GXPA 2J7LA 4ZT1A 3IN2A 1R3LB 3IPEA 1J8HB 1V3LA 4ZMYA 2J2ZB 1RZJL 4K3EH 3T2PA 2PPFA 4LSSL 1MHHB 3X11B 1NMBH 1KPVA 4N1EA 4B6ZA 1GYWA 1IBGL 1EZVY 2HTLC 3ZDZF 2XQYK 4DP9X 5H8DA 4M5SA 1WC7B 1YNKH 3H3PL 3L5IA 1QABA 4LLYA 1XF2B 1TSHA 5IQ9A 2DMBA 2XU9A 3HI6L 5TH2A 4JFEB 1HQRB 2CBOA 4TQEH 5F1IB 5E8PA 5C07A 3QB7C 1UT9A 1S7QB 3FDWA 4M7LL 1Z5HA 2QT6A 3L4UA 4W9GC 3F12A 4NQDA 1Q9LA 1YN6A 1YNLL 4ODWB 4LPWA 1CWVA 3F6LA 5AG8A 3TNMA 4NP4L 5E7FA 3ZYZA 1W0WA 4QT5B 1GXEA 2H7WA 2Q7YA 5B3JF 1OSPL 4WVRA 2FLBT 3BJ91 3ZTJH 3GSWB 4TF4A 2Z8SA 3G6AA 1U30A 1Y6MR 3BKYH 4JG9A 1G7LA 1NFIA 2QVKA 2JQAA 2X1PA 3NAAH 2ZOLB 3ARBD 4HFWB 4HULB 5C2UB 1YEEH 1KGCE 1P7BA 4M29A 5EZLA 5I1EH 2ITDB 3ZW3A 1Q9KB 2VN7A 4JG5A 2PO6C 2YXWA 1CF1A 1JVKA 2CRZA 2QR0A 4YBLB 5IEKB 1QI4A 5D2LE 5ID1A 2QADC 4H0LC 4OLXH 4BELD 3P4NB 3ZE2B 3HAEA 5KS9E 2OMWA 4TS6A 2XTJB 3BGFC 1MLCA 3HLKA 4GEIA 1ZS8B 1TU2A 4O02B 3TO4B 1TYEB 4PRHD 5EOQL 4BIKA 3FK3A 4FXGA 1MUJA 2JKWA 3NP4A 4YBLC 4H26B 1E4HA 3DVNA 4J27A 4X5LA 3PWPE 4QXWA 4L1LA 2PO6A 1MN4A 3QDJE 4P46C 3JV4B 5E51A 4Z7NB 1INQA 2MJWA 3BWUF 1IAKA 3NVQA 3L5WB 1L5GA 3TO4C 3MRKA 4Y0GA 3ROOA 4QHMB 1FVEB 2F74B 3VGBA 5DJ0B 4NO5A 1TOXA 2I7SA 2MIZA 4LGRB 3D1MC 3IJSA 2ETWA 4WKZB 5KSBB 3H3KA 3LB6D 2J8OA 2YA1A 1FFNB 1LK3L 1WBZB 4MCNA 4XNXL 5D72L 5F7KC 3GBNL 4ZOCA 4ILDA 4LLVA 1AQKH 3O9WB 4WK0B 3UP6A 5HBBA 1X4XA 2XOTA 2N7BA 4IKNA 2ZYSA 3ML8A 1RIUL 2QZ5A 4P46A 3O3BA 1RZGB 4YNYA 3UCQA 4OVUA 2LAAA 4TNGA 1VACB 4KUCF 4X5RA 4ZFGH 1J0HA 3OSKA 4HIJA 3UG3A 3DK2A 4N0YL 1DVFB 3SQBA 3VX0A 2KERA 1MHEB 2CKBB 1KF9B 3EOAA 3S5LG 1D5IH 1SJEA 1OCWH 4UZGA 2CD0A 3GB7A 3I9GH 4H1LG 3U79A 4M48H 3VXRD 5ISZA 1A6AB 5F7MC 4ENZA 4LCUB 2JCCA 4YHPB 5T1KD 4WJ5A 3ZHKA 5JHBA 5AVXB 3X1FA 4PGDA 4WCYH 1MIMH 4J4PD 3BZ5A 5EN2B 2BFGA 2AGJL 2NY1B 1KCRH 1U91A 1QEWB 3T6ZA 3MA9H 1BX2B 4PCTA 2Y6TE 1PNCA 4M6OL 3GMLB 3MX0B 3TCXA 2H9GB 3LRGA 2D9QB 4XVTL 3RQ3A 4JCLA 3K5RA 4DP7X 2ZX7A 3MRFA 1AKJB 1W0VB 4PWHA 2W9DL 5CP3A 5DK0A 3SOTA 2O5ZH 3R19A 3F84A 5A6LA 1T5XB 1MDTA 3V5HB 1FYTB 1TEFA 1RUAH 4LT7A 3LHAA 3MV9B 3RGHA 2WY3B 4FGMA 1CLCA 3APMA 1A6ZB 1A7OL 1SUHA 2FIKB 4FYTA 1U93A 3EH3B 3U6XA 3IBEA 4F5CA 4MA8L 3P11H 5TD4A 3RAJL 1BZ8A 2WXPA 4S2SB 3NJKA 4RFNB 4NN7B 3ZYIA 3BE1H 1VGEH 3W11C 5AB2A 5D2LF 4D0DB 2XG5B 1WAEA 1QLEL 4QR7A 2Y7OA 4QTFA 1FL3A 3FB5B 4FEMA 5KS9F 3MLYH 4P23A 3HMXH 4XNAA 1F6AA 1KUMA 1DSFL 4HUXB 1NCUA 3X2QB 4BZ1H 1ZA3A 4QCIB 5F7YC 4PJBA 3MV8E 1JRHH 4HALA 1JPSL 5CMAB 2PWHA 5IEHA 2LGNA 3GTVA 4AM0Q 1W6LA 4N26A 4QO1A 3ATEA 3C6LB 4XCFH 1G7HA 4GUPB 5HY9B 1RLBA 3BESR 1HKLH 1LO4L 4KZDH 2QLYA 1OZTG 2EC8A 3WHE1 3FTXA 2J21A 3PP4L 4R4ND 4Y1SA 5IF0B 5J6GA 3OZKA 4PBXA 4ESKA 4AJVA 1ZA6B 4B97A 2ZNXA 1S9VB 3C6LC 3P9MA 5GISH 4WK4B 4ZOBA 1A7NL 3O2DH 1CLYH 15C8L 3P73B 4FI8A 4M7KH 2WLLA 4GSDL 4NHCH 3A5VA 1XH3A 1UA6H 2GJ6B 3GMMB 2VE6B 3Q2NA 3JBG7 2BRQA 2JSFA 3II3A 4HS6B 3OJ2C 3ULVL 3ATBA 3REVA 3ZRFC 4PJEB 1Z9PA 4S10A 5BVPH 5DK2A 3QQ3B 5LG1A 5KYUB 3TIEA 3Q1EA 2W8CA 1SVZA 1UD6A 4ZS7L 1T3FB 3IGFA 4XB3A 3U9PH 2ZOKB 4KZEH 4PRNB 2GTQA 2G2PA 4JFXB 1G9MC 4K3GA 4KO9A 3CBRA 3G7TA 4AZUA 1Q94A 2LOEA 3SE9H 1JI1A 1KBVA 2BWDA 1CXEA 1WLHA 3CU1A 4LQFH 3TEXA 4G7VL 4BXVA 3O6FB 2VIRB 1H3XA 1AXTL 1FVDA 2XKNA 1NFDE 1X9LA 3VGFA 5EZJB 2GBVA 2FD6H 3KPNB 4L8CB 1ZE3H 4Q58C 2EKJA 1IJ9A 1I7TB 4HXBL 2Y6SD 5DO2D 3LQAC 2P1YA 2FR4B 2X4TB 3QS3A 3CMGA 3F7KA 4L1TA 4Y9GA 3UTTE 3AM8C 4TLTA 4OB5L 1H0DA 5C7XH 4GINA 1HWWA 2AVGA 1NOFA 3O0RL 1KLGB 3SKMB 4UWQB 5E8DH 4KRPB 4DOHE 5LXGL 3WKNA 3P02A 3ARGA 1CYWA 1WZLA 3NJVA 4KJYA 2VZVA 4MD4A 4ZUUB 3B6SA 3IM1A 5FGCE 4MAYD 3U1SH 5DD3H 5JOPD 4XBMA 1O5PA 5T3ZL 1DJGA 1ZHNA 3AM8A 1QFHA 3QCUH 4KRPC 2PR9A 4KJPD 4YS4A 1NIDA 4Q9CA 4JDTL 3SDYH 2CLZA 1NSNL 2XN9E 4F92B 1CDCA 3MV8B 3Q8AA 4G7SB 2WTRA 2X4SA 1SJMA 4G8GE 2N59A 3ALWA 4Y19B 7FABH 2WIMA 4MA3B 3LZFH 5FGBC 3UTOA 5IJVA 3VFSB 1D6EB 3K1KC 3WUWA 2J8UE 2OV0A 5LAPA 3CC1A 4IHBA 5AYTA 3DDGA 2W07B 4HZLA 3RZCA 5EIIA 4ZFFB 1EJ8A 4HS3B 3VG0L 2C1OB 4OF6A 1AHMA 1T5KA 3SY6A 1C8PA 3CPUA 4NOBA 3BSZA 3PWVB 5K33A 3WGVB 2X41A 5IQ7H 3CPLA 5AW3B 4RAUA 1DANT 1GCYA 5FYJD 5DYOA 2ZPKH 4XPBH 3EGSB 3D69A 3F65A 4MCYB 4RAHA 4S1RL 3UO1H 4BFNA 2P48B 5HGHB 5E6ID 3LXUX 4ODTL 4HUUB 4GXUM 2G2RA 3QC6X 1TZIA 4L4JA 3X3GL 2YMTA 2P24A 2NYYC 4U49A 1TVBB 4PJCE 1E6OH 1KBKA 3ZMNA 1MRDH 3M45A 3AB0C 1WD8A 2VR4A 4PIBA 3JTSB 5BUPA 4AJ0A 5FM8A 4AMXA 4YR6B 2UWEE 4PYGA 4U1IB 3V0GA 4JJ5B 1U8JB 2R29L 2AJXL 4BSWA 2XHNA 1ADQA 1FNGA 2XPGA 5GZND 4MYPA 5D7JD 5DDHA 3ZDXF 1YEKL 4JZOA 2VZUA 4MB3A 2G60L 5D1XA 2HVKB 3QUZD 2EXYC 1MNUL 1PY0A 1NFDF 2IDTA 4XMKH 1CU4L 1S7SA 3WDIA 1SLWA 1UM6L 5BUAA 2UY7A 4Q89A 2OR7A 1QKZH 4P2QA 2QGDA 2DWSA 4X80L 3OAYK 5T1LB 1SHSA 3M8OL 4AITA 4YIQB 3K74B 3Q2WA 4XP1H 2HH0L 3ECWA 1UHVA 3MBEB 4FN0A 3CLEH 5BRQA 4A2FA 4LF3B 2R8SL 5D93C 1JTTA 5EBLA 4JRXA 5GQBA 5D7LD 2DYPB 1ZGLA 4F7CA 2YD0A 3UIZA 2MPAL 3CMOH 4E0RB 3UTTB 4JDVA 3RGVD 1LE5A 5BO1H 1TZAA 2IPKB 1YPZF 3LTVA 4DGYL 3ASNB 5CSGA 5T5FH 2HPTA 3L13A 5EU3B 2L0DA 5AOZA 1NDTA 2GJZB 3A4AA 3UDWC 5F9WB 4E36A 4QY8A 4DOHB 3HHSA 3B9KB 3MYZA 4L4TA 4U1HB 4GO6B 3DJRA 2RCSH 1DJWA 5C08D 4XMLH 3TLRA 3IMTA 3WHXB 3ETTA 1DN0B 4Z76A 2LU5A 3OX8A 2M83A 5HPOA 5I1AB 1NGQL 2Q8BL 43C9A 1CFTB 4YZFE 5EU5A 3B34A 3F64A 3OR7B 1AZRA 1ZT7B 2I9TA 2J8UF 2DKMA 1ZANH 3CWGA 4HIEB 5CCGE 2XRAL 1E4WH 3UDWA 1H8NA 3JVFC 3ULUF 1YEJH 4M5ZH 4AXWB 2RD0A 1OGAB 1F3JA 4U4BA 1PEZA 4Z7WA 1JXDA 1DQDL 2OTWB 3QH3B 4TNEA 5E6YA 4J3OC 2GPZA 1AZZC 3WE6B 4IRZH 2G2NA 2VLLB 1HHHA 2NMSA 1S7TB 1U6AL 1RERA 5DTFA 5EORH 1LO0L 4OLYH 4S1QH 2X88A 1AR1B 1SMAA 3CC5B 5F96L 3NRFA 1VADB 3EH4B 4M03A 4YHOL 2NX5E 5HD8D 5BVJA 2RB8A 5B1KA 3WSQH 2BP8A 5ALBH 1JHTB 2P8PA 5EOCH 4QOKD 1AR1C 2ZWZA 3FCUB 1NAMH 4FQIL 3N1FC 3HE7B 4JHWH 4OCMC 3PNRB 1S7VA 1NUDA 3O4LB 4NAQA 4PJCB 5DRZA 4PGJA 1N2RB 1P1ZB 3IWVA 1JXFA 3UEQA 5HHQA 3GXDA 5EDSA 4F2MA 1IEBA 2Z64C 4HFUL 1P7QD 2FDBP 2X6CA 2UWEB 1A6TB 4LSPH 4DPBX 4FXKB 4Z3IA 1TFPA 4PHZA 4CMMA 5EHFA 1OP5K 5ESAB 4HWBH 3KD4A 1F02I 3S96A 5L4JA 3IKCA 5E1AB 1MH5B 3C12A 1OL0A 2IF7A 3O8XD 2YARA 3BMWA 5DHYA 4NRYB 4F58L 3MPCA 3T3PB 3VXNA 3N1MC 4GQQA 3K8MA 4APXB 4P9HL 1N0XH 1NWOA 3PQYB 4KK6C 1NMCB 1JWMB 4QAWA 4XAKE 1CDHA 2PTVA 2ZQKA 4L3AA 4NRXB 5JPNC 4OVVA 5GIRA 3U7AA 2PF6A 1QNZL 1T66D 5FS5A 3OC8A 1I8MB 4LDOB 4Q0XL 5CZVH 4BRJA 2VDRH 4M6ML 3DX4A 2K9FB 5C0DB 4Z7AA 5EU4B 1KB9J 4PCSA 4UQAA 4KKBD 2OQJB 4LSVL 2VLRA 1P53A 1E4XH 3F7QA 2PXYC 4NIKB 1OV8A 4Z8FH 2CUMA 1YMMD 2DM3A 1DVXA 2WMPB 1GC1H 4UQ2B 4AQ1B 5JPNA 2WAQA 1NOAA 3FS9A 5F3HA 2Q10A 4WW2F 2CO6A 3OAUH 4KXZH 4WSGA 4IEFB 3WTYA 4X9HA 5CKAA 1CGUA 5AKSA 3SPVB 3VTAA 4ANKA 4F33A 1K5NA 2LFEA 4WF7A 4Y9FA 1CGWA 1WP6A 2QVMA 4O9HH 4Y1TA 5I0VA 2W1NA 2PXYA 4ODHH 1WIPA 4RVBA 3QJOA 1J0YA 1B0GB 5E8OA 5AW4B 4YHLL 1F11A 3ZKQD 1X7SA 2CHDA 4KDVA 5E94B 1EZVX 1DSWA 4EXPX 5I2IA 1ECYA 3PGDA 4OLUL 4I3RL 5FYJH 3P0YL 5KSAA 5MEND 1V7MH 1HEZB 5TE4H 2BHZA 1BEXA 5EO0A 2H32A 2R7EA 3QZNA 4ADJA 1G7PB 3T2QA 1GIGH 2EDWA 5MI0B 1XR9A 1PX3A 4AYBA 2WPGA 3PHOB 1A9BB 5HI3C 4XP4L 3GSNL 3ZSSA 2F58L 3DV6B 5I17B 3HMXA 2QV2A 4OZ4B 4DNLA 4BZ1A 3NJLA 4DKEH 1L9NA 1FN4B 1O5DT 2F68X 2OSWA 3QR1A 3BVUA 5D9SB 3CFTA 3VXUD 1KXQA 4NQCA 4MJ4A 1XZ0B 2J1ZA 5MI0C 3L3OB 1KPRB 3CTTA 4FE9A 4X6FB 3RTQB 3SZ6A 4Z78B 2AJZA 1OF0A 4XBEL 1XVSA 4FABH 4OFDA 3CDGA 1GZHC 4ZPTB 5FECA 4NGHL 1HT6A 3GHBH 2HVBA 5C1MB 4A2EA 2NQCA 5CEXA 3ZE1B 4YDIH 3RUGF 5GSRA 2BNRB 3QNYB 3ESUF 2YXFA 1F4HA 1MCEA 2J44A 3HIZA 3L3OC 3RTQC 3ZYOA 5AAWC 2ERJC 1MRCL 4PJXB 1JF1A 1UWEH 4R26L 2WXLA 3TEYA 4MJID 2BJML 1EPFA 3AFLA 3G6JE 3LZLA 3TWCL 4MXQD 2XTJD 4ZFZA 4QJ5B 3MXVL 1QBLH 1XD0A 2BW5A 3GFUA 4JO3H 1XXFC 1GZHA 3B2UD 5GS0C 3BPNB 1AH1A 1X3DA 3D9AH 2GK0A 1PZDA 4JHBA 4X9BA 2OULB 4OFYA 1D2OA 4OZFH 4QPEA 1JDCA 3HNTL 1RUQH 2VDKL 3T0XA 1JYXA 1C5BH 3BPNC 1JSYA 3B7UX 3EOYG 3DX3A 1DUYB 2KBGA 3ES6B 3B1UA 3VJ6A 1DVUA 1L0YA 3D3VE 3MRDA 4JDEB 5FM5O 5JZ7C 2D4FA 2H0JA 4HJEA 3KPOB 4NDMA 4QHUA 4N6RB 3VD7A 2HX9A 5HYFA 4DHLA 2QELA 2QSQA 3MGTA 4LSQL 3QRBA 4NFDA 4AY0A 1KBBA 3NRQA 5D4QA 2ZOOA 2Z0UA 3IGAB 3RDJA 3VFTA 3O3UN 2YN5A 2N1KA 3ARBC 1KXTA 3KPSB 1NGXA 5IMLA 2VXQL 4PB0H 4W9DC 4K5MA 4BWWA 3MRLB 1PYWB 5FYKD 5LAXA 4FQHA 3ZZ1A 2WNGA 3ELAT 2DQDL 2DWTA 5LWYH 4FP8H 4EMZA 4Y1AE 5C9KA 3VX1A 1YDPA 2DJMA 2O30A 2JIXA 1VZHA 1C5CL 5LCVL 2RGSA 4XTRD 1GGYA 4LZKA 2G5RA 4GSQA 3CCHA 3L1EA 4GG6E 2XNAA 1YYLL 4HJ0D 4TNVF 3BO8A 5HDWA 3TM6A 4YJZL 3TEWA 5DD5L 3ARBA 1II4E 2NY1D 4K3JL 5JHDA 2VDPL 1VA9A 3RWEA 2MCMA 2FO4A 4J8QA 2GTWB 3Q1SH 3V6ZA 2F7OA 2NY2D 3QJHA 2RIKA 3JYBA 5BV7B 2P45B 3Q8EA 1JVOA 4QTHB 5EUOB 5E2TH 1NJ9A 4X0KA 3PDOB 3V0HA 2Z35A 3BUYB 3VXQB 4AL8H 2D3NA 2O6DA 3R8QA 3DVGB 3FN3A 3FU9A 3GJFH 3M17A 1D7FA 3EUUA 3OKKB 3R06B 4CW1B 2VDNL 5KYXA 1T6VN 2YJLA 4PRHA 4IBVA 3T8XA 1W8EA 5EOTB 5EO1A 2ZKWA 4TSAH 5BV7C 3KPPB 2EE0A 4NCC1 2AERT 5E4OA 1QZ1A 1AG6A 4NT6B 2O5YL 3QUYB 1U8IA 5JHAA 2BVEA 2F2HA 2Y22A 4XO3A 3SE8L 3K6NA 1KGCD 1OGTB 2VERN 4CSZA 3NQKA 5AVWB 3WJLC 2VKWA 3TT3L 2YD7A 4JR9L 3KBHE 4IRSB 2CIIA 1EJ6A 4OF5A 4TQHA 2AQ2A 4OZHF 4ATWA 3D87B 1UJ3B 4FA8A 1VCAA 5I0ZA 2HT2D 1CN4A 1F4WL 5KW9H 4ABVA 1NGWB 4ZFQA 5IQOA 3G6JB 3UGEA 4G6AC 4X4XA 2ZXQA 2WBJC 3NK3A 5JUEL 1RVFL 3VNZA 5CILH 5DZAA 1UJ3C 2J1WA 3KBFA 4HEMA 1H8LA 3MRPA 3WJLA 1U3ZA 3KHOA 1UEMA 3PWPD 1OWWA 3IRPX 3MCKA 4K23H 3QDJD 1UH3A 2BDNL 2R0KL 1YAZA 4K5NA 4OM0H 4PJDB 4JFVA 2VN5A 2BCKA 2C7UA 1LO5B 3B8SA 3TESA 1NLBH 1MVUB 4J23A 4KNTA 4JGNA 1AO7E 5IVZB 7CGTA 1EFXA 3L9BA 1ZRUA 5FFOA 3MRHB 4U3SB 1BOGA 4KXAA 3VRIA 1BBJB 2MHAA 3NBNA 2WBJA 3VXRA 1M57B 4LIQE 4PS8A 3VWKD 4FNLL 1MY7A 4IGBD 5J9PA 3CVHA 4GAYB 3QIBB 4JL1A 5T1KA 4MSWA 1CCZA 1K6QL 4M5TA 4J4PA 5CGBA 4P5MA 4KNSA 1X5MA 4UM9B 1MCOH 4JM2F 3VG9B 2VABA 4IBSA 3UJJL 2F7RA 4MCMA 4NSKB 2DQHL 3AS0A 4YDNA 3SDAB 4FZEH 4UDUA 3EDKA 2FT7A 3NIGB 5GGUB 4BSVB 1HJBC 3LKQA 3FCSB 3QIBC 3ULSA 4BQ9A 1MWAH 4I48B 3BLKA 4Z0XA 3JWOC 2IDFA 5E2UL 4OZIA 3BIBX 4OQTH 3VG9C 4PTUB 3V9FA 1J5DA 3CHOA 5DJXA 5HYSA 3IDIA 1HE7A 4BZ2L 4HCRH 4IOIA 1XGUB 1GOGA 1KFGA 1KJVB 1LO3H 3M46A 4UQ3B 1ZMYA 4FMFA 5C0CB 5T5FA 4JJHA 3BVDB 5DJZA 2ZP8A 3ESVF 3KGUA 1S3KH 3NTCL 4WHYH 1NLDL 4R4NC 1CFSB 1FDLH 2IBBA 3ZDYB 3OLIA 4M1GH 4HIIA 5DC4B 3UJTH 4PRPA 4YHIA 5H2BA 1R5IA 3DARA 2QZQA 1IGIH 3RWCB 4B96A 4CILA 1F4XL 4L0ZA 4PTTA 3HVNA 5FXCH 1OAKH 1CT8B 2V3DA 2W5PA 4D3CH 4YL4A 3CNKA 4XMWA 4ZOAA 2AXJA 3QWRD 5L9DL 1NDMA 2ATKB 2CDEB 1UXMA 2EYRB 4L8SB 4HKJB 4OZGE 2OMVB 3JT2A 2XWTA 1XGYL 3KPRB 1U33A 1L6PA 3BAKA 2HVJA 4XMUA 2X1QA 2Q76B 3RIAF 5I18H 3O3DA 1I8AA 1NMAH 3DKHA 1ACCA 4XNBA 2VN3A 1U3HB 4ZAKC 3EFFA 1EIBA 2P5EA 4YK4B 4F7PA 4L8SC 5GS2D 2IMMA 1OAQH 1U8NB 4KO5A 5L88H 5EFIB 4UV7H 2EIDA 2VXTH 1LDSA 1ZLEA 1PZSA 2DH3A 2V37A 3MV8D 5BMFL 4Y5VB 1ROCA 2P44B 3UG5A 3DROB 4YK4C 1RJYA 3MBXL 1K8IA 4YSPA 4I3GA 4LSUL 1E0OB 1TNMA 1A6WL 2DLHA 3INUL 4ZAKA 2WZAA 1JRHI 3CXDH 4GAJL 3TOPA 5BZXA 2ATAA 1CG9B 2XTSA 4KTEH 4Z5RA 3NCXA 1AY1L 2ZCZA 3N91A 3TYGH 1MHCB 3DTXA 3D0LA 3BGMA 2R1XA 3ZX1A 1L9RA 2YQ2A 3MV11 1G5AA 3C2AH 3FOLA 4LKCA 3SBRA 1CD0A 2NY6B 3S5LB 4HEPG 5CHNA 1UXSB 1NWPA 2X9ZA 3WIHL 1D5BA 3S88L 1NGZB 3L45A 4H1LB 3RPBA 4HHGA 1E4KC 2KDGA 4PJ7A 1AQDA 4LLUA 4LEOB 4YL9A 4DP1X 1T83A 4FFVD 3V0WH 5EO9B 4IU2A 5DS2A 2MKLC 5LBSH 5SX5K 4JFFB 2YC1A 2EO9A 3MV01 4JUSA 5FUOH 1UJTA 3BDBA 5MERB 4UQ9A 1IM9D 4CU8A 1KTDA 1WFJA 4JO1L 2CPCA 4NFCA 4HAGA 5FYKH 4D9LL 1D5ZA 2ATPA 3D0VB 1FFOA 2GW5A 4Q14A 1KT2A 2CZNA 3SKJL 2AJVH 4O2CA 4HJJH 2O6FA 3L95A 5AZEL 3FRPG 1Q9WA 3S2AA 4MXVF 4WV1B 5HYJB 4JRFA 2VXVH 4HP5A 4G6MH 4RGMB 3UC2A 4B9CA 4RGOL 1UB5B 2EDKA 1FCCA 5SWZA 2IDQA 1ETZA 1JI2A 5B8CB 4RIRA 2VDLB 2W65A 4JPIA 4APQC 3WFHB 4WV1C 3GSUA 5JORA 2PETA 3OKOA 1JGUL 4MAYA 1OQOA 3KLAA 3MBED 4U0RC 2W0FA 2B16A 4RGMC 1PNDA 3QIWB 4HGKC 3AXLA 2ADFL 5F0MB 4XNUH 5B3NA 3VXMB 4LNRB 5HVWA 3TJHC 4FQQA 2ZP9A 1NGYB 3UTTD 2VQUA 4UMSA 3CSGA 3LH9A 1SFDA 1IVLA 4XVUC 4OFKA 1NKGA 4OZGB 5D55A 2EDBA 3WIFA 4APQA 4D0BB 2HWZH 1EDYA 3PHSA 3IRCA 3V10A 1MCWW 4NUGL 4NQVB 5AW6B 3ESMA 2YA0A 3N42B 4C47A 3NQIA 3QQ4A 4N87A 3OGCA 4IQHA 4QDGA 4AIOA 1SBBA 1WE5A 4NPKA 2XT1B 3VWJC 3SEPA 1CE1H 3EJZD 2Y07L 5HHPA 2XN9D 1P4UA 5GZNC 5DUPL 1QA9A 2F19L 3OV6A 4G8GD 5FM4A 3TEUA 3TT1H 3HMWL 2Y5EA 3C2SA 3AS2A 1TJGH 3MTRA 5D8JL 3DNKA 3AQDA 5C0AE 4BHUA 4YVUA 1I8UA 3MMEB 5I82A 5EPMB 3IS1X 3M1BA 2J12B 3D39A 3JSSA 3PS6A 3LZNA 4K7FB 4DFHA 5J3HC 3GZQA 3BH8B 3GSQA 4KKAC 4LOUD 2EDRA 4ZS6D 1QR1A 2XA8L 4PJAA 3VWJA 1ASQA 3VXPB 4Q9QL 1XSKA 5I1GH 3HPJB 1I3GL 1C16B 2AANA 4XE5B 2JJTC 4UOW0 1OE1A 1FO0A 3BRFA 5GZNA 4E41E 4OV5B 5F1KC 2AQNA 1EGJH 3QUZA 3HG0A 2H2SD 4YXKH 3GKWH 4PB9L 2CKNA 2QGCA 5DUBA 3T5WA 1NCTA 4P8QA 4WSJA 4XPAL 4NC2B 4WUUB 3DI3B 4CL7A 4L9LA 3ZZLA 1OAZL 3HE7D 4WTQA 3NH7L 5L6YL 3AADB 4XPTH 3K4ZA 2W9LA 5HVGB 4J7RA 4KY1L 2JJTA 4PD4J 4R3SB 1BFSA 4MMXB 2X09A 3VFMB 4A1RA 1MQ8A 1GPOH 4I85A 3ZTEA 5D7LA 2OXGB 2XQBL 4RGNB 5FUCC 1AZVA 1ZPLA 5A6IA 2FX9L 1ZHKB 3MI6A 3RGVA 4LFHD 4U1MA 5J1AA 2XIBA 5KN5B 4FQXD 4BJLA 2FJGA 1KB3A 4X98B 4B9YA 3UX9B 1F1DA 1WCBB 3W5MA 1FHNA 4MMXC 5HYIA 1RZ8A 1CQYA 1B9ZA 1RJLA 3DOIA 1MCPL 4J1UB 4H8WH 1ES0A 2C9UA 1L7TH 3MLSH 4RGNC 2EYTA 4N5UA 4XB8A 1UGKA 3VFVB 1XCWA 4LDCA 1ZLWH 2VYRE 5C08A 3OB0H 5IB2A 1UZ6E 4YO0B 2JKIS 2VLJB 1H5BB 4JM0A 1E6JL 5CD3B 4KDTC 3BHBA 3RP1A 4F7MA 3LZQA 4G9FE 1TITA 1SEQL 1DVYA 3KS0H 1JHLH 3MJGX 3PQYD 4GXVL 4JHVA 4NQXB 3LEYH 4NM4H 5EU7E 2UZXB 2BVYA 3EYVA 2YD8A 1JNNH 2DTMH 3KLLA 3DRQB 1COBA 1N5YH 2VZSA 2ALAA 2XI9A 3DURA 1AGFB 1IGML 4F3FB 1JN6B 1H5BC 1T1XA 4OLZL 2P7TA 3WNMA 4LAQL 3HR5B 3O3EB 4RWHA 4FQJH 1WS7A 1I7UA 5FIEA 3U30C 2R4RL 4DAGH 4QNPE 2OJEA 1PCXA 1BMGA 1JERA 2VW6A 4X2UA 1AQMA 3EXJA 5CCHE 3VCLB 1XCQA 2F7IA 3L3HA 1JV2B 5GS2H 2DMKA 2MPVA 3CUPB 4IKJA 5I6OA 5DZ9A 4RFOL 1S7WB 2J57A 4U0QB 2O61B 4NPYA 2FWSA 3WS3A 1IBDA 5ACLA 5DJAB 3B2VH 2FJUB 5IIEA 4OGYH 5IVXA 3QJQB 1NAKL 1BD2A 4L8BA 4UNVA 4OT1H 5DF0A 4DTGH 5IFJA 1J9QA 3AXIA 3LS5H 3MV7E 4FG6C 4FNRA 5C0AB 2G4GA 2WZ0A 5AVTB 1QQDB 1I1AB 4JM4H 1QOKA 3CFBA 4ELKB 4DZ8A 1I8LA 1H3PH 3OXSA 3SKOA 1TTUA 1AP2B 4YWGL 2AJ3B 4KZ0A 1G0XA 2DWDB 1W15A 3AUWB 1P7QA 3FQNB 4HUVA 3KWTA 1YLBB 4AM0B 2Z91B 3HKZA 1INDL 1WO2A 3AWGA 4NWTH 4GQRA 4FQ2H 1MJJB 2NX5D 3HG3A 1G9NL 3HNSH 3O2VL 4I9XA 4BH7A 1CD1B 2B1HL 1FZMA 2BNQE 1NH6A 4X7DC 1HAUA 1OPGH 1CYXA 4G80B 2ZYRA 1DL7H 2OL3L 1DQJA 4PRAA 8FABB 3OKMA 2NCMA 3ISYA 4U1JA 1HHGB 1HXYB 2KT6A 4GKZB 4IMKA 5B39A 3HPLA 2VJ0A 4WY7L 1U41A 1R3KA 2IEPA 1MFCL 2VITA 4L5FL 3KW7A 1ZSDA 2GAZB 4FJZA 3X17A 1CXKA 4XNMB 4ZUWA 4DQAA 4PGEA 1IKFL 2E5EA 4HZAA 2WLZA 5DMKB 5AW5B 5DGRA 5IB1A 3HBGA 4GRLC 4GNKB 3WO4B 5FLUA 3QG6B 5ESVA 1SVCP 4UUJA 2ARJB 3NZ8A 1P5UB 3VGAB 3MKKA 3ZPDA 2OTPA 1HILB 2XDHA 2EP6A 1UZ6F 3FAXA 4ELMF 3RVXD 1OLZA 3QCVH 4M8QA 5LGHL 1HU8A 1YMMA 3GZOA 4Z18A 3MOAH 3P9LA 4P5KB 3CN2A 3TURA 2H26B 2C3HA 4XBPA 4K8RD 2E27H 1G1CA 5JW4Q 4FKKA 3MYJA 3KLSA 1P5UC 5I8KL 3BD3A 4GRLA 4PJIA 3VGAC 4G9FB 5A7EA 3KR3H 2ZTBA 1QD0A 1ZVYA 1XWVA 4MNHB 4XAKD 4XXDB 1UA7A 1DEEA 5DO8A 4PJ8D 4AEEA 5JMRA 2R56H 2RACA 4UILL 4P4KC 2OI9C 2CDFB 4RH4A 2MEJB 4N86A 5K1JA 2KZBA 4RMRA 5L8JB 3KYNA 2BRRL 3OHMB 1MWAA 4X50A 2CDGB 5IUCA 1BJ8A 2OS7A 2E8ZA 5D2NC 2NTFB 5SX4H 4GSUA 1LILA 3EJQA 2XN2A 4RISL 2O72A 2IJ0C 1TG8A 2XTLA 3EJTA 1M53A 3EFOB 4XMXA 3MLUH 3MLWH 4HCRA 2O26U 1J5IA 2IGFL 4IU3B 4FI6A 5MENA 2EC9U 2NUTA 2FECI 5E56A 1OOWA 1FPTH 4RMBA 5CP7A 2X6VA 4KKPA 4P4KA 4HKBA 2YKLH 3NCYP 1CLOL 1HL5A 4FOMA 1E4XI 2AV1B 4YBQC 4O2FA 1N19A 1HINL 1I7ZB 1WT5C 4EOWL 2BY2A 3C5SA 5D2NA 3VVWA 4JB9H 4ODWA 2Y3AA 2XZAL 1OIOA 2DQIL 2E7HA 1EJOH 5ILTH 4HK0B 4C56E 1KGJA 1T20B 4MNQB 4YVNA 3VXUA 3MV7B 4FFZA 1BQ5A 2WTPA 1KCWA 1PGRB 3JQOB 2BERA 1MFNA 1UQSB 4NAJA 2YPLB 2HUHA 2Y2TA 1NL0H 4A2DA 2NY5C 3B2UC 1T03L 2QHLA 1CLZL 2GTZB 2J6EH 4WI8A 1MJ7H 2EVGA 3BIKB 4G6JH 3B43A 3KH3A 4A7VA 4D8OA 4XAWH 3AJ7A 1PX4A 2A99A 1U3YA 2IMNA 3SIKA 2ADIB 4XC3H 1XF3A 4MJIA 2BNQB 4G42B 2HG5A 5MEPA 4EIZC 1S9WA 1FNSL 3BWUC 4XHQA 2F1BA 3UYPA 1KIPB 3LN5B 2R83A 4AQZA 4KUZL 3ZL4H 4FERA 3V0VB 2Z6FA 4EDWL 1BWWA 1FH5H 1KWKA 3ARED 2BSTA 4R0LB 5F6HI 4BHUI 2H45A 2JTYA 3QUYD 4IK7A 4ONGL 3TP4A 5CN3A 2JH2A 5DRXA 1IGJB 5DD1H 2E8YA 2AF2A 4UZUA 4JZJB 3NA9H 4O02L 5KWYC 4L3EE 3RGBA 2A6DA 3PJLA 4Q6YA 1NTDA 4GB9A 4X6BA 3T0VA 3R1GL 4EZKA 3MLRL 4IRSD 1A2YA 3GO1L 4F8LA 3GMRA 3O45B 4LP8A 3Q9PA 4R0LC 2AK4B 1AI1L 1FUNA 2YD4A 3HI5L 3QJUB 1QTSA 1BA9A 4O5LH 1KULA 1IFRA 1Z0NA 4XPGH 2AEIT 3RVVC 1BAWA 2I9LA 2NZ9C 3BQUD 2IQ9H 3Q5OA 4EVNA 3WJMB 1BBDH 1QW9A 2HJKB 3IS0X 4PRIB 3NFNB 3MRCB 1E67A 2C3VB 3K46A 3KJ4B 1MCNA 3W38A 2UZYB 4AQOA 1D5XA 4WTZA 5D70H 4JJOA 2DIEA 4FEIA 5D6DA 2ZSVB 1N3NA 3VMNA 4AIEA 3QFGA 2AITA 5JW5B 1UUSA 2J4WH 4TPRH 1F41A 3EDJA 3MRMA 5E5MB 3RNQB 3D3VD 3CD4A 1T0MB 4UOQA 1ZVSA 2A74B 1CK0H 3WYRA 1OCCB 2YBGA 1KB5B 3G08A 2A38A 1E7UA 2A4CA 2CKBL 4MX7A 4M6NL 3QZWG 3HZVA 4H0GA 4PGCB 4TNFA 4YFLF 4U6TA 2HFGH 3FW6A 1XIWD 2HFTA 3UTZB 4FQCH 1BQHA 3BPOC 3T0EB 1ZV9A 2DJ4A 3QWNA 4A6YB 2P43B 4UM9D 3LQZA 2BINA 1QEWA 1JPTL 4BA0A 4F27A 2VM4A 1UH4A 3G5ZA 1U58A 3MRBB 4KQ3L 4F2EA 1NFAA 3B37A 4JM2D 2R0LH 1WHPA 1KIQB 3T0EC 4BKLB 3MRJB 3QAQA 4MDRA 1DBBL 4EIUA 2P8MA 2WGNB 3SYPA 3D34A 3S37H 1JXKA 2HRPH 5JPMA 1RUMH 1A4KB 4YSDA 1VAHA 2KMWA 4Q9BA 2NNRA 1FHGA 2HXAA 1FG2B 5AVSB 4BFEA 2BZ7A 1FV1B 4LEXH 3GGWB 5E9DE 1C12B 4GW4A 2Z92A 2LT9A 2H6PA 1R3IH 2JLPA 3D52A 2KUTA 2VLKE 2YSSA 3MUGB 4LRNL 5D2LA 3EO9H 4UTAH 1E42A 2Z4QA 5KYWA 1RUPL 1JXGA 3DOHA 3MSPA 5KEZA 1ZIAA 4OCSH 5KS9A 2H8PB 4I7ZC 4U4IA 1XSIA 2PCFA 3LKNA 2FWOB 5IHZB 2PW2A 1NM9A 5TDOA 2ICEB 3QA3B 3VACA 4G8FA 2XZCH 3EYQD 4AT6A 3FH8A 3GK8L 4PLJC 3BW9B 1Z6JT 5HJGA 2W60A 2AEWA 1MCIA 1E9QB 3IDNA 3PWPA 1UATA 4OKVB 2VL5B 1X7QA 1LNUA 3GMPA 3QCTH 2ESVE 3QDJA 4LL9A 5F7BA 1FBIL 4AH2B 1RURH 1S7XA 3TBVB 2ADGA 3VB8A 3WIIL 2VQTA 2ICEC 5EA0L 2XWJB 4ZDHA 4ORZC 1A5FH 1SM3H 1U3HD 5E08H 4JKMA 2JF1A 2OMUB 4U6VH 4AQEB 3OZ9L 3Q8BA 2DQTH 4MQTB 1UXLA 2Q6WB 2DMHA 5SV3A 5DRWB 3GMOA 3TJEH 4AMKH 4NB7A 3VWKA 3N9GH 5KBNC 4IGBA 4ODXA 1OY3B 5H35A 3SGKC 4LMQE 1EGJA 4QUOA 4K8RH 3RYMA 3F04A 3L7EB 5G2NA 35C8L 4NJAH 3V9EA 5F7FA 2NW2A 4Z7QE 2WLMA 4ZOEA 4M8RA 2UUDK 4L9DA 3G5VA 3QEUA 4OIIL 2FATL 5DEFB 1JHKL 4KC3B 2A4EA 3L3GA 3HN3A 2FEEI 4GRMB 2KQMA 3OC5A 3FT0A 3H8NA 4PJHB 2H1PH 3BEWA 5INCA 1UD2A 2ICWA 1A3ZA 1S7UA 2R9HC 2DV6A 4JFDB 1AO7D 1MRFL 3SGKA 1G9ML 4NKOA 3CFJB 3MLXH 3S4SG 2UYLB 3DTUB 2JKXA 1J0KA 2IFFH 2OSYA 2BZCA 3LZOA 2WB7A 2Y06L 4I1PA 1YEHH 1V7NH 1B0RB 3FO0H 1OTSD 4DKDC 1SDDB 4DESA 5CN2A 3PWUA 1TTAA 4A63A 5KBDA 3GI9H 4KQ4L 2DWYA 2Q86B 4P2RE 3LS4L 1UTDA 2FAUA 3AQZA 1VEMA 1J1XH 3FU7A 3H7BA 5DZVA 1KCSL 5I1LB 3LQAL 4P9ML 1ZLVH 2IFGA 3FTWA 1IC0A 1IILE 1SOXA 5FCUH 4G7YH 3GSXB 3QWRA 3WOVA 4HWEH 3OKNB 2IBZX 4D94A 4K2UL 2UXVA 3FULA 1YVLA 1OGPA 4N9OB 1Y18A 4L8DA 5DZJA 1C1EL 2LABA 3GHEH 5I8OL 5HHVH 4ZMXA 5B4MC 4KITB 1X5ZA 5F7HA 4AGNA 2VO5A 5C70A 4XP6L 2EYSA 1JZ2A 1RULL 3QRGH 2VLKB 5C0RL 3UBXA 1JFQL 3S36L 1RFDL 3GI8L 3HHRB 3V0AC 3BSZL 1P84J 2YPKA 1C08A 2R69A 3KVPA 1HAWA 4OJAA 1KEGL 4G71B 3W2DL 1IAMA 5TK2A 3VGDA 4JAMB 3SE6A 5TQ0L 1FL5A 1FZKB 4QXGH 1J8RA 1DQTA 3E8UL 4X5PA 3AUVA 2FJHA 3FTGA 4P2OD 4PP2B 2QKSA 1FVCA 3MNVB 5CD5D 3F7VA 1SPDA 4BK4A 4BFIB 4XWGH 5G4MA 1FYHB 1NUFA 4LSDA 2IH1B 5EWIL 1RJCA 4IDJH 5H37A 1IMHC 1RJZB 2ZCKL 3UO8B 2FBRA 3D85D 2UY6A 4UM8A 4EI5D 1ACYL 4LOVA 3C8HA 2G9HA 2V2XB 3ZDXB 4YXHL 3QEQB 3GHPA 1ADQL 3SDXE 2JB5L 1RZKH 2X40A 2Z31B 2B77A 1R3HB 3QXVA 2A9NH 3BKML 4KXDA 1A7PL 2JV6A 5I6PA 1IM9A 4WNQA 1O7VA 1PLBA 2P5PA 3FT4A 3TN0D 1D9KB 1RQ5A 4UNTA 4K9EC 1ZEAH 5GS3A 3EH5B 1G7JA 2WCSA 1QFWH 3B83A 5GGTL 4BQ8A 2WXIA 4X5XB 4MQ7A 2Z31C 2CMRL 1QSFB 3EAKA 3L5XL 4OI9A 3VI4E 3VA2C 3T65B 4NO3B 2E7LC 4QWWC 1AS7A 1CBJA 4LEBA 1D9KC 5T3XL 3ZRCC 2JKRM 3CFEA 5F89B 1A6VL 2QTEA 5LBVA 4F8PA 1WFIA 3Q6FB 3BUPA 1M6UA 5BZZA 2EE2A 3WLWC 4YUEH 2KS0A 1NFDA 5C6PB 1DANU 3IBOA 3SQOH 3QNXA 2VR7A 1Q1JH 3MBEA 1TYRA 1WQVT 2MOQA 1O6SA 4HWNA 4GG8B 1T89C 1PKOA 2AJUL 1UWYA 1HL4A 4PMEA 1BAGA 3ZO0A 5K9JL 4LCWA 1BLNB 1MREL 2XCMC 2ZKHH 1FRGH 4E9VA 2HRLA 2WIIA 3RWIB 1WUZA 3ORJA 5FA3B 3T4YA 3HLAB 3JTTA 3KPQA 2YLHA 4R7DA 4UQIM 2WZPD 2QVFB 3OR6A 2ADJA 1X5XA 2F5BH 3TTYA 1YPZA 4PR5B 1RIHH 1FGVH 5LQBH 1YEGL 2EABA 4JGUA 1THAA 2JXMB 4LQ1A 4NRZB 1HOCB 1T89A 2I07B 3FUNA 3ULUC 5F1NA 1AD0B 1HTYA 3GUFA 4Z9KB 1EDQA 3BH4A 3RWFA 3N50A 5CO1A 5C0EA 4X9YA 2XBZA 3PGFL 2XN9A 3PHAA 1JV5A 2PPDA 3ZDWA 4ZPVA 2EDFA 1DEDA 2DZEA 4G8GA 5I76B 1A22B 3CH1A 5DZPA 1LXMA 5BRZE 4X8XA 2H2SC 4GUOA 3X14B 5IFHH 3B5GA 2J8UA 3AABA 4MHHI 1T22B 1A4CA 3OL2A 4UV4H 4X99A 1YY9C 3JTBA 5IFAH 4WU7A 1IBFA 1UCBH 3UAAA 5JIQA 2EIZA 4KDWA 1OB1B 2VB5A 4RNRA 5C0JB 4GAGL 2AMGA 2X70A 1VIWA 2BIIA 2NLJA 3LKPB 4M9PA 3EYOB 4PGBA 1NBZB 1IKOP 5FWRA 5D6CA 3BZEB 5CEYA 1ND0B 1I3UA 1A8ZA 1MELA 2J8HA 3X1BA 3E6HA 4MA1C 2CGRH 3SDCB 2ITCB 2IV8A 3BSGA 1XGTB 4N8CL 2XBDA 4Y9EA 3SDXB 4X4ME 3MCYA 1U8OB 1U8KB 3RFZB 3CZFB 5KJ4A 4Z77A 5KG9B 2HJLB 4J3SA 4H44C 2X89D 4N5EC 5C0AD 1UACL 1X4YA 3RY6C 3LAFA 3DX8B 2A6IA 1I1AD 4PJCA 3IFLL 1UCTA 3SDCC 2K9UA 1P1ZA 1PZAA 1UWGL 1JGEB 2GJPA 3KYKH 1WWWX 4NKIL 4X4KA 2X4RA 2YS4A 4J8RB 3EOTH 1AQKL 1PZ5B 2V5YA 3LKRA 3NMEA 3VI4B 4LIQH 4E41D 4FQXA 2J55A 4H1LH 4KHXL 3FRPB 2AC0A 3VTMA 3IE9A 5A2FA 4K71B 3UROR 2FX7L 4M7ZB 4G43B 3U36A 1I1FB 3RY6A 1AGEA 3IMWA 3VM5A 2QSVA 4X4YB 2VNCA 1GKEA 3KEHA 3FH7A 4PIRF 4TRPH 3NDYE 4K71C 2XJLA 3WFBL 1EJFA 4DP6X 1HE8A 4BCZA 2WXQA 4NJ9H 3OMZA 5TQ2L 3ZYJA 1ETJA 2N56A 2WBWB 3WKMH 1RSYA 2DW5A 4BCYA 1HJCA 4WEEA 3OXRB 2WCGA 5JW4R 4DP2X 1J05A 5CWSB 2DQ6A 1HI6A 1HYSD 3I2CH 4U1KB 4O58H 3PY9A 1TVHA 2J56A 5DFAA 1ERNA 2ICWI 3MA9L 3D18B 8CGTA 1M2VA 2WN3A 4RZKA 1NKOA 3P4MA 3HS9A 3QUKB 3X1EA 3ZO9A 2VDLH 4NNPL 3ILEA 2R59A 1F1GA 2VRAA 3QISA 1I3RA 3SO3B 4JY5L 2JB6B 1ASPA 4G8IB 1P7HL 2NY0B 1HEJC 3WUZA 4Q52A 4GBXB 4OGXL 4G9FD 1MG2C 1N4XL 4B3VA 2V8LA 5FYLE 3MR9B 3MROA 3U2SB 1P4LA 2R4SL 4W1TA 4WW2A 1KJ3L 3UACA 2YAEA 1EEZA 1OAYH 5A3ID 3SO3C 1UKTA 2K7PA 2NY0C 4AIZB 3CK0H 3BP7B 4DVRH 3HMXL 4R90L 3ARVA 1VENA 4PW3A 1KNOB 2HZHA 1SN5A 2K78A 4LSTL 1NCBH 2PYFA 3MREB 2D3JA 3ARDC 1JZHA 4ZTPL 2X1OA 2ZCHL 2V3EA 3DXAE 1AC6A 1U8MB 3PJSB 3U9WA 3LH8A 3PUUA 1H3GA 5AG9A 4M7LT 3O81A 4DP5X 3ZTNH 4YDVB 5JIMA 2NX5A 2N7SA 6PAZA 3WKPA 5I1DA 3SCMC 4XX5A 5D1QE 3SGJC 3P2TA 5D7EA 1UM4H 3FB6B 1OWRM 1CLYL 2XYBA 4XVSL 4ZW7A 1P9MC 1BCIA 3MAWA 3MV7D 3TZVB 5DVPA 5KBKA 1ZHLB 3ARDA 3HG1E 3UYRH 5HTSA 1BFTA 3FYIB 4JUTA 3ARFD 4I2XE 4CNIB 4ONFL 2VR5A 2IPUG 1M1XA 2VJXA 3TZVC 4CMHB 4ZUSB 3SCMA 1I9RL 1OHQA 5H94A 1VCBC 5F3BA 4G8AC 3SGJA 5BVPL 4OLWH 1WZAA 4Y4HB 5A1AA 1OQXA 4HS8H 3RVUC 3FQTA 3LRSA 1P9MA 3VFOA 4CU7A 3RUGA 1K4DA 2BNQD 2RA1A 3N1QC 3NJIA 4WWKD 1GYCA 3U9PL 2GJRA 1A4JB 3C9NA 4CMHC 1BAFL 2A9DA 4EI6B 3KCPA 3O11A 5CAYB 5EOCJ 5GS0L 1F13A 5F1OB 4BKTC 3TBYA 1LYQA 5DWUH 3H6AA 3DMMC 1JPFA 4TQIA 3ESNA 2EH7H 4HK3N 2JK5A 4PJ8A 1OP3K 1KENL 1BQUA 1HHKB 1LMKA 4N8VG 4FTDA 4NBYB 3V4PA 4NLHA 4N2MA 4F7TA 3QXAA 2ROXA 5JIDA 4CVWA 4LU5L 4ETQA 1YHPA 3ES6A 4ZNCD 1MCCA 4MD0A 2OAAA 4XPHH 4XP5H 4JG0H 2FD6L 4KKCC 3VGGA 2VDOH 1NGPH 1ML0A 4QXUH 4DERA 4G9DB 2F53E 4N0UB 2NCEA 5C8JA 3OTTA 1T7VA 2Q7AA 4W9ZA 5GRVK 1G6RB 4OAWB 3WTSA 3DMMA 2PPAA 4H8PA 2Y24A 3FQUA 2DQFB 3HN8A 3OAZK 2X05A 3LRHA 5MP6L 4YQXH 2CM5A 4RMQA 3FU6A 4PRID 4TNVK 4N2EA 3VGEA 4Y16B 4X6CB 5E8EB 1R0AL 1PD6A 1HCYA 2X4UA 4TOYL 1CICC 3BPLC 5E8DL 1G1YA 5AZUA 5K39B 5MEQA 4R7VA 3BXNA 4HPHA 2JCCF 1OAXH 3O6ML 4WI0A 1KEMH 4MXWH 2Z93A 2PP7A 4CSSA 4DW2L 2EDDA 4CDHA 4OD3L 1YYCA 5I8CB 2X3BA 3HC0B 2DBJA 5AVQB 4U6YA 5DD3L 4G6FB 1IT9L 1R4XA 4JZNA 1PW3A 2QBWA 1KYOJ 5IHLB 1L3WA 1VFBA 4LCIH 1IVTA 4RBPK 1CICA 5TE6L 3MUY1 2Z3FA 5I1CH 5F88B 2DBLH 2K45A 3QE5A 4PJGE 3KJ6H 4AEIL 2VO8A 3GUTB 3L3DA 3AREC 5CLXA 2FL5B 3FF7A 2PWGA 1EWHA 1AOZA 4W9CC 4UTCA 3MLVL 2YWZA 4FXLA 4IMLB 3TPUB 5FFGA 5KSUB 1J5HA 1GS6X 4PBDA 4NM8H 4X7TB 1E2WA 3ZT5A 4KVNL 4HJGA 3ROLA 4ISVB 5D1QB 2WK2A 3H9SB 4UBDC 2NY4D 5KVGH 3CFDB 5T3ZE 3H42H 1F8TL 5CIPA 5FKPB 4CW1A 3D4CA 4Z3EA 3IGLA 3FCTA 4BH8B 5BV7L 1J88A 2ZPKL 3P54A 4WI5A 2WLYA 4XPBL 4M3JA 2W94A 2WYHA 1VSCA 1YYMH 3AREA 3CBKB 4JFPA 1E5UI 1UVQA 3VFNA 5IV2A 4I2XB 5CJ5A 4CVZB 1DLFL 4AYEC 3LD8B 3MRNA 4JKKA 2OMTB 5HHNB 1RZ7H 2O5XH 2ZG2A 3GQFA 1P4IL 2IGTA 3B7SA 3KPMA 4MYWB 3LOWA 2A0LD 2ZF9A 4BBWA 2E9GA 1MJUH 5GRJH 1KC5H 1T2XA 3EDDA 2HKFL 1RK1A 2W0KA 2EEBA 3LD8C 1A1OB 3BQUA 1RIVH 4OZHA 3CVCA 4MJ5A 4DKFH 4UIMA 1M6OA 4ORGA 1FLRL 2P52A 4DEPB 4ELDA 3BAEH 3CVHL 5EUKB 5I6XB 2XA3A 1Q9OB 1SXAA 1XIWC 2DKUA 3LIZL 4HF5H 4WQOA 5JDSA 5TK4A 4AG4L 1K8DB 1OALA 4EUPB 3FFCA 3S35L 2AXGB 4NN5C 4QXTB 1EEUA 4PLOB 2ZAIA 1BDYA 1EXUA 1J8SA 1LK2B 1ZK9A 1KFAH 2DMCA 1OP4A 2C4XA 1PFOA 3D3VA 4LOFA 1GGCH 25C8H 5I1KL 3IXTA 2F53B 4HC1H 4XCEB 3C5JB 1ZTXE 3VH8A 2GSGB 1XIWA 5F21B 2LU3A 2NZIA 2GFBB 3DSNB 3D0AA 2G75B 3TYFB 5AVYB 1UYWH 1OSYA 4ABWA 1YNTF 4OTXH 2MRYA 1DBMH 4HD5A 2BNUB 1R5VB 1AGDB 2EDEA 1CIUA 2BIQA 3LPWA 2GEQA 1VFAB 1TO5A 2VUYA 5E1HB 5HDBE 4MWFB 4JM2A 3VI3F 3JWOL 1IBZA 5CINH 5C2BL 2FQEA 4L4VE 4YPJA 1Z1WA 5E1QA 4ZTOH 1KYUA 4WGVB 3MOBL 2YEVB 3QQDB 3SGDI 1OK0A 3CH8A 3GNMH 4Y1AA 5DHVB 3S7GA 5D7HA 2FGWH 1P7KB 3BZ4B 1RU9L 3QDME 3GZPA 4XZUA 1KZQA 4PJGF 1WA1X 1FQ9C 3TA4D 4GQZA 1Q0YL 5EULV 4LPXA 4GG6A 1QRNB 1E2ZA 4JPKH 1E4WL 3KXFB 4KK8C 1E9PB 3IXAB 4LLMA 4KKRA 5GS1A 4M5ZL 1K4CA 5EU6A 1N8ZA 4J39A 1MFEL 2BVOA 3K2UL 5DMIH 4XN8A 5ALCL 1HQ4A 3HCVB 2X1WL 1F2XK 2QFRA 2PTTB 4NWUH 4NKMA 5LDUA 1R6VA 4YFDB 1ED3B 1IQWL 5F70A 2Q87A 3RJQB 3VFWB 4S1QL 1JZIA 1P4BL 4GS7B 3FQ4A 5CSZB 1GY2A 1PG7H 3IT8D 1JNHB 3MODH 4I77L 3L4XA 1DFBL 2EYRA 1GGBL 3RPIA 1PL3A 1EAQA 1XF4B 3ECBA 5AKTA 2R23B 1BZ9A 2C9VA 4UIKH 3GSRB 3EBAA 4LLDB 4ZMZA 5L2JA 5E9DD 4PQXA 3QJFA 5IHHA 4HSCX 1PY4A 4PJFE 1HN1A 1MCJA 2VR8A 2BSRA 3T1FB 1EHKB 4U7KA 4F20A 5EF2A 2X4PA 4QRQB 3BPCB 2VLKD 3HRZA 1U8NA 1LO2L 1XGPB 2YN3A 1W72A 2YGOA 5F7LB 3P3YA 1XR8B 2W59A 3NFPB 2BSBA 4HIQA 4NZRL 3WKQA 5T1JA 3RWHB 3TVMB 1SMOA 3VRJA 2D4DA 2VC2L 5JLZB 1NBYA 3O6LH 3UBGA 4ZXBB 3E0GA 2ZWSA 2L8AA 3I9PA 4L48A 3DIFB 4WGWB 3TA3C 1BQRA 2GBTA 3WEOA 4WK2B 1INEH 1C7SA 1MFMA 1OTSC 2A6JB 2J43A 2VXSH 4ODSH 4TUOA 4D0CB 1S7RA 2ESVD 4OUUB 4BGDA 4PLKD 2VAJA 2BWQA 5JXED 4LPYA 3FOMB 1SJHB 4EO5A 1RZIA 4Q97A 3NN8A 1AO7A 4TKWA 5DT1L 1HHIA 4ZXBC 1NCDL 3K0WA 3BWAB 1LEKA 5B38B 1SNRA 3GS4A 2PCPA 4UZSA 3BVNB 3WY3A 1TZHB 1SDAB 3K81A 1PLAA 3PLYA 2OXHA 4LKXB 3UZQA 3TA3A 1AE6H 1HWHB 3PABB 3WFCL 2VAAA 3QZWB 3FB7A 3X1GA 3GSVA 2EDNA 3ABLB 2FECL 4KK9C 4LP4A 5HDBF 1TMQA 5JXAH 1J1OH 3VFRA 5DUML 4DIXA 2YQBA 5ADPL 4M00A 1E4XL 2F8VA 4IBLT 5E8NA 1AD9A 4QRRE 3D0VA 2DIAA 1IC4H 3DRTB 3QXWA 2R2BA 1JPEA 1X5HA 3RWJB 1T1ZA 3T3ME 3WFDL 3B1TA 3F62A 4KROB 2E4TA 2EDLA 3DUSB 3IDXL 5ANMA 3FQ1A 3WFEL 3IDYC 5F9OL 1BVKA 1JWSB 2W92A 4NX0A 3QDMB 4WEBH 5J6HB 1HH6A 4AGQA 4A6YH 5LJYH 5FO7A 2CALA 4PG9B 2F5AL 5DA0B 2OJZL 4TQPA 1VB9A 4AEFA 2HFEB 4POZD 5CEZL 3NZUA 2ITFA 5KTEL 5ENWA 2J72A 4P2RD 2Q1EA 2XC8A 8PAZA 3I02A 1HH9A 2WSKA 4JFOA 1R24A 4ZSOB 4FZ8H 3O4OC 4HCGA 5HPMB 1KTLA 1MEXL 3GXTA 1CGVA 1ZTMA 2X4OB 3FU0A 1LEIB 3GSOB 4Q2ZA 3BIAX 4AENB 4OBSA 4P2OA 3UAFA 2MNJB 1RP9A 2P80D 5DR5L 2CRMA 5K5YA 3C6SA 4I4WA 3REWA 3F7YA 4PV9A 4BDVB 5I1IH 3PWNA 3JUZA 4PJ9C 4S1DD 4U6XB 2CK0H 4JCWA 3FMGL 3DJ9A 4PJFB 2A9ML 2NOYA 3EJSA 3NFSL 3RDTB 3GC3A 3QWOA 3UTSB 3V6BR 4HG4J 5IWLC 1SBSH 1IFHL 1A64A 3D85A 1NOLA 2HSIA 4A7SA 4M1DL 1EXHA 4EI5A 1JZFA 4M62H 3STZB 3WFZA 1DDHA 3LXBA 1IARB 4P5TC 1KCVL 1SJXA 3IMSA 1A3QA 1NEZA 2ZSWB 1FO0L 2PYEE 2UXGA 3I50L 2FBJL 4U6HB 5DI8B 2DEWX 3V5DB 3FCGA 3PWJB 4XE0A 2QQLH 3K6SA 2CXGA 4AGOA 5KJRH 1I8KA 4NQEE 4PJ9A 5K9KA 1QAWA 2IH3A 3QUMA 1G43A 4P59H 4YOKA 4FYRA 3GF8A 5ICXA 5TPWH 1I9JH 4B5EA 3A0OA 3TN0A 4D2NA 2EZ0D 5GHWH 1UWEL 2APSA 3NIFF 1R9FA 5A16A 2OJ1A 5I75C 1QG3A 1VEOA 2VWEC 1WIUA 2BP3A 3QPKA 4P5TA 5FYJU 2J71A 3ZKMD 4Y4FD 2APWA 5J89A 1CYGA 2AABH 3SY0B 4F37F 1VF5C 1R34A 4YMPA 3FT2A 5I19H 4R2GC 4U2ZA 1FIEA 4TSCH 3HE6B 2F8IA 3IJHB 3WN5B 3S4SB 2OSXA 1KN2H 4L3CA 3ISRA 1DJSA 1BVLA 4ZNEE 2EO1A 1MHPL 2CIKB 4XI5C 3RX9A 3SOBH 1XF5A 4DJMA 3T77B 1L7IL 1SXSA 3L4TA 4U1SB 2M1KA 3T3MF 4BQ6A 4J6RH 4UTBA 3HE6C 3AG2B 3GMQA 3FL7A 1MZYA 4G3YH 4AYSA 1OW0C 1QFUH 3U0WH 2X44D 4NZUL 4E2OA 1N6VA 4Y89A 3VYPA 4UOZA 4X6DE 1B9KA 1GZPB 1KYFA 1TDQA 2WN2A 3QJZA 2I27N 4MAUL 5CGYC 4XZ4A 2BZDA 1XXDC 1GOFA 2GCYB 5LN8A 3FO1B 3I75A 2FEDD 3VW3H 1LQSR 1TKWA 3RG1C 2DWEA 5EF1A 1BQLH 5BQ7B 1MFVA 3LN9A 5CR1A 4ICXA 1OW0A 3EFDH 4L1HA 1F3DH 2UX6A 4NC1E 2YMXH 3QAZC 5JHLH 1BIIB 1MPAL 4XGZA 2VR6A 2BVTA 3WJJC 3IDJA 4J3XA 1N26A 5JQ6H 3QARA 4P5RA 3L4VA 4AVIA 3WGUB 1AHWB 2E75C 3V4VH 1UB6B 4JQIL 5FB8A 3FFOA 3OM3B 2D73A 5DS8A 3VO0A 1TZGL 4PHXA 3O3EA 3OF6D 4I0PD 5HJ3A 4Q6KA 3KNBA 4AI7A 3SODB 3D25A 1XD1A 2V2TB 2EXTA 4AL8L 5F2FA 4ZYKA 1QPXA 3KHQA 3W9EB 3EZ8A 4MB4A 5KOMC 1HDMB 1MOEA 2DQCL 4TUKL 3IDMB 1SN0A 3OPZL 3QFDB 3U0TA 3KL3A 2R1YA 4I5BB 5K1VA 1DJXA 3ILDA 3ILQD 3QP3A 5EB9A 5T33L 5I30L 4Z7OF 1GYUA 5DJAA 4DP8X 2SODB 4HHWA 4MDJB 3MJ9H 4CBZA 5LUMA 2J1YA 2CCLA 2UV3A 2K0RA 1M4KA 3JWNC 2WQSA 5IB4A 2CJTA 3QG7L 3D33A 1E28B 1MQKL 2GUYA 2VISB 3LKSB 4NQEB 1T1WB 5BRZD 2F54B 4UDTB 4GMSH 2HMID 1U8QB 2HUEA 5F71A 3K5SA 5D1ZB 2WUBH 3MNZA 3DGCR 3IEAA 2CO7A 4G5ZH 2MNWA 5GGVH 4C55A 3AY2A 1YEDA 3QO0B 4UMGA 4W93A 1YEFH 4NZFA 4TM9A 3DO7A 3LH2H 1I53A 3BUDA 2CLRA 2PWFA 3VB9A 3CZUB 5ADOL 5CJ8A 1CI3M 2GJJA 3CFKA 3MZGB 1A6PA 1JZGA 3C5ZB 4E41A 2DTSA 2IALB 3QDGE 5CILL 1YMHA 2LVCA 3LSOA 1U95B 3KYOA 3VE0B 4PY8J 1BEYH 5KANG 1HYSC 4NUJB 2Y9RT 2BIMA 1QLRB 2KC0A 2QMJA 4R7LA 4K7PH 4CC4A 2YFOA 3BAYA 3C5ZC 1DJYA 3MTXA 4HXAH 1MFBH 1NPJA 4ATTA 3N44B 4GUQA 1JK8B 3ETSA 4NYLB 2NUPA 1FZOB 4MQXC 3GWJA 5D96B 1JBJA 3SD2A 1O7SA 1P6FA 2V5RA 3HUJB 4AEHL 1YECH 3A6CH 1HSBB 1R1CA 4JS7A 3EYSL 1KCLA 4ZX6A 1MCOL 1MJ8L 1GA2A 1V05A 3CSTA 2JQMA 4X6DB 4Y4HD 5EU7C 1IGTB 3JWDH 4EPSA 4PRBB 1VFMA 1DQLL 1BFOA 2OMNA 2VDKB 3G6DL 1AFVL 2ZWYA 3I3EA 4KV5E 1MWAL 3H9HB 5BW7A 3N0PB 2LLLA 3U6RA 1EERB 2Z1KA 4JO2H 4JRYE 4WLCA 2P49B 2B08A 2Y7MA 4Z7UB 1ZT4B 1CFVH 2AEQL 4ELMA 1GW0A 4GKSA 2Q3XA 1FAIH 1T4WA 2F7PA 2X4QA 3EO0A 1ZWIA 5KVFL 1XGQA 4CU6A 1MLBB 5AW0B 2VUOA 4B27A 3FQWA 1KLFB 3ABKB 5I66B 4QRTB 1UADC 3V4UL 2X12A 3IU4H 2DIBA 1J5OL 3TO2A 5BJTB 1WV7T 2ZIDA 3M7FB 4MLIA 3VXSB 4B9JA 1QR4A 4ALAC 3K7UA 3PIQB 4K9JA 4DUXA 1KELH 1WVZA 2Y7LA 2D7TL 3LN4A 4F15B 4QRSB 5C0GA 1VKXA 4QI3A 3UJTL 2XQ0A 1V8HA 1BFVH 4J12A 4YXLL 4ODVH 3NUKA 1NC2B 4FFZL 4XPFL 5LGJA 4RDQG 1G7QA 5C71A 5IR1B 1A6UL 1Y1UA 4PSRA 4QF1B 4Y16D 3ARFC 2HYMA 2X6UA 2YGVA 3O2WH 1EEYA 1QBBA 4MNGB 2J73A 1EMTL 2MCPH 1QBMH 3UPAA 3VTTA 5IMOB 2AKRB 4W4OC 3SPGA 5J12B 2R51A 3ZSTA 1URIA 5FYLD 4HDIB 4AYFA 1KPUA 2KKQA 3IMRA 3QHFH 5C09B 1RPUA 2BWIA 2VDPB 4KBPA 3C60B 4E5XA 3DSFL 3FFDB 3MJ8B 3E8VA 3ECQA 3MJWA 3R7RA 4F1SA 2XFXA 4KMLB 2IPTH 3FQRB 2WQ8A 5F7DA 3F6JA 3BCDA 2OTUA 4YHMH 5J11B 3NSXA 3V6FB 1OAQL 5L8KB 5LQBL 2BOBA 5FW6A 4WU5A 1FJ1B 2WVVB 4N2DA 3OQ3B 3C60C 3ARFA 5GGSB 2NY5L 1JGLH 3QWQB 4NQTA 4LCVA 4W70A 1PLCA 2B3IA 3NABH 4KPHL 4YX2L 1NCWL 2B59A 3KMDA 2IANB 5INDB 1EUUA 2JTDA 3ZUNC 5J11C 3DV4B 3WUWG 4DN3L 1A1MA 3DXAD 4HJSA 1FG9C 4RMTA 3OB8A 2J1XA 4AZ8B 2DWXA 4R83A 1ZHBA 4OCRL 3BKCL 3ULAB 5BS0B 3BVTA 3RWDA 2C26A 3QULA 2B4CH 3QIUC 1AXSB 3X1NA 5D1QD 4WWKA 4N0FA 4IIQA 2C1PA 5JIHA 3IE4A 6TAAA 1AZCA 3RU8L 1NC4B 1OCRB 5FOBB 2GHWB 3WXVH 5IM7A 3MRQA 2X6AA 2YAPA 4IJ3B 2DQGH 1KIPA 3GM8A 3OWRA 1XGRB 4TUJA 5CZXC 4DPCX 1ZDQA 4KKLD 4YLBA 2EDMA 3EH1A 3DUHA 1RHFA 2WLIB 1KB9K 2V7NA 2D2OA 2L7QA 1CIDA 4B9FA 4ZW3A 3TH2T 3QI9B 7PCYA 2F18A 3N40F 4U3HA 2QJDA 4PS3A 1KTKE 3IFPA 5AW1B 1WYJA 3QIUA 3EYFA 1IGYB 4KV5F 4ONOA 4XCNB 3HC3L 1V54B 2AI0H 3IU3B 2H2PD 4R97B 3UYOD 1UD4A 3ZKSD 4KJWD 2FK9A 5BZWB 4MASA 3KVQA 2PCXA 3OJVC 2CBQA 4LSRL 4PV8B 1KJMA 1A9EB 4IJTA 3QORD 2B0SH 3UJIL 1JZ6A 1FNAA 4RLDA 1EO8L 4PJ6A 3EDFA 2YPVH 4G7QB 2VRKA 4CUCA 4XMTA 4PJ5B 3ZTDC 3MLTB 5KYYA 3GKZA 2ZX6A 1DN2A 3T71A 5ID0A 4JFZH 3UBFA 4LHUB 2K6YA 4MZRA 3EOBA 4HWUA 5IBLC 3BKJH 2UZPA 1IV8A 1OTUD 1EVTC 2HX8A 2MH4A 4J3WA 4Q8BA 4CVXB 5I1HL 3T0DA 3TWYA 3WNOA 2QQKL 1ZY9A 4M1CC 4Y2DD 1ZV2A 1PKQB 4DGVH 2VQ1A 5MHSE 5GJSH 4W6WB 5LNGA 2FT8A 2CG9X 2CH8A 3EW3B 4PP1D 2F53D 3BFOA 3U4EA 2NY4C 3ZU8A 1LE9B 2P4AB 4V1DB 1RZJH 4X8JB 2Y7QB 2V9TA 2MNUA 1M7IB 3MO1A 4IRJD 4LSSH 5KBMA 3UXFA 2FYYA 2BFVL 5SWSE 2IXQB 5C3TA 1IBGH 3BEVA 4MDIB 4W6YB 4U7SA 2YOCA 1KB5L 3N06B 1KLUA 4JKPL 1CGSL 1QPPA 3MJ7A 2D03L 4F80A 1QSEB 1DBAL 1QVOB 3S5YA 2WW8A 4JFTA 1LP9E 5L2KA 1KIQA 4POYA 1AS6A 2GIYA 1XBDA 3FTZA 4M7LH 3AACA 4YSRA 2WOYA 1YNLH 3FO9A 4C56A 4CC1A 4MCZB 4OU3A 5FKAA 4RFEA 1AIFA 4F2FA 1D3CA 5A2CA 2DMGA 1YJDC 2FZ3A 5CZKA 2V5SA 1OSPH 2WO3B 2APBA 4QRPE 3SJVE 1SYVB 2B7DT 1S8DB 1L9QA 3TCLA 4R4BB 3RFRA 2CLVA 3D2UB 2VQ4A 1T2QL 2EE9A 4HHAB 1CL7I 5T1DL 2UXTA 5IKCB 4NAMA 4R7NA 2EIJB 1MAML 1R3JA 1EAPA 2YFNA 1EK3A 3CHSA 3KG5A 2B1AL 1HXMA 3QC5X 1F90L 3H56A 4P0DA 4YPGA 4ZTEA 4UT6A 4HCIA 2ZOWA 4N24A 3RNKA 5T3ZD 4EJ1C 1ORSB 4JY4A 5C3IA 5IMKB 2A1WL 1F00I 1SEBB 43CAA 1T21A 2AV7A 5DQ9B 5EOQH 2E86A 4XRCA 3I85A 4J3OG 4BFRA 1HEHC 4YDJB 3VD2A 3D4GA 5EF3A 1HXKA 4L3EA 5IB3A 1XQ4A 1ZIBA 3L9RA 1JUFA 3RL2B 4GP5B 4YH6A 5D7IF 4AQ1C 5CJQL 5PAZA 2NY7L 2Y23A 1T1YB 3FSOA 1U9KA 5HHXL 4E9QA 4R8WL 3TVMD 1MXGA 1P2CA 1LK3H 4XNXH 5D72H 3G5YA 3GBNH 3VDCA 2HT4C 2GSMB 1RIUH 3WD5L 3DX9B 1TQCC 1F6FB 5DFWH 1TJIL 2XZZA 5DQJA 1BHGA 3KCWA 2FGZA 2VZTA 1FWXA 5DFVD 3W5NA 1MVYA 4N0YH 2GT9B 5AYUL 3H7LA 4PREA 4WW1B 4AQ1A 2WO4A 2D3VA 2GK2A 1U8CB 4FCHA 2A6KA 5HYEA 2H4EA 5E5LA 3X12B 4Y9CA 1EAJA 4PBVC 2B15A 1QEXA 4YAQA 1SXCA 1MCRA 2BIPA 2XACC 4PPTA 1JZJA 1S9XA 4B3EA 3QNZA 1TSRA 2V5TA 5DC0A 4M43L 2WYTA 5GGRB 5FYLH 1QI5A 1IAOB 3CZKA 1TENA 2AGJH 5DJ2B 4O2EB 2VDQB 1Z66A 4LBEA 1QO3A 2DI7A 4XNQA 4YHNB 4M6OH 5EEWA 4KVPA 4XVTH 2E4FA 2MTAA 1E30A 3OJDA 5JHLA 4RDBA 1U8PB 32C2B 4L4VD 2W9DH 1B6UA 3IJ8A 5DD6A 4KROD 2N1TE 3HZKB 3QEHB 2R69L 1G7MB 2W0PA 3V0DA 3QYMA 4NKDA 3QDMD 1E3ZA 2HJFB 1L9MA 1A7OH 3V4VA 3UAJD 1JIBA 3WNIA 3LNEA 1X5LA 4MA8H 5E9DA 2ZUQB 3SBWC 3RAJH 1PIGA 3ME0A 3WLBA 3CDZB 3CHPA 1CFNB 2ZXAA 1ZGLP 1ACZA 1QLEH 4RQQA 5TGBB 3B56A 1N64L 1HOEA 1LD9A 1BJ1H 4WFFE 5DURB 3D48R 1DSFH 1H3PL 4GLRI 1RZPA 2OR8A 1ZXKA 2WNWA 2H3NA 1SLUA 4FTVB 4ERSL 3PL6D 3CX2A 2VZ1A 4HV8A 2EEFA 4MA7L 4Q6IB 1XCXA 3NCCB 1JPSH 2J6WA 1F97A 1M71A 1LWHA 2IQAA 3DYPA 2BO0A 4MVBC 5AD0A 5HDQL 5DJDB 3I6GB 3SBWA 4FQ2L 4HBQA 2P5WE 3DVIA 1FNEB 3DPBB 4N9GA 4YDZA 1WFMA 3UMNA 4B9GA 1XCTA 2EKSB 4MGXA 2E7CA 3QFJE 5CBAB 3PP4H 4H8VA 2ESVA 3FZUC 4UT9L 1CFQB 5FWQA 3EHBD 3WEXB 3AW5A 4TULL 2VT0A 1DJHA 1ET5A 2AZAA 2CRIA 2ED7A 1A7NH 4XBGA 5FGRA 5AVRB 4YLQT 4QOKE 1FFPA 4TTDC 4YGAB 15C8H 4A7UA 4ZK8A 1G0DA 1UKQA 4ACPA 4NNYA 4K94H 2FHFA 4PUBL 1RZFL 5DD0H 2X2IA 3K71B 4HGWB 3ULVH 3P4OB 5C0NC 4ONHB 5A6MA 3GXMA 2K70A 3U46B 2P42B 5C0BB 1QMUA 3D4ZA 4E9XA 5ITBL 1V55B 4X7SL 1UG9A 4K9EL 2HFFA 1ODUA 3RX8A 4KXCA 3K8LA 4JN2A 1PFCA 5ETUB 3F5WA 2O6EA 4Z7VE 1IC1A 3NZHL 4ZS7H 4CA4A 3SDDD 3DUUB 1E5ZA 4WO4D 4K5PA 4D7PA 1IM3B 2HKAA 2O6CA 3P0VL 4OBRA 2IWFA 3RWGA 5TJWK 1G1OA 2AEPL 3TBSB 3KYMB 1DE4B 2CR0A 1IRAY 1DLHA 3BN9D 1M7XA 5FA4A 4GUCA 1T04A 5BNXD 4XCYB 3HFFA 2ZX8A 3L6FB 1JDAA 1QLFA 2V4LA 3FAWA 3INOA 1T5WA 4Y5YC 3WL9A 5IW6B 4V2BA 1UXWB 3LXCA 4UU9A 3EGXB 4L1BA 3VXTB 3F6IA 4P05A 4PWFA 2VM9A 4X8CA 5I16A 1ZDSA 2AJYL 2ZXDA 1AXTH 3BDYL 4QIRA 4BCXA 4P2RA 3LV3B 3NP3A 1JF6A 4ZQKB 3QXDA 3K2MC 1IAIM 2R2HB 2NSMA 3CFNA 4QHKJ 3UPCA 2EE3A 2A73B 4PMFA 4QRRD 4OIBA 1PJ9A 3V7AG 4G1EA 4HXBH 5DHVH 1HSAA 5F93C 4Y4KC 4CGTA 3CFIC 5ITFB 3GEFA 1MI5A 3K3QA 3BVXA 5C6TH 3T09A 4Y5YA 2YKLL 5JNYB 4AC2A 3MNWA 5HYQA 3O0RH 1U8HB 1XAUA 3LHPH 4JPVH 3U4KA 5HHOB 4JHAL 5IROC 4B95C 1X5FA 1XEDA 2R0ZL 1J0ZA 1DVZA 5LXGH 3EDEA 2EVHA 3DX6B 2ZWNA 3ZE0F 2G5BB 3Q8FA 3I6SA 2YKKA 3U9UA 4HPOL 5C0IA 5JO5B 2D31A 3ULUL 1DQQA 3DBXB 4Y4KA 3LMJL 3SYOA 3Q2VA 4FI7A 1CVSC 2OW7A 4EKJA 1YZZA 3PP3H 2HRGA 4FD0A 5F9JA 4OI8A 1JMZA 5T3ZH 1E3FA 4TTGA 4YFLI 2EILB 2Y5TB 3DBSA 1J8HE 4F57L 1RPQA 3FJTA 3H6JA 1GW6A 5IROA 4N2FA 5IMMA 4QRUA 2FNWA 3PE9A 1FC2D 1BXXA 2HKHL 1CE6B 2K8QA 5DJ6B 4FA7B 2DLEA 5E99L 4U1NB 4RAVA 3DX7A 3FNKA 2ZZUT 4NZ8A 1CF8L 1EXGA 5HI5C 2HLAB 5HI4D 1VFUA 1YG9A 3ALXA 5EEZA 1EHLL 4GW5A 4ZFOA 2VH5L 4JFEE 4DCQB 3VG0H 1PDKA 1JPGB 4G2AA 4GW1A 5FUZL 1KN4L 4Y4FA 1N70A 2HLFC 3ZL4L 1TIUA 3RE0A 5EC2A 4HIHA 2ZWLT 1E8ZA 4EN3D 3CG8A 1BYPA 1YN7A 4HEPA 3VNYA 2X28A 4S1RH 1JDDA 1U8KA 5TE7L 4JLRB 5J56B 3V9CA 1QSZA 2CM6A 1UH2A 4ODTH 4LCYB 2NXZB 5AL8A 4NQED 4M93C 1IBBA 2HPOA 3X3GH 2F54D 2V2WB 3NIDF 2BHFA 3MBWB 1JGDB 1A3LL 2FEDC 4Z7VF 4ZUTA 5I8EB 2GITB 1HCVA 3CSYA 4F15C 1O7DE 3L1GA 5IHUL 3TCTA 2Y2YA 5JOFA 5F7EH 2UX7A 3TBWA 2IQ9L 3N85L 2NXZC 1AZBA 3WG7B 3RB5A 5EU6E 3ZE2E 2HX7A 2R29H 2AJXH 5IJDC 4WWOA 5ABAA 4ZMVA 2WLHA 2Y36L 1OCOB 1H15A 2HT3C 4WTXA 1I85C 2G60H 2L7UA 5FF6B 1YQVL 1MNUH 3BP6B 3EJJX 3GJEB 1SQ2N 3FN0H 1QZNA 3EG9A 5D5MB 1FL6A 2GKIA 2J4WL 3CAFA 3BCFA 1CU4H 3QHTC 1OHZA 4NENB 3WDJA 1UM6H 4ZMLA 1MKFA 1ZKAA 4I0PC 4Z7NE 3JV0A 1IC7H 4YHZL 2B14A 3TL5A 2WV3A 4KAQH 4X80H 2IADB 3KDPB 1F18A 3H53A 4X8GA 3M8OH 5ISZE 2HH0H 5JOEA 2X0WA 2HFGL 5SV4A 2XXCB 1GHFH 2R8SH 5KSBE 1WF5A 1I85A 1KPVB 3BT2L 4AE1A 3ZHLA 4PW4A 2WWOA 1T80A 2O93L 1DBKL 2NW3A 1IGCL 4AQAA 4NZDA 1T0NA 1X4ZA 4FKHA 3FONA 1V3MA 1WBXA 2XSKA 2XV0A 4LLYB 5DXWA 2XVGA 4DGYH 4I0PA 5IQ9B 1BZ7A 2FBOJ 5TH2B 2WXKA 3PRZA 4NZJA 4KY2A 2WANA 2QKIA 1A8JH 5C07B 5E8PB 3FB8A 1YUKB 2HMIC 4GJTB 3F12B 4NQDB 1Q9LB 1YN6B 4N2NA 1PCSA 2JB6A 3TNMB 3OG6B