3AUUA

Crystal structure of bacillus megaterium glucose dehydrogenase 4 in complex with d-glucose
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
262
structure length
262
Chain Sequence
HMYTDLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYYNNEEEALDAKKEVEEAGGQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIKGNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPINAEKFADPVQRADVESMIPMGYIGKPEEVAAVAAFLASSQASYVTGITLFADGGMTKYPSFQAGRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided mutagenesis for the improvement of substrate specificity of Bacillus megaterium glucose 1-dehydrogenase IV
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Oxidoreductase
molecule keywords Glucose 1-dehydrogenase 4
total genus 100
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 1.1.1.47: Glucose 1-dehydrogenase (NAD(P)(+)).
pdb deposition date 2011-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3auuA00
1VE9A 1WZEA 4NQZA 1YONA 1V6AA 1O95A 5A9SA 2D4AA 4OL9A 1P77A 4Y6SA 1D4FA 1NVGA 4R9SA 4EZBA 1P1RA 1VL8A 3S2GA 1ULUA 3C1AA 2BHLA 4Q3BA 3MJSA 1D3AA 1SEPA 4YT5A 4BL5A 4B7CA 3Q11A 4WKGA 4J7CA 3ONEA 3ZU3A 3ZWNA 3GN2A 2PKQP 4XR9A 2AG5A 1UZLA 3OIFA 5JSFA 1WNTA 1X7DA 4ITUA 3LT1A 1P1IA 5IDYA 1CYDA 3OEYA 1VKNA 4DYDA 4B4OA 5ILOA 3L0DA 4EUEA 1PR9A 3CZMA 3RAJA 3RUDA 2B83A 2I5PO 4FJ2A 1ZJYA 4R1UA 1PR3A 3ULKA 1FXSA 4UREA 3VPSA 4CLRB 4CODB 3DZJA 3GC6A 1O8CA 1R4NA 3LU1A 4QFDA 1DFHA 2ZB3A 4Y67A 3HG7A 1OI7A 4OXNA 5IJZA 3CKYA 3I9KA 3CTMA 4F6CA 5KJFA 1PGOA 4E31A 3JD3A 4MINA 2ZTVA 1E7RA 4TMFA 1UXHA 2RHCA 4OYRA 4OMUA 3QA9A 3MZ0A 3E18A 3UH1A 4RLSA 4RGBA 1I0ZA 1IULA 1GYPA 5G0SA 2JCVA 1PEDA 4A26A 1ZK0A 4O5OA 1T1SA 4G81A 1LQUA 2NVUA 2YV3A 1TT5B 3RI3A 1VSVA 1V3TA 4B3HA 4UUPA 7MDHA 4MVJA 1DFIA 2DBQA 1EVJA 1AXGA 3EVTA 2Y67A 3DMTC 2O3TA 4ND4A 2J3KA 3ON5A 3OQ6A 1V9LA 3GDGA 2A4KA 1UXIA 4E5NA 1V35A 4OJNA 1P45A 3PDJA 4LVCA 4R16A 5EQDA 2I66A 1RM4A 2EHDA 1LLDA 1DIGA 1UAYA 2YV1A 3CMCO 2B36A 4WNCA 5F5LA 3ZV3A 5L4LA 5KVQA 3RC9A 4YB8A 1DAPA 2NADA 5CAEA 2HMSA 4WASA 5COAA 4L75A 1OC2A 4WEOA 1GZ3A 3H2ZA 4CM6A 1ONPA 4J0EA 4NH4A 3K92A 1NR1A 2EKPA 4N54A 2X0JA 5A5EA 4R41A 4TZKA 3E6AA 1DRWA 2CMDA 2WYVA 3CZRA 2BFPA 5CDYA 4D7AA 1HETA 4CQLB 3BMCB 2DFVA 5L9AA 4MDHA 2RCYA 4U5QA 3WLEA 2X1HA 2Q2VA 2J3HA 2G17A 2X0IA 1O94A 3LK7A 3W8FA 2X58A 4BKOA 4FIZA 1PL6A 4NR0A 5G0TA 4YAKA 1SOWA 3BHMA 3KO8A 1Q0LA 4ND1A 3D5TA 3FTNA 3GOHA 4NU6A 3JYNA 3SJ7A 2F00A 2VWQA 4NJOA 4OQYA 3IAHA 2W90A 1O9BA 4CLEA 5C7LO 2NU9A 2POQX 3LF1A 5G0WA 5HA5A 3AW9A 1HT0A 4XGIA 1ENPA 1HYEA 5G4KA 5CPFA 1N5DA 2EW8A 4GPD1 4JJFA 4IJWA 1LSJA 5BSEA 5I7SA 4JNKA 2AW5A 3H5RA 4WGGA 3GF4A 3I9OA 4UEOA 3ETDA 4FFLA 2WSBA 4JJGA 4Y6PA 1DB3A 1I2CA 4MVJD 3HE3A 5F21A 4L4SA 3ZN2A 3FPCA 1ZXBA 2RH8A 3FTPA 5F1PA 1KIFA 2J6IA 3GQVA 3OH8A 1GQQA 4E0BA 2GSDA 1JW9B 2GR9A 3Q9UA 1Z82A 1E6WA 1V0JA 3JYLA 4PZCA 3OP4A 2SCUA 3ZV6A 1QP8A 2C29D 5TSDA 4DLAA 3TSCA 1Y7TA 4NMHA 1DOHA 2BFMA 5K9ZA 1I3NA 2R6JA 4S3MA 3TOXA 4MVJP 3PHIA 4R3NA 2X4GA 3GVHA 4FFMA 4EEZA 2I67A 4URFA 4AL4A 4KP7A 8ADHA 4IDGA 5ITVA 2OHXA 4FGWA 1LU9A 1U1IA 2NQ8A 2OP1A 3S2FA 3CEAA 3JCZA 1B15A 2B0JA 1WVGA 5G4KB 3VHRA 5EINA 5T57A 3KOUA 4OIMA 4IXWA 1A5ZA 1MC5A 3S2IA 1C1XA 1U28A 2DC1A 4NU5A 1HF3A 2AEFA 2CY0A 1Y5MA 4ND2A 4R68A 4IBOA 2C2YA 3INRA 3WIDA 1K3TA 1PS8A 3MJCA 4OGWA 1EE2A 4WLVA 5L53A 4GX0A 1XKQA 3MJ4A 1B8VA 2C2XA 1W0CA 2I3GA 4GL4A 3V2HA 2UYYA 4YRDA 1V3UA 3H5AA 2ZIZA 2VRCD 4MP3A 1ZNQO 3IDSA 4YA6A 4I5GA 3D3EA 4FFRA 3WQSB 5IZCA 5BQFA 5AQ1A 3U4IA 5ILGA 4J9UE 3ZW9A 3RUAA 4UEJA 3D3WB 2VZ8A 4MKZA 4BNJA 3I3OA 4J9VA 4JROA 4MIYA 2Y93A 4WK6A 1PGQA 1ZMTA 4GLLA 3G0OA 3SJUA 4BB6A 2YFQA 4GAEA 1Z7EA 5JE8A 3VZSA 2PZLA 4D45A 3AM5A 3WWZA 1YXMA 3PJFA 4UVDA 4FDAA 3SX2A 1NXQA 3AUAA 4E33A 1YB4A 3FWZA 1ISMA 3FBGA 1I10A 1QG6A 3ICCA 3GA0A 2CDCA 5TS3A 1Y9EA 5A04A 4HV4A 4YT2A 4W7IA 1JQBA 2BFAA 3GK3A 5CG2A 3DOJA 3GH3A 1YJ8A 4CLHA 2HAEA 2PD3A 1LSUA 3BTVA 3C24A 4GVXA 1E3WA 4K6FA 1U3UA 1M2WA 1P33A 2YV2A 3W4IA 2HLPA 3D4OA 1I32A 3OFSA 1BXKA 2DQ4A 2O3QA 2O3JA 1RM0A 1DLJA 1U9JA 1BXGA 3DWFA 1U5AA 2R00C 1JKJA 2W98A 2AQ8A 2O48X 4N5LA 3ZWCA 1HXHA 5A3VA 3QWHA 3K96A 1MV8A 1A9YA 3QJ5A 3A4VA 5CEJA 5IFLA 4PG4A 1PZEA 2GYYA 4R1TA 1WW8A 3L4SO 3MTJA 4QFCA 4PLFA 2PD6A 3SEFA 1PS9A 3DZFA 3WQQA 1DAOA 3RJ5A 3I4CA 2QW8A 1K6XA 1YVEI 4BNXA 4JLWA 3OICA 2CDBA 4W9NC 1ENOA 4NFSA 1I3MA 4GX5A 4KUHA 5TJ9A 3LVFO 1YDEA 3ZNNA 4XYBA 4IS3A 3IUSA 2O50A 2VN8A 2JFGA 4IIVA 1Q0HA 2HK8A 1ENZA 1TEHA 4DTIA 2Q1UA 2IYOA 4DLBA 3FWNA 4HX5A 5EMHA 3I9LA 2YHUA 1C3VA 4FQ8A 4INAA 2W4QA 3PRJA 4GKVA 2WYUA 2W2LA 3WS7A 1U2DA 1XYGA 2P4QA 4J43A 1DFGA 2YZ7A 2HQ1A 4DL9A 1E3SA 4LGVA 3KHUA 2FR8A 4BO5A 4R1SA 1KOLA 2UDPA 4CM9D 1YE3A 3UICA 4OAQA 5IXSA 5GY7A 2YHIB 3HZZA 3WBFA 3ZI0A 4BO8A 1H2HA 4PG5A 4MPDA 3PEFA 1NAHA 1GFSA 3AUUA 4YPOA 2A35A 1HDRA 1GYRA 1U3TA 4EJMA 3W6UA 3GMSA 4CLRA 5KVSA 1GPJA 1PJCA 1GV0A 2DFDA 4D3SA 5DT9A 3I6QA 3PWSA 2ZATA 1GL3A 4Z3KA 2HRZA 3I1JA 1H9AA 1ZVMA 1VI2A 2ZTMA 1M6HA 3RC2A 2AG8A 3HDYA 1NVMB 2HK7A 4OKNA 4BNVA 1P1HA 4FW8A 4YAJA 4CM1A 2OO5A 3H4VA 1P0CA 5DULA 2E49A 4UAGA 2GZ1A 1UXGA 1H5QA 1SBYA 2RH4A 3I23A 5L51A 3PGJA 4LMPA 4RZIA 3C8MA 4HNHA 3WFJA 4E5MA 1U4SA 4DA9A 3ZZNA 2EERA 5F5NA 3D5QA 1EDOA 1K6IA 2IDZA 3ROKA 1E1MA 1FDWA 3GZNA 5CEEA 3C3XA 1GD1O 1ZXLA 5K0ZA 1VM6A 2Z5LA 5TJHA 4CMHA 2IEDA 3I5MA 1LDGA 1R0LA 1N92A 4BO9A 2FZEA 1NBOA 1PQPA 2VOEA 2ZB4A 3L07A 3LF2A 4IDBA 5CG1A 1J0XO 4KTTE 4AJJA 4XYLA 3GVCA 1ZEJA 4HP8A 1HLDA 3MTGA 2Y1EA 4ZN6A 1NPDA 1G6KA 3CPSA 3P2OA 5BNTA 4J2HA 1GAEO 5CDSA 3D7LA 2CFCA 1GR0A 5G0UA 4D0RA 5T64A 1RJWA 2NVBA 5L4NA 5KJ6A 1GZ6A 3EW7A 1NFFA 3EVNA 2Y1FA 1L1FA 5I8WA 4ZHSA 4NK5A 1JTVA 1C0KA 4M49A 3PQEA 4R9RA 4R01A 4DYVA 1ONOA 2YYYA 3AI3A 4CMJA 5EESA 4FOOA 1R4NB 4RCVA 2IYPA 4YAGA 3G17A 1BHSA 3CINA 3VKUA 4JK3A 1YWGO 1G1AA 1NVTA 1IYZA 4BV8A 3CMMA 5B4TA 2J8ZA 1BRMA 2CVOA 3LT2A 4WLUA 4BGEA 4WPGA 4DLLA 1X14A 1NWCA 2AA3A 5TX7A 3PYMA 1I3KA 2OOSA 1A27A 1O6ZA 1V8BA 2VWHA 3LT4A 2X5JO 5U9CA 2E4AA 4M55A 2QIOA 3I9MA 2DPHA 4AG3A 3INTA 4XWYA 1UZNA 3EK2A 3O8QB 1LI4A 1GDHA 1NTOA 4LRSB 1WP4A 1WPQA 3DC2A 3GDOA 3JQ7A 3JYOA 2LDBA 1HYHA 3RQSA 1KETA 3CUKA 4Y8VA 5KCZA 2PH3A 2UUOA 3WDSA 4UVGA 4M87A 4O6VA 3SC4A 1N7GA 5B1YA 4IXTA 4TRJA 5LDHA 2PGJA 2PD4A 1I2BA 2ZJ0A 5BSGA 1AN9A 2D5AA 1H6AA 5JAIA 4UVIA 2PKRA 4DMMA 3ORFA 3MEQA 4FJ0A 4YJGB 5BSHA 2A92A 5TRTA 4B3JA 3ZWAA 5JAZA 3V8BA 5A9SB 5EPOA 5EN4A 3L6OO 5JC1A 1K0UA 3BZUA 6LDHA 1BVUA 2NSDA 3S2EA 3V5NA 2A9FA 2EP7A 2G82A 2WDZA 1DJNA 4HFJA 4ZRNA 5H83A 1X0XA 2X8LA 3RUHA 3H3JA 2B35A 3CH6A 3BHJA 4XRRA 3IP1A 1PTJA 5KOIA 3JD4A 1ZZEA 4EUHA 4U6SA 5I7FA 1E0DA 2G1UA 1EEHA 3H5NA 3QW2A 3VVBA 4L4XA 4NPCA 3W6ZA 2E82A 1IPEA 1AXEA 3EZLA 4JCOA 1U3VA 4IZIA 3PWZA 3HDHA 4YBZA 1ISGA 1H0KA 4UULA 3RKRA 1CJCA 1KVRA 1JKFA 1R0SA 3IUPA 4NFYA 3ZV4A 4CM8A 1XG5A 5A1TA 4ALNA 2VYND 4N5NA 4BNNA 4D44A 3PZRA 3OJEA 4IINA 1EZ4A 4R51A 4XX0A 1JVBA 4DC0A 5JYDA 4B8WA 2R00A 3CXRA 1R12A 2NVWA 1EQ2A 5FYDA 4BNZA 1ZMOA 1E3IA 2C54A 1KC1A 1PJSA 4TKMA 2BI7A 4FFNA 2Q1WA 1YS4A 1GUZA 2VHVA 4J16A 4YJFB 4O59O 3O8QA 3TFQA 4QT0A 4I8XA 3IL2A 3EAGA 2GN4A 3E8XA 3PI7A 2O23A 3GFGA 5EQFA 3DHEA 1K89A 3DONA 3ASVA 4MVJH 4WCFC 2EP5A 2UAGA 2Z95A 2JJYA 3BMNB 3JD0A 4S1VA 4OSPA 2IODA 4KWHA 4DPMA 1PQWA 3PFWO 2EWMA 3I4FA 1MLDA 2Y68A 2OBYA 3W1VA 5IDQA 4CM7A 2HU2A 3DR3A 3OJOA 1BG6A 4XR4A 3C1OA 3DFZA 1YB1A 1QYCA 4A5OA 2GGSA 1O89A 4IDDA 3WWYA 4LISA 2ZCUA 4J1QA 2QRLA 3P2YA 4IJVA 4ZQEA 3RU7A 1E77A 1E3EA 3GG9A 3FF4A 3ONFA 4ZVVA 1ENYA 1O0SA 3S55A 4JBGA 1FF9A 5JO0A 4JN6B 3WICA 3IC5A 4YXFA 1O5IA 1OAAA 1H93A 1UH5A 4B7XA 2RBEA 1I8TA 3E5MA 4XQCA 4BO0A 1E3LA 4Q3EA 1R4MB 1HSZA 4C4OA 3GVXA 3GZ4A 5ADHA 3WFIA 1T26A 3S8MA 3E9NA 2WTBA 4HUJA 1MUUA 3JQBA 3VKVA 5A02A 4Z3DA 1B8UA 3DXFA 5JS6A 5J23A 2CZCA 3T7EA 3GHYA 4JBIA 1U3WA 4UUOA 3OA0A 4B4UA 1X13A 2VYVD 4RVFA 3RBXA 4ZQFA 1GQ2A 4R5HA 2NLOA 2B5VA 3F1KA 3KBOA 3QY9A 4MVJF 1E6EA 4CJXA 3PIIA 4OQZA 4P22A 3WLFA 1MB4A 4B7UA 4RDHA 4XYGA 1LC3A 4GSKA 4IS2A 3S1LA 3AM4A 2AEJA 4OXKA 4YT8A 4NFHA 3AJRA 3N74A 3U49A 3M2PA 4JXKA 3UW3A 4E6PA 3C85A 4CV0A 1VJTA 3WMXA 1WZIA 2GERA 4D3FA 1F0YA 2XPCA 1ISIA 1HE3A 1AE1A 3ITKA 1T1RA 4E5KA 1U7TA 5TIIA 4XQEA 3ZWMA 1P1KA 1P1JA 2BGMA 4J2OA 3FSRA 1PJBA 4TRMA 1KEWA 4WE3A 3JD1A 3U4HA 3QLJA 1N9GB 1NPYA 4XKJA 1F8GA 1IHYA 2P68A 4J0FA 3HADA 4GX1A 3SC6A 1ORRA 4AJHA 1PJTA 1PJ2A 2YUTA 5BNFA 1VC2A 3HSKA 1D7OA 3M2TA 3FNGA 4BS9A 5JCXA 1ARZA 3H6KA 2OORA 3ZNOA 1UXKA 4CMGA 4CQMA 4CQLA 2PFGA 2YFHA 4E2WA 1HSOA 3AWDA 3SBOA 3AI1A 5KJ1A 3LSYA 4J6FA 1ZSNA 4CR7A 4PRKA 1QLJA 3I6IA 4MJLA 2FSVA 5JDIA 3F3SA 2EG9A 1E3JA 2J5QA 3WTCA 2BI8A 3E1KA 3QVWA 2Z1NA 4FFPA 5IN4A 3WYBA 2EKQA 3H9EO 2PR2A 2EF1A 2Q50A 3UCEA 5A5FA 2YQ4A 3JD2A 5I9NA 3OJFA 4PVDA 4BNTA 3O03A 3DAGA 1DJQA 4RPJA 3WGOA 3C1TA 4ALMA 3BYZA 1A4UA 1DC6A 3K73O 2NNLD 3QIVA 3U5TA 1KVSA 5I7EA 1NAIA 3RBZA 1Y8QB 4II2A 4H16A 1B0AA 3AU9A 4BKQA 1E7WA 1K2WA 3WQRA 1EBUA 1W8DA 2TMDA 3C7DB 1HDCA 4D41A 4IJUA 3FN4A 5HS6A 3JTMA 3WYCA 9LDTA 1UZMA 4FB5A 4EW6A 4NI5A 4G2NA 4BMNA 4WJZA 1GUFA 4QEDA 1EUCA 1WDKA 4WLOA 3PDUA 3PYXA 5JY1A 2YDYA 3GZNB 4YJGA 1HL3A 1LDNA 3O9ZA 1GY8A 5L7WA 5DP2A 4W4TA 4E30A 1JVSA 3KRTA 2GNAA 3NRCA 3KTDA 3TWOA 3QQPA 1DBVO 3ZU4A 1U8FO 2XF8A 3GNSA 2NU6A 5LCXA 3MWEB 4YQYA 1L7DA 1CQIA 4DQUA 3A1NA 5A06A 1W73A 3DL2A 1LQTA 2H1SA 1PIWA 4GWGA 8LDHA 1EK6A 4MP8A 2E37A 4J4BA 1B2LA 1RYEA 2VUTA 5THQA 1N8KA 2GLXA 3SLGA 2HK9A 5JPIA 3VTFA 5BR7A 4J1TA 4OOEA 4CM8B 4I9UA 2EGGA 1T2FA 1XLTA 4LSWA 4WOJA 4BQPA 1KYQA 1ZK2A 1PJ3A 1YBAA 3UCFA 2OMEA 2P5YA 3I83A 3NX4A 1ADBA 3QHAA 3UGKA 2GDZA 1G0NA 1JKIA 1HWYA 2J5KA 1MX3A 3L4BC 4NHEA 1QR6A 4LMRA 4TROA 4TSKA 3Q3CA 1NASA 5A05A 1ZK1A 3P7MA 5IZ4A 2JAHA 1K6JA 4KDFA 2JCXA 3MOIA 2RHRA 1R66A 1SPXA 5JYEA 4FBGA 1XGKA 3N58A 1Z45A 4GLOA 3ONDA 4YT4A 4ZICA 4EEXA 1Y8QA 4BNKA 5AXBA 4CM4B 4IGFA 2VWPA 1IE3A 4NBRA 2VHZA 1A72A 2WEKA 1XEAA 3HB4X 3FI9A 1U2GA 1QLHA 3EMKA 5TQVA 1LSSA 1QYXA 3F1LA 4P38A 1E1NA 1A71A 1KY5A 2NTVA 2B37A 2P5UA 2Q1TA 4FC7A 2BELA 3Q6IA 4IMRA 3WXBA 2GUGA 1QKIA 4YJHB 1JAXA 3K5PA 4XQGA 1HDOA 2X9NA 1ZSVA 4PLYA 5JLAA 2H9IA 4WCDA 2XXBA 1ML3A 4BNYA 4BOYA 4CMIA 4MVJI 4KQXA 3GVIA 1YQGA 2XOXA 3ZNQA 4XYEA 3VDQA 2PLAA 1BXGB 4KDEA 4PLVA 2GRAA 4OXYA 5KKCA 2PZJA 3AFMA 1JLLA 3B1FA 1DXYA 4ILKA 4P4NA 4PIVA 3ZWVA 5KIAA 5I8ZA 1QSGA 1XWFA 5DN9A 5JW6A 2Y1CA 4B4WA 4BNFA 1Y5RA 4MKRA 2O3RA 1XQ6A 4GKBA 1DLIA 2I6TA 3TOZA 3HN7A 3VDRA 3VAZA 1MFPA 4U7WA 3PK0A 3ZWBA 4GVLA 4A73A 1B14A 1DRUA 1NQOA 3V1YA 3ZHZA 4MOWA 1NNUA 1OOEA 2LDXA 2NVUB 4RF5A 4CLXA 1KEPA 1QXSA 3Q0EA 3QRWA 4E3ZA 2Y1DA 5ENVA 1SEVA 2VT3A 3DOOA 4HNGA 4BQRA 5KWEA 2TMGA 2VOJA 3DHNA 3HN2A 3K30A 5K6AC 1A4IA 4PG8A 3KEQA 1L7EA 5H82A 1QV6A 1X1TA 3QWBA 3TL3A 4RVSA 2H63A 1IUKA 2EIHA 1IY8A 1OZAA 3HFSA 1M6WA 3F5QA 4N5MA 1UDAA 3RFXA 3DBVO 2B4RO 2Q46A 4JQCA 5T5QA 3A14A 4AJLA 1F06A 4LN1A 1CDOA 1GYQA 4ND5A 4AJNA 1ZUD1 5B4VA 1NWHA 3PYLA 1BGVA 3GUYA 5DCWA 3OIDA 3NTOA 4KQWA 2DBZA 1UP4A 1B8PA 1BW9A 4OO3A 1I01A 2I99A 4OHUA 4E32A 3DMTA 4BIIA 2B4QA 2FSSA 1LA2A 2J3JA 4P8RA 3T4EA 4CQMB 1SB8A 1JDJA 2JFFA 4WLNA 2IXAA 3PQFA 5G4LA 3Q9NA 5FEUA 1EE9A 2CVQA 4WCFB 3GG2A 3WGZA 3LZ6A 2P9EA 3NKLA 3ZU2A 3DB2A 2ZJ1A 1AHIA 2X7HA 4J4TA 2HJRA 4RPLA 1EVIA 2Q99A 1VL6A 2V6BA 4TVOA 2HMUA 5KNLA 5COQA 3WGYA 2JD0A 1PJ4A 1PJQA 3WMWA 1SAYA 4AJEA 1DC5A 3RJ9A 4J7XA 1I30A 3R0IA 3ZWXA 5I9MA 1F8FA 1OC4A 3IQDB 4Z0PA 1VJ0A 4BO6A 4ALJA 3G79A 1GU7A 2V6GA 1SOVA 1XCBA 1MFZA 1E3WB 3H9GA 3BTUA 1DHRA 2O3SA 1HDZA 3RD5A 5JCJD 4BNMA 4ALKA 1SZJG 3QV1A 5LDGA 3PTZA 3ZHBA 2Q2QA 3GVPA 4CMEC 3DBLB 3AM3A 3R3SA 4A0SA 1HYGA 5DBFA 1LDEA 2X5KO 4EGFA 5CPBA 4IM7A 4K9DA 3AY7A 4E2XA 3F9IA 3EUWA 2BRUA 4JP3A 4IQGA 3O38A 1T25A 4KZPA 3ETEA 4B8ZA 1V3VA 1C0PA 4GGPA 4CL8A 3KEOA 3JQAA 2O2SA 1LTHR 4L74A 1ZJZA 2W2LD 2DLDA 2VZ0A 1GEEA 4ZRMA 3ROMA 5TLSA 1RM5A 2FWMX 1Y9AA 2RAFA 2HMVA 2OBNA 1SO8A 2FMUA 1OFGA 2VRCA 4GQAA 4AJKA 3TZ6A 4IPTA 4XZ3A 3RUCA 3KYBA 2E6UX 2NACA 1QMGA 1TA4A 1LDBA 3PLNA 3VZQA 2HDHA 1C14A 3DAFA 3OECA 3ROQA 4MVJG 3T4XA 3HDJA 5TNXA 3JYPA 4AVYA 1C1DA 2VHWA 3LDHA 2QYTA 1B16A 5AVOA 4BKRA 3GRPA 3JQ6A 2ZQZA 3KYCA 2ZYGA 1UP7A 4HKTA 3VVCA 2OL4A 3GUCA 3PJDA 1Y1PA 4BGIA 2AQIA 3LLSA 3AI2A 2VUSA 5DDIP 2OP0A 4AJ1A 3OETA 1AHHA 4QO8A 2Q2WA 3JQGB 4TRNA 3O4RA 1VLLA 3KYDB 4BUCA 3B1JA 3LT0A 4JX8A 1R15A 5AYVA 1HE2A 2CDAA 3TZKA 5IG2A 1JU9A 5EJ2A 4PLTA 3QE3A 4N18A 4JIGA 4RVDA 2WD8A 1T2AA 2P91A 2JKVA 2YDXA 4K6CA 3C7CB 3QSGA 2CD9A 4I5DA 4RO0A 4CPDA 2NQTA 1PZFA 3AY3A 2VQ3A 1ZCJA 2FRDA 3ENNA 1VPDA 2UVDA 3EYWA 3HB5X 1BSVA 4BGUA 1I24A 2WD7A 1E7MA 3GAFA 4TVBA 5DOZA 4Q3CA 2YJZA 4Z9FA 1YGYA 3LYLA 2I9PA 3K2EA 3PP8A 1NHGA 2A94A 2AXQA 3ANMA 4Q39A 2EW2A 1GV1A 1X0VA 3Q2IA 4MP6A 3LC7O 1DC4A 2O4UX 2ZB8A 5HRUA 5COBA 2O2YA 4QX6A 4YR9A 4I5EA 3ROPA 4ZJUA 5KJCA 3IP3A 1LRJA 1IL0A 3UFXA 4IJKA 1A7KA 2X23A 3BIOA 3BMQA 4Z0TA 5GZ6A 1ZIDA 5FFFA 4CQMD 1TT5A 4TKLA 2HMTA 2IRWA 3DZBA 2X5OA 4BO7A 4LK3A 1YBMA 3PFFA 1DEHA 2C0CA 3KV3O 2JL1A 2IZ0A 1DHTA 1YBVA 4RF2A 1Q0QA 2QG4A 3GGPA 3GFBA 1GQYA 3TNLA 3KYCB 1H9BA 3RC7A 4ZQBA 1LUAA 2C82A 1TI7A 1CEQA 1C1DB 2Y0EA 4W6ZA 4JP2A 1NQAO 3RVDA 3ZWOA 4IZHA 3JQGA 1FJHA 1YL7A 2BGKA 2D59A 3SLKA 3BMNA 4Q3NA 3ADPA 2QZ9A 3D64A 2OZPA 2JHGA 5JMWA 4QQRA 1WDLA 1WLYA 2FHSA 4CV1A 4Y6RA 5CFZA 2PTGA 3TPCA 2D5CA 4IDAA 4UEKA 1D8AA 2YW9A 1TXGA 1UXJA 2JFHA 5I9LA 1QYVA 4JJIA 1I33A 1P3DA 1H2BA 3NEPX 4RVHA 3HDQA 2QRKA 5A9RA 5L3ZA 2JD1A 3ANNA 5CDGA 3DBHA 3QVTA 4K26A 4CMAA 4BGVA 4B4VA 4DC1A 4Z9YA 5B12A 1E1LA 4DGSA 3K6JA 2W2KB 3VH4A 3PHHA 3VPFA 5KTKA 1XHLA 3OQ1A 4PLHA 3KUXA 4ID9A 4D46A 1XDWA 5EERA 5BNIA 4L76A 3PHJA 4IQ8A 3ZGYA 2NV6A 4L8VA 2PZMA 2B4TO 3IS3A 1XELA 4YVFA 4Z0HO 5HWSA 3ZWWA 3GGGA 1ZBQA 4FS3A 1TLTA 1XSEA 4K28A 5CHEA 1FDTA 3A9WA 4IUYA 1EK5A 3RC1A 1HDYA 2AEMA 3NT2A 2WYWA 4UVHA 3R1IA 2CVZA 4J3FA 1R6DA 2AQKA 1MGOA 5G2OA 4CM4A 3NGXA 3JQ9C 4M54A 1Z6ZA 3LC1O 3TQHA 3JQBC 3GEDA 4A2CA 1XU9A 1H6DA 4UUNA 1PQUA 1I36A 3VZRA 3ZWYA 5HTOA 2IXBA 3RASA 2YY7A 4Q3AA 1IZ9A 2ZTLA 2FY8A 3OHSX 3FNFA 4HBGA 1NPTO 4M86A 3EDMA 1BDBA 1IHXA 4RQTA 3PXXA 3E5RA 5IF3A 1ZO8A 3X2FA 4RPHA 5BSFA 2ZTUA 3JQFC 3DZIA 3RFVA 4NK4A 4L9RA 1DIBA 2PNFA 5L45A 3L6EA 3RROA 2VTEA 1E5QA 5G0VA 3H9JA 4IY1A 2IZ1A 4XEHA 3FHLA 2GPTA 2PA3A 2WMDA 2VNSA 3DDNA 3PJGA 1JA9A 2FN7A 1S7CA 4ROSA 3JQCA 4E2YA 1CETA 1BWSA 1P9LA 2NU7A 3GN1A 1Q1NA 1PX0A 3GMDA 3BAZA 4XJTA 4MVJM 4BNWA 4AFNA 1SNYA 4CLOA 1KEVA 4E2ZA 1R37A 2GCGA 2HSDA 1TB4A 3NT4A 5JFOA 1PGJA 3H9QA 2DTXA 1XU7A 2ET6A 3ZWPA 1KVQA 2D0IA 2VHYA 4NDNE 3FBTA 5ES3A 3ZNPA 1XA0A 1BDMA 1ID1A 3HUDA 3R6DA 3WGGA 3K2BA 2EJVA 4OKIA 2Q1SA 5ITWA 3P5SA 4XB2A 4L0QA 3TJRA 5HS4A 2DPGA 3I52A 4PZDA 4U0KA 1B26A 3AOGA 4Z6KA 4HFMA 3ZCXA 1E7QA 3KLPX 2D3TA 3LLVA 4RV9A 4AJOA 4A03A 2O7SA 2O4CA 1UP6A 5CDUA 1F17A 2XXJA 3T7CA 4E12A 5KJEA 2H6EA 4PLPA 1PGPA 1H6CA 2ZKLA 3NYWA 2W8ZA 4ZA2A 3GEMA 3WBBA 4BO3A 3VH1A 2GZ3A 1LLUA 4ONEA 2HO5A 1EQUA 2PGLA 4H7PA 3WNQA 4U0JA 4AJ2A 1EFLA 1U5CA 3IJPA 2DT5A 3WNVA 5L95A 1M76A 5JDCA 1RYDA 3HWRA 1KY4A 2VNAA 1DIHA 4QUKA 1HTBA 2W2KA 5EL0A 5JAMA 1QYDA 3WR5A 2P9GA 3FNEA 1Y8RA 3KXDA 5AXCA 3TRIA 1WMBA 3N7UA 3ENKA 4AICA 1OBFO 2C20A 5CEFA 3BHIA 3K9QO 4DQXA 3COSA 3A28A 5C5IA 3A06A 1EUDA 3DMYA 1A9ZA 4YJHA 2PK3A 3AY6A 1DIRA 1KS9A 1NFRA 1Y81A 3PVZA 5TGDA 2GN6A 2X9VA 3KSDO 2Y0DA 1JAYA 2DTDA 2GF2A 2ZQYA 3IMFA 2Y05A 2B69A 2C7GA 4IDCA 4J49A 1RM3A 4TZTA 1DSSG 1VSUA 3GEGA 1DIAA 4BO1A 5JDCC 1ISHA 4RF3A 3BA1A 5AXAA 3H3FA 1GZ4A 3R3JA 1YOVA 4XDZA 1H6BA 3DOCA 1N7HA 5KVVA 5DP1A 3JYQA 3HJAA 5F3RA 1A7AA 2DUUA 3RU9A 2WWRA 3OJ0A 1XIVA 4IQ0A 4BV9A 2FPPA 3GAZA 3ADOA 3WG9A 1J49A 2YQ5A 2CNBA 2PWZA 4NBTA 1C1XB 4XIYA 4EDFA 3PWKA 1Q7CA 2EJWA 3JSAA 5HM8A 4CMKA 5FWNA 3KVOA 3WSWA 3WGHA 2FR0A 4AJ4A 4DRYA 1NFQA 1IPFA 3DAPA 3V2UA 1B3BA 1CRWG 1UUFA 4XJSA 3TZCA 4I9NA 2O7QA 1LSOA 4GWKA 3I9JA 2HCTA 3E03A 3D4PA 2IEBA 3VPGA 1DRVA 4J1SA 1EVYA 2QYSA 3AOEC 2D8AA 3DTYA 4R4JA 1I5RA 1T2EA 1RPNA 2CUKA 1ISJA 5A03A 4PLZA 3EHEA 1FK8A 3W4JA 4WUVA 3PQDA 5JY6A 4RPGA 2D1YA 3KYDA 2VHXA 4W7HA 3EZYA 2P4HX 4W99A 3I9NA 1NYTA 5F1KA 4J90A 4BVAA 3IIEA 1PS0A 4ALIA 5JC8A 4GI2A 4XA8A 2PH5A 1D1TA 2ILTA 3L9XA 1P74A 3WSVA 5AOVA 1M75A 4LRTB 2Q3EA 4WEQA 4XIJA 2YHIA 3F5SA 2GZ2A 4I9HA 4YAIA 1NR7A 2X6TA 3G1TA 3RIHA 3L6DA 4TRRA 5IXYA 1K5HA 2UV8A 3DEYX 2NTJA 2DU8A 1LDYA 1J6UA 3GDFA 2I76A 3AOEA 4D0SA 4FD3A 1NX6A 4FJ1A 1MC4A 3GT0A 4NIMA 4QO7A 4QTZA 4IDFA 1Z7BA 3OBBA 4UVEA 1SMKA 3NDJA 1Y6JA 1IOLA 1X7HA 4IDEA 5GZ3A 4GBJA 2PKQO 4WCFA 2WD7B 3TDKA 2QX7A 3F6YA 4XDYA 1PL8A 4I1IA 3JQ8B 1EVZA 3KSZO 4KUGA 4CR6A 4DBZA 5GZ1A 2NWQA 3UN1A 5DF1A 4DMLA 2X0NA 1YKFA 4NBUA 1NQTA 5FF9A 3VOSA 3OF2A 4CMBA 2X86A 3G3EA 4HXYA 4M8SA 4PCVA 4YYZA 1P1FA 3VPHA 1U4OA 3JQAB 3NUGA 4HFRA 5IAAA 1EMDA 3FR7A 3V1UA 2FZWA 4LSMA 3IJRA 3WJ7A 3RUEA 3ZDFA 1HE5A 3GGOA 4MKXA 5TT1A 5DBIA 1LBEA 2HRBA 3W4KA 2J5RA 1TVEA 1PGNA 1YDWA 3OMLA 4PG7A 5B37A 1PWZA 3E48A 4KUEA 3NDIA 4PZEA 1YQDA 2CF6A 4II3A 4ZD6A 5TF4A 4C7KA 4EYEA 5JMPA 2J3IA 2PY6A 4WLEA 3PPIA 4O0LA 3UAGA 2X9GA 3H2SA 1FDUA 1QORA 3HNPA 4GSLA 3DHYA 2EV9A 3NJ8A 4H3VA 1ZSYA 3U3XA 1WAMA 2DUWA 1UDBA 1ZKMA 5DCUA 4L73A 1UDCA 2G0TA 4EITA 4CUJA 2BD0A 3FRJA 2ZYDA 1Z75A 2NUAA 1KEUA 3DBHB 3JQ7B 1YH3A 4XQ9A 3RWBA 2BMAA 4JBHA 3UCXA 5JNLA 1DO8A 4PVCA 3TF5A 4Y9DA 3NTQA 1Q7GA 2VTDA 1TT7A 2G76A 2V7PA 3MCVA 4NBWA 5BT9A 1HLPA 1J5PA 1RKXA 3F4BA 4BO4A 3WYEA 1ADGA 1F14A 5MGBA 1BTOA 3U62A 3KLMX 4FPXA 3UF0A 2X0RA 4BNLA 4MO2A 4NBVA 4FGSA 3RFTA 1HRDA 1N1EA 2DAPA 3RUIA 2Y1OA 4ND3A 1HKUA 2Y66A 3HHPA 5TC4A 3L77A 4HADA 4GGOA 3E9QA 3WIEA 5H81A 4RORA 4NZ9A 1GADO 1E7SA 3IKVA 4WECA 3SVTA 2P9CA 4AJPA 4CM9A 3V1TC 3KETA 1DC3A 4PG6A 1HEUA 1T2DA 1G0OA 3TFOA 3WX0A 2C59A 3C7AA 3FNHA 2HJSA 4WOKA 4BMVA 2OXIA 3RSHA 3AUSA 2I3AA 5THKA 1J4AA 1SB9A 4F45A 2ZB7A 1VKOA 4RF4A 4YRBA 2JHFA 3DFUA 2WE8A 2OFPA 1X15A 3PIDA 2BH9A 5DBGA 3GLQA 1GCUA 3DTTA 1S6YA 1FDSA 1UR5A 3B1KA 1JWBB 4PRLA 4EJ6A 1UJMA 1ULSA 3GPDG 1EUZA 1QRRA 4MIOA 1LLQA 3EC7A 4A27A 3PHLA 3AU8A 3L9WA 1C0LA 4CM5A 1VRWA 3NTRA 3SXPA 3U4DA 1MXFA 2GD1O 3EY4A 4QSMA 4BO2A 1BMDA 1LEHA 4R69A 3ZHXA 5C7OO 3VZPA 3JQDA 4KWIA 4F6LA 1KVTA 4F46A 2OGUA 3OSUA 5T67A 1CF2O 3M6IA 3CSDA 5DNAA 4X54A 4YEDA 5DOVA 3VH2A 3KSUA 3X2EA 3GNQA 3OM9A 3ZV5A 1X1EA 9LDBA 3DZKA 5C37A 1HDXA 2IZZA 1GPDG 2Q4BA 1AUPA 4XD2A 2BKAA 2FP4A 3KB6A 2FOIA 3BTSA 3MOGA 4O1MA 5FI3A 5JXWA 3WJAA 2QQ5A 1E5LA 3WB9A 2Y1GA 3TL2A 1JWAB 4CLDA 4FN4A 1Q7BA 5GMOA 5IN5A 2D2IA 3JQAD 1LC0A 3ANLA 4BKPA 4HY3A 3OIGA 2EXXA 3F47A 2VYNA 3MJTA 3LC2O 1LLCA 4NJMA 3WGQA 4DWVA 2F1KA 1T24A 3H9UA 5F1OA 5CDTA 4GH5A 2VT2A 3LQFA 4G5HA 4E13A 4HFNA 2HUNA 1BVRA 4A10A 2HMWA 5A9TA 4E4YA 1N9GA 4PLGA 2FPIA 4P4LA 1PL7A 3QWAA 1WWKA 2DM6A 4DVJA 2DBRA 4DPKA 4NNJA 2GO1A 3MJVA 4XGKA 4DIFA 4D3DA 4R3WA 3U4CA 2JD2A 1MXHA 3PHGA 3OEWA 4HWKA 4IMPA 3B20A 4RVGA 2QHXA 3ABIA 2PGDA 4DREA 2O3UA 4ZQHA 3STHA 1W6UA 5HBRA 4EI2A 3EGOA 5L7TA 3Q1LA 1I2ZA 2QRJA 2X22A 1SCUA 1Y8RB 1GEGA 1Z74A 5A3JA 3D4NA 2C5EA 4L4RA 1NQ5A 1X7GA 1LRKA 3OQBA 5KKAA 3PZBA 4DPLA 2AMFA 4IIUA 3RKUA 3G49A 3FD8A 4IGEA 3CIFA 3BTOA 3TZHA 3VH3A 3WGIA 4OH1A 5TT0A 1LJ8A 3D3WA 1PZGA 5U1PA 3M1AA 1RWBA 2V6FA 3NT5A 5U4QA 2JAPA 1ADCA 1Z73A 2VRBA 3JQ8A 2AE1A 4YDRA 1I3LA 3JQEA 4ALLA 4M89A 1ZW1A 4A7PA 4RJTA 4M1QA 1PWXA 1LXCA 1YOVB 2B5WA 1T4DA 4QECA 4CUZA 1QYWA 2C7VA 2VUUA 1P0FA 2G5CA 3F4LA 3GY0A 2FR1A 4FR5A 4B3IA 4EUFA 3DZGA 3G1UA 4DXHA 1EDZA 5B4UA 4XRGA 3DBRB 2VYVA 4LCJA 1NM5A 3ASUA 1KVUA 1VJ1A 2I65A 1KBZA 4ZQGA 4YAEA 3RCBA 4D42A 4Z9XA 3DO5A 2GN9A 1EBFA 1YL5A 4E21A 1AGNA 4WLFA 4RL6A 4N7RA 3AFNA 5EIOA 4U6QA 3TN7A 4LW8A 4YTEA 1DPGA 5CP8A 2CF5A 3W8EA 3B6ZA 3JV7A 2Y0CA 3K8ZA 1WDMA 2NU8A 4GX2A 4KMSA 4R54A 2EGHA 1P44A 1ZH8A 1M66A 4LCEA 5L4SA 3ZHYA 2BF7A 5FI5A 1ZK3A 1R0KA 3BXXA 4H15A 6ADHA 3JQ9A 1VL0A 3ST7A 1YB5A 1GCOA 1UAGA 4WNIA 5JCJA 4GMFA 4CLOB 1ZEMA 4I5FA 3OA2A 4CV2A 2AQHA 2DTEA 2Y99A 4BHTA 2P2SA 5JBIA 1D1SA 1IZ0A 1LRLA 3E9MA 5T6BA 4FC6A 3B70A 4KOAA 1YO6A 1R4MA 3UUWA 4YCAA 4DIBA 3UXYA 4TWRA 3ITDA 4BNIA 2NM0A 3INGA 5ENDA 3BMOB 5DZSA 2C5AA 4FSHA 3WGTA 4QXMA 5JO9A 1HZJA 4DQVA 5C7IO 1GTMA 5AXDA 5L40A 2WM3A 3H8VA 2XAAA 5ER9A 4CMCA 3F46A 3OJLA 4Q3DA 3RBVA 1B3RA 5JDIC 3GHHA 3H7AA 1YRLA 3PLRA 1U7HA 3QP9A 4CM3A 1E6UA 4CV3A 2GN8A 4Y98A 3DBRA 5T8KA 4PN3A 2GASA 3ZU5A 2IE0A 1DDOA 2C07A 3MWDB 4O63O 4D43A 2BGLA 4ZGWA 4YWJA 4LVUA 1IB6A 4CMIB 3V2GA 2PZKA 3MJEA 3NJ4A 5C3MA 2ZCVA 1CWUA 4F3YA 4XGNA 3IKTA 1LX6A 1R16A 3HFGA 2HKIA 4TQGA 3W8DA 2AE2A 3K31A 3NV9A 4FFOA 1N2SA 3M1LA 3AK4A 4XB1A 1JN0A 4CL3A 1ONNA 3BMCA 2Q4EA 1E1KA 4RZHA 2R2GA 2VWGA 3UKOA 4R5MA 2ZK7A 2PV7A 1XQ1A 3PGXA 3QVOA 2DBVO 3RUFA 4YJFA 2EKLA 4FCCA 4FOSA 3AUTA 5ER6A 4ZU3A 4DUPA 1F12A 1W4ZA 1B7GO 3VC7A 4J1NA 2VZ9A 1WXDA 3NDRA 5A4DA 3E82A 3L4BA 3U09A 1ISFA 1HDGO 3ZW8A 4RPKA 4YRAA 1N1GA 3VTZA 2Z1MA 1H94A 4BNUA 4E5YA 4EJ0A 3Q2KA 4BKUA 5K6AA 1FMCA 4OM8A 3FPLA 3ZH2A 4G65A 3QWFA 4NG5A 3FCOA 2QZZA 4ESOA 4CMEA 1E92A 2DVMA 4JGBA 1QV7A 4MVJE 5ICSA 1MP0A 2VCYA 4YACA 4BNGA 1KERA 4AJIA 3GNTA 1NHWA 4PFJA 4OOFA 4PGFA 1SC6A 2ZYAA 3DQPA 3BMOA 3UHAA 3QVSA 2NTNA 1PU2A 3KZVA 3QWIA 2BFOA 2Q45A 3U0BA 1BXZA 1P31A 5DCYA 3D1LA 4RDIA 4W9NA 4RVUA 1CIVA 1EFKA 1MG5A 4CUKA 4RLHA 4YJDA 3UVEA 1OMOA 1PJLA 5LC1A 4B79A 4C7JA 4CR8A 1XR3A 2UUPA 3QVXA 3D0OA 1YJQA 2CSUA 1Q2XA 3IOYA 1FDVA 3HQ4O 1E7YA 1CQJA 3GRKA 4NJMB 2V6MA 1T4BA 2JCYA 5I7VA 4P4GA 3O26A 1KC3A 2EEZA 4MIEA 4UUMA 3WTBA 1HE4A 3ETGA 4DIOA 2Q49A 7ADHA 3BMQB 3GR6A 4BB5A 2BLLA 4J7UA 5T8KC 5L7YA 2WJPA 5IZCC 3ICPA 4U8GA 3P19A 4XYMA 3WOHA 4DBVO 4KTVE 1BW9B 1YQXA 1ZFNA 1HZZA 4Q9NA 1T2CA 4W82A 4YQZA 2V65A 3VPXA 1LDMA 4EBFA 2RIRA 5IDXA 1LNQA 2OUIA 5JAQA 1ADFA 4BNHA 1YL6A 4PLCA 1MG0A 2H5LA 2AHRA 4I08A 4J91A 1WMAA 4RQUA 3DBLA 4GMGA 2DKNA 5MDHA 4OSOA 1M67A 4XCVA 1PSDA 5IDWA 3U9LA 2FPGA 4PLWA 3TZQA 1C0IA 3PJEA 1ZK4A 3DZHA 3JQFA 3FR8A 1GUYA 4K1LA 2E48A 3H65A 3KM0A 1MA0A 4BMSA 3CE6A 3GPIA 3NGLA 3NAQA 3UOGA 1NP3A 4E5PA 4D79A 1U8XX 4R1NA 2WE7A 5KVCA 1CERA 4J4HA 1PZHA 5ICMA
chains in the Genus database with same CATH superfamily
2XCSB 4KIWA 3LL4A 1E2NA 2R6AA 1W94A 1GRRA 5G02A 1D4FA 3A1CA 4FE3A 2C5HA 1SUEA 5D6OA 5FPYA 4EZBA 3RADC 4LXXA 1I1QB 2GBIA 2ZYIA 5HFAA 4Q3BA 3MJSA 4V0MA 1E2IA 1HQDA 3IEMA 1JEQA 4YT5A 3F8TA 1W19A 4K6KA 5BRJA 4WKGA 3RRZA 5A62A 3RRMA 1QTRA 3FPJA 4XR9A 1SVOA 2AG5A 4ED9A 1OH6A 1RYYA 2ZVJA 3O4GA 3QVLA 5CHYA 4C3OB 2D62A 1ZW6A 5E6SB 3CWZA 2MHCA 4XARA 5JZVA 2GILA 4ITUA 3CR3C 1QE5A 4P2BA 1RYFA 1WXWA 3UOWA 1P1IA 5IDYA 1CYDA 1GA1A 4BBZA 1VKNA 4FUQA 4GU5A 4YRFA 2BEJA 4IFIA 1TJYA 4LFCB 1PDVA 2PMDA 1RVDA 1KK3A 1SKAA 3RUDA 3D1VA 4KQKA 2I5PO 2QVXX 1RXYA 4AMYA 4FJ2A 1KZ6A 4Z1MD 2VR1A 3EXHA 3FOBA 5F7ZA 3HN6A 4UREA 4CLRB 4D74A 4CODB 3DZJA 1ZGBA 3GC6A 3K4PA 3IHLA 3TTYA 1KNQA 4P7KA 4JC8A 5IJZA 2CXHA 3I9KA 2XMCA 3C3AA 3CTMA 4P86A 2VQFB 1O5OA 5KJFA 2Z4TA 2B0CA 1PGOA 3ZHCA 2VL7A 4J07A 2BZ0A 1SELA 4IJQA 2VF8A 4OB7A 4F85A 2BFDB 4XGRA 1UXHA 5H16A 2H3EA 2Z8YM 3VYWA 2G0NA 4OMUA 4P4TA 4DM7A 3MXOA 3VX3A 4E1BA 5BVGA 3RAGA 3UH1A 5H8WA 1I9CA 1XP5A 3HCFA 2P6NA 3UMRA 5FPQA 1I0ZA 4A3SA 3K0CC 1PEDA 3ISTA 3EVZA 4A26A 4ETWA 1AQYA 1R8SA 4LHYA 2WKQA 5T7BA 1PAUA 1Q12A 2DMRA 5KSOA 1LTKA 1LQUA 3H11A 2YV3A 1VSVA 1DT3A 5LWHA 2DX7A 2P2GA 4LNUA 1V3TA 1EDBA 1M7BA 4UUPA 1SXJE 3NVDA 3OIYA 1ESDA 1HK7A 2H18A 3W34A 1UCFA 2DQSA 4C43A 2Y67A 1KP9A 1QGED 1T9AA 3AHDA 1ZITA 2Q2OA 3K0FA 4WZZA 5JWHA 2O3TA 4ND4A 2J3KA 3ON5A 1SOMA 4AYTA 2VP0A 1V9LA 3GDGA 4OHPA 2V1UA 4RMIA 1UMBA 1D5CA 2JGKA 1V35A 2OR3A 2ZSJA 3DEFA 3MBKA 2OAQ1 4WNAB 2I66A 1RM4A 3ELYA 3T7AA 2EHDA 1BQEA 1H8EA 2ZR0A 5F5LA 5L4LA 1FUIA 2EFYA 3PFHA 5CK5A 4DOMA 5K4GA 5AUQA 2ATVA 2B4KA 2PG3A 5CAEA 1NGSA 2PU7A 4FXPA 1CUUA 2IHZA 3PC8A 1GZ3A 4D5GA 3GGCA 2ZUDA 3H2ZA 3O8CA 3GUHA 2XZPA 4RH0A 1GGHA 4Q3OA 4CFZA 4LJ9A 4V2UA 1PWYE 1O6BA 5F23A 1O95C 2EKPA 2XYQA 3FLAA 5IDQA 5A5EA 1PZXA 1XC7A 3T38A 4YCNA 1RBZA 2ZEJA 2P90A 4BV2A 3ZCSA 2CMDA 3X43A 2XT6A 2WAAA 1MOPA 1SG0A 5CDYA 2QMOA 3PVCA 4D7AA 3PNOA 1HETA 3HYLA 4QUIA 3NBFA 4HGZA 3UWOA 4U5QA 2X1HA 1OI3A 2J3HA 2Q2VA 5GJVC 3JS5A 1Y9DA 4FVTA 1O94A 2NYRA 4AWXA 3W8FA 1ZL0A 1IXKA 3OZSA 1RMYA 2QT9A 1PL6A 1NVFA 4FIZA 1LTQA 1TMOA 3A9TA 3D7NA 1Q0LA 3DOEA 3F67A 3HY6A 4M9QA 4RFLA 5KOJA 3FTNA 4RIGA 3E3MA 4NU6A 2GVDC 4JJEA 5K45A 3A58B 2FZGA 4NJOA 5KB3A 4DHEA 2GUWA 3IAHA 1SD5A 1U7UA 3GU3A 3PXEA 4NYMQ 5LU8A 1MR3F 1DAKA 2G36A 4FOLA 5M34A 4NENB 5CYOA 1MV5A 1LS6A 3Q5EA 4PNHA 4ZCLA 3BL8A 5KWIA 2NU9A 4PFSA 5C18A 2AVDA 4ZJYA 2IZ7A 3HDGA 2DT8A 1BS2A 1ENPA 1HYEA 2HCRA 1DNPA 2Z6VA 1K86A 1Y7IA 3DFMA 4I1OA 4KLAA 2IPAB 4ERXA 4YV0A 1RHMA 2EW8A 2XMPA 4DCPA 4BLOA 1GQSA 3FYHA 4IJWA 5BN5B 2IE8A 4JNKA 4DBLC 3MG9A 4GI3A 3U4QB 3GF4A 3FVVA 2Z4SA 3ETDA 4UEOA 3H11B 3FSEA 1D4AA 1DB3A 4IF6A 4Q1DA 5F21A 1US8A 2JGEA 4O4JB 2OB1A 4L27A 1D2EA 2RH8A 3EODA 3HB9A 4NFLA 1QWOA 1KIFA 1W581 2J6IA 1J7KA 1FX0A 3GQVA 2WTXA 2YYZA 2O8CB 1EFCA 2WJ4A 4QUGA 3ABQB 3BWBA 4I36A 3OOEA 4DLTA 1QP8A 1N57A 2WF8A 1ESZA 4D9IA 5TSDA 1X8KA 3FHJA 1Y7TA 3NU1A 1U2SA 1MAHA 2YUIA 3BCRA 3FCXA 1I3NA 3TLJA 3I8XA 4MVJP 3TOXA 3UB2A 5JHGB 3KKEA 5AKGA 1FJ2A 1HFEL 5EZQA 3WOVA 2JBHA 4O4JA 5BPFA 2CV0A 3SS7X 2WD9A 5EIWA 1KAGA 1K08A 4H6XA 2XYRA 4YDHB 3E9ZA 2I67A 1QCCA 3PDHA 2BJVA 3BM5A 4KP7A 4FNOA 4IDGA 3JVEA 2PIDA 4G0PA 4NULA 3SFZA 4J2TA 4DXDA 3P2MA 3DF9A 3PUIA 4HQFA 4LJLA 4XWTA 1QHYA 2FN3A 2NQ8A 2Z04A 1EG7A 2KJQA 2B0JA 1WVGA 4ZC1A 1IY1A 5D51S 4I81A 3VHRA 2QG9A 5T57A 3KOUA 4OIMA 4KEAA 3I8SA 4MRRA 1XTKA 5CVJA 1U28A 2DC1A 4MZDA 1Y5MA 3AO0B 3O84A 4HAYA 1LVGA 1U0SY 3K5HA 4K2AA 3HO8A 1Y6GA 1TYDE 1CQXA 3WIDA 1K3TA 4HMQA 1PS8A 3DAYA 4OGWA 1EE2A 3U7RA 4D98A 1S2OA 1XBTA 2G9VA 5FWYB 1DC7A 3A37A 4M0LA 1AA6A 1CRZA 4US1R 2VLBA 2IY9A 1GO2A 2UYYA 2X42A 3V2HA 1IB0A 2I2XB 3H5AA 3LV8A 4G41A 3R2JA 5EP1A 1GGKA 3C3EA 1YR8A 2ODAA 3IQZA 5FJIA 3OZEA 2CCKA 3IDSA 4WXPA 3UMSA 5ADUS 3D3EA 2XWBF 2Z57A 5EXTA 4FFRA 1D9ZA 5AQ1A 3OQMA 4AX4A 4MLPA 5ILGA 3KD2A 2IXGA 3UUFA 4QQNA 5I9TA 2QR2A 3C5VA 4HDRB 1JHRA 4RE5A 3DTVA 4NP6A 3I3OA 4JROA 5GVSA 2PN1A 4KWEA 5FYQA 2OCPA 4BB6A 4HC4A 4PGAA 1FDRA 4OLFA 3HR7A 2AUMA 2XYVA 1GNTA 1NT2A 1P19A 1NBAA 2B8JA 3FJ1A 1M10A 3OJWA 4KV7A 4DQDA 3ZVNA 4UVDA 2CFOA 4TV9F 1RAIA 2PR7A 5JV5A 3LTNC 1SVNA 3SX2A 1E9SA 1JR3D 2PWYA 1J0AA 4DUGD 3PFKA 2MIIA 1YCFA 1W7AA 5T4EA 5EE1A 5HJ2A 3TZBA 3UATA 5ADWA 4BVJA 2HPHA 3OMXA 2OPHA 3FBGA 4N3AA 4RJJA 2IUSA 1L5NA 3COZA 1WETA 1NURA 2RGBA 4FBMA 4N7JA 2QROA 3QVJA 1RHRA 1ZINA 1QG6A 4MW1A 4IJ5A 2CHUA 1JQBA 3HVRA 1OA0A 2JCGA 3BF8A 4OATA 4PC6A 5CG2A 2Q62A 3GD5A 3EE6A 3DOJA 5EZ5A 4A5SA 2BMVA 4EG0A 2WYOA 1QRUA 1JKMA 1U3CA 4JYMA 2WTUA 3GFSA 4B6FA 2ILVA 4D56A 2CNNA 4IUCS 1E3WA 4NONA 1DQPA 1TFRA 5CUQA 1U3UA 2WJIA 1LPNA 3BDIA 1BCRA 1Z0SA 2VNJA 3HFRA 4QBIA 3W4IA 3D4OA 2Y77A 4R2KA 4HO1X 3OEHD 4AECA 2IS6A 4IVQA 4F6RB 1QRSA 2J3MA 3E1SA 5GM1A 3WJ1A 4DJAA 5EJ5A 3F3KA 5FCDA 2P9YA 1KZ7B 1U9JA 2IYEA 2CD7A 1U5AA 3DWFA 3GUZA 2W98A 3T0IA 4OL0A 1LV7A 2AK2A 4M1SA 4G0XA 3RIGA 3VJLA 5JJKA 1BHO1 5DTMA 4YFYA 4IILA 1SUCA 1XEXB 2MYUA 3JAMA 3C3BA 1N0HA 2CJXA 5FL7A 2CE7A 5KYYA 1UXOA 5EJ9A 5IFLA 5ALSA 2CLOB 2O2EA 2EF0A 1LI5A 1DMSA 3EIHA 2RGEA 4N39A 2PUTA 4IEFB 3HKEB 3ORSA 1SBCA 1G4UR 1C3OA 5IRCD 4F2PA 3T8YA 4LECA 1Y4SA 2WKRA 2PGXA 3RJ5A 1FTYA 1Q74A 1K6XA 2AGVA 1YVEI 4UAUA 2DR2A 3AJ9A 3OIVA 4JLWA 4YO7A 2CDBA 3KSBC 1ENOA 1WDWB 4A91A 3EEFA 3NBAA 1KAHA 3BKXA 4HQNA 4B73A 4XYBA 2VBFA 2O50A 4PR0A 4MUYA 5ALNA 4CN8A 3R9XA 1WTAA 2RHOA 3NKFA 3GRRA 5JSKA 2JFGA 3EIXA 4IIVA 3F6SA 3AHEA 4MWZA 2ORED 2F7SA 4JI1B 4HX5A 1CJMA 3AKCA 5LA6F 1L9XA 3UJ7A 5EMHA 1U2RA 3BL6A 3OFVA 4ARBA 1OTXA 1U3FA 2VDNB 1LBHA 3BCHA 2QN2A 2QTTA 4KXUA 3OX2A 2EFEB 3M4JA 3WK7A 1RCUA 3M1IA 4TTQA 1UKZA 2BMDA 3EZ9A 3RVKA 3SY8A 4DCSA 2Y8EA 2WIKA 4JDUA 1IZZA 4D4JA 5A0TA 1VPEA 3GRYA 3H5IA 1U63A 1KAQA 2MSWA 4NEGA 3KHUA 1IXZA 1D9XA 4BO5A 5JT1A 4R1SA 5JS8A 4LV8B 4HFRA 3PE3A 1VZ2A 1RDFA 3SMVA 4UTPA 2Y3IA 3VHQA 4AQDA 2ZRQA 3QX7A 5IXSA 5GY7A 1QGAA 3WBFA 1S4MA 4OGLA 3H4IA 4PG5A 3PUKA 1J1UA 4K9NA 1GFSA 2VO1A 3AUUA 2A35A 1IHPA 2PYDA 3AIMA 4Q6WA 2X0DA 4KIGA 3SE0A 4RDXA 1M1NA 1XRLA 4NU8X 5FUYA 3AEZA 1CZNA 1M3SA 1GPJA 2DFDA 3L7KA 1G9TA 3RS5A 2A7XA 1M6VA 3OZIA 4QC2A 4EMUA 4DJDC 1GL3A 1M7HA 2R0QC 3ZDBA 2AFIE 2XWQA 3HL4A 5IAGA 1ZVMA 3AHHA 2O7VA 1VI2A 1U8TA 2ZTMA 3R5SA 2H1VA 2VDWA 3HDYA 1NVMB 2HK7A 4L4ZA 2ZWPA 5MGNA 1P1HA 4UHHA 3W8NA 1YFJA 4PSKA 1R10A 2BBOA 4OQPA 4BWVA 4EKIA 1N77A 3M7IA 2WSYB 3N8NA 2CXTA 1WHSB 2HRDA 9MHTA 4PAGA 1TNDA 4UAGA 1ODIA 1CS4C 2GZ1A 3TIGA 2J0EA 4CKWA 1RLJA 3EXHB 3F3YA 2ACKA 5K0NA 5FV7A 2HLNA 5REQB 1V48A 3C8MA 3PGA1 4R8SA 3H2GA 2P9HA 1U4SA 3N8GA 4QRDA 2P69A 1MEEA 3DHVA 1OV6A 4TMKA 4RESA 3ZZNA 3P96A 5KOYA 1RQ7A 1E1MA 4UXIA 1DBQA 4M0FA 4ZRMA 3ZBQA 4GEGA 1LB1B 2IOQA 5LLTA 3QE9Y 2OHHA 3RSSA 4CMHA 3BXGA 2FW0A 5EGSA 1FX0B 1N92A 2YYAA 3C4VA 3EEIA 3GEPA 1KQNA 2FZEA 1NBOA 3I6YA 2HIAA 1WUTA 1D2GA 2VP6A 3P4YA 4DV7B 3U44B 1V8ZA 3D7SA 2Y1EA 3G89A 4RPCA 1Z4LA 5BNTA 4OEHA 3DJFA 3QY0A 3T1TA 1SA0B 5G0UA 4AUKA 4D4KA 3U61B 5T64A 1RJWA 1W2GA 3QVVA 4OFWA 4G1VA 4HBZA 5KJ6A 3QLTA 2FPGB 2RFLA 2FUG6 2FFBA 3AV0B 5B1IA 3ZY5A 4AM8A 1EXWA 4YMHA 1X7XA 2Q5JA 1ILEA 4UNNA 5I8WA 1R6XA 4QKQA 5J9FA 3PQEA 5TPWB 3S6JA 2I80A 4BKMA 1XJCA 4R01A 4DYVA 3DQZA 1U0TA 4E7PA 4ZKDA 3ZE6A 1V95A 5CJPA 1QRTA 3BWVA 2BDEA 3D4BA 1R4NB 1XTUA 1QX3A 2IYTA 2IYPA 2HDOA 1Y89A 2QUAA 3F6RA 3PIRA 4X20B 5BSUA 2FN8A 2HQSA 2XKBA 2Y0BA 3VKUA 1YWGO 3RV4A 1FSGA 1S7GA 1XFDA 3M49A 2J8ZA 3BSYA 3R5XA 5AJYA 5JEDA 5MN4A 1SUBA 1BRMA 2CVOA 2AN4A 3TMAA 4A73A 4WPGA 5FXMA 1JKXA 3U1BA 1YK0A 4P93A 1X14A 1NWCA 4O25A 5LMZA 3AUKA 5BP7A 4XJXA 1I3KA 2CXSA 1XD8A 2PGIA 2VJBA 3U7IA 1COWD 2AD1A 1Z7WA 3N05A 4U6NA 4DR6B 1AH2A 2X5JO 2W9XA 1AURA 3ZE1B 2E4AA 3I9MA 1YDMA 2DPHA 2PUAA 4ZVQA 3KKOA 4EB8A 3GH1A 5K3BA 1GG5A 2ZZKA 3HY4A 2OC4A 3EUEA 3BGWA 1YRAA 1NTOA 2R1VA 1WPQA 3HGTA 4QD3A 4YRRA 1WBBA 3OOHA 4ZCMA 1DS6A 2A3RA 2OESA 3AVPA 3MUNA 5AHXA 5IW8A 3WWOA 3JYOA 5B36A 3JAKA 3ZQUA 2LDBA 3UANA 1HYHA 1N2IA 2IU6A 1FFBA 3AEXA 3ISVA 5BWOA 4G84A 3TOSA 1U8CB 2PH3A 4QTYA 1XEWY 4TT3A 4IUBS 1W2WB 2XW6A 4M87A 1N7GA 4IXTA 4RDCA 3NUQA 4AO6A 1D5WA 4DRXA 1FMTA 2ZJ0A 4GXRA 1G20A 2O1WA 3RGWS 2VI5A 2B2XA 2D5AA 3CRRA 1CUFA 1YAJA 1U9YA 1ISRA 4LZAA 5BSHA 4EM6A 3DFFA 3QLUA 4B3JA 3Q3VA 4JHLA 2DQYA 4HJXA 4YJ3B 5EN4A 3JVIA 3FHCB 5JC1A 1U0BB 4BZPA 1UBHS 2GCNA 2IWHA 3V5NA 1B74A 2XQKA 3D7RA 4JJKA 5CH8A 5KAMA 3WMFA 1DJNA 4CGYA 1G8SA 4Z5XA 3QYAA 1Q92A 4N0MA 4D97A 1U0LA 4X8HA 5C5EA 2HNKA 2PAFA 1O9HA 3R9WA 3IP1A 1G3MA 3OHMA 4YRJA 4CQJA 5KOIA 3OY2A 1HZZC 1Z2AA 1ZZEA 3L1JA 4NMMA 5C34B 4U6SA 2O5EA 1O94C 1P7ZA 2C99A 1J33A 1DEXA 2XT0A 3IBTA 4PPQA 4C3ZA 4LHEA 5JFTA 3D7KA 4U8HA 4L4XA 4NPCA 3W6ZA 2E82A 1IPEA 4P7GA 2Q8PA 3EZLA 4JCOA 4DT1B 4DKJA 4KHPB 1DAFA 3G2QA 5I7WA 4IZIA 1AVTA 4G36A 4G0NA 1DQSA 3GJ5A 4EHAA 2WSMA 3SHOA 1CJCA 3MWEA 2VLIA 5JQWA 1JKFA 4DS3A 1DDIA 4J75A 1MRZA 4XM0A 1O6FA 3N8IA 4ALNA 3QXJA 4C3VA 4CIWA 1UMDA 4I8DA 3T5MA 2C00A 3OJEA 4R51A 1YZ3A 3L0YA 4IGIA 4OMFG 1SXGA 3PQCA 2QQ0A 4IV5A 1KH1A 5JYDA 4CTOA 1YVUA 1PSWA 5A0VA 4YI3A 3CXRA 4IKEA 2NVWA 1EQ2A 4LCBA 5FYDA 1ZMOA 1E3IA 3DC7A 3IHTA 3K20A 2VXBA 3DDOA 2R8OA 4HNAB 1Q84A 4TKMA 5ECWA 3LHKA 1EJBA 4JT8A 1DO0A 1YS4A 3G5UA 1OCEA 4MR7A 4J16A 3VR0A 2VJAA 3D3JA 1W36B 4E5VA 3EAGA 3HKBB 5E9QA 2O23A 3GFGA 5EQFA 3BCUA 1XDGA 3KOOA 3GA5A 4ZEOA 2FFHA 1B6GA 1TOAA 3O2SB 3GLGB 3AM1A 1FSFA 1WEHA 2XGJA 4RGYA 2ZRJA 3JRWA 1SXPA 3VYVA 4KWHA 2IDKA 3VVLA 5BPHA 3RFCA 4B3TB 2C4UA 2CLHB 2GEVA 4CDNA 2UYCA 3H5VA 2Y68A 4K6HA 5EOVA 1ABBA 1RT9A 1Z5PA 2C7BA 2OBBA 4XR4A 1Q0TA 4LC0A 4NOKA 2WNSA 4L7QA 4WAUA 1U8YA 3ZE8A 4DZZA 5K09A 5LLDA 1L5VA 3DAHA 3GRVA 2XY4A 3KLOA 1C9YA 3WWYA 2F3TA 4CM7A 4YMLA 1YR1A 3KZKA 4LISA 5KBYA 4I99A 1KGDA 3P2YA 1TJNA 2DRIA 1O97C 2CFTA 1E77A 1T3TA 3U56A 2Q5HA 4FLEA 2ABWA 3FF4A 4G4SO 4G5XA 4ID3A 4BB9A 4EVQA 1W4RA 2YRWA 2ZXUA 1QH9A 2PUHA 2C8VA 2HHJA 3PXBA 3FAZA 4NX2A 1Q1EA 3E5MA 1GPAA 3IEIA 4UCFA 3ZWDA 3G0CA 3R23A 4NATA 1E3LA 4AZTA 4LYFA 1PO7A 2J32A 1XNHA 3EH1A 3O0DA 4KFCA 3AVVA 2HJHA 5DNVA 5E38A 3R75A 3AF3A 1L5WA 1QOQB 2WTBA 2WPDD 3FCYA 3JQBA 4B9AA 5A02A 1B8UA 1BEUB 1ZICA 3JQRA 4KZKA 4PX5A 2JJ1D 3QMPA 1K27A 3T99A 5J23A 3KB2A 2H4WA 1JDSA 2R7LA 3C8DA 2RC5A 3C98A 2NSYA 1Y34E 3CWQA 4LNHA 5C7YA 3GMTA 4B47A 4Q1FA 1JFLA 4G26A 4RYLA 3RBXA 4TV9A 4BRSA 1Y3BE 3G7SA 5GAJA 3TNYA 4R5HA 3WBKA 4DV3B 1K8YB 2B5VA 2ZJZA 3KBOA 4QELA 2D13A 1E6EA 3J80A 4OQZA 4P22A 1TPZA 1H5UA 4F7WA 2R4QA 4BQOA 1BMFD 4XYGA 2ZIUB 2OBMA 2IYSA 3S1LA 3PD7A 4D25A 4OXKA 5A0FA 2HIHA 4Z2YA 3U49A 3UAOA 1VMAA 1X7WA 4MRMB 4GUDA 4M1OA 4OQNA 4BFVA 5GADl 1TTQB 1GZ7A 4Q24A 4CZ2A 1XZ8A 2FFQA 3A2MA 1VJTA 2RSLA 4FLFA 4EHKA 3O2NA 3D6HA 4NNOA 4D3FA 2NZXA 2OENG 4ML3A 2OG2A 1T6ZA 3I9V1 1ADYA 3B6IA 1ISIA 1AE1A 2R751 2I4OA 1AMOA 5KTMA 3TW8A 3O7MA 4XQEA 3ZWMA 2XD9A 1WRBA 3EVFA 2O2ZA 2BGMA 5A6SA 3FSRA 1XTJA 5BWLA 4BFUA 3UT5A 5HVNA 4S05A 4WE3A 3DE5X 1OX6A 4PGHA 5HZHA 1HQKA 2XJ4A 3CVXA 4BNDA 1NPYA 4DY4A 2HT1A 4DE5A 2REQB 4TV8A 2QDKA 5NULA 4AJHA 3V1MA 2AN1A 1PJTA 1WKBA 3L1IA 1PJ2A 2C7OA 3VBEA 2IIPA 1NJ2A 1D7OA 1RAFA 3WHLA 4NBNA 1SC9A 5JCXA 3CRVA 1YHYA 1UXKA 5G3ZA 3MUEA 2YVKA 1W5AA 2QX6A 3UTCA 2OILA 3LBNA 2BMEA 3ZKAA 2J9GA 2V45A 2XCIA 3M9LA 4BLTA 5K3OA 3ITEA 4JBYA 2PBFA 1D2CA 4RMNA 3OLZA 3W6OA 5KQLA 1OX4B 2JFPA 4J6FA 2DFKB 4CR7A 1DUVG 3QITA 3I6IA 1MH9A 5JDIA 3F3SA 1AQIA 2EG9A 2FDXA 2E55A 2TMYA 3Q9SA 1Q6ZA 3CVYA 2OCBA 3JXEA 3E1KA 3P8ZA 4OG2A 4P80A 5HG0A 5K0EA 1AKYA 1RZUA 4JLPA 4FFPA 5AVJA 1S1CA 2WWVD 5IN4A 5ENZA 3G5MA 3H9EO 3W79A 3QNUA 1LBSA 5K3SA 3EG9A 1DG3A 4JLBA 5SV2A 2YQ4A 3RJZA 2CBGA 3G2HA 5I9NA 4GR4A 3AEUA 1JPVA 2XWJI 4FW9A 5JUWA 1ZH0A 4G6ZA 1Y9ZA 1H4VB 1RZVA 4PVDA 2H5EA 4UJ5A 3SG0A 3IUBA 4LOIA 3ICOA 1DJQA 3OOJA 1QV9A 2HPVA 2C9DA 1XZIA 1A4UA 1W88B 4KFSA 1V5IA 4PWZA 4TLDA 1U9CA 1NG1A 1VJ5A 4DCTA 1L5YA 4UM9B 5I7EA 1VLVA 5SZKB 5SZJA 4II2A 2IPLA 4P32A 3I2KA 1XMXA 4DLZA 5LQDA 4UNSA 3AU9A 4MCIA 3IDQA 3DLTA 4YECA 2H51A 4N6NA 1NVAA 2V7QD 3U39A 3ESXA 4OQDA 1U3DA 1Q0SA 3LY8A 4S35A 1LPOA 3JU3A 5LQAA 4D41A 2IFTA 3OIWA 3FN4A 4QBGB 5HS6A 2QDXA 2QRNA 4XFDA 1UZMA 4FB5A 3CM0A 2GJSA 2I22A 2WAMA 4YNBA 3FPGA 3GEEA 2I2BA 1EUCA 2LV8A 3K0KA 4W1PA 1GRCA 1U11A 2UYOA 1GLVA 1XHFA 1XL0A 2WZQA 5FFMA 5AW6A 3EGVA 5DHPA 4I9FA 3GZNB 3JQPA 5GGXA 3DT6A 4OU4A 2JFZA 4NYMR 3O9ZA 2GK7A 3MERA 1GY8A 2MDTA 4DCMA 2BT4A 3D8BA 3M6UA 3FYUB 1EK2A 4DAEA 4QFMA 4QXQA 5J4KA 3SXUA 5JH7F 3A27A 3WZLA 2AHOA 4HAIA 1JVSA 3A4IA 4ZAZA 1FRNA 5LXTF 3VRHA 3VNUA 2Z5GA 2DYKA 3DZ8A 5F4ZA 1QTIA 4K9MA 5B3JA 3TPZA 1JSLA 1DAGA 3HM9A 4LHVA 2QW1A 1U8FO 2XF8A 3FE2A 5DLDA 3O94A 5ESRA 3LPNA 1Z2CA 1B0UA 1L7DA 2BHTA 3WIEA 3IIKA 4ENQA 3QMWA 3R7LA 2EEPA 5NLLA 1LQTA 1F4VA 3IKLA 1Z62A 1BRTA 2O8EB 1KMNA 1QFJA 4H08A 2OHFA 3DP7A 4GWGA 1Q11A 1P5ZB 3ICQB 1CUZA 1EK6A 2UUAB 5JMTA 1NM5C 4MP8A 4LJ6A 4J4BA 1KI6A 2VUTA 4MW6A 5BSTA 3PICA 1X1AA 2GLXA 4YRLA 5THQA 3SLGA 1MZPA 4RTNA 4HRVA 3VTFA 1M6YA 3CONA 5KINB 4J1TA 3B53X 3PR1A 3QPVA 3FUCA 1PG2A 1K7EB 3Q3HA 1JU3A 5CT4A 5E9AA 1Q83A 5C3UA 1ZK2A 5EHZA 2H29A 4LE2A 1YBAA 4JGGA 2NGRA 1GNSA 3AF5A 3KFLA 3KDAA 3MJDA 3NX4A 1ADBA 1MT0A 3QHAA 3UGKA 4B6PA 3SICE 4ARZB 5FTLA 5HR5A 3E8MA 1SIWA 3GIWA 4PGGA 4M8IA 2HJ9A 4A23A 2J5KA 3ABRB 4KR3A 3EYAA 3VR1A 1XP8A 2J3LA 1XDUA 4KXVA 3UG6A 1A7JA 3Q3CA 5A05A 1XWIA 1NYQA 1R5JA 2JAHA 2R25B 2VDVE 5TPWA 3WK8A 2DCUA 4KDFA 1GU1A 2JCXA 3NR2A 4D81A 4DV5B 5AVWA 1XMPA 4OP3A 1V1JA 3MOIA 4YYEA 1INLA 2ZP1A 1E6LA 1J56A 2B2CA 4DGQA 4KLZA 1M2EA 1SIOA 2ONKA 2QJTA 3ONDA 3FWKA 4KN8A 3GX1A 3PXAA 3K1AA 4PS0A 4O2AA 5JS2A 5AXBA 3ZWQA 2AKAB 3IALA 4BFXA 5C5DA 3K09C 3BB3A 4NARA 1SRRA 4NBRA 4XLTA 4EY3A 2WEKA 4EKEA 2XF2A 2V1XA 3FI9A 2O7RA 1JXAA 2ECOA 1LVHA 5TQVA 4DUZB 3KXLA 3F1LA 2XUQA 2XDYA 5JARA 1KY5A 1VLQA 1V5WA 1KORA 2ICAA 1DTWA 1UC8A 3EZ6A 2WAOA 4IMRA 4P3XA 3O75A 1UMCA 4EGJA 1YA6A 3BX1A 1QKIA 3HEBA 2O2GA 3BICA 5LNK1 2PKEA 2R6DA 4JVOA 4N0DA 2W83A 1U5BA 2CV1A 1V8FA 4GSYA 3HTXA 1I7NA 3L7DA 5E95A 4FTWA 3FOCA 5JLAA 5A2GA 4YREA 4QDKA 4H2DA 1ECCA 2YZMA 3T3IA 4MAMA 1AKTA 4B31A 1H2RS 1WHSA 3GVIA 3ZNQA 4QVIA 2VCHA 3DVRX 5CVVA 1U98A 4KDEA 4LGYA 3PT5A 2PZJA 2ZM6B 4ILKA 4QUBA 2GM5A 4ZO8A 2Z2JA 3O6VA 5LOVA 2Y1CA 1KFBB 5HE8A 4B4WA 3B1VA 2GNPA 2PQ6A 4C03A 1D2HA 5ELLA 4GKBA 6AT1A 4LY9A 1I0IA 2GS9A 1PR0A 4DRXB 2I2CA 1T9ZA 3VC1A 2XHEA 1X3SA 1NF8A 1NQOA 3E84A 1QYRA 4QAQA 3V1YA 3RVOA 5B30A 1T6XA 2NVUB 1NNUA 4CXMA 3NKVA 3EVGA 1SN7A 1QXSA 3NBZC 1ZI9A 2H4ZA 4PIMA 2I6GA 1T4MA 2BM8A 1E98A 3RHZA 4HNGA 3H86A 4OYHA 3VKHA 1DEKA 1CSEE 2BBTA 2VOJA 3INYA 4C6TB 5B53A 3HN2A 3QE2A 5JXGA 4V38A 5K6AC 4G56A 3R0JA 4RPIA 5DGIA 5F2OA 2WJGA 4HRXA 2A86A 3O9VA 4L9AA 3OE5A 3QWBA 1SUIA 3QLUC 4U3JB 3FRHA 1IUKA 1SBIA 2O5VA 4AN0A 4YMUA 1ODFA 3DBVO 4HRYA 4I4TF 2ZSBA 1U28C 3U6KA 4IDQA 4LRQA 3A14A 3B5IA 3OZGA 1WHTB 4ZQCB 1XYVA 3FGPA 3PQ4A 1F06A 2WJ6A 3T3HA 1FJXA 1ZJWA 4HQ6A 3NPAA 5IYZA 2NIPA 2AI3A 1DKUA 1OQAA 1P17A 1ZUD1 2WJJA 1PUIA 3K9CA 4U7HA 4YIHA 3T7RA 1BGVA 4TKVA 3N0RA 2Q6VA 4X8OA 2G77B 1E1CA 1NW8A 3NTOA 5ALEA 3NNNA 3TQQA 3CF2A 4OO3A 3RYFB 4E32A 4BIIA 1FPMA 1Z0IA 4FFVA 2B4QA 4P8RA 1LA2A 4Y2VA 4CKWB 2ZYHA 3OEHA 3S8EA 3PITA 3WK9A 1VMKA 3WB0A 3IH5A 5E0KB 5FH9A 3HLYA 5AOBA 5HNKA 2R2AA 3Q9NA 1YIAA 4N9WA 4B84A 2CVQA 4C0WA 2BCEA 3GG2A 2ROQA 1KYIA 4NHOA 1BWQA 1E2DA 2YHAA 3B1WA 1O2DA 3NKLA 1Z33A 3GRFA 3DB2A 4KO2S 1W8IA 4JYPA 2WKSA 4MJ3A 4ZOCA 1USKA 2X7HA 3OLCX 2DFNA 3ND7A 4D4GA 5KVAA 2GEUA 4PGMA 4I4TA 2ZAYA 1W47A 2OV4A 1EVIA 2XMBA 2Q99A 3DE3X 3PDIA 2HMUA 1J8DA 1NU8A 5COQA 1PJ4A 2N42A 1D2RA 1PJQA 4LGMA 3LWZA 3WMWA 1VKZA 1P61B 1A7UA 3ZY4A 4J0KA 5LD2C 5DYTA 4J7XA 4OHWA 3L01A 3R0IA 4HTFB 4YRMA 5BYKA 5KKNB 5D3MB 4C6RA 1GUDA 1R18A 1VJ0A 4LF6B 3QTLA 1E59A 2HTFA 5GJWC 1KE1A 1GU7A 3AJDA 2BKXA 4EI9A 1HDZA 2D5LA 4DG8A 3QXXA 4CIBA 1SZJG 3ETCA 2PXAA 5LDGA 3ZDAA 1U9IC 1D0VA 4CMEC 4NCXA 3DBLB 5KNDD 2DB3A 3FCUB 2H08A 4NPHA 4UASA 2BUCA 3NEAA 4MYUA 1TVMA 1TRKA 3F9IA 1II0A 3GEIA 2BRUA 4JXXA 1WXQA 3R8CA 3B7PA 1V3VA 1C0PA 2VXYA 1I7SB 3BH6A 3BL5A 4JI0B 4CL8A 1JLKA 3KPYA 4RTLA 5TS2A 1BOOA 4Y9TA 1ABEA 1ZJZA 3FYTA 3ONVA 3MPUA 3PSHA 4FR2A 1F8YA 4MQ4A 2MSCB 3MM4A 1WABA 3Q40A 4Y2PA 1RRKA 4DHWA 5TLSA 3TUZC 4JYAB 2HMVA 1GPLA 2OBNA 3I01M 4RKYA 4CYMA 1SO8A 4S1NA 2FMUA 1OFGA 2VRCA 1T4CB 4C0LA 4AJKA 2VJKA 4ZO9A 3KPUA 5CLGA 3QKSA 5C1IA 3TZ6A 4DCNA 2QVLA 3KYBA 3DG9A 3HGMA 4IL5A 3SQWA 1TQ4A 1LDBA 2GZDA 1T6BY 3DAFA 1XTTA 2W2PA 3GCGA 4EPYA 1KKLA 2R11A 2G7ZA 2CNDA 2FCAA 5TNXA 5F51A 4D9EA 3VHXB 1SXJC 4TLMB 1TMYA 2DUNA 5FNVA 3NV7A 2QK4A 2QYTA 4CU5A 2MR6A 3GQBB 4FCVA 4BKRA 2I7XA 1EP3B 3CF6R 4JKIA 2CCJA 1UP7A 2ZYGA 4Q9KA 3ZG6A 5JS7A 2OVBA 1P0IA 3Q41A 1QONA 3LLSA 2VUSA 3NTUA 3V32A 3E4DA 1FTWA 2AIRA 2O9JA 2F9MA 1TQ2A 3KL2A 3QI7A 4OK6A 5A6SB 2G08A 1V2GA 2XXAB 1VLLA 3KYDB 1T8UA 1RI4A 4LDRA 2EFGA 4X1IB 1SOUA 2HXGA 1ELOA 3LT0A 5AYVA 1RKQA 1L7MA 4QG3A 1PW5A 1SQFA 1WQ1R 5FNVB 4ADSG 5CLLA 2JI9A 4PLTA 2IXFA 3D6FA 3SZMA 2V3CC 1S2MA 3U3KA 1IQ0A 4PFKA 2R7MA 2WD8A 2P91A 4Z4GA 4DSTA 2G9RA 1RWXA 2VNHA 4K6CA 4DMKA 4AMZA 2CD9A 5H9WA 1TL7C 2I2FA 1SJ9A 1YZHA 3HJUA 4LOJA 4OFBA 1PZFA 3JZAA 3LQYA 4U7FA 3KQSA 4BECA 4Y1RB 2XLCA 3EYWA 2WD7A 4TVBA 1PKXA 1B00A 1N1MA 3HRIA 3LVRE 2YJZA 4RZSA 5AJWA 3LYLA 2I9PA 1A9RA 1NXSA 3TGWA 2VQSA 1XKXA 3R9KA 2A94A 3LQ1A 3KJQA 3NFYA 3ANMA 2EW2A 4MP6A 3KR1A 2O4UX 4YIKA 4RD3A 1QIKA 4OUKX 3EA4A 4EMSA 2GVZC 2O2YA 4YMWA 4QX6A 1NVKA 4CKCA 3JWHA 4YR9A 1N78A 5JH7B 2VHEA 3GXOA 3HS3A 3IHWA 4HL6A 4H0NA 3H2BA 1LRJA 3GJXC 1IXYA 2Z3WA 1SCAA 1GGMA 4IJKA 4P36A 4P98A 5HIMA 3A2KA 3FM9A 3STTA 3TR0A 5GZ6A 1ZIDA 1XTQA 3G0IA 3HXKA 4MLZA 5FFFA 5SY6A 3WYGA 4X20A 1TT5A 4TKLA 5HZKA 3U7HB 2FWPA 3DZBA 3IQEA 3OEED 3CUUA 4V0QA 3MRSA 1R74A 3EBLA 1QF7A 2HSWA 2XNKA 2J5XA 1UM9B 2O8DB 2YWCA 1H3FA 2XWSA 2VP5A 4ARZA 1LUAA 2D8MA 3O4JA 4BP3A 4HLUC 5CIYA 2JS7A 4FHEA 4JP2A 5DYGA 5B7PA 1QG4A 4OMDA 2Z8XA 1JG2A 2BR5A 5CU7A 1S4QA 1JI3A 4IZHA 3GP5A 4ZAYA 2JIZD 4XB6B 3SZRA 3DCIA 1GAWA 2GHQA 3C3MA 3DKPA 3EASA 3IOCA 1NKSA 1X2BA 3A2LA 4DCVA 4Q00A 3ADPA 3ZY2A 3D64A 2JGFA 1OHHA 1T1JA 4L8LA 1Y6RA 3TJMA 4F04A 4ZCTA 2QM0A 4NCIA 3DFKA 3CS3A 1NJ5A 2NO0A 5LZ2A 1WDLA 2WT9A 4TX1A 1T0BA 1XRPA 2V7WA 3OZDA 2G7MC 1D1PA 4LZNA 2VK4A 2Q2NA 2SKEA 3TPCA 4QGBA 3C5WP 3LOQA 1S3GA 3DMFA 2YW9A 4U2DA 1DARA 1QYVA 3W5JA 1I33A 1F38A 2I6XA 2DFLA 1C1HA 2BE9A 3HCNA 4RVHA 3TVTA 4QBFA 3MK31 4P08A 2QRKA 1DEAA 2R8ZA 2BEVA 4U9IS 5A9RA 5CDGA 3CNEA 3QVTA 4GPAA 5FHQA 3K16A 1VFPA 4Z9YA 3HNRA 3V9PA 4DC1A 4DGSA 4ZOLB 3V8QA 2W2KB 1SHUX 3OT5A 3PHHA 4ZAGA 2PZAA 1XHLA 4X95A 3STYA 3KUXA 4ID9A 4D46A 1XDWA 2DWPA 4G4JA 3AKYA 3UK7A 4L76A 4MAFA 3PHJA 4EQ6B 4IQ8A 3ZGYA 3IS3A 1CZKA 3G5TA 1IQPA 3KX2A 4LI3X 3DV0B 4EL5A 4QTXA 5CHEA 1FDTA 2ZIFA 1NLZA 4JUFA 3QF7A 2G1PA 1HDYA 1H3NA 3NT2A 2WYWA 3C74A 2OC9A 1SU8A 2GFIA 1FYFA 2CVZA 3IAXA 4UVHA 3MHTA 1KI2A 2RMKA 3H2HA 4RV5A 1K8RA 3C43A 2FP3A 4CM4A 1CUAA 2HMYB 3P1JA 2OBLA 3OZAA 3JQBC 1EKXA 4A2CA 3CKLA 4C2TA 3P9SA 5FKJA 2OBFA 3OZBA 4C1NA 3ZWYA 4RTQA 3AH8A 4URXR 1CUCA 4IG4A 5BOSB 3OJCA 1ZAKA 4I1RA 2VP4A 1M83A 2UYQA 3KJIA 1CULC 3NW9A 2YY7A 4JVNA 2G07A 4UBLA 3IB3A 2WRZA 2FY8A 1IHXA 3MRVA 3PXXA 3E5RA 4R2IA 2CUZA 1QIEA 4J1TC 3THXA 1JG7A 4P3YA 1EVQA 4BIMA 3TEFA 2H17A 1JHZA 4HEQA 1QQTA 3G9ZA 2AOWA 4NK4A 3DOIA 3Q10A 1UK9A 5AVQA 2DLCX 1JR3E 1XVUA 2YNMC 5ANRB 3RROA 5KNCA 3QFRA 5G0VA 1PBNA 3KS9A 5AW0A 3RVLA 1P2UA 3R4CA 4LV6A 4MUHA 2VHCA 5IX8A 4UNRA 3U16A 4TQUS 2GPTA 1MW9X 3M4XA 1EGHA 3LBAA 3DDNA 4ZV7A 5J4VA 1JA9A 3VA7A 3CR8A 4UOQA 3L7AA 1S7CA 4D8YA