3AUMO

Crystal structure of ospa mutant
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
247
structure length
247
Chain Sequence
b'KNSVSVDLPGSMKVLVSKSSNADGKYDLIATVDALELSGTSDKNNGSGVLEGVKADASKVKLTISDDLGQTTLEVFKSDGSTLVYKYVYSKDKSYTWEYFNEKGEVSYKYIYRADGTRLEYTGIKSDGSGKAKEVLKGYVLEGTLTAEKTTLVVKEGTVTLSKNISKSGEVSVELNDTDSSAATKKTAAWNSGTSTLTITVNSKKTKDLVFTSSNTITVQQYDSNGTSLEGSAVEITKLDEIKNALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer surface protein A
publication title Aromatic cluster mutations produce focal modulations of beta-sheet structure.
pubmed doi rcsb
source organism Borrelia burgdorferi
molecule tags Membrane protein
total genus 51
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 2011-02-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.160 Mainly Beta Beta Barrel Lipocalin C1 set domains (antibody constant domain-like) 3aumO01
3.90.930.1 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 3aumO02
3CKGA 5B2AO 2OY8A 5B3MO 2OL8O 2OL6O 1P4PA 2FKJA 5B10O 1FJ1E 2I5ZO 3CKFA 2OYBO 2HKDA 2OY5O 2PI3O 2OL7A 2FKGA 2AF5A 5B11O 2OY7A 2OY1O 3EC5A 1OSPO 2I5VO 3AUMO 2G8CO
chains in the Genus database with same CATH superfamily
1SREA 4Z2VA 2F09A 4RUUA 4HPDA 3FR5A 3UEVA 4GK9A 4JNJA 5CE4A 4C5PA 1FE3A 1ML7A 4MVLA 5LJGA 1JZUA 2VDFA 2C1SA 2OY1O 5K06A 3BX8A 1LCVA 2QO6A 2LA7A 1JBHA 1SA8A 1VWBB 4OMXA 1MK5A 2OYBO 2R73A 1SWTA 4EDEA 3FEPA 1LCZA 3G7XA 4UU2A 5JVHE 4IB9A 4I3DA 2IZBA 1KGLA 1H91A 1ZRYA 2NNEA 1VWFB 4FGIB 4YH0A 1KL4A 3FEKA 1YWBA 4ZR2A 3BLGA 3RDUA 5MLCH 4FBOA 1PMPA 4Y0QA 1KZXA 2PI3O 1I04A 3Q6LA 2CM4A 1N7YA 4LKPA 3B2LA 2X8FA 2CBRA 3GAQA 4MVEA 3HWGA 3NP1A 1Y9LA 4Z28A 4U8UO 1U0XA 3VHHA 1VQKE 3BS2A 5EEDA 4O3XB 2P8GA 1K8AG 5GAHG 3ZW0A 2OL7A 5BVTA 2A3FX 1ICNA 3VG5A 1O1VA 3N91A 1SWEA 4ORWA 1VYOA 2RCTA 3I0AA 1JIWI 1CBIA 3WXQA 3SLOA 3PK2A 3RDMA 4I6SA 3TZSA 4XMHA 2KTSA 3BY0A 4BX7A 1VQ9E 1O1UA 4KCAA 4GDAA 1RXJA 1Y52X 5IO5A 1VWLB 4ODDA 1SWFA 2IZAA 1X89A 1IKJA 2AT3X 4CDEA 3PPTA 2RTAA 2VFCA 4IAXA 3SZHA 2JOZA 2ACOA 5H1SI 4ALBA 4OS8A 1OSPO 1GT1A 3DLLE 4ZFXA 1KD1G 3WVMA 3DTQA 1GT5A 1YJNE 4FBRA 1QVGE 3AKNA 3B2HA 1LUQA 2BC3A 4IB6A 2NNQA 2CZUA 1X8QA 1R0UA 2Y32A 3NADA 3F9DA 3FA9A 2M4LA 1I9HA 1T68X 2I5VO 3D97A 2NP1A 1G85A 1ERBA 4BGFA 3D4RA 2FLJA 5LJCA 1LIBA 4NV7A 1X8UA 2BHVA 3VG4A 3FIQA 1BWYA 2WPUA 1X8PA 1SXUA 5JD2A 5KICA 2X56A 1IW2A 3WJCA 1LPJA 4ZH6A 3SLJA 4BJ8A 3CCME 1L6MA 5KIDA 5H9AA 4WF9E 3RSWA 3S26A 4O4UA 2FT9A 1JYDA 4YGGA 4BOEA 1A2DA 4OS0A 2UYWA 4HPBA 1EQDA 1HQQA 2OFMX 1I05A 2G8CO 3P6CA 5B3MO 3TGBA 2Q2MA 1MVGA 3PEDA 1S7DA 4WBKA 4EXZA 3T2WA 1VWHB 2QO5A 1K73G 1RAVA 4N7CA 1OEKA 3WYPA 4GNWA 1STRB 4O4XA 1KT5A 1VWOB 2HYSA 5LJHA 1G74A 4GZVA 1STSB 5DM7E 5JR8A 3TF6A 1OBUA 1I78A 4D6BA 1E2TA 2LBVA 4BX6A 4EFGA 2IZCB 4OS3A 3V8UA 1VQLE 1UYNX 2NNDA 4JGLA 4U8UM 1DFVA 1P4PA 1SRIA 4YBPA 3S5VA 4EEJA 1DC9A 3MG5A 1I06A 2HNXA 2ALLX 4LZVA 3NX1A 2FS6A 5HCEC 2DM5A 1X8OA 1LIDA 4BX6B 4YCEA 1VQNE 2ZAIA 3PH5A 2QCBA 3P24A 4XMCA 1KC8G 2WEWA 3WZPA 4TQ2A 4NNTA 1EIOA 2AT8X 1HXZA 1Y9TA 3SAOA 2X34A 3I55E 1KL5A 4NW4A 4NLJA 3H3IA 2A0AA 1SWRA 2W2AA 2W2FA 4QYNA 1UYOX 5AQ6A 3KFGA 4ZH9A 4IMOA 4NV8A 2K23A 4YFQA 1HMRA 3X00A 2X8TA 4GGTA 2A8GA 4CK4A 2GTLO 1BSOA 3PQUA 3P6DA 3DSZA 4U8UN 1M1KG 2MM3A 5F58A 3AKMA 4ZHCA 3Q34A 2I5ZO 4A8ZA 1YWCA 3JSQA 3PIPE 1K9MG 4IABA 4BCSA 4A1HA 1FENA 1N43A 1A3YA 3CCJE 1AB0A 1KL3A 1DZPA 2X8SA 4XMGA 4M6SA 3CMEE 4DNEA 2RTNB 1XKIA 1DZMA 2IZHB 1YIJE 4WFBE 2JU8A 1E5PA 1D3SA 1T8VA 1YWAA 3BRNA 2RTRB 3CCLE 1HN2A 1GGLA 3RE6A 1BEBA 1S72E 2AL0X 3IFBA 4TKHA 4Y0SA 1SRFA 5L8IA 5B29A 4GGZA 2OY5O 2RQ0A 3UEWA 4KT5A 4AZRA 3D95A 1VWMB 3WJEA 2Q2PA 1ZNKA 3J7ZG 5L3YA 3K3LA 1JJ2E 4BX5A 4XMEA 3RKGA 5HTEA 3FIDA 1STPA 1HY2A 1U17A 4O9SA 1AELA 5H8TA 3P02A 3CC4E 2GH7A 4ORRA 5HZ5A 1EIIA 1LICA 1LKEA 4BX5B 1XCAA 5HTDA 1PBYA 4ML7B 1Q7YG 5LKFA 3EM0A 3CF5E 3NQKA 1GKAA 4ZGUA 2FTBA 3NX2A 3BU1A 5BYPA 1KT3A 1SRHA 1DZKA 1VWQB 3FA6A 2IZGB 2QOMA 2IZFB 2L67A 1LFOA 3U03A 1HQPA 1GKAB 4XMDA 1IJ8A 1NQMA 3BU9A 3APWA 4MVKA 5AEOA 1LDOA 2CQLA 2AVIA 2WSJA 1PEEA 3FDCA 1VWEB 1JJUA 4UU3A 3T6LA 4O3YA 3ZZVA 4QNIA 2GJ5A 3CQNA 4ARHA 1B4MA 2A5BA 4MVIA 2FGSA 5DPQA 4QQ1A 4AZMA 3KFHA 2POAA 1VQ7E 1EW3A 4Y59A 3VHIA 3CBCA 3ELXA 2X32A 3SLTA 4L3RA 4EKVA 4GDZA 1YHQE 2RTDB 4QAEA 5K67A 4NYRA 4JHQA 1HMSA 5HCCC 4BBOA 4YCHA 1W6FA 4HPCA 4ORSA 4D6AA 3MM0A 5HA1A 1K3BA 2WWPA 2YMSA 1SY3A 1HBPA 1SWGA 1MUPA 2AT0X 4EQAC 4YFRA 1RSTB 1Q86G 1JYJA 3CMPA 1KQXA 3QKGA 5HCDC 1MDCA 5HZ9A 3ELZA 3F6ZB 4PSQA 3CCVE 3VHMA 2XKLA 2X45A 5EEEA 1W2BE 1AVDA 3PDFA 2O62A 1BBPA 3WJGA 3RWXA 2ZJRE 2G78A 1LDQA 3ZW0B 3S60A 5DM6E 2LKKA 5FQ8E 4WCEE 2RTFB 4CPIA 4CDDA 3I17A 1SWSA 4GJSA 4U46A 3UEUA 4KC7A 4U67E 1B8EA 1MEPA 2RN4A 4Z2OA 4QGXA 3SZIA 1LNMA 2Z4IA 3T6FA 4BX7B 2FKGA 1VWJB 3WJFA 4AZOA 5CHKA 2FHNX 5HWZA 3EW2A 2AT5X 2AH7X 2RTJA 3APXA 4LZUA 5FQ7E 1AVGI 1ICMA 3PH6A 5HZQA 3JQOA 5FQ6E 2RTMA 1MX8A 3CPWE 1KXOA 3EC5A 2ZJQE 2Y3EA 2WEXA 3IG9A 1SWAA 1NJIG 2QEXE 2JN3A 3CKFA 1VWKB 2RTBB 3FMZA 1ALBA 2R56A 1RJLC 3KQ0A 1UREA 4CDFA 3RDSA 3FYFA 5F1EA 3UAQA 2OTLE 1N9MA 4BQUA 5L8OA 3P6EA 3PIOE 2G79A 3APUA 1BSYA 1PBOA 2OVAA 4ORUA 1E00A 5D4AA 1VYFA 3WJDA 4IRWA 1RXKA 5GADG 2BS6A 2RTGB 5B5FA 1QFVA 1QY1A 5LJEA 3ZUOA 2ZAGA 1QY0A 4I3CA 2QM9A 1SRJA 5B27A 2C1QA 1FDQA 3OD9A 5H9NA 1MOYA 1Z24A 1YWDA 3FR2A 4Z2PA 3C78X 4BVMA 2PY1A 1RBPA 2IZLB 2W2BA 2FWVA 2JU7A 2BT9A 3VU1A 3CCRE 3LHNA 2JW1A 4QYPA 2CAMA 4IOCE 3D96A 4GGRA 2WUTA 1TXLA 4COTA 5IO7A 3FW4A 2FS7A 1YIVA 1SXWA 3KFFA 5LKEA 5LJBA 3MVFA 5IRWA 2IZDB 2CBSA 5CYBA 3P6FA 2OF9A 2RTOB 3ZW1A 1KQSE 3CWKA 1E02A 1BRPA 1SWHA 1LF7A 1FELA 1JJXA 2IZJA 1D2UA 4ORXA 1QQSA 1N4JA 1HXLA 5H9LA 5B5GA 2Q4NA 3TGCA 3HPEA 5B11O 1B56A 4YFPA 1VQPE 1SXYA 2BS5A 1KT6A 1OPAA 2XSTA 4HPAA 1SY1A 2Q39A 1GX3A 4K19A 5GAEG 4ORYA 1W5RA 4LKTA 4Z27A 3T1DA 3B2KA 3RE5A 1VQ5E 2RA6A 5IRAA 3B2IA 4CV7A 1SWJA 1I4UA 4NP1A 1JMXA 2FR3A 3MBTA 1N0SA 4LQZA 1S2PA 2FHLA 2RD7C 4CPEA 2LB6A 4GJVA 1BM5A 3CCSE 3STMX 1T0VA 4NLIA 1BJ7A 1SY2A 3FR4A 3EBKA 2X46A 3HK1A 4PJ2A 1ZNDA 2QMIA 5D45A 1SWDA 3CMAE 2RTIB 4KIIA 3FENA 1FEMA 4O3ZA 2OL6O 2MF6A 1ERXA 1SWOA 4KH8A 1ZNGA 2MWHA 5BVSA 1SWLA 4YKMA 3WZQA 3NBXX 4TNNA 3I56E 4U9CA 4DQ3A 4NYQA 1B0OA 3CC2E 4IO9E 3RDXA 2ZJPE 4ZHGA 4YDBA 3U9PC 1QABE 2L9CA 5HA0A 2OY8A 4AZQA 3EMMA 3AEHA 3NR3A 3VE2A 1SMPI 3EBWA 2IFBA 3VG7A 4GH7A 1CRBA 1MM9A 1VWGB 3RDOA 3FA8A 3RY1A 1VQ6E 4UY8G 3IGEA 3ZUIA 3WYQA 2K62A 1CBQA 3OE3A 1RL6A 3UEXA 4TLJA 1QVFE 1VQ4E 5EDBA 4AYHA 1YITE 2AT6X 5EPQA 1YJ9E 4GRJA 4IOAE 2Z4HA 2JU3A 3F8AA 3CD6E 4ZGFA 4GD9A 2WQ9A 3BDRA 5K68A 1A18A 2KW1A 1SLFB 1X8NA 5FAZA 1DZJA 1SWQA 5AJCA 4N7DA 5HAEA 5KHPA 4I9SA 4YGZA 1JJJA 1RLBE 1ADLA 4Z6JA 1NP1A 3CCEE 3WJBA 4QZUA 2AF5A 5EDCA 1VWCB 3CQRA 3IA8A 2HZRA 1SLGB 4ES7A 3FA7A 1BRQA 3FW5A 1FJ1E 2MO5A 2FR2A 2QO4A 4YDAA 2A5CA 1CBRA 3LV4A 1VWDB 3CBSA 3PQSA 4QGVA 1LIFA 2E4JA 1VQOE 3VG2A 2JMBA 1SLEB 2RTPB 4MISA 5HL7E 3C76X 4GNYA 2HLVA 2OZQA 1IFCA 1RSUB 2F01A 5FENA 3APVA 3P6GA 1SWUA 1Y55X 2ACPX 4OMWA 4GKCA 4I9RA 4ZHDA 4YKOA 3VE1A 4L1NA 3O22A 1YP6A 5C0NA 1A57A 2L68A 3G6EE 4CDCA 5GAGG 2KD2A 2GTLM 1ZNEA 4XMFA 4I3BA 1DF3A 2F73A 2OFAA 4CSBA 2WR6A 1QG5A 1QFTA 3CCQE 3RY2A 2QA4E 4QZTA 3KVNA 3STNA 4QRLA 1ACDA 3RBYA 1JMZA 1QWDA 4ON1A 2IZKA 3OBLA 2A2UA 5CSEA 1O8VA 4INNA 2FKJA 1OEEA 2WQAE 1YJWE 2AKQA 4WHIA 5HZ6A 1K24A 3T2XA 1IKEA 1HMTA 4Y5DA 4AZNA 3OJYC 1NP4A 4YMYA 3G4SE 5JVGE 4YGHA 2KTDA 4ZJ0A 5EZ2A 2GTLN 3O19A 2HZQA 2MJIA 2GC9A 1WBIA 1KZWA 3SOTA 4O49A 4TKBA 3P6HA 3FELA 2FRSA 3WZOA 1SY0A 4HWMA 5D47A 1NC9A 4NNSA 1SWPA 4R0BA 1FTPA 3HWFA 1OBQA 4ALOA 4GU8A 1X71A 4ZCBA 4HFOA 3ZI8A 1G5WA 2QOSC 4GUZA 1JV4A 1EI5A 2HMBA 4WFAE 4QGWA 4A1YA 5F7GA 3HOEA 4WFNE 4A60A 1VQME 3WOVA 3HWEA 5HZ8A 1W4TA 1TVQA 1IFBA 4OKAA 1EPAA 1VWAB 2UZ2A 4O3WA 1DV9A 1S44A 1PM1X 1EXSA 1GM6A 1VWNB 1MX7A 1YP7A 1BLRA 4KC8A 2EU7X 2AMMX 1KQWA 1AQBA 1GX9A 3EW1A 2RCQA 3VGWA 2IZIA 3JS1A 4WFUA 2IZEB 2A13A 1RXHA 1WUBA 3CKGA 1TOUA 4IBAA 5D48A 2OVDA 1KT4A 1SWKA 1LELA 2MHDA 2OY7A 3CC7E 1SLDB 2RTQB 2LFOA 4RUNA 3NPOA 1G7NA 3CR6A 2RTEB 3G71E 1SWBA 1JQPA 5L8NA 2DJGA 1U18A 1GT3A 2ASNX 1TOWA 3BSZE 1HBQA 4OEMA 3C77X 2GTFX 1PTSA 5AJBA 3EYCA 2A2GA 1EUOA 2CM9A 1NGLA 3ZW2A 1SWCA 3S5XA 3VG3A 1NQNA 5IRUA 3E3CA 4Y0RA 1NBXA 3U0DA 2Q9SA 3MX7A 2RTLA 3O2YA 4I60A 1SRGA 4AZPA 3ZW1B 5B10O 2BLGA 1NDJA 1ZNLA 1EPBA 3FLLA 1Y0GA 2VFBA 4FBVA 4FQBB 3HTYA 1E06A 3RZYA 1KT7A 2R74A 4O4OA 2L5PA 2OTJE 4O4SA 1GX8A 3ZWEA 1Q81G 4ZHHA 3RDQA 4AW8A 3AUMO 5DG4A 3QQ2A 5AN9B 4MIRA 4ID2A 4IB8A 4TKJA 3TGAA 1VWPB 3STKA 1YUPA 2ANSA 3VG6A 1Q82G 3KZAA 1M90G 2YG2A 1P6PA 4GETA 5LJDA 4B55A 5F6ZA 1GT4A 3NQ9A 4GE1A 3SZJA 2DJFA 1VPRA 2OVEA 3KFIA 2G5LA 3B2JA 4CPFA 2KT4B 3L4RA 1CBSA 5BVQA 1OEJA 1KOIA 2OFRX 1BSQA 4IMNA 1N8RG 2G7BA 2HKDA 1CJ5A 5FFHA 3PECA 3OW2E 3CXCE 3WZNA 2X4MA 1Y53X 1ZNHA 3CCUE 1VYGA 2C4IA 4Y0PA 3GE2A 1TW4A 5LJKA 2RTCB 3D9WA 2BSZA 1VQ8E 2CZTA 4DCBA 4ZHFA 1OPBA 1QY2A 5IXGA 2ZSCA 4TJZA 4YBUA 3HWDA 3NQ3A 2OL8O 1VWIB 2N93A 2RTHB 1AVEA 4JO6A 3BX7A 5H9KA 3VPJE 1IIUA 3WBGA 4WFVA 1VWRB 5F6BA 3ZQ3A 2RTKA 2LBAA 1GXAA 1DF8A 5F2BA 2JGSA 1UZ2X 1EALA 3LTWA 1YI2E 1SXXA 4M7MA 5D8JA 2OFBA 4OELA 1LCWA 4CPHA 2X55A 1SWNA 4IAWA 1N9YA 5B2AO 4DQ4A 3HOLA 1OBPA 4I95A 4U3QA 2OF8A 5HBSA 2OVSA 4IB7A 4CPHB 4MEEA 5IO6A 1KFFA 1LIEA 3PP6A 4YVBA 2Y3FA
chains in the Genus database with same CATH topology
3CKGA 5B2AO 2OY8A 5B3MO 2OL8O 2OL6O 3IG9A 1P4PA 2FKJA 5B10O 1FJ1E 2I5ZO 3CKFA 2OYBO 2HKDA 2OY5O 2PI3O 1RJLC 2OL7A 2FKGA 2AF5A 5B11O 2OY7A 2OY1O 3EC5A 1OSPO 2I5VO 3AUMO 2G8CO 3IGEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CKG A;  5B2A O;  2OY8 A;  5B3M O;  2OL8 O;  2OL6 O;  1P4P A;  2FKJ A;  5B10 O;  1FJ1 E;  2I5Z O;  3CKF A;  2OYB O;  2HKD A;  2OY5 O;  2PI3 O;  2OL7 A;  2FKG A;  2AF5 A;  5B11 O;  2OY7 A;  2OY1 O;  3EC5 A;  1OSP O;  2I5V O;  3AUM O;  2G8C O; 
#chains in the Genus database with same CATH topology
 1SRE A;  4Z2V A;  2F09 A;  4RUU A;  4HPD A;  3FR5 A;  3UEV A;  4GK9 A;  4JNJ A;  5CE4 A;  4C5P A;  1FE3 A;  1ML7 A;  4MVL A;  5LJG A;  1JZU A;  2VDF A;  2C1S A;  2OY1 O;  5K06 A;  3BX8 A;  1LCV A;  2QO6 A;  2LA7 A;  1JBH A;  1SA8 A;  1VWB B;  4OMX A;  1MK5 A;  2OYB O;  2R73 A;  1SWT A;  4EDE A;  3FEP A;  1LCZ A;  3G7X A;  4UU2 A;  5JVH E;  4IB9 A;  4I3D A;  2IZB A;  1KGL A;  1H91 A;  1ZRY A;  2NNE A;  1VWF B;  4FGI B;  4YH0 A;  1KL4 A;  3FEK A;  1YWB A;  4ZR2 A;  3BLG A;  3RDU A;  5MLC H;  4FBO A;  1PMP A;  4Y0Q A;  1KZX A;  2PI3 O;  1I04 A;  3Q6L A;  2CM4 A;  1N7Y A;  4LKP A;  3B2L A;  2X8F A;  2CBR A;  3GAQ A;  4MVE A;  3HWG A;  3NP1 A;  1Y9L A;  4Z28 A;  4U8U O;  1U0X A;  3VHH A;  1VQK E;  3BS2 A;  5EED A;  4O3X B;  2P8G A;  1K8A G;  5GAH G;  3ZW0 A;  2OL7 A;  5BVT A;  2A3F X;  1ICN A;  3VG5 A;  1O1V A;  3N91 A;  1SWE A;  4ORW A;  1VYO A;  2RCT A;  3I0A A;  1JIW I;  1CBI A;  3WXQ A;  3SLO A;  3PK2 A;  3RDM A;  4I6S A;  3TZS A;  4XMH A;  2KTS A;  3BY0 A;  4BX7 A;  1VQ9 E;  1O1U A;  4KCA A;  4GDA A;  1RXJ A;  1Y52 X;  5IO5 A;  1VWL B;  4ODD A;  1SWF A;  2IZA A;  1X89 A;  1IKJ A;  2AT3 X;  4CDE A;  3PPT A;  2RTA A;  2VFC A;  4IAX A;  3SZH A;  2JOZ A;  2ACO A;  5H1S I;  4ALB A;  4OS8 A;  1OSP O;  1GT1 A;  3DLL E;  4ZFX A;  1KD1 G;  3WVM A;  3DTQ A;  1GT5 A;  1YJN E;  4FBR A;  1QVG E;  3AKN A;  3B2H A;  1LUQ A;  2BC3 A;  4IB6 A;  2NNQ A;  2CZU A;  1X8Q A;  1R0U A;  2Y32 A;  3NAD A;  3F9D A;  3FA9 A;  2M4L A;  1I9H A;  1T68 X;  2I5V O;  3D97 A;  2NP1 A;  1G85 A;  1ERB A;  4BGF A;  3D4R A;  2FLJ A;  5LJC A;  1LIB A;  4NV7 A;  1X8U A;  2BHV A;  3VG4 A;  3FIQ A;  1BWY A;  2WPU A;  1X8P A;  1SXU A;  5JD2 A;  5KIC A;  2X56 A;  1IW2 A;  3WJC A;  1LPJ A;  4ZH6 A;  3SLJ A;  4BJ8 A;  3CCM E;  1L6M A;  5KID A;  5H9A A;  4WF9 E;  3RSW A;  3S26 A;  4O4U A;  2FT9 A;  1JYD A;  4YGG A;  4BOE A;  1A2D A;  4OS0 A;  2UYW A;  4HPB A;  1EQD A;  1HQQ A;  2OFM X;  1I05 A;  2G8C O;  3P6C A;  5B3M O;  3TGB A;  2Q2M A;  1MVG A;  3PED A;  1S7D A;  4WBK A;  4EXZ A;  3T2W A;  1VWH B;  2QO5 A;  1K73 G;  1RAV A;  4N7C A;  1OEK A;  3WYP A;  4GNW A;  1STR B;  4O4X A;  1KT5 A;  1VWO B;  2HYS A;  5LJH A;  1G74 A;  4GZV A;  1STS B;  5DM7 E;  5JR8 A;  3TF6 A;  1OBU A;  1I78 A;  4D6B A;  1E2T A;  2LBV A;  4BX6 A;  4EFG A;  2IZC B;  4OS3 A;  3V8U A;  1VQL E;  1UYN X;  2NND A;  4JGL A;  4U8U M;  1DFV A;  1P4P A;  1SRI A;  4YBP A;  3S5V A;  4EEJ A;  1DC9 A;  3MG5 A;  1I06 A;  2HNX A;  2ALL X;  4LZV A;  3NX1 A;  2FS6 A;  5HCE C;  2DM5 A;  1X8O A;  1LID A;  4BX6 B;  4YCE A;  1VQN E;  2ZAI A;  3PH5 A;  2QCB A;  3P24 A;  4XMC A;  1KC8 G;  2WEW A;  3WZP A;  4TQ2 A;  4NNT A;  1EIO A;  2AT8 X;  1HXZ A;  1Y9T A;  3SAO A;  2X34 A;  3I55 E;  1KL5 A;  4NW4 A;  4NLJ A;  3H3I A;  2A0A A;  1SWR A;  2W2A A;  2W2F A;  4QYN A;  1UYO X;  5AQ6 A;  3KFG A;  4ZH9 A;  4IMO A;  4NV8 A;  2K23 A;  4YFQ A;  1HMR A;  3X00 A;  2X8T A;  4GGT A;  2A8G A;  4CK4 A;  2GTL O;  1BSO A;  3PQU A;  3P6D A;  3DSZ A;  4U8U N;  1M1K G;  2MM3 A;  5F58 A;  3AKM A;  4ZHC A;  3Q34 A;  2I5Z O;  4A8Z A;  1YWC A;  3JSQ A;  3PIP E;  1K9M G;  4IAB A;  4BCS A;  4A1H A;  1FEN A;  1N43 A;  1A3Y A;  3CCJ E;  1AB0 A;  1KL3 A;  1DZP A;  2X8S A;  4XMG A;  4M6S A;  3CME E;  4DNE A;  2RTN B;  1XKI A;  1DZM A;  2IZH B;  1YIJ E;  4WFB E;  2JU8 A;  1E5P A;  1D3S A;  1T8V A;  1YWA A;  3BRN A;  2RTR B;  3CCL E;  1HN2 A;  1GGL A;  3RE6 A;  1BEB A;  1S72 E;  2AL0 X;  3IFB A;  4TKH A;  4Y0S A;  1SRF A;  5L8I A;  5B29 A;  4GGZ A;  2OY5 O;  2RQ0 A;  3UEW A;  4KT5 A;  4AZR A;  3D95 A;  1VWM B;  3WJE A;  2Q2P A;  1ZNK A;  3J7Z G;  5L3Y A;  3K3L A;  1JJ2 E;  4BX5 A;  4XME A;  3RKG A;  5HTE A;  3FID A;  1STP A;  1HY2 A;  1U17 A;  4O9S A;  1AEL A;  5H8T A;  3P02 A;  3CC4 E;  2GH7 A;  4ORR A;  5HZ5 A;  1EII A;  1LIC A;  1LKE A;  4BX5 B;  1XCA A;  5HTD A;  1PBY A;  4ML7 B;  1Q7Y G;  5LKF A;  3EM0 A;  3CF5 E;  3NQK A;  1GKA A;  4ZGU A;  2FTB A;  3NX2 A;  3BU1 A;  5BYP A;  1KT3 A;  1SRH A;  1DZK A;  1VWQ B;  3FA6 A;  2IZG B;  2QOM A;  2IZF B;  2L67 A;  1LFO A;  3U03 A;  1HQP A;  1GKA B;  4XMD A;  1IJ8 A;  1NQM A;  3BU9 A;  3APW A;  4MVK A;  5AEO A;  1LDO A;  2CQL A;  2AVI A;  2WSJ A;  1PEE A;  3FDC A;  1VWE B;  1JJU A;  4UU3 A;  3T6L A;  4O3Y A;  3ZZV A;  4QNI A;  2GJ5 A;  3CQN A;  4ARH A;  1B4M A;  2A5B A;  4MVI A;  2FGS A;  5DPQ A;  4QQ1 A;  4AZM A;  3KFH A;  2POA A;  1VQ7 E;  1EW3 A;  4Y59 A;  3VHI A;  3CBC A;  3ELX A;  2X32 A;  3SLT A;  4L3R A;  4EKV A;  4GDZ A;  1YHQ E;  2RTD B;  4QAE A;  5K67 A;  4NYR A;  4JHQ A;  1HMS A;  5HCC C;  4BBO A;  4YCH A;  1W6F A;  4HPC A;  4ORS A;  4D6A A;  3MM0 A;  5HA1 A;  1K3B A;  2WWP A;  2YMS A;  1SY3 A;  1HBP A;  1SWG A;  1MUP A;  2AT0 X;  4EQA C;  4YFR A;  1RST B;  1Q86 G;  1JYJ A;  3CMP A;  1KQX A;  3QKG A;  5HCD C;  1MDC A;  5HZ9 A;  3ELZ A;  3F6Z B;  4PSQ A;  3CCV E;  3VHM A;  2XKL A;  2X45 A;  5EEE A;  1W2B E;  1AVD A;  3PDF A;  2O62 A;  1BBP A;  3WJG A;  3RWX A;  2ZJR E;  2G78 A;  1LDQ A;  3ZW0 B;  3S60 A;  5DM6 E;  2LKK A;  5FQ8 E;  4WCE E;  2RTF B;  4CPI A;  4CDD A;  3I17 A;  1SWS A;  4GJS A;  4U46 A;  3UEU A;  4KC7 A;  4U67 E;  1B8E A;  1MEP A;  2RN4 A;  4Z2O A;  4QGX A;  3SZI A;  1LNM A;  2Z4I A;  3T6F A;  4BX7 B;  2FKG A;  1VWJ B;  3WJF A;  4AZO A;  5CHK A;  2FHN X;  5HWZ A;  3EW2 A;  2AT5 X;  2AH7 X;  2RTJ A;  3APX A;  4LZU A;  5FQ7 E;  1AVG I;  1ICM A;  3PH6 A;  5HZQ A;  3JQO A;  5FQ6 E;  2RTM A;  1MX8 A;  3CPW E;  1KXO A;  3EC5 A;  2ZJQ E;  2Y3E A;  2WEX A;  3IG9 A;  1SWA A;  1NJI G;  2QEX E;  2JN3 A;  3CKF A;  1VWK B;  2RTB B;  3FMZ A;  1ALB A;  2R56 A;  1RJL C;  3KQ0 A;  1URE A;  4CDF A;  3RDS A;  3FYF A;  5F1E A;  3UAQ A;  2OTL E;  1N9M A;  4BQU A;  5L8O A;  3P6E A;  3PIO E;  2G79 A;  3APU A;  1BSY A;  1PBO A;  2OVA A;  4ORU A;  1E00 A;  5D4A A;  1VYF A;  3WJD A;  4IRW A;  1RXK A;  5GAD G;  2BS6 A;  2RTG B;  5B5F A;  1QFV A;  1QY1 A;  5LJE A;  3ZUO A;  2ZAG A;  1QY0 A;  4I3C A;  2QM9 A;  1SRJ A;  5B27 A;  2C1Q A;  1FDQ A;  3OD9 A;  5H9N A;  1MOY A;  1Z24 A;  1YWD A;  3FR2 A;  4Z2P A;  3C78 X;  4BVM A;  2PY1 A;  1RBP A;  2IZL B;  2W2B A;  2FWV A;  2JU7 A;  2BT9 A;  3VU1 A;  3CCR E;  3LHN A;  2JW1 A;  4QYP A;  2CAM A;  4IOC E;  3D96 A;  4GGR A;  2WUT A;  1TXL A;  4COT A;  5IO7 A;  3FW4 A;  2FS7 A;  1YIV A;  1SXW A;  3KFF A;  5LKE A;  5LJB A;  3MVF A;  5IRW A;  2IZD B;  2CBS A;  5CYB A;  3P6F A;  2OF9 A;  2RTO B;  3ZW1 A;  1KQS E;  3CWK A;  1E02 A;  1BRP A;  1SWH A;  1LF7 A;  1FEL A;  1JJX A;  2IZJ A;  1D2U A;  4ORX A;  1QQS A;  1N4J A;  1HXL A;  5H9L A;  5B5G A;  2Q4N A;  3TGC A;  3HPE A;  5B11 O;  1B56 A;  4YFP A;  1VQP E;  1SXY A;  2BS5 A;  1KT6 A;  1OPA A;  2XST A;  4HPA A;  1SY1 A;  2Q39 A;  1GX3 A;  4K19 A;  5GAE G;  4ORY A;  1W5R A;  4LKT A;  4Z27 A;  3T1D A;  3B2K A;  3RE5 A;  1VQ5 E;  2RA6 A;  5IRA A;  3B2I A;  4CV7 A;  1SWJ A;  1I4U A;  4NP1 A;  1JMX A;  2FR3 A;  3MBT A;  1N0S A;  4LQZ A;  1S2P A;  2FHL A;  2RD7 C;  4CPE A;  2LB6 A;  4GJV A;  1BM5 A;  3CCS E;  3STM X;  1T0V A;  4NLI A;  1BJ7 A;  1SY2 A;  3FR4 A;  3EBK A;  2X46 A;  3HK1 A;  4PJ2 A;  1ZND A;  2QMI A;  5D45 A;  1SWD A;  3CMA E;  2RTI B;  4KII A;  3FEN A;  1FEM A;  4O3Z A;  2OL6 O;  2MF6 A;  1ERX A;  1SWO A;  4KH8 A;  1ZNG A;  2MWH A;  5BVS A;  1SWL A;  4YKM A;  3WZQ A;  3NBX X;  4TNN A;  3I56 E;  4U9C A;  4DQ3 A;  4NYQ A;  1B0O A;  3CC2 E;  4IO9 E;  3RDX A;  2ZJP E;  4ZHG A;  4YDB A;  3U9P C;  1QAB E;  2L9C A;  5HA0 A;  2OY8 A;  4AZQ A;  3EMM A;  3AEH A;  3NR3 A;  3VE2 A;  1SMP I;  3EBW A;  2IFB A;  3VG7 A;  4GH7 A;  1CRB A;  1MM9 A;  1VWG B;  3RDO A;  3FA8 A;  3RY1 A;  1VQ6 E;  4UY8 G;  3IGE A;  3ZUI A;  3WYQ A;  2K62 A;  1CBQ A;  3OE3 A;  1RL6 A;  3UEX A;  4TLJ A;  1QVF E;  1VQ4 E;  5EDB A;  4AYH A;  1YIT E;  2AT6 X;  5EPQ A;  1YJ9 E;  4GRJ A;  4IOA E;  2Z4H A;  2JU3 A;  3F8A A;  3CD6 E;  4ZGF A;  4GD9 A;  2WQ9 A;  3BDR A;  5K68 A;  1A18 A;  2KW1 A;  1SLF B;  1X8N A;  5FAZ A;  1DZJ A;  1SWQ A;  5AJC A;  4N7D A;  5HAE A;  5KHP A;  4I9S A;  4YGZ A;  1JJJ A;  1RLB E;  1ADL A;  4Z6J A;  1NP1 A;  3CCE E;  3WJB A;  4QZU A;  2AF5 A;  5EDC A;  1VWC B;  3CQR A;  3IA8 A;  2HZR A;  1SLG B;  4ES7 A;  3FA7 A;  1BRQ A;  3FW5 A;  1FJ1 E;  2MO5 A;  2FR2 A;  2QO4 A;  4YDA A;  2A5C A;  1CBR A;  3LV4 A;  1VWD B;  3CBS A;  3PQS A;  4QGV A;  1LIF A;  2E4J A;  1VQO E;  3VG2 A;  2JMB A;  1SLE B;  2RTP B;  4MIS A;  5HL7 E;  3C76 X;  4GNY A;  2HLV A;  2OZQ A;  1IFC A;  1RSU B;  2F01 A;  5FEN A;  3APV A;  3P6G A;  1SWU A;  1Y55 X;  2ACP X;  4OMW A;  4GKC A;  4I9R A;  4ZHD A;  4YKO A;  3VE1 A;  4L1N A;  3O22 A;  1YP6 A;  5C0N A;  1A57 A;  2L68 A;  3G6E E;  4CDC A;  5GAG G;  2KD2 A;  2GTL M;  1ZNE A;  4XMF A;  4I3B A;  1DF3 A;  2F73 A;  2OFA A;  4CSB A;  2WR6 A;  1QG5 A;  1QFT A;  3CCQ E;  3RY2 A;  2QA4 E;  4QZT A;  3KVN A;  3STN A;  4QRL A;  1ACD A;  3RBY A;  1JMZ A;  1QWD A;  4ON1 A;  2IZK A;  3OBL A;  2A2U A;  5CSE A;  1O8V A;  4INN A;  2FKJ A;  1OEE A;  2WQA E;  1YJW E;  2AKQ A;  4WHI A;  5HZ6 A;  1K24 A;  3T2X A;  1IKE A;  1HMT A;  4Y5D A;  4AZN A;  3OJY C;  1NP4 A;  4YMY A;  3G4S E;  5JVG E;  4YGH A;  2KTD A;  4ZJ0 A;  5EZ2 A;  2GTL N;  3O19 A;  2HZQ A;  2MJI A;  2GC9 A;  1WBI A;  1KZW A;  3SOT A;  4O49 A;  4TKB A;  3P6H A;  3FEL A;  2FRS A;  3WZO A;  1SY0 A;  4HWM A;  5D47 A;  1NC9 A;  4NNS A;  1SWP A;  4R0B A;  1FTP A;  3HWF A;  1OBQ A;  4ALO A;  4GU8 A;  1X71 A;  4ZCB A;  4HFO A;  3ZI8 A;  1G5W A;  2QOS C;  4GUZ A;  1JV4 A;  1EI5 A;  2HMB A;  4WFA E;  4QGW A;  4A1Y A;  5F7G A;  3HOE A;  4WFN E;  4A60 A;  1VQM E;  3WOV A;  3HWE A;  5HZ8 A;  1W4T A;  1TVQ A;  1IFB A;  4OKA A;  1EPA A;  1VWA B;  2UZ2 A;  4O3W A;  1DV9 A;  1S44 A;  1PM1 X;  1EXS A;  1GM6 A;  1VWN B;  1MX7 A;  1YP7 A;  1BLR A;  4KC8 A;  2EU7 X;  2AMM X;  1KQW A;  1AQB A;  1GX9 A;  3EW1 A;  2RCQ A;  3VGW A;  2IZI A;  3JS1 A;  4WFU A;  2IZE B;  2A13 A;  1RXH A;  1WUB A;  3CKG A;  1TOU A;  4IBA A;  5D48 A;  2OVD A;  1KT4 A;  1SWK A;  1LEL A;  2MHD A;  2OY7 A;  3CC7 E;  1SLD B;  2RTQ B;  2LFO A;  4RUN A;  3NPO A;  1G7N A;  3CR6 A;  2RTE B;  3G71 E;  1SWB A;  1JQP A;  5L8N A;  2DJG A;  1U18 A;  1GT3 A;  2ASN X;  1TOW A;  3BSZ E;  1HBQ A;  4OEM A;  3C77 X;  2GTF X;  1PTS A;  5AJB A;  3EYC A;  2A2G A;  1EUO A;  2CM9 A;  1NGL A;  3ZW2 A;  1SWC A;  3S5X A;  3VG3 A;  1NQN A;  5IRU A;  3E3C A;  4Y0R A;  1NBX A;  3U0D A;  2Q9S A;  3MX7 A;  2RTL A;  3O2Y A;  4I60 A;  1SRG A;  4AZP A;  3ZW1 B;  5B10 O;  2BLG A;  1NDJ A;  1ZNL A;  1EPB A;  3FLL A;  1Y0G A;  2VFB A;  4FBV A;  4FQB B;  3HTY A;  1E06 A;  3RZY A;  1KT7 A;  2R74 A;  4O4O A;  2L5P A;  2OTJ E;  4O4S A;  1GX8 A;  3ZWE A;  1Q81 G;  4ZHH A;  3RDQ A;  4AW8 A;  3AUM O;  5DG4 A;  3QQ2 A;  5AN9 B;  4MIR A;  4ID2 A;  4IB8 A;  4TKJ A;  3TGA A;  1VWP B;  3STK A;  1YUP A;  2ANS A;  3VG6 A;  1Q82 G;  3KZA A;  1M90 G;  2YG2 A;  1P6P A;  4GET A;  5LJD A;  4B55 A;  5F6Z A;  1GT4 A;  3NQ9 A;  4GE1 A;  3SZJ A;  2DJF A;  1VPR A;  2OVE A;  3KFI A;  2G5L A;  3B2J A;  4CPF A;  2KT4 B;  3L4R A;  1CBS A;  5BVQ A;  1OEJ A;  1KOI A;  2OFR X;  1BSQ A;  4IMN A;  1N8R G;  2G7B A;  2HKD A;  1CJ5 A;  5FFH A;  3PEC A;  3OW2 E;  3CXC E;  3WZN A;  2X4M A;  1Y53 X;  1ZNH A;  3CCU E;  1VYG A;  2C4I A;  4Y0P A;  3GE2 A;  1TW4 A;  5LJK A;  2RTC B;  3D9W A;  2BSZ A;  1VQ8 E;  2CZT A;  4DCB A;  4ZHF A;  1OPB A;  1QY2 A;  5IXG A;  2ZSC A;  4TJZ A;  4YBU A;  3HWD A;  3NQ3 A;  2OL8 O;  1VWI B;  2N93 A;  2RTH B;  1AVE A;  4JO6 A;  3BX7 A;  5H9K A;  3VPJ E;  1IIU A;  3WBG A;  4WFV A;  1VWR B;  5F6B A;  3ZQ3 A;  2RTK A;  2LBA A;  1GXA A;  1DF8 A;  5F2B A;  2JGS A;  1UZ2 X;  1EAL A;  3LTW A;  1YI2 E;  1SXX A;  4M7M A;  5D8J A;  2OFB A;  4OEL A;  1LCW A;  4CPH A;  2X55 A;  1SWN A;  4IAW A;  1N9Y A;  5B2A O;  4DQ4 A;  3HOL A;  1OBP A;  4I95 A;  4U3Q A;  2OF8 A;  5HBS A;  2OVS A;  4IB7 A;  4CPH B;  4MEE A;  5IO6 A;  1KFF A;  1LIE A;  3PP6 A;  4YVB A;  2Y3F A; 
#chains in the Genus database with same CATH homology
 3CKG A;  5B2A O;  2OY8 A;  5B3M O;  2OL8 O;  2OL6 O;  3IG9 A;  1P4P A;  2FKJ A;  5B10 O;  1FJ1 E;  2I5Z O;  3CKF A;  2OYB O;  2HKD A;  2OY5 O;  2PI3 O;  1RJL C;  2OL7 A;  2FKG A;  2AF5 A;  5B11 O;  2OY7 A;  2OY1 O;  3EC5 A;  1OSP O;  2I5V O;  3AUM O;  2G8C O;  3IGE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...