3AUJB

Structure of diol dehydratase complexed with glycerol
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
179
structure length
179
Chain Sequence
b'GFLTEVGEARQGTQQDEVIIAVGPAFGLAQTVNIVGIPHKSILREVIAGIEEEGIKARVIRCFKSSDVAFVAVEGNRLSGSGISIGIQSKGTTVIHQQGLPPLSNLELFPQAPLLTLETYRQIGKNAARYAKRESPQPVPTLNDQMARPKYQAKSAILHIKETKYVVTGKNPQELRVAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Redesign of coenzyme B(12) dependent diol dehydratase to be resistant to the mechanism-based inactivation by glycerol and act on longer chain 1,2-diols
pubmed doi rcsb
molecule keywords Diol dehydrase alpha subunit
source organism Klebsiella oxytoca
molecule tags Lyase
total genus 63
structure length 179
sequence length 179
chains with identical sequence E
ec nomenclature ec 4.2.1.28: Propanediol dehydratase.
pdb deposition date 2011-02-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02288 Dehydratase_MU Dehydratase medium subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold B12-dependent dehydatase associated subunit 3aujB00
3WB0A 1UC5B 1DIOB 5D5QA 1EGVB 1MMFB 1IWBB 1NBWB 3WB2A 3BRCA 1IWPB 5D5PA 3WB1A 3AUJB 1EEXB 1EGMB 2D0OB 2D0PB 1UC4B
chains in the Genus database with same CATH superfamily
4BO0A 2AYZA 4JGIA 1WXXA 621PA 4IAOA 3EQ9A 2G1AA 3ER9A 5JRZA 3PE3A 5IMSA 1HOTA 4X3PA 3L8CA 1MFZA 1B15A 4GZ5A 1VRCA 1EFRA 2WT9A 3RODA 1VECA 1PUXA 4C06A 2FWJA 2BC9A 2NUTB 2YOGA 1VHLA 2PQMA 2WM9B 4QO7A 1K5GA 1PD1A 2EERA 1SIBE 4JT9A 3WWPA 1T2UA 1TIBA 3IOCA 3D6TB 2BTOA 3JYHA 5FF9A 1A8IA 4YCSA 4YR9A 3QU5A 1RWXA 2HA6A 2HU2A 2OPBA 3PX7A 3K5WA 1KEZA 3P5BA 1A5TA 1DJPA 2O0KA 2VAWA 1YKSA 1YVUA 3LG2A 2ZATA 3UVEA 4LK2A 4ALMA 6REQA 4V1CA 1KFCB 1GG9A 1LF5A 1KSHA 3CZ5A 3QPDA 3S1AA 4F5WA 1X8JA 3I61A 3IVCA 1UIMA 1B16A 3OKFA 5I9TA 1SXHA 2ACKA 3C41J 3N2ZB 1MEOA 4B1FA 2FW7A 1DLJA 1IG0A 1P91A 2BZSA 3KEFA 3PNLA 1EYZA 2I4MA 2JIQA 3GYGA 1FRNA 2IODA 2WWTA 4YRAA 1RS0A 1B7GO 1M6VB 1O87A 5I7SA 4BNKA 5LA6B 1R6TA 7MDHA 4GOJA 3L46A 2J3LA 1XRRA 3FUXA 3DEHA 2OXFA 3GD7A 3LWNA 5EP4A 5TMBA 2W4IA 3QXJA 3SHWA 1BH6A 2X7HA 3JYNA 5BRNA 6ADHA 2AWOA 5IS2A 1FDIA 1JPJA 5TMEA 3VR4A 4DCJA 2EEPA 1K7SN 2E7ZA 3KJEA 3WHKA 3KLOA 5LZ5A 3LI2A 2P9JA 2BOVA 4BLRA 3JAMA 2PJRA 1QMGA 4KUHA 3S4YA 4HDRB 4DSAA 3ABZA 2IVZA 3BXGA 3NT4A 3KG2A 1J25A 1EHIA 1JTVA 1JDTA 3PFCA 1V4VA 4X9XA 1HA3A 3IVMA 4L6CA 2PZGA 3AHGA 5DWQA 2VVTA 3C3PA 2GD0A 5AXBA 3SGLA 2H08A 3O4VA 3EG9A 1QR2A 4B3MB 4E2YA 2BF4A 3P2IA 4E7PA 5A4IS 2WINI 3F9IA 3EW9A 4FC7A 1TB4A 2CE2X 4P4TA 2WUWE 5I9SA 4RFSA 4GEKA 4XJTA 4LF8B 3V8EA 3ZV6A 3CRRA 2W43A 4TV9B 3DGFC 4TN1A 3T95A 1R0ZA 2O8CB 3DFUA 3IEKA 5COAA 4CL2A 2FSFA 2WI8A 4HLDA 4YCDA 5H3CA 3O4HA 4DEXA 5B6PA 2R65A 3PR2B 4RHXA 5KYUA 1SQSA 4D9BA 2RSLA 2AFIB 1RE1A 4DT1B 4ND5A 4US0R 4RQUA 4A5OA 4TV8A 3BKWA 3EZLA 1QYCA 4ZDKA 5CLHA 2XUOA 5AHXA 5GM1A 2XY4A 2VJQA 1EU1A 4NONA 5C80A 5DGTA 4BNDB 5AK3A 2FQWA 2Q46A 3QWFA 3PFKA 3S70A 1DUSA 1VBNA 2N9UA 1RWMA 1OU4A 1N6PA 4K6CA 1NG9A 1C1XB 3WJAA 3FLBA 5CT8A 1RQ7A 4IOLA 3AU8A 4ERXA 2V4ZA 3VNRA 1MIHA 2PUFA 4K9RA 4Z9FA 5E2IA 3GU3A 3TLXA 4LVOA 1EK6A 1GV0A 3MW8A 3FPEA 4HPJB 1ZU4A 5BQ5A 4W9RA 5BR7A 1J8QA 3P97A 5K0NA 3HCRA 4RGYA 5ES3A 4O2AB 2W00A 4LY3A 5FBQB 1UJBA 1SR8A 1CQJB 3IPAA 4M1QA 3U4IA 2NVBA 1BGWA 2OCXA 4L4XA 3RV3A 2E5FA 4Q21A 5IKPA 1P5FA 2C98A 1U6IA 2XWBF 3BE4A 4BLTA 1Y5LA 3W4JA 1Y4ZA 3JQFC 5J40A 3MXTA 5P8WA 3I6IA 2AQHA 4X61A 3CLUC 1C8LA 3T3MB 5CYGA 3GRRA 5CDTA 3L41A 4TWBA 1JLHA 3LDUA 4LXUA 4B2PA 1CRPA 3WJ1A 1JZQA 2BFMA 1OHHA 1T3GA 2FW0A 1OPXA 2HJ9A 3W7AA 2QTVB 1QHHB 1J5XA 3S28A 5CBPA 1NVMB 1NVUQ 1PR1A 2HC9A 2IPLA 3A7EA 3RHFA 5C8YF 1BRTA 1JSZA 4XUCA 3WRYC 1M0WA 5HKBA 2JJYA 1IC6A 4YRCA 1QE5A 4JA0A 4TMFA 2F48A 2YFKA 4YJ3F 3BTOA 4IIHA 4U8HA 4OI1A 1KEWA 1S8OA 4L75A 4QX6A 4TSRA 1WMDA 3LT0A 4JELA 4HT3B 3BFKA 2AFHA 2KWIA 2LP4Y 2X1MA 3UENA 4F0JA 5B5SA 2BBSA 2R60A 4QGAA 4V3BA 3PZBA 2LKCA 4F56A 3Q7RA 4X8OA 4MR9A 1F7UA 3A4LA 1NDUA 3ELYA 2CWWA 1BXRA 3LUFA 3M4ZA 1XJ0A 3U4CA 4RZ3A 4AFNA 1QNFA 1Y7IA 4P5DA 4RKRA 2EZUA 4D82A 3PLAE 1ZL0A 1QJ4A 1XZAA 5BT9A 2GBLA 1P4HA 1XZKA 4BO1A 4DC1A 2P8SA 5I01A 4DLLA 2R00A 3AEUB 1EDDA 3SHOA 1FVOA 4QBGB 3O4GA 4MVJD 1MOSA 4EI2A 3WKBA 2PUJA 6ABPA 2WF7A 3JAKB 3RVNA 3I0MA 1KSFX 4YECA 5JBQA 5EIBC 3G82C 2B0CA 2A4MA 2P2GA 2WJAA 3TW8B 4M7WA 4BJ5A 3KZOA 4EKGA 2XXAA 1FQJA 1YASA 2VJAA 2CLIB 4HS9A 2ZYGA 3CGWA 4UARA 4ECAA 1WDLA 2HT1A 1NX9A 1G18A 4GKAA 5LUBA 2QU8A 3TGLA 5AJVB 6YASA 3DT6A 2EARA 3G0BA 3GVXA 1NU8A 4HRAA 5FLKA 2RDMA 4G09A 4YJGA 2BSAA 1J42A 3PENA 4P93A 4KQXA 5DX1A 1GUBA 1J39A 3PF8A 4S1PA 4A1FA 4BV3A 3ETJA 1O4WA 4KIWA 3QKTA 2BMDA 3TZHA 1NZFA 1OQAA 1RHJA 5U4QA 4Q4CA 2CXTA 4AYXA 5AHKA 3GJ4A 2IV2X 4EPVA 4WOJA 3ZKWB 4M76B 4L27A 1P1RA 1UFVA 1SC4A 1N4AA 4B7AA 3L6OO 4I5IA 2XR1A 1XRMA 2ZI7A 3BIWA 5CT9A 1TIPA 2AR0A 2IPNA 3H87A 3IB3A 2GNOA 3PQ4A 3UCFA 5AM5A 3C3YA 2OCDA 3KCNA 5KQSA 1Q11A 3EVAA 1XXHA 3FPHA 1HSZA 3OZXA 4LJSA 5K0GA 4L50A 4D56A 1E9DA 4N47A 5C7YA 1J33A 3R0QA 4RS3A 3PGLA 2XUGA 2SKEA 3LT5A 4R1OA 3O8OA 4NE2A 1TF2A 3C3JA 3SHFA 4QG3A 1ZD1A 3H2SA 2DUMA 3ZEAA 2ZKIA 4ZMRA 1WDTA 1XUOA 3HH8A 1YZKA 3HRIA 2XRZA 1Y1RA 2E1PA 4U7HA 5C3UA 4INPA 2PUHA 4M49A 4ODIA 1XSEA 2CVQA 2QGFA 3NH6A 3ORHA 2IYFA 2NWQA 4TKVB 3N2GA 3DV9A 5LZ7A 3MBKA 10MHA 2CMDA 4GX5A 4PSAA 1ZK1A 3DCNA 4OAQA 3RUCA 3KR2A 3VU9B 4HMOA 4AY2A 1UAYA 5L6LB 3R5HA 2VYVD 1BGVA 1LCIA 1XD2B 2A7QA 3MQ2A 1Y98A 4O6VA 4C4SA 2O8FA 2FKNA 1S2MA 3TLEA 1DEOA 3CX3A 3CVOA 2YQZA 1BOFA 1F1JA 1MIOA 1CUBA 5DE3A 1UBOS 3R3SA 1JWAB 2XEDA 3C0KA 3F4BA 3HZRA 3GNTA 4MCAA 1JEEA 4N5DA 4D9KA 3JVIA 1CX9B 3T3EA 1BKSB 1UXOA 2NYVA 3PHBE 3K8ZA 4GIBA 4EG7A 5EJ4A 2PUDA 4KRFA 2DT8A 3VKUA 4ZQIA 2OFFA 3PDUA 1GNVA 2EV9A 3F7NA 3I6ZA 1R64A 4GI1A 4AU1A 5JSHA 5LQKA 2EL9A 3QUBA 1QV9A 4P38A 3H3FA 3DL4A 1RLJA 3QE2A 4CM6A 3A9VA 1V8BA 4PX5A 5TXGA 1N78A 4DLTA 1FU7A 2WKWA 2CC2A 1WIWA 5EIHA 1ZNZA 2JZCA 4K6FA 1N6IA 3I58A 1MC8A 5DBHX 5DGDA 1GA1A 3F7OA 3WMFA 1HEUA 5A2QA 3MTAA 1RM0A 2G1PA 1U1EA 1SEVA 2O4CA 1G2PA 1EH5A 1WD7A 4A73A 1BW9A 3QPUA 4F1KA 3GJXC 1X9GA 4ZI7F 5C1DA 5I7WA 2WK1A 3S2IA 4YNBA 4I5GA 3G02A 4IYRA 4B7UA 4BNHA 2QRLA 1OBCA 3C3CA 3OU2A 1D4OA 2P3SA 1ATZA 2AF3C 3OIFA 5KAMA 2AN1A 4JROA 4B8WA 5CFQA 2EU8A 1K3TA 1PEKE 1ZGJA 3AHHA 4G5YA 4GDMA 2PZBA 4LRXA 4OHBA 4RH1A 4XSGA 4XW2A 2XLBA 3WA6A 3GLRA 3QVOA 4MW1A 1T0BA 5D1NA 2YMMA 4JT4A 1VIMA 3PQDA 2ZE8A 4JOCA 2ILTA 2FOIA 2GLUA 5E7QA 1E0KA 1N0HA 2I3AA 3SVZA 2HO5A 3EQ2A 2ZR0A 3KTFA 1F3OA 5EZYF 4HDMB 4KMOA 3M5CA 2R1UA 3EXEB 1S8AA 1YAJA 1N2BA 3JD2A 1RKBA 4Q9IA 4XWOA 2V55B 1CS4C 4EQ6A 3HCCA 1NMQA 2MINB 3PWKA 4X3CA 1E0SA 2IYVA 4QRDA 3Q98A 2RK6A 1OLSA 1OX5A 1WY7A 1X7XB 3H8JA 4HX2A 2OAQ1 1UP6A 4S35A 1LLDA 3G0GA 4II3A 1SY7A 2VUTA 2BWJA 1XD9A 1OJ7A 1T1IA 1PNVA 1DAMA 1I80A 2AMJA 3B1FA 3FFTA 1AVTA 3WLFA 4EEXA 2QOEA 5H1YA 5CCEA 3C3BA 2QTAA 4CMIA 4ZV4A 1EQ2A 3RYIB 5HZMA 2MHCA 3O7MA 4DEYA 3KT8A 2P9YA 1OAKA 2OFWA 4K2AA 2CSUA 4RH3A 2FEAA 4CT0A 1QHIA 4JI7B 1H1DA 4Z7JA 4HRVA 2FP3A 1FY2A 4KVZA 3GJ3A 4E46A 4EECA 4YT8A 4OH7A 4EAAA 4B3IA 4LKRA 4YH1A 2DPLA 1MVOA 3E5RA 4HO1X 2X8LA 4LSMA 1EXNA 4JYZA 1JH9A 1CG6A 1U4SA 2GPJA 3T9CA 3N8IA 4YJDA 5G3YA 2O9JA 3TLMA 5JNWA 3I4CA 1N7JA 1V1MA 1YRWA 4Q7KA 1CQIB 4UM8B 2DYKA 3WGLA 5CITA 1X7DA 1P6XA 1RBMA 4FCCA 3Q3JB 1R4MB 2B7LA 3QVSA 1EP9A 5CDFA 4PC2A 2ZBUA 1ZNWA 2UZ1A 2G4CA 3B3AA 4Q9NA 1D5CA 3R7AA 3GP3A 2V97A 3T9DA 4F91B 3JVEA 2JBAA 1B14A 1YMVA 1XQ9A 1KDOA 2Z2XA 3IE1A 2Q6KA 1TNDA 2VQ3A 3AUKA 4N3NA 4M46A 4EF6A 5EEGA 5F7XA 3BRWD 4P3XA 5BSRA 1TQ2A 3HSKA 1BWSA 3ONWA 1T36B 2BTEA 1T9CA 2C5FA 2FQYA 1GKLA 4MUXA 2G4LA 1P6QA 4RDIA 1LJUA 4FFNA 3I4FA 1F1BA 4EJSA 2O2DA 3Q8XB 3RU9A 3ZTWA 4PS0A 4C3VA 4RCVA 2FG6C 2IIQA 4FCTA 3S68A 3S27A 1TI7A 4P32A 1TZ2A 2DBVO 2QR2A 4WJZA 4A91A 1ORHA 1Z75A 5CX1A 5T6BA 1DG3A 2OHJA 3F98A 2A1UB 4AMUA 2BGTA 3X1WA 1E60A 2XE4A 1Z5GA 1KY3A 2ONZA 2XGGA 1NN3A 4FE7A 4HYQA 4MVJG 3K0CA 3UJBA 2O7SA 3HR8A 4GC9A 2AG5A 3ROMA 1ZMBA 2G88A 5F12A 3DMTA 2A0UA 4U2DA 2YC2C 2PGAA 1UKZA 3L7NA 2AH5A 1Z33A 1VCIA 2IOFA 3TH5A 1JJAA 5JSUA 2C5HA 3IOMA 2ZZKA 4P3PA 4U7FA 5GY7A 4AL4A 2P3QA 8ATCA 4N9QA 5KEIA 1AMOA 2HB6A 1QB7A 1T13A 2KYRA 3WY9A 3VU3A 5KYTA 2Z3ZA 1A5ZA 3UGQA 2CUTA 3KUDA 3L0DA 1II8B 3GEMA 2FZVA 1F5NA 3RW9A 2Q7XA 3BF8A 3GRZA 1W0KD 2ZIVB 4PANA 3ZHYA 2JFQA 4UBNA 1SPXA 1Z0IA 1BQEA 4QC2A 1BXZA 3BM5A 4NMLA 1N5JA 4XVRA 1E9BA 2FSSA 2OQIA 4BC1A 1W4BA 1QIHA 1EXDA 4HGRA 1M0EA 1EZZA 4J94A 4C7BA 4ABTA 2OV8A 4HRYA 3URMA 4KYIB 1RVDA 2YW2A 4TTVA 5FBVB 1PNRA 4G4SP 2GYWA 1TM7E 2P0EA 3SX4A 3F1LA 3MF4A 1YDWA 1WSWA 1LUAA 1XJWA 3ORRA 2BP7B 4EY8A 3OEED 4MA0A 1ZY2A 2O3TA 2I7XA 3BPSA 5H82A 2QTWB 3WB9A 2FR8A 3ZU5A 1CE8B 2CHFA 4IDHA 2O8BB 1NGSA 3JARB 3RGWS 3R5KA 3I1YA 2E4AA 4FNMA 3DL7A 1J09A 1QH8B 1J2RA 3T5CA 3ZU4A 2BRUC 1GTVA 3I5MA 1AKNA 7GPBA 3E7PA 3PQCA 4JYPA 3GJZA 2GCPA 3W3ZB 5FLEX 2WZQA 2FJUA 2XQIA 1Y6GA 5K0ZA 5DHTA 5BRJA 2LWIA 3NXKA 3GWZA 1L7EA 4KH1A 5FUQA 2MSWA 1XA0A 2I6XA 3A1TA 3E4DA 4DANA 4XWTA 3JWHA 521PA 4XRGA 5CAEA 4IEIA 1G66A 2IYZA 1HYEA 3PTLA 1O0SA 3HG7A 1CZUA 4HF7A 4WQMA 3BMCA 3FW1A 4MLPA 2ID7A 4CCYA 1NV8A 2C4UA 2YN4A 4OJTA 4CU5A 4O63O 4M0MA 3VO8A 3FHCB 2YWEA 1NONA 1STOA 2VP3A 2ZWMA 3DH0A 3GJ6A 1ST2A 3IDSA 4G23A 4K9OA 4RUKA 1P18A 2GZAA 2X9NA 2NUPB 3DZIA 1JEJA 4J0QA 5AJHA 4AJ9A 3ZHQA 1T9AA 3AR5A 2Y0BA 2VNJA 4H0FA 3G23A 1KEKA 2BYTA 4IF4A 4NBSA 5CG1A 3BVPA 2VZ9A 3MS2A 4FT2A 4QD3A 2VDLB 1FL9A 3KQQA 2YIJA 3U0BA 4DA7A 3GQVA 4OQMA 2GBPA 4BVLA 4EGCB 4EKDA 2H51A 1ND6A 2OAGA 3HU2A 1FB5A 4DXHA 2I22A 2ZSBA 4B87A 3RBXA 1B2LA 4B6SA 2O3SA 3I9OA 1N0IA 1H6AA 1R6VA 1U98A 3KBOA 4ZOEA 5B1HA 2PYIA 3VGJA 2I3DA 1N2HA 5EMLA 4ZT2A 3KDAA 5AW1A 1RMYA 1G3QA 4GM4A 4INAA 4YPFA 3WQRA 1ENOA 4ARIA 4F71A 4JS0A 1OIVA 2A57A 3S7TA 3DBHB 4WKPA 5FDFA 3HBFA 1J8VA 1EG2A 1PS8A 2QTHA 4N54A 5CFMA 5T64A 4I9HA 3NBXX 3HY6A 1Z4IA 3OOJA 2BLNA 3C8DA 4R1SA 5C8YA 1DKQA 5FOTA 1TAGA 3JR7A 1D0VA 4TSFA 4C3UA 3ICQB 4IOJA 1IB6A 2Y93A 4C0BA 4C6SA 1NT2A 4YJ3A 2Q7DA 1MJHA 1OFVA 2BFOA 2I87A 5FO1A 3AY0A 1I10A 3PDCA 3SF8B 1N6KA 1SXJD 3RUIA 3UW1A 2JB9A 3PFHA 1HZJA 1IY1A 1ISMA 1LNQA 2DQZA 4R6XA 3EMBA 4QEKA 3H1BA 4TS4A 1EUZA 1E8MA 3QPBA 3DHEA 1X0XA 4PZPA 1DPFA 4D9HA 4EGFA 3EYWA 2C8KA 3S2UA 3T54A 2QTTA 4IIGA 3R7DA 1G5RA 3QE3A 3M4NA 2BFFB 3LMKA 4UJ5A 3CYFA 4P0TA 2EG5A 4CE6A 2PY6A 1N0UA 5CD9A 1XJCA 4JC8A 3C6KA 3RU3A 4RX1A 5AM1A 1ECFA 3FNHA 3OIGA 4ASUD 2JHGA 2ZRNA 3IIMA 4FVTA 5ALOA 2VP4A 4MTLA 2XWQA 3LSTA 2Q2VA 1PK8A 3C4QA 4CWAA 1EVYA 1Y63A 4NIMA 4BEWA 2I2WA 3GNLA 4GWKA 5SZHB 3STXA 4URHA 4HGYA 2M6RA 1SN7A 2AOUB 1YKGA 3CC8A 4X6XA 5CM8B 4FGJA 4OXYA 2XE8A 1XLTC 2C00A 2C97A 3OFND 5HIMA 5J59A 3VYTB 2IZ1A 5KUTA 2CEAA 3ER8A 3PXGA 2UVPA 4Y6OA 2AZDA 1QFJA 4OMDA 4DM3A 2NMVA 5ADHA 4UTPA 2FPOA 3KQMA 2CXQA 3K4HA 2DHRA 3C4JA 3MOSA 2ERXA 3LNTA 3WWEA 5ICGA 1XNGA 4ZZ3A 5JWHA 5HFNA 3Q41A 4M1ZA 4XB1A 1JHAA 2FEMA 1F6DA 1UXKA 3Q3VA 4URYR 5TR9A 1T2AA 5BN4B 2CLHB 4KCGA 3LA8A 1MB3A 4O4HF 3OPNA 3QWAA 2VDWA 2E4WA 2ZSJA 4B8YA 3VR5H 3Q7PA 4GS5A 1Q1GA 4RIEA 4A92A 1FS6A 3VOTA 3QTBA 1PZNA 1DKUA 3GUUA 4HDCA 4RQAA 4E4RA 1B41A 1JKJA 1SK8A 3EEBA 2E2WA 3LCUA 2ZM6B 2HA7A 3STYA 1RLMA 1X1CA 2VP6A 2IELA 4H7KA 4J91A 3S2GA 3IELA 2UXBB 3QVMA 4CEHB 2QJTA 3E9ZA 1YS9A 1K4YA 3CIFA 3PC6A 1H6DA 2EX1A 4GXRA 4R7TA 5DM4A 4L0DA 3ZLUA 5JYBA 2CLOB 4HDNA 5AXAA 1XPRA 3SYKA 4LA4A 1UC9A 3L7DA 2EHDA 2I1WA 3GWGA 2FWAA 4JR1A 4LZPA 3TAXA 1I1QB 1XMPA 5C1IA 1YB5A 5KBYA 1HQCA 4YLEA 2FZKA 2OD7A 4XD7D 5EJEA 2AEJA 4P6VF 3W5VA 1Y34E 3CH6A 3SC2A 4AQDA 1V5GA 4F3KA 4FJ1A 4JUDX 1NTRA 4EG1A 1OFIA 1P4RA 4URVR 4C7OB 1TTPB 3LWDA 4V2UA 3ZWQA 2IE8A 3TW6A 3L6DA 4MMXB 1AMNA 2Q8NA 1J2YA 4YTEA 2X8AA 4ZOLB 5IAEA 4IKOA 3VAZA 3TNFA 5T6MA 4G85A 4Q66C 1Z9BA 4UTRA 4QEDA 4G8BA 2VCYA 3G2MA 2Y1GA 4NMXB 2HA3A 2Z2ZA 4CEIA 3HKEA 4GG1A 2OBFA 3GPDG 2PZKA 3MJRA 1U8FO 4TKUB 1XTIA 4G24A 3CEMA 4MAAA 4QOHA 3QUTA 4CV1A 4DBZA 5AICA 4IVQA 1GSHA 5FUYA 1EWKA 4HCJA 4J7AA 2BH9A 3LWBA 4FFBB 2IIBA 3RNLA 1LVGA 4UTNA 4ZI7A 4W6ZA 4EJMA 2DWPA 1TM5E 2DPMA 3FPGA 3BDVA 1YIOA 2JFGA 2NNLD 4PAOA 1G21A 4JBYA 5EXXA 1AUXA 3TGPA 2JATA 4EITA 3AVVA 2D0DA 3K16A 2OVBA 3P0RA 4OQXA 3CKYA 4Q7LA 5I9MA 5ULLA 4DCPA 2NVUB 3EZ2A 4DAOA 4X60A 3A26A 4GMXA 1RWWA 4WBNB 4CG3A 1JR3D 1VPDA 1W581 2DSTA 2G76A 3HP7A 3OIWA 3LQ4A 1CUEA 4JQZA 2WYIA 3KE9A 4L5IA 4V03A 5EZYA 5BMVF 4Q3CA 4V38A 5EHQA 1W36C 4HKTA 1OGYA 1C7JA 1HNWB 1V47A 4Z7QB 4YAUA 4I6GA 1E4YA 4JJ8A 4POAA 2C7RA 1LLCA 3PNPA 4HWOA 3WKAA 3NYIA 1EBFA 1EM8A 1U0SY 1UQRA 2JLAA 1U1GA 3AXTA 2FZGA 2XUJA 3EUAA 2N1BA 4CU2A 4Q37A 4RIGA 3UGTA 5KYXA 2DE0X 1VIVA 4RD2A 4WZBB 4YDRA 4JJZA 3RR2A 1KZ7B 4MUHA 2V6JA 1KO4A 2FPGB 3IQXA 4J07A 2JJ2A 2L42A 3P45A 4ZO6A 3IMCA 4DIOA 2W2LA 1VBMA 2YFHA 3QFCA 4ZEMA 1AQJA 1PUJA 2ZVDA 4RDCA 4AUKA 1KEUA 1HZZA 2VL7A 1OWMA 2C1ZA 4HBZA 3CE6A 4AWAA 1RAEA 2VPPA 4UEWA 3GRUA 3JD1A 4MVJI 2MSEB 3C6BA 3MRSA 5KNDD 2BGKA 3H2ZA 2HV8A 5FQNA 1KYIA 1NVVQ 2EWVA 2IHJA 4XOIA 3PRHA 4QSHA 3CX4A 2QD1A 4GUAA 4ZU1X 3L82B 1X74A 1WE2A 5CX4A 4R9NA 1CC1S 2BTQA 4Y2UA 1ISSA 4MGHA 3ZCVA 1RQXA 1JIUA 1AQNA 3U4HA 4CQNA 1K1EA 1GGNA 1YUBA 4R1UA 3H42B 1IOWA 1EBUA 1TEVA 5JXJA 5I51A 4C04A 2HXGA 1OXMA 1ZI8A 2EFEB 4IV0A 1BSVA 5DGXA 3ZR4B 2HF9A 3RSFA 3CX7A 1RR6A 1YOBA 2V5VA 4JB8A 1T24A 4FHEA 4H6VA 4QDTA 3M34A 3Q7EA 4MW6A 1T5LA 4FC6A 1IN1A 2YZNA 4KE6A 2XA1A 1U9IA 3HUUA 5TQ0A 1ENPA 4NU5A 3V1NA 4D8YA 1H0RA 3I32A 4DLPA 4GR9A 4MH0R 1HYBA 2WKSA 3ZE7A 3ZVRA 1Q77A 4M0EA 3OHSX 1IXRC 5B7NA 3ZH9B 1CRWG 5JRDS 2PGOA 1XNHA 1NR7A 1Y7HA 1WB6A 2GN6A 1DS6A 3B3QA 4MXDA 4DSZA 1EFRD 3VVBA 3LXXA 4G5HA 3KXIA 3HY4A 1NVBA 4RIIA 4HOYA 3IP1A 3AEKA 3FI9A 2XX3A 3KB8A 1NXVA 1SK9A 1Z2AA 2XDQB 3QG1A 4KIGA 1DFGA 1XVLA 3UH0A 2OBMA 1THMA 1E2IA 1USVA 3CNLA 4DABA 1R6DA 2B7CA 4PO1A 4YRIA 3HYSA 1FMCA 1EG7A 3EFOB 2QYOA 4EG5A 3B3GA 2I91A 3LY5A 3DZCA 3OAAA 1PWZA 1ZRSA 1ECPA 2ODPA 1X7YB 4FNOA 1FVFA 5AVKA 5KSPA 4G8DA 5I4IA 1JZTA 3QYFA 4MPTA 5BVGB 2GZSA 4NLLA 1THZA 4RJIA 3VUEA 1HKHA 2KQUA 4QDOA 1ULAA 1U5BB 1L4EA 3ZZ0A 1RVV1 2O7QA 3KV1A 1CSEE 2Q0QA 1C0IA 4GKBA 5AUQA 3PR1A 2CXPA 1SVWA 1YKFA 1M8PA 2AVNA 2CKMA 3JPYA 4BMDA 4ZKDA 5AM2A 2QZ4A 1FQWA 1XQXA 5LZ4A 1T25A 1WOMA 3P9KA 4K87A 1JDBB 1Z3CA 4WZZA 4CN9A 2IKQA 2UYCA 1BCSA 3KJZA 3M8KA 3AIIA 3I9JA 3CA8A 3JQ7A 3MS4A 2O8VA 2IEAA 2JEYA 4PBTA 3AQIA 3RK0A 1DCMA 3RSZA 4GSKA 3UPDA 1WR8A 4P92A 1H42A 1OXTA 2WD8A 3CSDA 2HJWA 5TT0A 1V5EA 4B3TB 2JAWA 3H5LA 2FETA 4RPCA 1C0KA 3HJHA 4ID9A 3TTYA 3CUSA 1MO4A 1YFJA 3T3HA 2IE0A 5DF1A 1WB5A 1AN9A 3K0FB 4Z99A 5KJFA 2IP1A 4UHEA 4UBLA 5HCIA 1DKLA 1RAHA 3R6TA 5DDIP 2VHZA 3RVLA 4QXQA 4QDJA 3W7BA 3WYDA 4F4FA 5AUOB 2AGVA 1A04A 4YJHB 3G0CA 3BQ9A 4PO9A 1SQFA 1P1BA 2D8AA 3HNRA 3KXDA 4AY5A 1SVKA 1NF8A 1N75A 2FPKA 3FVRA 2RBKA 3P2JA 2R62A 3IP8A 2WDZA 4N4AA 1FYXA 4IIJF 5EGNA 4ARVA 1MFPA 2QZ9A 1NZDA 2QW1A 5KYGA 4YGYA 3PXUA 2QX4A 3THYA 3EGXA 1NOJA 2AS0A 1W44A 3EA5A 5AKEA 1XP8A 3K6RA 1WY5A 5E3JA 1Q74A 1UC5B 1ZDMA 2BFEB 4QHTA 1TZMA 4UAGA 1C7FA 2H4XA 3OF2A 4YRTA 5A9RA 3O73A 5JRJA 2BSQA 2AX3A 2QX8A 1N2OA 3W3AA 2Z3VA 4MWEA 2Q27A 1ES9A 2M98A 4R81A 1ECCA 1LNZA 3TJZA 4AO6A 5CB4B 5KX5F 1XF9A 1FMFA 5HVNA 3U4AA 5IJZA 2ZRAA 4XEUA 2WMYA 2JHPA 3W5IA 2I3BA 4LF5B 1V6AA 3D1JA 1Z5VA 5CXQA 3RJTA 1GPAA 4IV5A 1QLHA 2PX2A 3HA3A 3UMBA 5C7IO 2MYTA 1XRPA 1E8DA 4ZVLA 4R54A 2Q21A 3HCPA 1KF0A 3CEJA 2F4VB 1ZAKA 1C0LA 1Q1BA 1P2SA 2C2WA 4ETWA 4CMCA 3EEOA 1BEEA 3OA0A 4BFTA 1NPDA 5HCNA 3RREA 5JROA 1SWVA 3E7XA 4MRMA 5TVKA 2HWKA 5T41A 4QHYA 4A0SA 4I1PA 4A0QA 1YZFA 1CRQA 2AR7A 3H2YA 1O08A 3BSYA 2LRHA 4NHOA 1K4MA 2YJ5A 3FIJA 5HGXA 4L2IA 3Q2OA 2VSFA 4MS1B 1XCJA 4GI7A 3SK0A 4U3JB 2V6IA 1UXGA 3LPAA 3OCVA 2PH5A 2PUAA 1OHHD 1LS6A 1S0UA 2ENUA 3F8TA 4Z8YA 1QBGA 3CONA 4KXVA 1U9YA 3DEYX 1KI1A 1R9MA 2X2PA 1BE8A 3OZCA 3ZJVA 3HKDB 3NTUA 4QBKA 3M5WA 4JJEA 1QHFA 1ZOOA 3U26A 2F9LA 3EJWA 4G5OA 4L95C 3FVTA 4HNUA 2WJPA 1J1IA 3HQ4O 1E1KA 5B3JA 3SM3A 3PHHA 2QLMA 4RV9A 1U4OA 4O5AA 2VYND 1IWPB 1H23A 2I4RA 3UJ7A 4NFLA 3KVOA 3T7TA 3L7AA 2DZDA 5C0OE 2NQ2C 5KVVA 3LBFA 4CT4B 3N05A 2HLDA 3AL2A 3EEIA 2YWBA 3FTPA 3MT9A 1UL1X 2YJTD 1E4VA 2FN8A 4LCJA 3K9QO 5BUCA 2VWGA 2CGEA 1TZBA 4K7JA 1W6UA 3PQ2A 4OATA 5A02A 3ZNOA 1A9QA 4NJOA 4ZO7A 3TQRA 4DNFA 1QJCA 3L2OB 4G3XA 4AZ0A 4X54A 3AFOA 1I8TA 3IDQA 3CS3A 4FZRA 4KWCA 4MW9A 4AICA 4CI9A 1WUIS 1NOKA 5JD3A 4WL0A 1N2CB 3ACBA 4DPLA 5T3YA 3NPAA 3ZJ4A 2AZMA 2AW5A 3ABQB 3ZYCA 1CVRA 1PX0A 3AG5A 3K8QA 4D9CA 4FWBA 5IDWA 2CT8A 1TT5A 3AB7A 3EDRA 3OM0A 4JBIA 4PSVA 8AT1A 4CL8A 4A27A 3WHIA 2C2OA 4DLUA 1QAOA 4PHGA 2H4ZA 3ZZNA 3ZQUA 2QD2A 3H04A 3OZWA 1JILA 4N0PA 4RTLA 2ZRCA 2VPXA 2WHYA 1O7JA 3T3DA 3IXQA 4BAGA 1E64A 2YCLA 2YVQA 1Y4SA 3HKCB 4IJMA 4JI8B 4RSMA 1VRWA 2YN2A 1RADA 4FBLA 2DPHA 2CF6A 4IFBA 5T4BA 5JBIA 3VC2A 5FL7A 1OH8A 3BA6A 4TTQA 2J0UB 1Q2UA 5JNUA 3ZPXA 2HNKA 4HNHA 1NWHA 2C8LA 4L4RA 4WXRA 2XODA 3ADPA 1Y9AA 3HS3A 5BW6B 1Y7PA 1Q6ZA 1WW3A 3AR4A 4IIDA 1IWOA 3VJMA 1O03A 2PZAA 1RYNA 1ZXLA 1NRJB 1BEUB 4CCSA 2DLNA 2A88A 3G68A 5GIPE 5LWHA 4OP2A 2FFAA 5FLYA 1UBJS 4UREA 1JFFA 2R5NA 2W9XA 4YMSA 3SEAA 3KSBC 4QOFA 1RYMA 3DCIA 1RCTE 4AX4A 1JQLB 4JJGA 4MLDA 4L22A 2VJLA 3ILYA 3K9BA 4NNJA 1JE1A 4BMCA 5C4IA 5KNLA 4O4HA 2R0QC 4BMNA 1SHLA 3AI2A 2INGX 3EGEA 4HAWA 4II7A 3BZBA 1AKTA 1JHMA 3TVYA 5B57C 3B1VA 3HB1A 3LS2A 1RRGA 2PZ8A 3ANTA 5K6AC 1JIIA 4YBRA 5FWDA 5JMWA 2RB5A 2O5EA 1HUQA 3RJMA 1X77A 5K3AA 1L5VA 1EK5A 2V6FA 4MSUA 4FS3A 1XMQB 5CYOA 3NHJA 3UTCA 2PMCA 3FNIA 3MLEA 3OPYA 4NBKA 4UEJA 4GKVA 3QE9Y 1SO8A 1UZAA 1W5FA 5DBIA 4AZ3A 2P2ZA 2RGUA 3A4MA 4WXEA 1ECLA 4YFVA 4AMYA 1MBZA 1HT0A 3GFPA 4LQ4A 1D9XA 3OY7A 4DDWA 3OOWA 1H0HA 5KWIA 3O83A 3FZGA 2WIGA 3EXHC 1MAWA 1U0RA 2AW3A 2G7MC 4ITRC 4EA9A 2P0YA 4WGGA 3DEJA 1Z5OA 2AHOA 3BXHA 1M75A 1YRYE 3NIFB 4TWIA 4Q9KA 2YICA 3JWIA 2B30A 3NGMA 1O9HA 3D31A 3WGKA 5EHZA 2F17A 5G4LA 1K9SA 5TS3A 2IU6A 1R8QA 1IE3A 3HBMA 5B1EA 3GA0A 4E11A 3K1JA 3E0XA 5ISMA 3BAFA 3RSOA 3NMUF 1RPJA 3GEEA 4C3ZA 3UMGA 3NASA 3O9VA 5KWVA 3OG9A 3AVOA 4W1SA 2NQ8A 4PWYA 1KKMA 4KSBA 3T1NA 3I28A 1GL6A 3EPRA 1W76A 1XGKA 3OFVA 4OHYA 1G5IA 2XUKA 5FOVA 5H02A 3GJ8A 4ZARA 4H27A 3NRCA 4RKWA 2W71A 1G291 1JQKA 4EZEA 5HJ7A 1O97C 1R4ZA 3GARA 2VHCA 4TMTA 1P1CA 1S1MA 2E82A 1JLLA 1ZBDA 3SLGA 3MFQA 3REGA 2MSKA 5JI2E 2KB0A 3NEJA 1YQTA 2QVXX 2WHPB 3CNBA 3DC7A 3HUTA 3R24A 2PZLA 4IX1A 4JI3B 3CWCA 1RM5A 2NU7A 4YXFA 1UXJA 5CCDA 4N5NA 3B13B 3RF6A 2X6QA 4E22A 3O6VA 3TVDA 2Z8ZA 4DMLA 3A9TA 2J45A 3IUBA 2YWFA 4AYTA 2O48X 3JAWB 3I2HA 3TM5A 5JARA 4DMRA 2AWNA 3PF9A 1A2BA 3HCBA 3PWZA 1SIUA 4REQA 4EPRA 4RMJA 4ND6A 1E0AA 1CEQA 3KEOA 3L8DA 5BMVA 3OZRA 4E03A 2YW9A 1MQSA 4LYFA 1L5OA 4E07A 1H9AA 1QCDA 5E1DA 2YJ4A 5L8VA 1T4CB 2P9CA 3QELA 4WGFA 1OREA 3PDIB 4RF4A 4O0MA 1E5QA 3GB9A 1ACLA 2A0WA 5B1SA 5JTUA 3NBQA 3V2HA 4AZSA 1SCDA 4XI9A 4DVJA 2HI0A 5G41A 4AN4A 5FWXB 3VX4A 1KFEB 3AF1A 1OIWA 3QVVA 1JAXA 4IJUA 3R6LA 2IIPA 1FTQA 3OCCA 5K0BA 1E0JA 3L1JA 2R66A 1M7GA 3B20A 4LXQA 4PZLA 3H1FA 5IYZF 1FS4A 2Q1YA 3W5DA 1K5PA 3RS5A 4BU1A 1B23P 3LO8A 5KQRA 4RVFA 3ONEA 4PBRA 3T6KA 3KJNA 2QF7A 2JH3A 3A9UA 1OBFO 3NHAA 3OZVA 1XNRB 1PD0A 2EW8A 2IY7A 3DEAA 5KYVA 3E9DA 2DPYA 2VF2A 4GRIA 2QN7A 3T41A 3V7YA 3D6UA 4YA6A 2VA9A 3T5DA 5JZSA 2JA2A 2VHUA 3D7SA 4JLDA 5L3VA 3N7TA 1C9DB 1PJ8A 4TTTS 1YQ9A 2FMTA 1EKXA 1QVWA 4UFOA 3NTLA 1EFHA 3ASZA 3KQSA 3UAXA 5DP1A 3VPHA 3FPKA 1W0JA 3RNOA 1BE6A 2HMTA 4H3HB 3TWOA 4HDQB 5KTTA 4YY3B 3WLQA 1EUCB 4FE4A 1FFBA 4DLKA 4RANA 4JFRA 4R2JA 3TPFA 3UA4A 2B8NA 4JCOA 2ZUFA 1AB6A 3EF0A 1QCYA 1SUCA 2ZRDA 4FZ5A 3RSLA 1IFXA 3E8SA 2JZNA 3DKKA 1L5NA 3RFVA 2D1YA 4KUEA 4C88A 1X19A 4BEBA 5CUQA 2HN9A 2ONYA 4NWIA 4HNGA 2J9GA 3PUZA 1QK3A 3K8YA 2C4TA 3LZCA 3V3KA 3DCYA 4MS3A 4DF3A 2DF8A 3UV3A 4BRUA 1WSAA 4IIUA 4WLVA 1J0DA 4F2PA 3TK1A 4GXNA 2FQQA 2CJFA 5L7WA 4G1EB 2VZ8A 5K01A 5IW8A 1JNYA 4ZI3A 3RPEA 3QX3A 1I2ZA 1D5WA 4BECA 8LDHA 4C9BA 4BMVA 3C4VA 3O2JA 5THQA 3TNJA 1QPZA 4MQ4A 4PHHA 3TLGB 4R8SA 1P8JA 3ZXSA 3OTGA 4EHNA 2HXYA 3JVUA 3TG8A 4N12A 2UZ4A 4TQ9A 1NW7A 3JZMA 4ZOCA 4A2QA 4IDAA 4FJ0A 3BWVA 2ODAA 4EY6A 4CIDA 2REQB 4U7WA 2ZSFA 1F2VA 3J81k 1AA6A 5CDGA 1ZEJA 2QRNA 5JQGA 3AF3A 3SJ7A 1QU3A 2ADOA 3RIGA 3PEWA 1GT91 4OGKA 2NW6A 3D2BA 3V46A 3H05A 2VDVE 1LRLA 1XTSA 3OWHA 1Y1SA 2ZSUA 4A8PA 4ZT7A 1JFLA 4OSEA 5HK8A 2VAXA 2J7PA 4DUGA 4UBMA 1E3WB 3IRUA 4L74A 2C8VA 1BKYA 3NZEA 4UPEA 2G83A 2R8EA 5CVDA 4CMEA 3LGSA 2JLVA 1T5HX 2ZXFA 3NHFA 1Z36A 4G0YA 4LXXA 4MKHA 1B00A 2V8OA 4X24A 3UZUA 1P39A 2D00A 1AV6A 5B4TA 2ZJ0A 3KPJA 3M6UA 2QMUA 4UDYX 4FHFA 2DX7A 5FBZA 2XZPA 4AMZA 4BNNA 3WFJA 3L93A 3MLBA 1CR6A 3MGAA 3OA2A 4FD3A 1GKIA 2ZJ7A 5EVJA 4KOEC 4BBPA 4UQLA 3TIFA 4MUIA 3VPSA 1IDOA 5EIEA 3C16C 2W0SA 4HWRA 1H2HA 1JEOA 4UMFA 2IH4A 1KMCA 3CUVA 5LXTB 4C21A 1BVRA 1PSWA 2G9UA 1FX0B 2A5DA 3TCXB 3ETHA 2ZUVA 1PWEA 1WJGA 4NV0A 4FIDA 2ECQA 2REBA 4J1SA 2BMAA 3BZWA 2AI3A 4NK5A 3PV0A 1FTYA 4OIFA 2P9HA 4CF4A 1A69A 4L8VA 4D41A 4YI5A 1DKPA 2GKOA 1I3NA 1K8RA 5SY4A 1DBIA 4G36A 1OZAA 2V58A 4KXQA 3K0KA 2IJGX 1CUHA 3MGBA 1DXHA 4WVFA 4W6QA 2JG3A 2PKYX 5CYPA 1SXQA 4DV5B 2IW3A 1XTTA 1A5BB 1ZJZA 2QE7A 4RZSA 3OCJA 4C4OA 3IDFA 4H60A 4HGOA 4ZT3A 5KX5A 3IESA 2QLNA 4OIMA 3TTSA 1DQZA 2BPOA 4B82A 4I5FA 1U8XX 4BBAA 4YYZA 2BKVA 2C77A 3QY9A 4EFKA 1T2VA 2R6ZA 2D3WA 4NZNA 1FFGA 3W6UA 4KDCA 1SVMA 4MRRA 3DDWA 1TVCA 3HFGA 4RCYA 3WWDA 4AZWA 1WMEA 3ZCSA 3OQVA 3T52A 1YJQA 3UMFA 4L3VA 4B44A 5JSZB 3NT5A 5G0UA 1FLVA 1W96A 4ZD6A 5JJBA 2WUGA 2RGYA 3FNGA 3OEHA 5KHLB 1RC8A 1EESA 1F20A 1XZNA 3FMVA 3K0SA 3V6LA 3PJRA 3BG5A 2VNSA 3VR6D 3E22B 4NBUA 1VIYA 3KOMA 5TX7A 3WWZA 1J4AA 1MRNA 4MR8B 2H7VA 4GVXA 3H4IA 4RK0A 1CUDA 3KS9A 2CY0A 2JGAA 3F74A 4WXPA 3RJZA 4CM9D 1DC3A 2CVPA 4Z4GA 1GN8A 4Q0MA 4QYSA 3UIEA 4YRRA 1LK0A 5D3MB 3HJTA 3NYWA 1QDUA 3AF6A 5JH7B 4BQPA 1U2QA 3P0FA 2VEDA 2SKDA 5C2JB 1ZHFA 2Q5HA 4EA6A 1C3OB 4F06A 3W4KA 5A9SA 4I2VA 3MJ4A 4V0ME 5DNVA 3N2KB 1JH8A 3PFBA 4HPWA 1TZKA 2Z95A 3ISJA 1KTIA 4AJNA 4GO1A 2IITA 2P2NA 3QBDA 3E5NA 1AURA 4N5IX 2AI2A 4QEZA 1GZDA 2Z6VA 3QU9A 4HDKB 2Q6LA 3PITA 3WBKA 1M2EA 5KTOA 4Y6PA 1ESMA 2I2BA 2W11A 4YJ2F 4HDAA 1LTQA 5HRAA 2JZOA 1KVTA 2Y68A 2X5NA 1R0WA 3JQRA 3TD2A 4P3KA 2O20A 4OBXA 2KMLA 1JR4A 1IY9A 5LBIA 3QU4A 1YS4A 2WJHA 1IEQA 2B1GA 4Q4DA 4E12A 4E30A 5K9ZA 2WHEA 3IP3A 3O82A 4JT8A 3F47A 4WESB 1NIPA 4LWZA 2WFAA 1L5GB 3T7EA 5JAOA 2IH5A 4IHKA 1BC5A 2Y67A 4KFUA 2UYQA 3EW7A 1WA5A 2QTZA 4HP8A 3V7NA 3VZPA 1YE8A 4F4CA 3L7KA 4GPD1 3PHCA 3KYCB 1QCCA 3R3YA 2PTGA 5HF5A 1NVEA 2OCIA 4U39A 1MABB 1VA4A 4B84A 3VOBA 5TLSA 3VZBA 2OR3A 4BL5A 2ZIXA 4HC4A 5B12A 2VNAA 4FEEA 1FRVA 2MMCA 5FA5A 4BKOA 1VLLA 1GCIA 3HEMA 4KK4A 1RYBA 3RABA 5CDHA 3II6X 3WZMA 3AHCA 4ZT6A 3UGJA 2A2ZA 5FUWA 3N8KA 1NVDA 1UWKA 1X7ZA 4OQFA 1C1DA 3KZNA 2XVAA 2P30A 3NUGA 4HX5A 4KK3A 4OI4A 4MI3A 1KJ9A 4TXMA 4OSPA 3ED5A 4NOLA 1QG6A 2IL1A 1NM5C 4OH1A 4QSMA 4S1TA 4EI7A 1S9HA 4HLUA 3VSDA 1N77A 4GC5A 1ZH0A 1EVLA 2I7VA 4OGFA 4TRRA 4C14A 1E7SA 3ESAA 3FCSB 3KKZA 4R2XA 5DO9A 5D3KA 5LQJA 1FFYA 2FZ5A 5CTJA 3D6NB 1GPYA 3R41A 2HA2A 4HEHA 1Y8AA 3CRMA 3GLKA 3BRQA 2HNBA 1IHOA 1G9SA 1PGPA 2DTXA 3ZWAA 4EL0A 1NR1A 3GRAA 4YRBA 6REQB 2I6TA 2P3LA 4V1CB 2VDPB 3NEPX 4ARBA 1J8FA 2EXXA 5HQJA 1P0IA 3BJEA 3BXEA 3IBSA 2PMFA 4KZKA 4Y6RA 3S1AB 4YAGA 1WVIA 1SKMA 3PNBA 4BFUA 1FYWA 1XA4A 2ONKA 5D7NA 1FS5A 1FU8A 2XUIA 1AGXA 1NN0A 3OC0A 3GJSA 1UFKA 3PEEA 5F76A 3HXTA 4I7EA 1D0SA 4KU4A 2YDYA 1ZISA 3F0TA 4U6SA 4FWIB 2EEZA 1TOAA 1ZM2A 3U4QB 4YCJA 2EL7A 4B3GA 4KGZA 5J4YA 2Y3IA 3ANYB 1QRUA 3HRHA 2F67A 3BAZA 3L49A 3E9YA 4EPYA 2PRZA 1BQ4A 2ZKLA 2DJ5A 4AXBA 2FPUA 1G6OA 4IMRA 2CCGA 1EXWA 4Y9DA 1ETHA 5K3OA 2WZBA 3K6SA 1FQKA 1J99A 2C9YA 4MROA 4KAFA 3VHLB 2E5LB 2SNIE 1AH2A 3K70D 3OMWA 1Z2EA 1DX9A 4JI6B 5BQFA 3MILA 1SHUX 3MM4A 2G25A 1IK6A 2CNWA 2IP2A 4XQEA 4JHLA 5BYKA 1R66A 1FFHA 4LJ7A 5JISA 3OD5A 5AIBA 3R9KA 3OFJA 3T7CA 3ORYA 2AN9A 3PNQA 4UHJA 3STHA 1CERA 4A16A 2Z6UA 5MF6A 4WOKA 2PANA 4RFSB 5B30A 4YT4A 3UPUA 2XCQA 5F5LA 5A9TA 1QM5A 4DCMA 2W2PA 4X1IA 1XTBA 3FPBA 3WBBA 3U61B 3DF7A 9LDBA 2G5CA 4QTXA 4BPBA 2RAUA 2F3QA 3PB3A 3ABIA 2JDID 1DBRA 3PJGA 4LHVA 1HFEL 4XWAA 2JI6A 5HMLA 4E5SA 3CRZA 4MQMA 1LC3A 5KYUB 3A3PA 3C70A 3D8NA 5CVEA 1ID1A 1PV2A 2X5KO 4TV8B 1ZH4A 4EOGA 1N5IA 2KLHA 2GFHA 3GFRA 1P74A 2QW8A 3ENNA 1CFJA 3FPSA 3MZ0A 1HRDA 1KMQA 2HSDA 4GX0A 4MIYA 4PQFA 5EY5B 2NV2B 4BATA 4PG8A 5CA1F 3WTBA 1PHPA 3BMOA 4MI9A 2YWJA 3SR0A 3ZE2B 3G8DA 2M2IA 3EIQA 4FQ5A 4AS1A 1PG0A 3Q1KA 1IONA 1XAJA 5E95A 2BJHA 2PCJA 3I9KA 5GJBA 1P72A 1DKMA 1OY1A 3LUDA 3DW1X 2YRWA 2DUWA 1QDEA 2IU3A 2R97A 4QFDA 1L7XA 1EDEA 1ML4A 2NYAA 3KOZA 2X41A 3SJAA 3TFOA 2NU6A 2A59A 4Y7CA 5FYDA 4HB2A 5K8JB 3EODA 3QK7A 4DLRA 4PHFA 4LDAA 3ZDEA 2NGRA 1M1YB 2RHWA 2W7TA 4PLGA 4QECA 5F64A 2VZLA 2W2LD 5ICMA 1TMOA 3NBUA 2XGOA 4YJKA 5BWLA 3A2KA 2RARA 5BPFA 2FUKA 3QA9A 1PGNA 4EATA 3H3JA 3T1OA 5DSTA 1VE5A 5F1OA 3I2KA 4O02B 3KZMA 4XSHA 5ADWA 4GOMD 5L53A 1F2TA 1H6BA 1NVWQ 2FFBA 3ZS8A 2QRKA 4CUZA 4ZDJA 5CBPB 1A27A 4OHXA 4BFXA 1JJ7A 5CGQB 5FYQA 1ATIA 5IYZA 5KDLA 1GM5A 3NO4A 1N6LA 1P4GA 5AI8A 4Y18A 3AKYA 4BNGA 4CQLA 5I3ZA 1N5LA 4A10A 3FYDA 4PZYA 4XIFA 5LNK6 2XA2A 5ALJA 3PTZA 4KFRA 3WYCA 4JASB 3JATA 1YR9A 3B9RA 4RM2A 4BVGA 1VGVA 1Z8HA 3O4JA 2AFHB 3G1UA 4EVSA 4BCDA 2VN8A 2D8MA 4TKZA 3NAGA 3CPEA 3RAEC 2D0OB 3TSAA 5DTEA 4MR9B 1OXUA 1EEHA 2FHSA 5FBLB 5FXMA 3MBIA 5JOQA 5C3MA 2W2VA 4EEKA 3D3QA 4H0NA 2VT7A 5CNIA 3JQAD 1QONA 1PVDA 3VR4H 5ANRB 2J46A 4A0RA 4FDMA 5JUWA 3E1GA 4PONA 4Q9HA 3MSXA 5AJTA 1QX4A 4ZXFA 5K6TA 4OI2A 4Z9AA 5FPHA 1Z4JA 4D0SA 3IAAA 1G9TA 4LWPA 1XAGA 4UDXX 1KI2A 3CB4A 3VH3A 3IVGA 8GPBA 2XXAB 2WZDA 4FYIA 3EMVA 1YUMA 5CFRA 2DH5A 2FUCA 1FE8A 4I5EA 1S7CA 2HJSA 2QJRA 3MUOA 3UJ3X 3KYDA 3BFXA 3EXFA 3W1EA 3RS9A 4R83A 3OAAD 1J2TA 4CM8A 1NQ5A 1KO1A 1WMFA 4YJGB 4EFNA 1NLFA 2Z9CA 3KL2A 5FAXA 3PXDA 1CDEA 1UBLS 3UOAB 2VHVA 2YYZA 3DA8A 2ISQA 2E9SA 3GVIA 1BEZA 3GP5A 3OWOA 2NP6A 1DOHA 4BJ3A 4YUXA 1KU6A 1A72A 1NQOA 3RRBA 4Q05A 3CZCA 1C4KA 5LN1A 4LRSB 5AMXA 2DLCX 2F1KA 4NSNA 4ND1A 4A2PA 3I04A 5BXYA 2GNAA 3C8ZA 4DPKA 3LUCA 1U3DA 1VSQA 2VUUA 5KU7A 2B35A 1R0YA 3AR9A 2AJDA 1GUAA 4K86A 4OHOA 3TLZA 4MWCA 1DRUA 1Y7TA 1AJEA 3FCYA 3NORA 3JZIA 2ZRMA 1II9A 1VLHA 4DSNA 2MWMA 3ZOKA 1PS0A 1QGYA 3N5KA 4R98A 3HO1A 1Z6GA 4DW8A 2BHTA 1CIVA 1I1OA 1V16B 3EIFA 1HTTA 3DULA 5E2BA 3D81A 4HQFA 3MTJA 1GUDA 1LLUA 3O8OB 5KKCA 4B35A 5DKFA 1FW8A 4XARA 3HCNA 1B3RA 2BELA 4QZVA 5JJKA 1C3JA 3AZOA 1KP9A 4QXPA 3FA2A 5A6SA 5J23A 1ZD2P 1HC7A 3H11A 3OZSA 1NHGA 3PGMA 1Q7CA 3TRIA 1EGVB 2IU4A 4WOPA 1HXHA 4JB2A 3VR0A 5BOSA 4LWOA 1CUVA 1IXZA 3N2GB 4C0AC 4KO1S 4PF1A 2JFYA 3TFQA 1S3SA 3F2IA 5KHAA 4C7JA 4GMFA 3WLEA 3SI7A 1OV6A 3I12A 4TLDA 1S2LA 5BV7A 2ZSEA 4Q12A 1RMTA 2DR3A 1RABA 4X71A 3SQOA 1VMAA 3HN6A 1O2DA 3G6KA 3PGJA 4O2BF 3VAAA 4GBMA 4INJA 5IHPA 2O8FB 1LZKA 1NQTA 3WLAA 1HYHA 3IPLA 1XRLA 5K3BA 4Q19A 1MIOB 3P2OA 2R2GA 1T5TA 3IILA 4TLAA 1N32B 2C3MA 5IBCA 2XOEA 1LXCA 2X8JA 1ISRA 2C9ZA 2YMPA 5HZGA 1C41A 5EWMB 2V4MA 5TJHA 2BKLA 2GN4A 4FMDF 4K40A 1BQ3A 2GWRA 4UTXA 1DEKA 3DWFA 4L7VA 3W3AD 2YUTA 5A06A 3VPBA 2ZAYA 1ECGA 1RAGA 1ZXXA 3QEMA 4NCBA 2OGZA 3N2NA 1VHJA 2ZFUA 2VNIA 1ZP6A 2Z04A 4YRLA 3UUEA 5JY1A 4UU7A 2O8EA 1YC5A 2A94A 2QN8A 5TF0A 2R8OA 4K5QA 3HLYA 1E1RA 2F1IA 2GBFA 3IV6A 3IUNA 3L4BA 4KPUB 1XTPA 3FNFA 4LPKA 5DLEA 5DXJA 5ARDA 1SB9A 2XNKA 2VC2B 4XOUA 3INYA 3T5GA 5K3SA 1QV7A 2E85A 2AG6A 2OOKA 1RFGE 4XFKA 5KVCA 1YZQA 3Q8KA 3UWKA 3KKOA 4QNRA 2CL5A 1BW9B 2FI1A 1XZDA 2R1VA 3B6JA 4GPTA 2VRCA 5D1HA 4YUYA 1R4AA 2E49A 1FNBA 4ROTA 4UUPA 3U17A 3MINA 2Z98A 3DLBA 4W9NA 1AX9A 4JBGA 4TT3D 2IYLD 2BN4A 3BIJA 3CLRD 4X8HA 4F6LA 4DHWA 4JXXA 5HS6A 2HHAA 4BB9A 5FFNA 5EHIA 3A04A 4L3OA 3ZXUB 1VYUA 4RXUA 4G1MB 5KKAA 4EZBA 1HKUA 2OM6A 3RH0A 1QZTA 1GXSB 3IT1A 4JLNA 3BA1A 4DR5B 4OXQA 4UOEA 5J2TB 4HD8A 1UAGA 4PSKA 1WEHA 5ALPA 3HHEA 3LK6A 4QJBA 3HBNA 1QNLA 3V2UA 5F77A 2CJPA 3ANXA 2AF4C 2IEYA 3LOUA 3LPMA 5G0VA 2IZOA 4YJFA 4Q4JA 3VU1A 2DHQA 3SQXA 2AXQA 4PR0A 5LSAA 3O31A 2H2DA 5EHNA 3QEJA 1O94D 5JXHA 3OMXA 1Z6XA 2PUVA 4MP8A 4XGIA 2XA9A 3DYVA 3SXJA 3H9CA 4A8JA 5CTAA 1JAZA 1VJCA 1B6GA 3OBBA 4OBBA 3AC0A 1DOZA 2EJVA 1BZYA 1HGXA 1OBHA 2BM8A 4LHWA 3QPVA 2UYYA 4OCZA 1Q0LA 1YZYA 2UYHA 1X8XA 4RWZA 1AY0A 3R3JA 4LOJA 4P2BA 1SAYA 1K97A 4CMIB 1ZBQA 1EXMA 4GEGA 1FXWF 1MW8X 1J24A 3TM4A 3JQBA 1C7RA 1RI4A 1R6UA 1NULA 2IXDA 3ODPA 3RS7A 4O25A 1F4LA 1RKXA 3WWOA 3ZW7A 1YS6A 5L3ZA 1CY1A 2P4QA 1YAHA 4K6MA 4EUHA 4DTCA 2DU8A 3ASYA 4UVEA 4DMGA 1CYDA 2PIAA 4FLEA 3PRJA 1H3NA 3KB1A 5HHTA 4YJ2A 2RD2A 4R4JA 4BNUA 2WIKA 3H5TA 4XPIB 5FV7A 2DEUA 4KBYA 3IERA 3KT0A 4KEAA 3LVRE 3OLCX 2VSYA 4WK6A 3CJQA 1C8VB 4NBTA 5CYFA 1FQOA 4KFSA 1TADA 4PLVA 4F4JA 1YI8A 2YXDA 1E7QA 1P2FA 3GCDA 1O77A 3CPSA 4OK6A 5DK4A 3AYXB 4HATA 2CNBA 3VR2A 1ZKMA 2DR2A 1AZTA 1HDRA 1NW9B 3U1VA 1OFUX 4OYRA 3L8GA 4CFSA 1L8AA 4EO4A 2YRXA 4J43A 5TPWB 2JBAB 3L4JA 3BMNB 4MVJE 2B69A 4G9BA 3U62A 1OI7A 2D74A 3UK1A 3B8HA 2YNMA 5FL7D 3SIPA 2BSXA 5A0TA 2WF5A 2ALJA 4TWRA 4C4AA 1FLDA 2YR0A 4KIUA 5JPDA 1GA6A 4G2TA 2WSLA 4FXOA 5ED4A 1PT8A 2O2JA 4XQGA 1EK1A 1NURA 2VI5A 3GLSA 4RFLA 3TNLA 5GZ1A 3WZLA 2PAAA 3PXAA 4GI5A 1B0UA 2CEKA 4XYBA 1P19A 1Q6YA 2EFHB 2OQ2A 4GUDA 3WRXC 3ZY5A 2JLYA 4EJSB 1J70A 1K8ZB 4ZO9A 3RAGA 1TRHA 1RJ9A 1EFKA 2Y1KA 1EPUA 1PT7A 3LUHA 3WO1A 4OFZA 4YAOA 3CINA 2ZI3A 4CTKA 2P3OA 4Z1OA 3S40A 4ZRNA 3KELA 1VDMA 1Z4MA 1KEEB 2ZU0C 4L6AA 3SYMA 1MXHA 3P2MA 3W78A 4DC9A 4US1R 4Q00A 3A7DA 1UJ5A 2DQKA 1Y42X 5C7LO 2DBQA 1B6SA 2OZEA 1K68A 1OWLA 1BA3A 1MO6A 3U19A 4JIMA 3UXMA 3TRDA 3GI1A 1TM1E 3KYJB 1UJNA 3B12A 2RH9B 4H2DA 4HXGA 3AI7A 1YCHA 1MQAA 2OGUA 2Y4OA 3IUMA 5EE0A 4DCUA 2C61A 1HORA 1CLEA 4ZJYA 3VYVA 4XWWA 2HU5A 3ETCA 4DMMA 1PDOA 2C1EA 2CZQA 2RIPA 4N3GA 2AEEA 2HSWA 3AJ8A 1Z8FA 3A1NA 1Z0SA 3GJ7A 3UA3A 4ARSA 1U04A 4MV9A 2WUEA 3MCVA 4AECA 4ZGWA 1NF9A 1LVUA 3LDHA 4KO8A 5BPHA 3N0XA 3OQHA 3QUQA 4HPXB 3HVHA 1KRXA 4A23A 1DIGA 2A84A 5FR2A 1SVOA 1L2TA 3IGFA 3TAUA 4R7ZA 2X9VA 3F49S 3L4EA 5ETJA 1I01A 1YDGA 4RPKA 1E9EA 3I5AA 2GXSA 4FILA 6AT1A 4RTOA 2BI7A 1AUOA 4QUHA 1QIKA 4J75A 2H7XA 3O3CA 3TR0A 4PXSA 2QVGA 2F00A 3A6DA 3PA6A 5FTWA 4KE8A 4OQZA 2CFOA 1PJ4A 2VOJA 3RFUA 1IZ8A 3GLIB 3HDQA 1R7RA 1M54A 3PDHA 3GD5A 4ZCSA 2A35A 4CBVA 4L07A 4OB8A 3BX1A 2C0PA 3GLHE 1I3OA 1Z28A 4B7XA 2BGWA 4XQ0A 3WGTA 4YT2A 1U2GC 2HGZA 4UAVA 5AW7A 5REQA 1SHJA 2OESA 4QPNA 2HDNB 2ZDQA 2E4VA 1O5OA 5KIAA 3IL2A 3HACA 1D3AA 1DAOA 2Z5GA 4YV1A 7ADHA 3IIIA 4XR9A 4Z6KA 1DV2A 1GEGA 3E58A 3IBTA 2RFLA 2D59A 2OECA 4QU9A 1F2UA 5GV7A 3J80A 4CI0B 1FC0A 3DLHA 2P6OA 1N5KA 1USKA 3AM4A 3DMPA 1T9DA 5HXAA 3UM9A 1Q3TA 3RTGA 3BFJA 3DQPA 5I7FA 1HFJA 5HJ2A 2Q45A 3VHRA 3WIBA 3DLIA 4YBZA 1U8TA 3NFRA 3R5FA 4H0CA 5CAEB 4KJZA 2WV9A 1RYZA 5JIBA 2R8BA 2OILA 1WB4A 1GCAA 1GR1A 2GDJA 2EBWA 4BLQA 3E3LA 3L5KA 5AKZA 2R68A 1R8JA 3HEAA 4MKFA 4AF7A 1N6NA 4B09A 3O8QB 4JL8A 4DDKA 1PRYA 1LF0A 4W5HA 4BV2A 1JDBC 1FNDA 1D2NA 2WTXA 5CA1A 2IYEA 3AW9A 2P68A 3RUAA 4X66B 1Y1LA 3VR1A 1Q0ZA 2XHZA 3EULA 3IP9A 2ZJ4A 4ZTZB 3DEFA 2XW6A 1BVYF 2IUTA 4GMGA 4KQMA 4R9SA 4WNAB 3I6QA 4Y0AA 2BMVA 3PI6A 1VJTA 1ESCA 2FLKA 5HJ5A 4G37A 5FIUA 1RIFA 3LKVA 2FSUA 5AK6A 3KQVA 4ZEWA 1F17A 2DFLA 2XBMA 1AU9A 1YJAA 3P52A 2L0XA 4MAFA 1N0VC 2C9CA 2W6NA 4I66A 4BYMA 4NS4A 5IN4A 3NALA 3U7JA 3R0VA 4GI2A 2B8JA 1UMDA 2B0JA 3GRPA 4UBKA 1T8UA 2H1FA 2R8YA 4PFSA 2G6TA 4BNJA 2Q8QA 4DRXA 2GHIA 4PLHA 1LBSA 4EAQA 2AG8A 4GOKA 3OEWA 3MRVA 1P2TA 3QFTA 4L28A 4NCHA 2HLHA 2O52A 4PX3A 3T4XA 1V5WA 5FWNA 3UHPA 1IUNA 4G8CA 4J0IA 4EA7A 5K09A 1HBJA 4H3KB 4HH3C 5B53A 2MSLA 4MQ6A 3DHYA 5E38A 1B43A 3A28A 3CSUA 1M0TA 1XK6A 5JANA 2FEKA 3I9V1 1U9JA 3G5LA 3O8NA 4J03A 1RXVA 1NN1A 2FR0A 5DHRA 5C8YB 2CD9A 3F78A 5FTMA 4QG7A 2X4IA 3TKYA 3W90A 3S5UA 3DMRA 1RRCA 4IXWA 4BV9A 3GDOA 4YAJA 2KBEA 5DNEA 2ATCA 3BEDA 3DE3X 1CF4A 1LPMA 1IEXA 1ZCZA 1H0KA 2F4NA 4RHTA 1N2CE 2J9XB 4YRJA 3R74A 4EG4A 4XEHA 1BX3A 1ADYA 4D25A 3ZQJA 2FJ0A 4GX1A 3SE7A 3G7NA 4S1VA 1KZ6A 3H2IA 5EIAA 2DVMA 2XCLA 3MJDA 3ZGLA 3ECCA 3TZKA 4HQKA 3ONNA 2J3HA 3WDMA 3BWEA 3C3KA 3L7LA 4B4KA 4FMCF 4BP8A 1P33A 2ZT6A 3DGEC 4TYMA 1LNSA 4MYRA 1AKEA 3DVAA 4Z7NB 1V1RA 3LCJA 1W47A 2WUDA 2H0QA 3FE2A 1A82A 4DMCA 1NUTA 1GQYA 3QKRA 1F5SA 2W22A 3PWTA 1E1CA 1QANA 5AYVA 2VLIA 3CR7A 4HDSB 4XWYA 2QL7A 1M8KA 1FP1D 1KFJB 1J90A 3TCNA 3WLIA 4YRNA 4URXR 4DCTA 1Q0HA 3RS3A 2CCKA 2UVPB 1AD2A 5CA0B 1XVAA 1PEYA 3NHKA 5JS8A 4TL7A 3W5BA 4MGZR 3IT3A 1EIWA 1W85A 3AILA 1TYBE 3QHPA 1IVYA 3DUFA 3GIDA 5BQPA 4DY6A 4GVLA 4DA0A 4I3HA 1SNYA 5GP1A 5LYJF 3DW3X 4UHBA 3I9LA 3TBKA 4CLOB 1F51E 1CB7A 2C31A 2FRDA 2IEGA 2V03A 3FY4A 4DUGD 4FZVA 4J1TA 4ZN6A 3OUZA 2C9MA 4H7EA 4LDZA 3ZWCA 4OK5A 2AZXA 2QLLA 4M9UA 1RZ3A 1ZUNA 5FX2A 3ZY4A 3MT7A 5K3CA 4G81A 3A6EA 4MGIR 2VDWB 3UMCA 3QWIA 3I62A 1KQPA 1CUCA 2RC5A 4JYMA 1B6TA 4RHUA 5DTJA 4E08A 1T26A 3KQLA 4WTOA 4QUBA 4ZVPA 1JSCA 4KV9A 1QQBA 3MRTA 2NO9A 3NUQA 1DCKA 2NX2A 1G1MA 1JKJB 3PD0A 4JBNA 2Z9BA 3HJNA 3H18A 4Q16A 1Q12A 4AP6A 4D8UA 1RLUA 1GZ3A 1REQA 4K9LA 1QOPB 4F8JA 4I4TB 4OJMX 3ROQA 4Y7DA 2WD7B 3W5CA 4ZOAA 3S2FA 5IZCA 1P17A 5TPZA 3WADA 1LV7A 1W5SA 3LL4A 4HUQA 3SQDA 4F85A 4QOGA 1GYPA 4Z49A 4I4IA 1GQRA 1UMKA 2Q7OE 1A76A 1VKNA 4ESOA 1OSNA 1M5UA 3SFZA 2QVBA 4OGGA 4O2BA 4NJMA 1MDFA 1I14A 1QO0A 2AXPA 2FEXA 2DSNA 2J6BA 3I01A 3NWOA 3R5SA 3SSNA 5F23A 2D1QA 3GXOA 2HOQA 1VPTA 1W4AA 2GLXA 4LE1A 4TX1A 3HKBA 4YHHB 2GRJA 4QUIA 3TDKA 3QEKA 1MT0A 1WXFA 3P5SA 1VOTA 4OP1A 4PGMA 3T7RA 2QE7D 3KOOA 2FWPA 2O3RA 3P4YA 3KT3A 4DR7B 3B1WA 4E3WA 1GADO 2Q3LA 2P6RA 3QI2A 3LT2A 4L85A 4EUEA 3GJRA 3BZUA 3ON5A 1FIUA 2Z09A 5GGXA 4EYEA 3D7NA 1YRBA 4EK9A 3PFGA 2PX8A 1PYGA 3OESA 4FR2A 1IM2A 1GCOA 3A1DA 5K6RA 4CEIB 1J0AA 2NTEA 1SU4A 3HKEB 4I46A 1CJVC 4QT0A 4TVOA 2I2XB 2FWMX 3L0ZA 5IF3A 4GLBA 4ARZA 4L51A 5A05A 3M2PA 3WR5A 5DW0A 1LBEA 2PJDA 1E96A 4JVMA 3KKMA 1EFTA 4Y2PA 2CUNA 2FCAA 1GP2A 4ZI7B 1VE7A 3HI4A 3VYRB 4IG4A 4IGEA 1Q5PA 1NN5A 4F8EA 5KJ1A 4KGDA 1FSPA 1G21B 4Z0TA 4RA9A 4F5DA 3RI3A 4OLHA 1BXGB 3T99A 4H17A 4UEQA 4U7JA 1OWPA 3I45A 1NF2A 4C0LA 4GQIA 4RELA 1FP6A 5A71A 5IDVA 4DCSA 4YT5A 5AHRA 4CQMB 3TRJA 4C0JA 2VQSA 3N6RA 2O8DB 4UUOA 4RHCA 3IV9A 4RMGA 3CMCO 1X1SA 2LCQA 5KI6A 3H0KA 4KQEA 4EGSA 3J81A 1XN4A 3QXXA 4HGNA 1J5PA 1NIJA 3WYBA 2V65A 1WU7A 1C2TA 2I6SA 3JX9A 4B4UA 1DG1G 1XCBA 2A7XA 1GZ7A 4MPRA 4JVSB 1SBNE 5H16A 3FPAA 4AM8A 3AONB 3K4PA 1ODSA 1N2SA 1TLLA 1UPTA 4DCGA 4UXHA 3CIOA 4ESVA 2CE7A 5EIXA 4M1TA 5AI9A 2A86A 3GPLA 2R86A 2X5JO 2X0KA 5IXYA 5EVCA 3C45A 4U0JA 3HYRA 1T3HA 1KC3A 4R9VA 5EN4A 4V0RA 4A15A 2P78A 3KKLA 1Z0DA 3BQMB 1C0EA 4DZTA 4WN9A 3OETA 4PZUA 4EHJA 4K6KA 5DBGA 3R4VA 1G55A 5KYXB 1R0KA 1P9NA 5DEIA 3FN4A 1EE1A 2W2KB 3QOFA 3AEXA 2CXOA 4BP9A 1HDCA 5B36A 1CYEA 4MWBA 1UOEA 1FXWA 3WLSA 2ORVA 1Z7WA 3B6MA 3GJYA 3K92A 5F73A 5M3BA 4ES6A 1T8SA 3DE0X 2PXXA 5EKTA 4RSGA 1IDN1 4L3WA 1YBFA 2H57A 1C1HA 1TXGA 2R8ZA 5KOYA 2FRVA 1SD2A 1UWLA 4M1KA 1NYQA 1RRVA 2H4JA 1A4XA 3E8MA 2JFZA 3CF6R 1Z73A 1SXJE 5F1YA 4XUDA 4CMGA 2BTQB 2IZ7A 4O4LF 3DO6A 4OLJA 5ECGC 1UP4A 5MFZA 3NANA 3AK4A 1N8TA 1Q3KA 4IIBA 3DZFA 1J0CA 4RZIA 3EX7C 3VKGA 4XPZA 1Y9EA 4OVKA 4S2UA 3DE7X 3VPFA 5LLTA 3H16A 3CCCA 1YA6A 3IODA 1V48A 4BPRA 2NTNA 1AF7A 5LVAA 2P6PA 4PYNA 2ZJOA 1DE0A 1CU1A 1XZQA 1L5HB 5TQ0B 2II6A 1RYEA 4J2OA 2X1HA 4I55B 3AVTA 3NBKA 1WP9A 1W19A 4V0MA 2OXTA 3PGXA 3QNWA 1PDWA 2IDZA 3PC3A 4HK4A 3GAAA 5K3DA 4PEVA 1V6SA 1J1ZA 2V7TA 4LGYA 5DISB 3RRMA 3K71B 1Y6JA 2Y1OA 4BS9A 2AQKA 3OCUA 4YO8A 1XT6A 1A3CA 4J49A 4F4HA 4L4UA 3ZHRA 5AESA 3QUCA 4YPOA 1ZK2A 1J0EA 4IQ4A 3EIEA 1AK9A 1OXSC 1PE0A 2V54A 2ZBPA 1E4EB 1QAMA 1ONOA 4Y2SA 2B9VA 5LM3A 3OEYA 1B4DA 1U6KA 1M5TA 4R0VA 1IEVA 1SUEA 2AC4A 4QTYA 4OXIA 4Z3OA 3MPUA 1C9KA 2EIHA 2FG7C 2GPWA 3HB9A 3JWJA 4MA5A 3VYSB 2PL9A 3G2JA 3KVVA 3VV3A 3QIVA 4GXQA 4EQZA 2AV6A 1P4SA 1HYQA 4HG2A 2QTRA 1NJ1A 1IPHA 1OC2A 2C96A 5JCJD 5FPQA 4D96A 1DRKA 1UH5A 5C1OA 1V96A 3HHPA 1G2OA 4NOMA 1SFRA 4KX5A 3UAVA 1DDGA 5ALHA 5FT9A 1CJSA 4MVJF 4KO4S 3UOGA 4A8HA 4W63A 2Y9MB 3W8FA 2VZEA 1KDYA 4YAIA 1JG4A 1CF2O 1Z4OA 4WNIA 4YWJA 5TV2A 5KMGB 1D4AA 4C0WA 5AW3A 2ZUSA 1KBOA 1YZLA 3FXAA 2VF5X 3D6HA 5L3SB 2BEJA 2JS7A 3S7ZA 3JQ7B 4AO7A 4LDJA 4NPHA 4B47A 3UK0A 3Q6NA 1L1QA 3U39A 2W8ZA 2JVJA 3QPCA 4LEIA 3V55A 2QPAA 4PYQA 5E6UA 2QBYA 3P32A 3JYOA 3VNBA 4C7KA 2BONA 1I33A 1HNZB 1VCOA 1NLZA 3K5IA 4EMSA 4MV7A 2XAAA 1ORVA 4ZJPA 3T1YB 4FMBB 4E5UA 4XSVA 5F21A 2QYTA 1VC2A 5KTSA 1BROA 4MHSA 1D2MA 5DP2A 3WMWA 2D7CA 4PS1A 3X3HA 4CF5A 1O95D 2CSXA 3FFWA 3ZJYA 3FG9A 3NVDA 4BQRA 1ULHA 2IZZA 2XD4A 4KGVA 3FRIA 3IEXA 4DUZB 3EGIA 4HNSA 4FQ7A 3TDMA 2GB4A 4ID3A 2RG7A 2VP5A 3OURA 1I24A 2X0DA 1R0SA 3JQQA 3R8FA 3IC5A 4Q7EA 5GONF 4LMPA 2OSBA 3AR7A 4KQHA 3LX8A 1P1FA 1OFGA 3VPCA 5B58T 4RAOA 1Y80A 5BSMA 2C4WA 2XSZA 3BD8A 4HR7A 1TK2A 3EGXB 2CZCA 1QYDA 1GQQA 4D5GA 1LQUA 5HBRA 5TQ2B 1S3IA 3LTEA 1E62A 4JOQA 3SR3A 3LFUA 1MC1A 4XA8A 2P11A 2QRVA 4CMHA 1GIAA 2GHQA 1TJ3A 2EP5A 3ZGVA 4Q9JA 3LP6A 2BEWA 1OXBB 1XKLA 2PRKA 1UJMA 4D0GA 1W4LA 2E37A 4M9ZA 5KNCA 2AI1A 2GN9A 4OMFG 1MP0A 1OTHA 2P4SA 3KHTA 4G1FA 5DHAA 3VISA 5IJ0B 1W9MA 3AIKA 3BS4A 1E6UA 1GFZA 3M9XA 4F93B 4P7FA 4ZU6X 1PEDA 4B4DA 1HRKA 1G2QA 1P4AA 4D4MA 3FBGA 5J4LA 2Y4NA 4KODA 3MTDA 4IRXA 4YRQA 3FVVA 1XDZA 4A4DA 3DYBA 3W06A 1S4QA 1CJUC 1L3IA 1UK9A 2I65A 2E48A 2X8WA 2HK8A 3HJCA 3KL4A 4G65A 4K9SA 1DJQA 4QA9A 4R8MA 4TSKA 1ZI9A 4DWOA 1JR3E 3UGKA 3CU5A 3WLJA 2WEKA 2IW1A 4XVUA 2Z1MA 3AM1A 1VJ5A 1D6NA 1U3UA 2OGTA 3UQYS 1TCBA 1W4RA 3AF4A 2UVQA 3Q3HA 1PLLA 1F6BA 3VHXA 3IHWA 1G4UR 1YDEA 1P7CA 1G8SA 2D2IA 1L5LA 1B8OA 1H2XA 3IMEA 1ZN2A 3Q6IA 2Z56A 3MSCA 3PSAA 4MQUA 1ZIXA 3O1JC 4IWYA 1TVMA 1T5DX 3TIVA 4XDGA 4E6EA 4F2HA 2NPOA 4UVGA 4ZYWA 2BBTA 2NSLA 3QVTA 2PM8A 3KVRA 3VH2A 5TIIA 4E94A 1GPH1 5I5EA 1Z5WA 3CCFA 3OJFA 5JEEA 2XRFA 5DK6A 2FXVA 5KREA 2FX3A 1ST3A 2O6HA 4D9NA 1ZGGA 4OLAA 2AYXA 3H17A 2RGEA 2XUAA 4H7HA 4P08A 2ON6A 4FFVA 1MJ5A 1ICEA 2GEVA 2PX4A 2X3YA 3E27A 3GW8A 3PUYA 4G1CA 2WIFA 4EUKA 2HIGA 1RU3A 1ZD5A 2B21A 1I32A 2VJNA 4RXTA 1CZHA 4U5XA 3LIIA 2O2HA 2JC3A 3C97A 2XMQA 4L0QA 5F9FA 2VJYA 2J9FA 2V7QD 4CKWA 1UT5A 2GTPA 1KYWA 2QP4A 1O89A 3RSHA 2FDCA 1BJTA 3C5WP 3RSSA 3P2EA 1SHTX 1QXSA 2ZOSA 3T9BA 2WYHA 3V80A 4MA4A 2D4AA 3HCOA 1D1QA 3K9CA 1L0BA 5EPUA 3GFTA 3BCUA 5ALGA 4PCUA 5HQTA 1R0RE 4BXOB 4GYYA 1HDYA 5IN5A 1L5YA 3PGKA 1OH6A 1DWOA 1PR4A 1TT5B 2P77A 2KE5A 3Q85A 3OSUA 4ZIRB 1DKNA 2H65A 3E9MA 2AMVA 2OV4A 3L3BA 1U2EA 1SJ9A 2EW1A 1TJYA 2IYRA 3N28A 4PW0A 3RYFA 3HVRA 3HTXA 1Z35A 2C8JA 1U28A 2ZE5A 3R09A 2OQRA 2OGSA 4E21A 5JMTA 1ZJ6A 4JP1A 3ONDA 3EDQA 3K8OE 1GO2A 2WNSA 4DGSA 4DQDA 4XXHA 1MU0A 1M7BA 1RQ2A 1SPBS 4MVJP 4KKXB 4DE5A 4PC6A 2GESA 1JYFA 3HO6A 2Z58A 2X0EA 2W83A 1KO8A 2VT2A 3W3AH 3A6FA 3D3KA 4F9GA 1WO8A 2JH8A 2VQFB 1TW2A 2WWIA 4DMFA 4I1SA 4DSUA 4OG2A 4QYWA 1SM4A 3M1AA 2PRIA 3EZ9A 2ZAIA 1GL9B 2ZETA 3WLNA 5IJAA 4EY7A 3H5IA 3F6SA 3EGWA 4S05A 4PICA 3F8WA 5LYJA 3PCXA 2QG9A 3I0ZA 3WGHA 5DX0A 3FLMA 3S1SA 2JLWA 2P7HA 2DM6A 1X6VA 5HEKA 5KQLA 2BR3A 2RI1A 2XZOA 4G8JA 1KY4A 1K6XA 5DVZA 2RKBA 3GN1A 1XWWA 2V0NA 4FGSA 3A0UA 3LX4A 3VOAA 1JLKA 4EGQA 4O4HB 3OPVA 3HJGA 3EF3A 3LCVB 3SC3A 1OZHA 3H9JA 4OM7A 5GMOA 5I9LA 1L6IA 3ONFA 1TVKA 4RK1A 5F7OA 4JC4A 2Q99A 3DE6X 3H2KA 4I1RA 5CJJA 2ZT5A 1WKCA 2ZTHA 3TTXA 3VJKA 4YN3A 2PSHA 3VYWA 2I7CA 1SKAA 1R8SA 2XNCA 2C94A 2ILVA 1E79A 5AJXA 2HIMA 1KERA 3DTVD 4MLZA 4XIIA 3UWDA 1TQ6A 2FN9A 2HK7A 4EZIA 5JW6A 3OPYB 4WLFA 2EBHX 3ENWA 4NQRA 2I62A 1EWTA 3GCZA 5EUBA 5HOQA 1CPYA 2GN8A 1FYFA 1QHSA 3VYUB 4D80A 4QL3A 4NECA 1VZ3A 3EZXA 2AA3A 2ZJFA 1JIJA 1PJAA 1WCIA 3A6ZA 4BMPB 2I2AA 1EX9A 1NBAA 3TOSA 1OB2A 3Q5EA 3L1VA 2BFBA 4FN4A 3FB4A 4LXYA 2XXBA 3NONA 4X92A 4OQEA 5BV0A 4KNYA 1ZVQA 2A5YB 2EJBA 1E1RD 2VDJA 2WJWA 4RETA 4W7HA 3FNQA 4FOPA 1T6XA 1N2ZA 4J4HA 4TZTA 4F9TA 1Z6AA 3IR5A 4P3OA 1RZUA 3H2HA 5CVUA 5JD6A 3CLTD 5CNMA 2WYWA 4OHFA 3JWGA 2RJOA 4GPAA 4BJHB 3D4PA 4K6GA 2CNOA 2GYVA 3C3WA 1IHPA 5DXFA 1I5EA 1KKUA 3OQIA 4DWJA 4YV2A 1UKYA 4NZOA 4C0HA 5D6NA 3AQ4A 2QSJA 2YN0A 3EOZA 3NKVA 4H7PA 1X1DA 4BVKA 5CBKA 2XYHA 2BFDB 3GROA 4GLOA 3OTWA 4D8VA 5JFTA 2Z9DA 2B4RO 1VCNA 2ZTUA 2EJWA 4G9EA 1JLLB 4E15A 3NH9A 3MG9A 4HAUA 1E66A 1I7LA 1C80A 3NP7A 2A4KA 2A3NA 2QD4A 2R6DA 3KC2A 3MNFA 1CD5A 1HE1C 3LU1A 3QY0A 2JI4A 3SSOA 4XFDA 4R71A 4B71A 2F6RA 2VTKA 4D6XA 1YMQA 5AW2A 1IBKB 4X7MA 2D5BA 4OQQA 5B1YA 3JQEA 3CVXA 4QGSA 4KVFA 3JU3A 2JGJA 1L7BA 4BLSA 4P9NA 2ZIZA 3HJBA 5LP6A 2ZBEA 3ME5A 4V39A 2RK4A 2WM3A 1PUIA 3FVQA 3ND5A 2Y6VA 4REQB 4X45A 1KOFA 4YCBA 4QM6A 5BMVB 5A0FA 1K7YA 2G67A 1KDVA 3U3KA 4CIAA 2WWXA 5JO0A 4K6HA 5BWNA 3QELB 1M2NA 4Q3AA 4NEQA 3RVRA 2D7JA 3ZI0A 3OUUA 2AX4A 3KOYA 4IUYA 3TB4A 5CLJA 1WQ4A 2JGRA 3KDSE 4I5DA 3RS4A 3EPPA 1MB4A 2JFPA 2OCGA 3N2YA 1WCWA 4ZRMA 1CETA 3KKKA 1U3GA 2QORA 3RHZA 2WLTA 1LDBA 2D13A 2ASVA 3A37A 1BE0A 2NZ8A 2HX1A 3YASA 5IDXA 4MQBA 3MCUA 1RD4A 1ACMA 1BHO1 3ZZ1A 2F43A 4BMYA 1TU4A 1KOGA 1ZN9A 2Q41A 4R8VA 4XDYA 5EE9A 3UY4A 1N8KA 3ZGXA 5FD8A 1MO3A 2ZJYA 2G09A 5EJ2A 4IHJB 2DECA 2I66A 2AD5A 5F2OA 2BBWA 2DFNA 2JRLA 3TIGA 2RGRA 4CDMA 3CKMA 1DFIA 5KTKA 3FUWA 2DWOA 2HZBA 2LPMA 1Y8RA 2VG8A 3WL3A 4B40A 4M55A 3SMQA 5CPBA 4AY6A 1WKVA 5A3JA 2I8LA 1U7TA 1XCLA 2EKDA 2ID4A 2H4HA 3AHFA 4GH5A 2CBXA 3B2QA 4U2KA 5BQOA 4KBFA 1KJWA 2ZI5A 1F06A 4O4LA 1RJWA 1RI5A 1PQPA 4KB5A 5JSQA 4NYMQ 3IQFA 5I8PA 2YNMD 1UK8A 1GJRA 5ALLA 1KRWA 1IZ7A 2Y1CA 4D3XA 3ZX4A 4HGPA 2J6CA 1AZLA 2PIDA 1YGPA 1QB8A 4H1VA 2WVGA 3TLCA 4MUMA 1JEYA 2VHXA 3L06A 3Q5DA 3GLVA 1MH9A 3GDGA 2V4UA 2F3UA 5BN5A 3KCQA 4FYXA 1SUPA 4YMTA 5JSFA 3RGGA 4QKQA 3G9QA 3N76A 4CN8A 2FEOA 2GCGA 1IN8A 3HO8A 4H7DA 1O96A 3BN3A 2FGJA 3A0RB 4MS3B 4ZT4A 5KQGA 3AWIA 4FDUA 1AN0A 1DBQA 4RV4A 4XM1A 1HNNA 4IEEA 1B3BA</