3AUUA

Crystal structure of bacillus megaterium glucose dehydrogenase 4 in complex with d-glucose
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
262
structure length
262
Chain Sequence
HMYTDLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYYNNEEEALDAKKEVEEAGGQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIKGNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPINAEKFADPVQRADVESMIPMGYIGKPEEVAAVAAFLASSQASYVTGITLFADGGMTKYPSFQAGRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose 1-dehydrogenase 4
publication title Structure-guided mutagenesis for the improvement of substrate specificity of Bacillus megaterium glucose 1-dehydrogenase IV
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Oxidoreductase
total genus 100
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 1.1.1.47: Glucose 1-dehydrogenase (NAD(P)(+)).
pdb deposition date 2011-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3auuA00
4D0RA 4UVDA 2HK7A 4FFNA 1E3WA 5G0VA 3JQGA 4BKOA 4H16A 5HM8A 4CMIA 2CSUA 4YA6A 3DHNA 4TROA 4OHUA 4XIYA 4YAEA 1DLIA 1HE2A 4OKIA 4XDZA 2HDHA 3D3WB 2BFMA 4E4YA 3LYLA 1EE2A 3EDMA 1EBFA 3D64A 3HUDA 4EW6A 1V3TA 1YOVB 3WNQA 2RHCA 1Y81A 3E9MA 5T8KA 1LDYA 2IODA 2WEKA 2ZTVA 4LCJA 4B3IA 3PFFA 2CY0A 4XB1A 5KJEA 2GRAA 3T4XA 3FNGA 4PLFA 3B1KA 3QA9A 3U49A 1SNYA 1XEAA 3BXXA 4PLZA 1LRKA 4NNJA 2P9CA 3NAQA 4PLPA 3WMWA 1YQXA 1YDWA 1T4BA 1YVEI 4B4UA 4BO5A 1H0KA 3GDGA 4Q3AA 3G0OA 2O23A 5A5FA 1NR7A 1PGOA 1ZH8A 1CWUA 3D5QA 1YBMA 2BGLA 2YDXA 3VTZA 1Q7BA 1PZFA 2HJRA 3Q9NA 4IDEA 4BVAA 2PKQP 1HTBA 3AY7A 4Y6RA 4OXYA 1JVSA 1IPEA 1P3DA 1G0OA 1MX3A 4GBJA 4RLHA 1RKXA 4RF5A 4RVSA 4DMLA 3DZHA 1K6IA 5EERA 5CDGA 5I8ZA 3TJRA 3L6OO 4IZHA 2Q1UA 4CMAA 4CLHA 5JAZA 3L0DA 1I8TA 4GX2A 1HEUA 9LDTA 1X13A 4LRTB 3HHPA 1I2CA 1NR1A 3BYZA 1I3KA 2CDAA 3RAJA 4YJFB 5LDGA 3VH1A 3OMLA 5IN4A 3EW7A 5ITVA 1GYPA 3GVXA 3RC9A 2O3JA 4FCCA 3RBZA 8LDHA 1PX0A 2RH8A 4YRDA 4D0SA 1N92A 3OH8A 1B0AA 2EW8A 3QY9A 5TNXA 2GN4A 3AFMA 3K2EA 2PLAA 2QIOA 3WGOA 4CM6A 3MZ0A 4FFMA 4AG3A 3S2FA 3E5MA 4PFJA 3BHJA 3ANLA 2HQ1A 2NV6A 1ZUD1 1C1XB 1M75A 4BNLA 1DRWA 1DFGA 2JD0A 4I5EA 2JAHA 4MVJH 4L8VA 3IKTA 3KSZO 4TSKA 2NVWA 5LCXA 4RPHA 4WEOA 4QFCA 5TGDA 3TDKA 4OO3A 4DLAA 3CH6A 4E31A 3BTUA 1KC3A 1P0FA 2X9GA 2JJYA 1YB1A 1YBVA 2EWMA 4IS3A 3NDJA 3RUAA 1KEWA 4C4OA 3TZQA 3F4BA 4BO4A 1QKIA 1W73A 2YW9A 4Z0HO 3DR3A 1BXGB 4IJVA 2G76A 2AQ8A 1T2EA 4FB5A 3KBOA 5IZ4A 5IXYA 5ENVA 4GH5A 1R66A 4E5NA 3DBHA 3IJRA 4BNMA 4J0EA 2WMDA 5GMOA 2DPGA 2PA3A 4GKVA 2O3TA 2EF1A 2UV8A 3S2EA 1H9BA 3HG7A 4HNGA 2Y0EA 4IBOA 1T26A 1YKFA 2XXBA 1E5LA 4HBGA 1QV6A 2GNAA 4ZQHA 3U4DA 5IDQA 3U5TA 1GDHA 4S1VA 3KO8A 1PWZA 3C1TA 1E1MA 4E2XA 3PRJA 5CDYA 1I10A 1NX6A 4WASA 3F1LA 2B5VA 2O3SA 5DULA 3NTOA 1OZAA 4FC7A 4O0LA 1DSSG 3JQEA 3LF1A 4DQUA 3WYEA 3SLGA 4JBGA 4CM4A 1NFFA 4ALMA 5L7WA 4KUHA 5IJZA 4FPXA 4BNHA 2NTVA 3PYLA 1NAIA 2FY8A 4XWYA 4E5YA 2PGDA 5ILOA 4JJIA 3BMCA 1P1FA 2Q46A 4J1NA 3GPIA 1F17A 2WD7B 3G3EA 3JQ9C 1JAYA 3ZWNA 1CETA 3UICA 4TZKA 4BO2A 1YGYA 5EESA 3QV1A 2WD8A 2IXBA 1QMGA 1XU7A 1ZW1A 2E82A 4JQCA 3KM0A 2HO5A 2HUNA 4CM8A 4E2WA 4AVYA 4BNTA 1E1NA 3RFXA 2X0NA 1JW9B 2QHXA 1SB9A 3DFUA 4C7JA 3EGOA 2P5YA 4RO0A 1ZXLA 4ZGWA 1LDEA 1X15A 5JYDA 1O94A 4KWIA 1ZSVA 3EZYA 2ZJ0A 1NHWA 4AFNA 2ET6A 1E5QA 2CUKA 3UF0A 2O2SA 3TZHA 4TKMA 4ALJA 1Y5RA 3VH2A 1UDCA 5CEJA 4XR4A 1R12A 3ZV6A 4XRGA 1BWSA 4DBVO 2GPTA 3P7MA 2CMDA 1OC4A 3U09A 3WTCA 3G49A 4CQMB 3IJPA 2BMAA 2JCXA 4CQLB 2FPPA 5GZ6A 3ZCXA 4E30A 3LT2A 4RVFA 4OXKA 1P1KA 1P1HA 2YY7A 3EAGA 1PGNA 3M6IA 3BHMA 3OEYA 5CEEA 2ZQZA 5F3RA 1N9GA 3GLQA 4X54A 1E7YA 2Q49A 4W7IA 1R4NB 2WM3A 4RPKA 4GVLA 1GV1A 4BKPA 1V8BA 1WDKA 2F1KA 2OP0A 2E48A 3DHEA 4ILKA 4PLCA 1YL6A 1C3VA 1YQGA 3LT4A 4P38A 1E7QA 3OEWA 4NK5A 5COQA 4MO2A 4II3A 3L9WA 3LLSA 1C0PA 1X7GA 5KJ6A 3SVTA 3NYWA 4MINA 1SEPA 1IHXA 3TL2A 3CIFA 4D3DA 2GF2A 1YXMA 1YB5A 2A94A 2R00C 3WGGA 3OM9A 2O3QA 3GY0A 3BMNB 3JCZA 1H6BA 1TLTA 1UXGA 3ZHBA 2HU2A 4D42A 5L3ZA 1AHIA 5TIIA 2VHXA 1XHLA 4KQXA 2P9EA 3TNLA 4U8GA 2HMUA 2X5JO 1O8CA 1CRWG 1I24A 1Y8RA 2VZ9A 4O59O 3WFIA 3ZH2A 1F06A 3UGKA 4PZCA 4IY1A 1MFZA 2OFPA 2VHVA 4GLLA 3PQDA 5ILGA 1CF2O 4NJMA 3TFQA 1UZLA 1DLJA 1PL6A 5JPIA 3L6EA 3U62A 1PJTA 1BW9B 3PYXA 5H82A 2CFCA 3BHIA 5JO9A 4RJTA 3RIHA 2A35A 5L4NA 5B1YA 3AFNA 3E1KA 1NM5A 3D0OA 4LISA 3KLMX 3D4OA 4MVJI 2A9FA 1PJQA 1PQWA 5KTKA 4R54A 4LW8A 1QLHA 3AUTA 2ZB3A 2VT2A 1TVEA 5F1KA 2BFOA 2OBNA 2EG9A 4Z0TA 3ZWVA 2NNLD 4ONEA 4O6VA 4MIOA 1JWBB 9LDBA 4HV4A 3VVBA 4NPCA 1EQ2A 4NU5A 3QSGA 2YQ4A 1Y9EA 1RM0A 3H6KA 3QW2A 1QXSA 1XKQA 5A03A 2VHYA 1PJCA 3CTMA 3N58A 4I5DA 5CDSA 2PZMA 4B7UA 4NQZA 4MPDA 1M67A 5JLAA 5JW6A 1GYRA 1LU9A 3GQVA 3I9KA 4N7RA 3OF2A 1EK6A 1SMKA 2YHIB 4WOJA 5A9RA 1LXCA 3GNTA 2YJZA 3RJ5A 5ICMA 1RJWA 3KV3O 1LEHA 1EUDA 1I2BA 3CMCO 3I23A 4WLEA 3ZV3A 4BNUA 4EJ6A 5C7LO 3ZGYA 1VSVA 1BTOA 2HK9A 2NQTA 4PRLA 1ISJA 3DB2A 1W8DA 2Z1MA 4I5FA 5DBFA 4KZPA 1Y1PA 3MTJA 4DTIA 3DEYX 2CF6A 1DIGA 3H2ZA 3GAFA 3ULKA 4MVJE 4U0KA 4YBZA 3WIDA 5CFZA 2CD9A 4DIOA 4GX1A 1GL3A 1NHGA 1TI7A 1ONOA 3W4IA 3DZBA 3S55A 4HWKA 2Y1FA 3DAPA 1YDEA 3DDNA 3LLVA 4ND1A 5KVQA 4CLRB 2VRCD 4RZIA 4P4LA 3FTPA 3JQAB 4JGBA 1M6HA 3H7AA 3VAZA 1UAYA 3ROMA 4NBRA 4B8WA 1PQUA 1UR5A 5ICSA 4M86A 3PWZA 4XR9A 1GPDG 4AJLA 5JMWA 1EDZA 1VE9A 4U6SA 3DAGA 1O89A 3CPSA 3H3JA 4I9HA 4TQGA 3DBRB 2FMUA 4YCAA 3SC6A 3IC5A 2EKPA 3K96A 2D0IA 3IS3A 2UVDA 4DYDA 3JQCA 3CSDA 3PI7A 4XQCA 5CDUA 3DO5A 1HKUA 2ZTMA 5F5NA 5AYVA 4KTTE 2A92A 5BSFA 2NU6A 5BT9A 3AI3A 3JYLA 1Q7CA 4RGBA 3GNQA 2GD1O 3MJCA 1GV0A 4BQRA 5TC4A 4DPKA 2X6TA 2HRBA 2QYTA 4RPLA 1GCUA 1QYCA 1V6AA 4J49A 1GEEA 2HAEA 2V6BA 3FNFA 1UUFA 4H15A 4FC6A 3CUKA 3GUCA 2IDZA 3MOGA 2NUAA 4J16A 3RU7A 4HP8A 4BKQA 4BQPA 4XIJA 4DQVA 4S3MA 3HB4X 2W2KB 2ZB8A 1HDOA 1N7HA 4D46A 4AJHA 4L9RA 5L9AA 2V7PA 4RVHA 4MVJG 4AJ2A 1GR0A 3C85A 3IUPA 1XG5A 1IZ0A 4CV1A 1HETA 5KWEA 4AJOA 1VC2A 2Z5LA 5BNIA 2RCYA 4E12A 3ADPA 2FOIA 4MVJD 3QVWA 3DMTA 5DCWA 5LC1A 1E1KA 3NUGA 5F5LA 3H5AA 3EK2A 3NGLA 1ADBA 2V6MA 3VC7A 4R5HA 5IAAA 1GUFA 4NBVA 4P8RA 5G4KA 1T2CA 2O7SA 4Y6PA 5T8KC 2EW2A 4CL8A 3BMOA 4RCVA 2VUUA 2B5WA 5K0ZA 4DREA 4XA8A 3IUSA 5B12A 2ZTUA 3SLKA 5L7TA 2X5KO 5DBGA 3BA1A 1HF3A 3LVFO 1WVGA 2Q3EA 1B3RA 1E3WB 2FPIA 3JQGB 4L75A 3VVCA 5JAQA 1XIVA 1NASA 2VTEA 3T7CA 4E5PA 4PG5A 4NMHA 1Y5MA 2P2SA 3M1AA 3MWEB 2GN8A 1EBUA 1NQ5A 3GDOA 3Q0EA 4KDEA 3GGGA 3O9ZA 3JQBA 3NDIA 2AG5A 3W6UA 4L4RA 4HX5A 4MVJA 2VWHA 4QSMA 2DBVO 3FPLA 5KVVA 2BLLA 1M76A 3FBTA 1B7GO 4J9UE 3OQ6A 4IGFA 5JS6A 1ISHA 1DFIA 2Q99A 1HYGA 4XEHA 5L51A 3JQ7A 1X7DA 3AK4A 1FF9A 1Z75A 3QP9A 3KB6A 1QYDA 1NQAO 4CV3A 1JVBA 4CLEA 1IZ9A 4WNIA 4AL4A 3I6IA 2B4QA 5JCXA 5HWSA 4I08A 3JD0A 4UVHA 1CIVA 4CMKA 4FFOA 3I9JA 2NU9A 3VKVA 3EVNA 4A10A 1PR3A 1PIWA 3MWDB 1E1LA 4UUPA 4MP8A 3ENKA 1QRRA 2J3IA 1PR9A 1GTMA 3C7DB 4HFNA 3UCFA 1CERA 1V9LA 4YT5A 1A72A 5A9SA 2VYNA 2WYVA 4AJNA 2JD2A 3GUYA 2EEZA 4J9VA 1IUKA 4EUEA 5JDIC 2Q4EA 2PH3A 3U4HA 5B4TA 2WYWA 3L4SO 4IDCA 4J6FA 3FTNA 2GCGA 4NDNE 1HE5A 4CMJA 4J4BA 1XQ6A 2WYUA 4WLFA 2D3TA 2DTXA 3MJ4A 4PCVA 3RUIA 2X7HA 3OICA 4W9NC 4DBZA 4R41A 1U3UA 4J2HA 3PXXA 3DOCA 4YDRA 3K9QO 3CE6A 2QRJA 1C0KA 2GUGA 1SBYA 3JSAA 5TX7A 4DXHA 1LA2A 1MXFA 2P4HX 4HKTA 1JA9A 4W82A 5I9MA 1ZK1A 2DFVA 2YUTA 1Z7EA 4JBHA 3X2FA 1E6EA 1LDGA 3FWNA 1O5IA 5L4LA 4QTZA 3FF4A 4Q3BA 1U28A 5L95A 4FR5A 4UEKA 3UHAA 1D3AA 5GZ1A 2VZ0A 1Z82A 4A03A 3A28A 5JCJA 1UZNA 3C1AA 4TVOA 4K26A 3O4RA 3ONDA 1PSDA 2W90A 3ZWYA 3GZ4A 4CMCA 3VHRA 4YJHA 3ZWPA 1VRWA 4ZQFA 4NBWA 4IDBA 3WBFA 1SCUA 1QV7A 3H3FA 1XSEA 4B8ZA 2NTNA 2ZQYA 3QVOA 5ITWA 3IAHA 3PWSA 3C7AA 5BSGA 5TLSA 1KEUA 3B6ZA 3GFGA 5JY6A 4L73A 5C37A 3ZU3A 1P1RA 1A9ZA 5JAMA 5FF9A 3DBHB 1PS9A 3HADA 5FI5A 2YFQA 1GCOA 1KETA 1KYQA 3GEDA 4JN6B 7ADHA 3RUCA 4OMUA 1KERA 1VL6A 2W4QA 3GG2A 4FGSA 1WMBA 2OO5A 1JQBA 1JAXA 4F46A 1SOVA 1MV8A 5I9LA 2QRLA 1IY8A 1LTHR 1A5ZA 4PRKA 1T2DA 1NWHA 4PLGA 4Z9YA 4OIMA 3WWZA 4YTEA 1VL0A 5C5IA 3EY4A 4TVBA 3M2PA 4EUHA 5G4LA 2AQIA 2DTEA 1T2FA 4HFMA 4DMMA 3JD3A 4IJKA 4J91A 2C07A 4WLVA 2POQX 3S2IA 4YYZA 3AY6A 5HS4A 3H4VA 1YS4A 1M2WA 2QRKA 2DQ4A 3JYNA 3VKUA 1ML3A 1ZJYA 3L9XA 3JQFC 2YFHA 2D1YA 2Y1OA 2ZATA 1V3UA 3WDSA 4ZRMA 1MA0A 2Z95A 2HK8A 1P77A 3G1TA 1GYQA 5TJHA 2BD0A 3HSKA 2HSDA 3FNEA 4OOEA 4R3NA 5COAA 4CL3A 2OBYA 3TF5A 1PL7A 1SO8A 1VJ1A 2X9VA 1QORA 2PK3A 3M1LA 4CM8B 5MDHA 3WGZA 1HSZA 1Z73A 1ULUA 3FD8A 1U5CA 3WQRA 4PLWA 4IJUA 5K6AA 4M89A 2EKQA 4DWVA 1I3MA 2PY6A 3WGTA 1B26A 1HSOA 5K9ZA 1Y9AA 3AUAA 4Y6SA 3RI3A 3GOHA 2GN6A 3ICPA 3AU9A 3O26A 2QYSA 1MXHA 1MC4A 1NWCA 4E6PA 1I33A 3TOZA 4LVCA 4QFDA 1D8AA 4R1SA 2BELA 1PWXA 1H5QA 2CNBA 2UUOA 4NK4A 5DF1A 3VZPA 3ZN2A 3TRIA 5JC8A 1KEPA 5TF4A 3UXYA 2YZ7A 1DC4A 4WKGA 5ADHA 2Q2QA 4BO3A 1A27A 3ROKA 3I4FA 4MVJF 3WQSB 4E2YA 1EVZA 1Y6JA 5B4UA 3S2GA 5EQFA 4F6CA 4GX0A 3HQ4O 3W8EA 4EI2A 3JD2A 2IZ0A 3WSVA 1GQ2A 4UUMA 1ADCA 1B15A 2PFGA 3RC2A 4IPTA 5A02A 3OQ1A 3IDSA 1NVTA 3JQ8A 1ISGA 2YQ5A 3BTVA 3NKLA 4CM1A 3PHGA 2Y93A 1I5RA 1NP3A 3GEGA 4I9NA 2VWGA 1A7KA 4BNIA 5IZCA 1Z74A 2UUPA 3DZGA 3ETDA 4A0SA 4MVJP 3NJ4A 1GEGA 3QWBA 4ND4A 4D44A 4ND2A 3EHEA 1EE9A 1HDCA 4YEDA 4YQYA 2JCYA 5T64A 1DXYA 4WUVA 4XGNA 1YQDA 3KSDO 1ZVMA 4ESOA 1WNTA 3QWIA 1ENPA 1ZXBA 3DTTA 2EV9A 4LMPA 3TFOA 1HZZA 1U3WA 3OJFA 5KNLA 2WSBA 1UXIA 5JSFA 3K8ZA 1J6UA 2PGJA 3QWFA 1O6ZA 1E3SA 1JKFA 4XGIA 3UW3A 1VSUA 2XXJA 1MB4A 4ID9A 4WPGA 1N5DA 1E92A 2A4KA 1NTOA 2YYYA 1L7DA 4KDFA 4J2OA 3GRKA 1SEVA 2NU8A 4KMSA 1PL8A 3RD5A 3ZWXA 1E0DA 1DRUA 1D1SA 5FI3A 1Y8RB 5IG2A 2EHDA 1KEVA 2VUTA 1ZK3A 1E7SA 5JDCA 1OOEA 4U7WA 3JYPA 2I67A 2Q2WA 4NJMB 1VM6A 3SJ7A 2X23A 3VZQA 4FW8A 6LDHA 3ANMA 2PKRA 2C20A 1B8UA 1LRJA 1Q0LA 2J5QA 5U1PA 5CG2A 3QVTA 1KY4A 3KYCB 1XQ1A 3TZCA 2JFFA 1DJNA 1A4IA 1O0SA 5JAIA 1J5PA 2G1UA 1ZEJA 1U7TA 2H1SA 2X0IA 1IOLA 4GL4A 3IP1A 1F14A 1ISIA 3RQSA 1KC1A 4FFLA 3AOEA 2J3JA 4ZQEA 4WK6A 2CDBA 3R3JA 4WJZA 3NT2A 2XPCA 5DCUA 2I99A 3E5RA 3BTOA 4FD3A 1X1EA 4LK3A 5DP1A 1Q0QA 4PLVA 4JX8A 1P1JA 4PG8A 4YAKA 2DVMA 3ZU2A 2JAPA 4RDHA 1OC2A 4RF2A 3EYWA 3FN4A 1WDMA 1H94A 4YJGA 5HBRA 3RFTA 2O7QA 1YOVA 1PEDA 4CM9D 3KEOA 3C1OA 3ZV5A 3VDQA 1CYDA 4BNXA 1DC6A 1XU9A 2DUWA 2PZJA 3OQBA 3U4CA 1D1TA 1GZ4A 4OM8A 5I7EA 2Z1NA 4JXKA 1DIAA 3L07A 5T5QA 3UN1A 5GZ3A 4YT8A 4KQWA 4WLUA 1MGOA 3H5RA 4K6FA 1EVIA 3UFXA 1K6JA 3C3XA 1PZHA 1HE4A 3GFBA 3RBXA 3GGOA 1HDYA 3QHAA 2PV7A 4MOWA 5BSHA 5C7OO 3MJVA 4CMBA 2PR2A 4M55A 5H83A 3WFJA 3H8VA 3AWDA 4BB5A 1PGJA 5DOZA 4BGEA 3WYCA 1SZJG 1FDTA 1I2ZA 1GZ3A 1J49A 1MUUA 4B4OA 1J0XO 2YHUA 1WZIA 4MKXA 1RYEA 1U4OA 1HYEA 1R0SA 1PGPA 3F5QA 3GHHA 2DKNA 4NHEA 3HWRA 2DU8A 2GGSA 7MDHA 3ZZNA 4ND3A 1FMCA 3HFGA 3F1KA 3WGQA 1ULSA 3INGA 1AE1A 1GFSA 4EBFA 1VI2A 3GR6A 1TB4A 3PHIA 2ZB4A 4JP3A 1B8PA 4E32A 4PGFA 1NPDA 5DBIA 2JKVA 3VPSA 4CLDA 1FDUA 4HY3A 3W8FA 2O48X 2NACA 2D8AA 1PZGA 2GR9A 1DFHA 2Y05A 5AOVA 3RC1A 4BOYA 1JDJA 1N1GA 2I3GA 2B35A 2C2XA 2EJVA 4IS2A 4GWGA 3UCXA 3JD1A 3WS7A 2VUSA 4DVJA 3GG9A 4R1UA 2VQ3A 4YJDA 1TT5A 3JQDA 4CUKA 4NR0A 3GPDG 1V3VA 1ENYA 1ZKMA 3ZWCA 3QQPA 3G79A 4GWKA 3GC6A 5G0WA 3AM3A 3U3XA 1P0CA 3KOUA 4FSHA 3PIIA 4YRBA 5CAEA 4CMEA 1OFGA 3ETGA 1DDOA 4J3FA 4BB6A 3V1UA 1E7RA 5B37A 1QR6A 3JV7A 4R1TA 1B3BA 4LN1A 2C2YA 2NVUA 3I5MA 3ICCA 3MJTA 2HRZA 4IXTA 4NFHA 4IDAA 1R16A 4OGWA 2ZCVA 5JC1A 3LT0A 2H9IA 3ITKA 3HFSA 4GLOA 4K1LA 3ENNA 3RUEA 3GNSA 2OXIA 2VWPA 4IUYA 1ZK2A 2VNAA 1UZMA 4A73A 2GLXA 2FZWA 1T4DA 5BNTA 2G5CA 3RVDA 3ZWWA 2C5AA 4A5OA 4OQZA 4GI2A 1WXDA 4XJSA 1FDVA 4UVGA 5ER6A 4B79A 3F3SA 1LI4A 2FP4A 2JHGA 4AJIA 1DEHA 2ZTLA 5EJ2A 3CMMA 3HDQA 1F12A 1LSUA 3GMSA 1PJ2A 1XDWA 1PS0A 2NU7A 2BI7A 5L45A 2JFHA 3IOYA 2DTDA 4QECA 1OAAA 3ITDA 4OOFA 2HKIA 3LQFA 2RIRA 5G4KB 5JMPA 4CM7A 3JQBC 4QUKA 2Q1SA 2HCTA 1I3LA 2P4QA 1U4SA 5KOIA 4RORA 3N74A 1E7WA 3DZIA 2DC1A 4J4HA 3D4NA 4YWJA 3DZKA 4XYEA 3PK0A 1O95A 1R4MA 3U4IA 1E77A 2I76A 2CVZA 5KVCA 4NG5A 3TZKA 1H6CA 4LSWA 3TSCA 3HNPA 4EJ0A 3GZNA 4CQMD 3P19A 2VCYA 4WE3A 4CM5A 1M66A 3KYDA 5TT0A 4ALIA 2AE2A 2AG8A 2AE1A 4Q3EA 4EITA 4JJFA 1AN9A 1QYWA 2WD7A 4L0QA 1KVSA 2AEFA 3GVIA 3U9LA 2VZ8A 2VHWA 1ARZA 2X9NA 2PGLA 4J1TA 1U3TA 1WWKA 2ZIZA 1H2HA 1EUCA 2B36A 4Q3DA 4IXWA 4AJJA 1TT7A 3KYBA 4NIMA 6ADHA 3FCOA 3JQ7B 4BNZA 2VN8A 3DTYA 2Y1CA 2NWQA 1UP6A 4UEJA 2V6FA 3PLRA 4BNWA 4CODB 1YB4A 2HMSA 3RKRA 3AY3A 4DPMA 1W6UA 3A4VA 3R6DA 4OSPA 1T2AA 2QZZA 2Q1WA 2HMWA 1PZEA 5CEFA 4YAGA 5AXBA 3E6AA 1U7HA 1KIFA 3ONEA 3JD4A 5LDHA 4OAQA 3PGJA 1R0LA 5A9TA 5A5EA 4RF4A 5BNFA 1I36A 4U6QA 1LQUA 2D5CA 2J3HA 3D3EA 4Q3NA 5AVOA 1F0YA 3E8XA 4UREA 3T7EA 3PZBA 3VH4A 4NU6A 4XYLA 5A9SB 2BF7A 1XCBA 1LLUA 4I8XA 4BNVA 1WW8A 5A05A 3NJ8A 3PJEA 4PZEA 4W7HA 3R1IA 4J0FA 4E33A 4E13A 4CUJA 3V1YA 5TSDA 4FOSA 2JL1A 4W99A 5CP8A 4KWHA 4J7UA 3RFVA 1K3TA 3WJAA 3F6YA 1UXKA 4GSKA 1YH3A 1L1FA 3VTFA 3A1NA 4IQ8A 1YBAA 4OXNA 2NLOA 3WGIA 1IPFA 1DRVA 1PGQA 1KY5A 1R15A 1PJ4A 1RM3A 3ROPA 3I3OA 3WJ7A 1VKOA 3SX2A 2VYVD 3QWAA 3FPCA 4DPLA 3L4BA 4FS3A 4G2NA 3V8BA 1UP4A 2CF5A 1ZZEA 2GO1A 2VRCA 3I83A 4J43A 1GUZA 1KVRA 1N2SA 4PLHA 5A04A 3JTMA 1HL3A 2C0CA 1HXHA 1K6XA 4GPD1 3W1VA 1LQTA 3LT1A 2C29D 2W8ZA 3E03A 4XD2A 5U9CA 4XDYA 4UUOA 1HE3A 2EJWA 4OQYA 4P22A 3JYQA 4BMSA 4BMVA 4BNNA 1EVJA 5IN5A 3IIEA 4FIZA 4ZJUA 4KTVE 4NI5A 1V0JA 2R2GA 5DDIP 1LRLA 4DQXA 4Q3CA 1B14A 1CQIA 4Z9FA 3EC7A 1DIHA 1H2BA 4M49A 3QJ5A 1I01A 4HUJA 1YJ8A 1ZEMA 4MVJM 4CR7A 4N5MA 3DOOA 1TXGA 4PG7A 3K31A 3KXDA 1HLDA 1LX6A 1BW9A 3ZNQA 1H6AA 3GMDA 1AHHA 4PG4A 1NPTO 1MP0A 1PU2A 4FJ0A 3GGPA 4E2ZA 1V35A 4INAA 4CMGA 3FR8A 2P5UA 3NT4A 3ZDFA 4CMIB 3KVOA 4DLLA 2W2LD 1P31A 3HDJA 4FJ1A 2OHXA 3K2BA 4OYRA 3TN7A 3WG9A 1OBFO 3LDHA 2YDYA 3WLEA 1LC0A 1UP7A 4TMFA 3KRTA 4GQAA 5CDTA 1HZJA 4L4XA 5U4QA 3D7LA 4URFA 2F00A 3ETEA 3WXBA 3PJGA 1Q7GA 2LDBA 4IGEA 5K6AC 2I66A 1BHSA 3R3SA 1DHRA 4YACA 3GVCA 3JQAD 2DM6A 5THQA 3WICA 1MG5A 3ONFA 5F21A 1UJMA 2PNFA 3W8DA 1H93A 4O1MA 4PIVA 3PIDA 4BO8A 3DFZA 3LK7A 3OIGA 1Q0HA 1I32A 4DC0A 2DT5A 2DBRA 3OIDA 2YHIA 1PJBA 4PZDA 3ASVA 3F4LA 1ISFA 3A9WA 3GH3A 1CEQA 5DZSA 2AEJA 2IZ1A 2Q45A 4U5QA 2O2YA 2X0RA 4BO6A 3OSUA 4EDFA 3GEMA 5G2OA 1Z45A 2TMDA 4HADA 4EEZA 5A4DA 2ZB7A 1R37A 4IQGA 1GQYA 2ZYDA 4CLXA 2Q50A 4CLOA 2BHLA 1E3IA 4RPJA 3WGHA 3DQPA 1FJHA 1ZIDA 2WDZA 3FR7A 1Q1NA 3R0IA 5IZCC 1XYGA 4J7CA 1G6KA 1X0XA 3ORFA 3PWKA 1LDBA 5JFOA 3DZFA 1F8FA 3ZWBA 2AHRA 4E5MA 2FHSA 3DHYA 3EMKA 3ZU5A 4MKRA 4PLYA 4YT4A 3TL3A 3V2GA 3PDJA 1HDGO 5DCYA 1KOLA 2PWZA 3CKYA 5C7IO 1Y8QA 3DMYA 2Q2VA 4RVUA 4YR9A 1W4ZA 5I8WA 2GZ1A 5FEUA 3JQ8B 2NSDA 2H63A 1DPGA 2BGMA 4XYBA 3RCBA 4BV9A 2IXAA 4XB2A 4BIIA 5JBIA 1WZEA 1C1DA 4ALNA 4B4VA 1N1EA 1YRLA 3HN7A 1BXKA 1A4UA 5F1PA 1JN0A 1HRDA 4BMNA 1BRMA 4M87A 2C5EA 3UVEA 1ZK0A 3HZZA 5DOVA 4BNKA 4A26A 3ZNOA 4JLWA 4R4JA 4QEDA 5I9NA 2BGKA 1DO8A 2O4CA 3B70A 4II2A 1LLCA 5JDCC 2J8ZA 3DBVO 3KUXA 3SJUA 4M8SA 2DAPA 4RF3A 1LLQA 3ZI0A 1S7CA 2PKQO 2Y67A 4TKLA 4BO0A 4M1QA 2IYPA 4YT2A 5CG1A 1ONPA 3CZRA 4MIYA 3I9LA 3T4EA 4DIFA 2EXXA 4K28A 5G0TA 1RM4A 4R16A 3ON5A 1JLLA 3OBBA 5TJ9A 4RL6A 1LUAA 3AOEC 5EIOA 4E0BA 2BFAA 4XYMA 2VWQA 2VRBA 2WE8A 2X1HA 3LC2O 5GY7A 3LSYA 4E21A 2P91A 3RUFA 2EP7A 3KLPX 4XYGA 3VPHA 1ADFA 4B3HA 3KETA 8ADHA 3ZW8A 1GPJA 1LLDA 4Z3DA 3VPFA 4QX6A 2H5LA 4HFRA 1AXGA 2C7VA 2JD1A 3AOGA 4CR6A 3O03A 5HS6A 3GHYA 4DC1A 4LMRA 1GU7A 5AQ1A 4HXYA 4NZ9A 3RBVA 1LDNA 3V2UA 3I4CA 1PTJA 3DAFA 3QVSA 3SC4A 4CM4B 2Y0CA 1CJCA 3AM4A 5H81A 2D2IA 1DBVO 3TOXA 1BDBA 3VDRA 1DJQA 1SB8A 2ZKLA 4FGWA 5BR7A 5KJ1A 3H9UA 3Q9UA 3BMCB 1EVYA 3U0BA 3OJ0A 2I6TA 1DIRA 4DGSA 1BG6A 2GASA 3LC7O 3ZV4A 3JYOA 4YJGB 1GD1O 3L77A 2DFDA 3HDYA 2NADA 3O8QA 4IINA 2OL4A 5KVSA 3MOIA 4FN4A 5JXWA 5A3JA 1ZBQA 3DBLA 1K89A 1UDBA 4CR8A 4L74A 1QYXA 4BKRA 1RM5A 4YRAA 3H9GA 3SBOA 4ITUA 4C7KA 4CV2A 1PJ3A 2GN9A 3PEFA 4D45A 3A14A 2PD3A 1LNQA 4JCOA 2PZLA 3BMQA 4G5HA 3AU8A 1EZ4A 1X0VA 4GAEA 4WCFA 4BS9A 2OOSA 2NQ8A 2CVQA 4FQ8A 5IXSA 4BGVA 4XRRA 5EPOA 5T57A 2GERA 3OIFA 2X4GA 4RPGA 4PLTA 3B1FA 5TQVA 3ZU4A 2BI8A 1YJQA 5FFFA 1JKJA 1N9GB 1FXSA 2XF8A 4FBGA 2VOEA 5IFLA 3K5PA 2G82A 3WR5A 4CMEC 1U1IA 4JIGA 2ILTA 4Z6KA 1KS9A 5TRTA 2AMFA 2Y68A 3UH1A 4D3FA 1RYDA 1GY8A 3HJAA 2Y1GA 3RJ9A 2FN7A 5JO0A 1M6WA 4KOAA 4CUZA 3DXFA 3RWBA 5TS3A 2H6EA 3PP8A 3VZSA 3D1LA 3NRCA 2AW5A 4YQZA 1TT5B 5B4VA 3E9NA 3HB5X 2IYOA 3ANNA 4WLNA 3B1JA 4P4NA 3FRJA 3C24A 2DUUA 5JDIA 1CQJA 3MJEA 4KP7A 2DPHA 2FR8A 4MKZA 3FWZA 4I1IA 5JE8A 1NFRA 5F1OA 1VJTA 1I3NA 1NYTA 1E3EA 2QZ9A 5T6BA 2NVUB 4UUNA 1QG6A 2FR0A 3PFWO 1QYVA 2PZKA 4TRJA 2NM0A 4B7XA 3NTRA 4W9NA 3ST7A 3V5NA 4BNJA 3WB9A 2E4AA 4NBTA 5CPFA 2ZYAA 3RASA 4D79A 5KJFA 1NVGA 3WGYA 1XGKA 4BGUA 4CV0A 1GADO 4W4TA 4J4TA 4B3JA 1P9LA 4WOKA 1S6YA 2OORA 5EINA 4DLBA 3MTGA 2B0JA 2PD4A 2FSVA 2GSDA 1O9BA 1NQOA 1ORRA 2O3UA 2HMVA 3H9QA 5FYDA 1BGVA 2NVBA 1SPXA 2D59A 4ZU3A 3VH3A 4D41A 1BSVA 4KUGA 2Y99A 4R69A 1C14A 3BIOA 3E9QA 4OKNA 4BUCA 5CPBA 4NJOA 3ROQA 1WMAA 1PJSA 1LSOA 4ZVVA 2DBQA 4XX0A 2G17A 1L7EA 3BAZA 1EUZA 3P5SA 5CHEA 3DZJA 2JHFA 3G17A 4R51A 4E3ZA 4EGFA 3WNVA 4A7PA 2GZ2A 3H5NA 4F45A 4Y67A 2R6JA 5HTOA 1ZMOA 2O3RA 3D3WA 1KBZA 1IHYA 3IKVA 2CVOA 4RV9A 1R4MB 4G81A 3S1LA 3WOHA 2VHZA 4D43A 3HDHA 3MCVA 3QVXA 5AXCA 1D4FA 2AA3A 4MP6A 1GZ6A 2WTBA 3GZNB 1LDMA 2PH5A 4AJPA 4UEOA 3GDFA 1DHTA 1SOWA 5ES3A 3WWYA 1YE3A 3K30A 3KYDB 1ZSYA 4ND5A 2E49A 4L76A 1YL7A 4AJ4A 2WWRA 1JU9A 4UAGA 1U8XX 4BO7A 1MLDA 4IJWA 2WE7A 5A06A 2ZK7A 2EGHA 2CZCA 3PYMA 1K0UA 4TRRA 1P33A 1T1RA 3TZ6A 2X86A 2XAAA 3IP3A 1AXEA 3GA0A 1CDOA 1ENOA 1VJ0A 4R9RA 4ROSA 4O63O 2JFGA 1I30A 3JQFA 1MFPA 4GMFA 4U0JA 2BFPA 4ZQBA 2P68A 3ABIA 1LBEA 1Z6ZA 2RBEA 1X14A 4WNCA 2SCUA 5BSEA 3LF2A 2FSSA 4GGOA 4IDDA 1LSJA 4JK3A 4ZD6A 4CM9A 1EK5A 1NAHA 3PHJA 4Y8VA 3AJRA 3IQDB 2NTJA 1HLPA 3DC2A 3MEQA 4R3WA 1UAGA 1W0CA 2D4AA 1QLJA 2OGUA 4XCVA 4R01A 3ZNPA 1K2WA 4JROA 3VPXA 1R0KA 1X1TA 1JKIA 2IZZA 4PG6A 3GT0A 3KSUA 3HN2A 3L4BC 4RVGA 4GSLA 3K92A 3OJOA 4YJFA 3VPGA 3INRA 2O50A 1KVUA 3M2TA 3IMFA 5KKCA 4MJLA 5DNAA 1AGNA 3KEQA 4WLOA 1LSSA 1VKNA 3BZUA 1XA0A 4J7XA 2X22A 1HWYA 3TQHA 3WQQA 1PQPA 1IE3A 4BNGA 5KJCA 4DL9A 1KVTA 4Z9XA 4Y98A 1BVUA 1U2DA 1ZJZA 2EIHA 3TPCA 3E48A 4R5MA 1C1XA 3DMTC 2XOXA 3P2YA 4YB8A 1WLYA 3S8MA 4L4SA 5I7SA 3Q2KA 3ADOA 5I7FA 1P1IA 5AXDA 4GVXA 4LSMA 1E3JA 3WX0A 4Q39A 4IZIA 1I0ZA 3AM5A 3KTDA 3WTBA 4GMGA 1BXGA 1BMDA 4BO1A 5C3MA 5IDWA 3G1UA 1JWAB 3KHUA 5L4SA 5KCZA 3GN1A 2EERA 2P9GA 1UH5A 3AI2A 2B4TO 3UOGA 3PHLA 1OI7A 1DOHA 1NVMB 3FNHA 4DYVA 3NX4A 2DBZA 3CXRA 4LCEA 5DN9A 2BH9A 4EYEA 3BMOB 3HE3A 2G0TA 1FDSA 3FHLA 2D5AA 3RUHA 5THKA 2VTDA 2J5RA 4BV8A 1E3LA 5BQFA 2Y66A 4MIEA 4HFJA 3KYCA 3LC1O 3ZWMA 2Y0DA 1R6DA 1XELA 2O4UX 3AUUA 3V1TC 2I5PO 3ZW9A 1U5AA 3WIEA 4BO9A 2FRDA 5A1TA 4Z0PA 1EQUA 3I9OA 4FDAA 1U2GA 2QW8A 2B83A 1EFLA 2IEDA 2ZJ1A 1N7GA 1GUYA 2HJSA 2X8LA 5EN4A 4HNHA 1HYHA 2GZ3A 1XR3A 5KKAA 4GX5A 4DUPA 1LJ8A 2VT3A 2FZEA 1DB3A 5COBA 1G0NA 1U3VA 1FK8A 3I6QA 1SC6A 1XLTA 3QRWA 3WMXA 4EEXA 2TMGA 2AQHA 3FI9A 4EJMA 1A9YA 3NDRA 4XGKA 4CJXA 3RKUA 1WDLA 1TA4A 4N54A 2RHRA 5JYEA 2OMEA 1DC5A 4W6ZA 2Q1TA 4YAJA 4E5KA 4DRYA 3GN2A 3K73O 1E6UA 1PJLA 1NNUA 4ZQGA 5JY1A 2OZPA 1P74A 1DAPA 3AW9A 1H6DA 4R1NA 1NPYA 3JQ9A 4MP3A 1P44A 4F6LA 3W4JA 2CDCA 2QX7A 4IMRA 3OA0A 5EQDA 4CLOB 4CQMA 3SEFA 2PTGA 1ZFNA 4AICA 4CQLA 4B4WA 3PHHA 3OECA 1A7AA 5MGBA 2DLDA 2C59A 2FPGA 5L7YA 4UVIA 4I9UA 4EUFA 4XQEA 2I65A 4J1QA 3MJSA 4G65A 4XQ9A 3EUWA 3ZNNA 4YXFA 1EEHA 4MDHA 4CMHA 1ADGA 3GVHA 2BKAA 2X58A 4QT0A 1VPDA 3H9EO 4CPDA 2Y1DA 4ZA2A 3OHSX 2X5OA 3GF4A 3Q2IA 1U8FO 1OMOA 1R4NA 4RVDA 5G0UA 3A06A 3VOSA 3ZHZA 1YONA 2UYYA 3OA2A 4K9DA 4NH4A 4Y9DA 3KZVA 1Y8QB 5HA5A 3RU9A 4BGIA 2AXQA 2C54A 3NV9A 3Q6IA 1H9AA 4IM7A 3JQ6A 4P4GA 4H7PA 1C1DB 3INTA 4AJEA 5ER9A 5IDYA 2ZCUA 4GGPA 2FWMX 3VZRA 1Z7BA 3EVTA 4PN3A 3ZHXA 4O5OA 3NEPX 4ZHSA 4OSOA 4GKBA 3SXPA 3BMNA 1B16A 3PQFA 3C8MA 4IIUA 3K6JA 3CZMA 2BRUA 3E82A 1WP4A 1EDOA 2J5KA 3E18A 4NFYA 3RSHA 4M54A 3F46A 4YJHB 4H3VA 4ZN6A 2I3AA 4FFRA 4N18A 4B7CA 4EZBA 3Q11A 5IDXA 3UUWA 5FWNA 2Y1EA 2YV1A 4IMPA 4PVDA 1EMDA 4F3YA 1GAEO 3STHA 3GK3A 3DOJA 4PVCA 3GRPA 3TWOA 2X0JA 1IL0A 1U9JA 4N5LA 2AQKA 2W98A 3NTQA 1T1SA 4TRMA 3PJFA 2B69A 3DONA 3P2OA 2VYVA 2R00A 4WGGA 5KIAA 4AJ1A 3IL2A 1NQTA 3PGXA 1ISMA 4OL9A 5DT9A 4BNFA 4A27A 2B37A 1G1AA 1ZNQO 4A2CA 5HRUA 1E7MA 3OP4A 1UXJA 4TWRA 4BL5A 5IF3A 2I9PA 1DIBA 2J6IA 4FOOA 2EP5A 4LVUA 4RDIA 1VL8A 1VLLA 4LGVA 1HT0A 2J3KA 3RUDA 3B20A 1UDAA 1YL5A 1ZCJA 2EGGA 4IIVA 4D3SA 3OFSA 1NBOA 3I1JA 3N7UA 3RROA 2PD6A 3Q3CA 4BKUA 3W6ZA 1SAYA 1T24A 5J23A 1K5HA 2V6GA 3F5SA 3WLFA 1Q2XA 3RC7A 2LDXA 4KUEA 2C7GA 4NBUA 4XJTA 3I52A 4BHTA 3DWFA 4JBIA 3EZLA 3COSA 2IE0A 5EMHA 1ZK4A 3QLJA 4WCFC 4DA9A 4CM3A 1BVRA 3AI1A 3CEAA 3O8QB 5EL0A 2VYND 3ASUA 1B2LA 4RQUA 4I5GA 1C0LA 3V2HA 2GDZA 3PQEA 3DBLB 3H9JA 5AXAA 4WCDA 4ZRNA 1ZMTA 1ZO8A 3UKOA 4RLSA 5G0SA 3L6DA 2OUIA 2W2LA 1MC5A 2AEMA 1IB6A 2UDPA 2OP1A 1IYZA 2VNSA 4WECA 4JNKA 5TT1A 2WJPA 2VOJA 3NT5A 1X7HA 1EFKA 4OJNA 4IDFA 3UAGA 2RH4A 3W4KA 1F8GA 3BMQB 4UVEA 3QIVA 5L40A 4TZTA 3PPIA 4WCFB 1T25A 2FR1A 4CLRA 1J4AA 2E6UX 4K6CA 4OH1A 1P45A 3JQAA 4LRSB 2B4RO 3PJDA 3PVZA 4FFPA 4WEQA 2IEBA 3PTZA 4BNYA 4TRNA 4XKJA 3C7CB 3GVPA 4ALLA 1RPNA 3UCEA 1YWGO 2YV2A 5JCJD 2IRWA 1XWFA 4J90A 2QQ5A 4AJKA 3QE3A 1NXQA 4IQ0A 4QO7A 2QG4A 3PDUA 4Z3KA 1KVQA 1RWBA 3DBRA 1E6WA 5T67A 2HLPA 4YAIA 4NFSA 4N5NA 4QXMA 3GAZA 3ZWOA 4IDGA 1B8VA 3Q1LA 2YV3A 3D4PA 4DIBA 3LZ6A 3OJLA 1TEHA 3WSWA 4FJ2A 3CINA 3LU1A 1UXHA 3PZRA 5JNLA 2UAGA 1JTVA 1WPQA 3FBGA 3PLNA 3OJEA 2JCVA 2C82A 3H65A 1ID1A 1MG0A 4YPOA 1GQQA 1BXZA 5A3VA 2HMTA 4JP2A 1A71A 3I9NA 1LC3A 1QP8A 1WAMA 4JJGA 2V65A 1D7OA 1C0IA 4D7AA 1IULA 1HDRA 2W2KA 4XQGA 1N8KA 1ZSNA 2Q4BA 1YO6A 5L53A 2E37A 3F9IA 4QO8A 3H2SA 3I9MA 2GYYA 4UULA 4RZHA 5ENDA 4QQRA 1ONNA 3ZWAA 1DAOA 3ZHYA 5I7VA 4Q9NA 3WBBA 3O38A 1DC3A 1HDXA 1ENZA 1NFQA 1FDWA 4ALKA 3QWHA 3AUSA 4J1SA 2EKLA 4YVFA 3WYBA 3X2EA 3D5TA 4R68A 1AUPA 3F47A 3OETA 3FSRA 4XZ3A 3BTSA 1HDZA 1PS8A 4R9SA 5DP2A 1BDMA 1QSGA 3NGXA 2ZYGA 3DL2A 4RQTA 2RAFA 1Y7TA 4ZICA
chains in the Genus database with same CATH superfamily
1WXIA 2V0CA 3EZ2A 2F3TA 3EMBA 4FFNA 1Y89A 2CNDA 2OXRA 4OB7A 2AUMA 4IFEA 4LNUB 5BVGB 2Z57A 1KL7A 2F9MA 2NPIA 4L08A 4N3GA 4W9RA 5JHHB 3GP8A 4YAEA 1DLIA 2WU8A 1P39A 1JJIA 1ZUNB 3E9RA 4I8DA 3ZR4B 5FL3A 2YTZA 2R0QC 2HDHA 1OX6A 3D3WB 3IDAA 1R74A 2BFMA 5AK3A 4E4YA 5HP4A 1PX2A 3C5CA 3D64A 821PA 4EW6A 4PSCA 1JHQA 2A33A 2VK4A 2QM8A 1ULBA 2MIIA 2Q6VA 1P0MA 5EUMA 5BSMA 4H27A 1IZ7A 1TZJA 2PGOA 4JLKA 3DT6A 1NC3A 3OMXA 3M49A 4UCQA 3RSSA 4BFCA 3T4XA 1G7SA 2Y2UA 5DN6A 4JNCA 4R40A 5EFOA 4C6TA 3R5SA 1SNYA 1JU4A 1XEAA 4YRZA 1NRIA 3BXXA 1LRKA 1P72A 1SVIA 3G9UA 1NE2A 4PLPA 3PB3A 1HO3A 2HPAA 1F2UA 1MO6A 1O7JA 1RIFA 2YIMA 4WY8A 5D3MB 3P4UA 1O97D 4B4UA 4EFKA 1KBQA 3LSTA 2L18A 1H0KA 1YA4A 4XPIB 3RG2A 4AG5A 1ZM2A 2ZJ5A 3KWJA 1US8A 2FUCA 1S01A 4DBLE 3IVXA 1MU0A 1WRBA 4YO7A 1HGXA 1NR7A 2IX9A 2JJ1A 4WN3A 1WD5A 1GRCA 3I53A 1WS6A 3VYSB 2HJRA 4BVAA 5T41A 4P08A 2X0DA 1P2BA 3VR3D 5C5EA 2CUTA 2IIPA 3AY7A 1A1VA 1TTTA 1ZL0A 2WG1A 1IPEA 1P3DA 2R8YA 3PQ6A 3QKRA 2XQVA 4NY1A 5EHZA 1PR0A 1AMOA 5KQGA 3JZAA 1NI4B 1RKXA 4REQB 2FDCA 1FVFA 3W78A 5I3ZA 4YP1A 1W9HA 2ZULA 1K6IA 2W6ZA 1S02A 4GI3A 1C4KA 4F8JA 3HRKA 1XYVA 1WSBA 2JIZA 2LUOA 3K2QA 4JB2A 3BBLA 4CHTA 3L0BA 1G64A 1KO4A 3GCZA 5JAZA 3FGNA 5JIBA 2GEBA 2AOXA 2AYXA 1MW9X 2VHCA 2VF2A 4EGAA 3HHPA 1I2CA 1R8XA 5BOSA 4MJ3A 1I3KA 4R31A 5KC8A 1U63A 1GNQA 3RAJA 2XCUA 3EIXA 5DW0A 4DT1B 5TMPA 3VH1A 3OMLA 1C7JA 2FMHA 4ZYLA 5ITVA 4E3WA 1GYPA 5AHOA 2XTZA 2O3JA 4FCCA 1XAGA 8LDHA 1X77A 2RH8A 3WGUA 3PDCA 5LM3A 3AZQA 5CUQA 1B0AA 2P11A 3VYVA 2Z3ZA 2JBAA 4CM6A 3IE0A 2QIOA 1JG4A 3MZ0A 4FZVA 2P6RA 3KXIA 2ALJA 5MFPA 4PCUA 4FFMA 3WHPA 3BFVA 1O4WA 3BHJA 1S0UA 4LJ9A 1UBTS 2NV6A 4MLZA 3T1QA 2GK6A 1C1XB 1K8RA 2CLHB 1M75A 1JG3A 3K9BA 4OU5A 4XE5A 5IC5A 1D2NA 1DRWA 3UV7A 3GFSA 4F86A 5J4HA 5JZBA 2DPLA 2JAHA 4UNRA 3PICA 3WDLA 3KSZO 3KVNA 3IKTA 1CV2A 3I5YA 1L5KA 2KLBA 1Q84A 1UMDA 3K2IA 3PD7A 4JP5A 3ZEAA 5EJ7A 3TDKA 3CH6A 5L3SA 1SZDA 1TLLA 2FF5A 2JJYA 1JPVA 1BKDR 2EX4A 3RUAA 5AUNB 1GT6A 4X3PA 2IYRA 5MN5A 3KJXA 3VNUA 1QKIA 2RHGB 3TMAA 3ZLTA 4EKYA 4D8XA 4HSEA 2H2FA 3V2IA 1BXGB 3NYQA 2Z4TA 4HLNA 3WOVA 5DGTA 1DT5A 3WK9A 5JAPA 3RIYA 1QU2A 2HFKA 4H4CA 1J70A 2XKJE 3KBOA 4UDXX 5AVZA 4BWYA 1PFGA 3BXZA 4N3AA 2C1ZA 3TR6A 5CU7A 3MLAA 1R66A 4JGIA 5JV5A 3IJRA 1QGDA 5FTMA 3QFSA 3KG2A 2FW7A 3E3OA 4LEIA 1QFZA 4AK9A 3WA7A 1OLSA 4UCWA 2PA3A 5GMOA 1NW3A 2O3TA 2UV8A 3EG5A 1TCCA 4HNGA 4IIXA 5K09A 4QGGA 4IWXA 3PCRB 4K40A 1F3OA 1E5LA 4BKMA 3EF3A 3PFKA 1EA7A 1W7AA 3U5TA 1KH2A 4S1VA 4EA9A 1YTLA 1QX4A 1N2JA 3PUWA 4CEJA 1EK1A 2V7GA 1O9GA 2PXXA 3ZUPA 4K7JA 5DHAA 1I10A 5AKXA 4KE8A 1RZVA 4CEJB 2WKWA 2XOKD 2L42A 2AFHE 2QLFA 3LZDA 3NTOA 5DULA 2Z8YA 1DSSG 3JQEA 4NSNA 2FPXA 3LF1A 3SHVA 3WY9A 3KB1A 4C2UA 2ERYA 4JBGA 2PRYA 1NFFA 1PQ4A 2C2WA 2DWQA 5L7WA 3GGDA 2ACEA 2XTAA 5IC4A 4BNHA 3OX3A 1V8FA 3BBPA 3HL0A 1J20A 1RBYA 2XB8A 2P6PA 1NAIA 2FY8A 3DQZA 3KDSE 3G2HA 4KXLA 3GLGE 4FX5A 2PGDA 4AZ0B 5IJ9B 3HNRA 5ILOA 3E7PA 4FEAA 2Q0XA 3HV2A 2Q9CA 3M83A 4CF6A 1QHGA 3GPIA 3W5VA 3G3EA 4O25A 1ICIA 4DTCA 4D3YA 1TJ4A 3PNVA 3MJTA 2IKSA 4TT8A 4B80A 3I64A 5KYXA 2IBSA 1YGYA 5EESA 3QV1A 3VKFA 2IXBA 1XU7A 2QX4A 1JJ7A 4K6OA 3GJZA 5KMGB 1QM5A 2AUTA 4YPVA 1VB5A 3OIWA 1E1NA 2X0NA 1JW9B 1W88A 2QHXA 5ADUS 2J09A 4C7JA 1EGAA 1M1NA 5KNDA 1NY6A 1LDEA 4BP1A 5JYDA 1O94A 4U5XA 1ZSVA 1BCSB 1NHWA 1WKVA 2Q6LA 4G41A 2J7PD 1CB7A 1SXJC 2X1MA 5KKNB 4KK3A 1W5TA 3U7RA 4TSFD 3OT4A 3VH2A 2PEYA 3ZDXB 2RI6A 3ZDZB 4LBZA 1BCRB 3B3FA 1T5SA 1YS2X 3U7FB 1L1EA 1BWSA 3KTAA 4BJ1A 4DBVO 2VNKA 5J47A 1E63A 4KBGA 4P53A 3WTCA 4ENTA 3G49A 4NFLA 4M98A 5KO2A 2D7DA 2J3QA 5GZ6A 4DF3A 5DYGA 1AK2A 1CZUA 4B44A 4LOKA 3U3KA 1SIWA 3A9SA 3ZCXA 4E30A 3VR4A 2QE7D 9GPBA 2GO7A 4OXKA 1P1KA 1AH2A 3JALA 3DEFA 2HU5A 4C3OB 5BN3B 2RGCA 4US0R 4HLUC 5LP6B 2QVCA 3SX0A 2QMYA 2PBRA 2YZNA 1E7YA 1IUNA 1GRQA 4N3BA 1LW6E 2FN8A 2WM3A 2BGWA 2NYUA 1GV1A 4Y2QA 5FTNA 1V8BA 1WDKA 2ISCA 2OP0A 2DXIA 2FP3A 1TYDE 2ZJ4A 2D2EA 2J9YB 3CLTD 2BDTA 5B3JC 3QZUA 3OEWA 4JR0A 4C4XA 4RFVA 4R0NA 3SX4A 1JJBA 4MO2A 4B0OA 4M7OA 1LS1A 5CGZA 3KE8A 1KAEA 4HAWA 5DHTA 1FTSA 3NYWA 1I6LA 2JANA 1SEPA 3L1KA 1NT2A 2FJUA 2XW6A 1JRLA 1IN7A 4ZK6A 3EPHA 3RAPR 3WKBA 1QCDA 3HU3A 3ZDBA 3NM5A 2DUNA 4B3DA 1YCFA 2A94A 2ZSJA 4RE6A 1TQDA 2VSOA 4ZAWA 2QN7A 2XNCA 1T5IA 2VVTA 2ZWAA 3BMNB 1H6BA 4O2BF 3THSA 2HJHA 3ZHBA 1FFHA 4YAOA 4C0AC 2XT0A 1LS6A 3EG9A 3EDRA 1BH2A 4A2PA 2N42A 2J48A 2V7BA 4P34A 3TNLA 4C4AA 1ZUIA 2HMUA 2X5JO 1T8RA 2HJVA 2JATA 3LO5A 4HAUA 1L5YA 2JZNA 3ZH2A 1G20A 4B9AA 3OTIA 3CVWA 1N4AA 5F4BA 4AKHA 4RYLA 4E7PA 1RAGA 4C21A 1TEZA 3JWIA 5KBYA 4HXGA 3TFQA 2VDQB 3BMXA 1UZLA 3DJFA 2FGKA 3GD5A 1PL6A 2VNJA 4ZOAA 4ZMSA 1OH8A 3L6EA 4QYTA 2PRKA 3PYXA 1KRXA 3GLHB 2TMKA 3ICQB 1MH1A 3KPVA 1I4EB 1N57A 3OKAA 1NM5A 3D4OA 4NLLA 1JFTA 3AJ8A 1RMYA 2WF5A 2XITA 2HDWA 3ZK9A 1PJQA 5JVDB 1PQWA 4OYLA 5KTKA 4G4GA 3WLPA 2EKBA 4MUGA 2I1VB 4O4IB 1M0TA 3OZDA 2FXIA 2I1QA 4IIGA 2BFOA 3AESA 3HYRA 3IURA 5AICA 3KQTA 4O6VA 2JBWA 4MIOA 2IU0A 4Q7LA 3VPAA 1P8JA 4CVNA 1H23A 5BQOA 4CKXA 4CNQA 1NVEA 2YQ4A 3ASYA 4M6WB 1NYLA 1QXSA 2QJTA 2XYQA 4F91B 2FMXA 2BEUB 2VHYA 5JQGA 1XKTA 5CK5A 5CDSA 3Q72A 4KN9S 4B7UA 1Y7PA 3MLEA 1M67A 2C98A 4U3JB 2CJFA 4P35A 5JW6A 3V80A 1L8LA 2ORED 3FPGA 2EAUA 3QVUA 4N7RA 1USKA 5I51A 1E18A 1YU6A 2YJZA 1HL7A 1RJWA 3KV3O 3LM8A 1EUDA 4EJ6A 1JDUA 1QANA 1VI5A 1WEKA 3AFOA 4A1FA 4BNUA 5C7LO 2HK9A 4PRLA 1M8PA 3R3XA 2I2XB 2Z1MA 3WE7A 1XJWA 3DYVA 5LP1A 4FWBA 5IU6A 1W1UA 1B41A 3LBHA 3TIGA 3ZG6A 2WFLB 4D4IA 4RV5A 4U1RA 1DIGA 4F72A 3ULKA 5JAOA 1KDPA 3NV7A 4I4IA 4HMPA 4MVJE 3GV0A 4QBTA 3QK7A 3WIDA 5CFZA 1ZAKA 1SKYB 2CD9A 3PEVA 5F33A 2QMZA 2LCFA 4D0LB 3VFDA 3D0QA 5IHPA 1ONOA 4PYOA 3W4IA 3DZBA 2I8LA 4OQFA 3S55A 2Y1FA 4MV6A 3BRWD 3TBHA 3LLVA 1GFIA 3EXFA 1L5ZA 2VRCD 1ITZA 1Z16A 2GEKA 4P4LA 2YC2C 3FPKA 5H7XA 3WV5A 1KRHA 3FTPA 1XK6A 4HEJA 1Y7HA 1XJQA 4QLOA 1M6HA 5GGXA 1L5GB 3X1DA 2F1RA 3GPBA 3TCKA 3DOUA 1VTKA 2Q28A 4UM8B 4MRAA 5KDDA 3DAYA 3BDIA 4Q4LA 3STWA 1PI3A 4ND8A 2EW1A 1F38A 1CCWA 1I3OA 4GFDA 5EIHA 4E1BA 1II0A 1ZN7A 2PWYA 4ZARA 3C3MA 3ZD6A 1K3UB 1LBSA 1MOZA 1DXHA 3OZBA 3DAGA 3QUQA 2LRHA 3CPSA 1J56A 1EFHA 3ELUA 4L0DA 1SCBA 1Z4OA 4JR2A 1Z3IX 2FMUA 3OE4A 2P4UA 4LV5B 2D5IA 3H84A 1DC8A 2XKAA 4FYPA 4HB2A 4DYDA 1QQBA 1ZM7A 1XC7A 2CE7A 2IHZA 3CSDA 4QOSA 4RC9A 1UJ6A 3DO5A 3I61A 2B8EA 1VXOA 2NO1A 3NASA 1Q91A 2OGWA 3B7PA 4KTTE 5AYVA 3RPEA 4ZO9A 3M1IA 1GNRA 4KO1S 5BSFA 3AI3A 3V7FA 1JHYA 1DKMA 2UYHA 1Q7CA 3IA2A 3WKCA 4YQFA 4ZMRA 2UZ1A 3V8QA 2B61A 3MJCA 1GV0A 4EGQA 2GM4A 1S3IA 1SJ9A 3HO1A 4JC4A 1BVHA 5TC4A 5LZ5A 3SDBA 1M6YA 2R62A 2H4YA 1G2PA 2HRBA 2JEOA 2QYTA 2Z2YA 4ECEA 2D1QA 3MXTA 3AJAA 4ZCQA 5JROA 5LDDC 2GEVA 1OLXB 1GLGA 4XTRA 1MJGA 1MN6A 2IDZA 1WD7A 2WKPA 3OIUA 2EEPA 3DQQA 2NUAA 1PF7E 3KCQA 4J16A 1FPMA 5FR1A 3RU7A 2NIPA 3FMFA 3UUFA 4BQPA 4XIJA 1BS9A 5CFLA 3ZHSA 1FRVA 2BGUA 3IERA 2REBA 2QRUA 2QTWB 4RLFA 3MUOA 3H8SA 4QBIA 4AJHA 3O95A 4D46A 3L7KA 4N0EA 4I1RA 5BMVA 4PWYA 5F9FA 1RRFA 2HBQA 2VP5A 5DYIA 1RI4A 1LW7A 2QNRA 4CV1A 1HETA 4IVQA 4BWVA 5KWEA 3L8CA 4MQEA 4JL5A 3OPVA 5ENZA 2Z5LA 3NWBA 1EFVB 2RCYA 4PYLA 4I1PA 3ADPA 2I29A 4F9GA 5DCWA 4C7OB 1J0BA 2XZOA 3TJMA 1UQTA 3IILA 4G5GA 3RM3A 3I28A 3K4HA 1E2JA 3RB8A 4KE7A 1DARA 2NO4A 2ZAIA 5IJXA 4I4TB 3BE4A 1CY4A 2QVZX 2O7SA 3VU9A 5T8KC 2P8JA 1N5KA 2XUHA 3KQUA 4O33A 4IIHA 2OHOA 2VUUA 5AK5A 3EFEA 1DAHA 3WISA 4JI5B 1JNYA 3EBLA 5B12A 2PT9A 4PNZA 5K1ZA 2ZTSA 2DGDA 3O3OB 5L7TA 5DBGA 3VMMA 5LQCA 3AHEA 5TGZA 1CJSA 1N5RA 1SCAA 2JFWA 2Q3EA 2TSYB 4FYYA 3C6ZA 3I3SR 4ZXPA 5JH7B 2WJJA 1D07A 1O54A 2MCFA 1P9WA 2HTEA 1L5RA 1JFFA 1Q77A 2X3UA 2X42A 5CH3A 4AMGA 4ZTZB 2FEKA 3BXPA 3SS9X 4KACA 4WESA 2RGNC 4HNVA 2A9QA 2A58A 3AF5A 4O4JB 1R4AA 3C8DA 1NN0A 2BI4A 1Z5PA 2FMIA 3SMVA 2AJBA 3W6UA 3IQGX 1TUEA 1T3TA 3O2QB 2GN0A 1Q0PA 4PV7A 3KB8A 3WJ1A 1XHFA 1IHOA 1RFLA 2AFIA 2CZGA 2DBVO 4QSMA 5KVVA 3TFWA 1G18A 4N8EA 3LDUA 1T0IA 5AESA 2IOFK 2YASA 4J9UE 3REQB 2O8DB 3X3HA 1ISHA 2Q99A 4XEHA 1HYGA 1QQAA 3JQ7A 1WZ2A 4LY3A 3VU8A 1IONA 5C32A 4KGXA 3NHLA 4KJXA 4O08A 5F7OA 4JZYA 2QLMA 4F6RA 4CV3A 4JITA 1K6EA 2PU7A 2HPHA 3H83A 3F2IA 5GAJA 5HWSA 3DZDA 4ZO8A 2I2AA 5DTMA 3QY0A 3M4XA 5EZ5A 2R65A 4UVHA 2AK2A 3OZXA 3CNBA 1YUMA 2I78A 4OHWA 4F2WA 3D6UA 2PHZA 4WXEA 2X4IA 3U1VA 2ZJZA 5CB4A 1AMNA 3TOVA 4PSAA 3P0JA 4A10A 1ZI6A 1PIWA 5DNVA 3CLSC 2HA4A 5JQGF 2Q5FA 5EJ9A 4CGZA 5A2QA 1QRRA 1SG9A 1D0VA 2GZHA 3HL4A 4B7AA 1PR9A 1MJFA 3T0IA 4URXR 2A57A 2IXGA 3JZDA 4JI7B 4REMA 2Z9DA 3C7DB 1MQ8B 3HKBB 1EGVB 2FETA 2V1UA 3GP3A 3GARA 2AUNA 2MR6A 1A72A 4P81A 3YASA 2RK4A 4L02A 4OP3A 1KI2A 3DVAB 1HDEA 1Q20A 3HABA 4YV0A 2EEZA 1IUKA 3EZ7A 5CCEA 4X63A 1KGSA 1JHVA 1ECFA 4OGGA 5B4TA 2AVNA 4JSYA 4PU0A 4IDCA 4B7ZA 3WP1B 4CMJA 2GCGA 1F8XA 1HE5A 1ZVKA 2Z1DA 2DKFA 1N0HA 1QH0A 4OK3A 3AINA 3BJMA 2QRVB 2F4VB 4X92A 1XQ6A 4JB0A 4D4GA 2WYUA 5AJWA 3WL3A 3RUIA 4PCVA 5AJVB 3OICA 3KZOA 1IRXA 3GMIA 1M0SA 4KXVA 3K9QO 3AEYA 1HNWB 3NONA 4E07A 4DV2B 4RY8A 1CQXA 3JSAA 1VE6A 1CR2A 1H1LA 2YS7A 3I01A 1LA2A 2P4HX 2ERCA 3A37A 5LP6F 3GJ3A 3P26A 4RIHA 4YFVA 2ZT5A 5GONF 4ZO4A 4W82A 4QTXA 4LWPA 4R1OA 3N59A 2V4UA 3EF1A 1WQ3A 2FSVC 4JLOA 3X2FA 4I3GA 5I45A 1LDGA 4BPRA 3FWNA 4EB3A 2BSQA 3FF4A 3FGZA 4XX1A 2WHRA 4EP1A 2O2HA 5AVUA 4FQ7A 4EAAA 3UHAA 1X38A 1DRKA 1ZOIA 2C00A 2H1FA 5KVAA 4EVSA 1GQOA 3EVBA 2B2CA 3OZGA 3C4JA 4A8TA 2XA1A 2JNWA 1ZA2A 9ABPA 3HGMA 3W9YA 2R8PA 3ONDA 1PSDA 2XYGA 5J5CA 6PFKA 3ZWYA 4CMCA 4DQKA 4YJHA 1FDRA 1W30A 1YAHA 3GBVA 3PI6A 4F3KA 5CBPA 1QPZA 4JDUA 2FPKA 4COKA 1AT1A 4EYOA 1TCBA 1QV7A 3DKKA 4DY4A 4ER7A 5EXSA 3TW8A 1NSYA 2NTNA 2WILA 1FIUA 1YBHA 2V0GA 4L6IA 3PWSA 1ZKDA 4I50B 3X1MA 1CRPA 4U7JA 5JJCA 4WI1A 1JIQA 4RFLA 3B6ZA 1XQ9A 5ELLA 4YBRA 3V1LA 4P0TA 3DBHB 3ELWA 3L7BA 1VPVA 5FI5A 2YFQA 1KETA 4LKOA 4FOLA 1GGEA 1Y82A 1W25A 4DEYA 5AVWA 1IEXA 1E9EA 5HQTA 1YRYE 2WB4A 1YE5A 4FGSA 3B3QA 5CYGA 1JAXA 1WUYA 3L8MA 1WB6A 1EXWA 1TM1E 2X15A 1MV8A 3GB9A 5HQJA 4FNMA 1LGYA 4XWOA 3GLFA 4TOIA 2VQFB 2YXBA 1NI5A 1NWHA 3TQIA 3KQLA 2NG1A 2D0OB 2OBLA 2YIJA 4N0DA 4TVBA 2CJWA 4XSVA 1U2SA 2AQIA 1R8QA 3MTEA 1T43A 2B99A 2ZWOA 2V58A 2QJRA 4IAOA 1Z2NX 5CT6A 4C3VA 2IELA 1F6WA 3LJKA 4RS3A 3W6NA 4WLVA 4QHSA 5EJEA 3HTXA 1DJLA 1BU8A 3JYNA 3G2IA 3PXDA 5F52A 1ZJYA 4D9IA 3IVCA 4PYKA 3OIYA 2D1YA 1P5RA 3P2MA 3PRKE 5HIMA 4RSMA 3IT2A 3K5WA 2ZATA 1MX1A 3F5MA 1V5IA 3H1TA 3IOBA 1TFUA 3PU6A 1MA0A 4K6KA 2HK8A 1ZI8A 1P77A 4I81A 4UPDA 2BD0A 3HSKA 1R5JA 3DR5A 3D3JA 3RU3A 4HEHA 5HSGA 3B2QA 2G1PA 3EXG1 4OX9B 3FLBA 2HLDD 4CL3A 5COAA 1V25A 1EUQA 2OBYA 4J2TA 2HB6A 5K8LA 1NUSA 3L46A 5A1JA 2PKCA 1PL7A 4Y7CA 1M6NA 1SO8A 2Q6IA 4TXLA 2QNIA 2PK3A 2PQ2A 1A96A 1XUOA 3HUFA 4P4UA 4CM8B 2UZ4A 4I6JA 1O5TA 3U3ZA 1W93A 4YPFA 3LDAA 3TNJA 1PFQA 1ULUA 3FCYA 3LQ4A 4QATA 3L0PA 5AJHA 5FD8A 4ZK2A 4IJUA 1JA1A 4QDJA 1GNVA 3KR9A 1G55A 1F6DA 2NYRA 3K4QA 2PY6A 4MTCA 3AYZB 1B26A 5K9ZA 1W48A 3ETLA 1W0JD 1WHTB 1ZHHA 4KIGA 4LHVA 1O6CA 2I4RA 1EB8A 4Y6SA 2ZRJA 4G1MB 3RI3A 2GN6A 2GB4A 2GESA 3AU9A 2ZKIA 3BZWA 3FCXA 3O26A 3OO0A 3PUXA 3WBJA 4BVFA 4E6PA 3R7WA 3ELDA 4L16A 3Q85A 4LVCA 1A5TA 1NNSA 4R1SA 2BELA 1PWXA 3G1WA 5DLDA 1H5QA 2IYTA 4TTIA 3MINA 3VZPA 3TRIA 4L07A 5EE3A 4Q4CA 1JXQA 3KHTA 2N47A 4GPEA 1GTVA 2C4TA 3OM0A 2YZ7A 4MS3A 2FPPB 3KZMA 4L1KA 1A27A 2CNLA 1BX1A 2X8AA 2ZSFA 4X6UA 3EFOA 4DUGD 1R9JA 3TIIA 1Z08A 3S2GA 1LY1A 4GI7A 4EI2A 3JD2A 2IZ0A 3O21A 1FFYA 4YQEA 1GQ2A 3WAJA 1K9SA 4P2BA 5DIFA 3U26A 5BOVA 1XD2B 3TRHA 3DLHA 2G0NA 5KAPA 4F5DA 2PVCA 2PMKA 3B52X 5C0OE 3OTGA 3ZDYB 3A7EA 2YQ5A 3L4JA 1GN9A 3PHGA 2OZEA 2VWGA 3ITEA 2ZRHA 4BNIA 1FRQA 3L7MA 3EXHA 3U9SA 4PSVA 3ETDA 2NO9A 1W2GA 3U6BA 4NOMA 1JT2A 4EB8A 4ND2A 1SXQA 5D00A 2GRJA 1SXHA 1X7YB 4Q9AA 2PBFA 4YEDA 4YQYA 5T64A 4EZEA 2D74A 2HC9A 3Q87B 4KLAA 1ST3A 3MWJA 3VTAA 2E18A 3MIZA 1PJRA 1R5BA 1ZJ6A 1PHRA 1ECPA 5ANRB 2AOTB 4DDUA 3TFOA 3P4XA 1XBTA 4MYUA 1CKEA 3EXIA 3FSEA 1UXIA 1EFCA 3B9PA 3F74A 3H9CA 5FLKA 4F3NA 5JSFA 1JUDA 1XXHE 2EU8A 4GE3A 1E3SA 1JKFA 4X62B 4F7WA 5I4CA 3CN9A 1MABA 2Z8YM 1RW4A 2GVDC 3DV2A 1RWWA 1TMOA 3IA7A 3MYRA 4R05A 1UKZA 5K8JB 3KLOA 1N5DA 2R6CA 2NYVA 2B2NA 3FIJA 2JI9A 4KMSA 2YJTD 5ALQA 4RHYA 1RADA 1Y80A 2OXTA 4MZXA 4YY3B 3HKCB 5F35A 1Y8RB 3V4SA 5IJ0A 3SE0A 5IG2A 3K70C 2IHNA 3PPWA 2EHDA 3C3BA 4C43A 4JSTA 2HDNB 1V9CA 2XMQA 4NMLA 3EEBA 2JCSA 1QU3A 4DA4A 3MCUA 3FSJX 1OOEA 3PRHA 3JYPA 4WUTA 3HCEA 2Q2WA 2VAVA 2HSGA 3WKAA 4EPTA 4N7JA 4GM1A 3VZQA 2AJDA 3GLUA 3OMWA 3S8EA 3PXBA 2Y9MB 4DSTA 4GRDA 2YWGA 3E1SA 1FMFA 5GV8A 3DDOA 5I9IA 4P32A 5D85A 3C5HA 3GDWA 4ZVTA 1XLTC 2C4WA 1ZEJA 1II8A 4LV6A 4M7RA 5AFSA 5L6MB 3NCTA 3PKZA 2WMNB 5HR5A 4JEUA 5E95A 3IEVA 1ISIA 1LK5A 3MGGA 4QM6A 2H29A 3CURA 4NZNA 1YMUA 1TVKB 3K70B 4M3NA 5KSOA 1EB9A 3V55A 4OI0A 3C74A 2RJNA 2G72A 2I99A 3E5RA 4B34A 3BTOA 1A2KC 4LK3A 1R6UA 4HNUA 2E5FA 5IVIA 2DSTA 1NF9A 3ZPXA 4CN8A 1P1JA 3F7OA 2MSCB 3AJDA 2OGSA 1YHYA 1MO3A 1I4WA 3EUFA 3WMEA 4IQ4A 1WDMA 2Q3CA 4YJGA 4ZI7B 4M8LA 4MS1A 1SZPA 4EJSA 4F56A 4HEA6 1I5OA 1K8YB 2C78A 1Z5NA 4L8FA 2O2JA 2PANA 1CYDA 1F0NA 3QMVA 3PHBE 4MEAA 3WYNA 1AVTA 5JRDS 1DC6A 2PZJA 1DC7A 2VNHA 2CXRA 3EIFA 3OQBA 1D1TA 4FKZA 4UHJA 1NNEA 1OREA 4ZVLA 3HP1A 5ALRA 5DSZA 2LBPA 1BQEA 4W1PA 4QHYA 4KMMA 4WIAA 3L07A 1N1DA 4JGGA 5GZ3A 2GYUA 3MD0A 5DYNA 5HDBB 4ER3A 4O2AB 2PBLA 3BSWA 4Y2GA 3UMMA 3EZGA 3QBJA 4K6FA 2RMKA 3DEHA 1KDRA 3IR5A 5EE5B 1LV7A 1UC9A 3GL9A 1TO1E 1PZHA 1A9QA 3RBXA 4IZ6A 2BDUA 1YAJA 3MJVA 1T5DX 2PR2A 5HUQA 1X39A 3HCNA 1KDYA 4DKJA 5ALZA 2HNKA 4BB5A 1QCCA 1PGJA 1STOA 5DOZA 2CMHA 3TQFA 1LFAA 1V6CA 4S2UA 4DCNA 4F4JA 3FCSB 5KYWA 1OX5A 1E4YA 1BE8A 2HIMA 1FVXA 3VKWA 1J1UA 4QGHA 4ENQA 6YASA 1U2RA 3VGPA 2ZI9A 3F5QA 3HHEA 2DKNA 3I2YX 4R2IA 2DU8A 5GV7A 5ECWA 1NF3A 7MDHA 4KVZA 4REQA 2A9JA 3WWPA 3ZZNA 3ZVKA 1S2MA 1BOOA 5CRIA 3WGQA 3G5UA 2HJGA 3EPPA 1GFSA 1D4AA 1PW7A 1Y7LA 1M34A 1TB4A 3UMGA 3MMNA 5TS2A 3PHIA 3MXOA 4MUFA 3IAUA 4R9NA 4B6QA 4DCUA 2XI4A 5BW5A 5DXJA 3FYSA 2XB4A 2JKVA 4X24A 3AVQA 3FUWA 3RRJA 3B85A 3I2GA 3F97A 2ZRNA 3GRYA 3CNEA 4MV3A 2GZAA 3BUSA 4LHYA 4CLDA 3TB4A 3UYLA 1D2AA 1FDUA 1T9BA 3NVDA 3T4PA 1PL0A 1ESZA 5J2TF 3GROA 3T4UA 2NACA 2D8AA 4BOYA 1OROA 2Y05A 2V59A 4YLEA 1JDJA 2B35A 2WWVD 3OPMA 3RIMA 4QOGA 3M8KA 3UCXA 3NFYA 1O57A 1ECCA 1WPGA 2VUSA 3N1UA 5F2OA 5BO5A 3FCCA 5TXGA 3O1HB 2JKZA 4CUKA 3LYUA 3NBXX 3GPDG 3NVAA 2P2GA 1ENYA 3HN6A 3E35A 2RGUA 3OP1A 5EWJB 4D0GA 1SRRA 2HHCA 2JFUA 3A36A 3KQQA 1UMCB 4OGWA 4QGAA 2C4KA 4M22A 4ECAA 4TLCA 3PIIA 2VPPA 3SBDA 3V46A 2IYEA 4BZXA 4J3FA 1OXBB 1AUVA 3V1UA 1TIBA 4PX3A 4S1NA 1ZH6A 1O87A 3ECAA 5IDVA 1X19A 2PL9A 1B3BA 4LN1A 1MVLA 3I5MA 4Q4JA 5EFZA 5CCXA 4IXTA 2D1FA 1R16A 4EECA 1QIGA 2QU7A 4BZPA 3FVRA 1T8SA 4HAZA 1E2EA 1T10A 1JAHA 3WBKA 2BM8A 4DMFA 1XRPA 1WOMA 3ENNA 3V42A 4DSZA 3GNSA 2CFTA 3OQPA 4IUYA 1LTKA 4ZVRA 4A73A 1Z2CA 1P6XA 4I36A 3WLTA 2DETA 1L4GA 1U3DA 2RB5A 1CVRA 4P9NA 2YJ3A 3DXXA 4A5OA 3GQBB 4LWOA 1MVOA 1S3SA 1ZNXA 1BO6A 3AERB 2F67A 4FLMA 1DEHA 1QHYA 1CHNA 3ZZMA 4E51A 2PS1A 3DGEC 5CB6A 3I45A 4B1FA 3DE7X 1F12A 5DTEA 1F4PA 1XDWA 5BYAA 2NU7A 5DHPA 4B3BA 2CBXA 1Z7WA 3EGIA 3KL2A 4W5NA 4K1XA 2DTDA 5KWSA 2HRQA 1NRWA 3V4VB 3ITDA 3QF4B 3R5HA 4MQUA 5CITA 5KPJA 3LQFA 2RIRA 3CEHA 3IESA 4DFDA 3ZCSA 3HU5A 4CM7A 1JDNA 1CUAA 4F96A 1NNI1 1S8AA 1ODFA 4E14A 5BWMA 4RM3A 1KU0A 5A4JA 3LLCA 1QZTA 1CJUC 1SCIA 2H1LA 2WUDA 3IV7A 2NO6A 1L5SA 3CKLA 4KFRA 1YTUA 4KV9A 2F8SA 3DJYA 5LLSA 3TRJA 4F71A 1JZQA 3ABSB 3G9XA 3PK0A 1VI6A 1PE0A 1M2EA 4OQXA 1R4MA 2C8LA 4TMXA 3UXEA 1CRZA 5CA1B 2Q4TA 3TCXB 5JZMA 1DXQA 1E77A 4ZCSA 3WAKA 3HCDA 5IYZF 3V4LA 1IOZA 2KM1A 2C97A 4LSWA 3TSCA 4J07A 4LX8A 2CHQA 2KJQA 3O92A 1MB9A 3GZNA 4RBNA 1QO0A 3DPIA 1PTKA 4IXMA 2ZBRA 4L4ZA 5IJ9A 3UC5A 1M66A 3DEJA 4ZT4A 5CX1B 1AQYA 3HA2A 1U0JA 2AE1A 2RGRA 4BUZA 4JJFA 2BDEA 4D96A 1AN9A 2BEVA 4L0QA 3ZY2A 1YZNA 5JCZA 2AEFA 4IV0A 4S2EA 2AS0A 5ERXA 3DWGA 5ITSA 3EX7C 2Z04A 3VBEA 2ZOSA 2ZIZA 1H2HA 2HLHA 4RMIA 4GMDA 5CXUA 3AXTA 2JGKA 1H0SA 4G0QA 3IYLW 1DKNA 3H11B 3PFNA 3HXKA 1KE2A 1F1JA 1FE8A 2P40A 2J1LA 2Y1CA 3CHYA 1CR0A 3VHQA 4JA2A 2P3SA 4E5DA 1YB4A 2HMSA 4NYJQ 1IEQA 3KXKA 2JI7A 2C2BA 4H7HA 4NENB 2P75A 4MK4A 2WB2A 3R6DA 2VAPA 2QZZA 1PZEA 4FGJA 1IATA 2F62A 3IEUA 3VHXA 5CEFA 2MYTA 2XE6A 4KAJA 1U7HA 1BCRA 3ONEA 4YR7A 4OAQA 1M5UA 1NSFA 1RJGA 4G5SA 1EAYA 2XUKA 4RFSB 1U2EA 3DW3X 4KFTA 4UEQA 3E9CA 4OUDA 4RF4A 1YDMA 4RHFA 1I36A 4L78A 3ELBA 5EQTA 2J3HA 3HKDB 1YSCA 3Q40A 3E8XA 4UREA 5AHKA 5FWAA 4XYLA 3BH6A 3VH4A 3FWPA 2WHYA 5A9SB 2BF7A 1MF7A 2P2NA 4JUCA 1K27A 2GD0A 2AW3A 4BNVA 1NU8A 4GECA 5F3DA 3PJEA 5DIZA 1L1QA 3EAFA 2QN6A 1AS3A 4W7HA 4E5VA 4CUJA 1FXWA 3G0HA 3I42A 4UFOA 2VG8A 1SXJA 4FOSA 2JL1A 4X94A 5CP8A 3RYHB 3Q7QA 4FS8A 4J7UA 4KWHA 4LJLA 3RFVA 5IM4A 3WJAA 2RE8A 3PNSA 4R7GA 4YLGA 3AM1A 3OCWA 4GNKA 4GM4A 4HRXA 1DUIA 2OY0A 2YUIA 1XTVA 4U7PB 4OEHA 3DL7A 4WXMA 1DRVA 1JIJA 3FFBA 3OCZA 2UVPA 4IDHA 5C7YA 3GJSA 2YBDA 1VKOA 4J0KA 4Q21A 4KYVA 3SX2A 3FOAA 3K0FB 5HF5A 4IKEA 2EFJA 3QWAA 3FPCA 2EFHB 2WICA 1QS0B 3CXUA 2GAOA 1XMJA 4G2NA 4KHZA 1MTOA 3BB1A 1ZZEA 2CF5A 2Y92A 4KI7A 5H1YA 5J3JA 5JNWA 1GUZA 3KSRA 4PO9A 4PHHA 1TF5A 5ALYA 4JVNA 4JYMA 3UG6A 4A8JA 1KMIY 1DVRA 4LMBA 2HIAA 4QLAA 1ND5A 3CZ4A 2CCGA 4Q7EA 1KFJB 2C29D 2AK3A 1KYXA 2IQIA 2CFIA 2W6QA 3E03A 4N49A 3CA8A 1AGRA 2F9LA 4S0ZA 2ODNA 2WT8A 3MBOA 2QUHA 4KE9A 4RSHA 2OO5C 1EESA 2GT1A 5K8CA 3OD1A 1P3JA 4OQYA 1UBHS 2G9RA 4QWWA 4P22A 3JYQA 3ROEA 2YVUA 1XFDA 2E4YA 2M6LA 4OHPA 5AUQA 1EVJA 1G8YA 2W6IA 2JI8A 3PFGA 4EMUA 5HOEA 4MRRA 3IIEA 5ALTA 3EWAA 1GZVA 4F5EA 5DDIP 3AF3A 4UEWA 3RVLA 4CNBA 4M49A 3FTEA 1N0WA 1X2EA 1I01A 3MHPA 5LNK6 3HWX1 1DAGA 4DIUA 2HW8A 3ZDAA 5LJIA 4LAFA 1IY0A 3TAHA 4W7SA 4LKRA 3ZNQA 1K4YA 3GLHA 4HDRB 1NPTO 3OZUA 2XCQA 1JX6A 4ASUD 1PU2A 2C61A 2FGJA 3B48A 3FHJA 3IPAA 1RTTA 3GGPA 3LQ2A 1TEXA 5CJ2A 5ESWA 4HN4B 721PA 1GPBA 4MIKA 3ZDFA 3PE6A 1QBKC 2IF2A 4HPWA 4DS3A 4L5JA 4GBMA 5JVDA 5E6RA 1W47A 1FDOA 1S2GA 1ZIPA 4DLLA 1QOZA 1KP9A 1U7OA 1WLSA 4OQMA 4AKGA 3HDJA 4DRXA 3MILA 3TH5A 4DWWA 3H86A 1X3LA 4QOEA 4TMFA 4GQAA 2CXOA 1PFWA 4XIIA 1HZJA 4D0NA 1Z2PX 2N1MA 2UUCB 2MYUA 4URFA 1Q1BA 1S96A 1G16A 3K1ZA 4Q12A 2COUA 2LDBA 4BUJA 2GMWA 1G2OA 4M6WA 3NC1C 1SBZA 2BISA 4G86A 2IUEA 2QIPA 4JOCA 4F0JA 5JANA 4LBYA 4YLYA 1RC8A 2COKA 4NCAA 1DHRA 3RF6A 3TLEA 3VAAA 3GVCA 3ITNA 5JWHA 2R97A 4OK6A 3SEQA 4C4RA 2BFFB 4U3JA 1UJMA 4CXMA 1KZYC 1A2QA 2ZWVA 2J0VA 2UXCB 4GO1A 2BHRA 3BWEA 4DXDA 3A1TA 3IUEA 3OIDA 1PJBA 2AF4C 4FMDB 4CKBB 2WJGA 3TE7A 3F4LA 2PX5A 3A9WA 5AJTA 1CEQA 4GYWA 3TW6A 2AEJA 1FJ2A 2IZ1A 2QR5A 4LYJA 3TQRA 3ZGLA 2N9UA 1ORIA 3NTXA 4EG8A 4BO6A 3ICOA 2QP4A 5ADWA 3GEMA 5G2OA 1JEAA 3T38A 2K2WA 3R3UA 1QTQA 4HADA 1JBKA 2I2DA 1N6IA 1Q3TA 5LZ2A 1URPA 3BZBA 3I01M 1RI1A 3K6RA 1A5SB 4CLXA 4LRYA 2FOXA 3DE0X 1E2DA 4RELA 2Z2KA 5KSZA 3DQPA 1OB5A 3R5KA 1XPJA 3C7TA 3LKZA 1UQRA 1WABA 4KVFA 3C3EA 5J59A 5IZCC 1W34A 4TTSA 5KTOA 5JADA 3G2OA 1QVRA 4DQDA 3B6JA 4EA8A 4P98A 1LDBA 3HYCA 4C04A 4TZ6A 4BLVA 1YQUA 4OGFA 1F8FA 1I0LA 3RSGA 2HV9A 2OUKA 5HCUA 5JEEA 3PEWA 2VYQA 1CD5A 2VTVA 2NN3C 3DHYA 3IVRA 3NQ41 3IIMA 5DPMA 2OA0A 3ZU5A 3NVKI 4X1YA 1AY0A 5CHYA 4WFJA 3L04A 3U40A 1VBKA 1KOLA 2VC2B 3H2IA 4X84A 2Q2VA 4RVUA 3PC4A 1W4ZA 4D5EA 5FEUA 4PQRA 3TZBA 3JQ8B 3HYSA 3UOAB 1FFXA 4TWJA 1ZC4A 3O2NA 4YMIA 3THXA 1DCMA 1WZEA 3USES 1GLNA 3P1JA 3R0JA 3ROZA 4ALNA 3MGKA 3ZGNA 3LXUX 3CYFA 3UPDA 1YR8A 4MR8A 4UQOA 3DCYA 3G0GA 3DHVA 4GM0A 1U7UA 4R7TA 3S27A 2GXAA 4ZI2A 1VSQA 4N9QA