3AUJB

Structure of diol dehydratase complexed with glycerol
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
179
structure length
179
Chain Sequence
b'GFLTEVGEARQGTQQDEVIIAVGPAFGLAQTVNIVGIPHKSILREVIAGIEEEGIKARVIRCFKSSDVAFVAVEGNRLSGSGISIGIQSKGTTVIHQQGLPPLSNLELFPQAPLLTLETYRQIGKNAARYAKRESPQPVPTLNDQMARPKYQAKSAILHIKETKYVVTGKNPQELRVAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Diol dehydrase alpha subunit
publication title Redesign of coenzyme B(12) dependent diol dehydratase to be resistant to the mechanism-based inactivation by glycerol and act on longer chain 1,2-diols
pubmed doi rcsb
source organism Klebsiella oxytoca
molecule tags Lyase
total genus 63
structure length 179
sequence length 179
chains with identical sequence E
ec nomenclature ec 4.2.1.28: Propanediol dehydratase.
pdb deposition date 2011-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02288 Dehydratase_MU Dehydratase medium subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 3aujB00
1IWBB 1EEXB 3BRCA 1DIOB 1UC5B 3AUJB 3WB0A 2D0OB 3WB2A 1EGVB 1NBWB 5D5QA 1UC4B 1MMFB 3WB1A 1EGMB 2D0PB 5D5PA 1IWPB
chains in the Genus database with same CATH superfamily
5BYAA 3OQMA 2C2XA 4OPMA 3B2EA 3CTPA 3O8OB 5B36A 4K9SA 4TM8A 3P9PA 2VRNA 2VOEA 5DHFA 5ALRA 3DOUA 3Q3CA 2ZUBA 3ZKWA 4BNFA 3H6KA 1AZSC 1DAOA 3EUEA 2DFDA 4AF8A 3U7EB 3WYEA 1C8VB 2H2HA 3COZA 3S5JA 4CI9A 2FPWA 4YAGA 4YDQA 2G1JA 3GLFB 4JXXA 1I3OA 1P1CA 3D4LA 3T4UA 1Y6RA 2X8BA 3G5LA 2CHVA 2GD0A 4Q9NA 5F35A 3C4JA 5LC1A 1N5RA 4Q18A 1Z16A 4EJ2A 3GW8A 4PZCA 3RVRA 2SHKA 4PICA 1G5RA 1EVIA 4Y9SA 3P9YA 3S4YA 2I62A 2Q5LA 2XH8A 2GPYA 3UAZA 4ALJA 1MJ5A 2FPLA 4ZTZB 2QTLA 4DNOA 4DA6A 2FSVC 2HK8A 2JLCA 4IZIA 4JR0A 1OH5A 1G6KA 3FYCA 3ZI0A 5LOVA 1OZHA 1WKCA 3DEJA 2GI4A 4KSYA 1LBQA 1UXOA 2E9SA 3SR3A 4A2QA 3BBPA 4UEQA 5J4YA 4WW0A 4MVJA 2VUIB 4B44A 3DFMA 5I7HA 3UW1A 2XMGA 2MR5A 2XEXA 3V9PA 1DIBA 3TF5A 1TDJA 2IIVA 4N3NA 3ZY6A 3TI9A 1PLKA 4QFCA 3STUA 4TMKA 4IICA 4G0QA 1NQOA 5JNSA 1NW9B 3HO8A 1KSGA 3AR5A 4BKRA 1BWQA 2QQFA 1Z22A 4E70A 3AMVA 1N2GA 3E3NA 3K8YA 4JC4A 1FXUA 4C7MA 2P41A 3DD5A 2VHTA 5HZGA 4W7IA 5IU6A 4F7DA 3TJMA 1OXXK 4JLMA 1CY4A 3FUXA 3TLEA 4X1IB 2ZSFA 3M4NA 3PNKA 4G0OA 1OLXA 1UKVY 1XBTA 4LF9B 1FZTA 3BZUA 2DFVA 5JMOA 3WLIA 3OQBA 4BLSA 3IKMB 2ST1A 4KG7A 3VVCA 2XQGA 1CUVA 2XUQA 5A9RA 1T2NA 1TECE 1ZVJA 4OOFA 3BH7A 5DNAA 1E4EB 2A7XA 2IPAB 1SWWA 1R0KA 1MX3A 3KUCA 4MRNA 5JCPA 5KVVA 4JP5A 3AFMA 3DLIA 2FRDC 3IOCA 1U81A 3ISJA 2ZT8A 1YS2X 4FILA 2QVZX 2WLTA 3GVCA 3KOOA 4X00A 3DOEA 5CTJA 4AJ2A 5L6LB 3TZBA 1IWBB 1EXNA 2PUFA 1X7WB 4PCUA 4YLYA 5COBA 4IGEA 1GZ4A 4NBUA 4HO1X 3IOMA 4G81A 3A3YA 3K0AB 3SP1A 6AT1A 2F1HA 4B6EA 5EZYA 5H3HA 4CQMB 1QO7A 4YFYA 3K9BA 4H60A 1GYRA 3QQPA 4B31A 3KFLA 5DXJA 5DXFA 3H17A 4WINA 1FBNA 3RSQA 4N01A 3T0FA 5JBQA 4R16A 1FEZA 4DR7B 4YIKA 2Z8XA 1XZHA 4UBJA 5LDGA 3R7BA 3AOGA 3B5EA 1P5RA 3BA6A 4MV6A 4RD4A 3VZBA 2R6R1 4UHKA 3VBEA 2V3CC 1L4LA 2Y76A 2XE4A 4XRRA 1US8B 4ID3A 2G9NA 5E4YA 2NUTB 4ABTA 3FVVA 2FDCA 3SF8B 3RU2A 4EIWA 1EQ2A 1YV9A 2ZU0C 3UF0A 1TU3A 1AN9A 1X1EA 2CYBA 4R98A 2POQX 1QRUA 4PZPA 3VPGA 4DKXA 2PKWA 3BDIA 3FKJA 4YRJA 1XTJA 3DAOA 4NV1A 3L1HA 5DASA 1NGSA 3A1EA 1QIFA 3BPSA 3JQBA 4Y9UA 5DCWA 3HKEB 3ZWOA 1NVVR 4U2DA 3TBFA 3LC0A 4UUMA 3ZIAD 2BJWA 4GPTA 3G9UA 1G8SA 3IR5A 5B58T 1JKIA 3S2SA 2F4VB 1OKKD 2GMWA 1JDZA 3EG9B 1MA0A 1F4PA 2VUTA 1Z6GA 3PJGA 3T1OA 3Q72A 1XU4A 4PTYA 2FSFA 3R3UA 3EZFA 3GVPA 5H0IA 3V1KA 2XA1A 4FJ0A 4RQTA 3W5HA 3QXXA 4FIZA 1IYZA 4OGGA 2YHIA 4LXHA 1QU3A 3W4KA 4F5YA 3SEAA 1EYZA 4Z6KA 1OIXA 3Q98A 1C8LA 3N76A 1L5HB 4NU8X 1NV9A 2ZIXA 1LBEA 2F3RA 4M98A 5CNMA 3PXBA 1PR0A 3HCEA 2RBEA 5E3HA 3O2SB 4POAA 2IS1A 4ZVKA 1GKLA 5TQ0A 3TRJA 2X76A 3ILYA 3NX4A 4XXHA 1ZC4A 4ZODA 1JHRA 2P8SA 2QMYA 2ATVA 3KEFA 5AICA 2C4HA 5F5XA 4BVJA 3WIEA 2EJTA 4LX0A 4AUEA 5E2BA 1RKBA 1RPTA 2AHRA 1PQWA 3CMMA 4AK9A 4AP6A 4YO8A 1U9YA 2QQ0A 3NYRA 4UAGA 3VJRA 3MMPA 4B85A 2O4CA 4RH0A 2KMLA 3ED1A 2Q7DA 2BGWA 2VJKA 4H7IA 4QT0A 4URHA 5KKNB 4TTRA 2VT2A 4D8WA 4L51A 4AQ7A 1OLUB 4KX3A 5I9LA 1NUSA 4TKZA 1TRKA 4RKFA 4RK5A 4JXJA 3EASA 1BD3A 1BMFA 4GMHA 4XJXA 3FLMA 4GVXA 5AUPB 3L7AA 1KP9A 4CLEA 1S2IA 2WA2A 3M9XA 4HXYA 3G8CA 5G1NA 1I0IA 2O2ZA 4HDNA 4O3MA 4CM8A 4HSGA 2RH5A 3C15C 4AMZA 4RE5A 1ZO8A 1TIPA 5C81A 2FR8A 3QW2A 3WWCA 3M4ZA 4H6PA 2VO1A 2XQKA 3I73A 3TIIA 2HSZA 4F84A 5BSKA 1A9SA 1H5QA 2IYNA 2BWJA 2FW0A 4TGLA 5LZ8A 5TF0A 4G0ZA 2HCTA 3EULA 4Y7CA 2E4WA 2ZPAA 4EG3A 1Z34A 3TNDA 5EHNA 3TOSA 2ZT7A 3KALA 3BD7A 4LWOA 2F8MA 2P1RA 4OLBA 1GZSA 3ZGOA 1WXIA 1CT9A 1ZP6A 2YZMA 5F9FA 1U8FO 1J2JA 2C7PA 1JLLB 3GRFA 3DUWA 4FNGA 3WIBA 1JG7A 1XAJA 1XQXA 1G0OA 1MEJA 2A5LA 4YJFA 4RU1A 1CRWG 5HQ3A 1TU4A 3AF2A 4C4XA 2ZE5A 4RD0A 4J1TA 3K6JA 4HH4A 1JQLB 3F7TA 2YHSA 4S24A 2Z6VA 3GUZA 1Y5MA 2BMWA 3C6YA 3E9QA 4MWEA 4ZA2A 4YMGA 2GM5A 5FTMA 1RCFA 4ZCPA 4UJ3A 5EXPA 1OC4A 1D2EA 1GZDA 2V7VA 1FW6A 3M6IA 4AXXA 3MIZA 3B2QA 3CE6A 4BX3A 1TQ4A 1QQ5A 2CBGA 2IE0A 4R8SA 3RC8A 4LCBA 1SBYA 2AXPA 3MOGA 3AKYA 3OJEA 3FVQA 3QVJA 4P4SA 4ZQCB 1M8JA 2REOA 4NYMQ 3WNDA 2JVJA 2QR3A 2UDPA 3TSZA 4RTQA 3KAQA 3TRDA 1UQUA 4B7UA 1Z6XA 3TOZA 2YOGA 2IUTA 5JTUA 1A4UA 2WU1A 1IK4A 2OFFA 3NEAA 2JIMA 4JI5B 4U9UA 4B3TB 1WB9A 2PBZA 1FX0A 1SG6A 2FU5C 5FWYA 2Y6VA 5MN4A 4ENSA 1FYVA 3UYKA 2Q8NA 2BELA 3GAFA 1KI6A 4OQYA 4NEQA 3B6IA 5DK6A 3AEYA 2VRCD 4QYMA 1P44A 1R0CA 5FO1A 3RTGA 1DBVO 3FJ1A 3VNVA 2LIVA 3EBPA 3GU3A 5LP1A 3EGXA 2D4HA 2G4LA 3ZHZA 2NO1A 4K05A 3W9UA 4ER6A 5IVHA 4UU0A 1WABA 5AIAA 3QX9A 3ETEA 3OT1B 4NOLA 1PT7A 1ZOLA 1WRBA 4G0PA 4IXTA 1OI4A 4LAFA 4W9NA 1JEJA 3LUKA 3X2EA 1KK0A 1C9KA 3BRQA 3PE6A 4CKZA 3H05A 3QRWA 4OL9A 5CGZA 1OB2A 2Y0BA 3CG0A 4KGZA 4AUKA 2WABA 1Q0QA 1AXEA 3KAJA 1UDCA 4CLRB 1XEWX 2JF0A 1TCCA 4JBNA 1WPRA 1H8HD 1T9ZA 2UYHA 2V1UA 4C22A 1C4KA 2PN1A 1OAOA 2I6UA 3MILA 4M2LA 4PCAA 3FKSD 4PGMA 1QQ7A 4UTXA 5CLQA 5AJUA 5E9AA 2OXIA 4HWOA 3WYAA 1ECBA 3PUJA 3U16A 6LDHA 3D4BA 4OQXA 3C45A 5HP4A 3H83A 1FUIA 1AUQA 4WE3A 4E6EA 1PZGA 4DLKA 3V34A 1C9NA 4QNRA 3IODA 3J7AC 4CUJA 1OFGA 2G63A 3ABOB 5FT9A 2C1EA 1CZRA 1XKXA 1TYZA 3L8MA 4HPWA 1BN7A 4MKHA 1V26A 3HUUA 4TQGA 4NF2A 4KRFA 1HYQA 4I2NA 4R2KA 2P35A 3DO8A 1D2MA 3OFNA 1ZHHA 1ID8A 3L1IA 1FSFA 1LSJA 2JFOA 1D2CA 5BWNA 2NTYC 1JG2A 1AF7A 2XTNA 3RVBA 1NVKA 4XUEA 4Z2YA 1DJQA 4BP1A 2N0SA 1E62A 2VPTA 4C6TB 4KXYA 5KNDH 2A6PA 5GJCA 2OG2A 1GV1A 1DKMA 1SPBS 1Z29A 4RACA 1L5WA 2HQBA 4RPCA 3RG8A 5GZ3A 5FLXA 2B1QA 1LLDA 3DMYA 1K4KA 1BDBA 2WMDA 1UK8A 1KK1A 1GCOA 1XZJA 5CT6A 1R37A 1QDLB 3WNQA 4D0RA 2HD4A 4LHWA 3W8EA 3QE3A 1HNWB 2XXAA 4L75A 4TWAA 3M4YA 3ZXXA 1V2GA 4PSCA 4ZV9A 1N6NA 3VU3A 3M8KA 1CUHA 2JBHA 4Y98A 4BMOB 4CGZA 1JG6A 1KGDA 2FN3A 2NU6B 3U6KA 1RXVA 3OE7D 2AOUA 3T3DA 2WV9A 3FUVA 3U1BA 5BUSA 4P82A 4D0SA 3DWFA 4B81A 2ALJA 1LCIA 2K6GA 1F2DA 1RAAA 5J2UB 4RKEA 1V1JA 2IXAA 1MHPA 4WBNB 4UDNA 3W7AA 5KOIA 4LFAB 2MT9A 1KY2A 3MRVA 5K45A 1MD9A 1A77A 2ZGVA 2P91A 1KJZA 4NBKA 1A1SA 1HC7A 1Q15A 2FN4A 2XOKA 3FTDA 3AKEA 2FTKE 1QP4A 2OK7A 2ZYHA 1ICIA 3DJYA 3LW8A 1JFFB 3AI3A 4KAAA 2H0QA 1D6JA 2WJ6A 3AYXB 1ULHA 2SNIE 3DE0X 3W8FA 5KU1A 4P33A 1HE8B 4RIGA 1HL7A 5J23A 3OOHA 5H4HA 1K75A 1PYDA 1YHNA 2MSEB 5HIKA 5J5AA 2H65A 2I2XB 3IAUA 4N0EA 3O9VA 5L8VA 4XJSA 2NO7A 3DNPA 3VNSA 1NYLA 5F3RA 3VYWA 5JQGF 3N28A 3DC7A 4P3KA 4HNUA 3KYDB 3I5XA 3A1DA 1NX9A 1Q1QA 5HVNA 2IELA 3IXMA 4RMIA 3CH4B 4GLFA 3D3WB 1X1DA 1W94A 2WF5A 2V7EA 3TRKA 1P2SA 4M55A 2A86A 2GJ4A 5HJ2A 3MT0A 4ZVTA 1F8XA 5C7OO 1O97C 1HNZB 4ES6A 5JU6A 2ZG6A 1YAHA 3AQ4A 4D3FA 3I5YA 2HGZA 3RGGA 3TE7A 3QXSA 4EPWA 4EG4A 2Z09A 2GBFA 4XB6B 3T7AA 2YQ5A 2C95A 4JXZA 2CJWB 4GLBA 4O4LA 4EUEA 3P4YA 1SU8A 1NVBA 1MG5A 4B5KA 2ISCA 2QTHA 1Z5VA 3MJDA 4LJRA 3ZDYB 1X2EA 2DSNA 2W6MA 1Z0AA 2D2VA 1T8RA 3WK5A 4RQUA 4D9BA 5CNKA 4P36A 1S01A 5T6MA 2R6FA 4BO6A 4K87A 1D1SA 1MHTA 4P2BA 3KQNA 1B26A 4S1VA 4TKUA 1F9EA 3DDOA 1DRKA 1UMCB 2BTEA 3NIGB 4IIDA 1UKZA 1YDFA 4M60A 4R1TA 5D85A 2VKQA 3PBKA 5I8ZA 1GNVA 2FW9A 3GOHA 3LHIA 4DILA 1VJDA 1TI7A 4COOA 1TNDA 1YOBA 3V97A 3LBIA 2JIPA 1RRCA 1N0WA 3KJFA 2GUWA 1H93A 4NZNA 1OAKA 2XRMA 3PC4A 2FPXA 1ZD1A 3T3NA 1N0IA 1A82A 3ZDQA 5A4IS 4HPJB 4A8JB 5CIYA 4LSZA 3T0IA 3L07A 3LRPA 4L6CA 2CLHB 2PH7A 5FPPA 5BY2A 3I4LA 3E18A 4TV8B 1ADFA 3PNPA 1N1GA 4YUVA 1DRJA 4CG1A 1HE4A 4Z3OA 2GR9A 1U5BA 1HZZA 2A33A 2QYTA 3INRA 4M0MA 1QP0A 3F1LA 4GKAA 3FTCA 5AKEA 2DH6A 1S6YA 4YXWD 2Q4RA 3ZJTA 1V5FA 2HK6A 1CUWA 4FEEA 5HF5A 4ZDIA 2GYWA 3UWSA 1FIUA 4IJ5A 3K8QA 1SKMA 1XZPA 4LKRA 1RWMA 1KBOA 2PLFA 3GHHA 3GPBA 4B2PA 5FUQA 1X7XB 4QNNA 1N9ZA 3QXJA 1E2MA 2WYOA 4EA7A 2A5FA 1PBNA 1UT8A 1DAHA 1T6BY 4IEFB 4GMKA 3A8TA 4ECAA 4CL8A 5M3BA 5E3IA 4V0NA 3P5SA 4G1VA 4RWEA 3I53A 3GLTA 3GA0A 7YASA 1A69A 3STTA 4TUYF 4XWTA 3AR6A 4BBZA 1YOVA 2GJAA 5IN4A 5K3OA 4YT8A 1UP6A 1IC6A 3EZLA 1ABFA 4AJIA 1ZY2A 3SX4A 2V7XA 1COWD 4NCBA 1YK1A 1BVYF 5THXA 3HDGA 3A2LA 2VUUA 4KV9A 2O05A 3KO8A 4Y1EA 2P27A 4TS1A 3L9WA 1FFYA 1L7MA 4UDXX 2J41A 2XR1A 3KE8A 4FCCA 1UPXA 1U1IA 3I9MA 4IL5A 2W37A 4FYMA 3UXHA 2GN9A 3U7IA 3WLSA 5KREA 2IZ0A 1FFSA 1KPIA 1L4UA 2JJMA 2O2IA 1P7WA 1VE5A 2ZUWA 4OUKX 3WLRA 4QUJA 3N86A 3QE0A 4NBLA 2CUTA 3VTFA 3ZQJA 4XDYA 1ZYUA 3ND6A 4MMYB 4X1KA 5JPIA 3QMPA 3GF4A 3CLRC 1XKLA 4D41A 1ADJA 3HFRA 3RYIA 3WRVA 3VKGA 2PH3A 5DN6D 2R6AA 1LDYA 1TZBA 1VGVA 4G0XA 1D2HA 1RBMA 4RSHA 3IDQA 5BUQA 4J16C 3R77A 5UKDA 1YA8A 4DDHA 2VJNA 4I1UA 4MR8A 1C3OB 3OPYB 1V8OA 3LDAA 1K8XB 1RAIA 1ZH8A 1J9GA 1NP7A 3BMCB 4BBPA 4C6SA 1R8SA 3WADA 5C18A 2N47A 3WJ2A 4BHTA 1K9SA 5I3ZA 3NT2A 3O8QB 4FR2A 4HQKA 2EWVA 1NMYA 4L2IA 2ZBPA 3W6ZA 4L3WA 1EUDB 3RFFA 3CF2A 5FI0B 3QVMA 1QWSA 4KQGA 4EX7A 3NP7A 2O8EB 1FS6A 4ZOCA 5JARA 2BOVA 5AKXA 1IG0A 1SD2A 3RU7A 4MWDA 3DXXA 1RKXA 2HHJA 4RHEA 3RARA 3DTVD 2E18A 3PFGA 4FWBA 1J6UA 4RLSA 2NXWA 3CUUA 2M1XA 5TIIA 1UZNA 4QJBA 2FQYA 3BFPA 2BEUB 4OXKA 2P2CA 4M49A 1XHLA 3VU9B 1YU6A 4MAMA 3V7FA 4KRXA 3A9UA 4G97A 1ID1A 3SHQA 1MB9A 3E3OA 3M3PA 4D42A 2C7VA 1NI4B 3WLFA 5CLJA 4J2OA 3LECA 3LNTA 2JA1A 3KEGA 1R18A 5SZKB 1FMCA 4EA8A 5EP3A 1N2ZA 1XLUA 4MS3B 1M2WA 4LSMA 3LXRA 1JWLA 2E4AA 2PGXA 2Y2VA 3RUIA 3AKDA 3PSHA 4X0EA 4LGMA 2GPBA 4K1LA 3ZGXA 1F5SA 2KSQA 3VOAA 3OT5A 4FYKA 4UVHA 5JAZA 5HDBB 2HSJA 5JD5A 4G0WA 1ABBA 4MKRA 4YAOA 1WBBA 3WNBA 3PCTA 1BOOA 3R44A 3RGWS 3OQPA 4A82A 3MAGA 1E2KA 1XZLA 4HGQA 3RSSA 4QG3A 3TGWA 5B55A 2QX6A 3C3XA 4HWRA 4Z86A 1JEOA 1QVWA 4ZO6A 4DSTA 1C30A 2Q3HA 1NBMD 1BTOA 4GM1A 4LXIA 3KB6A 4K6CA 4PPNA 3UG6A 2C0QA 5CA1F 1MB4A 1JTVA 1RDFA 3Q3IA 2H7XA 3ZOZA 1FXWA 2W48A 3GYBA 2R44A 4IIJF 3UUGA 2Y1OA 2ABWA 5C2JB 4GVLA 4BWYA 4FGUA 3LP5A 3FPBA 5DNWA 1ZRNA 4BNGA 2VF2A 2G0TA 2P4UA 2PYDA 2W2VA 1MABB 4ZYWA 2PG3A 1QV7A 2AOTA 2OR3A 1L7NA 3F7NA 4H27A 3KQQA 5KIAA 1E9VA 2QQEA 1VFPA 1ZM4A 4XOUA 2EF0A 5L3QA 5DTEA 5KNBA 4JYAB 4XJTA 4MQ6A 2H4HA 4GT1A 4Q66C 2QZ9A 3O4FA 5AK6A 4JEMA 1CR2A 5CXUA 2DTDA 4UM5A 5LQJA 3ETCA 3VZQA 2J7PD 4MJXA 1J23A 4CJXA 4UM9B 3TJZA 3QKRA 3Q7QA 1AKUA 1Y1QA 2HADA 2JK0A 5CFPA 5JZSA 3BAZA 3MGBA 4FYJA 4ZXFA 1T8SA 1UM9A 1PJLA 4DLUA 4AQYB 1N78A 1Y1KE 4BMNA 4MWBA 5K6AC 1FMFA 3H9GA 4DIEA 4I1PA 2ZJ8A 4DIFA 2QMZA 3WAGA 1VGQA 4F8JA 1GZ5A 2IUFA 2OXRA 1UKYA 1PK7A 4AFNA 2Z43A 2Q5QA 3PFNA 5BRAA 1P17A 1U7ZA 2XZPA 3G1TA 4E5NA 2AMJA 3DQPA 3HCWA 3LCJA 5H3LA 3TEJA 3V5NA 4BGEA 4DPLA 4BNDA 3BULA 4ZK2A 3GC6A 4PGAA 3TOXA 2ERXA 2X41A 3FRIA 5LMUB 4H3SA 2PS9A 3NVKI 3ETGA 2WSIA 4KWCA 2ODBA 1E3WB 2TMKA 5CHEA 4M0FA 4FS3A 1AK2A 4KSCA 5JSYA 1T9KA 2OZPA 4WGGA 3HI4A 1XCMA 5JLAA 4G5YA 1D1QA 2RI0A 4IDOA 5J5CA 1R8XA 4D74A 4ED9A 5FORA 3EQ7A 4ROSA 3DTNA 3OC0A 3VR5D 2V8BA 1W4RA 1U2SA 1ZITA 4GECA 4DYDA 4N9QA 3UJNA 5YASA 1UK9A 3IP5A 2BZSA 4IINA 3NYIA 3RU3A 3BTUA 2C7OA 3KJIA 2P8JA 2BZ1A 2YXDA 4P0QB 3T9AA 2W8BA 2ZREA 1NF9A 4QE3A 2ZRGA 4KFCA 1EU1A 5EQDA 3SNKA 4RJLA 3RODA 3VMMA 4MV5A 3OZEA 4GWGA 4W8GA 5B7GA 2ETVA 3D4OA 1QX4A 3GGOA 2EQ5A 1CJBA 1NUPA 2OMKA 2ZIWB 1QF9A 4IDFA 2CZCA 4ZVVA 3ZKWB 1GN8A 3HKBA 3VJLA 4C0XA 1IH8A 5FBQB 4DLXA 1JLKA 1AT1A 4G9EA 4UFOA 1NJSA 1IBLB 1QHHA 4MW7A 4PXYA 4BN0A 1BCSA 1OA1A 1XJ5A 4XCXA 3H87A 1TQDA 4A36A 2HKIA 3DBLA 3HRHA 5FOUA 5AW5A 3C6XA 4JSTA 1XZDA 2GXQA 3GA5A 2M6SA 4RYLA 4CT0A 5TJ9A 4AC9A 5IFLA 2CKMA 2W83A 4RZ3A 1WUYA 2HCBA 2JCBA 1MAUA 2CE7A 4XYEA 4CHTA 3GVIA 2ZULA 5JVDA 2ASEA 2FRXA 3NC0C 4PAOA 3MJEA 5AVKA 4N0PA 1ZGHA 1NT4A 1QYXA 5JXJA 5LOVB 4D9KA 4UE6A 2D1QA 5DSXA 4N12A 3KHSA 1Z0IA 2XWSA 1Q84A 3WYBA 4CKWA 1SJ9A 3EWSA 2ASVA 2UZ1A 3DS8A 3KVRA 1RQLA 4BJ5A 3G89A 2VH5R 1HOXA 2QR2A 4JSRA 2A67A 1CFJA 3D8SA 1U4OA 4UNNA 5DLPA 5LUAA 3ADPA 1VRWA 1O5TA 4G84A 3QPCA 2GRAA 4IGKA 3CU5A 3JU3A 1SHKA 2CVFA 4P83A 2R25B 4KXMA 4WERA 1BU5A 3HJBA 1LH0A 2JGMA 4AKHA 2H85A 3NBKA 4ASUD 5AVSA 2D1FA 3C7AA 3IUBA 3LHDA 1BMTA 1X39A 2CHQA 3QENA 4B74A 4WOPA 5FOQA 5K0LA 2J6HA 3FM9A 3B9PA 4XWOA 1OLXB 1EX6A 2H8GA 4WBXC 2IEGA 5FNVF 2IW1A 2O7RA 3USZA 2W00A 5BW5A 4YMLA 1C3XA 5IT5A 5KTTA 5LQCA 2Q0HA 1Z0DA 2HSWA 3I09A 3OQJA 1ZA2A 5KJEA 5ALYA 3K30A 3OWOA 4N4AA 2B83A 2WTXA 1DKPA 1SXGA 3SZMA 4IIJA 2IP4A 2Q2VA 3H5NA 3QITA 3GLVA 5BT8A 4OHBA 3GFSA 4QXOA 1YKSA 2PJDA 6PFKA 3GT7A 1QKJA 2GDZA 2Z4RA 3FUWA 2VJDA 4YACA 1GG9A 3G2OA 3T54A 2FUEA 3IC5A 5CCDA 2F59A 1N5OX 1Q20A 2PWZA 3IUMA 3CVVA 4N48A 4HV4A 1HH4A 1PL6A 1V3TA 2GX6A 3TFWA 4UVDA 5GADl 5CA0B 4IDQA 1Q7CA 3K9GA 4EOGA 3D0OA 5EZYB 3QKSA 3REOA 4IDHA 5A06A 1I13A 4Q3KA 4TLCA 3L5OA 3H5IA 2WFAA 5IVPA 2VNAA 5JW6A 3J81A 4X5OA 3I01M 5HSGA 3GH1A 3RRNA 1WEHA 4JQYA 2XUFA 1DEOA 2ZSDA 3EVCA 4JH0A 4AJ4A 6GPBA 1AC5A 1XL0A 1L8XA 1YS9A 1J2TA 4RK6A 1BGWA 5BW4A 3E53A 1CUBA 2OT3B 1I1HA 1EP9A 3RS7A 3N1UA 3CH7A 3VOTA 2X7JA 3H9UA 2O57A 3CLVA 5GZ1A 4TM7A 1BGVA 2NXNA 4GX0A 4YAWA 1E7MA 3WLAA 4M1MA 2QRHA 1Y9EA 1U7XA 2H3HA 2R47A 3L7IA 4L8WB 3TOVA 3VZCA 2BYTA 3FSRA 5E38A 1G42A 3E5NA 4IWXA 3MLEA 2YY7A 2GF9A 3ONNA 4YRCA 5AVJA 3NRCA 4G4IA 3NHUA 4HB0A 1VG9B 3GRPA 2UZAA 4FI3C 1YSCA 4UUQA 4DWVA 5DF1A 1BG6A 3IMEA 4TV9A 2AUTA 3WK8A 2DWCA 2HNBA 2EAUA 2RDMA 3CSDA 3DVRX 2H1OA 4Y6SA 3RTCA 2G8LA 2W2NA 4G0UA 2HWXA 3MT9A 2G6TA 2C5GA 2FWAA 2JFXA 3NHSA 4ALMA 1GUZA 3C4VA 5HE9A 4DZRA 3B70A 2R8YA 3KT6A 1CUJA 3PFIA 2GCOA 5A4DA 3IVCA 3Q1KA 1NBME 5JZOA 4U7PB 1CY6A 1YZVA 2D0OB 1D3AA 4RESA 1OE0A 1R16A 2YHIB 4Q1AA 2ZYGA 1TIKA 1PT5A 2NYUA 4KE6A 4MWCA 2B4KA 4PTZA 4AQDA 5LNK1 4GVPA 5JBNA 2ROQA 1DV2A 2ZIXB 2GJ9A 2RGRA 1ND5A 4G4JA 2EATA 5JATA 3QPBA 4DJFC 2IHNA 4IIVA 3BE8A 1P62B 2C9CA 4LIPD 4MSUA 1CQWA 1E89A 3ITKA 4LG1A 5F21A 5TQ0B 3BEOA 1NX6A 2QVYX 4IILA 3PT9A 3FFAA 3T3HA 2BMFA 2RAUA 2ID8A 3T12A 1ZJJA 1P73A 2IYLD 1UFVA 1E6LA 3OTIA 1SRQA 4N49A 2FDRA 1KJ9A 4KNWA 4ER3A 1ORRA 4TMXA 5FL7D 1PS8A 1QIGA 4Y6LA 1HE2A 1OYOA 1SBCA 2UVPA 1XZNA 1XWFA 4GO1A 5EXDA 4LHXA 3EDCA 1NBHA 1TZJA 2J4FA 3LKDA 2OAGA 4ZGGA 4D96A 3HFJA 4ZQHA 2W8ZA 3A2KA 1T35A 3EQ2A 3ILVA 1DFIA 1TEXA 4ZHQF 1KJQA 4KHZA 1VE7A 1A2KC 2PX4A 3FROA 3L0SA 2F1KA 3I6ZA 3NG1A 4MWSA 4XDGA 5KVSA 3U5TA 1SA0A 4HDNB 2XQIA 3AHCA 4K3UA 4CM8B 1DADA 4Z7OB 3DEAA 3I39X 2EBFX 2F8LA 4LSWA 4RZ2A 3GZNA 3SLKA 2V7TA 3D81A 3LLCA 3G3EA 1XTVA 1HTTA 2IBTA 3EUFA 3IQEA 4N5MA 1ISRA 1S9DA 3RFCA 2OCXA 5DCYA 3V8EA 3AIMA 2A0XA 3FR8A 1AMUA 3ND9A 1KNXA 3OQOA 1K06A 2VDNB 2JD1A 3D54D 3NP9A 2CGEA 3SVLA 5C7YA 1EK1A 3BKWA 1UBHS 3LYLA 1WMFA 4OMCA 1GY8A 4H6WA 4UVIA 1KSHA 4PANA 1G0NA 4QU0A 3LQFA 2FPRA 4DS3A 3PHJA 3UXMA 5AW4A 4MHSA 4JP1A 3MUEA 4A0HA 4JP8A 5EEHA 3G68A 5KOYA 2HPHA 1NXOA 4ZT5A 2A5JA 1R8QA 5LYJA 3T7SA 3K16A 3LQKA 5HQ3B 1RBYA 1U0LA 2Y0DA 3U44A 1AKMA 3UOWA 1Q7RA 2G5CA 2EBWA 2QRZA 3L0IB 5KKCA 3ZNOA 2YMMA 3VC2A 4V3CA 1J07A 1YUNA 5DYWA 3SFZA 2D0IA 3PFFA 1WULS 5CVUA 5DSTA 4B84A 4TZ0A 2UV8A 1PL7A 1GPH1 1TYBE 2YMLA 3UO8B 2L0XA 1M1ZA 1R4AA 2F2TA 4TOIA 4WK6A 2C94A 1PQYA 2W0MA 2R66A 1JP7A 1P74A 4UHCA 1M2GA 5HUJA 1JH9A 2PY6A 3FETA 2FX2A 9MHTA 4P4SB 2X3FA 4FCWA 2VHXA 4BAZA 3STYA 1G3IA 1AJEA 1SUCA 4CM4A 2IXTA 3G8DA 2ACWA 1NN1A 5ALMA 1DTSA 1HLGA 3A4LA 5L4LA 3SQXA 4EW1A 2XNKA 1JSCA 1OWNA 5BQ3A 4LGCA 2KYRA 2J4CA 4DR2B 4X90A 2P2LA 3FI9A 1T2VA 1FX0B 5FWYB 2FG5A 2G5GX 2OESA 3EN0A 1IN6A 2UUPA 4WKNA 3WLJA 1KI6B 5ABPA 4S1TA 4OG2A 3BWDD 2H9AA 2JHPA 2Y0CA 1TZCA 4IRXA 3S2IA 2ZJOA 3LZDA 4M8IA 4M6WA 4U3JA 2C2YA 1LV7A 1CE8A 4K0RA 4B43A 4QGHA 3QVUA 1YBAA 1SQ5A 2KBEA 3EGXB 3OSZA 4PW0A 2PIDA 4IYJA 5E2IA 4DJTA 1NN3A 4OJMX 2I6FA 1ODFA 3JTEA 4RXTA 1KO4A 1O97D 3VR6A 3R3JA 7ABPA 2E4YA 2GF2A 1GPYA 1B8PA 2XE6A 2Z5VA 1Y1RA 3E35A 1JJ7A 4K86A 2ZSUA 4RTJA 4X71A 1VSUA 2DZDA 1Z6QA 4IGIA 1DO0A 3H42B 1ATZA 4NMWA 4Z7QB 4XIGS 1J90A 2D1RA 3IJRA 4BFXA 3LH5A 4INZA 3BIWA 4BQRA 2GTPA 3HR8A 4UCQA 3PLNA 1TW3A 5E9JA 3GCGA 2C9BA 1JEEA 1AK1A 2AW3A 2OAEA 4J90A 2YMQA 2O7SA 5KQPA 4D8XA 3AL3A 3M5CA 1T91A 3GP3A 4EP1A 1PNVA 4JU9A 3R7LA 4BO2A 1JHDA 4JS0A 3IAS6 4RH3A 4EG1A 1E58A 2WUDA 4OXNA 5F3DA 3PZRA 2MIIA 2CF6A 3EVTA 2APJA 3ELYA 5IC4A 1GUYA 4YJHB 3I8OA 4MEJA 4ZQEA 3RAGA 4XGRA 3RK1A 1XGKA 5AKKA 5BSRA 2ZJAA 3AR4A 4JODA 3C3JA 3OKPA 4PXAA 4BB5A 4MUXA 5JAHA 1KEUA 3R7FA 3B38A 5J59A 2X2FA 3FCSB 4IKEA 3VPSA 4JD5A 5BMOA 3KB8A 1EM8A 2YUIA 1MO5A 2PGOA 4JJAA 4GAEA 4B9AA 1CP3A 4N3BA 4MW5A 4IV0A 2GYVA 3P9KA 3GRVA 2LD4A 2YDXA 3HGTA 2QDKA 3RTBA 2D1SA 3FCXA 3IIIA 2CJYA 5CVDA 2BHTA 3KKQA 3UJBA 4PO8A 1KORA 3EBOA 3MAJA 1G5IA 4MJLA 4YREA 4PIPA 1N9GA 3KXLA 1TM7E 4XCVA 3U4QB 2J46A 1Q22A 5LKAA 3CCFA 5I9MA 4N5DA 3A06A 5G02A 2B2NA 2AOUB 3V46A 4HNTA 8AT1A 2BIFA 2HEGA 3A58B 2O52A 3L8EA 5ER9A 5A62A 4DR5B 3L8GA 1EJ2A 3MERA 1HUQA 2X5KO 2WJIA 3IE1A 1WUIS 1OZGA 3VAZA 4CVNA 5TMBA 3W77A 4E4YA 1RAFA 5M34A 2REXB 2YQ4A 3S2GA 1JLSA 2I2DA 4JP3A 1P4AA 1KDZA 3ROZA 1ZVKA 1XF1A 1TYAE 5FA8A 2O1XA 3HCRA 1KBQA 1O5OA 4HFNA 1J5PA 4EY3A 4FPXA 4UNPA 2CL7X 4DXAA 1RU3A 1T3LA 4U7TB 2X23A 1KI1A 5FYQA 4U2GA 2R97A 2I9PA 4R84A 5DYNA 2XT6A 4HWPA 1LK5A 5AKYA 2ONCA 5IKPA 1XMXA 3WIUA 3NJ8A 5G0VA 1FP6A 3R8CA 3ENZA 5FUBA 1NXQA 1BFKA 2I65A 3EXIA 3IBGA 4YHBA 1WCIA 4HT3B 2B35A 5JAUA 4KBYA 3FRHA 5EIBC 3WB2A 2NADA 1K6MA 3MWYW 3UKOA 3IHTA 3CLRD 4JJKA 3PEYA 2AOXA 4BJHB 1JR6A 1SULA 1SCJA 2R8PA 5EE5B 4ZZ0A 4QYXA 4Z0HO 5EESA 3L0PA 2AJCA 4KMRA 5B1SA 3WNZA 3W2EA 4TTJA 2WVAA 2HN9A 5H02A 4EARA 3OM0A 2OQIA 1ZW6A 4KXNA 1MO2A 4URYR 5EE9A 5FADA 4NYIR 5I8WA 4AI6A 4C43A 3I4FA 1RWKA 1SUFA 3NHAA 2IPXA 4ZZ2A 1PF7E 4GQBA 4O4LB 2ZCUA 1DXQA 1XL1A 2ZJFA 4R4JA 3C6BA 4JVNA 1PJAA 4F3CA 2DPHA 2G67A 5AKHA 2ZE7A 1BA2A 2GN0A 2LZ0A 2VR1A 4TKUB 1EH5A 4PC3A 3KOUA 2GAOA 1QE5A 2HXSA 4P86A 4CF5A 3F96A 3MQ4A 1JQ5A 4CG3A 3GBSA 1I51A 4G65A 4C0AC 2GVZC 3SSNA 3GGPA 3ICCA 4LW8A 4FDLA 5ALFA 4I9GA 4DC9A 4KIGA 4XQCA 4ENWA 1BD4A 1BE8A 3N5CA 2R7KA 1SIWA 4NJEA 2RHRA 2Q07A 3WWYA 3N5KA 1CHDA 4WT7A 4Z51A 1WCYA 3UHFA 2QJFA 2KWIA 2WJZB 2PJRA 2QT1A 4GPAA 1DG1G 3HACA 1BW9A 1F2TA 2IOYA 1DKQA 5IK2A 1W1IA 3ABIA 4OLJA 2ZTHA 1OGJA 3IB3A 3GG9A 4KDRA 3TZ6A 5A4AA 1U5BB 2WWWA 5CK5A 5AJHA 2BY4A 4U5QA 4I66A 4QUKA 2ZUDA 3N87A 4IIGA 1S8AA 2IYOA 1BEEA 1CVIA 1NNI1 4MK4A 1AQ6A 4J1NA 5ALTA 1SHUX 2AJTA 1JJFA 2AZTA 3HB9A 4IHKA 4IFEA 1D03A 4IXNA 4LYFA 4XFJA 1MC8A 3DAGA 2BE9A 1QORA 1H4QA 4HYYA 3KLNA 1IBSA 1ZI8A 4QGBA 3DJFA 3K0KA 4WKPA 2GDJA 2JNWA 4D4IA 4A9AA 2GZSA 1GEGA 1TM4E 2GD6A 5JIBA 4FU0A 1S3IA 4K6KA 4RKWA 1IIRA 2BGUA 2QVBA 3FOZA 3L6EA 2P1DA 1N25A 4N82A 1YOVB 2EV9A 2DLCX 1B6RA 3MWEB 1P45A 1E5QA 3RNLA 4NCNA 4NCJA 2VZ8A 1DKLA 3ELWA 1RT9A 1SXJB 5EJIA 5FULA 4IDBA 1CDDA 5TARA 3VGJA 3VQTA 2F1JA 1DAGA 4A5OA 3TMAA 1K66A 5KWJA 1QO0D 1MEOA 3QLUC 4CV3A 1UJ4A 3KX2A 2JHAA 2NIPA 1P31A 3TZQA 5BNTA 2EJVA 3RQSA 2QRGA 4MLDA 1UOOA 2F4NA 3OZGA 4WFJA 4ANFA 1X86B 4TS9A 5BQ5A 4AS2A 5P21A 2GF0A 1XK6A 3C5CA 4CLDA 1NW7A 3EFEA 1N6OA 3IT2A 2GCPA 3V4ZA 1KYTA 4D9HA 4L27A 1VRVA 1R4MA 2AMYA 2FUG1 4LXQA 5DYTA 2DUWA 1Q12A 4X1KB 2Z8ZA 5IMSA 3MHPA 2CMKA 2RHLA 2GSWA 3RYIB 2MSCB 1A7AA 4FWIB 4E11A 1B42A 3S8YA 2QT9A 3LP6A 3K9NA 2AE1A 2W2LD 1Y6GA 4NZMA 3PVZA 1EDBA 3G0DA 3MCVA 1GPUA 4MR8B 1YZUA 2OORC 1ABEA 4GFDA 1PUIA 1H0HA 3D6VA 5CDFA 3VDQA 1BE6A 7MDHA 3V80A 4OQ4A 1GQRA 1Z5UA 3I83A 1RRFA 3UTDA 3ZV4A 2IU6A 1WUJS 5FBLB 1O6ZA 2A4MA 2FMIA 2IQ5A 4MPRA 4L2IB 1VG0B 4O33A 4AKEA 2PKQO 3FPLA 4K26A 4W8OA 3ZDRA 2HQOA 2QTNA 4R05A 4X9XA 4UBIA 9GPBA 1E94E 1MO6A 2NVUA 5HDQA 3HXMA 3ICWA 2B6HA 3SHOA 1U2PA 1E9RA 2JHFA 5DX1A 1XHFA 3ZS9A 1PGNA 4ZAYA 3S2EA 4QOIA 1LNZA 3CS3A 3OLXA 5LJLA 2QUJA 5EZ6B 3QFHA 1BHQ1 1KZ6A 1YS7A 4FEAA 1KY4A 5TS3A 4GPBA 2NWQA 3WKBA 2XNDD 2OCLA 2GBGA 2QNRA 2QTGA 1FFWA 4YMSA 3FTEA 5DHRA 4QU8A 5LD2B 3RANA 3QU4A 3ZHVA 3ISTA 3LZ6A 4YFVA 1DUSA 3GEIA 1YQ9A 2CXHA 1XN4A 2HXGA 4JOCA 4YBRA 3M9LA 1SC6A 3NHRA 4KTVE 1E0SA 2Q5CA 4AS3A 4RVSA 3ZWDA 1W47A 1Z13A 2O1WA 4PBSA 3C3AA 4BKOA 4ZOQI 4MW2A 1H5UA 3VNQA 1KJJA 3AVOA 4LJKA 2OO7A 4WXHA 4DG8A 5BR4A 3FNGA 2NPIA 4LOJA 4E0BA 1BDMA 1CS4C 1ENOA 1HBJA 2LBPA 3WP1B 2Z57A 5K5EA 1P1IA 1JKJA 4IQ0A 1SURA 1ISFA 1U7HA 1WR8A 3GAMA 3AEKA 3DW3X 4JUAA 1BH6A 5JROA 1WCXA 1HM5A 2OCIA 3TCKA 2O2EA 4MUGA 1X7YA 2ZANA 2VEDA 2DCUA 3OZVA 4TWJA 5C80A 5LLDA 3V2UA 3I8SA 2Q5EA 3A1CA 4HN9A 3RSLA 4MW6A 3U31A 5U9CA 1U7DA 1TCBA 4H18A 5U4XA 2FW1A 3MMZA 3OTQA 2HMUA 1C30B 1JI0A 3NUZA 1BKDR 4NFYA 4G5QA 4LXGA 4MRRA 1RLIA 2Z2YA 3FG9A 2BP7A 3OEHA 4DE5A 4DRXA 4EEKA 5CDFE 1RJEA 1G4AE 1ZVQA 2R6HA 5F2KA 3AF6A 1PWXA 1Z28A 3TDNA 1W0JA 5JRJA 3UC9A 4X1YA 4EFNA 4WMLA 3HNRA 1WV0A 2BKEA 4LZPA 5E6UA 4N9WA 2W70A 1JF8A 3AZOA 4YRSA 1EQAA 3KJNA 4YR7A 5B30A 2ZZNA 2AOTB 1XNHA 1I2DA 3NU1A 1ENPA 4J2TA 1FDSA 3P0EA 3K0EA 3VSAA 1KJWA 1AUPA 4EBFA 2Q7OE 2CJPA 5L3QB 2YFYA 2QU7A 1DI0A 1CF4A 4GC9A 1GAQA 1B41A 2CMHA 3P0IA 4KIFA 3S2YA 4B76A 1YE3A 3Q8KA 1EWTA 3ND5A 1W7AA 4LJAA 2WKSA 2WTMA 3OO0A 5AVQA 5K4HA 1PN3A 3U80A 3TQCA 1IQRA 2VA8A 1QYRA 3WGMA 1QHIA 1VPDA 4OQMA 3QKRB 4MMZB 2L17A 3HGQA 1Z2OX 2C9ZA 1U8YA 1Q6YA 2GYUA 1JALA 3FMPB 3L7CA 2VN8A 2DT5A 3Q40A 3C6KA 4ALKA 2ZIAA 1UM9B 2R87A 1H85A 5EMMA 4J0KA 5L3ZA 2CE2X 1WA5A 1NF2A 1GFWA 2QG9A 3B6KA 4EO7A 1DUIA 5IDWA 2YY6A 5JDIC 3PVCA 3WGHA 3UM9A 4EI7A 3UJPA 1NIPA 4PIMA 2QWXA 3IAHA 3HJTA 1Z18A 1PX0A 4LY9A 3SX0A 4GICA 3IFSA 4INAA 3T7KA 3VR2A 3CX8A 4BNXA 3P9XA 1BYUA 1Z5PA 3VNAA 4MYSA 4BQSA 4BNDB 4YJ3A 1KC3A 2R7AA 4LHSA 2JLXA 1XRJA 4QQKA 4YYEA 3GJ8A 1P2GA 1AHPA 3LQYA 1E79A 3RBAA 1DC8A 2GASA 4FDTA 5K20A 3K1ZA 1FSGA 3AHIA 3L8YA 4MARA 3QY9A 3SY8A 3ZUGA 4C21A 1L7QA 4FUTA 5EWJA 1BXGA 3RWMB 1AU9A 4PHTA 3N39C 1IHDA 1WUKS 4YECA 2EW2A 4WY8A 5EIWA 1PFQA 4PX2A 3KOMA 3CKMA 5K8LA 2DBVO 4F2WA 1R9MA 4YUYA 4W5NA 1Z62A 4DJJA 2W8BB 3G2QA 3SS9X 1Z2AA 3LKVA 1PZXA 3KZVA 3L0DA 4RVCA 1FNDA 2BGKA 1TEHA 4TMZA 4CM9A 4CIWA 2WFMA 4HATA 4C5BA 2OQ2A 2V7BA 1LW6E 3MJRA 3ONWA 4IKPA 2BGJA 5IX8A 1RFGE 3LSYA 4Y2TA 3NAMA 1E2BA 4CL3A 3F8TA 1ZJZA 1KVQA 4O2RA 3HKBB 4I3HA 4OA8A 1ZHOA 3JQ7A 2B2XA 3C1TA 4GI7A 1JAIA 1N6HA 2AN3A 2X0KA 3HL0A 4P38A 4HLUC 3EEFA 1QHHB 5AJWA 5GIOE 1U7UA 1X2BA 1Y37A 1BCSB 1J09A 2PS1A 1LLCA 2VHVA 5DHQA 1WCWA 1C1DA 3DBLB 3K0HA 3HXPA 2AXQA 4BQEA 3ZK8A 5FWNA 3ZBUA 3K9CA 1OWOA 5A3VA 1TADA 2IX9A 3DZIA 1GL3A 1T3GA 4IUYA 4KPGA 1Z6PA 5TVGA 4PVCA 2VXBA 2ZAOA 2YVQA 3OFSA 5KOHA 3DVAA 5JVDB 4ETNA 5KYWA 1T8WA 2HUPA 2YJTD 4FI3F 3SYKA 2RHJA 2BKXA 2ERYA 3BE5A 4HY3A 4LNUA 4A6XA 4JWKA 2FMFA 4WLFA 4MW9A 3NHLA 4ZAZA 3Q5DA 1IHXA 1XRNA 5IFKA 4RA6A 1X42A 2QX4A 2VTVA 4N0MA 3C3KA 4CKWB 1T36A 5IT0A 4KGXA 1RI2A 3AF4A 5F51A 1CJMA 3KHUA 2UZ1B 4MRMA 2ZJ6A 1UC8A 4XVQA 2YFHA 4D4JA 1DC5A 4DJAA 1A71A 3W3AA 3WB1A 2X4GA 4RX1A 2AN9A 2QORA 4OHWA 3ZE7A 5CITA 4KK4A 3PZBA 3U81A 5BNZA 3QPWA 4OY3A 4ZT7A 4HQNA 3DPUA 4G67A 3HO1A 2WNSA 4EHLA 5K05A 1G8AA 4RZSA 4B09A 4YXFA 2DLDA 3EOBI 4DG5A 3DONA 4EVIA 4IWNA 3ZY2A 3N9IA 4EUHA 1KQ3A 3WLKX 5HIAA 2O8DB 3N8IA 2IEDA 4TTVA 4V2UA 1T4CA 3KLMX 4E5DA 1F0NA 1WVGA 3BWEA 2PM8A 4R1UA 5DM4A 1UWKA 2VVTA 4QULA 1B6TA 2IPMA 3MLAA 2CFTA 4KLRA 4EYEA 5BSWA 3MHTA 2WYWA 3HV2A 3DHVA 5FNZA 5JCJA 3IAFA 3OX3A 3LY5A 1J00A 4FCTA 1MOZA 1XMOB 3WO1A 5ICFA 2X7XA 4RHFA 1Z0FA 3OESA 4IIJB 1NONA 4F2PA 5IM4F 1GAEO 1QRAA 2QM7A 1LRLA 1OI2A 1CY2A 1AN0A 1YE5A 2CVPA 3O7MA 3P2JA 1XZGA 3BZBA 3DXYA 4BGDA 4KPUA 3UB4A 3DO6A 4MKFA 1U0JA 4IKOA 4LJ7A 4HQOA 5GVRA 5FH9A 3FWNA 2HJSA 1WKVA 4R2IA 2E1RA 5L3VA 4UUOA 5K51A 1FFEA 2V55B 2YICA 5IBCA 2V65A 3R6GA 2HDNB 2Y9MB 1LPSA 3O31A 2CXNA 3HB0A 1AGNA 1ZLXA 5B1HA 1EFLA 3KWMA 1FSZA 4XIJA 4N65A 3TB4A 1QKKA 3CTMA 3HB1A 4RQBA 5TQ2A 1ZG3A 2CLSA 3QKSB 1NHWA 1RTKA 3W9YA 2WFLA 4P0PB 1DU4A 2GARA 4Q82A 4NY1A 1CUCA 1GCGA 5DBGA 1K7FB 2EYQA 3WMWA 2DR0A 3SXJA 1IULA 4CTKA 4O1IA 4OYYA 4DXHA 3VZSA 3HXKA 3WBBA 2ZFUA 4ZCLA 3QA3E 1APBA 1ZH4A 3CT4A 3TRHA 3BJMA 4E2ZA 4NI5A 1JH8A 4I6JA 4A0FA 1WB4A 3HFSA 1H2HA 3JR7A 1KJYA 3C3WA 4O63O 3W6OA 3CQ9A 4A0GA 1NN0A 1NJFA 4UEKA 1DE0A 3WRYC 3KB2A 3HBFA 4PLWA 1ZVMA 4U7FA 2IXFA 1IVSA 2AOVA 1QK3A 4R69A 4WOCA 4MKZA 4L5BA 4OYRA 2XUIA 3PHCA 4MQUA 3DVQX 3MYRA 4HZUA 4CTOA 3TS1A 2OV6A 3KT8A 4F3TA 1JGTA 5DGIA 2JIZA 4O2AF 3DYBA 5C3UA 2QQ5A 5ARBA 3T9DA 2C8JA 3EXHA 3IXQA 3G0IA 5DXAA 4EG6A 3AL2A 2JZNA 1KWKA 2Z08A 4BV3A 2QW0X 3IAAA 3RF7A 4AZWA 3FWZA 4BB9A 4TV9B 5HTOA 1NOJA 4C04A 4HCJA 4DXDA 3V6MA 5IAOA 2ZROA 4XB2A 3GUYA 1R8YA 1OPRA 4JOSA 4CT5A 4YAIA 3KJXA 1KEEA 3B60A 4KDCA 4X95A 2Y77A 3BDAA 1JKMA 1TJ5A 5HK8A 2DBYA 2GCOB 2YC4C 1DCTA 3PXAA 4J94A 4MGEA 5F2NA 3DPIA 2UYYA 3I6QA 3PQ5A 5HW0A 2SBTA 2ZIEA 1NYQA 1SVUA 1ZQ1A 4HR7A 5KNBH 4ZT3A 2BFMA 2GFQA 4MWTA 4RPKA 4X41A 4EPRA 1P9NA 1XYGA 3F6RA 4MKXA 4PN3A 4YJ2A 4GI1A 5JANA 5CU7A 5FR1A 3IE0A 3MFQA 2FK7A 3RSCA 2VJMA 4HPXB 2D8MA 1T26A 1TW2A 1QH8A 4JKIA 5LWQA 1NQVA 4YDRA 3SKYA 1KQGA 3GFTA 5KAPA 2PWYA 3QNMA 2NG1A 4BNMA 4YUAA 3IKLA 3X2SA 3EHEA 3ANTA 4IJUA 1OTXA 1GITA 2H48A 1PZNA 5KTRA 1HE3A 3SJAA 1XVUA 4DA0A 5HCUA 4DSOA 4BFCA 4EL5A 4EGJA 4B45A 1N5MA 1DBPA 1O6FA 2UVPB 4M37A 2GB4A 4LDAA 2PL1A 4DUGD 4PBRA 4B3JA 2RGBA 1SVWA 4ACAA 2XMDA 3DEZA 1QJCA 2FWNA 3BYZA 3LPLA 3DMHA 4G4SP 3MC1A 4OMDA 4CTMA 3CNLA 4XM2A 3ZIDA 3KE9A 3CXUA 2DFKB 5CB4F 3ZVNA 2JG3A 3G0BA 5B4VA 3R6DA 4ZDKA 3P97A 4YDHB 4BV2A 1RNLA 1FVFA 1KDPA 4OMUA 1FDOA 2G5PA 1SA0B 1UINA 4KWHA 3CR8A 5FLYA 1OX6A 3BSFA 4OJTA 2Q4EA 2WJHA 2KE5A 4MQBA 4YMWA 3ACDA 5I9TA 5HKKD 3JQCA 1SXJD 3GZNB 5C46F 3BHNA 1OIWA 2BEWA 4GUDA 2GK4A 2Q6VA 4JT9A 1WEKA 4QVGA 3L77A 1AKTA 1C29B 2DWPA 2R65A 3WGYA 3IAM1 5AR1A 3ZJYA 4LF7B 1RE1A 1A7UA 3C6QA 3IHWA 4Q1DA 1LF0A 1WDTA 2DE0X 5DX8A 1Z0UA 3QJYA 4OYHA 4P22A 5HRAA 4X6YA 5ALSA 3W3ZB 1L7DA 4AAYA 3GHYA 2I54A 3IEPA 3P96A 1VQ1A 2I5PO 2BR5A 3P45A 4J4BA 3Q5GA 5TDHA 3RUAA 4GR4A 3U7JA 5TPZA 4ARCA 4HTFB 3V3TA 1FYDA 5CFNA 2FN7A 4QUGA 3CZRA 2OYCA 5LYJB 10MHA 5IM4A 1CJKC 4E51A 5A71A 3U44B 2PQ2A 2XE7A 4PXSA 1KI4A 2F17A 4TRMA 3SI7A 4AZTA 2JFGA 5CAEB 2A78A 4A15A 5BUZA 3DE6X 2AUMA 4KO8A 4Q4HA 4UE2A 2X58A 3ZQKA 3HCBA 3SD7A 3GQBA 3V2IA 1WZCA 2WTAA 2H4ZA 3KJGA 3ACBA 2CUNA 2V0CA 3GFPA 3E61A 3ENNA 3P5BA 3OICA 5IN5A 4CFZA 2PUGA 3R3SA 4ZREA 4IF4A 4ZOEA 5A0TA 3SU8A 1D9ZA 1U7OA 2WIDA 4ZT6A 1EGMB 1G8PA 3MPOA 4LK2A 4F9EA 1IZ9A 4TMYA 3TJRA 4UBNA 4B3DA 2VATA 5JZMA 4CM4B 4MGIR 5C1PA 1H9AA 2QV0A 3EGCA 4EYGA 5JOQA 4RLQA 4LVOA 4EJFA 3UFXA 1G6Q1 3ZXIA 5K0SA 4QXQA 1MX1A 2YVAA 1Q7GA 1EJ6A 2HSGA 1YIOA 2GPJA 2J0UA 3NHKA 1JFTA 2YNMD 3KT0A 1YBVA 1Q19A 1RM3A 3OZRA 1G5HA 1ODCA 3UCEA 4PHHA 3JQ6A 1G3MA 1OWPA 2VQ3A 3AJDA 4M6WB 4U3JB 2EZUA 1CE8B 1W581 3PI6A 4R3NA 1E2DA 1G18A 1XMVA 1Y4SA 2Q2WA 4MTLA 3S2UA 3UHJA 3V7YA 3KT3A 4UNIA 3WR5A 4F3YA 4ZHSA 1XAIA 2REQA 2D5AA 1SVLA 4WL0A 2HK7A 3PNLA 2WG2A 2PS0A 3GFQA 1E2LA 1ZBDA 3AG6A 4E5PA 4Q9DA 5TR9A 5L7WA 3K4PA 5KZMB 3O91A 3TRIA 2YXEA 3K20A 1P9RA 4LXTA 3E5RA 2ZOSA 3G5UA 3OT4A 4P5DA 4PG6A 5LN1A 1GDDA 2V1XA 1KI7A 1CR4A 2A84A 3PIDA 4MPTA 4QTXA 1LI4A 1ORWA 2SKDA 5LLTA 3OF2A 2PRZA 3WMGA 2O1SA 4MB6A 4TMWA 3TLJA 2AJ8A 2ZI7A 4IBOA 1DKUA 1W34A 3TXAA 4OJKA 3LT5A 2G9QA 3JWJA 4O1MA 3E03A 4MS4A 3W05A 1SHZA 3ZQ4A 4O8ZA 2YZ2A 1JA9A 1WMDA 2B20A 2DYKA 2G7MC 2H4YA 4BO5A 1VYTA 3BT7A 2AG0A 4EHAA 2FH5B 3CT6A 4FZ5A 4H7PA 2RHCA 4KI7A 4QAQA 1IOLA 2CCGA 1NDUA 2XUZA 4PNHA 3I0ZA 5SY4A 4YBZA 2ID9A 1OGYA 4XYBA 3LBFA 3SZGA 4LYEA 1I4TD 2YFKA 2O3JA 1OSNA 1QQ6A 3EIOA 4HQ6A 3PHBE 1TAHA 2PR2A 3DMRA 3PUZA 3QKTA 4P4UA 2ZJ7A 3CH5A 3PYXA 4E12A 3MGKA 1UOPA 2GFIA 5BPHA 2J5KA 3PD1A 4PPYA 1N5IA 2J9YB 1C7ZA 3DYIA 1NNEA 1EM8B 1UPAA 4P6VF 3GRAA 2P2YA 2GYYA 2VHYA 1XQ9A 2P75A 2VOJA 3BN3A 1E6UA 4QD3A 1CPYA 3ZWWA 2HIMA 4F5DA 5I7FA 1FLAA 2QE7D 3KQPA 3KVVA 4I5DA 3C8HA 1DEXA 4MHOA 3AQIA 3TNFA 2JRCA 4Q7LA 4ZYUA 2QVLA 5JPCA 4TS3A 1NP6A 3QGMA 1T6YA 2XOEA 2EKQA 2H7CA 5G3ZA 4A5SA 2WHQA 4RKYA 4ZOLF 3WSTA 1GGJA 3ANMA 1N9GB 5CB4A 2WWTA 1I1QB 2G88A 3NXSA 3T35A 1EFTA 1V9LA 2ZKLA 5D7BA 5FIUA 2CUKA 2RBKA 1D2RA 3LQ4A 5DDIP 4C0WA 4J0FA 1JRLA 4N5IX 2IY9A 1JPUA 3B13B 4UCWA 4BU1A 5TS2A 2AXEA 3D3NA 3VC7A 2SCUA 1J2EA 1II9A 4BBJA 2WTNA 1YVEI 2X7HA 2ZEJA 2Y27A 2ZS7A 3MWLA 5F77A 4FOLA 5CT5A 1FJXA 4PC6A 2C92A 1M0WA 1QGED 2H08A 3NTOA 5I9NA 3SLGA 2F3QA 5CB8A 3EQ8A 2FR1A 1D0VA 1PTJC 1A8PA 1P2VA 2BEJA 1OTHA 2FZKA 1CNFA 2ODAA 2XRFA 3NBZC 4MYHA 3HU1A 5TSDA 3TCNA 4YASA 1UOQA 1GL6A 3EOZA 1AUVA 1SRRA 2YZ7A 3GJTA 3OPNA 1CQPA 3OPMA 5FTWA 3M9WA 4JL6A 3GRKA 3N2NA 3NC4A 2D2FA 3JW8A 4CI0B 2Y1LA 1VLHA 1RAHA 2ATIA 2NGRA 4H59A 4LHZA 4M36A 5AHRA 4E15A 2GRUA 5DWDA 4JI4B 4J3JA 1X1RA 2O07A 1T5BA 2PT7A 3CW2A 2WWXA 1MPXA 2E3JA 4LCJA 3DV0A 2P9BA 1L8OA 3EXIB 4JX9A 1WCIB 1N2CA 1QDUA 2X14A 4G09A 1J5EB 1PG0A 4WACA 2XSZA 1S1MA 1U3VA 3QLVA 4KLAA 4KXVA 4ZKDA 3U6BA 3MSCA 1UR5A 5HILA 3VU1A 2Q1UA 4RPJA 3DXFA 2AN4A 4AJLA 3NEJA 1TTPB 4CF3A 3DM5A 1GGHA 4R3WA 5ALQA 4YQYA 2YBEA 5ISMA 1OWLA 1P75A 1SD1A 1XQYA 1X0XA 4MLPA 5HG0A 4DANA 1R6TA 2H2AA 2P2SA 4NPAA 4XAQA 3UK1A 2JJ2D 1AHIA 1CZKA 1GG8A 1S2DA 1TEZA 1O4WA 1PQ4A 5ICGA 5B7NA 1WD5A 2WDPA 1HE1C 1N8KA 3O73A 1U94A 4RHUA 3DFFA 4EGFA 4RKRA 2HNAA 1SXQA 3A6KA 2AZMA 3MMSA 5BOSA 2G40A 1DS6A 4GWKA 3E5HA 3GJ0A 1GNLA 3OIDA 1SAYA 3U9LA 5FPKA 4EABA 3UMSA 2EZTA 3NR2A 1KI8A 3ECCA 3ZI4A 4X94A 1LBSA 3ZK9A 3LM8A 5FX2A 3G1WA 4M9CA 1XN1A 1CQXA 1F5NA 1DIHA 4YMUA 1VE1A 3DZFA 1N2HA 3D8RA 2XPCA 3N7TA 1RKQA 2D8AA 4DR1B 3Q8LA 1DO2A 1AUXA 2C5HA 3G2PA 3NV7A 2ID7A 4JJ8A 3DE5X 4B3GA 1RHRA 1C1XA 2PKEA 2IPOA 3UHPA 4NJEB 3GGGA 1J1ZA 2WM9B 4PLPA 4XM1A 2BE7A 1YO6A 2PIAA 3VO1A 4QDTA 3U5ZB 1F2TB 1XB2A 5IH3A 1KU6A 1Z6TA 3KTFA 3AGQA 4DM4A 1UJCA 4CM3A 1NW4A 2AKYA 3MQ2A 4F06A 1BKSB 4WJKB 5JJIA 4WCFC 2XB8A 4OB7A 1ZIYA 4LTMA 3G2LA 3PEEA 4H7HA 3RVOA 1XNJA 2FE1A 4LRTB 4ZJPA 4ARSA 1JKFA 2D3WA 3FDXA 4Y2GA 1DKRA 2HLDA 2VPPA 1TE2A 4HBGA 4K0KB 3HEMA 1W0KD 4DCVA 2C2MA 2B5OA 4O6VA 1XCPA 3ST7A 1FNSA 2OQRA 4Y2YA 1FUKA 1BEUB 3RFTA 3IEUA 3K9FC 1P4RA 3I23A 1E1DA 2QP4A 1DUVG 3FOAA 4OI1A 1B76A 4WLEA 4EX6A 3NNNA 2I7TA 2IPNA 2CVZA 1BN6A 3GD7A 1NJGA 3I30X 4KU4A 1YRHA 1A4IA 4PRLA 3Q0TA 4AKTA 4LF4B 1JTEA 1SBHA 4IO1A 3C2QA 5B7PA 5CM2Z 1DTWB 4ENPA 3TGPA 1NC3A 4CIVA 2R84A 1IJBA 5DWQA 2R00C 2PUHA 1UBKS 4N03A 2ZB7A 5B2ZA 1X7GA 5IAJA 3STWA 4NBWA 4EITA 3QM1A 4RGVA 4L8GA 1E3EA 2IV3A 3VPBA 5CBKA 2D5IA 3G8BA 4L73A 5IUNC 4OQZA 4TWBA 1OY1A 1Z2CA 5DTJA 1PEKE 2WK1A 1H2YA 3FGPA 2R85A 4PLTA 5FTKA 3VR4A 4MHTA 2HRQA 2WR8A 4G36A 4GZ3A 1ZCBA 1CK4A 1DJLA 4ZOLA 2PE5A 1SGWA 4X93A 1MPTA 1V47A 3RB8A 2QTTA 2Z0MA 3F78A 3JYLA 4M54A 1P2BA 4QRIA 1Z8DA 1R4MB 1OUMA 3BGVA 1QZZA 4J6FA 1H1LA 4QFBA 1L7VC 1WWKA 2VS1A 5K0TA 1XEAA 4UQPA 1Z2DA 3ZEIA 4PYRA 2A9OA 4HWSA 4ZVSA 4KITB 2NZVG 1QTNA 1JVSA 2J3EA 1J0CA 2WAXA 2VDWA 3FZGA 1E9SA 2GCIA 3O5AA 1M33A 1YB7A 3S70A 5IRCD 1ZINA 1SBTA 3O4RA 4PNEA 5BP7A 1G66A 2RIRA 3LRTA 2OXTA 3GJSA 4KR9A 2GS9A 4HJXA 4QRHA 4FFNA 1FRQA 4QYWA 5AVZA 2IYSA 3WGNA 2HDOA 1ZR4A 1DG9A 3CRW1 5BYKA 2A0YA 5KEIA 3R5TA 2I7DA 2QN3A 3VYRB 3GA7A 2GXAA 5A3RA 2ZPUA 3PXDA 1HO3A 1M6HA 3U60B 1RYBA 5ECDA 2I3GA 3QLUA 2OKGA 1RQNA 4CN8A 2I6QA 3DOJA 1UL1X 1TK9A 3R0IA 1Q2UA 2CDBA 2NVUB 1U0BB 1YONA 2IH5A 1UXGA 1ECFA 4G85A 4ZCQA 3TWOA 1WDWB 1OROA 2RGAA 5T5QA 3ZIUA 1WP9A 4GBJA 4BUZA 4ENRA 4G2NA 2XHZA 4E1AA 3V4OA 1LDNA 3OPXA 4ZYZA 1Z83A 2J0SA 4ND1A 3EBLA 3OTHA 1GILA 3ZDAA 2O3TA 3C41J 4JB8A 3RRBA 1Z7YA 3ID6C 5GONA 5JALA 3JYOA 3JAKA 4TMVA 2HU5A 3HDTA 3FN4A 1R74A 4MA4A 2FX5A 1CKEA 4HRXA 4IVPA 3T7EA 4EMTA 5B37A 3BB4A 3B1XA 2GZ2A 1S9HA 1FL9A 1I4EB 3C5HA 3GOQA 4L7VA 4N5HX 1UK7A 4Y9DA 3RAPR 3VC3A 3NBAA 5J2TF 4IW3B 3BWVA 1M2FA 1U0TA 3OURA 4HAUA 1NFRA 2VDRB 3B7GA 3B1FA 2P79A 3UNXA 3AH8A 1DEAA 1YRAA 1DIAA 3F3MA 3K70C 1AD2A 1O95C 1YC5A 2UYOA 4FNAA 2XT0A 4M9ZA 4RD6A 1JKJB 4FGWA 2IH4A 1V71A 3G9XA 5J4HA 1JEAA 3HHPA 2FVXA 2ZE6A 3AEKB 1ZS9A 2PLNA 3AW9A 3LIIA 4PINA 2AQ8A 1UADA 1VLLA 1X7YB 4FFPA 5LLSA 4ZI7A 3ZOKA 2ZUVA 2CNLA 3WK7A 5CTAA 2VJBA 4FNOA 2Q3BA 3O4JA 5E0KB 1NNUA 1DSSG 3AFNA 2A14A 3R6WA 2QI9C 3D2LA 2ZJ5A 1MGPA 1TK2A 2FCAA 4DPMA 1JIQA 1DBIA 1K0FA 3OQNA 2BP7B 4DRXB 4KGVA 2WT9A 1TYEB 3D1VA 1LEHA 1EAMA 3GMSA 4IZOA 4N7JA 1L4EA 4Q1FA 1VJTA 4X1YB 2YYAA 2PZBA 3L4SO 2DMRA 1IB6A 1KIAA 3C8MA 5E6UB 3BRWD 2Y05A 1E6WA 3SE0A 2ZXEA 2GT1A 2W6QA 4PZUA 2VTBA 4C4OA 2V03A 4JC0A 4ZU3A 2YVKA 5B6IA 2HA4A 3FB4A 5KKAA 4C4ZA 4EKNB 2JGJA 4IMRA 4U9HS 2E4ZA 4A0RA 2P7HA 3E3LA 5B3JC 1PNQA 4BIMA 1NA5A 1XRPA 3ZG6A 1TFUA 2P5YA 2YIDA 4NEGA 5I47A 4KQEA 4E22A 3MCZA 4FLMA 2GESA 1XA0A 1OREA 3FNEA 1QIDA 4MPDA 3EGIA 5C1DA 1Z4QA 3A3NA 4IXWA 1VL1A 4PWZA 5EWLB 2ZCVA 1YDMA 2HZ7A 2XMQA 4G0NA 1ZWLA 1LX7A 3UWPA 3ZE1B 2WAYA 1RWVA 1FYWA 3MYYA 2XBUA 3D6FA 3QJ5A 4EHBA 4KGDA 1K2VN 1VLMA 4E7OA 1G21A 2JAUA 1G8YA 4PHCA 4E13A 3K05A 3TKYA 1VZ2A 3TN7A 4J8PA 4GWLA 2JFVA 1AQLA 5CR9A 5TGDA 3R7DA 3WBFA 1RACA 5IM5A 4TL9A 5B64A 5DX0A 4ZYXA 1G55A 1Y98A 2A30A 4G9BA 2QJOA 1RHKA 2PBRA 5HFNA 4DMLA 4YJ3B 4XRGA 3SMVA 1SQ0A 3E4DA 4ODIA 3RT7A 4RBNA 2O2JA 3FPEA 4XVUA 2XTJA 1DHTA 3RRFA 3KR0A 3OZIA 1L4GA 4DMRA 3L7OA 5H82A 3HCNA 3P2YA 2COKA 2OP1A 4KOAA 4TYNA 4HKTA 5JJKA 5EWJB 1BXGB 1FFHA 3FPJA 1QFSA 1B0ZA 1N8NA 3C4QA 1T3TA 3HA3A 1C0LA 3L46A 3LQQA 4IQ4A 1O96A 5CYPA 2D7DA 4CMJA 1M76A 4AECA 1W4BA 4FFVA 3S68A 4XQ9A 4HLCA 2ZJ1A 4YA6A 2O7NA 2FEPA 2JGKA 4HGRA 4QFMA 1DAPA 1L4MA 3IAXA 4HH0A 2R1TA 4GOXA 1UKCA 3IQWA 3DSRA 3GFRA 4P2GA 4PG5A 2WSBA 4G26A 3ADDA 1E0AA 4UZSA 1MXFA 1C9MA 1WAMA 5KQSA 4G5FA 3N2LA 3H9BA 3NDJA 2P3LA 1Z15A 5DOVA 1OFTA 2WLSA 3JQ7B 3U1VA 3W2TA 4EJMA 3UPTA 3CZAA 5L6MB 1KAMA 3UKJA 3O83A 1U1EA 2G9UA 4QGFA 4OYLA 1EK5A 1GUDA 1XMSA 1YB1A 1C1DB 4BUCA 3QY0A 5NLLA 2AR0A 1X9GA 2WBLC 4A4DA 3GO4A 2MJLA 2PMBA 4PO3X 1GKYA 3FKQA 3AUAA 3UMBA 4C3ZA 1MT0A 2XUGA 3DVAB 4LJ8A 5AI8A 5KOHB 4EJ0A 2PDAA 5KYWB 1IXYA 4M8KA 4LNUB 1FRNA 2NTJA 1G21E 4F4CA 2ZRNA 2XAAA 5BSGA 4RA6B 5KU7A 2ZAYA 4F3NA 1ODIA 1B8UA 1T36B 3MWFA 1L9XA 3C7DB 4PR3A 2NP7A 4MA5A 4MRMB 1QIEA 1WY5A 3AXSA 1P3DA 2RG7A 1QOPB 2ZYVX 1EHCA 1XXLA 4E08A 3RWOA 1G59A 1OTYA 4M7WA 4PZ0A 3QPVA 5K0EA 3DZDA 1AKNA 2Z8YA 1SPXA 4UTZA 1JFRA 5ADWA 5FR2A 3REGA 4YQZA 2J5RA 1T4CB 1USKA 4DWJA 1UZLA 2WT8A 2XWPA 5K3DA 1NBWB 3GIDA 3NFYA 4G4GA 3RRZA 4A1OA 1WJGA 1UXJA 1LS6A 2OCGA 1SUWA 1P6XA 4MEAA 3MBKA 1SG0A 3J7TA 3L05A 4OBEA 4YO7A 1H22A 3AFGA 2YN0A 2NO4A 4FX5A 1D4ZA 3JRWA 2O3RA 3PGA1 1Z08A 3FPSA 3I2IA 1GRRA 1Q0RA 3A1TA 4KTTE 4PC2A 3ADBA 4KPUB 1WVMA 2Y67A 1JMKC 1H05A 3H5OA 3IXLA 3TINA 4Z4GA 4NMLA 2N42A 5BN3A 1NMEA 2I2FA 5AYVA 4LQ4A 4OSPA 3RRJA 1YUMA 5G4LA 4FMCF 1HYGA 3CB2A 3CW8X 3DKIA 3H2GA 4FYPA 2FOLA 4JJGA 3X1JA 3CVUA 2BFDA 1IY2A 2Z5LA 4MUEA 1PLLA 5D8DA 2E4VA 5TQ2B 1WU8A 2F1IA 3R7AA 2QIPA 3ETDA 4FFMA 2D06A 2QZ4A 2VTKA 3JD3A 3NWPA 2X42A 1JDBC 3JVUA 1Q17A 3UH1A 3NTQA 3Q12A 3HYNA 3UT6A 3P1JA 1DAEA 2L82A 4JQCA 4H0NA 3T0GA 5DBEX 4UJ5A 3AY0A 1X3SA 3OKAA 4TRJA 4E03A 3FAKA 1Q1BA 3KUXA 2OGTA 4ND5A 4RENA 5K0NA 2OENG 2FFBA 3EE6A 4ESHA 4JBYA 3FSGA 4RM2A 4G89A 5DKFA 5A4FS 121PA 2D1TA 4TTTS 2IF0A 3H5RA 4A6EA 1N0VC 2HLPA 3KM0A 2AYXA 3DMTC 1AB6A 1J99A 3VDNB 1RZ3A 3AUSA 4DKJA 4HZUB 3RBZA 3ANYB 3A1SA 3UTCA 1A27A 4YCMA 3OLCX 2P1ZA 1N8TA 3FYTA 3ZHXA 2CV0A 3R23A 3VU0A 1LBIA 4DC1A 4PO1A 3EXHB 3WA7A 1XZIA 3GK3A 2AV6A 3GG2A 4J0GA 2Q6KA 2R86A 5AI9A 2PWPA 2Z3VA 2RFLA 4EO9A 2VRBA 5TEWA 3PEWA 2NV6A 1GP2A 4QOGA 1TTQB 2OLKA 4ZRMA 4RDCA 1NVGA 4L07A 3ZDCA 1ADCA 1U0NA 2G08A 2G80A 3BRCA 1Z4MA 4DB4A 1ZR2A 2XITA 2ZZKA 5F5NA 5CD9A 1KEEB 3VI4B 1Z33A 2O2HA 2V59A 2ZI9A 3HNOA 4UUAA 1F8FA 1SUDA 1IN1A 1DP4A 2HA7A 4IG4A 3QIAA 5DHUA 3ROFA 1TYDE 1V39A 1TA0A 2QXUA 4KE7A 1E59A 2JD0A 2QMEA 3A11A 4MV1A 4X3OA 1Q3TA 5EVJA 4CF6A 2IWRA 1CTQA 3BXZA 5ERXA 3TD9A 4AWAA 5KBYA 2JEZA 1IHPA 3HLKA 1ACJA 3I92A 3KV3O 4W4TA 1PZEA 4H7FA 4XGNA 4YJ2B 3T61A 1MDBA 3UICA 5CX1A 4CTJA 3X0DA 3TPFA 5AOAA 4X54A 2G28A 2VJMB 3LJKA 5U4QA 1OLOA 2RKOA 5T64A 4ENTA 1QH8B 1A8SA 2GPTA 2O48X 1IONA 5FBWB 3RHZA 3OMLA 1JAYA 4URFA 4CMHA 1VMKA 4C14A 4YJGA 4IH1A 2WNIA 1GUFA 3D7NA 3HA7A 1R6BX 4CE6A 4MO9A 4HXFB 4BFVA 3H1BA 2Z4TA 2VBGA 2K2QB 1X8LA 4A8HA 1BHSA 4G0MA 3OEED 1RI4A 3EPRA 1XYVA 4MAFA 4F3KA 3L04A 3T94A 1Q0UA 4NZZA 2QUIA 1I6WA 1H4SA 1T0JB 1P7VA 2XIQA 2OBMA 3T1QA 4DMHA 3R3WA 2JIBA 1P80A 2C59A 1EDDA 1WNTA 3U49A 4DIDA 3JV7A 4LA4A 3HCCA 5MDHA 1JXMA 1UDXA 3KIPA 1YQQA 1BVUA 3KKPA 4DLAA 2O54A 3HCDA 2I4TA 3D8HA 3DZJA 3EZ7A 1JILA 2BEWB 4JLKA 4V39A 1R66A 3JARA 4J1SA 3TR6A 2Z95A 4OHZA 1NMQA 3PXCX 1KFBB 3EC2A 1NXTA 1LJ8A 4YPVA 1QM5A 4PX3A 2DY0A 4MDHA 2EFEB 2HYIC 1L4YA 5BV0A 4C78A 3MT7A 4NARA 3H5VA 1ZX1A 2AD1A 5EEGA 3G0OA 5EVCA 2NZUG 4Q3LA 2XTAA 3LC7O 1AGYA 1LPNA 1E3LA 5ED4A 5ICCA 1TM2A 3BWCA 3QBEA 2QGNA 3EB9A 4Q4AA 2G1UA 2ZJBA 2CXOA 1PZHA 1VM6A 3RVNA 2XDWA 1NYRA 5AHWA 5AKIA 1WPGA 2DR2A 4IHAA 3ZJ5A 4E1BA 2PZAA 4AJPA 2FFHA 4Z5XA 3EQZA 4EBBA 4Q4HB 2JBAA 3W5JA 3WWPA 3GQBB 2H31A 3ILSA 5KVAA 2WJAA 2AX4A 3OZDA 4OCZA 1NLFA 2UYQA 3AWIA 1UDRA 1FRVA 3DGFC 3TZLA 4A26A 4I1YA 1JI3A 6ABPA 4DR6B 1QBGA 3FNIA 4M8NE 1P9OA 3RT1A 3G2NA 1UT6A 4J03A 2W71A 3U3ZA 5LDDC 4G2TA 3LG2A 4TXHA 1F48A 1D4FA 1KO7A 2B8NA 2GFHA 1CEYA 1SXIA 4ZQBA 1DIGA 2Q6TA 1O58A 1XCBA 2V7QA 3DPSA 5AQEA 4AVYA 4BECA 1OF1A 1DPGA 3CUVA 4ZCSA 4GLLA 3UFXB 2GA9A 3FNRA 5IASA 4RK7A 5JXWA 1G2QA 3ORSA 5FP0A 3ZD6A 4C2BA 1XPUA 1UM8A 2UZ4A 4TTSA 4B6PA 3QWHA 1GA4A 2J0UB 2OHOA 1D9XA 1UJ6A 4QKQA 5A5VA 2RK4A 3I12A 1WZEA 3IEKA 3M4JA 1TVEA 3HXOA 5LM3A 1ZI6A 3JD1A 4CEHA 4P4LA 2JGRA 4BMXA 3SHWA 4LGYA 1T5HX 5I7OA 4FFRA 4K9LA 3MGCA 4LOIA 4Y6QA 4NOJA 2FW6A 4PQYA 4OOEA 2ZUTA 4LFBB 1YB5A 1JR4A 3OCVA 3QF7A 4IIHA 4EA6A 4Y1RA 2REQB 3HCAA 3R09A 3LC1O 4DLRA 2HX1A 5C52B 3FCCA 3ZJ4A 2ZI6A 1JHPA 1YQUA 1GQ2A 2VRWA 2H1SA 2XEDA 1MVLA 4AJHA 3FHJA 4R01A 1NVUQ 5GM2A 2FKAA 2QY6A 3KVOA 1YQTA 3N0WA 4EUFA 2D5LA 2JL1A 4GUAA 1U4SA 1GYQA 1V11A 1L5MA 2YJ5A 3MUNA 2H06A 3PCRB 4HLNA 1JTFA 2VK4A 2XT9A 1JWAB 2K7FA 4AJJA 5ALJA 1ZW1A 2HPVA 4MPPA 4PPQA 4FQ7A 3H99A 1DQRA 2B1JA 5F98A 4ZPXA 2CWWA 4AMUA 1Q5PA 1V3UA 5CPBA 1VCOA 5FWDA 1Q77A 1JU3A 3Q9UA 3LCMA 4MS4B 3ZZMA 2OBFA 5IJ0A 1L1RA 1NMXA 2K7ZA 2PSDA 3GFOA 1JQEA 4P34A 1FDRA 3QP9A 4FFBA 5G41A 4GSLA 3OP4A 2B9EA 2W6ZA 3QKIA 4IVNA 4S2EA 2OSVA 2ZBFA 4D79A 1N57A 2ZS8A 3GLIA 3NNSA 2WFZA 3DLHA 1E3DA 3C3EA 3EF0A 3KXPA 5EP2A 4HNQA 2YXBA 2A1UA 4KMSA 1NNSA 1OBHA 3MJCA 1W0JD 4QVIA 2HMAA 4BQIA 2R7NA 2VDKB 4BX8A 4V0QA 1IRIA 2Z2JA 4JYBA 3OSUA 4M22A 4R8KA 4D80A 3M6XA 3TXXA 2GZAA 2C88A 2IDZA 4OLFA 4OI0A 1Z3IX 2OHJA 2GHIA 3M2PA 1PV4A 4CM1A 1ITZA 1EEHA 2DCMA 3KXKA 4PO9A 3CWQA 2I6GA 2OOSA 5EUMA 5EUQB 3F5DA 1N6IA 2BZGA 2IIBA 4EFDA 5BQFA 3LBNA 3MJTA 2PLAA 4GGPA 1UP7A 4NMMA 1SFRA 4B2YA 2CSXA 2V98A 2X86A 4FSHA 1CJUC 5CCXA 3ICQB 4TLAA 1FDIA 4XSHA 5CB4B 4S04A 5H80A 4ZYYA 1U98A 1ISPA 1E77A 2FKNA 2J08A 3G0GA 4RIHA 4S2UA 1ZONA 1LI5A 4F91B 3WP0A 5KYTA 3NBQA 3QX7A 1KOLA 1G6HA 1F0PA 4AO7A 3HCOA 4EDFA 1RZRD 2HBQA 2OZEA 1VKZA 2FSIA 1E4VA 2SCUB 3A6DA 3PNQA 4LE2A 1E2HA 1LNSA 3WX0A 5F33A 5GJWC 1DNPA 2RE8A 2AIRA 5HGJA 1WXHA 1HDZA 2FXVA 3BIXA 1KMHA 3DOOA 4TTPA 4Z0PA 1YZFA 4AS1A 1SNYA 2XDAA 3CRQA 1OXBB 3FYHA 3JSAA 2B4QA 4ZDWA 1KMCA 2R11A 4NDNE 3T3IA 3RW9A 1BWRA 2OV8A 3OMXA 1U4NA 3IMFA 1A96A 1ZOIA 2R4UA 4LXYA 3OCWA 1YZNA 1RYYA 2QSZA 2O5RA 2VC2B 3KJQA 3PKZA 4KWEA 2VQEB 2BKVA 2BHNA 1C7QA 1MH1A 1K8QA 4L22A 2NSDA 2OWDA 5HTKA 5EJFA 1BFDA 1I1OA 2HF7A 3LHSA 1Z25A 1YIDA 2ZBQA 2FEAA 3L4BC 3L7KA 4HGOA 4B3FX 3IUJA 1R0BA 1MRZA 1YI8A 2RGWA 2P90A 3OG9A 4ZEOA 3EQ6A 1EIWA 3DV0B 5JD4A 3K5IA 4QDUA 3A4YA 2PMCA 1N2CB 3PR2B 3V32A 3LHFA 2VSQA 4CMKA 2GZHA 1WM1A 5HIIA 5K3CA 3T1VA 5A9SA 2W6JD 4D9JA 3CLTD 2AB0A 4C7JA 5HQTA 3IO3A 4N41A 2OGSA 4YRNA 3EW7A 2X6QA 3WDLA 1T5TA 5A0VA 1G4HA 3IUSA 4CIAA 4J0JA 2IOFK 3NHFA 2ZYUX 3C98A 4G1BA 1JIIA 1PT6A 2EIHA 3B5JA 3RKRA 2C1XA 5D3KA 5ECGC 3F97A 1VPLA 2FP4A 3VOBA 2FSSA 4Z1MA 3U19A 2PO7A 4EG7A 1KK3A 1T1GA 3U2QA 5BO5A 5LVAA 1YR7A 1GTSA 3FOBA 4DLVA 2FW8A 1H69A 3ETLA 3TQIA 4L5IA 5BOSB 2NU9A 1R9GA 4CCYA 2Q1YA 4DLLA 2ACKA 2V6GA 1Z7EA 4TYMA 3T5GA 1XRMA 1ADYA 2I6TA 2J6CA 3ZGNA 1SQSA 5EJ7A 2RGCA 3CEAA 1W0CA 1XCLA 2G06A 4R1OA 5IT9A 3ZVMA 1L4KA 2ODPA 3MJHA 1WF6A 3KOXA 2LVBA 4ZT4A 3T5CA 3GYGA 2ENUA 3O1IC 3EIWA 1FMTA 3FYUC 4MP6A 3JWGA 1C1XB 4I55A 1U8XX 3I5AA 5SZIA 3B78A 2NPFA 3RM3A 3H2JA 4DV5B 1CSEE 1WXQA 3DTYA 3A7DA 3FPGA 4Z3DA 1Z35A 1YFJA 3NBXX 2FFRA 2FR0A 2H6EA 2KHZA 2P9QA 4LTNA 4WKBA 4Q4CA 5BXYA 5KYYA 3RK4A 4YCLA 3QYAA 4BVBA 1ZXLA 3Q88A 3RFVA 7MHTA 2DM6A 4D8UA 4ETIA 3U7RA 1OASA 2JGAA 2Q4DA 2GCEA 3A10A 4G1MB 3CCCA 3Q3VA 3T3GA 2FE4A 1QPBA 3OUUA 2DLNA 1NASA 4RMHA 5LZ2A 1TL7C 2XNCA 4JN6B 1CRLA 2V4UA 4TT8A 4ZKEA 3S27A 1D6NA 3RADC 1IM8A 1Z5WA 1K4YA 5KCMA 3PENA 4C7XA 2IX3A 5EGNA 2XVMA 3A6PC 4H7JA 3R20A 3OX2A 3H5WA 1QFYA 4B17A 4D99A 5MFPA 3P9QA 1K1EA 3UAWA 4BCDA 3HDYA 5KQGA 2ZYIA 3WZ2A 1VDZA 1LTHR 1JQJC 2DQZA 1E8NA 4K81B 1OFUX 4B7ZA 1RMYA 3KQMA 4RTLA 3A9RA 1TKRA 4D6XA 4JNKA 3PTLA 3ROTA 4Y3UA 2BI7A 4AZSA 4I4TA 2QLLA 5J4LA 2QUZA 3MTAA 2XWBF 3L18A 4TRRA 1QH9A 2BM9A 2LRHA 3V42A 4A0SA 1UZUA 4D2IA 2QI9F 5K4GA 4B0PA 3KSZO 1Z17A 1QTQA 5FUYA 5HHTA 4YMIA 2QYOA 4ON9A 5KAMA 4DN6A 3AVVA 5BW6B 4HGYA 4D4HA 4BVKA 1TCVA 1KDVA 1PJ3A 2HA3A 2MWMA 1WZIA 2P77A