3AUJB

Structure of diol dehydratase complexed with glycerol
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
179
structure length
179
Chain Sequence
GFLTEVGEARQGTQQDEVIIAVGPAFGLAQTVNIVGIPHKSILREVIAGIEEEGIKARVIRCFKSSDVAFVAVEGNRLSGSGISIGIQSKGTTVIHQQGLPPLSNLELFPQAPLLTLETYRQIGKNAARYAKRESPQPVPTLNDQMARPKYQAKSAILHIKETKYVVTGKNPQELRVAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redesign of coenzyme B(12) dependent diol dehydratase to be resistant to the mechanism-based inactivation by glycerol and act on longer chain 1,2-diols
pubmed doi rcsb
source organism Klebsiella oxytoca
molecule tags Lyase
molecule keywords Diol dehydrase alpha subunit
total genus 63
structure length 179
sequence length 179
chains with identical sequence E
ec nomenclature ec 4.2.1.28: Propanediol dehydratase.
pdb deposition date 2011-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02288 Dehydratase_MU Dehydratase medium subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 3aujB00
1NBWB 1IWPB 3AUJB 1DIOB 3WB2A 3WB1A 2D0PB 1MMFB 3WB0A 3BRCA 2D0OB 5D5PA 1UC5B 1EGVB 1IWBB 1EEXB 1EGMB 5D5QA 1UC4B
chains in the Genus database with same CATH superfamily
4BAZA 4PU0A 2A9KA 1GL9B 3B70A 3SOPA 3TW4A 2AE1A 5DPMA 3QU4A 4D02A 1RLJA 4DQLA 2MJLA 4UOEA 1UP6A 5F77A 3RK1A 5TQJA 4P86A 4M1MA 1H8HA 1RYZA 3BEOA 4AMVA 3SAJA 3B7WA 2VNHA 2IYRA 3UH1A 3M3DA 1GYQA 3LRXA 4G0YA 1TCAA 3EOBI 2N42A 1P44A 2A5GA 1H4TA 4J16C 4MVCA 3I53A 3MPOA 4XIJA 3JQ6A 3I9NA 2RHHA 4ZO7A 1PE0A 2UXCB 3K8QA 3KELA 2YCBA 4J0EA 4TQAA 5CFRA 4PIVA 3CVOA 3EASA 3NNDA 3CZCA 2OXTA 1HYBA 3V9PA 1MIOA 5CLLA 3QJYA 4Z3OA 1BE1A 1DMSA 5JALA 1M1UA 4KKXB 4BC1A 3SXJA 4D8TA 3QLTA 4PCUA 3VJLA 3LXMA 5IJZA 4BLUA 3RJZA 2VJDA 2WTEA 3RBAA 2X15A 4MJXA 3E15A 3KEOA 1E2PA 1VL8A 2W5UA 1G21B 2OCXA 4LYYA 3ZE1B 2NAPA 2ZETA 3WK4A 1SBCA 3BX1A 3T5DA 4W1QA 2B9VA 1VE9A 4DGSA 2ZEJA 2XZTA 1QHYA 1ZICA 3D3WB 4EPRA 1PWHA 4E2YA 3K9CA 2O2ZA 2PQ6A 2YBDA 4P7KA 5CVVA 4JI5B 3KT0A 4M89A 5KNBA 1GDTA 2XECA 2FQ1A 2DAPA 1RC1A 1KQNA 4CMIA 4TV8A 4GLJA 1MFZA 3L1IA 2AHRA 4JC0A 1L8QA 1EJ2A 2I71A 3CG4A 2A1UA 4R8VA 3RS3A 1WXXA 4LXXA 1OILA 5CT8A 2CB9A 1ZUHA 1CUDA 3C1TA 3F6SA 5JEEA 5KZMB 3JWEA 4Q9DA 1QHXA 1ZKMA 1LLUA 4RVCA 3IHWA 4IHJA 2WT9A 1KYTA 3N8GA 5JAPA 2FR8C 3A0RB 1NNUA 5B2EA 4EB6B 2Y9MB 1YFZA 1EK0A 2XUPA 1V6SA 3D6JA 3I0ZA 4L76A 4A2PA 4RPKA 3VU0A 4NBRA 1U9JA 3FPEA 2HIAA 3FZEA 1MU0A 1G16A 2K4MA 4N0DA 3P8ZA 3QEBZ 1EVEA 4XQEA 5SZHB 1RWMA 2PS0A 1V9CA 3EA5A 4WK0B 4E5NA 1JU4A 4GM4A 3DKIA 3KLNA 4LGVA 1QU3A 5A4DA 5IZ4A 4IICA 4BX9A 4NVRA 3GCWA 2ZVDA 5JBIA 4FR0A 3L6RA 3DJFA 1C1YA 1BD3A 1Z26A 3AXSA 4RHEA 2E4VA 2J3LA 1U6JA 2ZJBA 3EQZA 3FB4A 2XUZA 3MERA 4YCSA 3W5SA 4DG9A 3Q10A 4J0GA 3ZHRA 2WPDA 1ISGA 2JCBA 1QANA 2XQVA 4DT1A 5LP1A 4KPYA 3FWZA 3SICE 4YALA 3GR6A 4V0OA 4HP8A 1PEYA 1Y8AA 5IN4A 3GDGA 5EESA 4JB8A 3F74A 4I9FA 4M6WA 4LI3X 1GTZA 2GZ1A 4RIFA 5F21A 5B3JC 3QVKA 1L4BA 3I28A 1CZRA 3Q3IA 4KH0A 2ZT5A 4QWWA 1UOQA 2AJLI 2OHIA 2XE8A 3BTVA 4RTRA 4EF4A 5CDSA 5KU1A 4WLEA 1DG9A 1ADCA 1PYOA 2FHSA 2PH5A 4IV5A 2DC1A 4RXTA 5BN3A 5HE9A 1KC3A 4MNTA 2IBTA 1R9GA 2HZBA 2L69A 3IDFA 1NLMA 2UZAA 3M4XA 4Q3BA 3EQ6A 2ZCUA 1SA0A 2XZPA 3P94A 5HZMA 3UMYA 1ADYA 3GRPA 3PCXA 2ZATA 3KEMA 4RZXA 4Z5XA 2OCKA 4KPUB 2EARA 1AV6A 1E4VA 4O02B 2VN8A 3HY3A 2QZPA 2YXEA 3LC7O 2VUTA 4MHSA 4YAJA 3SC3A 4BGIA 2CJFA 1D9ZA 4WBNB 1ZIDA 3JYPA 4LYAA 4BNDA 4KDFA 5AHKA 4I3GA 3TRFA 5C37A 2BEKA 3FSGA 4FW9A 2IW3A 2X1VA 2XYPA 2YRWA 3HKEB 4OQNA 5B3AA 2Q7XA 5P8WA 5HFJA 1QCYA 1KFKB 5TSDA 3RUCA 4YAIA 3IEXA 4M8NE 4K2AA 2QZSA 5C5EA 4MW5A 1BVUA 4RIEA 4JB3A 3IUMA 1Q7RA 4KN6A 3U0VA 4DMHA 1IG0A 4LQDA 5KDOA 3DCYA 3AB7A 3BKWA 5AKKA 1JIVA 1NTRA 1RWNA 1U0HC 4KPFC 4MQEB 4PQYA 4QGGA 1EFCA 3PQ7A 4B2YA 4CEHA 1ESEA 2K7ZA 1QQAA 2R3SA 1KHHA 5T6BA 2RKWA 1FVXA 1GQSA 2A9PA 3QWFA 3DAFA 1E6MA 2K2QB 1WQ1R 3DBVO 1MJGA 2V3WA 4LTNA 3R3YA 2JBAB 3UA4A 3KRTA 1JHXA 1FUYB 5FI3A 5BW8A 2OCDA 4DLXA 4OJNA 4KMOA 2GK4A 2R7AA 4E7OA 4U0JA 4EA8A 2IHUA 5CLQA 1W5SA 2WAYA 1YZFA 3BXGA 3PQ5A 4WBNF 1GCAA 1FXSA 2DFVA 3QU7A 3NTXA 5E2IA 5J4LA 1J5EB 1ZGAA 3MT0A 4O1HA 5AI0A 4Q3AA 2BGUA 1AK1A 4UNRA 2PMDA 4MROA 3F46A 5KYUA 1JA1A 1NU6A 1M0TA 3T0GA 3LLMA 1RKUA 1D07A 4YCLA 2XCQA 3I04M 1YBMA 1EGMB 1HE5A 4URFA 5C32A 1DKMA 1QQ5A 3ER8A 4KNYA 4ND2A 1HLDA 1Q7TA 2H2HA 2QN8A 3MYRA 4HNQA 1PL8A 4QULA 5DHUA 4L2IA 5GY7A 2HXYA 2QN7A 1DC7A 1NX9A 2Z9DA 3K05A 1XMQB 1H2BA 4KMMA 4FSXA 1T3SA 2D06A 3HXTA 3MAJA 4GXTA 1T4GA 2ZIXB 1ZD1A 2IL1A 1RFGE 2ST1A 2W6ID 3AK4A 3LVQE 4NEGA 2XE7A 4MTLA 3PP8A 3QNMA 4OU4A 2WLSA 4N03A 5F1YA 1OASA 4CL2A 3MRTA 3R6LA 3Q85A 3K5IA 1Q1AA 4U8GA 1XCPA 1EFPA 2PUJA 1YJAA 2ZSFA 4JJIA 3STYA 3NORA 4G85A 1ENPA 1UODA 2AW3A 3KKPA 2XKAA 4UCQA 1BN7A 1DXQA 3ICOA 4O5OA 5AP9A 4E14A 3G8DA 3HA2A 2JK1A 3ZBPA 3KB2A 2BY4A 1G41A 1NP7A 4K9QA 1QM5A 5AI4A 1AHIA 1CCWA 1GQ2A 3M1YA 1MAWA 4JBXA 1QPZA 4Q34A 3AILA 4IMPA 4GFDA 4X20B 4J3JA 4PO9A 5ELLA 3AUYA 5TF4A 3TZBA 4EKNB 2FOXA 2XBMA 1Q19A 1ISMA 2PX5A 4W6QA 4EB8A 5KMGB 3Q7TA 2ZJ4A 4C7KA 2CBXA 3JAWB 1P6UA 4IJWA 1EG7A 2J45A 4MUIA 4BBAA 1Z6YA 2FY8A 2XTAA 3HVJA 3CGWA 3WI7A 4JYPA 4UM8B 1ZONA 5B4TA 4CN8A 2O2GA 2XRFA 3WXMA 5HQ3B 2J0EA 5TMBA 4XSHA 3KQNA 1KOJA 4HDMB 3U4GA 3LVBA 3GZTB 2UZ4A 1Q84A 2NSYA 3KTOA 2YV5A 3TKAA 4PYOA 3TTTA 3DXXA 1RAGA 3BJEA 1CZOA 3ETNA 3GFGA 2GBIA 2SBTA 1B2RA 4E5KA 2Q3DA 3Q72A 3QFFA 4GDFA 1G66A 3GFPA 1GYPA 2BEJA 3LWZA 3JD4A 4MINA 3V46A 5BMVA 3G2KA 3CSSA 2HEGA 3TLEA 5ICMA 3D31A 4RETA 4Q0MA 5J58A 1HE3A 4X3CA 2RK4A 4KC0A 3TSCA 3EIQA 1A97A 3N2NA 4GNKA 4KVZA 3V2GA 3S3TA 3T9BA 3K09C 4HY3A 4PYLA 1ZX1A 4Q7LA 3SEAA 2O0HA 4CFYA 4MR8A 1CQZA 3HJFA 3B6JA 3AZOA 3S1LA 2FPPA 4OYLA 2H5JA 3CUKA 3G1WA 3H5LA 3F7MA 521PA 3SYRA 5JZVA 1MGPA 4II2A 2G4CA 4HXFB 3EF3A 3U6KA 1Z4NA 1DOAA 2FW1A 4OPMA 1F4VA 4YLEA 4B3SB 2QVBA 4C6TA 2XH8A 4DJEC 5E6UB 2CFIA 1Q0LA 2PR7A 1EAMA 4YYEA 3HVKA 3PDUA 3QKRB 2DWQA 5AT1A 2GCEA 2P9YA 2C31A 5DM0A 1IAQA 2LP4Y 3O4IA 3QELB 5SY4A 2JVIA 5L9AA 4FCTA 3DNFA 2BP7B 3A6EA 1IONA 1VSQA 4C0WA 3AM5A 2XSZA 1OXKB 4IFBA 3HKEA 2P4SA 4RDIA 4AY4A 3GBVA 4G0WA 3A6PC 1WU7A 4ZEOA 5DYGA 3D9QX 3K9GA 2V6JA 4C6SA 3KR1A 4YUWA 1Z16A 2V8BA 5JJCA 1QQ7A 3OLYA 1OBVA 4IKPA 2JATA 3D43A 5FJIA 5G0WA 1ZIOA 1O89A 3HXLA 3BWMA 4UAVA 1LF0A 3K0SA 2W0SA 1C3JA 5FYDA 1RRCA 3RJTA 2FDRA 1R64A 5JD4A 3WMRA 1MX5A 1VP9A 3LP5A 3MWDB 4ZDKA 2Z08A 5AW5A 3VPAA 1K8QA 4X0EA 1SG6A 1KE1A 4BECA 4EBFA 2OR3A 3HKCA 4JXKA 3OT1B 3H75A 3IODA 4TTTS 4C7VA 1I2BA 2E3JA 2ZSJA 4QRIA 1KO8A 3VSEA 4YYZA 1L5HB 2ZWVA 1DJLA 3G82C 1MB0A 4BTVA 2FG7C 2PGOA 5KX5A 2WF9A 1A9RA 2OMKA 1M54A 1YIDA 3C85A 2JLVA 3DO6A 4J7XA 4BNMA 1JHUA 2RIRA 2N0SA 3E58A 4YT4A 4JUIA 4QYIB 3OZVA 3BCRA 1RPTA 1T9BA 2OG2A 3WIDA 2FMIA 5CBPA 2BUBA 4XM0A 1RMYA 2O7VA 1R4NB 2F59A 3ADPA 1SHTX 3SPXA 3LOPA 4GUAA 3HFRA 2Q99A 2XWSA 1RI1A 3RTAA 1AN0A 1F2UA 1KBQA 4WZZA 2Y4NA 3MGGA 3QMWA 4HQOA 2GN6A 4TTJA 3DZBA 1E9BA 2Q6KA 4ZQEA 2JJMA 2EG9A 4X6LA 1Q1GA 5SV2A 4EMUA 1QK4A 1WMBA 5TJ9A 1QV9A 4EP1A 1P2SA 5DW0A 2GCOA 2V0GA 1R6AA 4B83A 3NV9A 3EPLA 2UVPB 3ZDXB 4KIFA 1G21E 2Z1DA 3U19A 4RS4A 5BUCA 1FTYA 2GI4A 3WISA 2I6SA 2H1HA 1E2LA 1P4GA 3ET5A 3TTXA 5BNWA 2RONA 1CUGA 1T2NA 4IAOA 1DEAA 4LK3A 4TKMA 5AVSA 3HXKA 3I4CA 5ISMA 2ECPA 3EEQA 1I6LA 4DS3A 1XMJA 1UKYA 3AY3A 3AM1A 3RK0A 3NBQA 3GJ4A 2A88A 3MILA 1DAIA 2I55A 4NZYA 4BX8A 4ENPA 2ZSAA 2YCLA 2JLRA 1E3EA 3H2GA 4ZI7F 3MJRA 4RZIA 4BGUA 3AY0A 5C8YB 4NJOA 3BCSA 3FVWA 1AO3A 2Z9BA 3TB6A 4LMPA 1KI4A 1RRMA 1P5JA 4YP0A 4TV8B 5EKTA 1M1NB 2ZCJA 2HJWA 3HJHA 1J00A 3UWPA 1UZNA 2EWWA 1C3VA 3LPDA 4PW0A 2DQKA 4U2KA 3A6FA 3O8RA 3ZZUA 2CHEA 2O48X 2G83A 2EXXA 4DCNA 3Q5DA 4ZHQF 1OB5A 1GQYA 3LZDA 3C7AA 5HBRA 2GHQA 3DQZA 3L46A 1FRFS 1WD5A 1RHUA 4UNSA 3V1TC 2SKEA 1O2DA 4POOA 1KGDA 2IYQA 1B7GO 1W88A 2CVFA 3HMQA 4MPDA 4MVYA 4O4IA 2CXSA 3QLEA 4FFPA 1K7FB 3DBRB 5TQ2B 3BJZA 3SIWA 3WJ1A 1NY5A 3GRZA 3KE8A 4GEKA 4QE3A 4UJ3A 1D2RA 4LRYA 2DKOA 1PG0A 2QRVA 5FLKA 2JFNA 2RB5A 1ZD9A 2Q3JA 1MOQA 3H9BA 2VZ9A 2EP7A 4GYWA 4JWTA 2AD5A 2P91A 4HQRA 1O94D 4MQLA 4PWZA 3T34A 4KGVA 4N4AA 2RH9B 3WA6A 3FHJA 5F7JA 3WGMA 2X5OA 2EQ5A 2FCRA 2RGCA 2X42A 2WVHA 3TE6A 2B30A 1G0NA 3FB1A 4NCXA 5A6SA 2HLDD 3C3MA 4M0FA 4JYCA 4WFJA 5IPFA 2FPMA 2ZU0C 4OI1A 1DKQA 1RLUA 3NO4A 4LE0A 5HUQA 2VT6A 2Y1DA 5D85A 3VZBA 4ZEXA 1WB6A 2X13A 1R0BA 3EUEA 1TMYA 1T8YA 1YFKA 4UVGA 4IXTA 3OX2A 2NV6A 3ZGYA 1T4MA 1JXQA 3VAAA 4IIJA 4JBWA 2D4HA 2NXJA 3CNQS 4B73A 1UZMA 4V03A 3WKAA 3EPKA 3EXAA 3SQOA 4Y2RA 2Z6AA 4RE6A 2DFKB 3B3FA 4FBLA 3CLSC 2R1TA 1EXWA 1SHJA 3A26A 4X8OA 4I8DA 4KQ9A 5FBKA 3O03A 3VR2A 2NWQA 1FJHA 1ZHFA 3OJCA 1SUAA 3PIDA 2ZWMA 4IHKA 4KSBA 3D8RA 4ONEA 4YBRA 4X6UA 5E4TA 5ERXA 2P8JA 3FWPA 2BM8A 3G2QA 4Q48A 1PV4A 2K2WA 5DGHA 5CXQA 1J99A 1HFKA 2I99A 4TN5A 3FH0A 3RIYA 4GD3Q 1J39A 2KBFA 4TKVB 2PG3A 3LOUA 1VCHA 2BF7A 4DNOA 4MUAA 3C8UA 1W2WB 4KXMA 5EVCA 2MYNA 1SKYE 5EN4A 4YAGA 4QFMA 2C7RA 4GR4A 5K4GA 3J81k 1SOAA 4Z3DA 1KS2A 2DWPA 3LY8A 4TWBA 1V5GA 4XA8A 5FFFA 1J0CA 3LHSA 1R5BA 1C1DB 4V3BA 3GT7A 4IJKA 5AW6A 1XZLA 4GHWA 1R66A 1EZ1A 3TBHA 3GPLA 4S1PA 3O93A 3WNBA 4K1XA 3PT5A 1T0HB 3PR2B 1IDOA 4L3VA 4FDVA 5FUBA 4EBBA 1QCCA 1ZMRA 2CXXA 2R6HA 1IUPA 2HRBA 5FLXA 2C7BA 1BWRA 1L5FA 2E4ZA 1RRFA 2NPFA 3CVYA 2FN3A 3H1TA 3WRVA 1X1SA 1RM5A 5CMLA 3QXCA 3WLFA 4PZ0A 4C14A 4IRUB 1SC1A 1V96A 4J0JA 4L4ZA 3WIUA 2V9CA 1RWWA 3BD8A 3DV0B 3F6CA 4FDMA 4EVSA 3AETB 2O7NA 5EFOA 3IUPA 5E6SA 3PXCX 1AGYA 3K0KA 4GOLD 1GAQA 1YT5A 3RSSA 4HAXA 1E2GA 2Q3BA 3HGMA 2FFRA 2GN2A 2JAOA 4HD8A 3DEAA 2PZ8A 3NCTA 4I1UA 5EZYF 1C50A 3E9EA 2O5CA 4PSCA 5HILA 3UHOA 2WHRA 2VSXA 1MO6A 1CJSA 3ORYA 2C1ZA 2H2AA 4WQMA 2JRLA 3I0NA 5ECDA 3QG5A 3QBJA 2A94A 5CW1A 1JHPA 4AKSA 3I2KA 2FP4A 1N3IA 1U1IA 2PWZA 3H42B 3HLKA 3NDIA 4L0QA 4WESB 3EWNA 2NTVA 2IK8A 4KYIB 5ESDA 3UPDA 2OZPA 3WWZA 4DYHA 3SQWA 5ADHA 1CZHA 4P32A 2CNOA 5NULA 4QYTA 5CT5A 1WHTA 3W8NA 1NMYA 4WV3A 3AT1A 1OXXK 2A86A 2Q6VA 2YWFA 4OU5A 4AQYB 1W1WA 1W29A 2BSXA 3OJOA 5EJ7A 5H8WA 2FUKA 2JLQA 4QUGA 1J0AA 2CD9A 3VPBA 1YOVA 3MTDA 2NACA 2OK8A 3QVGA 1W1UA 4YLGA 2VCEA 3K32A 1QZXA 2NLOA 4H7HA 4O1MA 4CTMA 3PQ2A 3QXHA 4I5IA 2QY9A 3FMGA 1TKBA 3E8MA 3MELA 1J9EA 2OYSA 1U63A 1IOWA 4B44A 1YS6A 4FOPA 4CG0A 3DBIA 5BVGB 5KHOC 2BHLA 4QXQA 4K6HA 4M36A 1YDMA 2GHIA 4MVWA 1NZFA 2DBQA 3ZI0A 2ZPUA 1TA9A 3DWEX 1DIGA 2B83A 1U4OA 3HL4A 4NMXB 3L6OO 4MR7B 5MF6A 2BMDA 4NYMQ 5KYYB 3EXG2 4TTSA 4LRWA 5IVIA 4N5IX 1HLPA 5EHXA 3F1KA 1CHNA 2P2SA 2X4LA 4RHUA 1JHYA 3RC8A 3THRA 2O59A 3BGOS 1T91A 1ODKA 3AVQA 5HIAA 4V39A 3ETEA 2J33A 2XHZA 1JU3A 4G1UC 3S70A 1U0GA 3ZD8A 2ZRFA 2ZVQX 3GLFB 2YICA 4CDRA 5I9IA 1N57A 4Y0AA 2OYRA 4GBMA 3ZNPA 3AIOA 3W7VA 3DG9A 3RIHA 3GT0A 1VFPA 5CFPA 1J20A 3T7TA 1LVUA 1ZCFA 4OQPA 2FG6C 1E1NA 4B3FX 5IUJC 2WABA 2VA8A 1RRGA 1QGDA 2XYVA 2D8MA 3MS7A 4YJ2A 2AN3A 1G20A 4R0VA 1IJBA 5CDHA 4KHZA 4LRSB 4H60A 1NAHA 4INJA 4MHTA 1BIFA 2HF9A 1AE1A 3CW8X 4FB5A 2I54A 3I2HA 2YJ3A 3ZWNA 5I9SA 3UJDA 2VF5X 1ETUA 5J2UA 2JGFA 2B4TO 5D3QA 1Z0ZA 1JU9A 2QL7A 1L3CA 2FFBA 4KB5A 3AYZB 5EJ8A 4MXDA 5CIWA 2I7DA 2C2MA 3RUPA 3GEEA 2FPPB 3HJUA 2ODNA 1U2QA 3LDHA 4RPJA 2YQ4A 3B3QA 2QUHA 1ADFA 2AFVA 3UJHA 1TCBA 1DFHA 1OJLA 4PXAA 2N3ZA 5KO2A 5ITZA 1LDGA 2VWHA 3MQ2A 4J0FA 1JAZA 3ASYA 1SBYA 4FGLA 4FKMA 4L8GA 1U6KA 4QVGA 4R1NA 8LDHA 3NHYA 1KI3A 1NUSA 3AP3A 3X2EA 3E7DA 3FW1A 1VZ3A 3PL1A 3QU9A 4M9RA 4UOZA 4ZCIA 3HZZA 4TVKA 4O4LA 5ABPA 5IZCA 2YW2A 4QECA 3VAYA 2AXNA 5A3JA 2AXEA 2JIBA 4DV0B 3LG2A 5IAEA 5EJ4A 1A2BA 4UBOA 1E66A 1E2FA 4OK5A 3PZBA 4J0KA 3LBIA 4UQPA 1BG6A 3WNZA 3UANA 4F4UA 2JLSA 3TSWA 1L4EA 1GIAA 1SD2A 3C6MA 4MTCA 3EJ6A 3BB1A 2NVUA 3REQA 4G24A 3SMVA 1OFHA 3UBTA 1E2BA 3MT9A 1F2TA 2J3JA 3T7DA 4BKOA 2WJ6A 4NMLA 1OBFO 2DH6A 2ZK7A 2OGTA 3LRTA 4HWOA 4RVDA 4EY5A 2RHBA 1ODLA 4ZP1A 1NVFA 4BCCA 1B6GA 1EFVA 3NWEA 5H70A 1OI2A 1GY8A 1JA9A 1KS9A 2NUPA 3VSAA 2QQFA 3DCJA 5DRYA 3ZDAA 1GNLA 3PUJA 2MYPA 3CU5A 4EYEA 3AETA 1LDEA 3QOFA 2VI5A 3X1ZA 2YWDA 5FJJA 5A4JA 2ZBPA 2V4UA 4DMCA 4ESEA 3TTYA 4AG3A 5NLLA 3KUKA 4IWYA 2C8LA 2J7PA 1EZZA 4R2LA 3T9AA 2D0DA 4B35A 1GGHA 5JFTA 4GMXA 4BFSA 4IIJB 4AWXA 1QP4A 4QOFA 2OHJA 2SKDA 1VPEA 4K28A 4RK1A 1XZDA 1KFCB 1IY0A 3JWPA 2FAXA 3ZTWA 1C2TA 3AW9A 2YXLA 4BFLA 4HAZA 1Q0TA 3HB4X 1K66A 2ONKA 1AX9A 2R5NA 5LIRA 1II9A 3L41A 1E6WA 2X4GA 3MFYA 3DXZA 3QVGB 5FV7A 4OKIA 3RYHB 3JPWA 2HC9A 3NFYA 3EOAI 4NCBA 4QU5A 5CA1A 3BRSA 1UBNA 1ZWKA 1R4ZA 1Y4UA 4DDKA 5GJBA 1GEEA 3G5MA 4OEHA 2HLNA 2MR5A 5A6VA 3CJQA 4KH1A 5B6JA 2O50A 4NZNA 3VR3A 5K6TA 1KR5A 4GPEA 1JEYB 1FFWA 4QFBA 2Q0XA 4ECAA 2GFHA 1JKJB 1UFKA 4FJ0A 5E8RA 3RC1A 4IR7A 4TUYB 2H29A 1KO5A 2P2NA 3U7GA 3IAFA 3STTA 5CK4A 3WKEA 2BDTA 3IT0A 3QE9Y 4DA7A 1Z0UA 2P27A 4TWAA 4ZIRB 3WGZA 4WKNA 4TPKA 5GZ1A 2Y1CA 3KT3A 5AVXA 2OHFA 4RBNA 3T35A 4D9MA 3GH3A 2PZBA 5HKBA 4YAOA 5H5JA 4WVFA 3FBGA 4ZC1A 5K3OA 2XRZA 4Z4FA 1E5LA 4XD7A 3LBNA 4S1TA 1O0BA 2DG2A 2XXAB 2BW0A 1HFEL 3M5WA 1TC1A 3KLOA 1VCIA 1UXJA 4URHA 3IA2A 2RH4A 2DBZA 1W4RA 2C9YA 2CLOB 2L17A 5CJJA 1JILA 3AYXB 3SHOA 5DZSA 3FDJA 5BN5A 3JRXA 4QAJA 1GKKA 2C3MA 5TS2A 3SXUA 1VG1A 3TSZA 4D45A 4FYWA 4RTJA 4GVXA 4O4IB 4CLHA 4DWOA 4QDUA 3HB7A 5TQ2A 3DJYA 4HB2A 4B6OA 3W78A 3PFHA 4F9EA 4ZPXA 2DQZA 1DPGA 2YZKA 3CRVA 4E70A 2HMTA 1O9BA 3JD2A 221PA 4P5EA 3MWGA 1Y3IA 4K40A 2YHAA 3IAM6 1PLKA 2Q3EA 1E3IA 1OBCA 1U2EA 5M3BA 1Z8DA 1TPZA 3G5LA 1MA3A 1U1GA 1CSEE 2YV2A 4MMYB 3V8NA 2A1IA 1U0LA 3VR4H 3A25A 2P77A 3KQQA 4DDVA 1DO2A 1PVDA 3CX7A 3QLUC 4CT0A 3G9ZA 5AUPB 4U7HA 2Y6VA 5J2TA 2EL7A 2RHGB 3ZY3A 2HUNA 1LZKA 1YUNA 2QRLA 3G68A 3QG1A 5FTWA 3U4HA 3WB9A 4JJZA 4BVFA 1GPLA 4HTFB 5JMOA 3NG1A 1Z6ZA 3ELUA 2A9RA 3DMDA 5HR5A 4DVGA 3L01A 4OQMA 1GEGA 4O2AF 1N6LA 1NVTA 5JYBA 1PBTA 2C2YA 3RROA 2ZYTX 6CHYA 3NOXA 2IZ7A 1QYRA 4R1QA 3FTPA 3FGPA 5AJXA 4V0MA 3S55A 3WP0A 1E7WA 2B4KA 2M6SA 2G77B 1V4NA 3PL5A 3WGVA 1T36A 1W73A 3CLUC 1HFJA 1KK3A 1OWPA 5A7FA 5JY6A 1I7SB 7MDHA 3E7XA 1M10A 3EWAA 3OH8A 2V98A 5C8YA 1I36A 1KI6A 4OG2A 4CDNA 4I4NA 1VKZA 3CJTA 1CUJA 3DQQA 3HGQA 3UTDA 5CLJA 2EW8A 4GKKB 2LKCA 3UJ6A 2QRZA 4F92B 4KYTA 2JNWA 3OX1A 1IY8A 1P2BA 1OLSB 3LFTA 1JFSA 2CUTA 2EFEB 1YL6A 3DHNA 1RQLA 4MEJA 1SVLA 2G6BA 1B1AA 1Z5VA 4NE7A 2PH3A 2WT4A 1DIAA 3VBEA 1E5VA 2BR3A 3FCOA 5IC6A 3CN9A 4MGYR 4JDUA 4QJIA 1M8PA 3HJCA 4CIDA 2RGNC 2B78A 3VNRA 2FMHA 4GSKA 3CLKA 2DTEA 1CYDA 3MGBA 3TQIA 3DMPA 5G40A 4JLNA 1XQ6A 3G13A 1IEQA 3AR4A 4CQLB 5BURA 1SRQA 2BKAA 1N2BA 4YJFB 2E49A 2QU7A 3BD6A 3DTVB 3ZHVA 3NATA 1QFMA 3KHTA 1JSRA 3AI3A 1XQWA 1IHXA 1FDIA 2QX6A 3CNEA 2B1IA 4A36A 2X0RA 3LO8A 1E62A 1X70A 3NEYA 3TRHA 4C4SA 4TKUB 3UYKA 4D3FA 5E7IA 1OYYA 2XLBA 3VNVA 4RO0A 3RS0A 4HBGA 2SKCA 4JJEA 4TQGA 3GI1A 4XGNA 1KF0A 4F4CA 4CCSA 3UZUA 3TMKA 4RY2A 4MP8A 1KARA 1X14A 3E3NA 1UBFA 1PWXA 4JYAB 3K0AA 3FM9A 1XN4A 3A7EA 4BFUA 4H77A 4ITRC 4OHUA 3DAOA 1OU0A 5EA2A 2FQYA 5KTRA 1ESDA 3CVUA 1A4XA 1JDVA 4OMUA 2VJPA 3K53A 4JGBA 2IHJA 3E9NA 1I4TD 1RPNA 4FE3A 4WASA 4ZVVA 5BNFA 3G0OA 4EVRA 2VFAA 1ANKA 3BXXA 4G36A 4MW0A 4B46A 1EXDA 2G5PA 3DOEA 4Z0PA 1HT3A 3WNQA 3PUXA 2VP9A 3FOBA 4BNDB 1Z4LA 5JADA 3ZD9A 4FZ3A 4E3ZA 1JVNA 3AHJA 5DI9A 4ZAWA 2V55B 1JHVA 4B3IA 5HX7A 1M6WA 3AIIA 5FOUA 1I9CA 1S9HA 2AI2A 3O7WA 1U8UA 1HURA 1ZJ6A 3IR6A 1TL7C 3IALA 3OICA 1VA5A 1IQRA 1MBZA 2JDIA 3CF0A 1ZVJA 3K6JA 4IWNA 4JLJA 3NB0A 5LVAA 3MOGA 4EHNA 2ENWA 4E33A 4A82A 3GLIB 1X3SA 2ATXA 2IOQA 4O29A 4DKJA 3UVEA 2JS7A 5C9ZA 2FXIA 3BL6A 2MTBA 4PZPA 3E8XA 4R40A 4A2WA 3DMTC 5J59A 3HV2A 4E4RA 5LQMA 4RQBA 2QAJA 5BW6B 5L3QA 3L8EA 3ABQB 4X54A 1GADO 1UZAA 1QP0A 4N40A 4E1AA 5GJVC 3I42A 3HZOA 2C77A 4B3HA 1H0KA 4ZAXA 1N0HA 2EKQA 1OU4A 3FSJX 2G7ZA 1MVLA 1TK3A 1SZDA 2R1ZA 3VVBA 4UEJA 4K9KA 4RKEA 4CNQA 3ANXA 4N3GA 1Z7WA 4QGHA 4ZT2A 1R3UA 2O3TA 3OZAA 3TI7A 4DL9A 1PEAA 5EXSA 2VT7A 4H59A 2UVDA 3E0QA 3BMNB 4PSVA 1TJ3A 2W93A 1RS0A 3AB8A 3EX7C 1E2QA 1PUIA 2R5WA 1M1YB 3BT7A 4YRLA 5CA0F 1QVZA 1V39A 4Y9UA 3H1EA 3OO0A 3IAS1 4BNNA 1WUTA 4DJTA 1ZBDA 2O8DA 3EXFA 2YIMA 3C7DB 1E2MA 5T4EA 3RSQA 2R6GA 4PVCA 3H97A 5H3HA 5I7EA 3DOOA 1DKOA 4KPGA 2WD8A 1XDBA 2P2CA 3HWRA 4NK4A 3E9CA 2PX0A 1Y8QB 4IXMA 4EZEA 4YUZA 5FO0A 3VX3A 4D9KA 3MCZA 2FZCA 2UUPA 3FVQA 1PJ2A 2O0MA 4PO3X 1BMTA 4FN4A 2MR6A 1PJ3A 2X8BA 1L7XA 2XB6A 2I4IA 1DDIA 3LW8A 1PLLA 3FPBA 2PN1A 4HGNA 1CU1A 2XYGA 3C48A 1BQ4A 1BXRA 4LYFA 3PJEA 4NDNE 4Q82A 4CV3A 5AXBA 3WZMA 2W2LD 4V2UA 3QBEA 4ZQFA 3ZK7A 3COPA 1Z4JA 2WF8A 4R7TA 4R6XA 4C4TA 3JATB 3GCGA 1U02A 4ZYYA 4QTYA 2VJBA 2DKNA 2OT3B 3LXXA 3IURA 4OATA 2JJ1A 3OPYI 5LXTF 2ZB7A 1Y5NA 3GN1A 1SBHA 4JXZA 4F7WA 4MDHA 1BFUA 1V9SA 2PZKA 4PBTA 5C31A 3NYIA 3UXYA 3E5NA 2G88A 2DR0A 5HS6A 2VWGA 2C4HA 4YJGA 2DGDA 2BC9A 2ZDGA 4DRYA 4F93B 4P80A 1GFIA 3KPUA 1YVDA 3PJRA 3L0BA 1U7WA 4AZTA 1NBMA 2X5XA 4FD3A 5CNKA 4K88A 3KBOA 2QJFA 1T9CA 3DCIA 2C9OA 4N41A 4Z0TA 3TOVA 2OFPA 4UMVA 1WEHA 1XTJA 2J6BA 3QWAA 3RW9A 2O8FB 3TSAA 5EE9A 4LJSA 4IOJA 3RFUA 2BOVA 3FPLA 2QMEA 5CXXA 1KE2A 4NP6A 1C2YA 1AGNA 1Z18A 3OPXA 4HDSB 4ZT5A 4X3OA 1PGJA 3G5AA 4XX0B 2OFXA 3CLVA 4AECA 2GEDA 1OUMA 1XQYA 1RYNA 1DIRA 4RE5A 3TL6A 1NU8A 4MCHA 4Q9JA 4BFVA 1QRSA 3RFFA 1BROA 3GGOA 2OGZA 1Q83A 4L28A 3MF4A 3IP5A 1KVTA 3BL8A 5A4IS 3I76A 2CLLB 1MC1A 1QHHA 1UXHA 3L0PA 4FHDA 4G5YA 3DULA 3OA0A 4TV9B 4E03A 2V5UA 4AJJA 3ZLTA 5F1OA 5EJ2A 3DKRA 3BHNA 1XMPA 4R68A 3WGQA 5FEUA 3N3BC 2HRQA 2F9LA 4F4JA 3K70D 1P45A 4CMCA 1ECLA 2DF8A 2UZIR 4PQRA 1QO9A 2FJPA 4W9NA 1W6RA 1PR5A 5TPZD 3WXBA 4B31A 4DIKA 3AQIA 1DARA 1KJQA 3U80A 3WK6A 4RJLA 2EC5A 4OGKA 1SEVA 4OAQA 2I6XA 4FPXA 1MVNA 1QPGA 3HCFA 3EDCA 1J0EA 1P5HA 2WWVD 2Q27A 2RHWA 1W36D 1IQPA 2Y1GA 3E48A 1I4WA 3EA0A 4M87A 1G19A 3FHOA 4D8UA 3GNQA 2BLNA 4K9MA 3BB4A 2FDXA 2PGXA 3HU2A 1P2TA 3RQSA 1USIA 2ZSHA 5DNDA 3W3AA 1O95D 4PWYA 1YL5A 1I80A 4IHJB 1YCGA 2QR5A 3K5WA 1MX1A 3TNLA 5LMCA 2KM1A 4O0MA 4UEKA 1KWKA 4JLKA 1ULZA 1U9IA 5C51B 5I51A 2AZMA 3HI4A 4DXHA 5LQUA 1HOTA 4Y1FA 1KH3A 4CQLA 5K8JB 4BU1A 4DUYB 4L8FA 4B6FA 4F4DA 4FZVA 1RP7A 1TRKA 3PGKA 4D98A 1J2UA 3DZCA 2GCPA 1R15A 1AIPA 1KJNA 1RTTA 1YZYA 2G9QA 1VYTA 2VYCA 4JU9A 2AN9A 1D2NA 1AK9A 5DHAA 2P1DA 3A4NA 1E7SA 3FCAA 1PN3A 2IOYA 2QVZX 4Q21A 4ZWNA 9LDBA 1O7JA 1P73A 1PR3A 1K6MA 1P5FA 3C41J 4RADA 2VNIA 4Q24A 4N3CA 4JMPA 3I8XA 4UTOA 5DU2A 3ENZA 4FBMA 3K92A 3RRXA 1ZGJA 2D2IA 2DKFA 2OWEA 2OCPA 1AXGA 1BMQA 1NQXA 2AMVA 4HDKA 1MT0A 4QXMA 3T9FA 3VYTB 1HV8A 821PA 5K8LA 1XMSA 2VH1A 2YYYA 4HQKA 2O4UX 3CPHA 4LQLA 1SU6A 2G5TA 2QYOA 4NOLA 1E69A 2VHEA 2HWUA 4J43A 1JT9A 4JYMA 4MWEA 3P9IA 3CB2A 1G98A 1DJMA 3O4GA 4IH9A 4DLSA 3SBEA 1KEEA 4ND5A 3FUTA 3R7NA 2YYSA 5JSQA 1NC1A 1P5RA 2H16A 1OKKD 2HSDA 4C0XA 1XCJA 5F1PA 1FXWA 2XTJA 1LPMA 3IRUA 4OLAA 1ZLYA 2H07A 2WKQA 2W4MA 4Q16A 3R5TA 5KQRA 4ARVA 5FWXB 1ONOA 4O1IA 3TS1A 3JAMA 1KYWA 5T5QA 1QAMA 1T3GA 3M6WA 3ER6A 2FKNA 1SC4A 4GDMA 5ARBA 5LYJA 5BV2P 5EVJA 1W88B 1NN5A 4NKRA 2RAPA 2ZAOA 3KOZA 4FLFA 1UT5A 1EA5A 4Y6SA 3X1DA 5EJ9A 4YJ3A 2P6RA 3IB3A 1Z12A 5TX7A 1P1BA 1TM5E 4DCUA 2J5KA 3QY9A 2XOKD 3MCUA 1Q15A 4KNVA 1K89A 4ENRA 2BMFA 3U40A 5EKSA 2WJ4A 1QVVA 1C7FA 4OXQA 4FFWA 5KOJB 2XDWA 2OOSA 5H80A 4CEHB 4G8DA 4YRGA 1COZA 2I6UA 1XVAA 3H7IA 1XTKA 4Z4CA 5ADUS 2FB9A 2HPAA 4F56A 1IN8A 1G20E 2IV3A 1GTG1 2L19A 4RD6A 3UAXA 4NCJA 1FS4A 3H4MA 5CRIA 5IAJA 3GC6A 1BXGA 2WRZA 4JKIA 4KU4A 2IYZA 4Y9TA 5DHPA 4KWCA 1UCFA 3FZQA 4ENVA 1D04A 4JEIA 4M0PA 4A15A 1B6TA 4L1KA 1MC8A 4WN9A 4B7XA 3H5TA 5FFNA 3GYGA 3RS9A 4BVAA 2OHXA 2X7HA 3A1DA 3L8MA 3L4BC 1USWA 2XUAA 3OTWA 2C83A 3WZLA 2IDKA 3WFZA 1WHSA 4C3VA 5AKJA 4C89A 3ROZA 3Q9NA 4LXQA 2JKVA 1WZUA 3PXAA 4XDYA 2I8AA 5JV5A 1S2IA 1A72A 2W2KB 2XD4A 3GJ3A 2R86A 3HBAA 1SVKA 4D74A 1CW2B 1VPLA 3NEJA 4CM4A 4JI4B 4L2IB 1T4CB 5CM9C 2JGDA 1CC1S 1NVMB 1THTA 2VHZA 2I33A 1E96A 4UFPA 3DYBA 3FYUA 1KYVA 4TMVA 4BS9A 3MCVA 4H0FA 3F9IA 5JAUA 4JBLA 2RARA 3LK7A 3OT1A 3R7AA 1M76A 3BAFA 3PX3A 1PW5A 3D7MA 2QD5A 3K16A 5E1DA 5IJ9A 1DO8A 2RB4A 5TC4A 1XZQA 2YDYA 4AJLA 5BR1A 1T5OA 2XAAA 2CHVA 1FW8A 1UJCA 2V9ZA 4YRCA 2WTUA 3FNFA 3NR2A 3RTCA 1WWKA 2GVNA 4I7EA 16PKA 2OC9A 5LP6A 3ESQA 4LK2A 3VJRA 1WLSA 2WB4A 2V7PA 3Q3CA 1V2HE 4R98A 1YR9A 2V74B 1CK4A 4D4KA 3P0EA 5FR2A 3B1VA 3O2JA 3OKCA 4GC9A 1UKEA 5IJAA 1B76A 1A0OA 5JJ5A 4TX1A 1XB2A 4MUXA 1WXDA 1MNQA 5CLHA 1KI6B 4BU0A 5BQFA 1THGA 1CF2O 2WNHA 4WEOA 4YRNA 5BSEA 1BYIA 4LZAA 4EG1A 1ZRHA 3RIMA 3IDAA 3U60B 5EFZA 3K2QA 4GR5A 1A1SA 3QWIA 3NM6B 5K45A 2QT0A 2R4UA 1QIKA 2OHOA 2PGDA 3DLTA 2WBLC 3CCFA 4MAAA 1UBJS 3DTVD 3GAMA 4S3MA 3UMVA 4AICA 3OPQA 4P0TA 4CPDA 4DKXA 3U7HB 1DSSG 5HM6A 3CMCO 1NXVA 4QDZA 1B8OA 1DAEA 1DTEA 1NHGA 4MQFA 1IEVA 3GGJA 3EGEA 4LZWA 1PL0A 5JNUA 3KFXA 4C2TA 4HYTA 4IGAA 4MYCA 4X1YA 4UTNA 1JEQA 1X8KA 2KYRA 1DUSA 4ZKEA 3IBSA 4WXPA 1M2OB 4RELA 3BICA 1RXUA 1M2KA 5GGYA 1F3OA 2XQIA 3C3DA 4BBZA 1NMZA 4U39A 2QZ9A 4CM5A 2WMYA 5IYZB 4BJHB 1XA3A 1WUIS 2CK3A 1S8FA 1DINA 1J97A 4QBHA 1O1YA 2Y9PB 3AUXA 5DHSA 4CTOA 1R27A 3B3JA 3EIOA 1NXTA 4HYEA 3QUQA 3JD0A 1VTKA 1ILWA 1E4EB 1XLWA 3GPIA 2QSJA 3QPWA 3V7YA 1VCMA 3NTQA 1VE1A 1MR3F 1N7IA 2HH9A 2VDRB 4MB0A 4CIAA 2O5EA 2RG1A 5HGXA 5JYEA 5K0ZA 1EUDA 3PCRB 3SR4A 5KAPA 3GLGE 1Z28A 1YO6A 3B20A 3GEPA 4F5WA 1UP4A 3WL7A 3FIUA 4ZPJA 1MENA 2OBXA 1T3TA 1A71A 4M9XA 2YVQA 3JVUA 4Q37A 4A3SA 4Y18A 3UW3A 1GTSA 1LRJA 4GQBA 1XNRB 1YULA 4BVLA 4RTMA 4MWGA 3D4PA 4KVAA 5DNAA 4MV1A 5BPFA 2HWYA 2OLEA 5CH5A 1V7CA 2QT9A 1Y6QA 1Z07A 3I5MA 1PQ4A 1IN4A 1ZEMA 3DVLA 3MAAC 3PFCA 4CTJA 2XCIA 4EI7A 4TROA 4XWKA 2RKOA 3QSGA 3DTNA 1STOA 4ID9A 3OHPA 5GZ3A 1BGVA 5JCJD 1MFPA 1J7KA 2JAHA 4D1YA 2G9ZA 3F3YA 4AS1A 4RGVA 2VYQA 2FPUA 1E1CA 2ZE7A 4UMEA 4C05A 3SZMA 3KJHA 4QQNA 2WZDA 3K0HA 3SC6A 3A3NA 1P2VA 2DWOA 5AVVA 4EG7A 2J1LA 3TXAA 2IBSA 1NQ5A 8MHTA 1C1XA 3QA9A 2B99A 3IIIA 3E23A 4EG8A 4H15A 4XRGA 4R1MA 2DH5A 1LCIA 4MYUA 1TI7A 3U6BA 2AC2A 3SJCA 4KSCA 3ZEIA 2BGWA 3HK2A 2F3UA 4X7MA 3QU5A 3G2LA 5ARDA 1V16B 1U7ZA 5BSTA 1ID1A 1I0LA 3SHWA 5BV8A 1HQYE 3IILA 1O58A 1ZCZA 2QZJA 1E77A 4RIIA 4BHTA 1EE2A 2G5GX 1GFWA 5ILGA 3P27A 3NV7A 4YN3A 5BQ5A 2D1SA 3ML1A 1LNQA 1EAYA 1DEOA 2HNBA 4OFBA 4WESA 5BWLA 1EXVA 1V3UA 2ZS8A 4AUMA 1ZJZA 3KXPA 4DB4A 4LFCB 3BE6A 3PKZA 4US0R 1YJ8A 2ZJAA 3D3WA 3FCYA 1W85B 1TZ2A 1VHQA 1R5JA 4M83A 5D3ZA 5IULC 4G5GA 3LSTA 2AXQA 4UTPA 5CM2Z 1MJ5A 4B34A 4Y9RA 3V2UA 1QJCA 1QE0A 2GNPA 4P81A 5KVAA 3L49A 2DEUA 2GD6A 3U4IA 2CCKA 5EIBC 3EGXB 3Q0IA 2BMAA 3I52A 3HKBA 4RKQA 3WLIA 3B53X 2I4LA 1ZITA 3TE7A 3WBBA 4EA6A 2FPLA 5FWNA 3MWEB 5E3IA 3AUJB 2GNAA 5JY1A 3HRKA 3K71B 2QRMA 1PFVA 3QVTA 4BL5A 3NC4A 3G17A 2I3BA 2PXAA 3OQ6A 3AH8A 3EZLA 4X3PA 3RF6A 3WY9A 4A4DA 3L6BA 4DABA 2X2OA 4DRXA 5BMOA 3HJBA 3S99A 4BJ5A 5JU6A 3OCJA 1U65A 4AJ4A 4IEFB 2ILTA 3CNOA 4ND8B 1B2LA 4WX2B 4UFNA 4YASA 5DI3B 2G1AA 1SM4A 3KAKA 2GTIA 2IU6A 3DEZA 4J76A 4F04A 1VA4A 2W4IA 4NFYA 2EOAA 5MFZA 4P8RA 2Q21A 2R85A 4LV6A 2XOXA 1OX4B 3TO5A 1H2ZA 3R3SA 4ALMA 4DCVA 3L8YA 1VXOA 2D5IA 5F76A 4XWYA 3QOXA 1D1TA 1Q14A 3OECA 3HUDA 3TXYA 4HZGA 2W37A 4P54A 1E58A 2XNDD 3JZIA 4NH4A 2W6NA 1FSSA 5FNVF 5JBQA 1CRLA 1C3OB 3CKLA 4BC0A 3THXB 3NM5A 2C1EA 4IQ0A 3KU1A 4IPTA 4H1TA 5FCDA 3EGCA 4XH9B 1BHJA 3QIVA 5IYZA 1RBMA 2XUFA 1A8HA 3SM3A 3VJKA 5JSZA 3OFJA 2ERCA 1S2GA 1H0HA 3DA8A 3LX6A 3WTCA 2PM8A 4FGSA 2FEWB 3KJNA 4FS8A 4ZV9A 4CG1A 4FP9A 2DBRA 2J32A 3ZHZA 1Q2UA 5ALRA 2BFFA 4RD1A 3TLYA 5C81A 4HPXB 4OHMA 3LQYA 3P4YA 2B0CA 1E1RD 1H23A 3GLHB 4HDKB 4JSYA 5K8IA 2QW1A 1TTTA 4KBFA 3R3JA 2PZMA 1RI4A 3EE6A 4HLCA 2FZKA 4B79A 2HQSA 2PT5A 5D7NA 4B6QA 4JX8A 1WQ4A 4HEQA 1IXZA 4JEUA 4ISBA 4M1SA 1KNQA 2J5RA 3A1SA 1QE3A 2EBUA 3NQ41 4J91A 4RC9A 3VU9A 3T1TA 1W0JA 2FPIB 4L57A 1OBHA 4GVPA 3I1JA 1Z0DA 4S0XA 4TXLA 4J16A 4LY9A 1TNDA 1YDGA 4DSUA 1WTAA 1SCUA 1F5NA 3CXUA 4RMIA 1PTJC 1H6DA 1KVQA 4IV8A 4GOOD 3WMFA 3VNSA 1XVVA 1V47A 4X8LA 4M98A 1W87A 2I1WA 1DQYA 2GEBA 3FCCA 4RTSA 1P8AA 1RBZA 3K0CA 3O83A 3OPMA 4FSDA 2GHTA 4H1HA 5C8ZA 5DBFA 4OO3A 4C7JA 2WDPA 2IS2A 2H4WA 5DF1A 5AESA 1UPXA 3SHTA 2WYUA 3WC4A 1HL7A 4FCVA 3ZW9A 2PUDA 2X9VA 1C1XB 2EFJA 2M32A 2JFBA 4HC4A 2OB1A 2VPTA 3DEKA 4AJHA 4IOLA 1ISRA 3GJTA 1W5FA 1KJ9A 1XZAA 5CDTA 4LF7B 1ZUWA 1HYGA 1QPBA 2VIIA 4U7DA 1H0SA 1GZ6A 3AI7A 3KZOA 3VTFA 2CV0A 2E37A 2NU8A 1B0ZA 3CTMA 3M4JA 4M0CA 3T4PA 1L4HA 4H6XA 5IJ0A 1W7AA 1JJVA 5COQA 2FFHA 1T1RA 2ZIEA 3WRXC 3H2ZA 1X7HA 4GC5A 3JW8A 2E6KA 1BXGB 3WBKA 2GYYA 5FBWB 2ODEA 1K0UA 5THXA 1NBME 5C7YA 1R8QA 2FWRA 2H4YA 5FQOA 4GZ5A 3ZJ4A 4EJFA 2VXBA 1YL7A 3NEAA 1QGAA 1SNYA 2PAAA 1NDUA 1O97D 1Z2EA 2A2ZA 1E9AA 1AHHA 3BFJA 3AUFA 4IINA 1LLCA 2Z58A 3FKQA 2ZT8A 1MX3A 4M9CA 4HAOA 5JWHA 2ZRHA 1JG3A 5C5IA 2RI6A 1K9SA 3U7QA 2O8BB 1M6YA 1YASA 5DGDA 2FFJA 1M34A 3HCPA 3PNPA 1OH7A 3OZEA 2I7XA 2IPOA 5EPUA 5A4FS 1WB9A 5BSHA 3IESA 3TOXA 2Y1XA 3HKBB 1NPDA 3ZG6A 1F2TB 3L40A 5ERYA 2XWQA 1IZ7A 1M0SA 1ZGHA 3QHPA 1XZEA 4LY0A 5DT2A 2Z5VA 4D81A 1G8KA 4L4RA 2ZAGA 2WV7A 3P9KA 1FLAA 2MINB 4E2ZA 2HWWA 5LQRA 4HAUA 3KSAC 2AG5A 3IP1A 3QKTA 4XIYA 3RHZA 4F06A 5LUBA 1AH2A 1J1ZA 1XKQA 4RPIA 4HX9A 4JT8A 5KTMA 1VJ0A 3B9BA 3QF4A 4Q4JA 4Q3NA 4HS9A 5CPFA 1M7HA 1WSWA 3NBXX 1EB9A 4KK3A 5FWXA 1A8QA 1Y42X 4G0VA 1GJRA 2PMEA 1SOUA 1ZWLA 4UBMA 1ZJJA 6REQA 2GZ2A 4TWIA 3B36A 1IVYA 3R3ZA 2I6FA 4DCOA 2VDPB 4RXUA 2EDCA 2VLBA 4DN6A 4TVOA 3RC3A 3AGPA 3HXPA 5BUQA 4O2BF 1FNDA 3K70C 1BWSA 2AC4A 2HCFA 3MINA 5KPDA 1U2DC 2F8LA 4PZ9A 4RTLA 2C7VA 3DTVA 4EGSA 2G8NA 3EVGA 3EXEA 2I66A 2PGJA 4G8BA 1NN3A 2A92A 2C78A 1H9BA 2OLKA 3CWCA 2XT0A 3G9QA 2YXBA 2DUJA 1GZVA 2D4AA 5KNCA 3ENVA 3A04A 2IQIA 1XTIA 4KLRA 4HV4A 1Q20A 2VOJA 1ZGBA 4ZEVA 1E1DA 2VPPA 1XZMA 3I9OA 4WE3A 3TRKA 4TL9A 4CFZA 2NU6B 3ROFA 3ITKA 1AUPA 1K6XA 2FSFA 3IGFA 1M74A 3IUNA 4CMKA 3RYTC 5A1JA 1M2NA 1VGQA 1NR5A 3EQ9A 1E1RA 4YJ2B 2NZJA 3L8DA 2Q6TA 2R47A 3RODA 3UJ7A 3ZJYA 3T4XA 2L82A 1EFKA 3HFSA 4RU1A 4MSUA 3RM3A 1QH8B 5G1PA 3F67A 3KXLA 3Q40A 1P9OA 4BGDA 1F8XA 1RYFA 3RI3A 3LXUX 4JQOA 2JLYA 1RAFA 4I36A 2WI8A 1JLMA 2W2KA 1TZKA 3V7NA 3ADKA 4IJQA 1Y5LA 2GAOA 1LI7A 1U5AA 1TQHA 2Q4BA 2QRHA 2WW8A 1QH0A 2BGRA 1S1CA 3PSAA 4AL4A 2F67A 5AFSA 1CB7A 1BH6A 1C9MA 3EQ7A 2PVCA 2A4MA 2GRJA 1ZA2A 2O1XA 3LPCA 2BGNA 5DLDA 5GV7A 5SZIA 3TJMA 2MU1A 2WUDA 3WG9A 1KEUA 2XMBA 1GTL1 1UMDB 1ZC4A 1CIPA 1BE8A 1N3BA 2Q1XA 1HZJA 1BKDR 3E3LA 2B8TA 2ZYIA 4MHOA 1WCWA 4UNQA 4Q3CA 1FK8A 2CLDX 3VPDA 1NR1A 2ORWA 3C3AA 4DLZA 3KQHA 2EFYA 2XYHA 4OGLA 3GAFA 3TZHA 5DGCA 3D81A 1Z7BA 4RZSA 2VYND 1GZ3A 4U9UA 1WULS 1Z3CA 4BRZA 1XD2B 4GWKA 2TSYB 1WB4A 2COKA 3ESZA 2PD6A 4F8JA 2QM3A 3O9ZA 4J1TA 4PNHA 4ZZ1A 5CCXA 1V2GA 2PY6A 1J90A 3IXQA 1EWRA 1FMFA 1NP3A 4EHDA 1P77A 1SQ6A 3QMPA 4WTOA 1YI1A 5EJ6A 1E7MA 3T3NA 4B80A 4QJ3A 4TM7A 4DA8A 2RK3A 3LT2A 4EGAA 4HWPA 4EW3A 4B9AA 5I47A 2D2FA 2EBHX 3IV6A 2FLWA 4R71A 5C7LO 4P1ZA 1F7UA 1EESA 1L6RA 1X1QA 1U5CA 2ZR0A 4OHBA 5EKDA 5KNBH 2DHCA 3ELDA 4WCFA 1UM9A 3OSZA 1I5OA 1TC2A 2HYDA 4AFNA 1P29A 1XWWA 3QKUA 1IZZA 3IQZA 4C4RA 4DV4B 1NUPA 4DC9A 1IZ8A 3F6PA 2JI8A 4QRDA 5E3JA 1TU0A 3ZK8A 1KU0A 4X71A 4KPEC 2AD1A 1J33A 3NBAA 4KUHA 3W8DA 3OOYA 4OFWA 1X0XA 3EPJA 3MQ4A 1UC9A 4QYWA 1BN6A 3S40A 1QHIA 2AI3A 4UC0A 2DPGA 4RMJA 3HGTA 1HORA 1YZHA 3CYFA 3SSMA 3LCVB 3V1LA 2IHKA 5E3HA 4M1KA 4HYYA 1IOLA 4XIIA 5JVDB 4AF6A 4L5AA 5DULA 2R0QC 1I4EB 4BP1A 1C30A 3TR5A 1SPBS 2VL7A 3CNHA 1IC6A 3JSXA 3IR5A 3TFQA 2V7XA 2X1HA 4C03A 1SU7A 1Z5NA 2CMKA 3BE5A 5BW5A 2PBFA 1EWVA 5KTKA 1OLSA 2C95A 1EP2B 2HGSA 3JATA 3O95A 2RH5A 4WBSA 5DLEA 4ATNA 1ST2A 3TFOA 1J21A 1ECBA 1LPPA 2PKXA 3K0EA 1XC7A 3KOOA 3ZV5A 2JLUA 1UH5A 2P8SA 3L9WA 3ZXIA 4ZJUA 5JBNA 5REQB 1P9LA 2JFXA 2HQRA 1PEKE 3U48A 3CUWA 4DCJA 1EFUA 4BQEA 4CF7A 4ZAVA 4UD2A 1U8CB 3WZ2A 2M1XA 1NW9B 2KBEA 1H9AA 4BNIA 4G26A 1O4WA 3FUWA 4UUPA 1K4KA 5LKAA 1S7CA 3QVUA 4HAVA 2XVZA 3C3XA 3RYCB 1IN1A 1X38A 4WZBE 5FRDA 3PNKA 3TW8B 3DKKA 4ZTZB 2GMWA 3WAGA 1T43A 1Z37A 4FFRA 1JDTA 4ZDJA 2TECE 5B3JA 1Y9JA 5TV2A 3SE7A 5J1TB 2CL5A 4GKBA 2IOFK 2C54A 4JJ4A 1A8UA 1KRHA 1B74A 4N47A 2MYTA 4N6GA 3VC2A 3ZGOA 5A6SB 4YCJA 3ZDYB 1R4MB 4EI2A 1Q3TA 5G4KA 1G6OA 2GBFA 3GFOA 3GHYA 4LGCA 5LQDA 1L9KA 1XNHA 2HBRA 2CBZA 1E9FA 2D8AA 2VATA 4OAOA 3WLSA 3HXOA 5AVOA 5HCIA 1TYZA 1Z4OA 4H0NA 1P7VA 1SKBA 2AC7A 3ZDCA 3N6XA 2XUDA 4NBNA 3EYAA 1E3DA 4GR9A 1BDMA 1D2EA 1M2FA 1PWYE 2IH2A 1N0VC 2ETVA 3OM8A 5DTIA 2XAUA 2ODAA 2PJZA 3N5KA 1WU8A 3IX7A 3AVYA 2ZT6A 1GITA 4FQ7A 1FFSA 2LRHA 2QVCA 4JP2A 3TMYA 4D96A 3NT2A 4GM1A 1DVRA 3CR7A 2J3KA 4D92A 1HQKA 1O4VA 2JAUA 3KD2A 1NXOA 3KQOA 1G8HA 2R6DA 3OZXA 1WIWA 5EPEA 5TB5A 4EG3A 3AHIA 1FP4B 3HBLA 3KOUA 4HATA 4BCBA 4ESOA 3O1JC 2YN4A 3H83A 3IQIX 5BYAA 2JCXA 1VJ1A 3KB6A 1ZK3A 5BXQC 1ARZA 4WSOA 2RH8A 3NHFA 1WXHA 3TRJA 3W90A 3HM9A 3F9CA 2RHMA 3JWHA 5C3UA 4EHBA 5A62A 3ACBA 4Q4LA 4L08A 2QAIA 2UVQA 3DW3X 2EJBA 2TMKA 3DO8A 1XD2A 3ERCA 2NU8B 3H6HA 4FIDA 3DL2A 1TO2E 2ZE5A 2F1OA 2UYYA 3FPFA 2PV0A 4JH0A 2OD2A 2WFZA 2FGJA 4U6QA 5A2GA 2WKPA 2C2WA 2ZJ3A 3WTBA 2OCBA 3PX2A 4K0RA 3AVVA 3TXXA 4JELA 3ZU2A 1V0JA 5SICE 3CCBA 3SYNA 1YFLA 1SG9A 2A35A 1QDUA 4RZHA 2ZBGA 5TE9A 3SKXA 4BFXA 5IEJA 1R9MA 1USKA 3VR1A 4I4TB 5AI6A 1O0CA 1UBRS 5FOQA 3LSYA 4DGQA 2JIDA 3PWSA 3NHKA 3TJRA 3VNAA 4DEYA 1QG6A 4H3HB 3B52X 1P7ZA 4FONA 1V7QA 4A03A 4REOA 3DE0X 4WNAB 4J9VA 2VVTA 1LU9A 2B8EA 4R9NA 5HUHA 1G5PA 2ZI7A 1YRBA 3E82A 5DXAA 2Y1EA 3O4JA 2EV9A 1QQBA 3PT9A 4GBGA 4OL0A 1NQWA 1SB9A 5B53A 4MI9A 3RGGA 4Y2YA 3UENA 2ZROA 4QU0A 2G82A 5AKIA 1YQTA 2WJJA 3A4LA 4EPWA 5B12A 4Z4HA 3HFGA 2WICA 3DMTA 2CDAA 3FMVA 3NIBA 3U09A 2Q5QA 2MINA 2B6HA 2VDWB 1B16A 3K0CC 1C3OA 2WE7A 1EQ2A 3HU3A 4V24A 4YNBA 3UJCA 2CV2A 5TGZA 3E3AA 4O33A 3GO4A 1HFWA 2CFSA 1VKHA 4QOEA 5HKLA 3TD9A 3WGUA 1KA9H 4OBBA 1NVWQ 4CIXA 4JBHA 3GLGA 2E5FA 3UOWA 1VQ1A 2QAGC 3NETA 3PNQA 3UUFA 1FFGA 4HXEB 3IRVA 4GO1A 4HO1X 2C9BA 1Y3CE 1QRRA 3EFOB 3FPHA 1D8TA 5K3FA 1OWNA 3H5RA 3A9CA 4C1BA 4XVHA 1WBDA 3ONFA 1UPAA 1WDKA 1O54A 4OQQA 1UKVY 5JI2E 5AW3A 3CINA 4E5SA 5HK9A 1UKBA 2GA9A 3OOEA 1DZ3A 1MZVA 3NLLA 3NNNA 3BWYA 2IYUA 1P60A 4MDEA 1NVUQ 1M6NA 3VKWA 5J2UF 4LC1A 1R74A 5BSRA 3UWKA 2DY0A 3IEVA 3ZS9A 1RJDA 4R4JA 2OY0A 3RS8A 2HA0A 1K27A 3LNTA 1UPUA 4CETA 2I91A 3ENKA 1CDEA 4AK9A 4BNHA 3SQNA 1A7KA 4XZ3A 3EOZA 4OLBA 2FEAA 1RM4A 5CIYA 3UKDA 2GUGA 1AUVA 2ZWOA 2BGGA 3R8FA 3VKHA 2WF7A 5J40A 2AE2A 2Y1FA 3R5FA 2QIOA 1TFRA 3IH5A 1I0ZA 2QD2A 2NQ2C 3MRXA 1QHHB 4JBGA 4TV9A 3RVJA 5KJFA 3UWOA 2NQ8A 3WAJA 4A10A 4LF9B 1GPBA 1LW7A 3LY9A 3UGQA 2CLSA 2YJ6A 3MBOA 1OQAA 1FDRA 3OE1A 3OM9A 3QF7A 1TYBE 3DFKA 4NBUA 5AK5A 3VYVA 3AHGA 3I6MA 5FR1A 3N6VA 1EE1A 1ACJA 1IEXA 1Z4PX 2ZSDA 3D8HA 3G88A 4UM5A 2YL2A 3U5ZB 1N4DA 3K9HA 4P3YA 4E2FA 3VH1A 1JVBA 4WXHA 3ELBA 5IP5A 1RXSA 5ED0A 1A5BB 5TY0A 5G0TA 1U04A 4Z8YA 5E7QA 2FG5A 1HWYA 1KK0A 1RSZA 3I72A 3LKZA 2QX4A 4K6CA 3VR6H 2HCRA 4C5BA 4E07A 1DUVG 3SZ3A 1TEHA 2HSEA 4IGIA 1K75A 1VP3A 3PDHA 2BM9A 1SQ0A 4PZAA 4UTXA 5A03A 1Z5PA 4M1OA 3T9DA 1L4NA 3EEBA 1Z06A 5CTAA 4DLNA 4IP0A 4NMMA 3UJ3X 1V1MB 2W00A 3A05A 2Z98A 1UAAA 2AZXA 4TL8A 2Q1TA 4ZRMA 4D9IA 3DZ8A 2VHCA 3ETHA 3H2YA 4OP2A 1T10A 2UUAB 2XCTB 2QVXX 4AB1A 1Y6FA 3HDTA 3QYPA 5CB4F 5D00A 1VCOA 1TEZA 1U8ZA 4KEAA 5GWXA 2BKVA 4OAPA 1J2TA 3TQQA 4IYRA 2NYUA 5L3VA 4DXAA 3U1BA 3NHUA 4LJ9A 2OO5C 2RE8A 3ICQB 3IAEA 4WUTA 3N8DA 4EFNA 1BA2A 2XIJA 3ZVNA 1APBA 4L85A 1DADA 1GUYA 3V48A 1M8JA 2RDMA 1Z75A 2VQ3A 4MULA 3ZLVA 4HLQB 1Q2XA 4EHLA 2G1PA 1A3CA 1XA0A 1UM9B 1FYWA 3RBZA 2Q6LA 3JZAA 3NT4A 5GOTA 3NDRA 1E0DA 1OPXA 1UBCA 1EM6A 1NF8A 3K2EA 2WM2A 3OPVA 3R20A 1W35A 3Q6MA 5B7GA 3AF6A 3KXKA 1XO1A 1XRSB 3IQXA 3O2SB 3SXPA 2PKCA 2RJ3A 1NSYA 5JYDA 3GROA 2YMLA 4V02A 4WY2A 2CYCA 4CL3A 2JJYA 4CKBA 2R9VA 4UTRA 5I7VA 5J4YA 1N25A 1BXKA 2J59A 3CT4A 4IGKA 2YJ5A 3K70B 3IOCA 1IWOA 1PHRA 1OAOC 2QM8A 3Q7SA 1MO4A 1WUKS 5DBHX 2XX3A 5I48A 2C42A 2MWMA 1BH2A 1PUJA 2QTHA 1WHSB 3IQFA 3EVCA 4UXIA 4Y0NA 3ZCQA 5ULLA 3DDOA 2QQEA 1GRQA 3UM9A 1AA6A 4QQKA 2FWJA 1KMQA 1S89A 1PNVA 2CUKA 4ZAYA 4XW2A 3VSDA 4EPXA 1QR2A 2J8ZA 2P1RA 4ZYVA 1CJVC 1NWHA 2DPYA 3KZMA 3T7RA 4N5DA 1EE9A 5L3QB 4U2FA 1V3QE 3RAEC 1WZ2A 3L6EA 4PRKA 5ITWA 3I1IA 1E4OA 2AJ8A 3B2QA 1A4UA 5CEJA 2PBZA 1NOJA 3TX2A 2IGTA 2QUKA 3FZYA 1KSGA 2ZSIA 4G1EB 4DMUB 4YQEA 3DOUA 5HM8A 5IUNC 5EZSA 1OHHD 1Q11A 3P2JA 5IFKA 5HG0A 3CMMA 1ZINA 5CR9A 2QDKA 3JTMA 3LVFO 4OXIA 4RKRA 2EP8A 1Q0SA 2WK1A 3MG9A 1P7WA 2A5LA 3MIZA 1Y9EA 1CJUC 2OCAA 4RZ3A 3GCXA 4XGIA 3N0WA 3AC0A 3CRQA 3F3MA 3ZOZA 1CS0B 1ZR2A 3M8KA 4Y6QA 1IL0A 2BDEA 4Y7CA 1EUCA 4AY2A 1O6GA 3QKWA 4LYEA 3TZQA 1EK2A 2HU2A 2WSSA 3UB2A 3UYLA 1N7JA 5F2KA 3TECE 4QASA 1DFGA 1G1MA 2VDKB 3BUSA 4P4NA 2QAGA 3PQ4A 1VL6A 4C4AA 5JQWA 1ORDA 9GPBA 2VJLA 4JNCA 3G8BA 4B7UA 4G25A 2P41A 4B17A 4JL8A 4MVJE 2PRJA 4ZI5A 5LWHA 1HG1A 5KSWB 4ZOCA 5KHLB 1M73E 4OF4A 4C30A 1JIKA 2BHSA 3IVMA 4XYEA 4CQMA 3DE1X 1H2RS 1NA5A 4JLDA 4JR0A 3VPGA 1ULUA 1YE5A 1JYEA 2ZRPA 1KYZA 1VLMA 3JSAA 2IXFA 1U7TA 1S7GA 1I14A 4EZBA 3IUJA 1TUBB 3OQHA 5JSUA 3O75A 1R9NA 1O9HA 5IJXA 2F90A 4BEWA 5LXTA 3BMQB 3DF7A 3DZGA 4E1BA 3ND5A 2CNWD 1I6WA 2W2VA 3NM4A 2HU7A 2OCGA 4I5DA 2JH3A 2ZIXA 1TJYA 1VBNA 1XVUA 1XZBA 3NHJA 2C2HA 3OFND 4KIWA 1K4MA 2GWRA 5DYNA 5EL0A 4YLYA 5AVTA 1A1VA 3MTGA 2D1RA 2VYNA 2CXHA 1XLTC 3I32A 3BGVA 2BM1A 3JVVA 1OFIA 1N0WA 1T6XA 4BV2A 1C5KA 2P5UA 1VE3A 3VDXA 4Z1OA 3E9DA 2O4CA 5KTNA 2DFDA 5LOVB 1C8LA 1JFTA 4WVLA 3RVRA 4U7PB 4YRJA 4A5SA 1ZJ5A 4J49A 3W6ZA 4YPFA 5T4HA 5I3CA 2H1WA 4PY2A 2HMWA 1PJBA 2ON6A 4IF4A 3AEUB 5DBOA 4ZU1X 4BYGA 3VYWA 2VH5R 1PR4A 1XBTA 2BV3A 2OD7A 5FPQA 3WICA 4D4GA 2QL6A 1DV1A 4P38A 4DC1A 1N2SA 4M46A 5AVQA 4ZTBA 3V8RA 2TS1A 4RSHA 1R9JA 5TPZA 3O1IC 3W1WA 1S2DA 1U8YA 4KXQA 1RMTA 1XRJA 5FB3A 4MKZA 4PFQA 1EFVB 4DIEA 4CEJA 2AR9A 4W5OA 4UVEA 2XCUA 3IMEA 3PA6A 1KYXA 4KIUA 4PTZA 4R2HA 2AK2A 3ZGXA 2PE5A 1XEWX 10MHA 2VXCA 2VDQB 2Q5HA 5KYXB 1LDMA 1TK9A 1CUWA 2Z57A 4EUKA 4BQIA 2YJTD 3RIXA 4ZO6A 1N8SA 3V4OA 3VDRA 5G2OA 3TLGA 2FA9A 5BWMA 2JLZA 2OGUA 2GM5A 4R1OA 5H82A 3U3DA 1HXHA 1XVIA 4FZ5A 1YU6A 1W5BA 2Q0SA 3E2MA 4AIRA 4PAOA 4C6TB 3PKIA 4EFLA 3R9XB 3PQEA 4HNUA 4DYVA 4J7UA 2WTAA 4PZUA 2IITA 4IMJB 1OZGA 1I3OA 1XJQA 1JJAA 1K06A 4KO2S 3WGNA 2R6R1 1R8SA 5AOVA 1U3UA 2I3ZA 2VTBB 1XSEA 1P19A 4DDMA 1XLVA 3R9IA 4MW7A 2RGRA 3HBNA 1GD1O 2CL0X 2ZUCA 3IBFA 2HF2A 4JLWA 1ZN7A 3T61A 4RVOA 3EIWA 3P9NA 3ZLJA 3DZJA 2CT8A 1OTHA 2I2DA 1RJFA 5HCUA 4WLVA 1S1MA 1U0JA 2ZBRA 3NCHA 3O8DA 4BV8A 3M1LA 3PEFA 2I2WA 4OLFA 1RQ7A 1YAHA 4HDCA 2XKKA 3ZE2B 1W36C 1KKMA 2DPLA 3AKDA 4IZOA 4JI0B 2ZJ6A 3HJNA 2GD1O 5AXDA 3KXIA 5G3ZA 4J0CA 2A9OA 5HKAA 1R10A 2G9VA 5KYTA 3NEPX 1TM2A 1BX0A 1W85A 4MQ6A 2FHPA 5ALGA 3RUDA 2PRIA 4DCTA 2ZULA 2V54A 4G3XA 4KR2A 1E89A 3DOCA 2IV7A 2AQIA 2WFLB 2A57A 2QXTA 2OV2A 1QJ4A 2NO4A 2PUWA 2QTCA 4U2CA 3RJMA 3VU9B 2E4XA 3KQPA 3KKLA 1FS5A 2A5YB 4ER7A 3FFBA 1NC3A 4Y1GA 1D9XA 2B82A 3UG7A 5JWOA 5KTYA 4V0KA 1AUXA 2RHCA 3EGXA 4M9UA 1W75A 5T3UA 2OP1A 2RGDA 2QT1A 3K4HA 1V45E 4CIBA 4N0QA 3VTZA 2PUTA 1FUKA 1R4NA 1RM3A 1PGPA 4HK4A 4X94A 4CKEA 4QPZA 1GRRA 3EY9A 2OSVA 3HBJA 3RV3A 3TIXB 5ADVA 3B7GA 2RMKA 3KLBA 1KPIA 3O1LA 5ER6A 3B78A 4PLHA 1YR2A 2W2NA 1SKMA 1ISFA 1IHOA 3WX0A 1KOLA 3SN6A 1C0LA 2BUCA 5EUBA 3R0QA 3MUFA 3WIBA 4YRBA 1ZOPA 1UPTA 6LDHA 4DBLE 3ZVKA 4NL4H 1NLYA 3OOHA 1XRMA 1HNNA 3QXGA 3ZZTA 1LDNA 1LY1A 1OREA 3TZKA 3B1FA 1KEVA 4R5HA 3SZGA 5K3EA 1TM3E 4TL7A 1AC5A 1CUZA 1P4HA 3QITA 5LA6F 4PC3A 5LBIA 2XWBF 1QGOA 1AZSC 1JIJA 4W7HA 1I7DA 2J4FA 4BRSA 1CTQA 2GESA 3RFTA 3OAAA 1JDNA 1EDZA 5CHEA 3WO0A 1GA1A 1M75A 1JUDA 4DWWA 1AHNA 1M1YE 3L77A 1A8PA 3WMGA 3IO5A 4DXDA 4E09A 5CBPB 1T0PA 1WF3A 4JI1B 1DQZA 4ZQBA 5K0BA 1OIWA 3BMQA 3HYNA 4LIPD 3JYNA 2IELA 3KB8A 5F98A 3PIIA 2GERA 3H1GA 4LJLA 1DQRA 2WZBA 2HSJA 4Y9DA 5FLYA 3WWPA 1CPYA 3JYOA 5K09A 5KKCA 2JLWA 1GRVA 2UZ3A 1VE7A 3A0UA 3EH1A 3ILSA 3W9BA 1YKSA 3K31A 1ESCA 2XMRA 3UB4A 2WWGA 2X4IA 5JS6A 2ATIA 3F5FA 4D6XA 1LD3A 1OGIA 5AM2A 1Y8QA 2ZSUA 3FZNA 3NTLA 4N8SA 5FADA 3UPTA 4JKYA 5EERA 1TZMA 1JPJA 3L1VA 3LWBA 5DEOA 4C0KA 2J48A 4I50A 3IVCA 4RS3A 1G3MA 5H9VA 1C0EA 2B20A 3VR3D 3ZVLA 5BN4A 4RPCA 3MM4A 4JIGA 3D6UA 2QRVB 2AG6A 4PFSA 5LBUA 4RM2A 3VFDA 1ONPA 1YRYE 1KVSA 1NJFA 4KR3A 1MQ9A 3ZIAA 3QEMA 1USVA 3MHPA 1JDZA 4MJLA 4KOEC 3SDBA 3ZZ1A 1QYXA 1H4SA 4KVGA 3GJYA 1IZYA 1EJ6A 4IDNA 3S2IA 4D0GA 4DQVA 3W5HA 3KCQA 1CXZA 2X0DA 2WP8J 4FYVA 1M66A 4MGZR 3GLIA 4DMRA 2VHWA 1THMA 2IE0A 3C4VA 4L5BA 3CT6A 1I4OA 1DXHA 3TM5A 4L7QA 1VPVA 4AP9A 2ZUBA 1QC5A 3CEAA 4HT3B 4LYHA 5F3WB 2ADMA 4FS3A 2AK3A 2ZFUA 1ODCA 3COZA 4IXWA 4NCHA 4BZZA 4FR5A 1DHTA 4LQCA 2HQ1A 4C04A 4ON9A 1TMKA 3P2EA 1Y1PA 2D2EA 1C1HA 3H5NA 2IF0A 3H0EA 5DHQA 1KMHA 4AROA 2GKGA 4NICA 3MJ4A 2L0XA 3DSRA 5ALHA 3HI6A 1JG1A 3EG9B 4HRXA 4P5PA 1GLNA 1JS1X 1RACA 2EWVA 1U1CA 4NAUA 1I3MA 4PVDA 3HJRA 4H7DA 4KMRA 2AA3A 4YAKA 2FUG1 1K3FA 2ZQ5A 1UMCA 1FL9A 1X9HA 1QGUA 2HRDA 5AKXA 5CG2A 4BMXA 4FFMA 4ZDIA 5BPHA 1C9NA 2FKAA 4ZYUA 1LBHA 3ZDBA 4IH4A 1PQYA 1CRWG 3CEJA 4M7PA 1GQFA 4W1PA 5DMXA 5DO9A 4QODA 2ZWAA 3OT5A 1XTZA 5K1ZA 1YTUA 1FQKA 3IV7A 3T1QA 2Y1OA 5HEKA 1C7ZA 3EIXA 5B2ZA 1G3IA 1QUFA 1US8B 4ZMSA 1Q77A 3EZXA 1RHKA 4HN9A 5AYVA 3WGHA 3RAFC 4V3CA 1DZIA 2R1TB 2CMDA 2RIPA 4ZVQA 1UK6A 1LKZA 4OLHA 3UAOA 2NV2B 3I04A 4O25A 4FVTA 4F5ZA 5JC1A 3A3OA 1OXBB 2QNBA 3TK1A 3FHTA 3L2OB 5FA5A 4C76A 3U4MA 3O4VA 1FNCA 3HCOA 3L0DA 2A33A 1U0OC 4AVYA 5A4MS 3TPFA 1CEQA 5CFOA 2O3SA 3EPHA 3GGGA 2R7MA 3SC2B 2O2CA 1WL8A 2FPGB 4Z0HO 1PK9A 3A1VA 5BYKA 4TYNA 1GAXA 1HQCA 3BRQA 5JSYA 2DR2A 3AF2A 3G2NA 1B14A 5FI1B 1ZSNA 1PEDA 2I3AA 4GOJA 5DP2A 3ZXSA 1OB2A 1ZH4A 1UOOA 2WYOA 4KZKA 4P4GA 2PX6A 5FOXA 1JIXA 2VJYA 3KEQA 5DGXA 1MC5A 4QDJA 4GX1A 3PCTA 1DXYA 3M6XA 2IWHA 2O1EA 3UBMA 1X7DA 1M8FA 2GF2A 4NX2A 3WLOA 3QUBA 1PX2A 2W90A 1K8ZB 4UUAA 1OFGA 1TEXA 4MP3A 1P6QA 2VSFA 1SXJE 1NQUA 2VJOA 1T4DA 2GAFA 2I87A 4JENA 2X6RA 4PINA 4I8XA 3ZNQA 1L9XA 2WM3A 2QZ4A 2DMRA 2H9IA 2OBBA 4ARUA 3H17A 4PC7A 2G76A 1Y37A 3BE8A 1ZXXA 2P5TB 3NASA 3TR6A 1TK2A 2I4RA 1Y1TA 3D3QA 4FX2A 4DRXB 2O8DB 3HXMA 3LYHA 4KFUA 4FUQA 2I7CA 3U7RA 2QI9F 4PGMA 2J0UA 4IRXA 4JOSA 1E9VA 5AKYA 1MHTA 1UBKS 2N46A 1KGSA 2GJAA 3GIDA 3H3FA 3OIWA 4O2LA 1TVMA 4RPGA 5A5VA 3DHYA 4QPDA 1BEUB 2QN3A 2WIBA 2FX2A 4OP3A 3W5BA 4WWHA 2JCGA 1GLGA 2ATVA 1B6SA 4DLUA 4R3UC 2HA4A 1OWMA 3KYJB 2XMZA 5L95A 3QKRA 2CDBA 8AT1A 1X87A 5HDBB 2V9PA 3OP4A 5DW3A 4D3DA 4QOSA 2I29A 4IV0A 1SUSA 2IEAA 4Z49A 1BKYA 3LV8A 2H52A 1DOHA 6AT1A 1X1CA 4M22A 3OQMA 4CGZA 3CUSA 3TKLA 4FHEA 3KVYA 3OLWA 1I30A 4DM3A 3NZEA 1YMVA 1PJQA 3SEFA 4DV5B 4GP7A 1N2JA 2BEUB 4HH4A 2EEPA 3DHWC 3T5BA 3HPQA 2IYXA 1M72A 2GGSA 1FPQA 3AM4A 4NU8X 4D57A 1Z7EA 5CYGA 2J7KA 2JI9A 3A8TA 2IYWA 3FRJA 4LSWA 3K0AB 1J2EA 4K9PA 4BIIA 3L18A 1Y7PA 1ZNYA 1DX9A 7ABPA 4J3FA 2BIFA 4N0MA 4OGFA 4COOA 2CNNA 2PXHA 2W2TA 4OFXA 1PFGA 3S8MA 3KOXA 1PFYA 3B85A 1UWLA 3VC3A 3WL8A 1T24A 3IAAA 1PO7A 4J6FA 1VHWA 4KFTA 4F8EA 3DLHA 4HWSA 4XFJA 3H5AA 4B87A 3V3TA 1CUUA 1DAGA 1K2WA 1LSUA 1JMVA 1Q22A 2IDJA 4PPNA 2OHVA 1S3IA 4CUZA 3WL5A 5HW0A 2FSHA 2HRZA 3VH2A 3DT8A 4OIMA 4BJ6A 4REMA 3WLRA 1N9ZA 2ZBUA 1A8SA 1X7WB 3HLYA 3NOOA 1YK0A 2ABWA 2OAQ1 3TL2A 4IKEA 3D2AA 3OX3A 2IW1A 2GXSA 1UF9A 4RTNA 1GZSA 3EC1A 3VM6A 4BTEA 1TAUA 3MWDA 1XQXA 5AM4A 2VOEA 1QGUB 1JLHA 1SHZA 3K7EA 4L6IA 1MJGM 1YI0A 3E61A 3EIFA 4PLPA 4X92A 4K3VA 3ZU3A 4EKYA 5HOQA 2IP1A 2VK4A 4G84A 2IDMA 2HZ7A 2PZJA 3RC7A 5IT0A 1ISSA 1FF9A 3I09A 2H2WA 1FTNA 1YJBA 3GJ7A 4PV7A 4B6PA 3O8QB 1EGQA 4LHVA 2E18A 4AJ2A 2IX9A 1MVOA 3FCSB 5EWMA 5B1SA 4YT2A 2BTEA 3R8CA 2NP6A 5EWLA 1Z6PA 1JLSA 1F9EA 1ULTA 1XCLA 1MABA 3KV3O 2DE0X 4R9UC 4MQ5A 3ZHOA 2RC5A 5JZSA 3D6MA 1G7CA 1E0SA 2R8RA 4GI2A 1XOIA 1EDDA 2BSAA 2HPHA 1CKEA 3SCZA 3TIIA 3AR7A 3V00A 3WJ7A 3RS5A 1R5OA 1AKWA 1KMCA 1NE2A 2EBFX 3CVJA 3MWYW 1QKIA 4E32A 3QV1A 1BCSB 2Y1KA 4IDBA 4BX3A 5JLJA 3MGAA 1CY1A 4UBLA 4DWJA 3CBQA 2GS9A 4TS4A 3RR2A 1NXWA 3ADOA 3MBKA 3SJZA 3QUSA 2DQSA 1N0UA 1X1RA 1BGXT 4HQ0A 3T3HA 3VV2A 1MIHA 4AJEA 5GAJA 2BE9A 4D8YA 1ZRNA 3PR1A 1RKXA 4YRQA 2EWMA 4WY5A 4MKGA 1Z5UA 2BISA 2ZIWB 2W2LA 3KJZA 3UIEA 3ZE0B 1SRRA 4W5NA 3QTLA 2ECQA 4HPWA 3U7QB 4BV3A 2O8BA 5JNVA 1R37A 5AVZA 1FRVA 5JUWA 1KZ4A 3E7FA 5BVHB 3BH0A 4D6PA 2CDCA 3PDIA 3QLVA 4RDXA 2ALJA 2HREA 2QTBA 5DNWA 1TCVA 4MRRA 1RC0A 5DM1A 1SKUA 5CB8A 5A9RA 4N5HX 5D01A 4EGFA 5FV4A 4M6WB 1X7XB 4DLTA 1KNXA 4E88A 5EMHA 2AXPA 4NU6A 1GPNA 3DKVA 4OL9A 2V97A 3ISVA 4J7CA 5GM1A 4YO7A 3ZBQA 4YS6A 3PHIA 4RGBA 3D6VA 4Q66C 4RVFA 1ECPA 1RWPA 2DPHA 2QPLA 3WYBA 3VXKA 3C24A 3FPGA 3MVEA 4PS1A 3IP7A 1GKUB 5JHGB 1B0UA 3RT1A 5CD1A 1W6UA 1QCZA 3W2EA 1KY2A 2PQMA 2XKBA 1HDZA 2NSDA 1C0PA 3UMFA 5C4GB 2GAJA 2C8KA 1VHLA 2H3EA 1Y6RA 4M7WA 2PO7A 1QTQA 4YHHB 2VUHB 1RIIA 1VLVA 4BFTA 1SIOA 3T3OA 1A7AA 1BVRA 1A04A 1OXMA 1RLIA 3H1PA 1O6BA 2V45A 1EPUA 3MINB 1S02A 1WP9A 1II8B 2OBFA 3WB1A 4BMDA 3IE0A 3ZCSA 5A4AA 5CLIA 4ZU6X 4DPKA 5JRDS 2A67A 1XYVA 1RAAA 3IB6A 4C0HA 4CDMA 1QORA 2XUHA 1NGSA 2IQ5A 3VUEA 3NHRA 4XWGA 4B8WA 4EG5A 4D26A 3LYAA 3NBFA 1ZR4A 2JI4A 4UXJA 2OLJA 1Y1RA 2ZBFA 2ZUEA 3EODA 2ESRA 5CCDA 1FDVA 4QAQA 4CG2A 1W8IA 1BWQA 3Q9SA 3GVIA 3NWPA 4D3SA 3OU6A 1IIRA 5BVGA 3WA7A 1BS2A 2IUEA 4MVJF 1YDHA 2OUKA 1UIMA 1W47A 4GE0A 2W70A 3ONNA 3SSOA 4H0CA 2CFTA 4QIHA 3WMXA 2IY9A 4WAUA 5KNDA 2Q50A 4KQMA 2EGGA 3FD8A 4XX1A 1IZ9A 3L06A 4O2AA 5JATA 2H7XA 2G09A 5ALNA 2PUFA 4QG3A 1DT3A 3UXMA 4A0QA 1KJWA 2F1RA 2R60A 1TF7A 3FR7A 4GBJA 4QXPA 1ZJYA 4BZQA 4EO7A 4NHEA 5IT5A 5IXJA 3RTGA 5COAA 4H1UA 1YOBA 2G67A 2VQFB 2BJHA 7GPBA 4OBXA 1QTRA 2NNLD 3OEEA 4I2VA 4MI6A 2BBTA 1ZCAA 5D86A 5DVZA 2V58A 3REQB 5IKMA 3DC2A 3UGTA 3R0JA 2OILA 2ZGVA 5FL3A 4PAQA 3V4LA 2IHVA 4QOJA 1EFLA 3AUUA 2V59A 2BELA 3IQEA 1Q44A 2H51A 2PD4A 2YJ4A 4WN9B 3SVTA 1X2EA 1WY7A 2ZI5A 1FTQA 2ZBDA 2PQ0A 3MGCA 1ABFA 1C8VB 3AVUA 4UTZA 1IK4A 2J87A 3KDSE 4BB9A 4QXAA 3ZJ5A 1FJGB 3CX3A 4J0IA 2Z30A 2PKRA 3Q3EA 5E9AA