3AUJB

Structure of diol dehydratase complexed with glycerol
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
179
structure length
179
Chain Sequence
GFLTEVGEARQGTQQDEVIIAVGPAFGLAQTVNIVGIPHKSILREVIAGIEEEGIKARVIRCFKSSDVAFVAVEGNRLSGSGISIGIQSKGTTVIHQQGLPPLSNLELFPQAPLLTLETYRQIGKNAARYAKRESPQPVPTLNDQMARPKYQAKSAILHIKETKYVVTGKNPQELRVAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diol dehydrase alpha subunit
publication title Redesign of coenzyme B(12) dependent diol dehydratase to be resistant to the mechanism-based inactivation by glycerol and act on longer chain 1,2-diols
pubmed doi rcsb
source organism Klebsiella oxytoca
molecule tags Lyase
total genus 63
structure length 179
sequence length 179
chains with identical sequence E
ec nomenclature ec 4.2.1.28: Propanediol dehydratase.
pdb deposition date 2011-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02288 Dehydratase_MU Dehydratase medium subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 3aujB00
3WB1A 3AUJB 1DIOB 1IWPB 1IWBB 1MMFB 1EGMB 1UC4B 3WB0A 1UC5B 3BRCA 5D5QA 1EEXB 2D0OB 2D0PB 1EGVB 1NBWB 5D5PA 3WB2A
chains in the Genus database with same CATH superfamily
2M98A 3G1WA 5JZSA 3AI7A 4E6PA 3AUAA 1WZIA 3BE6A 2CV0A 1FL9A 1YXMA 4DUPA 4WFJA 1WSWA 1DSSG 4WXYB 3LYAA 3IAXA 4B35A 2RD2A 1L7VC 4RD4A 4JASB 4EG6A 1YS2X 3LBNA 1XA4A 3C7AA 5H5JA 1Z0KA 4DV3B 4BGIA 4L8LA 2JIPA 1BS9A 4L5AA 4O5AA 4Z54A 1D9XA 4ZFNA 4QG3A 1S3IA 4DY4A 3PFFA 1MO6A 1ZNYA 3ZQJA 4BNKA 3REQA 5B5SA 4OQQA 1S1CA 2VHEA 3WBJA 1ES9A 3HXQA 1US8B 3KL4A 1KEEB 4IIEA 3TUJC 4D5EA 4I1UA 1MAHA 3FHLA 1V8ZA 5EAIA 1AGPA 2NV0A 2YZNA 3AHEA 5DM0A 2ADOA 2Q45A 3D6UA 2R86A 4NCJA 2IHVA 1O08A 1VGVA 2DFTA 4B71A 1PR9A 4D9HA 3ERCA 2QL5A 2DPGA 5FBVB 3DBRB 1HDIA 2XUZA 3I2YX 1N5MA 2HNBA 3Q87B 4OSPA 4R2IA 3KDAA 3V9AA 1ZM2A 3CIFA 3ZHYA 1DT5A 1TM5E 3QLUA 4FHDA 2DXIA 4IQ0A 1LCIA 2QAJA 5J2TB 4ZK6A 2XQVA 2ERCA 1PR6A 2XEDA 2XRYA 3IQXA 1AQLA 3NHSA 1ZVQA 1WXFA 1GCAA 3C41J 4X97A 3C5CA 4BN4A 2UUAB 3I8XA 3KKNA 221PA 3N8GA 2VP0A 1YASA 1PG0A 1QYIA 1Z0ZA 3IT0A 2QY6A 1GFWA 5DWVA 2HHAA 1ZYUA 2NVUB 3GZ4A 3CVXA 4UHKA 3IPYA 1MB4A 5AK3A 4P82A 1F6WA 2ZBPA 4BMZA 3LYHA 4QA9A 5HQTA 1WPQA 1JHUA 3AEQB 4K1XA 4DHEA 2C99A 3TQTA 1UK8A 1M74A 2NQTA 4GI7A 4JEHA 2CLIB 3HB1A 1BMDA 2CL6X 1NQTA 1KI6B 2WWXA 3LQ4A 4WZBA 5DVZA 2ONKA 4MJLA 3OE1A 4U8HA 5BXYA 1EQUA 2WAYA 4LHWA 4MKFA 3W5JA 5BQ3A 3EWIA 5BR1A 5JQGA 1X7HA 1GUFA 2GBCA 4PSKA 1JSRA 1UXJA 1P7VA 2FFQA 2YHIA 1FQKA 4ZODA 2IXFA 2PG3A 2XT9A 2YV4A 3C74A 1WSBA 3V4OA 1YS7A 3AVWA 1KRWA 3OD5A 3CO0S 1WUYA 2UUPA 4Q3LA 3QEKA 3GLHA 2J5RA 4JQZA 4BCBA 3QEAZ 4HGYA 1ZVMA 2I55A 4KPEC 3QG5A 1P6XA 3FWPA 4I08A 2RHJA 2BGGA 2R5FA 3IAUA 2P0EA 5LSAA 2I71A 3HB5X 4ZHQF 4EJ2A 1H6DA 5A3SA 3UYKA 3L0CA 4DWOA 2LCFA 3ZJYA 1E6CA 1SUDA 2H8GA 2WVGA 4A73A 4AXBA 3BSSA 5DH9A 3TW4A 5JRJA 2WUDA 1MQSA 4QSMA 3DT6A 3FVWA 4MVJA 5KI6A 4QATA 4X8OA 1ZLYA 2PXHA 3EVFA 4N3GA 5DISB 1T6XA 3KFXA 5F77A 2WIJA 4HR7A 4DL9A 4B75A 1FS4A 2IXGA 3GN1A 2RAUA 4HRYA 4D9EA 5K3FB 2R6R1 1LA2A 3Q8MA 4NFHA 4EFMA 5AW0A 4BFSA 2PJRA 4M76B 2XPCA 1CS0B 1IY0A 3WJ7A 3EVNA 1SIUA 4ONEA 2QTHA 1KQ3A 5D6OA 3ZV5A 1QZ3A 1UC8A 3QVOA 3RTGA 2VT6A 2XYPA 1VE1A 4LPKA 1KDZA 4AJJA 1N2EA 1U94A 5BN4B 1Q0QA 2OKCA 4P4LA 2F9FA 3EEYA 4DCVA 5LD2B 3WRYA 1NVDA 4XVHA 1T4GA 3O8LA 4P4NA 4DGSA 4PTZA 2NU8B 5ADVA 4QT4A 4OQEA 4PR0A 4ZOLB 1U11A 1A9ZA 1PR5A 2EKBA 3D6AA 3DWEX 3LWNA 4Y9SA 1TF5A 2COEA 3RB8A 2XNCA 3BMOA 1QGYA 3VC2A 1GL3A 5A4JA 2C2KA 1Q0LA 2CZGA 4IJKA 4XWGA 1N4DA 2GD6A 1J2EA 5SYAA 4U7JA 2ZRLA 4HDAA 1X9IA 2IPAB 2G8LA 2O6LA 2H1IA 3OO0A 4TWJA 4EX6A 1GHTA 2W0MA 4H0CA 4R5MA 4PAWA 1E5DA 2I22A 4AJ1A 3IUNA 1LQ2A 3AEZA 4H35A 2Q07A 2R4UA 5ALWA 3VUFA 4CV2A 4HH4A 2JAPA 4YQYA 1NN1A 1ZOIA 1SQSA 3U1BA 4P53A 1GPNA 2QRMA 1WBJB 4LGMA 5CNKA 3OQMA 1DBVO 2C0PA 4NYIR 1Y48E 1G21E 1JEQB 2G4LA 2II6A 4MV6A 2P77A 3TLYA 2ENUA 3V4FA 1S2NA 4CQMB 2DFNA 4N65A 1JYFA 1SAYA 1KY4A 4TWRA 1A5AB 2ILVA 3P9SA 3HXPA 4TV8A 1E58A 3ZE1B 1P72A 4D6XA 2JLRA 4L4SA 4ZVTA 2O57A 3WLIA 4EMBA 1C8BA 2TSYB 4AY5A 4J75A 1LDBA 1L4LA 2HMVA 3B48A 5BVGA 3CLKA 1ZH0A 2X9VA 1KYIA 4U2BA 2JCVA 4EIWA 2MMCA 4J0QA 1XCGB 2J09A 3NNSA 1UM9B 2ZSFA 1NVAA 3JTEA 2CMGA 1Z17A 5CM9C 1QO9A 4YGXB 3RVOA 5EXTA 2AOTA 3RANA 1C3VA 3EH1A 3QLEA 4KQFA 3G0IA 2XH8A 4J4TA 3UGQA 4XX0B 3B9RA 4FOSA 4LFCB 5TPZD 2R25B 4A0QA 2PMDA 1Y1KE 4FU0A 5D1NA 3V4VB 4WLFA 5A6SB 2UXBB 1B6RA 2J08A 2DPLA 4ND2A 2ZSAA 4HDKB 1RMQA 1JEOA 3BFVA 3MXOA 2HJ9A 3GPDG 3RFCA 2YY7A 1VSBA 3FHJA 3IJPA 3SX4A 2H92A 1QORA 1Q2XA 5JJKA 3U62A 5EKXA 3EEBA 2J67A 1P4RA 3TGPA 1ZGZA 2RG7A 4KVFA 1XTZA 1MAUA 2OCKA 3IDZA 6YASA 2HJVA 1LBEA 2ZTUA 2GAOA 3HXLA 1GNLA 3AEUA 1SCJA 4ZANA 1M7GA 4FGLA 4GOOD 1HNXB 2O1EA 3ER9A 2YNMA 4AS3A 2CFIA 4XD7A 2XTZA 4U6NA 4URHA 2IGBA 1TGVA 1QKIA 1AT1A 1N2HA 1ZU5A 2OBBA 3V1NA 2QS9A 4Q18A 4V0QA 3UJ7A 1MPTA 2GB4A 1MENA 3BH7A 2RGCA 3S1AA 1AS2A 4KN5A 3L0SA 1KZ4A 4S1NA 1PQ4A 2Q4DA 5IAAA 1MNAA 3DDUA 3A3PA 4I5IA 3DMRA 4D0RA 2I8LA 4UOEA 1JEYB 3GRFA 3OWXA 3TTYA 4E1BA 3FSEA 5DNUA 1N9KA 5B7PA 4BIIA 4L4RA 3WHIA 3SYTA 2G1PA 3AVVA 3HB4X 1OIXA 1LW7A 1H5NA 1WZEA 2WZQA 4PM4A 3IDAA 2HZBA 3H1BA 4MQEA 3FNIA 5IJ9A 1EGAA 2AR9A 4NXMB 2F8SA 5THXA 2Q5LA 5LFAA 1D2RA 3U9SA 2C7GA 3FAZA 1QDEA 2RGGA 3LLSA 3UANA 4ZZ2A 1MRZA 4ILEA 2X0RA 1CDOA 5FBRB 1QYDA 2H29A 1GD1O 1ZLXA 4ADSG 2AG5A 1SC9A 3L1IA 4HN9A 1ZRMA 2ZIXA 1HDZA 4OX9B 1XQ1A 1I9CA 4MR8A 2VHCA 2OAGA 3V5NA 5FT9A 3KDSE 4BVGA 1ZL0A 2XW6A 2O20A 4AMVA 1V26A 2Z3VA 2PUCA 3HBNA 1SOAA 2Y3IA 3O9MA 3NV9A 3C5VA 2ZJ3A 1WMDA 2WF7A 4GP9A 2OXIA 1DGQA 3ANYB 2ZWMA 4RGYA 1XZHA 2AN3A 5LXTF 1E9BA 3DAYA 2EV9A 4YMSA 3SVZA 4UCXA 1MDBA 3I01A 4KWTA 5CD1A 1S7CA 4YJ3A 3RS2A 5IVHA 2NUPB 3GRAA 4MPPA 4L4ZA 4R2JA 4Y2YA 3M3HA 3BAZA 3A25A 2V96A 3DZ8A 3F98A 1LLDA 5D3MB 4EKYA 2DWPA 1V37A 1I7LA 1SVSA 2P6OA 2ZI9A 1UZLA 3DV0B 4YP5A 2C5SA 3CN9A 3P9NA 4M21A 1NLZA 5TQ0B 5EIWA 3KOWA 1VKOA 3KQUA 4YRTA 1H0RA 2NO7A 2ZVJA 3KE8A 3GLIE 1VLVA 2ZJ2A 4JOSA 3ZIAD 1OV4A 3FOBA 3ZWKA 2HRZA 5G41A 1F38A 2P90A 2W6ZA 3KT6A 4H7EA 4BVBA 4CBVA 4HVLA 1QRRA 1XVUA 3JWHA 2V7BA 1G1AA 2I29A 2YS6A 1FU8A 2FOLA 5K0NA 2D1YA 3BQNB 2Y9MB 1CQXA 3CH6A 4PYQA 1AMNA 2B98A 3LX6A 2C7QA 1W87A 1ODTC 5H81A 4KREA 4X24A 2BM9A 1Z5GA 1QG6A 4IGFA 3RF6A 4EG0A 2GX6A 1SUSA 1HO3A 2WWIA 1C5KA 3C7KA 2GBIA 3M6AA 1ZI6A 2BI7A 4R8RA 4M8KA 4Y1FA 3AC0A 2C96A 4IG4A 4LYHA 1DG9A 4R1OA 1F20A 1V8DA 3QXHA 4KJXA 4MW1A 1ISMA 4PGGA 3SXUA 2QVYX 2ODWA 3ZE9A 1AKUA 1UWVA 5LWHA 1QOQB 3KS9A 4UD6A 3PE6A 3LLVA 5KYYB 4AUNA 2NSLA 1ZNQO 4FXPA 2KQUA 1X7WA 2E9SA 3VBEA 1O0BA 2Q3JA 1TMOA 3G02A 4QUBA 3EN0A 2X6RA 4ZYLA 3N3BC 2IWRA 2OYRA 1WSDA 1FDRA 3KU4A 5AT1A 4JJZA 4KAAA 4KQCA 2VSQA 1XA0A 1UMBB 1E9VA 5HIMA 3RVDA 1D2MA 1CE8A 1J9ZA 1WHSA 3SBDA 4Q05A 3GP8A 4TSRA 1PFGA 4XWAA 5G1PA 2ZR9A 2ZUSA 3WADA 1R1DA 4GPD1 1G17A 5FCDA 4XOIA 1RTTA 3DL2A 3ZBPA 4BB0A 5JDCA 3ZQ4A 4N0DA 1ZUNA 3G68A 3RARA 1RJ9A 3NHKA 3MHTA 1NVVR 3DMPA 4CGYA 4NCBA 2PQMA 1HLFA 3NOVA 4QPNA 4EP1A 3VSBA 5FOQA 2PWZA 1NI3A 4S3MA 4CMHA 4YUZA 2C82A 1W96A 2HADA 2FWBA 2X40A 2Z8YA 2ZBFA 3CKKA 4GS5A 1H4VB 3ESQA 3VVBA 2IU6A 3G9QA 4B4UA 5FPPA 3IAEA 3M4XA 1KVTA 4JENA 4JROA 1MJHA 2X1LA 1K6IA 1SB9A 2XZTA 5FUXA 1XAGA 1CYEA 3D54D 4O63O 3NJ4A 4LF5B 4F6CA 1C2TA 1IN4A 5K05A 1XDWA 1VM6A 3R40A 4MKXA 1N1DA 5ARCA 3OE7A 4PYMA 4MEAA 3HRHA 4RSMA 5G1NA 2I6FA 3KQSA 1KK2A 1THMA 3SZUA 1EM8A 1EQ2A 1YR8A 1PNTA 3CSUA 4NYMR 2AEEA 1DKUA 2EJWA 3IBGA 4D26A 4AKGA 2PUHA 1CC1S 3R74A 3I2GA 1PBTA 3NASA 4CG0A 4CV1A 5U9CA 2FKAA 2IIBA 3NETA 3WOHA 5EMMA 2W8BA 1FRVA 8ADHA 4Y8VA 3CT6A 2Z2KA 3RW9A 2F6RA 1YQGA 3S99A 3SZLA 1Y98A 2G88A 4MHOA 5CCXA 1XRSB 3MUEA 4P5EA 4C6TA 5HJ2A 1YIAA 2YRXA 3UB4A 3IO5A 3D0RA 4J3FA 4PLFA 1DRVA 5EIAA 4LDAA 3DL0A 4AF7A 1QG0A 1XKXA 2WHEA 2CWWA 1UIRA 4XA8A 3S44A 3ZEIA 4KUHA 4OMDA 3BD9A 4WCFA 4DR6B 4FYKA 2I7XA 1M6WA 1WPXA 4G86A 5CD9A 2P4EA 3S8YA 1N75A 5A71A 4GW3A 4IDHA 3P0EA 4JX8A 4LTDA 1OJ7A 4BV9A 1Z29A 3N3AC 3B7WA 3D6TB 2C94A 2I66A 2O7VA 3R3JA 4MMXB 1DAPA 2WM3A 4S1OA 1M76A 3I8OA 1KYQA 3AVQA 1LBIA 5IDQA 4LE1A 4K6MA 4F3TA 3FPKA 3PYLA 3AY7A 2O8VA 3L5OA 2A7XA 3EGWA 3HB7A 5C8YF 4Y1RB 4DM4A 3PZRA 5C1OA 1H4TA 1TADA 3INGA 4BMXA 4UZSA 2ICAA 1V95A 4HLDA 5BR8B 2Q2OA 3ABIA 2OOKA 3ZHUA 3C2QA 5CFMA 1P3JA 3N39C 2ZJOA 3BD8A 4R1UA 1ZONA 2WU1A 3FIUA 2A1UA 4RV9A 5EWLA 5EXDA 2NO1A 1T5IA 4LX8A 3HSYA 1M5TA 1VJDA 2D1SA 2JEOA 5EG5A 1ICEA 5C5CA 2BZGA 3AR5A 2NU9B 2FMIA 1KP2A 3WDSA 4JQOA 2FE1A 5AVOA 2XT0A 1T0HB 1YCDA 1KO5A 1M2WA 4V0SA 1OI4A 3FRJA 4QDZA 3SYLA 1I13A 5FH9A 1H4QA 3PFCA 4NZNA 3ZHSA 1PFUA 1T5HX 3D3WB 3IQZA 2QRJA 4HMQA 2OT3B 2NO0A 2V98A 3H5OA 1TA4A 1B1AA 2XMZA 3FMVA 3L06A 4I8DA 3T5BA 3A6FA 2A57A 3PJEA 1KEWA 4D79A 5BOSA 1XMQB 4QHSA 1FY2A 2Z57A 3I64A 2PGLA 2WJAA 2Z0MA 3KWMA 4MI1A 4LZJA 1Q3HA 1JIXA 4C3VA 4PLTA 1HMYA 2WTBA 4BBZA 1W4CA 1E5VA 2O7QA 4EHDA 4WY8A 5DNYB 1G41A 2J4FA 2QP9X 5ALDA 4KG7A 4LF8B 4CEIA 2W8ZA 2GZ2A 3LCVB 4UTOA 5F23A 2BRUC 3K6SB 1ORDA 3NYWA 4Q1AA 3NONA 4RPHA 4ZMBA 4IZOA 1G5QA 3R5KA 1II8A 1K8QA 4M98A 5T3UA 3W8EA 2YX1A 1PUJA 4EB3A 1FA9A 3OOSA 1U8ZA 4P80A 1XVIA 1I51A 3EGEA 3A1FA 1Y9AA 2B30A 5EXXA 5AYVA 3NKFA 2QENA 4WBNA 3K32A 5G3YA 1J70A 1PJ2A 2FOXA 4OEHA 3BJRA 4NNJA 4XJXA 4P2GA 4MHSA 2RI1A 3USES 2O2EA 3RVSA 4IIHA 2QUIA 5JNSA 1R0YA 4PS0A 4XCVA 1DWPA 1KI8A 3C15C 3W3AD 3FD8A 1WTCA 1EB9A 1RWVA 1L5VA 1ATZA 1I9GA 1IEWA 3BH6A 4NBRA 4RZ3A 5E9WA 2Y1WA 4KXNA 3V2HA 1R8XA 2GXUA 3CH4B 4KSCA 2PGJA 3RS0A 4ZHQA 2FH5B 2VJDA 4PICA 2YFKA 4Z1OA 2OA0A 4YJFA 5BOVA 5THQA 1RQ2A 1OVGA 1LSOA 1Z75A 5JWRA 2FDRA 4OY3A 3TLAA 3AR9A 1I7DA 3W05A 5J63A 4K0KB 1U7XA 1AF7A 2B1JA 3AX6A 3C3MA 3KALA 4BQPA 3HXOA 3O4IA 1JFFA 2PO7A 2QD4A 3CU5A 2I7VA 4UU7A 5FOVA 5HCUA 3V4PB 3V8NA 5KTNA 1LLQA 4XX1A 2X4DA 4FE4A 1GG5A 3PHLA 4M9QA 1TC1A 4RNCA 5TPWB 4RKFA 3VR1A 2MSDB 3GCGA 3KOUA 3UJ9A 4BMCA 3GOQA 3HMKA 4RIHA 1NF2A 1NX9A 5I7AA 1SOVA 5K4AA 2OQIA 4D57A 3G17A 5EJAA 4MUHA 4UHCA 2IOFK 3ID6C 4NEGA 1I3CA 2AKYA 1MC1A 3W8RA 4MZXA 3H2ZA 3EX7C 1Z07A 1RAAA 2WI8A 3PP8A 1CNFA 1T1JA 4FZ3A 5D86A 5IYZB 4D99A 3HL4A 2HIMA 1HURA 3EXG1 1D6JA 4NCIA 1A8IA 4WVFA 4ND8A 3ZE6A 2UYQA 1PO7A 1ZU4A 4YT8A 1P45A 3KJIA 1COZA 1PZNA 2QSYA 4HADA 1AS3A 3WRXC 4QXAA 1EDBA 1OY1A 4W9MC 3L05A 1KMHB 2QM8A 4OQ4A 1IJFA 1Y1SA 2F48A 1IEVA 3AGPA 2BGRA 3RG2A 5JY1A 2XWPA 5FBHA 3PQCA 3V6MA 4QICA 4RADA 3OLZA 2P9HA 3PF9A 5TMDA 2ZIEA 4I55A 2OBMA 1V5WA 2EARA 3AEKA 4NS1A 4LQCA 3T9FA 5TPZA 4EX7A 1DQSA 5LKRA 2E18A 1WCV1 2R60A 3N2YA 1JU3A 4OHRA 2PWAA 1K5GA 2RGAA 3N0VA 2HHHB 1UL1X 1FVOA 4IKOA 2J0UB 2PMKA 2H1OA 3W7BA 1N6PA 1FPMA 1NSFA 3JD4A 4MVJG 4DIFA 3LF1A 4NJMA 4NRDA 3QV2A 2DLCX 2GNOA 2Q5CA 3W6UA 5K0FA 4Y2TA 4TVOA 3U3XA 2JK0A 2VUIB 2Q5EA 1OC2A 1W49A 1NUTA 4TLEA 4AWXA 3IGFA 2EIHA 1JHQA 2AX3A 1XHLA 3BL6A 3DZDA 2NAFA 2H4YA 4QJ3A 4ZD6A 3WX0A 1UPBA 5LZ5A 3R9IA 2D1FA 1ODJA 3A4VA 2JLWA 3EYWA 2VJCA 3QFRA 2X0FA 3EFOA 4I9HA 3QFSA 1Z39A 4FR5A 4Q82A 1KDYA 4DT1A 5AW7A 2I9KA 5E7QA 5BW8A 3ZZUA 3PFNA 5GADl 1N6NA 1RJEA 2YMMA 3BJZA 3LNCA 4J1SA 3A9SA 4PPQA 1U8TA 4J16C 5CT8A 1RYBA 4GE0A 4CF7A 2WILA 4FYYA 4Q48A 2CKMA 2B1GA 2O0KA 4H15A 4G0ZA 3TGWA 4CKWA 2HJSA 2OGTA 4PAGA 4BO1A 1B41A 3HPRA 3GEIA 4JIMA 3PU6A 4W1SA 4BATA 5AJXA 5EHIA 1A0OA 4TMXA 4ARVA 2G0NA 5B30A 1QCDA 3SHOA 4Q12A 4ZEOA 5CG2A 2JJQA 3PX2A 4OXYA 1NW9B 3IDSA 3OP1A 5FOTA 4TT8A 4EW1A 1F2TA 2ONYA 4IEIA 3G8AA 2ZS7A 1T0JB 1NXOA 4LK2A 4ZEWA 2V8BA 2ZUWA 2R1VA 2QZSA 1QR6A 3R7AA 1VI2A 4LXGA 2YVAA 4CEJB 4C2BA 1EU1A 1PT8A 2EQBA 4WHMA 3IELA 5H68A 4RFSB 2D1QA 3A70A 3VHLB 2BH2A 3WZMA 1XCOA 1XZBA 1DTEA 2O3JA 1S4QA 3FPBA 2WKPA 3IQDB 3UM9A 2P9JA 3H9EO 1JWLA 3E2IA 3QYPA 4K6FA 1NBHA 1KEPA 3MUOA 3PFKA 1PS0A 2CNBA 1W4BA 1S02A 1IG3A 2GASA 2W6PA 4ZVKA 4MO2A 5FBKA 4PNEA 1SOWA 3I6BA 3VJMA 3PKZA 5DM60 1KWGA 1EM6A 3LPMA 1QBGA 2W2MA 1BRTA 3O84A 3C6ZA 1C41A 4XFKA 4ZU3A 5K8LA 2X0DA 3H99A 3UWSA 1R8YA 3HA7A 2WZBA 3WHKA 2F1RA 4MGIR 3VTKA 1F8YA 5AKEA 5TJ9A 4B83A 1LUAA 2O2DA 4XR9A 3ZIAA 2Q1SA 3JX9A 2P4UA 1YRLA 4NS4A 1HT1E 5FWYB 1YQQA 2NAPA 5D5HA 2AF3C 3F90A 2D2XA 3RAJA 1ADCA 1Y37A 3AW8A 2FLKA 2MSEB 3LPLA 2IS4A 1IN8A 2DJIA 5B53A 4Q24A 3ED5A 4D8UA 3P71T 3WYGA 4JLMA 5DX0A 1BRMA 1ZXLA 3C3CA 4NX2A 1AK9A 4XVCA 5LXTA 3LZ6A 4A0HA 1I1HA 4XGRA 4LA4A 3HB9A 3A6PC 2L42A 2B78A 4M0KA 1E64A 4RVFA 2OHIA 3O0TA 2BGMA 4L78A 1K1EA 1Z6GA 3QWFA 5CX1B 4AJHA 5JNTA 2WB2A 1DC4A 2WWFA 2O8CA 4YRQA 3TW8B 6Q21A 4NOJA 3CTMA 4C22A 3VV2A 1GSAA 4HQKA 4K1LA 5I01A 1B23P 4QUGA 3WLEA 1LRLA 5IEBA 2PUTA 3H6KA 1L5HA 2HB6A 4PANA 5L8VA 5AKLA 4OFWA 2QL7A 1OASA 1EVLA 1UFKA 3FVTA 4II7A 1ZPDA 4FBLA 4L2IA 3EDCA 3O31A 4O2AB 3RIXA 3HCNA 3L1KA 4FQ8A 3O8BA 3TMKA 3TTVA 2QMQA 2YMLA 3U44A 1OTYA 2OESA 5BPHA 2P4QA 2QGNA 4DLWA 3HVHA 4MKZA 2PSFA 3P9KA 4MV1A 3VAAA 1SQGA 4XB2A 3TL2A 4N5LA 1H66A 2FWAA 4BY9E 2IS6A 2VT3A 4DZTA 1E96A 3GLFE 4CM6A 4X93A 3SSAA 3D02A 5IMBA 3ANLA 1PDOA 4ZYVA 1STOA 3OHSX 3P7MA 4K6KA 2R6CA 1GPDG 4BLPA 2XJ4A 2WJVA 2XB4A 3KSRA 4S1VA 4XH9B 4Q0MA 3T9DA 2UYOA 1Z8FA 1UDXA 4HNRA 3VNRA 4MVXA 4F84A 4V1CB 4B82A 5JS7A 3GIDA 4UAGA 3H5IA 4O29A 2HSJA 4RDCA 2CMDA 2G06A 2PBZA 2JG3A 1NW6A 2P7IA 3G79A 1RZ3A 3WLQA 1QK3A 2HBZA 2QSUA 1GTJ1 1XPJA 3MM4A 3LW8A 1H8HD 3ITDA 4FI3C 1I3KA 4J9VA 5CVCA 1SIBE 5DMHA 4EPTA 1R9GA 1Z4KA 3FMPB 4YLEA 3WFZA 2D6FA 3HJGA 3UENA 3R3XA 1LF5A 1QE0A 3KXLA 3QMMA 1UC9A 4JBXA 5JXWA 3R5TA 4BASA 1SCDA 1ECFA 3O47A 1XHFA 4F7DA 3AJAA 1IBSA 1MXFA 4HHEA 2IYNA 2F43A 3AB8A 3IAS6 3CR7A 4XJTA 5CMLA 4N0PA 4D4LA 1YFJA 4UCFA 5AM4A 3WGQA 4ZZIA 2IELA 3LPNA 4C4OA 4DNQA 1NVTA 3GW8A 2JJYA 4XDGA 5I9IA 4XYLA 2K87A 3NPMA 4BO6A 2H1WA 4MR9A 1Z7GA 3BRWA 1USGA 2G9NA 1BG6A 4OYLA 2XMBA 3WIUA 3WLMA 1J8DA 2RHMA 4M37A 3VR6H 1V4NA 1LEHA 4PLVA 4C4TA 3OUTA 1E3WA 4RENA 4H3HB 4N3AA 1BKYA 5B55A 5C46F 2VZ8A 3RK0A 4S04A 1JSXA 1RYZA 3CZCA 3M5PA 3MMPA 2NYUA 4E2FA 1IUNA 2QTMA 2QUZA 2WF9A 4OUDB 1X1AA 3C6XA 4YCBA 1SXPA 3I0MA 2XMPA 4EI7A 1N2IA 2ZIVB 4GICA 5AKJA 3O38A 4DJ5X 2HF9A 3TNFA 4FFMA 5BSWA 3OPVA 2P68A 3FA2A 1FMLA 2Q6LA 2QQFA 1PX2A 4QO8A 2CXNA 4R9SA 5KVQA 1GZ4A 5REQB 1K7EB 1DLIA 2CLEB 2Q3EA 5HS6A 1F5NA 4QVGA 5LJIA 5IT9A 4MS1B 1Y4UA 5SY4A 4OREX 3SKYA 3GRUA 3W7VA 1RYDA 1M1YB 2G04A 2Q8NA 1X9HA 4YECA 1CF4A 4HWPA 2YVKA 4P5DA 2B7LA 2H51A 2KB0A 4BUCA 1JBQA 1XFAA 1ECPA 3M5DA 2HNAA 4PZYA 2A3RA 1U80A 2PKWA 2RSLA 3FSGD 2H2FA 1TYDE 4PG5A 4IF6A 1ID8A 4B80A 2D13A 3RRFA 4J4BA 3P32A 4TMWA 3WL7A 1XNHA 1RZVA 3ZD8A 1POXA 3A26A 2XQFA 3CR8A 4UBMA 1OA1A 1DTSA 2OVBA 3DMHA 4QYIB 1FJ2A 4UFPA 3FJ1A 5DLPA 4N7JA 4DLAA 1G7RA 5AKXA 1YB6A 3CEMA 2RGNA 3PGA1 2H2IA 3JATB 3RBXA 1ISGA 3THSA 2ZREA 4YUYA 1XZKA 4CMKA 2EJBA 3K16A 3GT7A 2G6TA 4KLAA 3OF3A 3ADBA 4RGVA 2XUKA 1E5XA 2DG2A 1XX6A 3NGMA 4RZQA 5DFAA 2OD2A 4UE2A 3UMCA 2P3LA 2Q3LA 3OZDA 1EXNA 2BBTA 1Q16A 1QU3A 1U81A 4GOLD 2ECOA 1OPRA 1J24A 3KL2A 1LK0A 2OBYA 4P86A 1Z34A 3CXUA 3MCAA 1D1TA 4JT4A 3GRRA 4LYYA 2C83A 1J5XA 1Q91A 1V1MA 5C8YA 3RBAA 4EARA 4AMUA 5JSQA 4DR1B 2Y66A 4UASA 5FYQA 3IE1A 4IDCA 1P75A 1E9SA 3JVUA 1T36B 2PE5A 4FC7A 2GD1O 3TSYA 3UC9A 3NVKI 4IFTA 3QI2A 4JI1B 1Z9BA 2Q9BA 2WF8A 3T4UA 2XLCA 4HWOA 2BBSA 1AO0A 1SVWA 2E4VA 4RLQA 5AI0A 2XCRB 4QXOA 2YOFA 1JTVA 2HA3A 4WXPA 3IFSA 4UM7A 3ZS8A 1VB3A 2C9YA 2EFCB 5ERXA 1GKKA 4JUAA 1H2BA 4JP1A 3D59A 4MW6A 3WQHA 1DJMA 1AE1A 4RORA 5DGXA 3ZKWA 4E1VA 5A4KA 3D8BA 1EP9A 1T8RA 4FYIA 4II3A 1DG1G 3DFZA 1TJ4A 1NM5A 3MTGA 1BFUA 2FP4A 1MO3A 5A9TA 2V55B 3S55A 3ZWMA 1Y7PA 3FF1A 3BD7A 3IERA 4YUXA 1BD3A 5JT1A 1ISHA 2IK8A 4B6EA 4EW3A 3RJMA 3OUZA 1TOAA 1RPTA 4BZQA 5KDDA 2VHXA 4DV2B 3FCUB 2BKUA 5E6UA 5LDGA 1E2LA 4KRYA 2PBFA 3T3EA 4E5NA 5E4YA 4UHBA 1AC5A 3W3AA 1ULUA 1YO6A 2JGIA 4GXTA 4EJSB 1B8UA 1CUDA 1G20E 1WUTA 1JJIA 2G7MC 1GUAA 3QTBA 4JN6B 5HX7A 4EVSA 1KC1A 2GCNA 2Z9CA 2A0XA 4AJIA 4FQ7A 2D5IA 2ZKLA 4JA0A 3TW0A 1XK6A 1M6VB 1AX9A 2D0IA 2QTGA 3HNOA 4Q4HB 2I3GA 2CHQA 3OX1A 4AWAA 2WP0A 4LC9A 2O2XA 2EP5A 5C2JB 4IEEA 5CURA 5BW5A 1DO2A 1RKXA 5ESXA 3ZWAA 1K06A 1C8VB 2PZJA 2WJGA 2ZTVA 4RVOA 3TDNA 4ESVA 1SQ5A 3T7KA 3STYA 1Q1AA 1KKMA 1N0WA 2BD0A 3EXEB 4E03A 3DTNA 1UMCB 1JRLA 3ZHRA 1T2UA 3RS4A 4BNNA 4V3CA 4NTZA 3GJQA 3VGJA 2P9ZA 2J3IA 3KKMA 2A9QA 3LE8A 3QKIA 4R8SA 5TT1A 3H7IA 3H5VA 3I6QA 1A9XB 1YR9A 1WDWB 2YJNA 3FKSD 3KOYA 4XCQA 3T0GA 2FXVA 2VQ3A 4RPGA 1JA0A 1QAMA 1WNTA 3IO3A 2NT3A 3H86A 3RC3A 4EJ6A 1O96A 5FBQB 4EZEA 2C77A 3NBMA 2OGWA 4MV9A 3IRVA 3DYBA 3G5UA 4MW4A 3VOTA 1U8FO 4F71A 1SPBS 1XEAA 5FFFA 4ENPA 4BN5A 1QE5A 2JEYA 5LC1A 5DLDA 5CB4A 5FQOA 1O54A 5H3HA 3NATA 1XAIA 3JVEA 3DTYA 4GOKA 5EMNA 2Q8PA 4ZKDA 5DF1A 3P2YA 4YA6A 5HIIA 5GY7A 4UAUA 4BLOA 2A0WA 1UJ5A 1WULS 1CNMA 1ENOA 3VR4D 5EE0A 2YWCA 4BNFA 2COUA 2VZ9A 3KR0A 3TTTA 1P4AA 4LE2A 4LVOA 5CA1B 1FNDA 2W70A 5A4IS 2O8BA 2FTKE 2Z58A 2FZKA 3GZJA 1CBUA 3OPYA 4KZPA 1L6RA 1M2KA 3A6DA 3CUYA 5LQKA 5CVJA 4H1UA 3ZJ4A 2HCFA 3BCSA 4GWGA 3NT2A 1DIRA 4HEQA 1JHRA 3REFA 1ETUA 3EDQA 3LDUA 4CM9D 1QFSA 2V5VA 1N6KA 3UH0A 4DZRA 3DAGA 4DV1B 1OBOA 4OA8A 4GMKA 1YR7A 1LX7A 4B8YA 2IP1A 3MWYW 4E09A 5AESA 1OI7A 2E85A 3R6LA 3M1AA 4UNPA 3BMNA 1YJCA 2AVDA 1VJRA 3PR1A 3HWX1 4XVRA 2VDKB 4UTZA 3NTUA 2Q62A 3DXXA 2H0RA 1M83A 1FVFA 3AP1A 4C4YA 3NGXA 3QJ5A 2XOKD 3QXGA 5BN5A 4IUDS 1V96A 3H16A 3AF6A 1JDUA 5JS8A 3E5RA 3HFGA 4EJSC 1KHHA 5TSDA 4BCCA 4ABTA 2V7XA 4ZYXA 3ZN2A 3MINB 3O0DA 4G2TA 4BO9A 1X7XA 1AKRA 4ZZ3A 1TO6A 5E95A 4GP6A 3HUDA 4RHTA 3SG0A 1N2BA 3STUA 4JA2A 3LQKA 3M5WA 3N59A 1HE2A 3W77A 3ZBUA 3IMEA 3F9IA 3KZMA 4I1PA 1KU0A 4AXXA 4TLLB 2J41A 4YX9A 2HCJB 4MI9A 2WG2A 4NBWA 4PFQA 4LY9A 1T3TA 3LLUA 1J0CA 2JGKA 3ILSA 3VA7A 4AP5A 4HDOB 4NOLA 3IAFA 5AUOB 1G8KA 1T9DA 2Y1FA 4V02A 5BT8A 1KI9A 5CYPA 1M73E 2HLPA 4LEIA 2ZYHA 1MABA 2QMYA 1GDDA 1DS6A 4FHCA 3DE2X 3AERB 3E3AA 4KIFA 1KR5A 4HRVA 2QMEA 4LJ5A 3LFTA 4PQEA 3EY4A 3HWWA 1VCOA 2RHCA 1YMUA 4A26A 4QJIA 5EPEA 5LYJF 4C6HA 4IMIB 1SVIA 1KU6A 3GA7A 5DXAA 4B76A 5L3QB 3D3QA 5AVSA 2OSVA 3JQ8A 3H8JA 5CNMA 3H4TA 4RIFA 3IT1A 4M89A 4DR7B 4CRWB 1YB1A 4M0CA 4RUKA 2BW0A 4XLLA 4U6QA 5FOUA 1FYDA 1KA9H 2PGAA 1GNSA 2HIAA 2G25A 2R2AA 3HFJA 3UJCA 2P6RA 2RJ3A 2ZBQA 2OZLA 3EXAA 4G4JA 3F47A 1ZICA 4NMWA 3NJ8A 1I4EB 4HDNA 4WESB 2BZSA 5JNVA 5C52B 5DTMA 4ARZB 3ASUA 4F6LA 4L0MA 2B0CA 4CM8A 5F5XA 3MIIA 1OU0A 3Q3IA 4KW7A 2B4KA 4D6YA 3QK7A 4RC9A 4GKKB 1CDZA 1GPMA 4IF4A 1J97A 2A9FA 4O02B 5H3CA 1U7HA 1WZUA 4P4UA 5GONB 1DO0A 3U9LA 1YHNA 1JS1X 1V3VA 3OOJA 2GPAA 2X8AA 5L7WA 4FEGA 7ADHA 2O0HA 2O2ZA 1M2GA 1P8AA 3NDRA 4QU0A 4R01A 2HO4A 3LKDA 5IG2A 1P29A 1LY1A 1YA6A 1VP9A 3GGCA 3NALA 4IDAA 3WLLA 3ZHBA 1GGEA 3SZRA 4C7JA 1T8SA 2RKWA 1WP9A 3IVXA 1T0BA 3NPAA 1S8NA 4GBED 3AG5A 3QQPA 4HX9A 2QQ5A 4G3XA 4IO1A 4QDKA 4ZCSA 5K6TA 1KWKA 2ZI4A 3PR2B 3LO5A 5A04A 2YIMA 3HU1A 2JBAA 5B7GA 4E7PA 5E2AA 5AM3A 1YACA 3RHTA 3WMRA 3HA3A 4N8EA 4TM7A 1DI0A 3BCRA 4X64B 2DWUA 2XUJA 4EUSA 4R8VA 2ODEA 4LWOA 3AEYA 1GGJA 1U6IA 2ZWVA 3B3QA 3RUEA 3S1LA 1RT9A 3W79A 4FKZA 4M9UA 1V39A 4BPBA 2R62A 1YA8A 1ZOSA 4QFMA 4BMYA 3BL8A 2A6PA 4KV7A 1MH1A 3E03A 3R3HA 1HE5A 4KSBA 4PHFA 4NBVA 3GLVA 4RHFA 5DLQC 1F12A 5KC8A 1Z7EA 1CPYA 1P18A 4LC0A 4TTAA 4DSTA 4E3WA 5HSGA 5IEJA 2P2YA 4RMGA 1B0AA 3T5AA 4PGAA 2QU8A 5H02A 5K4HA 3R20A 3K2IA 2YWFA 4NYMQ 2C4WA 2PKYX 3TRHA 3AU9A 2QXTA 3QLUC 1A82A 5FPKA 5E7JA 5J9FA 1AK1A 2W2PA 4QM7A 1XN4A 1ZUWA 1ISFA 2HWXA 5DTIA 4IUBS 3U9TA 3QX9A 1FVXA 1V1RB 1MZVA 2H4HA 3K3PA 3U1VA 2AOVA 1GUBA 3I58A 1MGOA 4E21A 3SYNA 1H0SA 4MVYA 1VBMA 3C8HA 1UBRS 4AIRA 2HT6A 4YP0A 1IHDA 2EZUA 2VBIA 5CW2A 3RROA 3ZE0B 4BDSA 1MN6A 2BHSA 5BQ5A 5J1TB 1KO4A 2C9DA 5IKXA 1ISSA 1H8HA 2UZ3A 3W2IA 5ED4A 1NVMB 4Y6PA 4UUBA 5FR1A 3UAVA 1AHIA 5I3ZA 1IM8A 4OHXA 1JXMA 4OMCA 5K51A 3YASA 4TROA 1Q3TA 4LV5B 4NG4A 3RAPR 3VISA 3W6ZA 4TMYA 3VXKA 2NU6A 5BPFA 3F73A 3H0CA 4NE9A 2VDRB 5T4HA 1J7KA 1G8JA 5IZCA 1G8MA 1K7XB 1JH9A 1WNFA 3PWZA 1EIWA 2H7YA 4RH3A 1SM4A 4LYAA 3GLKA 1T0IA 1W93A 3C1OA 3HU3A 1GNRA 5FJJA 3TR5A 4CR6A 4UTNA 2RBKA 4PGMA 3FUUA 4IO0A 1LI7A 1PQUA 3EK2A 4ZALA 1M8PA 3ZK7A 1WKVA 4V2UA 2AOTB 2H7XA 3GJRA 5H7XA 1YVUA 3R0QA 4OJMX 4BFYA 2PLFA 1GZ7A 1NG1A 2YN2A 3HS3A 1HPLA 4KH0A 5L4LA 3FE2A 2EZ4A 4JLWA 4ZOEA 1Z12A 3JQ9A 4FR2A 4XE5A 1XYGA 3FBWA 3WKBA 4C6SA 4D7AA 2QORA 2B4RO 2E48A 1B6TA 4RU1A 2V7QD 4PCLA 3B9QA 3G0BA 4R68A 4LVNA 3WV5A 3AI2A 1U3FA 2QL6A 3C3DA 1RLOA 2QTVA 1PL7A 4MSUA 1YAHA 2AMJA 2BVNA 3EF0A 1AGYA 4HC4A 4J1QA 4Q21A 4UFOA 5B1SA 1F0YA 1HH4A 2BISA 1CETA 3QVGA 1TM7E 2WDZA 1J9EA 4BP8A 2QBYB 4KX3A 1WV0A 2W6ID 3NYRA 4NYJR 4R0NA 3TLEA 1XFDA 1OX4B 3CB2A 2J6IA 4TKUA 4E15A 2QQGA 2AWOA 5EWJA 1GEEA 1WU8A 2HSEA 2RHHA 3F6RA 4DTIA 2R87A 3PRHA 4MKGA 1XA3A 1W581 2V4UA 2HN9A 4MWGA 4X6XA 1VE9A 4AY3A 3PENA 1ULHA 3D4OA 5AXCA 1YSCA 3LCRA 1P2VA 4S0ZA 4R81A 4BLUA 1KTIA 5JPCA 4GR9A 4CM4B 2XZOA 4JELA 4YXWD 4N47A 2PCLA 1GGNA 1NXVA 2JJMA 2ZRHA 1NBWB 4IHJA 2R66A 5F1OA 3WRYC 3V3KA 5L40A 3CZQA 1QF7A 3CLTD 4MWZA 4QPCA 5KWVA 3UBTA 1TFUA 1UJCA 1V41E 1U1GA 3NUQA 5KWJA 3N8NA 4WZZA 5DGTA 4EQ6A 3C4JA 1NNSA 3C1UA 4QGGA 2PZBA 1KQFA 2PH7A 5EKTA 3AHGA 5LUAA 2Q46A 1TM1E 1YJ8A 5E8JA 4MGYR 1UJMA 2GPSA 4IX1A 3P26A 4DIBA 5FAKA 4GVXA 2JBHA 2IE8A 3Q0TA 4K26A 3UAYA 4D4GA 4CL8A 5JC1A 2R1TA 5DBIA 3ZY2A 4N82A 2H2WA 3OLXA 2PPLA 3ROFA 3X44A 1TM4E 3BGVA 3H8VA 1B2LA 4HEA6 4FFPA 2PKQP 2Z5FA 2ZU6A 1YVRA 3GQVA 1EA7A 3OZWA 4EKNB 1MZPA 3GQBB 1JPJA 3H9BA 1U5BA 1NJ6A 5EMHA 4YRSA 4Y2PA 1R00A 2WM8A 3JPWA 1XD2A 1H1DA 3WK6A 1YH3A 3MBOA 5ALZA 5CEJA 3A1CA 5IT0A 2B99A 2GK6A 1XRMA 4ZO4A 1JYSA 2R11A 3G6WA 4BJ1A 5IXYA 2WY2D 3IBCA 3GH3A 1W85B 2D5LA 4TL6A 4PC2A 5F1YA 3ZWCA 4GNKA 1UXKA 2C92A 1QPGA 3IPRA 4B3RB 1E7SA 4RA9A 3MQ2A 4B87A 4US0R 4L9AA 5HIJA 2N42A 3ASVA 4G1EB 5KNCD 1PJQA 3QUTA 4ZDJA 3TTUA 5A9RA 5KOJB 1NN5A 1YQUA 2XYRA 4U7WA 3V8RA 3PC3A 4HYTA 2QT1A 1RS0A 3M82A 4DRYA 3FBGA 4W8OA 1CNEA 5IAOA 3U16A 1UWCA 2V8OA 2WC1A 4IILA 3ZV4A 2L69A 4MX8A 3JPYA 1N7HA 2CLKB 4EW6A 4PR3A 2WKWA 4RIIA 2BHNA 1H8EA 4OHBA 4V0NA 4A0GA 1CU1A 5FFMA 3DW1X 3CVUA 5J4YA 1IVSA 3KOZA 4OQMA 1IQPA 4F4DA 3MBIA 5COAA 5IXSA 4LDZA 1YVPA 1R16A 4YRIA 1E18A 1Y7HA 2G0AA 4INZA 2GS9A 3TEMA 2CCKA 4IJUA 4TMTA 3ZVKA 2GFIA 1CZNA 4NCXA 3AH8A 5CH8A 4NDAA 1QYRA 2YCLA 3RGGA 3ZZ1A 4KODA 3O95A 3PJDA 5BMVB 1IK4A 4LJKA 1J2YA 2QR2A 4E31A 4MRRA 1SCBA 1Z28A 4KLNA 5AOAA 2YNMC 3ZE7A 2H6EA 4TZ6A 4BYGA 5AVXA 4JITA 1PQPA 5C1PA 2P1RA 4I4LA 3FYUB 1TUIA 3LKBA 1F8GA 4OJKA 3UHAA 3LQFA 2PX6A 2Q0QA 1FUEA 4LVUA 5TE9A 3IBYA 3F6CA 2IC5A 5IW8A 1V8FA 3ROXA 1UPCA 3GLIA 1LPNA 2EHJA 4RVDA 1RKVA 2V5AA 1U0TA 3QBJA 3ORFA 2IYVA 3I1FA 2WNSA 1OBVA 4GPTA 1L3CA 1Z3IX 4Z9XA 4B17A 2AFIB 2JFVA 3WS7A 1GR1A 1OXVA 5JH7B 3TSAA 4Q4LA 1G4UR 2N9UA 4RZUA 3FKSA 1YRAA 2X1VA 1X80B 4E4RA 4Q9NA 1T9GR 2CDRA 3QOFA 4FYPA 3BJMA 1WHTB 3TG2A 1P44A 1EXWA 1OPXA 4FK8A 5AM0A 3KLPX 1ZUNB 2XNJA 3O1LA 1RJ9B 1VIYA 1NJ1A 3FNGA 3EIEA 4JBIA 2FX3A 3BMCB 3QU2A 3INRA 4Y2HA 1IOVA 3EG5A 2JVKA 3GG9A 3L6DA 1WZNA 2FPRA 2NADA 2V6GA 1D0VA 3DE1X 3MUNA 2Q7XA 3ESAA 4BZPA 3QVWA 2P2LA 5KYTA 2XITA 2XUAA 4ZAXA 2HRRA 3QKSB 1SKQA 3K0EA 1ETHA 1ZMRA 3VR4A 1PJSA 1KFKB 3BWVA 3MWKA 3EBLA 4LJAA 2G28A 4CKYA 3NHYA 4JUFA 2YZ7A 3GA5A 1H3FA 3M4ZA 4TN5A 1ESEA 4M99A 3RFXA 3CV3A 3DAOA 4CR7A 4ALLA 4DV6B 5F3WB 2Y4OA 3U7QA 1U02A 2J1LA 3FZYA 4LI3X 2WV7A 4EI9A 3FOWA 1H22A 4RTQA 3OQBA 3A28A 4ZYUA 4CKEB 4CM9A 5HJ5A 3LFUA 3IURA 3FGZA 2ZIUB 3NXSA 3C3EA 4KO3S 2ATCA 3GZNA 3NIWA 1D2CA 1LLUA 3R7WA 4F2HA 3DAHA 4RW0A 1WCXA 2ZAGA 4PLYA 4ZI7F 5AIAA 5I7HA 1PT9A 1EJBA 4PFKA 4L07A 1ORTA 4ZGWA 3OTIA 2GARA 3D2BA 5TS3A 3IUQA 4L73A 2IVFA 3MELA 2QG6A 2FWPA 2ZVDA 3P4UA 2A59A 2ISCA 2XOKA 3PGMA 2H11A 5CIWA 3ESBA 3RSHA 5HOQA 2QYTA 1CUYA 3FZEA 1EX9A 3MIZA 3BWDD 2QIPA 2OG1A 3BBLA 4YYEA 2I91A 3G1TA 1XEXA 2CKDA 4NH4A 4Q9LA 2LVBA 4E5DA 2VTBA 2NXEA 3LX8A 2B83A 3K8OE 3O75A 4GSLA 4QECA 4RY2A 1RKUA 4QZVA 5DHRA 1BMFD 3DVQX 3GMIA 3T94A 2GBGA 1N8TA 5TS2A 1QVVA 2Q7DA 4DN6A 2B5OA 1X77A 4YDQA 4B81A 2XGOA 1JDVA 2GD2A 3JYOA 1XLTA 2CN1A 3M6IA 5IANA 4DIEA 1GCGA 5AKGA 1F17A 2FFHA 4MH0R 3HJFA 1R6VA 3SVTA 4UHDA 1KMIY 2TECE 2JC3A 5EL0A 5G2OA 4UCWA 1P8JA 3PTAA 5BUSA 2HBQA 1ZFNA 1V7ZA 1BQ3A 1YQEA 2GM4A 3CRW1 4XXHA 1GGVA 3FCYA 1I0LA 2F67A 2O52A 4ZMSA 5HQ3B 1GA4A 4B3MB 3A11A 3KWLA 5FJIA 5EWLB 2X0IA 1RHQA 2FJUA 5EVCA 1OFIA 4YREA 5B58C 5K20A 5AW5A 3RFTA 1URPA 4OHZA 5INTA 2X5OA 4HGOA 5F3DA 4QYXA 2F3RA 1RWMA 5JNLA 2HSGA 2VS1A 4BQQA 3BK1A 3BM5A 3ZXXA 3LHKA 5CYFA 3QRWA 1XVVA 3AMVA 5A4FS 3S68A 3EXIA 3KZ1E 4MIYA 4D8VA 1RYHA 3UH1A 1D4OA 4NBNA 2X3YA 4IPTA 4RA6A 3GWGA 4G5OA 4Y7DA 5KOHB 4V2IA 1Y8AA 5AI4A 1RXEA 3HVRA 1HV8A 4LRUA 3RHSA 3U39A 3ZWVA 3LY5A 1EHIA 2FPGB 1OXBB 1TCBA 1K98A 3LM8A 3K8QA 4IH9A 4LSGA 3K4PA 2ZQYA 3IP6A 1LPBB 1WW3A 3JQGB 4X7MA 3JWEA 2CT8A 4GT1A 4YT5A 3PT9A 3JCZA 3CNBA 3LUCA 2UAGA 3D9QX 4NEHB 2X2PA 1DARA 1UBUS 3NHMA 3QIAA 4A27A 1RQLA 2WFZA 5ES3A 3SLGA 1LQTA 1DBPA 4FIDA 4HZGA 4QQRA 3W0LB 3DUWA 3FPSA 4MAFA 1LU9A 4C0HA 4UUNA 4CCYA 2IOHA 1L5YA 3UMJA 4CLEA 3PS9A 4LMRA 3TJZA 1YJXA 5H80A 4E51A 4EUKA 4EUNA 2CJPA 5B1EA 2QN3A 3QU7A 3VSDA 5C4GB 2F2TA 1RZUA 5FWAA 2FPIA 2O7SA 1RKQA 3EPPA 2Q2NA 1ODKA 3X1MA 2AV6A 2PEYA 3VDQA 4GGPA 3K9BA 4CF5A 3DOHA 4C87A 2VHUA 4FONA 1V9CA 1YL5A 2E3JA 2XXJA 4QKQA 5I7UA 2W90A 2XCSB 3UUEA 1E2DA 4WCFC 2QI9F 4K9RA 2AEMA 4Q3KA 2YRWA 2ETVA 1QYXA 2FCAA 2KJQA 1TNDA 1XRNA 4I4TF 4KXFB 2X8WA 2ZB4A 3TW6A 4M55A 2PS9A 4US2R 3SX2A 3NAMA 1J8YF 1JSCA 5G0WA 5I8ZA 2Q49A 2ZYUX 4E5YA 3NC0C 2RGDA 4OLHA 3CKLA 3WAGA 1MG5A 5AXBA 5GWXA 4IJ6A 3BAFA 3DAPA 1QZUA 3FB4A 3NDJA 1UWLA 4F5ZA 2YHBA 4NDNE 1CZRA 3KYBA 3WLJA 5JLJA 6ADHA 4JUBA 2VBFA 1ODSA 3FF4A 1LS1A 1L7EA 3GCZA 1JFFB 1PYGA 2ECQA 3SNKA 5C7OO 1R18A 1OYWA 4KR7A 1NU6A 3DM9B 4LJ8A 4EL0A 1O77A 2DTDA 2FR8A 2P67A 2Y2UA 2YHSA 3GP5A 3NBAA 4PSAA 4WIAA 3CFYA 2H2AA 3H04A 5CDFA 1CVIA 1QQAA 4HNUA 4C03A 3LTNC 1RJWA 2GEVA 3MCTA 1ZN9A 1ZXBA 1U3GA 3HGTA 4JD5A 4CLRB 5B64A 1ATIA 1NMXA 3E8MA 2Q3BA 3M34A 5KTKA 4QEDA 4E6EA 3PNQA 1OR8A 2WD7A 2E1RA 3K8YA 5DHPA 5ESRA 4KHZA 4OI1A 5LQUA 4PX9A 1I3OA 4TWAA 1XWIA 2VF8A 1O5TA 3RDPA 3MTQA 3SAJA 3DE7X 5IH7A 1BH6A 5A0VA 3JQFC 2NUTB 5DGDA 4CUZA 1J1ZA 4D92A 4ZQIA 1BE6A 3DBHA 3FYSA 1O5IA 5TMBA 3RT9A 1TAUA 1GTG1 2ZEJA 5COBA 5HUQA 4Z53A 3PHBE 5DXJA 3IBFA 1GU0A 3PRJA 3FUVA 1UBFA 1YDWA 3SIPA 2ZI7A 3FFTA 1P1BA 1SMKA 4ZT7A 3TVDA 5L3VA 2CB9A 4AG6A 4TLBA 4OYRA 2IPNA 3MTEA 1Q50A 2I87A 3D43A 3EOZA 3CG4A 4G5FA 4GP7A 1MEEA 4LTNA 4OB7A 4R9UC 4X94A 4ZO9A 2JLVA 4KE9A 4YH1A 1NULA 4PX5A 3VO1A 1O94D 2WTAA 3WA6A 1J2TA 1BZYA 4EBBA 3ZU3A 3I32A 1K8RA 1SCUA 4QBGB 4ZVLA 1SULA 3LDGA 3UPDA 1DTWA 1PL0A 2QN1A 2XTJA 3I9V6 1RRPA 1OWOA 4NG5A 4DUGD 1FNMA 1XV5A 4QRIA 5FFNA 2FZGA 3S2ZA 2X6TA 1FXWA 4YFVA 3T7EA 2HDHA 4GMXA 4YQZA 3KTAA 3ZBTA 2W6IA 1Z6QA 2P6UA 3U6KA 2HQ1A 3Q7IA 4S05A 4Q3NA 1WAMA 4KDFA 3CX6A 4WXRA 1K8YB 5ADHA 1A5TA 1ZOOA 3SP1A 1QAQA 3TQQA 4DQUA 1JLKA 1NJFA 3EMKA 3V2GA 1UJ6A 2QAGA 2OAP1 5GVSA 2KBEA 5JEDA 3LXUX 5JRZA 5LZ4A 1UJ4A 3VUEA 2HK6A 2CDNA 1DJOA 3K9HA 3QIVA 2IYPA 2I2AA 4QHTA 5LB4A 4CM3A 4EG7A 1HETA 4Q1BA 1A9TA 1IIBA 2YW2A 4RF2A 4XWTA 5T64A 2I4OA 2YXBA 1DIGA 1P7PA 1YV9A 4OGFA 4E46A 4ENQA 1U0JA 3EPHA 1ISPA 2GM3A 4R3WA 3VU3A 4X5OA 3Q2OA 4OQFA 1WXGA 2A5JA 2EATA 2OKGA 4AECA 3B9BA 4LKOA 4F4CA 5DRTA 3HHEA 1L7RA 4LAFA 4HUQA 3KPYA 2SCUA 5WRFA 3ITEA 3C3BA 3R7BA 4AG5A 5LDHA 3TK1A 3VVLA 3ZD9A 5C7LO 4BL5A 4X62B 3F8WA 2BMAA 1FJHA 2I6SA 3GGSA 4HEHA 2HA0A 2PKCA 3QFFA 1WUKS 2IL1A 5ES4B 3FDFA 2HRDA 2HCBA 3ANMA 4OATA 2RBGA 1FRZA 1F5SA 3MMSA 3R8XA 3TAXA 3AIIA 4TXLA 4BVEA 2R7KA 3MJFA 1JVBA 1GG9A 2EWVA 1FCJA 3CGGA 5IVDA 2EAUA 3UEOA 2C5EA 4FCVA 1LJUA 4HFJA 4PAQA 2A0YA 2XKKA 5C32A 3IQHX 3E9QA 2ZUEA 1KOFA 2BMDA 1QRTA 4KR3A 1T2FA 2ANCA 1WU7A 3K15A 2V6IA 4Q03A 3FNQA 2J9RA 3L0BA 3AM4A 2ZK7A 1PGOA 3OWHA 3ZPXA 5KNCA 3GELA 3VO2A 2DR3A 4LXXA 1XTBA 3WLTA 1DIAA 4GMFA 3U19A 1FLDA 2VBGA 3EXHA 1ISJA 1QHXA 2QE7D 5IUJC 1KJ8A 1UMKA 1JJVA 3GVPA 2R4QA 3ABZA 3WYCA 2JFPA 4EB0A 2DHQA 3CF4G 2ZE7A 1MDFA 1C7ZA 2FEMA 3KO8A 4Z86A 1ZHOA 2A94A 5JIBA 3FUXA 5G02A 1SKYB 1C1XB 5DHSA 2ZYVX 4P08A 2WM9B 3UB3A 1O89A 4ZYTA 5L7TA 2X22A 1BDIA 4PZ0A 3S8MA 1MP0A 1IHXA 3A31A 1DAFA 3T4XA 1WMFA 2EQ5A 3I1JA 3JD0A 4B43A 1P2UA 4UOZA 5LXTB 1SRRA 2IJGX 5AICA 1Z4MA 3JARA 1IRIA 1DV1A 1H6BA 1A95A 1YHZA 5CGQB 2JD1A 4X65B 2Q4RA 1I2ZA 1P5JA 2Q99A 4AQYB 1DC7A 3MT0A 3V8PA 5MN4A 1HTBA 1XJCA 2DQSA 2J3DA 3M1YA 3QLJA 3TD9A 3KYCA 2O8CB 4Q1CA 5FI3A 2AH5A 1K6JA 4CIBA 1S0UA 4UDOA 2YDYA 1SVKA 3NC1C 1ZZEA 1ILEA 4ZAWA 3AV0B 4MKHA 1NFRA 2V7GA 2PX3A 1RPAA 1O6BA 1CR6A 2PMCA 3DVAA 1WA5A 2DQZA 5CHEA 3T0FA 4A2CA 3JAWA 4Q7MB 4E5SA 1U04A 2OUIA 2ZKIA 3CWQA 5AMXA 1TAGA 3W8NA 3AM3A 3X2EA 1JG4A 1ZH2A 1ZD5A 3LUHA 3TFQA 3OCCA 5LA6A 3AHFA 3N9IA 4Y2SA 3BQMB 2H3EA 1V16B 2VOJA 2IBTA 2AFHE 2JJ2D 4D9MA 5E1OA 4F7WA 1TI7A 2P2GA 4IMJB 3WYDA 2PUGA 5JAOA 4KPYA 5HG0A 1I6WA 5CT6A 4YAJA 1V2HE 1DB3A 1F3OA 1E8DA 2YJZA 5IM4F 3OQIB 3BTOA 4DLNA 1G5PA 4NU0A 4QEKA 5DOVA 4MQUA 1E77A 1H23A 1TO2E 1W0JD 2OE2A 3NRJA 4MLCA 4MZDA 3BFPA 4BB6A 7YASA 3IESA 4UTPA 2EQAA 3DNFA 3EQ9A 3NRBA 2IYTA 3CUVA 3WLKX 2QMUA 1TPYA 1U99A 1HEIA 2IEYA 3K9LA 3NXKA 2LCIA 1MQ9A 4IINA 4QAJA 3E3OA 3UCXA 2Q28A 2ZFUA 3V97A 4G0XA 2YWEA 5HZKA 3ZWBA 2I2WA 4EELA 1RPZA 3ONFA 4DLLA 2D1RA 4Q7KA 4IXTA 4KGZA 2VHYA 3MJSA 3BRQA 5HFJA 2GA9A 4TQUS 3ENWA 4MUAA 3W8FA 1GJRA 4DJTA 2AXPA 4WBXC 4IS3A 1C50A 2FEAA 1EWKA 1U1EA 3SS9X 1QGDA 2D4AA 3G8DA 5IHPA 2YV5A 4MUKA 5COQA 5E6RA 2BN4A 2ZJ8A 1UPXA 2FLWA 1PG5A 4G1CA 4LG1A 1BDHA 1O0SA 5CW1A 5FOXA 2PH1A 3OC6A 1A88A 2QLMA 2HJHA 4GI3A 5F35A 4DR5B 2V9CA 2IA5A 4XVQA 2R1ZA 1ORWA 1MHPA 5ECGC 2R6GA 4Q4DA 4R7ZA 2JIOA 5BQFA 4B4KA 2VQEB 1E3WB 3RWBA 3U0VA 3RRMA 1GILA 5HM6A 3SFTA 4BNVA 4CIAA 3ZDCA 3VBCA 1OLSA 1Z2NX 3IXQA 5BRNA 3DYVA 4YV1A 4LCJA 1EFVB 4ZU6X 3P45A 3LRTA 1TD1A 5MN6A 2VJMA 4GM1A 1N2SA 5TGZA 2IV3A 3ZH9B 4BNMA 1BMFA 2W7TA 4DWWA 1RAFA 4NZYA 4DY6A 5BQXA 3RS8A 4JVOA 3UXHA 2DHDA 2OCDA 4IGKA 4KB5A 4WKOA 2P9GA 5AWFC 1RC8A 5IAJA 2IYUA 1ZSVA 1P1JA 1U31A 1CUGA 5C5IA 1NDQA 2FN4A 4ERXA 1IN7A 4M49A 3BYZA 4F2GA 3LY9A 3IIMA 3RM3A 2GF0A 3DQQA 3SK0A 4ZI7A 4CIWA 2JAWA 1L3IA 1Z6YA 2JIRA 2PXXA 4KPGA 2CD7A 1EFPA 2QXYA 2YVLA 3MAJA 4YRJA 4DJFC 1YC5A 2FAXA 3OE4A 5C34B 3LUBA 4IJQA 3CX8A 4KQIA 5EZSA 1D1SA 1OXMA 4HZUB 3TCXB 1JG1A 3MWJA 4YCCA 5HS4A 4HB0A 1PWZA 1TW3A 4HTFB 5KNDH 4YY3B 4GOXA 4CEHA 2Z9DA 2PT6A 1P60A 3H2YA 1GEGA 3E1SA 2DWCA 2PSSA 3GRZA 4J0IA 1FYXA 1DDOA 1HYGA 1AUOA 2QNIA 3TL3A 4QM6A 2QN7A 4OLJA 4P0TA 5ALYA 4CMAA 5F98A 1P2GA 3OA2A 4BOYA 5B3LA 1USIA 1OX6A 1Z5VA 1HOXA 4DGQA 5J2TF 2QV7A 3OZCA 3ZHXA 2J32A 3H87A 4BNTA 1IQUA 1P0QA 4XEHA 5KEIA 3F0TA 1N7GA 2ETXA 4Q5IA 3LV8A 5BV0A 3COPA 2GXAA 3N8KA 4EAQA 1E6WA 2C3UA 4HAUA 5ALTA 5IFLA 5JBNA 3DXZA 3HXMA 1U28A 2HXGA 1X6VA 1Z2EA 4LBWA 3DMTA 3KR9A 4CQLA 4ZDKA 5DXFA 2PX2A 3D81A 1Z6PA 2I78A 4KWCA 1WMEA 3PIRA 2GHRA 2JLUA 1Z62A 3OZRA 4TPKA 3K70D 3Q2IA 4ZWNA 3FYCA 3KM0A 3OU2A 5GZ3A 1G8YA 3O3CA 1G3QA 4MEJA 4NMLA 1PKEA 2OXCA 4LJ9A 2WSLA 5B36A 1W46A 2GKGA 2DETA 1XNQB 4W8HA 4YMUA 4ZVRA 1UIMA 3HRIA 3WL6A 4G5RA 3PHHA 1L8OA 4IIBA 3NKLA 1IYZA 3P9ZA 4CMGA 3TI7A 1L8XA 1QMGA 3B36A 3CJRA 1UP4A 1GYQA 4E5PA 4KO4S 2OB1A 2JLXA 1LRJA 4L16A 1C1YA 1WRBA 1X1EA 1LPOA 4A2QA 3V55A 2XKAA 2IKQA 2WB4A 4IH4A 1WCIB 3MRVA 4O2RA 3KAKA 4WI1A 2JGDA 3OCYA 1T34A 4O3FA 2XHZA 4CMJA 3Q88A 1JMVA 5ANRB 2ZBVA 3AF4A 4AZ0B 2MYUA 1L5KA 3VRHA 3OIFA 1THGA 4HAYA 2PWYA 3Q8LA 1O7JA 2OLJA 1QKKA 2EZ9A 1T6NA 3CUTA 3MOIA 3RUAA 4YCLA 4TTIA 1DBRA 5EZYF 3T1HB 1JIKA 1C1HA 4QOFA 1Q0ZA 5FI1B 4M60A 1CY0A 5K3BA 4AW9A 3SHFA 3PFBA 4MUIA 1U7TA 1WV1A 4BNLA 4B40A 5JZOA 3I2IA 1OZAA 4JUIA 3P0IA 2J3HA 3EIQA 4C0XA 3QP9A 5DJ5A 2VPPA 1ZHFA 2DBZA 3RS7A 4W5RA 1MH9A 4OP1A 1JLLA 4WLEA 3HCAA 3TB4A 4DMHA 2PVCA 4IDOA 2FZEA 4RIEA 5IJWA 1P1FA 4OA5A 5BT9A 4ZOLF 4EEXA 1R4AA 5L9AA 1QO7A 1SFRA 2EXXA 2GSDA 3G2LA 4I4TA 1SN7A 1PT5A 5EJ5A 5F4BA 2BTEA 1J33A 4AO6A 1U8AA 4OD0A 2VI5A 5IBCA 1IL0A 2POQX 3VKGA 1SELA 1TVKA 3R0IA 4NYJQ 1FXUA 2J0QA 2C2OA 1N5RA 1UPUA 3A9RA 3GJZA 1OD6A 1OGIA 2NUAA 3ZNOA 5JMWA 1GPWB 4IJVA 2YYZA 3N5KA 3ZUGA 5CDUA 1F14A 3T7DA 4TWZA 5F64A 1O3YA 2P5UA 4M0DA 1GAWA 4QDOA 4OOEA 3ICEA 2NSJA 4MRMB 4XYBA 1OLXB 2IRWA 1S3GA 1BHJA 1MA3A 1W29A 3QOYA 2Q21A 3DUFA 2Q6VA 1IATA 1PEYA 3QKRA 1KAQA 4A1OA 3FPJA 3P9QA 3VDRA 1GLGA 3ZV3A 4KSYA 5FXMA 1O94A 2A67A 7MDHA 2BLLA 4L4YA 1N5JA 2ZETA 1X8KA 3C6BA 1JDJA 1NXPA 1XKTA 2CNKA 3QXJA 4JWTA 4UOQA 2O23A 2VQDA 2W5UA 2XAAA 3IKVA 4F60A 1D1PA 2CYBA 2YUIA 2DGDA 3NBQA 3NFYA 1DCMA 1SVOA 5K3SA 3RIEA 1QYVA 1XTVA 1PX0A 4DUGA 3C3AA 3A1DA 4NARA 5T5QA 1QMPA 2HSWA 3JZFA 1ZVKA 1SURA 1VHQA 3IV6A 2AYYA 2F62A 3CONA 3EODA 5DHAA 2I3BA 5IJAA 3H9GA 3TSZA 3IAM6 3GCDA 5FWXA 4MPRA 1CHDA 1A9YA 2JLAA 3K7EA 4PYLA 3O93A 4UM9B 1YUBA 4DLVA 2X3UA 1PGJA 3BWYA 3EYAA 2W98A 1GLVA 4KN8A 3T4PA 3GT4A 5EWMB 3KUDA 2QJOA 1X7XB 4P35A 5F4ZA 4CQMD 1KHTA 3O8RA 2DVMA 4AS1A 5AK6A 1KDTA 1PJ4A 2V65A 3RS5A 2XADA 3WZLA 5TJHA 1NQ5A 1DCFA 3ZY3A 1XAHA 3JQ7B 1V5EA 5M5BA 2NYAA 4F4FA 1XEWX 2NUBA 2VJYA 1EFTA 2ZE6A 5AUPB 1DU4A 2QA5A 3H1PA 3QEOA 2C31A 1A7KA 4X8MA 2OBLA 2PUWA 4DDWA 3TSWA 1KORA 3MC1A 1JP7A 3IUSA 5HW0A 5AFSA 2JD0A 4LHXA 4WXMA 2D59A 1IXSB 1LB1B 1SBCA 1Y5IA 2CGEA 1EUCA 1TIPA 3AEXA 2YFHA 1CZOA 1K6MA 3GX1A 4FCWA 4RXUA 2HPZA 2KM1A 2CUNA 2IYRA 4I1OA 2FEWB 3SYMA 2QUHA 4RDHA 3IHKA 1S3FA 4IIFA 5JCPA 2Q3FA 3E3LA 3NOXA 5EPOA 1KOLA 2XCLA 3WK9A 1XPRA 1S9HA 1YMQA 1EX6A 2R8YA 3TQSA 1FLVA 2ZJBA 4UUPA 1C7IA 4NPHA 3RYTC 1OF1A 4ZTUB 2BFFA 2BR5A 1V11B 4FYXA 4KH1A 4N8DA 3SU8A 4YCJA 3AI3A 2Q3HA 1HLGA 3EIXA 1Y1TA 1E92A 2LV8A 4FMBB 1FLNA 2ZI5A 3O4VA 3AILA 2GZHA 4O08A 5ECWA 1Z5PA 1OLUB 4K03A 4PBTA 3UJHA 4DXDA 3CUUA 4WSOA 2FEXA 5B4TA 1Z37A 3CN7A 1IPEA 1Y0BA 1WCYA 2WVHA 2QRGA 5A7HA 1DFIA 1DKRA 3H3FA 4LNAA 3GUZA 2J30A 1UZMA 1SK8A 3W2GA 1LFAA 5AI6A 1GPLA 4URFA 3G0CA 1XZQA 3VJLA 1A9QA 2ZXFA 3E7DA 4KAFA 4O4IB 4X7RA 3U4HA 3VPGA 4ENTA 2AOWA 2RC6A 3JTMA 4QOGA 4TXMA 4PSDA 2BEUA 3DOCA 3KHSA 1IBLB 1EUDB 4QSHA 1GCIA 1Y6FA 1XMOB 2FEPA 2ABWA 2AZMA 5K6RA 2NTVA 3COJA 3SS7X 5FI0B 5TEWA 1KAOA 3LBFA 1VQ1A 1I6KA 4ITRC 2YBEA 3HXTA 1SBNE 5HJEA 2V6BA 1Z4IA 3B78A 4G4SO 4LYJA 4Q6WA 4OSEA 3MILA 4BQNA 1KL7A 1ZEMA 4C4PA 1PQYA 2IHYA 2WMYA 1HFWA 3U37A 1T10A 2F4VB 4K2HA 2W2XA 5TGTA 2A35A 1NDHA 4BX0A 3AL0C 1D04A 4A8PA 1DWUA 1FMFA 1NUPA 2Q6IA 2VHJA 1R4NB 1E3DA 2O8FA 4RTNA 4KXUA 2EKLA 1QU2A 1TT7A 1XMVA 2W6NA 4QXRA 2G5CA 3ZQ6A 2G63A 4B34A 1K4YA 1C7EA 3T7CA 4M83A 5CLJA 3CX4A 4G41A 4G56A 1PTJA 1SHZA 2IUEA 4JOBA 4RM2A 5DI9A 3T4EA 3VU0A 4CM1A 2AS0A 5BSEA 3R77A 1W19A 1PZMA 4K9QA 3RREA 3WTCA 4F9FA 1YZ3A 3LIPA 2QW1A 3G2MA 1TUBA 5J4HA 3VZCA 1M0WA 1NAHA 4TOIA 1G8SA 2H7CA 1W88B 5JWHA 4J3JA 3GNSA 2ZZMA 2WK1A 3NBKA 1FJGB 2JH9A 3PL1A 2X0JA 4FLEA 3D8NA 3ZGYA 3ZS9A 5A6VA 4TL9A 1KGSA 1NKTA 3CBQA 5IDWA 5AKKA 3O5AA 1DL5A 1VSTA 3Q98A 1BX3A 1GGMA 1G2PA 4YK7A 3WWCA 3ZXUB 4WN9B 2JJ2A 1W5SA 5JEEA 1H69A 4JJ7A 4X6UA 2L82A 2YHAA 1GKUB 2F17A 5L3SB 3OTQA 1ESMA 1H2HA 2AEFA 3BSYA 3VU1A 4TVSA 2E4UA 3LKVA 3IKTA 5AW8A 1W4LA 1NN3A 1W0JA 1IWPB 1YS9A 3T1YB 3DCIA 3W2EA 2QV0A 4N48A 4IIDA 3F8SA 2Q29A 4Q3BA 4D9NA 3IV9A 2A9OA 1SBZA 2PRJA 2HDNB 3KB6A 3RHFA 1T1IA 4YDSA 3I09A 4DEYA 2GLXA 4PAMA 4X45A 4JGGA 4WMLA 4EGSA 1LF0A 2M6RA 4BVHA 2NIPA 5CB0A 3H5NA 3H5WA 2XGMA 1O03A 4CMIA 4WUTA 4KTVE 3I4FA 1QRSA 4ETWA 3ZIUA 4C29A 4M7RA 2HDWA 4QBKA 5EYPB 4MS3B 1KJIA 3OOYA 3VVCA 5L95A 1QE3A 4AZSA 1RZRD 1QH8A 3TRDA 1J0XO 2V0CA 1OGJA 3F7TA 3GLRA 3ITNA 1V3QE 5IJ0B 3BZWA 3AFIA 3CC8A 3DO5A 1NBMD 1YBHA 2WFAA 5HDQA 1E2BA 4P32A 3K94A 3Q9SA 3DDCA 3JWJA 4I14A 5IM4A 2YXPX 2X2FA 3IKMB 4MDEA 2ZYRA 2BHLA 2EFDB 3FNHA 2HK7A 3JQQA 1NMZA 5EUQB 2OB2A 2GBFA 3CMCO 5DBHX 5F7JA 3IUMA 2CHEA 2NP6A 1YFLA 3KTOA 3AUTA 2OLKA 3P9XA 4IFEA 2ZAYA 1YKGA 2GLUA 3B53X 2GPYA 2C4MA 3Q5GA 1YK0A 3HCEA 4E5MA 1VMDA 2QTVB 4RAOA 4Z6KA 1B6GA 3IVRA 4IHAA 1SHJA 1J39A 1KSJA 2VJAA 2XT6A 4ENRA 1VA4A 4X1YB 2CJWB 1KS9A 2GZRA 4PPYA 1CUCA 3O2JA 1YZKA 1RPJA 2OO5A 3FWZA 3NOQA 1P1KA 1QHFA 4MEBA 5EESA 3RQIA 4A6XA 2I7CA 3C24A 2FF5A 1F0PA 2FMXA 4AG3A 5K0EA 4B3GA 1P9WA 2GFHA 3OY2A 3HA2A 2B9EA 3LPAA 4B6OA 1T26A 2R96A 4RIGA 2AMFA 1YCFA 2DB3A 4XGKA 2AEJA 2QUKA 5IKPA 4IUCS 1WDMA 3OTWA 5YASA 4CKCA 2RHWA 3AQ4A 3D7NA 5EP1A 5DNDA 3T35A 4MI6A 4DRXA 3HLYA 2V3VA 2Y27A 5I5EA 2GN2A 5JHHB 4RULA 3RUIA 1OXSC 3KV3O 1OH8A 5D2CA 4ZOCA 1B42A 1QVZA 3V1MA 3RAFC 5ARBA 3D64A 4MW7A 4D46A 5ICGA 4TTPA 1HRKA 1XB2A 1I33A 4E3ZA 5CFZA 2KW5A 3O8CA 4HYQA 2Z2IA 2C1ZA 1OZGA 3A6ZA 3CZ9A 3L8FA 1CJMA 4RACA 4ZO8A 1BW9B 1DOHA 5K6AA 3SQMA 2Z6VA 4DV0B 3I9NA 1HZZC 3ZGLA 1C9NA 4AYTA 2QPTA 3KEQA 4P7JA 4YAGA 5CIYA 1ZS9A 5DYWA 1E1DA 1L7AA 4DNFA 3AI1A 3MXTA 4HVTA 3A3KA 4EGFA 1AQJA 3MD9A 3C70A 4M54A 5KWSA 5AXDA 4JVNA 4OQLA 3DEKA 4INAA 1US8A 3QXCA 4WN3A 4X20B 4UEKA 4BKPA 4DWVA 4YUWA 1KEEA 5EJMA 3V33A 5EE5B 3TQCA 2QTZA 2ZYSA 3EIUA 5EIOA 3FHCB 4YP1A 4DPKA 1IXZA 3D7MA 2GEDA 5HM8A 4NNPA 1PKXA 3DBRA 4QPJC 4NZOA 2BZ0A 1TMYA 5C9ZA 2PGIA 1GXSB 4JJ4A 4B79A 2QNRA 4U3JB 2OL4A 3ABRB 2GWHA 5FB3A 3H97A 1HL3A 4JC4A 3LCMA 3PCRB 2IYXA 4WH0A 4E2XA 3QUAA 4EGAA 5J2TA 8ATCA 4RHXA 3L6UA 3EPRA 5HYVA 1GZ5A 3ZE8A 1NBAA 1OIWA 2BDTA 2NXJA 3JQ9C 1U6JA 4IG9A 1JN0A 4FQ5A 1JJAA 5C8XA 4F3RA 2QTTA 2I7TA 1MT3A 4IFIA 4UNNA 2O5VA 2NVUA 2X5KO 1OU4A 4P33A 1M1NB 1N4AA 3I2HA 1JG7A 2WLSA 4EGCB 4LMAA 1GCOA 2VXYA 4RFVA 3AEQA 1M0SA 1QSGA 4P3KA 4QXPA 4ZDWA 4YASA 3U4AA 5L45A 2ZROA 3A6KA 5DLEA 1XYVA 4FB4A 1KI6A 1MC5A 3K92A 4Q00A 5JU6A 2GM9A 2A0UA 4HX5A 1Z33A 4OJNA 1UC5B 4EG5A 4ROSA 4PFSA 4LS3A 4ZZ0A 3R3YA 5JMTA 4L5IA 1QIMA 4OXQA 2QLJA 4BFWA 3UZUA 4XYGA 1FTYA 1O58A 1BROA 1HQKA 2FSHA 3IIJA 1K7CA 4HDRB 3L8CA 4XJSA 4F9GA 1E0AA 4LZLA 3CCCA 2QMHA 1L9XA 2RHLA 5FPYA 3WVNA 3KJHA 4II2A 1OBHA 1ABBA 1XZ8A 3TOVA 2JGJA 1USKA 2G77B 2QTFA 3OZFA 2OV3A 1U6KA 1QLJA 1AA6A 1JBEA 1VA5A 3FWYA 5T67A 4QUIA 1JG3A 1XZLA 2G4CA 3BE8A 3BRSA 4PQYA 4RGBA 4ZI3A 4YGYA 4J2HA 3EVAA 1ELOA 3F2VA 4BN0A 2PRYA 3WO1A 1HQYE 4NONA 4O33A 4AO7A 4KQ2A 2Q1UA 3S27A 3ZJUA 3E22B 2P65A 4OGKA 5DYTA 5J5CA 5C0OE 1SBHA 2H1RA 5EZYA 3PDIB 4CETA 2O0LA 3NWPA 3I05A 5EGSA 5FORA 2HMTA 3C7CB 5K3FA 2P2CA 2XVZA 1ADFA 1ZOLA 1TKAA 3PDHA 5E3HA 1GLNA 4MB0A 3HEBA 4MB2A 3L93A 3S8EA 3T3OA 4G23A 3WICA 3FUWA 1MEJA 4URXR 1CS0A 2VZLA 3UK2A 4JP8A 1L4YA 1NUQA 2JGNA 2PAAA 4BNZA 2GBPA 5JPDA 5JZVA 1QX4A 5HE9A 2OCPA 4DF3A 5EP4A 4EG3A 3MTAA 2Z56A 1N5KA 2BIFA 2PZMA 2J85A 3RTBA 5BN4A 3WLOA 5JDIC 2HW8A 3LUFA 2XIQA 4CMCA 4N4AA 2IBSA 2AIRA 4ISBA 2I1QA 4ESEA 4F1KA 3E1GA 5HGJA 4PV7A 2NU8A 2W6QA 3I2JA 4ZOLA 5BWLA 5CG1A 2NG1A 1M5UA 3NIDB 3OOHA 4P7KA 1BX0A 4AB1A 1U2GA 2XI4A 3QU9A 1M67A 5DT2A 1C3XA 1E2MA 1RXYA 3CEHA 4MWTA 3R7WB 4AC9A 3ND6A 4C43A 3AESB 1M8GA 3RRNA 3WQSB 4W5NA 1FNBA 4G4IA 4RETA 4B85A 4JKYA 4TSFD 1NKVA 1QKJA 4KU4A 1RCUA 4F11A 4UHFA 1Z0SA 3NGLA 4DJDC 2NW6A 5KKAA 5B3AA 3I72A 4BMPB 3Q12A 1AH2A 3W1VA 4TZ0A 3HO8A 1UPAA 3CWZA 3JQCA 3ND5A 3ORQA 1U0HC 1IY1A 4KYTA 5DIFA 5GGYA 3T41A 4L6AA 1DAGA 3N2KB 3O8NA 2VTBB 1JEQA 4IRXA 3TECE 3HU5A 4Y98A 4D5GA 1EWVA 3NP7A 4TKVB 5EXEA 1QOPB 4M88A 4OG2A 4Q9KA 2QVXX 5DW0A 4CQMA 5JANA 4HQLA 1EH5A 3KD3A 2TYSB 3PXGA 4JVMA 1UBKS 4HLNA 3SMQA 1WW8A 2OOSA 1FF9A 2GZ1A 2ASEA 2CVQA 1KIAA 3TIFA 4AIIA 4HPWA 4XSVA 4M1TA 4JMPA 2WRZA 1WM1A 4QRHA 3CNQS 4Y9DA 4EF6A 1DDGA 3M4YA 1YB7A 4G85A 2N75A 4R16A 4BKUA 1UM9A 4QJ4A 3MT8A 1XG5A 2E5WA 1U2TA 3MS7A 3OA0A 1ZM9A 3CPEA 3HEAA 3T34A 3SSMA 1XCJA 1KQOA 1MX3A 4BNDB 4EHFA 4I6GA 2MJLA 4XX0A 1ZCAA 2HCTA 3G5TA 3S2YA 1OUMA 3DGEC 4PC6A 2F3TA 1GT6A 4YQFA 2OBNA 4X6YA 3TE6A 1TCUA 2WD9A 3KCNA 1PWXA 3C0KA 4G8DA 2G07A 3G5AA 4NVRA 4QX6A 5CPFA 3V34A 4J2TA 5A6SA 2QN8A 4JLUA 1E9DA 3WHLA 4HDKA 2VRWA 3J80A 1K8ZB 3LHIA 1G7SA 1RIFA 3P94A 2AJLI 2GGSA 2R8ZA 4ZQEA 5SYMA 3WYNA 4JU9A 5ALOA 2OR3A 3NOOA 1UR5A 5DN6D 2O59A 1QCZA 1SD5A 1XNJA 3BE5A 4FOOA 2R44A 3DR5A 3TDMA 1O97C 2HTFA 2WDPA 3EVBA 4LOIA 4UBOA 5GAJA 5E2IA 5CK4A 1A9RA 2BJVA 3AF3A 3GD5A 3FZQA 4XYMA 4DYDA 1JQLB 2QTBA 3M6WA 1UBNA 4IRMA 1ZMTA 5F2OA 1X1TA 3E35A 1X7DA 1OAAA 5KWEA 3PEYA 5T41A 4GYYA 2JLZA 1LV7A 2IXAA 4PVCA 1FBNA 3B1YA 1GTSA 1B2RA 3H1FA 4JZKA 1JI0A 4KC0A 3A1UA 4YCDA 1RWBA 4OQPA 3MWGA 2XXBA 4LOKA 3B2NA 4C0WA 4CM7A 5AVJA 1VDZA 4G6ZA 4ON9A 2VNHA 1QF9A 5LIRA 1P2BA 1TRHA 3F5DA 2C84A 4L22A 2W6CX 4C04A 1JEYA 5LYJB 3GT0A 2H5EA 5FA5A 3T6KA 4D82A 3EFEA 2H1LA 2UZ1A 3ZDAA 1JQDA 2HMWA 4JB0A 3NDBB 4RS3A 1YONA 2HD4A 1XC7A 2OWEA 3OJXA 2P75A 5C53B 3HR8A 4HQ0A 5CJ2A 3HP7A 4C7OB 2ZJFA 2MCFA 1THTA 3AVUA 2EKQA 1SWWA 4KBFA 2DTXA 2HQOA 4KQKA 3OZ7A 4M7PA 3TLZA 5EFZA 1W7AA 2PH5A 2HQBA 4LWQA 3ZJ5A 4Y1EA 4P0PB 4GLLA 2HY7A 3AZQA 3FW1A 3AKYA 1P7WA 5GV7A 1BOFA 1ZCZA 1V6AA 3H4MA 4WV3A 1YVEI 3JYQA 3PGXA 1T3ZA 3UAZA 3I3SR 2AXEA 3PD0A 5BNTA 2IW3A 1ZISA 3RTAA 5L7YA 3JASB 3DZGA 2HL6A 2R5WA 2OMEA 3LHSA 4AZ3B 5P21A 1JKFA 3MERA 4IV5A 2V7PA 2BC9A 3FB1A 2PWPA 3FMFA 3CRQA 2IS2A 3N2IA 4DMGA 3UUGA 1EUZA 1W5BA 5KJCA 3E0QA 2P5YA 3ODGA 4M3NA 1WB9A 2PAFA 1N0UA 2NUPA 2J6BA 1IHUA 1XLTC 2WJPA 4J07A 4WBSA 5D3MA 3KZCA 2VBCA 1E4EA 3DV0A 1ZUIA 4UHJA 2Z2ZA 4MUEA 1C29B 2OTCA 5BUQA 3AHDA 4LF6B 1JVSA 4QPPA 3DZBA 3M9LA 4R5HA 4RD1A 1X14A 3WK5A 3VKHA 5TQ0A 4AX4A 4GQIA 2JAOA 3TI9A 3I61A 1QDLB 1Y1QA 3VTZA 3ZZMA 4DCOA 4R71A 3HM2A 1E2GA 4KQHA 1YZNA 3JD2A 1GNQA 1Z22A 2FSIA 3HDTA 2HNKA 3PNLA 4BX2A 1HT2E 4B8WA 3QPAA 4A9AA 1LBQA 3LBYA 1YQWA 2IPMA 5EE1A 3QNUA 2AK2A 4INPA 4FGSA 2ZR8A 2AFIE 2BGTA 3CLVA 4O2AF 4C88A 5HK9A 5HFAA 1Y8ZA 1FP4B 1H2YA 1L8AA 4UBIA 2OYCA 3RVJA 4GDFA 4I9UA 2BMFA 3D6JA 3VDXA 1AGXA 3T54A 3UK0A 2G17A 2V5UA 3PQ7A 1GSHA 1NMSA 5F73A 5H0IA 1POWA 5TARA 2X42A 6CHYA 1KK3A 1NATA 1E69A 1SCAA 2ZOSA 1DAMA 3NAZA 5JYCA 1GTL1 5DBOA 2YXEA 2KMLA 3AUXA 1PL6A 4POOA 4UVGA 2R6DA 1F06A 3A6EA 5KYYA 3B1VA 2QTWB 3QMVA 4WNIA 5FTKA 5IVIA 3LU1A