The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
63
|
sequence length |
179
|
structure length |
179
|
Chain Sequence |
GFLTEVGEARQGTQQDEVIIAVGPAFGLAQTVNIVGIPHKSILREVIAGIEEEGIKARVIRCFKSSDVAFVAVEGNRLSGSGISIGIQSKGTTVIHQQGLPPLSNLELFPQAPLLTLETYRQIGKNAARYAKRESPQPVPTLNDQMARPKYQAKSAILHIKETKYVVTGKNPQELRVAL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
Diol dehydrase alpha subunit
|
publication title |
Redesign of coenzyme B(12) dependent diol dehydratase to be resistant to the mechanism-based inactivation by glycerol and act on longer chain 1,2-diols
pubmed doi rcsb |
source organism |
Klebsiella oxytoca
|
molecule tags |
Lyase
|
total genus |
63
|
structure length |
179
|
sequence length |
179
|
chains with identical sequence |
E
|
ec nomenclature |
ec
4.2.1.28: Propanediol dehydratase. |
pdb deposition date | 2011-02-07 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
B | PF02288 | Dehydratase_MU | Dehydratase medium subunit |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | B12-dependent dehydatase associated subunit |