3AUFA

Crystal structure of glycinamide ribonucleotide transformylase 1 from symbiobacterium toebii
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
212
structure length
212
Chain Sequence
SSGENLYFQGHMIRIGVLISGSGTNLQAILDGCREGRIPGRVAVVISDRADAYGLERARRAGVDALHMDPAAYPSRTAFDAALAERLQAYGVDLVCLAGYMRLVRGPMLTAFPNRILNIHPSLLPAFPGLEAQRQALEHGVKVAGCTVHFVTAGVDEGPIILQAAVPVLEGDTVEDLRRRILAEEHRIYPEAIRLFAEGRLVIEGRRVRILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycinamide ribonucleotide transformylase 1
publication title Structures and reaction mechanisms of the two related enzymes, PurN and PurU.
pubmed doi rcsb
source organism Symbiobacterium toebii
molecule tags Transferase
total genus 60
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2011-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 3aufA00
3N0VA 4EW2A 4YFYA 2FMTA 2YWRA 1RBMA 4NV1A 3TQQA 4ZZ0A 1JKXA 4QPDA 1C2TA 1FMTA 1CDEA 1RBYA 1RBQA 3TQRA 2BLNA 4ZYTA 4ZYZA 3O1LA 1GARA 1RC1A 3NRBA 4S1NA 1ZLYA 4TT8A 5J9FA 4TTSA 1CDDA 3DA8A 3LOUA 3KCQA 2CFIA 1YRWA 5CJJA 3R8XA 1MENA 1RC0A 1S3IA 1MEJA 3AUFA 4ZZ1A 1C3EA 4ZYXA 4ZYYA 1GRCA 1NJSA 4Q12A 4YFVA 1MEOA 5J63A 4TS4A 2GARA 4ZZ2A 3OBIA 4R8VA 4ZZ3A 3Q0IA 3DCJA 3P9XA 3W7BA 4PZUA 4EW1A 4EW3A 1ZGHA 4DS3A 4IQFA 4QPCA 4ZYWA 1ZLXA 1RBZA 3AV3A 4ZYUA 2BW0A 3GARA 4ZYVA
chains in the Genus database with same CATH superfamily
1YVEI 1QFMA 5EMLA 4EL0A 5C7IO 4XKJA 3D6HA 5HRAA 2QTZA 2NZUG 1ST2A 5CPBA 3FJ1A 4G8JA 5E7IA 5LQKA 1A4RA 1AC5A 2JFVA 4RFSA 1X42A 3QLJA 2HCTA 1E6WA 2Z30A 4YPOA 2ALJA 1HH4A 3P2MA 1MAAA 2RKBA 2VXCA 3FNFA 7GPBA 1MJFA 1NE2A 1AKQA 1PQ4A 2BHSA 1A8QA 1AN0A 2HDNB 1PFGA 4KZPA 1JIQA 3S8EA 3MGGA 5BVGB 1F0NA 2JJ2A 3QEMB 4XH9B 3H9QA 5JQGB 3MLBA 4DB4A 1LC3A 4CWAA 5IDXA 1ZKDA 1U8XX 2FQXA 1ODTC 3PLRA 2RAVA 1K6XA 1HWYA 2QJFA 3AF6A 2ZVJA 1YCFA 1ZGZA 3DAFA 3FRJA 3PQ3A 1DAFA 1D2HA 2ZIUB 3IPXA 2OM6A 1DCTA 2B1JA 1R64A 2RGNC 3I9FA 5HPYB 1U0GA 1TM4E 2EZTA 4N5DA 4EY4A 4I46A 1QC5B 4YT8A 2YV2A 5LXTA 1NX6A 5AKXA 2H65A 3KLPX 3P5SA 3CVWA 2XUIA 1J7KA 3OOYA 1DAIA 3DMGA 1U0LA 4LS3A 1IVSA 2PGOA 1TLTA 1R9GA 3AO0B 3IULA 2XNDA 2OHJA 1XQ9A 3R1IA 1Y9ZA 4M1SA 3EXFA 5HIAA 1WKCA 2X9QA 1B26A 4EKIA 4RKWA 3JQ9A 3KBBA 2D2EA 2OAEA 4RA6B 3T12A 4IEIA 4PLVA 4BNUA 2G8LA 5A6SA 4P38A 1GL9B 4RY0A 5LWQA 3FHLA 1UP6A 1V5EA 1V3QE 5KKCA 3DTYA 1H3EA 1MENA 4ZO7A 4DR4B 4JOQA 2JW5A 1EFAA 4RD4A 3MWLA 5BY2A 1QP4A 1BEUB 5DM70 4ZI2A 2ZSBA 1KDRA 1RJGA 2WEKA 1MC4A 3ZK7A 1Z6YA 5EQFA 5H3LA 1C8KA 4G85A 2XUAA 3KSRA 4R81A 2BGJA 1N1MA 1X13A 2QGZA 3B6EA 1W8DA 4OD0A 3UA3A 3V8NA 1Y3HA 1F20A 3P4YA 4DABA 4EABA 3LWZA 1U5CA 1YFJA 1RDFA 1L4NA 5IT5A 4IHKA 4HUQB 4DAOA 1K6IA 2ORED 4N7RA 2OC9A 3LIIA 4Q66C 5DGDA 4D9NA 3IHKA 5EL0A 1XNJA 2ZE5A 5BO5A 5THKA 4Y2SA 2HI0A 3EPRA 1NVKA 2ZIEA 1GDTA 3PEYA 1G5IA 5I7WA 2QROA 2H2DA 4KWCA 5KDLA 4G8DA 1NC3A 4GL4A 2HNKA 4LCBA 1QTQA 1DKPA 2D3TA 1CUWA 1S5PA 4F1JA 4ZMSA 1TUIA 3OESA 2GJAA 3IYLW 2QG9A 3HEAA 2NU9B 3QWFA 1T25A 2DWUA 4GW3A 3IE0A 3Q3GE 4OXIA 1KOFA 6Q21A 3IKMB 4FKBA 1H69A 4LNAA 4KQCA 2JIZD 2I33A 3SIWA 4C4SA 2OLJA 1XELA 4KNVA 4MKGA 1UH5A 3SOPA 5K8TA 5GJCA 1UJBA 5KSWB 1TF7A 1CY8A 1E3JA 3R3YA 5T3UA 4RGYA 2V0NA 4JFRA 4U8GA 3I9V6 1Q3TA 1QZXA 1SHKA 2CDBA 2G6BA 4Q3CA 1SPBS 1KKLA 1Y98A 1M8FA 4XTCS 1Q7BA 1VIAA 1VI5A 2NO0A 2YRXA 3IP1A 3DT9A 3L2OB 3KD2A 1UCFA 3LS2A 3PR2B 4HFMA 3H4MA 4MQ4A 4QPNA 4LY6A 4UM9D 4AF8A 5KTRA 1DO8A 1ZRMA 4PYMA 1UKAA 1O0BA 2PYIA 3CNBA 3A0UA 4RPJA 3K8ZA 1OUMA 5BQPA 1KI4A 2PS1A 1L4UA 3TG2A 2I87A 1G4UR 2V03A 4FIZA 4UUBA 1ULHA 3IUJA 4IS2A 3RUIA 4EGSA 1US8A 2HO5A 2BBOA 2IT1A 1FTWA 2CFCA 2OGZA 3I1IA 4JL8A 4C3UA 4YPFA 3DLBA 4U2KA 3THXA 2CXQA 3P0HA 2GN4A 3GNTA 4LJ4A 5AM3A 3OO1A 2DXIA 1B0ZA 2ECQA 2N42A 2R7KA 1KY2A 3ZCXA 2WIBA 4GG1A 4X6XA 1IZ0A 4QOFA 2VHEA 3DV0B 1JPNA 1KC3A 5HDBB 5CBPA 1CUEA 3KEOA 4ZRNA 1N7GA 1EH5A 4LE1A 2CXTA 3B1YA 4R01A 1X1TA 3MWEB 3NR2A 4UAGA 2R66A 1TZCA 4D9MA 3IO3A 1YC5A 2N3ZA 3A3YA 4NOKA 1H1LB 4A8HA 3HVRA 1Z33A 2YHIB 2QSZA 3K8QA 1JAIA 5KSZA 1UK6A 4IVPA 4YC7A 2ICAA 3BXFA 4YJ2A 3GOHA 2IE8A 1Y3AA 2VC2B 2QD2A 1WB5A 5AVUA 4D41A 3WMRA 1CLUA 1F17A 1G5PA 1WXWA 2JASA 3CX4A 5DLDA 1IIBA 1MU0A 1TKCA 1PW7A 2HM7A 4Q6BA 4OI1A 5C5CA 2GVNA 1UDAA 3QOWA 4KLAA 2Y1KA 4X6LA 3RKUA 3LHDA 1UJ4A 1GPDG 5DHFA 3LNCA 3LK6A 3TECE 3ICWA 3SE0A 5JAMA 4QNMA 3I64A 4H0FA 4W9NC 4WK6A 2PSHA 4AKTA 5C32A 1T3GA 1YE5A 4MW9A 5AI9A 3W2TA 5TE9A 1E7SA 3P5BA 3PPXA 1KAMA 2WOOA 3UT5B 4C7JA 3QEBZ 3OPYI 2JEYA 3A1CA 3QV1A 1JU4A 2JLUA 1E2BA 2X0JA 4PTLA 4DYDA 4NJMB 5L3QB 2JAXA 2CLCX 1D9ZA 1FC0A 1N2GA 3DOJA 4MLCA 4OP3A 5DHQA 3BMNA 2DQSA 3GQVA 4JGGA 1F12A 2HLDD 4YCLA 1FRVA 2J8ZA 2PV7A 1T36A 3D8RA 4FGZA 3EFHA 4YJDA 4I1PA 1H5UA 1Q1BA 5IYZF 1KY5A 1NT2A 4F4FA 1MIOB 4TWAA 1N8NA 3A1TA 4AMVA 2CCKA 2G6TA 1W36B 1Q1EA 3PS9A 3WS7A 4MA0A 1TRHA 2FSVA 3CT4A 4HGOA 5IFLA 1U7DA 3K0CA 4ZODA 1SU8A 1YL5A 4KUHA 5FI1B 3TAXA 1OB5A 2ZIGA 3CUTA 5JCOA 4ACBA 1FTSA 4JLKA 3PWSA 4ODIA 4BJ3A 4HDNB 5BSFA 4I55A 6ABPA 2C2YA 2ZDQA 3ROKA 1ZJJA 5IDQA 5IBQA 2AWOA 3H5IA 4R05A 3O8OB 3L4KA 3ANMA 5D86A 1RLTA 2QMOA 1IZ8A 3GMIA 2I7CA 1HNXB 2W6NA 3C7AA 4Q3NA 2P6MA 1OWPA 1PVDA 1KL7A 2ABWA 4GFDA 4O0MA 4WJLA 4MI9A 1KZ9A 2D5AA 1UAGA 3LQRA 5C7LO 1XL0A 3EXG2 3FPJA 4LEIA 4FU0A 4WUTA 1XA0A 1O7JA 4PR0A 4CKZA 4WNCA 1OZ0A 1GR0A 1MO3A 2B34A 1Q11A 1UXGA 1AGPA 3H0CA 3KPYA 2OXIA 1FFGA 4XYEA 5AVTA 3AOGA 4XWOA 1HX7A 1MNAA 3L1HA 1KEUA 2J3IA 3GLHB 1I2AA 4GRDA 3KZXA 4YJ3A 5EXTA 1Y6JA 4N5IX 4YASA 3SJZA 4ARIA 2VT2A 1EFPA 1I2ZA 3T1HB 2PY6A 4YECA 2HN9A 5HKKD 2O07A 3AIMA 4KIGA 4L02A 1DXHA 2FXIA 2JHCA 2HT6A 2NO6A 1NW7A 2WP0A 3LFTA 3E4CA 3T94A 1ORWA 1G60A 3MGKA 1E2JA 3C6ZA 5IUNC 1D2GA 3IT1A 3HU2A 3B1WA 3R40A 4Y6RA 2IOFK 1Z0AA 4KGVA 4QOEA 1Z82A 3MMPA 4Q9LA 1OHHD 1SQ0A 2GCEA 1EDZA 4FUTA 1GTRA 4F8JA 3WV4A 4L15A 4MDEA 3AZOA 2WK1A 1FDTA 2YDXA 3QM1A 1MW8X 1KAHA 1YRQA 3PDJA 4EUNA 4EH1A 3OOSA 2QL9A 3RSGA 3WGTA 4DY4A 2VF8A 2I22A 5DN6A 1YFLA 3E9CA 3LXXA 2EJUA 4HT3B 3K70D 4MDFA 2QTNA 1S8AA 3RUAA 4BMSA 3GPLA 4UJ3A 4HNUA 4CM6A 2W2VA 4YP5A 1NMXA 1UADA 2XIQA 3F46A 4A4DA 3TI9A 4B2PA 5CFMA 2R6GA 1P5HA 4Z0PA 3LY7A 4REMA 2JZNA 4FM9A 4Y1GA 2DPXA 2GEKA 3L02A 4S1OA 3FMIA 3B3FA 3L1UA 4MI3A 4M0LA 3U4GA 3H9CA 2XNKA 3R3XA 3AR3A 3OQBA 5TEVA 2ZKLA 1LBTA 4IXNA 3FWNA 1NUQA 4TTTS 1Q0QA 4FFVA 3L8FA 4IIGA 2ESRA 2JI7A 1TYCA 2Y0DA 1F3OA 2VDWB 4M0EA 2IYSA 3MMZA 4WOCA 2ZUSA 3L0ZA 4E11A 2O8EB 1EVQA 1DDOA 3C3AA 1AE1A 3PSHA 2OV1A 4KIFA 4C78A 2VPYA 3CZ5A 5EJ7A 4S1WA 3CLRD 3GNQA 2DFNA 1K2VN 2QTHA 2RH4A 3CX6A 3N6VA 4GS5A 4PAGA 1EEHA 2A57A 3IVAA 2CEAA 5T8KA 3CE6A 3KYIB 5DE3A 2AOWA 4TKVA 1OA1A 1QX4A 4TZ6A 1ZOSA 5J5VA 5ARDA 2PS9A 4CM1A 2P90A 1ZDMA 3HNPA 3OJWA 3HUFA 1JE1A 4L95C 1QQTA 4KQ6A 4BZZA 4LF7B 3GRKA 2XVXA 2QRJA 1USKA 5DHTA 3I5MA 3GIWA 2ZFUA 5GZ1A 3FZQA 2ID8A 1ZH4A 5AICA 3RVSA 1JECA 1TQ6A 3DVAB 3BF8A 4JJ4A 4PRKA 1D6NA 1OSNA 4GBMA 4UUAA 1EWQA 1AGNA 1PK7A 1H3FA 2EFDB 5BNFA 4YR9A 1WTAA 3BE4A 5E6RA 1JQBA 3CUKA 3RM3A 4EBBA 1GRVA 3WHPA 5DNCA 3T41A 2AN4A 4TV9F 2AVNA 1YVPA 2ODQA 3OCJA 1CUJA 3H97A 1SXGA 2EFJA 5JW6A 3W4JA 5B55A 3CCCA 3HVUA 3KZMA 5FPTA 5C3MA 3QPCA 4HB0A 1CZNA 3H75A 1OVGA 2FPGA 1UM8A 2PU5A 2Q21A 2WKRA 5SYAA 4AKGA 3HR7A 3CLKA 3M6MD 5ALDA 3RS3A 1PR6A 1C9MA 3VKGA 1KR2A 1X7WB 2P11A 4PLZA 2BE9A 3EC1A 5DBHX 4J0KA 2FN7A 4NE2A 1W5AA 4G5GA 1RPNA 5B30A 2HZ7A 2WIKA 4V1CB 5BW6B 4B6EA 4RIGA 4UTXA 4DPLA 3EQ7A 4WLUA 1SB8A 5CFOA 1QP8A 3HB4X 5PGMA 2J46A 3FFXA 4AUNA 2A9JA 2B7CA 3V2HA 1NF2A 4OAOA 2I54A 1WSBA 1N92A 3ILXA 3NAQA 3NTRA 4C4TA 4N0PA 3GEGA 1DFHA 2D2VA 1ULBA 2JARA 3H8WA 4MGYR 3Q85A 5CHYA 5L7TA 5B1IA 1RNLA 3QPUA 2FZLA 4UTOA 4DQLA 3OQOA 3F6BX 3PI6A 2FHPA 1IY8A 1LWOA 5TMDA 1W34A 1U31A 1UPCA 5DEOA 1RYZA 4KHZA 4F6LA 4G5SA 4ANFA 1TADA 3GFPA 3OU2A 1DSSG 2K2WA 1YJCA 3RO7A 3THOA 4KIUA 4BKPA 3K8YA 3MCZA 3CBGA 4LIPD 3JAWA 4TTSA 3BYZA 1JPUA 3M2TA 4QQRA 5EWMB 3Q5GA 4E88A 3W5SA 2JLCA 3M9XA 2RD2A 2PL9A 4EJSB 4YT2A 1O94C 2E82A 3ZY3A 1JYEA 1PGJA 4XD2A 1T26A 2V7TA 1QH8A 3CR7A 4L3WA 4RV9A 3IPAA 1ILWA 4RENA 1YB6A 5SICE 4DSOA 4X90A 3GJ0A 3D3JA 4C43A 1FPQA 3TE7A 3PR3A 4WAUA 1AV7A 3U19A 2VKQA 2FX2A 3KQTA 1VXOA 5KIAA 3WK5A 3V4SA 5FUBA 4YCBA 3UC9A 1Z83A 4YUXA 1UKZA 4KSYA 5CG1A 1CNFA 1KY4A 1JH8A 4G4SO 5CGZA 4AIRA 1P8AA 1ODSA 2C5EA 3D7SA 2PGIA 2ZCUA 1LGYA 2WI8A 3EA5A 1GWNA 3LUCA 4E2ZA 5KJEA 4CTKA 1X9HA 3II6X 1JJIA 4WNAA 2P5TB 1XCBA 2WAYA 3NAZA 3ZTTA 8ABPA 4OHPA 3CRNA 3DL2A 3QUSA 3EGDA 4KXVA 4DZZA 4KGZA 4ZZ3A 4H6WA 4J2TA 3EVDA 4XJSA 2ZVQX 3VNUA 2QTTA 3BZUA 1I3MA 2QQFA 2C3PA 2OKGA 4IAOA 1ZJWA 2C1XA 1OY1A 3QVGA 4K8RB 3VPBA 1ELOA 1JG7A 3S27A 1FB5A 4CL0A 1E4EB 1UBLS 1OILA 1S89A 4FC7A 4KDCA 1R8SA 4HGQA 4UFPA 1IK4A 3KB8A 1WS6A 4PPGA 4Q05A 4ZDIA 3LLCA 2WJZB 2FSUA 1ZJZA 3HU3A 2YV5A 4PLYA 5DK4A 1ZUHA 1QK3A 4FB5A 1LLQA 1NHWA 2WJHA 2PHZA 3GH3A 3K9HA 3PJFA 1FUKA 2GUGA 5CXQA 3QWHA 1EFRD 4H31A 3FFWA 1HA3A 1T3HA 1Z88A 1HDXA 4RFVA 5I51A 5C8YA 4CHGA 2IUSA 2Q4TA 4MP6A 5KNBH 4QRIA 5T5QA 8ADHA 2B8JA 1JG6A 3TJZA 1L4MA 3EISA 1JHOA 2UZ3A 1Z25A 2HLHA 2NXCA 1OX4B 2O7SA 4H3SA 4ZV9A 1G3IA 1PJAA 5FULA 3CZ9A 2JH3A 4OMFG 3MJSA 4IMRA 3RIHA 4HB2A 4US2R 1Z7EA 2AUTA 2ECOA 3V8VA 3KVYA 4TS1A 5LUAA 4PC3A 1DNPA 1J5PA 1U8UA 3RIXA 3WIDA 4Q4AB 1ZNYA 2C9MA 3H42B 3L7IA 5DLYA 4OB6A 3ZH9B 2JFUA 1VL2A 1F8XA 4H4EA 3UK2A 3D2AA 2AEEA 2FNAA 3IOBA 3AKEA 3HHPA 5DWQA 3SN6A 3PG5A 1IMOA 3AM4A 3JQ9C 4JOBA 2R5WA 3OZRA 1MO4A 2GBCA 1K7SN 1JBEA 1M5TA 2GN1A 2R1TA 1MB2A 3FX2A 1WDWB 4W7HA 2DLDA 3Q9LA 3WG9A 4Z54A 4IIBA 2PGJA 4RMIA 4ZAXA 4NTZA 1IOLA 1VL1A 1WHTA 3DP7A 3OF2A 2YYZA 3K9NA 3HR8A 5BWLA 4IO1A 5CFQA 3H6GA 1WETA 4R8MA 4U7DA 3FPEA 4BNWA 1EHIA 2WFAA 3TN7A 1I5RA 3AESB 3O0TA 4EATA 4UVGA 121PA 1RJ9A 1CF9A 1Z2EA 1CIVA 1NXTA 1U2PA 5J9FA 5K6TA 2QXYA 3GZ4A 4YBRA 1MVLA 4DA9A 2UUAB 4YDSA 5BYJA 3RBXA 2REQB 4TXJA 3I8SA 2J5RA 5I9LA 3ID6C 1DRKA 3FW1A 4GO1A 4JKIA 2LCQA 4QOIA 3PHLA 4JROA 1SUWA 2WUWE 4E5SA 2H07A 1NF3A 4B09A 1M5UA 1IUNA 1DDIA 2UDPA 5FOUA 3FGZA 3ZWAA 3HWWA 3VRHA 3SC2A 2IEZA 2YQ4A 1OLUB 4TLBA 4FMDB 4ZGBA 3WGOA 4BYMA 4DMRA 3O4JA 4CMEA 3L82B 1PFYA 1XMSA 2PA3A 4RJLA 2ZYUX 4AJ2A 1VJRA 2JIPA 1UZUA 3DZBA 4MIOA 5K1ZA 4J0QA 2IXEA 3BK7A 4QOHA 3M81A 4MCJA 3VYSB 2Z09A 2QZJA 3SSNA 1DLJA 2ZJ4A 1ZM9A 1SWWA 1OV6A 3K16A 3WMXA 2BGLA 3VPGA 2XXBA 4JBYA 2HSJA 3A9RA 1DO0A 3DTVA 4UMVA 5GONA 4X64B 5IM4F 2I2BA 2R6FA 3KBOA 4AO6A 1PNQA 1J0EA 1UMCA 2AF3C 3F5FA 3HXPA 3A2LA 1VBMA 1CJBA 3L1IA 4IV5A 2PK3A 4E5PA 1TMOA 1E7RA 4OREX 2PH3A 1PVOA 5IKEA 4TLDA 3QF4A 2WV9A 1OV4A 2XUOA 3ABSB 1SCBA 5IF9A 4JL5A 4CF6A 1R8QA 2R65A 4UCXA 4BECA 5LU9A 1TCAA 3H1AA 3EOAI 3KTAA 4JLNA 1WMFA 4TTVA 3RG8A 4FD3A 4NLLA 1G2PA 3TQIA 6NULA 3AX6A 3FVVA 5AKZA 1VCHA 2NZWA 3NC1C 3WWCA 2H3HA 2D1YA 4NH0A 3KKOA 4PCLA 1PGPA 2QBYA 1RPTA 2BGWA 2QXTA 4TKZA 1KGSA 3SM3A 1L3IA 4Y9TA 3CF0A 4BKOA 4V1CI 2D4AA 3A06A 3IC5A 3P9YA 1VL6A 2EKPA 2YMQA 4B35A 3C87A 3KJEA 4L8GA 4N9WA 3PNOA 5AJTA 3HWRA 1MRNA 1OCEA 2BJHA 4B44A 2NT4A 3QRWA 1T8SA 3CS3A 3I01A 2QTFA 4Z8XA 1J23A 3EUFA 2HWXA 4EMTA 1AHNA 4F3YA 4E30A 3ZWQA 3LZDA 3BXOA 1YQGA 1MCZA 3OEEA 4BFCA 2ADFA 1T8RA 3CX7A 3DDNA 3IAHA 1U5BA 4OK5A 5SZKB 2FQ1A 5L7WA 3QHPA 1R88A 1GAQA 3PVSA 1XTSA 1J4AA 3AY6A 4EHAA 1SFRA 3ZXSA 4K9DA 4BQQA 3T4XA 1EESA 1ZD4A 4XDYA 1P33A 5LA6B 4YAUA 1PJ2A 2BHNA 2BLNA 2V4MA 2SKCA 3BREA 4LSWA 4O2BF 5CAEB 2J3EA 5JMOA 4YACA 3V33A 1JB1A 2XA1A 5LB2A 2C95A 3U09A 3U39A 5DTQA 5GTDA 5KSYA 1KQGA 1Y8RA 2GD6A 2OK8A 1QIDA 1ZC3A 1H2ZA 2DWQA 2HXSA 5B7NA 2CNBA 4QDXA 3TSWA 5F77A 4JBWA 3FBTA 3D6VA 4TS3A 1PZHA 3O8RA 2Y1DA 4YNBA 1Z5OA 4WKNA 4PPFA 2PTHA 3VSCA 4KYUA 4QDOA 5KYUB 5A06A 3JTEA 1OYYA 1QPGA 3OY7A 4L7VA 3ICVA 5TF0A 1RYMA 1FRNA 4MWGA 3W2EA 1JMVA 1P0CA 1J0BA 1PEYA 4O1MA 1Z8FA 3KVVA 5DCUA 1B73A 2OCIA 2AN3A 3IUPA 2B30A 2QSJA 4G23A 3UMFA 3ZXXA 1HT2E 5CJJA 3TUIC 5K2OA 4HUTA 4RSRA 3DO5A 5K6AA 1A9YA 4RHFA 2ZIXA 3K73O 3OKPA 4PG6A 2GYVA 3H6HA 3GEEA 4L2IB 3WLRA 3N5CA 3NBXX 2GSDA 2JHAA 1BCRA 4MQUA 3UIEA 2O05A 2XWQA 3CZQA 3NT4A 3ZE7A 1G3UA 1JEYA 2O8DB 3ZLTA 1D2AA 3E8SA 2XSZA 1WW8A 1G8FA 3OTHA 4EPYA 4BVGA 1UT5A 2G67A 2WABA 3M5CA 1RAHA 3OTGA 1KS2A 2JZCA 4OFZA 2LCIA 5CT9A 4H6XA 5D5QA 5JCJA 2XH8A 1FTYA 5EINA 2P75A 5IEBA 1GAXA 1QR6A 1IEXA 4EQZA 2IQ5A 3L4BA 4MUAA 4D4MA 4II7A 1KU0A 1AA6A 2VJAA 3QE3A 1NVXQ 1V4VA 5HS4A 3EX7C 2HRBA 3B38A 4DKJA 1Y48E 2D1TA 4WHMA 2M9MA 4G4JA 1KOJA 3CR3C 4L57A 1P1CA 1Y4UA 2AFIB 2HJWA 2VK4A 2C5FA 4W5RA 3RREA 3EODA 4Y9SA 2NYUA 2ZATA 4K2HA 1MV8A 2C78A 4L8LA 4OHMA 4XDZA 1RQGA 3LF1A 3PQEA 4DLNA 5INTA 3E27A 3TZBA 3QYFA 3WK4A 3PJRA 5HFNA 2VF2A 4CEJB 1Y63A 4DQVA 2GFQA 4B7XA 1L8LA 3HJHA 4HWRA 4A73A 4ND1A 3FPFA 3NLLA 1RCUA 3E84A 5B3JA 4R1QA 4ZYVA 2CLEB 4FFPA 4EUKA 2OB2A 4GUDA 5EOVA 2VAMA 4JUBA 4A0HA 1TLLA 1LU9A 3KE9A 1XMPA 2IDMA 3PFCA 3L0DA 2HCRA 1GGVA 2NXEA 3MRSA 4HQNA 3FSGD 2XODA 3UAVA 4K9RA 5HK8A 2LKCA 2A86A 1Q50A 1SG0A 1SU6A 2ZS7A 2GRAA 5DOZA 4HG2A 3O82A 1I4TD 3C48A 4DY6A 1E3IA 4GR9A 2HTFA 3C8HA 5EFZA 4DV3B 1QUFA 2ZT6A 2I76A 1NJ5A 2A9VA 3LKDA 1EK1A 4GR5A 1RYBA 5DASA 3RTAA 3IDFA 3ZHCA 4QPPA 4NECA 1T0IA 2LD4A 3ZJ5A 5BV2P 1E3MA 1N2CA 2EBWA 5H1YA 5HBRA 2D13A 3U16A 1SXJE 1U90A 1XQYA 4JUIA 2ZSDA 1LDMA 1SEVA 4YCDA 2ETVA 5AJHA 5FL7D 2O8CA 1JR4A 4TVKA 5TMEA 2Q5IA 4QFMA 2XMSA 4AZ3A 2QN7A 3A3KA 4EZEA 3K1AA 2VEOA 4PIPA 4M0CA 1ID8A 2Z4RA 4P22A 3X1JA 2ODPA 4DA7A 2AJBA 5U1PA 2H6EA 2O48X 1E2UA 5GAJA 2F3UA 5AVOA 3DPIA 5JTUA 3H65A 5T8KC 4NONA 4R2MA 3UHPA 4TKUB 5CB4F 3H9BA 2ZOSA 3UJNA 1C4KA 2K7FA 1FYXA 2RI1A 1TKRA 2D5LA 1YDGA 2H1WA 2IP4A 3JY6A 2PMBA 3N3BC 3NS7A 3O3CA 4D46A 4BTEA 1K4YA 1N1GA 2QYSA 1IHDA 1BKDR 1J9ZA 1ODFA 3K0KA 4GEGA 1NY6A 1KWKA 2I4NA 3AW9A 4N40A 3SWWA 2O8BA 3N8NA 1S8NA 1G55A 2WQZA 2ZRPA 3LJKA 4GZ5A 5LCXA 3TLAA 3GFFA 1PRYA 1DXYA 1MXFA 4FHCA 4UVHA 5AK0A 4Q93A 1HEUA 1SQGA 3H5TA 1TF5A 4RZ2A 2GR9A 1NVVR 2JCGA 2VWPA 3G2QA 4LRTB 3FFTA 1ZGGA 1ZYUA 3LO5A 4DLUA 3H3FA 5DSXA 5AK3A 1ZKMA 4YFVA 4AUMA 5JAQA 3JYPA 3SE7A 2V4ZA 3LD9A 2XGOA 4KG7A 4CUZA 3I76A 1KH3A 4FBGA 2E0IA 1KK0A 5H68A 2FSPA 4KH0A 2O57A 2Z2XA 4XWWA 3A0RB 2X40A 3HJAA 4BQNA 3SF8A 4PPNA 5K4GA 1IXRC 3PRYA 3PNLA 1L7MA 2G9ZA 3HJNA 2BF7A 2Q6OA 2ZTLA 3MELA 2DERA 2F3SA 1Y6QA 5IN5A 4RTNA 1OX5A 2VK2A 4ZI7F 3QEAZ 4X94A 4P6VF 4DLAA 1OJ7A 3K0BA 2GPAA 3RAPR 1H23A 2Z2KA 4IGIA 1UT6A 4BNDA 3SZMA 2GN9A 4R7GA 4Q39A 2GXUA 4ML3A 3HZZA 1OI4A 3CUSA 3BJEA 5EJ5A 4ESVA 4C7BA 3QKTA 4PZCA 4G84A 1Q83A 5JG7A 3UH1A 5BORA 1Z13A 1NJFA 3WGZA 5L3ZA 5CDSA 3WWZA 4OJTA 1NVUQ 3HRHA 5JYBA 4E33A 2YUTA 1VXRA 1ZD8A 4LA4A 1I4WA 2OD7A 2G82A 2P0AA 2CCJA 4B3JA 1P2DA 1QIHA 1ODIA 4XB1A 1EGQA 1SVLA 5KCMA 1N78A 3OZCA 2ACKA 1Q7CA 1IATA 3QELB 4GX0A 2UZ4A 3D02A 3C41J 4QECA 2XI4A 5BYAA 3ASVA 3FYUA 4PE5B 4LHYA 2ZRFA 1RHUA 4D9FA 1XWFA 3LY8A 3DVRX 4N76A 5LXTF 4BAGA 4YREA 1C9KA 2VLBA 2PA0A 1NJ6A 3WXMA 4Y2TA 3UWKA 1EP9A 2EU8A 2OR3A 3A2MA 3G02A 4NATA 3H11A 1LFDB 2IKQA 2AEMA 1KKUA 4P5DA 1JZSA 4AMBA 3H2IA 2XCUA 3MTGA 2PUGA 3NI2A 2R4TA 1HFWA 4EA9A 5LOVF 5EJ2A 1ZP6A 4HRAA 3HXTA 4JGIA 4N8DA 2JS7A 4BWFB 1L7DA 1JDPA 2X1MA 3HKDA 1JLKA 3OZFA 2NU6B 3N1UA 3PUZA 5FLXA 1L7RA 4MCIA 1WX1A 4G1MB 3DWIA 3DL0A 1D3AA 2XX3A 1CK4A 3DZ8A 3EQ8A 4UEWA 3L7MA 5H5JA 5ES4B 1DTSA 3PHBE 3Q1LA 4BX3A 3NDIA 1SXJB 1VMAA 4B6FA 4X93A 1L7BA 2OHOA 2KWIA 2W2XA 3GGPA 1C3JA 1WZNA 2Y8EA 1K3UB 3I9JA 4TT8A 4A15A 3WXBA 1UOQA 4FLMA 2NSHA 4UNQA 1KERA 1QOPB 2YKGA 1E79A 2EX0A 2UAGA 4CIBA 1NKVA 2HAEA 4ARBA 5FIUA 3EFOA 1YB1A 3TZEA 3GY0A 1Z07A 5JD5A 2YWJA 4J3FA 5JJCA 3VZSA 3RW9A 4ZREA 4YR7A 5ICMA 1R00A 3LKVA 3U7RA 5MN6A 3WP0A 1R4AA 1J8DA 2SKEA 1I7PA 2AG0A 2VHXA 3EEIA 3HKCA 3OZTA 2IU0A 5KU7A 4B73A 1E2MA 2NO9A 1EE1A 2CKDA 2H00A 2OOKA 2G08A 1G16A 2XHEA 1AZSC 3BBLA 2R62A 3UAZA 2Q5OA 3GUCA 1RM5A 1BZYA 3LSYA 3N0RA 3M3DA 1YBFA 3PYMA 5JHGB 1A9PA 1LUAA 3BPSA 3OP1A 5JCPA 1YS2X 2PKXA 2ZJ6A 1PJQA 2ZUBA 3NKVA 3I12A 3R0XA 3AHCA 4U00A 5HFJA 4K86A 7ADHA 1YAHA 4D4JA 4F1KA 2NW6A 1OE0A 4TS4A 3BXHA 2BBWA 3H3JA 1PSZA 3HB0A 4NBWA 3RK4A 1C1XB 3UJHA 3HB1A 2ZM6B 1M3SA 4QLAA 3RV3A 1FNCA 1CUFA 3PCTA 4Q18A 4B3IA 1JKJA 3L46A 2RFLA 3SBOA 3STTA 2GNAA 3AVTA 4ESOA 4RD0A 3OVMA 3CV3A 1N4DA 2WMDA 4IDQA 3ITNA 1UMKA 1VE6A 4P81A 3EBOA 2ZYWX 2CHUA 3OLXA 4FYYA 4I99A 2FR8A 3SZOA 1QV6A 5IKOA 4AICA 4UVDA 2PWPA 4QU9A 5ITSA 4QG3A 3ISTA 1GSHA 2XQJA 4HAUA 1HQCA 1XLWA 2X9GA 1DEOA 1ZGHA 3NVDA 4ZO9A 5CDTA 5IKPA 5LD2B 1X7XB 4U7JA 2GUWA 3OE1A 3NHLA 4IO0A 1M7GA 1PJ4A 3I39X 4A5SA 4B9AA 1TIPA 1U8TA 5A04A 2FX5A 4TMWA 4I5FA 4QBHA 1BDMA 1SAYA 3JYNA 1TUBB 1YXMA 4EOGA 2H1OA 2FZ5A 3ENQA 3ZJVA 3WL7A 3NJ8A 3HLYA 1S8OA 1E7WA 4QYTA 4K2AA 1M75A 2C29D 2MMGA 3A58B 3AEUB 3EWNA 4FFNA 4ITVA 1ZISA 3UMRA 2WG2A 5HJ2A 1JEJA 3IILA 4GYWA 4OQZA 2DSNA 2VDRB 2AKEA 3NGMA 1KARA 2H7XA 1N6PA 2R6ZA 2N1BA 4YJ2F 4OFBA 1OTYA 1LX7A 1RBMA 1QDUA 2JFZA 1DIBA 2YWRA 3A1EA 3KQVA 1A72A 3LXUX 5LC1A 4LFCB 1CV2A 2QSUA 5ALLA 1P4SA 4LRXA 1WXFA 3OWHA 3OPVA 4PCUA 1YDMA 2COKA 1N5MA 5HDQA 3LCJA 1A76A 3EYWA 4EUFA 1P7PA 5B57C 3I83A 4ARUA 1QHXA 2Y0BA 4EKNB 5BNTA 3HG7A 3ZUGA 1Y8QB 4WZZA 4AP9A 3IAS6 4Z2AA 5CP8A 2HYIC 4JP1A 4YUZA 5C7OO 1J0CA 2W2MA 2MCFA 4S35A 4LZPA 4NCIA 2NSLA 1XAJA 2PRJA 4UEKA 4CMEC 3ZJUA 1TW3A 1KP9A 2YWHA 4MKRA 4NSNA 1U3FA 4ZQCB 4LYDA 1XTTA 3PDIB 4CMGA 4L4SA 1XZAA 2GT1A 1SKQA 5KWJA 1KBZA 1UC8A 2JI6A 4NBRA 5DV9A 5GZ3A 1J9EA 4ND6A 2XZLA 5DMXA 3L43A 3R7SA 2UU9B 2XTMA 5JYDA 2H1IA 1LDNA 1RWMA 1SZDA 2C97A 3GROA 3O03A 4OM8A 4R68A 3VHLB 3AR5A 5DDIP 1QLWA 1UOPA 5KQSA 4O4JB 3G82C 2VDPB 5C37A 4WY5A 4UBMA 1HT1E 3MB5A 4CTMA 2PZ8A 2Z5LA 2XCLA 3OM8A 1LD3A 3U3XA 2EJTA 4FHFA 1XD8A 4YP9A 4EB6A 2VZEA 4PFSA 3I6QA 3HB5X 2WMNB 5ALGA 5EYPB 4CKWB 4V0LA 1DT5A 1QH0A 3WFIA 3HN6A 4NK4A 4K7JA 1E9VA 1GPJA 5HGJA 5DF1A 3K6KA 1E5LA 1LVGA 1ZMRA 2WIDA 4I36A 3QX8A 5KYWB 3BCRA 2FN9A 5DI9A 1TEXA 2RG7A 4GLJA 1YA8A 1SCDA 1BCSA 1WABA 2OO3A 3K96A 3N7TA 2GAIA 4LI0A 4EY5A 2G71A 1JJ7A 4JI3B 1SU4A 3UM9A 5CFPA 4FS8A 1NAHA 1DUSA 1CE8A 1V3TA 5CA0B 1POXA 1SRQA 4LC9A 3RRFA 4YJ3F 1BQEA 1BJTA 1ISIA 1A9SA 2GO1A 2IIVA 3S1SA 4E22A 2Z5GA 3JD0A 4FD2A 1GKUB 1WXDA 2JEOA 2OCAA 3ZBPA 4JI7B 4US1R 3ODGA 3K9WA 2ZZKA 1EA5A 2IU3A 1BVYF 1KYQA 2W93A 4GNRA 4BXOA 1M2NA 2AZ4A 2RAPA 2D0PB 4FMBB 1ZOIA 3Q3EA 3UNXA 2ZI4A 2XAUA 3QK7A 4KQGA 2YYYA 5FFFA 3ZBTA 3PUJA 4WRRA 3U4AA 3ZZMA 3RSSA 1PSDA 3EPKA 4RPKA 2ONJA 3H9GA 4QVIA 2PO7A 2YWGA 1Q0PA 1YNSA 4WBSA 5F5NA 1VDZA 3FUWA 2VO1A 1EHCA 3QBVA 4JHLA 2WMYA 2BZSA 1QFYA 4X41A 3GA5A 5CVUA 4MQFB 3GP8A 3OHSX 3BUSA 4EJ2A 1WSWA 2JGAA 3E15A 1QVVA 1E9RA 2ZPAA 1MP0A 3KOWA 4C1BA 3H7IA 3GFTA 1W4BA 1YHZA 1YS9A 3HVKA 3KL2A 2N47A 3PU6A 4YAKA 1ZJYA 4BQEA 3R3ZA 4X6YA 2JB9A 3C3BA 3FTQA 3IPRA 1GILA 1X70A 2C5LA 1MVOA 2OZPA 1SHJA 2WJVA 3WJAA 3S81A 1WZEA 3KX2A 1R4NB 4L78A 5B58T 3RT7A 4EY6A 4QHTA 4FSHA 4YXWA 1XZLA 2H4XA 3KZCA 4HNGA 2PUWA 1UZMA 1FYFA 2YH2A 5K6AC 2CXUA 2CL0X 3THWB 4NAVA 2FZWA 1IEQA 1MUUA 1XCPA 1S2IA 4K0RA 4MCAA 3V2IA 4ZYTA 5BV7A 5CDFE 3VPSA 5AHXA 1I9GA 3VHRA 5E9JA 3FFAA 3LQFA 4KN6A 1H66A 1QHHA 1GARA 1Y7HA 1Z5GA 2B1GA 2A0UA 2IELA 4RKFA 4ZO4A 3V8BA 3NRBA 1N9ZA 3OCZA 2WSSA 3WRWA 2UUPA 1OGJA 2Q2VA 4QNRA 1D5CA 2H4WA 1SKBA 1J2YA 2Q7XA 4CTJA 3IQIX 4MV6A 4Q1EA 3S99A 1U1IA 4R9SA 4WERA 1PX0A 1P61B 3O73A 3C6XA 1CUHA 1PJZA 4TXMA 1DE0A 2BI8A 2VHYA 4YMHA 3W1EA 3L4BC 3B6KA 1JLLA 2QF7A 2IW3A 1VLZA 3NJRA 5JE8A 1GPWB 3EF3A 4DOMA 1NRIA 3T9AA 3ROFA 3D6NB 3QU9A 1KEKA 2GFHA 1MLDA 3KR2A 1KA9H 2HMTA 4MKHA 1S6YA 2AD5A 3PQFA 2P2LA 2WFZA 4DLXA 1XK6A 2GM4A 1WPGA 1T2FA 2OT3B 5EQJB 5B1SA 1XTZA 3BTSA 3RSHA 2ZTHA 3GRCA 3NCTA 3V7NA 2Z6UA 2X8JA 1L5LA 3QKSB 1DJMA 1P2GA 2VAXA 5EMJA 3U0BA 3JQAD 4IY1A 2D0DA 1L5ZA 4CDRA 4G1EB 1QYXA 4FOTA 2C88A 2P3SA 3JU3A 4LTNA 3NHSA 2WTXA 3DNFA 2WJ4A 1G7TA 3I2FA 3N8DA 5HIMA 4DBVO 2I67A 2ARKA 1H2HA 2FR1A 1JZTA 4JEMA 1I14A 3UQZA 1JSRA 4PQGA 2PMEA 3PNSA 4FCTA 1E2GA 1O95D 1SXHA 2PUHA 4ZAZA 1QSGA 5JSQA 2ZZNA 4JLBA 1RHRA 4JIGA 1N0HA 3EVBA 4XUDA 3LPAA 4D3ZA 5KOHA 1M2JA 4HLUA 5FHQA 1K8YB 3UN1A 1DPFA 4Z4QA 4DDTA 1LBQA 3COWA 4XIFA 4GE0A 4G41A 2E5LB 1VFPA 1W4AA 2C1ZA 2FPOA 5AKKA 4BU0A 5IFKA 1IOVA 1E60A 4U3JA 3V6LA 5K3AA 4LNUB 4YHBA 2H7CA 3D3QA 4TQGA 5EZYF 5TX7A 2DAPA 4R8LA 2QTVA 4KJXA 4LBZA 1JDSA 1N57A 5FQOA 4U4AA 4CIXA 3I52A 3N75A 3VR2A 4RKEA 1U7UA 2QE7D 3W8DA 4ZHQB 1MO2A 3RVLA 4CJXA 2XDQA 4S1TA 5LR6A 1J8QA 3IEKA 5FKJA 4Z1OA 4FX5A 2M32A 3AFMA 2PFKA 3IIKA 4ZAVA 3WGNA 2G25A 3DHVA 5DCLA 1OXKB 2QRZA 2Q5QA 3TRFA 3TW8B 2ETXA 3OMWA 1JQJC 1K5DA 1ZNQO 2QKYA 4CLRB 2QT1A 1Q0TA 3TTTA 1JHYA 2J85A 4NESA 4BNTA 2UUBB 1MRZA 4NZ9A 2JLRA 3JASA 4L5JA 3KYCB 3U6BA 2Y9PB 1QKKA 3D8HA 1I5EA 3IDAA 3OIUA 3QW2A 3Q3HA 3KAJA 1VL8A 2CNWA 1IEVA 5CBKA 1NHGA 4URWR 2GD0A 1SGWA 3K1TA 4ACAA 2QVCA 3LHFA 2PRKA 3WBKA 1ZC4A 1Q57A 3JD3A 4BN5A 3OEWA 1ID1A 1UBSB 2Y93A 2GHQA 1WUHS 4TQ9A 3K94A 1L5WA 1VHLA 3CNEA 3S2EA 3ZHOA 4AJKA 4YBZA 5HZHA 1XPRA 2HR1A 2OP0A 4XYLA 2G17A 1G5HA 1G6KA 2CV0A 3SIXA 1XVUA 4IHQA 3VTAA 3QOYA 4BMXA 2A5FA 3ICEA 3U4QA 5FOSA 4FW9A 4KH1A 3T1NA 3LBHA 1L4KA 3QTLA 3UK0A 4C4RA 2HK8A 2Q5EA 1GZSA 2SNIE 4HFRA 4AMZA 1A7JA 3IV7A 3NVMB 1FP4B 2ZAGA 4BO9A 3UAYA 4CI0B 1IBLB 2FMKA 4YWHA 3DMTA 2I6XA 4D0RA 3DQPA 3WNCA 5JAIA 2Z58A 4HNVA 2Z9BA 3QPVA 4RSGA 1II8A 2J9RA 3V2GA 3RUPA 4AN1A 2D0OB 2FMHA 3FKJA 4W7SA 2P30A 3RLIA 1DIHA 3K0AB 3LDUA 4FEEA 4EY3A 1M0EA 3MXOA 1TEVA 5F73A 5DT9A 2GB4A 1DG3A 3A9WA 1P77A 2O1XA 4GMXA 3AI7A 4K3UA 4XI9A 1MAWA 3VYVA 3ANNA 1OFVA 4DFDA 4BO6A 2IPMA 4HOYA 3W5AA 3BTUA 2AI2A 4MUKA 5HF9A 4A6XA 2VYVD 3G8YA 4EFMA 4ES6A 3TFWA 3D8SA 1I0ZA 1TVKB 4UM8B 1T0BA 2A1IA 4QXAA 1RQ7A 1VP3A 2J45A 4HEA1 1UKBA 1BDBA 2R1VA 4ZN6A 1L8OA 4NL4H 5D6NA 4BO7A 3LVBA 5KNBA 2AR0A 3K70B 4QUDA 1DC4A 1X2EA 4WCFB 3K71B 3TPCA 4WBNB 1KBQA 3O1IC 4P32A 1AK9A 2Q46A 1D0SA 4KTTE 4YJGB 1P19A 1L4GA 3AH8A 3KKPA 1QTIA 3FYUC 2B2XA 4N01A 1SVOA 2G7ZA 2VJMB 2IZ7A 4L74A 1LBSA 5E0KB 5EESA 4M49A 5ERYA 1MB3A 2WJIA 1X8JA 2XKAA 4HO1X 5KKAA 4DR6B 1ONPA 1QDEA 1YU9A 2SHKA 4XGNA 2FFBA 3SS9X 2IH5A 1AF4A 4GP9A 2CCGA 2WZQA 1Z38A 3Q3CA 1B00A 2EBHX 1LY1A 2XNCA 5CDFA 3A28A 3TKLA 5I7EA 2X6RA 3PUKA 3LLVA 3HTXA 5IBPA 1FDIA 3GT3A 3K6SA 1PX2A 1VLMA 1JEQB 1E1QD 2QZZA 2WVGA 3JALA 1N5OX 4P2GA 5CM8B 4B6QA 4OI0A 3OA0A 2PKRA 1KDZA 5I3CA 5L51A 5EHGA 2Y77A 3IPLA 2GI4A 3FCCA 1U4SA 1ESCA 1RM3A 5KB3A 3CLTC 4JQCA 1T0HB 1EG7A 4A23A 1HO3A 2BFEB 2QD1A 2C8KA 5AI0A 4M46A 4ENPA 5BSEA 5LMZA 1G8YA 2NSJA 3V4PB 2G76A 1P45A 4DANA 1R10A 2CXPA 3WNDA 4OFWA 2BMFA 2O2ZA 3AHFA 5FR2A 3L01A 3PNBA 4RVDA 1QKIA 5T6MA 3AY7A 2FV8A 2REOA 4R1NA 3PD0A 3EXHA 1SVSA 1X74A 1RYHA 3EZLA 3KXDA 3TXXA 2GA9A 2QWXA 3CU5A 3OUTA 4HEJA 4Z3DA 1DUVG 3CIFA 1UDBA 1Z3IX 1NXXA 4FJ0A 4IHAA 2PKWA 1DV2A 1E1DA 4HWGA 1I2MA 2XOKA 3EIXA 3P52A 1DEKA 2Y71A 4REOA 3FPCA 3QEMA 1QE3A 3HKBA 1I4EB 3LYHA 2HMWA 2VRNA 2WWXA 4BFYA 1IJEA 1Q21A 4MR7B 3HCFA 4X84A 1POWA 4EUSA 3G0HA 4LMRA 1WG8A 3IOEA 2AWNA 4OXYA 1BGXT 2AK2A 3QVKA 2SICE 1U7PA 1JN0A 2C03A 3ES9A 4ADSG 1H1TA 1ZXXA 2OGWA 3KQQA 1ISGA 1WLSA 1A5TA 2P1RA 3A27A 4Y0NA 2QRVB 5DO9A 5KQMA 2I6GA 4E13A 1K88A 1KJJA 2F90A 1W4RA 1ZX1A 2WIGA 1DAEA 5LL6P 3A4TA 4YCCA 3KOMA 3ZUPA 5HWSA 1F0PA 1BMTA 2FSSA 3AK4A 3EFBA 2G9UA 3PA8A 5AWFC 3TTUA 3W06A 2FW8A 1IC6A 1ODKA 2FR8C 3QU2A 3N2GA 1SXJC 4DCJA 1PR3A 3UAOA 1L0BA 4FFRA 3AUUA 1VPEA 3AV0B 1C0PA 1MEJA 1U0JA 5GONF 1FNSA 1ZCAA 4RLSA 1NF8A 1F8UA 4TVOA 4B17A 3SHFA 1JIVA 5A5EA 4E5YA 1ST3A 3DULA 1GCGA 1UZAA 4QSMA 1QNLA 4DR2B 1IOZA 3O21A 2FDCA 3SX4A 2QUKA 3UBTA 1GZHB 3CVOA 4DLRA 2AEFA 1PS8A 3V8PA 1P0IA 1ODJA 5TPWB 3EGXB 1VTKA 4GPTA 3NBYC 4F60A 1J97A 2P9YA 5FWDA 1JQKA 4L51A 4Y0AA 4JBGA 3PXXA 5ALRA 2KE5A 3JD1A 3TL6A 3S6JA 2DWOA 4BMNA 3U0VA 4NYIR 4OHOA 4JI2B 2DFTA 2GBLC 2CK3D 5TS2A 1WP9A 1KH2A 1U8AA 4MAFA 3WL5A 2GPNA 2Y76A 1CQJB 4GXQA 4KVFA 1N9KA 4B8WA 2WKPA 3RJMA 3ZI0A 1W1UA 1S02A 3E3AA 4IDAA 3ND9A 4KODA 3IA7A 2DPGA 1KBOA 3LCMA 4L27A 4XZ3A 4DIEA 4UFOA 3H19A 3WKCA 4WY2A 1M1YE 4E2WA 1Y82A 1E3WB 1U7XA 3TKYA 1HTBA 1P1BA 2BT4A 2H2AA 1QMGA 1XZ8A 1B6GA 1Y9JA 3VR6D 1E2DA 3EH1A 2COEA 4LJSA 4BUJA 4JP8A 1BYIA 5TQVA 4ZCPA 1M0SA 1N2JA 5PNTA 1KAQA 4EKGA 1K92A 5EZ5A 2FW7A 3JD2A 4IL5A 1AK1A 2O50A 3B1FA 3T1VA 3SZ3A 1FYDA 3WMEA 1RCFA 2WA2A 5LD2C 2GMWA 1N2EA 1DWQA 2B5VA 2H59A 1K9VF 3NDRA 4HYQA 4MVJE 2FDXA 4HAZA 2ZWAA 4F92B 1QBGA 2CXHA 2HPZA 3BB3A 4BE9A 3D0OA 1S2NA 3C3PA 4J76A 3EDQA 2N46A 4KAFA 3EMBA 2LVBA 3HKEA 3IHTA 3SU8A 5F2OA 1N6NA 4HLCA 4KRXA 3O8CA 1J5EB 1VFNA 2G36A 1N7IA 1ZN2A 1EQAA 4X7RA 5LQSA 3HBFA 4F6RA 1K68A 3R9IA 2BTEA 4D4HA 2IFTA 5BPFA 5C5EA 2YJ5A 1WB9A 2VBIA 4L9RA 4R5MA 4G2NA 2JLBA 1RJEA 1WMDA 3C43A 4Q4JA 5C8ZA 2OD9A 2QTRA 4R3UC 5KVAA 3FYCA 4ZP1A 2BFBA 3W2GA 4YGXB 1GUYA 5A9TA 2AYYA 1CY6A 3PHGA 2D1SA 2DG2A 1N6IA 2P8SA 4FGSA 4HS9A 3T99A 3W3AH 4PN3A 1E0AA 3MWEA 4PGFA 4TLEA 3JRWA 3FNEA 1YQQA 5REQB 4PS0A 1DRWA 3LW8A 3GNLA 4UHEA 1GQ2A 1WVGA 3H5AA 1Y3IA 3D2LA 1J99A 4QO8A 2J0VA 3TBFA 4Z1MA 3RVNA 3RGWS 4UDYX 2CE2X 1CDZA 1DTWB 3QV2A 3NAGA 4XEHA 3ETGA 4Q1BA 3SKYA 1TM7E 3ET4A 3HPRA 2HPAA 4KKVA 4ND2A 1TVMA 4OLJA 3K05A 3VPDA 4ITUA 2VQFB 3QW4B 4YRMA 4DIFA 3TMAA 4D6YA 3O7MA 3BQNB 4OKIA 4R31A 2XMGA 5KOIA 3HI4A 5CA1B 2BSQA 3HA7A 2BGRA 1RWVA 4LE0A 1QIMA 3NC4A 1NW9B 2IIBA 3MD0A 3HBNA 5AIAA 5E7MA 1LSSA 3CEPB 1G6OA 4HNTA 5T57A 4MVWA 3ML1A 1DEAA 1W52X 1UBJS 4CNQA 2X8LA 4HDMA 4H17A 3DEZA 5L3QA 2XYQA 4FNAA 4TM7A 5LPNA 4JLUA 3IT3A 3TF5A 4NICA 3MJHA 2BVNA 3ZHQA 1UPAA 4XWYA 3SQDA 4ND5A 1XYYA 1WUTA 2W2LD 5IJ0B 1JFFA 2XWBF 2PZGA 5B2EA 3ON5A 4TQAA 5HOQA 1EIWA 3HS3A 3DWFA 4G9GA 1MIOA 1TT5A 4WVLA 1YHYA 5DHPA 4JX8A 3FYHA 5AKHA 3W5DA 4RMGA 1E1NA 1KK2A 2I1QA 2AI1A 2I7DA 2RONA 2VQ3A 2YASA 3G8DA 3NH9A 3PRHA 4I4LA 5AKLA 4ZT6A 4WXEA 4H1HA 4DMLA 3ZQJA 3E7FA 5IHPA 1KEEA 3ETNA 1VB5A 2AR9A 3OQIA 4ID9A 2HV8A 2WP8J 3E0QA 1SZCA 4FMPA 1C9YA 4N6NA 4EW1A 1LBEA 5GJWC 3QYPA 1XF1A 4BNXA 1T8TA 2AT1A 9ABPA 3P9CA 5FBZA 3A3NA 4R4JA 4C0KA 3GJXC 2IYEA 5EHNA 2IEAA 3ROQA 2EBFX 1NBHA 1RWQA 2IXAA 3VAYA 4GUAA 1M1YB 5BUCA 1RIIA 2YN2A 2GZRA 4IMJB 2Z8YM 4OP2A 4WXYB 4HN4B 3UMSA 2ZR8A 3VR5D 3HP4A 4R1OA 2W4MA 5DISB 3VO9A 4JL6A 2IWHA 2I66A 4AJHA 2IEGA 5BYKA 1PDVA 3OQMA 2YW2A 4RVCA 3RUCA 1FFSA 3LX8A 4EG3A 1JYSA 2H52A 3KUXA 2ZSJA 2F8MA 4E3WA 3OJFA 3NOQA 1T6XA 3ULKA 2EX4A 1ZA1A 3UXYA 1A1VA 2NQTA 3F3KA 1YL6A 2ZUWA 3T9DA 2GZ1A 1SURA 3M6AA 1LBIA 2C84A 2OWEA 3H9UA 1ZIXA 2P4EA 3LG2A 5CHEA 2FEXA 2SCUA 3FCEA 2ZQ5A 4XRGA 5GINE 3PYLA 2QE6A 3QE0A 3TCXB 1U1CA 1DFGA 1UKCA 1ZGAA 4MA4A 4QRDA 4JGBA 3WB9A 5C1DA 1R0ZA 1NT4A 4PNHA 3RJTA 2TYSB 2XYPA 1IJBA 1LV7A 1NW8A 1WBJB 4JJAA 4L0CA 4P0PB 3HP7A 3BDVA 2VYND 3ANLA 3F5SA 3WL8A 1Z0UA 1EFTA 2A1TS 3GN2A 1BW9B 2OZLB 3MJTA 1VG0B 1NM5C 1NP3A 4MP3A 1AGRA 4NVRA 5GV7A 1ZD3A 3R7LA 5AVRA 3THYB 4P8RA 3B2QA 3LC1O 2JJ1A 1J24A 1QFSA 2R84A 3HHEA 3T0GA 1JFRA 3UY4A 3WGQA 3WQRA 4CR7A 1XZNA 3QKUA 3L41A 4JEIA 5A9SA 2FDRA 2HX1A 4OMCA 1T5OA 2C7OA 4BO5A 2CHQA 1KI2A 3GRUA 3CH5A 1T1JA 2PQMA 2H1VA 4EG0A 5KEIA 4M88A 3N2NA 3NM4A 3MGBA 4E15A 1E7MA 3G0IA 2UYYA 1JDTA 2H4FA 1JJVA 1ZSYA 1BEZA 2XUZA 4TL6A 5M5BA 3AHEA 1KRHA 3GAFA 1ZCBA 4JQSA 4JCCA 3WYGA 1N77A 1CXZA 1LA2A 3ILYA 4WZBA 4JJ8A 1FFXA 4QELA 3UMGA 1XZEA 5CYPA 4Q82A 5BRNA 1U1EA 3MAJA 2XNHA 4KDFA 5FI0B 3T1QA 4F84A 1MR3F 3F4BA 2PR7A 1U02A 5TGTA 4PSKA 1DINA 1TVEA 5LDGA 4D9KA 4HLUC 5LQDA 5J2TB 1RQRA 5KHOC 2K87A 4M9UA 4PC2A 2PZAA 1I1OA 1QAQA 4IKEA 5DP2A 2Q1TA 3P8ZA 4C4XA 4BOYA 1E1RA 4FS3A 3RJ9A 4RPGA 2CHGA 2G04A 2D7CA 3UJ9A 4ZT7A 4A92A 4CM5A 1W85B 4FYVA 1Z34A 1T8YA 2KSQA 1XWIA 1IQRA 4OHFA 1XLVA 3ROZA 3AP2A 2BMVA 2WDPA 4MDYA 4BUCA 3HCEA 4JP2A 4QTTB 5IVIA 3TOSA 1CJUC 2AL7A 2CEKA 4J0JA 4X63A 4HFNA 4MS3B 3A3OA 4NXNB 4OHRA 2LUOA 1QB7A 2A59A 2C4VA 3AM5A 3FCAA 1YD7A 4ASUD 1BJRE 4DW8A 3GLGA 2R79A 4HAIA 3CWCA 1HSOA 3N0TA 5K3FA 4BKMA 1GJRA 1NMQA 3GOQA 4U7GA 4M83A 1BRMA 2C5AA 4YCJA 1DJQA 4FFMA 4HPWA 4JLJA 2CFSA 2R6DA 4EF4A 1AHHA 1LPMA 4GYYA 1Z26A 4LWZA 3AEZA 3HVJA 1JFVA 1WPXA 3JCZA 1D4ZA 1UBMS 2PJZA 2VYQA 4FEGA 4IQ4A 3EA4A 5U4XA 2WM3A 3JRNA 1ODLA 2X1HA 1WSDA 3R5XA 3QUAA 4N12A 4EEZA 4HAWA 1EGAA 1YB5A 2BEVA 4Q3LA 3A1WA 5KWEA 3ADPA 5C46F 2E5FA 4P84A 2G5GX 3NYRA 1Z6QA 3WNBA 1M5RA 2G1PA 1NQUA 1VBNA 1PLLA 1U2ZA 1VGQA 1E8MA 1VHDA 1R9MA 2E21A 2V96A 1U98A 1BKYA 5GMOA 2GDZA 5GADl 3KETA 2P3LA 3RC2A 1L1FA 5A7GA 2HA7A 2JEZA 4IIDA 1TYZA 1C29B 1FXWA 1Z6PA 2JBWA 2O4CA 1II9A 3AONB 4OA5A 3SVLA 3AB8A 1VG9B 2Q1UA 3JQBA 4NBVA 1C80A 2ISQA 4O4LA 1E2IA 2PH5A 2AE2A 3DMTC 5KREA 2Z6QA 1RI2A 5ADWA 2F3RA 2J3QA 4LJKA 4Y6GB 4ZRDA 4XIGS 1UWCA 1I10A 4F5WA 4AYXA 5CGQB 4IFTA 5LQNA 1I7QB 1AUVA 3JQQA 4Z4EA 3D31A 4IFEA 4LXTA 1X7HA 3FKSA 4X8MA 1XYVA 1M6VB 4K8OA 1W49A 2EJCA 4D25A 3B82A 3T3MB 2AQKA 4HJXA 1EK6A 3DZCA 2NUAA 4CGZA 3G9UA 4JVOA 1YJXA 3E18A 3TQRA 3K0FB 1WEKA 3GGSA 4IDGA 3DNPA 1X39A 3HB9A 1VYTA 2HK6A 2YS6A 4I5DA 5EKXA 2IF0A 1DIOB 1PZFA 1VHTA 3IMFA 2VUIB 2AQ8A 4YMLA 3QFTA 4UXIA 3H17A 1HDZA 1XDSA 4EA8A 1Z18A 3U44B 2VL7A 1RQNA 1MQSA 2QVYX 3ZE8A 4DBZA 3INRA 2C8JA 1G20A 3W2IA 3DLAA 3WSTA 2G0NA 5K0FA 2WMOB 5TGDA 8AT1A 3Q6NA 5F3WB 4RK0A 2R11A 2WE8A 4W82A 3QSYA 2VI5A 1JAYA 4MWSA 5ELXA 5EJ6A 1UKEA 1XKTA 2FEMA 1TEZA 4F85A 3INTA 3E53A 3L77A 4NBKA 1D5WA 3L6UA 3L93A 3OMXA 5ELLA 2CUTA 4MO9A 4OUKX 4D0SA 1PCXA 1O4VA 4UZSA 2YL2A 1GKIA 2E4ZA 3REQB 1MBZA 1OXTA 1JHVA 3BSYA 2R44A 5GGXA 3KO8A 1Z4OA 3KEQA 3B3AA 1X0XA 2ZTSA 1K3FA 4FYIA 4KXMA 1OXVA 4KYIB 1ZUNB 1XDZA 5KWIA 1ZAYA 3GP3A 3I23A 1J1UA 1ECPA 1PT9A 5EP2A 4DSAA 7ABPA 4I1IA 3OE7A 1A0OA 1AZTA 3P0FA 4Y6SA 3VR4D 5JSZB 1O1YA 2ZI3A 2ZS8A 1RIFA 3K31A 4A8JB 5BSVA 1V4BA 4PIMA 1ADBA 3DAOA 4C0JA 3ZNNA 4WFQA 3U7FB 3BB1A 4PHGA 5JV5A 4KHPB 1CUGA 1TU3A 2W48A 3WFZA 4XOIA 1ZA2A 8OHMA 5JWOA 4PPQA 1DOHA 1F7UA 2ACEA 3UGJA 1NV8A 2AOVA 3EXHC 4KO3S 1V8BA 1EP2B 3RARA 3RVBA 2OK7A 1BQ4A 5KYYB 3KZVA 4O59O 1KI7A 2NUTB 3DDCA 3VKFA 4PNPA 3EIOA 1ZL2A 3JYOA 1D0IA 2BKLA 5D5PA 4F46A 4YRJA 3CUUA 1O4WA 1AS0A 2H0AA 1RYDA 1BMFD 1XDBA 1K7FB 1SBYA 2DPMA 2NAPA 4JBXA 3SJBA 5KYNA 5TT0A 1JKMA 3GN1A 2X7XA 5DMHA 3X2FA 3DBHB 4O6VA 3TD2A 4V0OA 4KO8A 4LDQA 1TM5E 3LUFA 2VWHA 2VPZA 2XJ9A 1GAEO 1K89A 3C98A 4BWYA 3KQKA 1XU9A 5I47A 2VIIA 1RWKA 1QLJA 4GOKA 4R98A 3A4IA 3DE6X 3LKZA 1OX4A 3ND5A 1URPA 3P9PA 4C7OB 3DLIA 3X1WA 1NJGA 2Y92A 4MVJI 2DB3A 1F4VA 1KYXA 3OMLA 5NULA 3O1HB 3NG1A 4GBGA 2EDCA 3BMQA 4HQRA 5SZJA 9LDBA 5DI3B 1UUFA 4XDGA 3ZJTA 5L40A 1O9GA 2EW1A 3FDJA 3NJ4A 1FDSA 1RXSA 4QATA 1MAVA 3U1BA 1R0CA 2IEYA 3A1UA 4M8KA 1N2HA 4EDFA 1SD2A 1GL7A 4XFKA 3WDMA 3HCDA 3FYDA 2NIPA 1DX9A 1ADGA 4EA7A 5F4ZA 4I1YA 1P72A 3LC7O 2YXNA 1XBTA 1LXCA 4DQXA 4XGKA 2DR0A 3ANTA 4G4SP 1G6Q1 3AU8A 4RAOA 4RACA 4U7WA 5FV7A 3PFBA 4B71A 1I3NA 5DTJA 2NU8A 3AESA 2V0CA 2WVJA 3H7AA 3JVUA 4MI1A 4N8EA 4OXXA 1C9DB 2B0JA 2XVMA 3BD8A 3RWBA 2ZJFA 1UK9A 1YVRA 1A2OA 2PT5A 2QD4A 1QQBA 1P8JA 2G28A 1L8AA 3LM8A 2G40A 4KDRA 4XJVA 5EE1A 1T9DA 5HM6A 3DEAA 3IUSA 1HURA 3ENZA 3U7IA 1GZ7A 5BOSA 4JX9A 4LYYA 3RRYA 3ZE9A 1Z17A 2AFVA 4EHLA 3RC8A 2IUUA 1VOTA 4MVJP 3X1YA 4B3HA 1JB9A 1C0EA 4ON9A 3X44A 4YPVA 4BX9A 1HL7A 2EJBA 3KPUA 2QP9X 4YUYA 4CL2A 4CEJA 3DT6A 2XUGA 5F51A 3BHIA 5BQOA 1TJ4A 1L5HB 1KZ1A 2D06A 2AQIA 2ZI6A 4M1YA 3RTEA 3FIJA 1GKYA 2GJ4A 3BEOA 1IBCA 4K26A 4ZOLB 5ECDA 4XJXA 2G4CA 3ZE2B 2GCOA 5LFAA 1A5BB 2ES4A 2ZG6A 2ZI7A 3TEMA 4FDMA 4IUBS 5GM2A 2HJSA 2XMQA 2VP4A 2ZJ0A 4ZDKA 4G3XA 4JT2A 2XE7A 4A6PA 3UG6A 4EW6A 5HOEA 4LRQA 2J33A 1PYOA 1BXGB 3DKVA 4FOLA 1YL7A 1N7JA 2V7QD 3MPUA 4RF2A 1RI5A 3JATB 4XX1A 3IB6A 5FTJA 2PGDA 3S44A 1AKUA 3UT0A 5DEIA 1Y3DE 1U9YA 4G01B 2MOKA 4C20A 2ZB2A 3OFJA 4EY8A 3T3DA 4H9GA 5EJ9A 5LKRA 3KQHA 4PZ0A 4F9EA 1XMXA 1QGDA 1UQUA 3AF1A 3IP9A 2CLOB 3RE1A 2H9IA 3GD7A 1F5NA 2I6FA 4KJZA 4L5BA 3N2ZB 1ABFA 1YJ5A 1W6UA 4V3BA 2NOAA 4KMMA 4DSNA 3VAZA 2WKSA 2X58A 1JR6A 2YZ7A 3B48A 4TUYB 4GMHA 4I4TA 1NE7A 4TQUS 1T9AA 2BUCA 1D0VA 1M74A 1YBAA 2CNKA 3K2EA 1HDCA 2Y9MB 3KYDB 2CYBA 4OATA 1O8BA 2FFHA 4MKIA 1ZMXA 1Q2XA 1R0YA 4Q3BA 5H3CA 3WHKA 4EITA 2B1IA 1XB2A 4IDPA 1RXUA 2VNIA 2X9NA 1L3CA 2WV7A 3C14C 3AXTA 1SHZA 2M6SA 3HYLA 2Q7OE 1LH0A 5GIOE 5BN3A 4EECA 3ERCA 2OZKA 4XAQA 3OLYA 1FQWA 2JVJA 3D1JA 1NU8A 3L4EA 1I2CA 1E5VA 1GPAA 3O9VA 2AJDA 1JA1A 1I7LA 2HA6A 4LGMA 4OJQA 3VZDA 3B7GA 4RTQA 3OCUA 4B81A 5ILOA 4EEKA 5AUQA 2V0GA 3OOJA 3KJGA 2V54A 3MUOA 3PKZA 3I4LA 1P2UA 1L5GB 2JFXA 3F7NA 1BROA 3AIOA 2DUMA 4L0DA 4JLOA 5FUYA 5FTKA 5BVHA 2FUG1 3QJGA 4JH0A 4COOA 5HFAA 2X9VA 5CDYA 1NIPA 1C3OB 5KTMA 2WU0A 4G86A 2POQX 3AGQA 1HYQA 1UL1X 4M38A 4AKHA 2NO1A 3MG9A 5F7OA 5K8UA 4DR3B 1KKMA 1MAHA 1P80A 2PBRA 3GWZA 2FAXA 4LDAA 5D1NA 1HC7A 2XF8A 4II3A 3VYRB 3WIOA 4YV7A 4JI8B 3PGLA 3FH0A 5AHKA 4GX1A 4EHHA 3FZYA 3BAFA 4ZCTA 3MTIA 4DUPA 3TOCA 3JV7A 3KEMA 2IYPA 2XQVA 2XUKA 3PKJA 5HA5A 2XYHA 5AVVA 3NP9A 1Q1QA 2ZB8A 4I5GA 4PICA 1HI9A 2L2QA 2IA5A 2PZFA 2X7JA 4J1QA 3RANA 2RDMA 4Z2YA 3WHLA 1P4RA 1T4CA 4C06A 5JECA 3ZY4A 2CNNA 3OCVA 1H8HD 2ZYAA 3ZD8A 3IQZA 1ZHHA 2J30A 4PWYA 3QVSA 1SCAA 5JZMA 3DE5X 5KYUA 1EFUA 4OVKA 2IV3A 3WBJA 5IBCA 1UBRS 2ZTUA 2R85A 3I3OA 3HU5A 1YCGA 2Q3EA 2BDEA 4HXFB 5K0SA 3N7UA 3DFKA 1KAGA 2BM0A 2NTVA 5C53B 3SFVA 3ELBA 3B1XA 1KTIA 1IXZA 2NVUA 1F06A 3OKFA 3CKYA 2GZ2A 3IPYA 1ZRHA 2R48A 4GGOA 3BGOS 4L6IA 2JF0A 1ZICA 1B6TA 4ALMA 3VNQA 4IDCA 3SI7A 3IV9A 2PUBA 4POOA 5KMGB 2ZTVA 4UARA 2O8DA 5L95A 1KE2A 4N6GA 5E1BA 2ZJAA 4KP7A 5DM4A 3ZZNA 5ALXA 4RDIA 3IMGA 3ZV3A 5EERA 4LYEA 1E6CA 2Q4DA 2OEPA 2X77A 3D6AA 4X71A 4BBJA 1Y4AE 5KTYA 5BNWA 1Y7IA 1A04A 1L6IA 5IH7A 4QGBA 1B1AA 5IS2A 3BSWA 1FFAA 4UBJA 5ITVA 1X7YB 2VK8A 2Q41A 1XI2A 1A5ZA 1WU7A 4ZVPA 5KC8A 2J7PD 1U4NA 1OZFA 2IXBA 4RLFA 1KMCA 3DTNA 3DDWA 4TVBA 3RVMA 5IEJA 1SKMA 3L8GA 3KZOA 2AMYA 5CVVA 4B6PA 3ETDA 1S2DA 4OXKA 1MH1A 1YC2A 4Q15A 3PQ8A 3SJUA 1SU7A 3OCWA 3U7EB 3WIVA 2ZRAA 2Q0HA 1GCUA 3SMQA 1ZY2A 1WXGA 4B45A 3ZQUA 1OGYA 1SHUX 1ZD5A 1LLCA 2QI9C 2JBAB 1OLSB 2OCBA 2WSMA 2GGSA 3B7PA 3R74A 1ZINA 1JGTA 2RGDA 3G1TA 3JQRA 3PSAA 1H6DA 4H27A 2CVQA 4RY9A 4IH9A 3UHAA 3FCSB 1RCTE 2QRNA 3D3NA 4QVKA 4TTIA 4ARZA 1H9AA 3S70A 5B7GA 5DNUA 3DUFA 5IAGA 1A8PA 4OV6B 1QYIA 4PLHA 1LQTA 2OO5A 5LNK1 3M5WA 2PX5A 1O96B 1XV5A 2VCEA 3BCHA 3KCNA 4ENUA 3SLRA 5MF6A 5ITZB 1V11B 1COZA 4NBUA 4INJA 4DYVA 4M8NE 1IG0A 2IHVA 2P9GA 1DVRA 2HFKA 3A6LA 1TMKA 2WUVA 4MZXA 1QOQB 3DEKA 1GZUA 2FRVA 3SGLA 1D1PA 4PO9A 3ZD9A 3A4LA 1CHDA 3DKRA 4JELA 3WLOA 3QBEA 1RE1A 1WUJS 4UNPA 3SQLA 4CM9D 4CKXA 1Y1KE 2CDCA 2YWXA 3Q0EA 4V03A 5DHUA 3GYGA 3OEHD 4TVSA 1JIIA 1Z4IA 4WY8A 3IUBA 3RBVA 4UDOA 1EMDA 2NPOA 1JU9A 2C4MA 4PC7A 5KJFA 3WL6A 1V16B 3GQBB 5AJZA 3HGQA 5JNSA 1FFDA 3PPYA 4JZYA 2INGX 3H2BA 2ZITA 1YK0A 3DL4A 4FOOA 1QRUA 1E8NA 4YXFA 2ZU0C 3MIZA 3QXGA 4NYMR 2J9YB 1QIKA 4YO8A 1ZS9A 3N9IA 4Q9NA 3WJ7A 3P0IA 3Q72A 3N0WA 1L7PA 2AFHB 4Q24A 4BRWA 3PEWA 3NB0A 4DXAA 3WK9A 3RSFA 1KTVA 2X2FA 3VZPA 5CVDA 3L18A 3TQOA 4NMHA 3ADCA 2LIVA 3PXDA 4OLFA 2UYGA 3NNDA 3PLNA 4V02A 1JDNA 4YLEA 5EGSA 5FFNA 4RBNA 1WDTA 3E48A 4FOPA 1RLMA 4ENQA 1BGWA 2VJQA 1PEAA 1SRRA 1USGA 3HV0A 4JT4A 3K9BA 1WB4A 2AXEA 4KQJA 5ADVA 1CQWA 1SOUA 2QV0A 4DG9A 4YP0A 2F8TA 4OLAA 1TE2A 2EHDA 2QM3A 3ENWA 5ETJA 1H4QA 1ZVVA 3MS4A 1PT5A 1KQOA 1NN0A 2OGSA 2PGXA 3NW9A 2RIPA 3QLVA 3L6CA 3ZS9A 3KT3A 2X4IA 5HJ5A 5JAHA 1O94D 5KNDD 1Z4LA 3EBLA 2GPYA 2WHPA 2ZIVB 1ESZA 2E89A 4HDKB 4L4RA 5K45A 4DCVA 4CYMA 1Y1TA 2FP4A 2LP4Y 5DVZA 2IZ5A 3BWMA 4XFDA 4AJLA 2XWSA 1FNBA 3JQBC 1FU7A 3EHDA 4I1UA 4CM4A 3JYLA 4I81A 2JIDA 1JEOA 2Z1MA 3FNGA 4P7JA 3CWQA 4WEQA 1XZGA 4KK4A 3ZWKA 1R4MB 3E3OA 3F78A 4XD7D 2JI8A 4YQFA 2O5RA 2H2FA 4TLCA 5EUMA 2GJKA 4US0R 2ROQA 4CVNA 4PY2A 3EDRA 1VKJA 4X66B 2CHEA 2GYWA 3VVLA 4QPZA 3DMYA 3NOXA 4L28A 4BFZA 3PTZA 3ZGXA 4RVOA 1PL0A 5K05A 3AG5A 4XSGA 1H0SA 3A2NA 3D0RA 2PPLA 4YDHB 4PZEA 5BWOA 2E37A 1T3ZA 4B83A 4CQLA 1SBHA 5DSZA 5B1YA 4NCHA 3QI2A 4M0KA 3KWLA 3ZIDA 3N05A 4XR4A 3ZHTA 3HDJA 2H0RA 2X22A 3STXA 3ZTYA 3LPCA 2X5KO 2CMGA 3GEDA 1RPZA 1WV0A 1MG5A 2WFLA 3IIMA 1XRSB 4PBRA 3L05A 4CEHA 2ZAYA 4QT0A 1DKOA 4V38A 3G9QA 2Y2UA 2IZ1A 4ZVLA 2R4QA 1YZ3A 1SUSA 2OBMA 2OORA 2A4MA 3E7WA 5KNCD 2HW8A 5JVDA 1G3MA 1HE3A 2RGEA 1YRHA 1Z5PA 3EY9A 3U3DA 2R7LA 3ZIAA 1E9CA 1Z0SA 3WAKA 4IVQA 1FTNA 3K2BA 5JIBA 2YIMA 3MIIA 1EP3B 4LX0A 6REQA 2BFMA 1PTJA 3UENA 3N2KB 2R47A 1I1QB 3H83A 3NWOA 2PQ0A 4MW0A 1KZ7B 1EHYA 1HV8A 4C0HA 3GCDA 2AW5A 1USVA 2FLWA 2QN9A 1JR3E 3MWGA 4IQ0A 5KDDA 4JQOA 2VBCA 1FK8A 1LPBB 2O1SA 2ONKA 2VSXA 4LV6A 3SLKA 2HU8A 3B9RA 1N2OA 2B98A 4ZYLA 2BJWA 1BTOA 3DBVO 1QIIA 2H5LA 1FVFA 5L4LA 4WECA 1YQXA 4GSYA 5CNMA 1EJ6A 3KEFA 3QVXA 1L4HA 3P9SA 1X77A 1V6SA 2XLCA 1XJ5A 5B2FA 4XGIA 1D2CA 3V1TC 1KEVA 4LHZA 1YSCA 2OFFA 3T3NA 1D8AA 2N9UA 4EHDA 1EWVA 1A9XB 4MS4B 2WU1A 4O63O 4MQEB 4C03A 3WLPA 2JFFA 3DXFA 3RIGA 4JDUA 4C6TB 5F98A 1ZD2P 3DBRA 3NBQA 1UWVA 2A5YB 1JQAA 2NO5A 3TSCA 2Z2ZA 3AZPA 4QLOA 3ZY6A 1WHSB 1B3BA 4EYKA 4NMWA 3CISA 4MROA 5IVHA 1SBTA 2H2GA 3DZIA 4FILA 1Z62A 2R6CA 4KYVA 5L3SA 2VTBA 1W35A 1XAGA 1P9NA 1R66A 3E1SA 4FC6A 4MWOA 5FWXA 3CUYA 5HE8A 1JTFA 1DARA 1K6MA 5CK4A 5IVPA 5KQLA 3K72B 5IC4A 1CUYA 5TEWA 4F4JA 3MTJA 2PBZA 4PGMA 1SZPA 1TVCA 1SMKA 2YVAA 4OOFA 3D3WA 1NW3A 3HH8A 3F6YA 2J3DA 2O2XA 5JNTA 2CD9A 3FI0A 1EM8A 4H7IA 2XYRA 4G63A 4PXSA 4DJAA 5LDHA 4MB2A 5KUTA 2CJWB 1NUHA 4L8YA 1A95A 2XE4A 1Q0RA 1FVOA 3EXIA 4CCYB 1K5GA 3BGIA 4XX0A 4AECA 3H2KA 4MRRA 1L1QA 3Q7PA 1G21E 4TV8A 2R6R1 3HP1A 1MABB 2FPLA 3NHMA 4RQTA 1HMYA 5IN4A 4JYCA 1YASA 1HDYA 3GCGA 1SC1A 2B82A 2I7TA 1Q95A 1YR7A 4OBXA 2CGEA 4LBYA 4HDQB 3SZLA 3DO8A 2X76A 3H5WA 2JATA 3GFVA 3S2FA 4TTAA 3S8MA 4DJ5X 2I1VB 3ANSA 4CGYA 2QAGB 1NASA 1QH1A 1COWA 1Y80A 1E58A 2HLNA 1YZVA 2RGXA 3T35A 2FE1A 5IVDA 1XEWY 4UOZA 2DUWA 2X8BA 2HNBA 4OQFA 2BIFA 1O89A 1IDOA 3T7RA 3DDUA 4AJNA 4GZMA 4E7PA 1JAHA 1EWRA 4KOAA 2OCPA 1P7ZA 5IT9A 5F1YA 3RUEA 3DHYA 2G83A 2Z3VA 1OROA 2EBUA 4HX5A 4UM7A 4WX2B 4YDRA 3P9NA 2JCYA 1P1HA 1ZVKA 3HYNA 3K9CA 4OBWA 4WDRA 3ABRB 3SVZA 1QRRA 3CUWA 4MJ7A 1RYFA 3MYRA 4J0FA 3JWGA 5HRCA 1CQXA 3EWIA 4IJWA 3C8ZA 3PF9A 1M2FA 4IHJA 4Q0MA 4COKA 1PVVA 1Z7YA 2XRMA 3HFGA 3EIEA 4BLUA 2XCSB 1LRLA 2AHOA 2G07A 5JS6A 3PXEA 4FE4A 1SKAA 4KPUB 1HQYE 4X54A 3JQ8B 2A9OA 5M34A 1C1YA 3BFKA 1FSFA 2WU4A 3PGJA 1I7SB 2DYKA 2V6MA 3KHTA 3TLCA 3QKRA 1IG3A 2BHTA 2XCQA 1G5RA 4Q3DA 2I34A 3O4RA 4G5OA 1RFGE 4UZFA 1WWKA 2JBHA 5JSUA 3HDTA 2KBFA 3LCVB 4LMAA 2OGUA 1M9NA 1J8VA 2H8GA 4EFLA 2HDHA 2ZJBA 3N2YA 3O9MA 4B76A 1PUJA 2XT6A 3OX2A 2JFHA 1HE2A 2PXHA 2QZPA 2HSEA 3DLCA 3LUKA 4RJJA 1SXQA 1CJVC 3ZVLA 3ENNA 1LK7A 4ZAWA 5KX5B 4MVXA 4LPSA 4UHCA 5DM60 3UEOA 4D6XA 1FLDA 1CQIA 3U4MA 1OFUA 3F49S 3LQQA 4OLHA 2RHDA 3N2LA 1X2BA 4PYJA 3TLGB 1OBCA 1T5LA 5CPFA 5DX0A 2PVCA 3FY4A 4E1AA 1CB0A 1KK3A 3HNOA 3I0MA 5K8LA 1H2EA 1CZHA 3DYIA 5FH9A 2O19A 4II2A 4H7DA 2I4OA 1L5KA 3QXHA 4ZVVA 1P31A 1YGYA 1YS4A 4DR5B 4HAYA 1UJMA 1N6HA 4UPEA 1Q20A 2F43A 1BHQ1 4I2VA 2HPHA 3DBLB 2ZRHA 4ZYXA 1E62A 4RTSA 3HQ4O 4WPGA 3J80A 1QJ4A 3OQ1A 1N2ZA 2BKVA 3FPGA 4WA8A 5I45A 1ZU4A 2AOUB 4JDPA 2GZHA 1XOIA 2ZUEA 3D8UA 3O75A 3RTGA 5KYWA 2GESA 1HQKA 3USZA 2YY6A 4ZZ2A 3FGNA 3ZCTA 3I32A 1U99A 2LPMA 2UVPB 3K9GA 4Z3OA 2B6HA 1LQUA 2CVPA 1WKVA 4Q4HA 5E95A 4QJ5A 3T6KA 1EBUA 2BC9A 1PW5A 4GKBA 4LTMA 5GY7A 3AF2A 3LUHA 4BVJA 1WMEA 1N3IA 3J7TA 2DBZA 3D7RA 4V0QA 5LBTA 3QLEA 4M0MA 4LQLA 3C7TA 3NEJA 4H18A 3P32A 3NTXA 5I9TA 1NXQA 4YQYA 2CUKA 3JYQA 1LPOA 1ZZEA 1NQTA 4ALLA 1USWA 1JR3A 4FFBB 1ETHA 1N6OA 2ZDGA 3MT7A 3H13A 1E63A 2OBLA 4X20A 4PX2A 2B6NA 5H81A 5LQCA 4Q3EA 2QLTA 3QMMA 5C4MA 3LBIA 2H29A 2OP1A 3EXEA 4MICA 2X0FA 4YT5A 4B5KA 4BFLA 1IL0A 3U7QB 4HUJA 4TYWA 5EP3A 5ERGB 3HDVA 1EVJA 5KYGA 1NPDA 4KVGA 4JC4A 4W1QA 5A05A 3TPZA 1S4QA 4RZQA 2QI9F 5KVQA 5AVXA 2QJWA 3UYLA 4IJQA 1LQ2A 4DLKA 4NBLA 4M22A 5EHXA 3IIJA 1D8TA 4NNJA 3RB8A 1Y5MA 1YR8A 4JCOA 3SR4A 4B6RA 4MQFA 3NDPA 4Q7EA 4PX3A 1WKBA 5EJGA 2V55B 3GLVA 2J5BA 3SNKA 3TZCA 1U5AA 2O2HA 5JFOA 3UMJA 3U4IA 3LGAA 4G1BA 2H2WA 4CXMA 5BNIA 3B36A 1Z2OX 5K0NA 4B85A 1KETA 1NSYA 2ZUUA 5FBHA 4Z3KA 4UTZA 2GCGA 2PMKA 1UR5A 1KEPA 2A78A 2BD0A 2XTNA 1R12A 1KVQA 3AEKB 3DKPA 3NTLA 1I32A 1ANKA 1ZN8A 4OGGA 4QREA 4PAOA 2AEJA 2GKGA 3ZEIA 3L8DA 4FW8A 1WDLA 1OXBB 2XYGA 4L6AA 4MPDA 3O92A 4KE8A 2HRCA 3B51X 4MRSA 3ZE6A 4EGFA 4RQBA 4R9UC 4S05A 3T1OA 1F7VA 1CEYA 2I4LA 3TCNA 1SQ6A 1YTUA 2WB2A 4ESHA 2JIZA 1M6YA 2LDXA 1EKXA 1J2TA 2G3YA 3QBTA 1YUNA 1AX9A 3BJZA 1MOQA 4E5DA 3IDOA 1GDHA 1V1JA 3RKSA 4EBFA 3KB1A 3L7JA 1G21A 2RSLA 1V7ZA 3AEQB 3DC2A 1M34E 3QU7A 4W1RA 5DU2A 5UKDA 4DF3A 1IHOA 4YRAA 4Z4FA 2H63A 2G88A 4WKPA 4OSOA 3CPJB 3Q6IA 1DS6A 2C04A 1Y89A 2HPVA 3GAMA 5JEEA 3QSGA 4JJFA 2WYIA 4ZEOA 1MGPA 1FJ2A 3I04M 4RFLA 3LPMA 5EKUA 3B89A 2Q2QA 5J5AA 3BBPA 3P0RA 3UV7A 4FYXA 4YGYA 4CKCA 4YRKA 3UTDA 3BKXA 5I9BA 2R6HA 3FTCA 2C59A 3JXEA 3KP1A 1JRLA 1TQDA 2RGYA 5SYNA 4W8GA 3SC6A 4JSTA 2GCIA 2KMLA 2Q27A 2X9LA 3CLUD 5FA5A 2WD8A 3B8HA 2QTWB 1WB6A 4ZZ1A 1RRVA 1UPXA 2YFHA 3O90A 3WGKA 4WSOA 1SA0A 4KRFA 1IH8A 3T7IA 5AJVB 3C7CB 1E3SA 3W8RA 1K3TA 2H9AA 4FFWA 4ZFNA 3RRZA 5BRJA 2RGBA 3NEPX 3TWOA 5B7PA 5AP9A 4ZJPA 4IIJA 4BE4A 3D6JA 4F5DA 1CS0B 1NBEA 4MINA 2XOXA 1LNSA 1HORA 2E4XA 4XOUA 5HQJA 4PINA 4A2PA 3ZQ6A 2YXEA 1QHYA 1R5NA 2G0AA 4P33A 2OXFA 4QG7A 4Q9IA 1IZ9A 1XMVA 2WZBA 3OY2A 1EUDB 3CMCO 3MB8A 3RR2A 3OECA 3EZ7A 2M98A 3LI2A 1UWKA 4OJKA 3SEAA 2OILA 4UQLA 4BMOB 7REQA 1W48A 1SCJA 3B9QA 2Y67A 4GX2A 4IUCS 2EQBA 2M6RA 5KVCA 2JGNA 4BB5A 2LKDA 3A10A 1YQEA 1SUDA 3PICA 2LR0A 4FB4A 1ULUA 1V5FA 2FPIB 2CVHA 4RHEA 3ZK8A 1XWWA 2CBGA 3BRCA 1AQIA 2ZLBA 4PFJA 4M9ZA 3RU9A 4UHFA 4N0EA 4REQA 1Y1PA 3L7NA 4YRZA 3DKIA 1VMKA 4N5NA 2W2KA 1EX9A 4ZHQA 4R1TA 3WL3A 1F2UB 3P9RA 5EJ4A 4I14A 2A3NA 3LUGA 2A1UB 3M49A 7AT1A 3RYCB 5DBFA 1AKNA