3AUUA

Crystal structure of bacillus megaterium glucose dehydrogenase 4 in complex with d-glucose
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
262
structure length
262
Chain Sequence
b'HMYTDLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYYNNEEEALDAKKEVEEAGGQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIKGNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPINAEKFADPVQRADVESMIPMGYIGKPEEVAAVAAFLASSQASYVTGITLFADGGMTKYPSFQAGRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucose 1-dehydrogenase 4
publication title Structure-guided mutagenesis for the improvement of substrate specificity of Bacillus megaterium glucose 1-dehydrogenase IV
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Oxidoreductase
total genus 100
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 1.1.1.47: Glucose 1-dehydrogenase (NAD(P)(+)).
pdb deposition date 2011-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3auuA00
1YKFA 1GDHA 3X2FA 3GR6A 4IIUA 1X7GA 3DBHB 4OQZA 3RCBA 2IXBA 1R37A 4R3NA 2CF5A 3DTYA 1NX6A 1H5QA 3GHYA 2WMDA 3JYPA 1Q1NA 1VKNA 3MJEA 4YQZA 4LVUA 3ROPA 1E7RA 1A7KA 4CLRB 2X58A 2HK7A 3STHA 3A14A 1LDGA 3PQFA 2DFDA 4CQMB 3JQ8B 1JA9A 5G0SA 8LDHA 2EG9A 3AW9A 5HA5A 3M6IA 2OZPA 3PK0A 4I9HA 5TT0A 3GG9A 3WYBA 1DRWA 4E2YA 3L6EA 2C54A 1D4FA 2QRJA 4INAA 2ZQZA 1U7TA 3VZRA 4A2CA 4GX2A 4NR0A 1PWXA 2DC1A 1Z7EA 4PZCA 5AYVA 2C59A 1RM5A 5IXYA 1X14A 2DFVA 2GSDA 3OQBA 5I7SA 1ISIA 2VHVA 3H9QA 2V6FA 3E5MA 4IM7A 4RGBA 4BNIA 3D4OA 5L40A 5JDIA 1OI7A 3AWDA 1MA0A 1O5IA 4HX5A 1NFQA 2I65A 1KEUA 4UVIA 1PJBA 4IS2A 4B7CA 2JKVA 1HZZA 1TT7A 2QZZA 4R69A 1JW9B 2YUTA 3D64A 3DR3A 4WCFB 5ER9A 2V6MA 1E6EA 4JIGA 3UHAA 1E0DA 4DRYA 1NQTA 3FTNA 4UVDA 3T7EA 3QVTA 3NAQA 4CPDA 2NU9A 1E7QA 4N18A 4YT4A 4CLOA 2Q49A 4ZQFA 1EK5A 3BZUA 4RVFA 3RUFA 4E6PA 4G5HA 2BI7A 4J1TA 2QG4A 4WOKA 3DBHA 1G6KA 3HUDA 2HK9A 1LLCA 1NAHA 1ZMOA 1ZKMA 3DOCA 4GQAA 1N7HA 2PGDA 4GWGA 4YYZA 4GVLA 2YV3A 3MJSA 1HDOA 3M2TA 1AHHA 1NPTO 5JC8A 2O3UA 1BGVA 4W9NA 4UAGA 1U3UA 4CLRA 1HDXA 4HADA 2J3KA 3B70A 5G2OA 3O38A 4IMRA 2YHIB 1MC4A 5JCJA 4EUEA 1N7GA 4TVOA 4CQMA 2OFPA 1T2EA 2C7GA 4OO3A 5FWNA 2HJSA 1C0PA 3LQFA 5F5NA 3S1LA 2DT5A 2GGSA 3GF4A 4MVJD 4IJVA 3L77A 4NFHA 5IXSA 2EGHA 2VHWA 2XAAA 1BXGB 1P1RA 3AJRA 4WEQA 1P0CA 5H82A 5T6BA 4Z3KA 5ICSA 9LDTA 4HBGA 3I9MA 1ISHA 4GX5A 5KVQA 3MJCA 1LQUA 4CMBA 4J7XA 5AOVA 3MOGA 5KNLA 5GZ3A 4MVJE 1CF2O 3K96A 2CF6A 4BGUA 1ENZA 4YAEA 4L9RA 4L8VA 1CQIA 1ZXBA 1UUFA 2BLLA 5L7TA 2I3GA 4E5NA 2HMUA 1MV8A 3OEYA 3UXYA 5G0WA 3EW7A 4A27A 1NVMB 3CE6A 2AG8A 3C1AA 4DYDA 3PJEA 3I9LA 2JHFA 5MGBA 4FCCA 1LLQA 3I9JA 5I9MA 4YPOA 1ONOA 1H6BA 3K73O 2HMWA 2TMGA 3WR5A 5C7OO 5A06A 2HKIA 4DIOA 1NFRA 4WCFA 4JQCA 5GMOA 4BMSA 3VTFA 5CEFA 1OFGA 2YFHA 4CQLA 2O4CA 1WDLA 2QZ9A 4E5KA 4HUJA 4JBIA 2G5CA 1EE2A 1YQDA 3A9WA 5JY1A 4IQ8A 2X8LA 1NFFA 3JQFC 3PGXA 2BFPA 1Q0HA 4PLCA 4YJDA 3IP3A 4LCJA 1HDRA 2EHDA 3GMSA 4J0EA 4ND2A 4PLZA 4Z0PA 3ZV6A 3W8FA 3OEWA 5BNFA 1M6WA 1U8FO 4M87A 1Z45A 5A03A 4BVAA 2QYTA 3JTMA 5KJEA 2PKQO 3JD4A 1Y1PA 3QVWA 1EVIA 3GH3A 4R9SA 3FF4A 2YQ4A 1NPDA 1YL6A 3OIGA 3PYXA 2YHIA 1ZO8A 4YAIA 3WQQA 4DGSA 1E6UA 2E82A 1LRKA 3G17A 3EMKA 4UULA 2EJWA 4ILKA 1NQ5A 4B4OA 3OP4A 1PS0A 1KVQA 1P1JA 5JPIA 4DREA 5THQA 4LRSB 3KOUA 2UVDA 3VH3A 3RU7A 4PLPA 2FSSA 3F46A 1LU9A 3NTQA 2DVMA 2X86A 4TRNA 1IY8A 2NSDA 1BXGA 4Q3AA 4ND3A 2VQ3A 1VPDA 1DO8A 3ZGYA 3GVCA 4BNUA 5JY6A 4XR4A 3V8BA 3ROKA 4J9VA 4D0RA 3U4IA 4BNFA 5CDUA 1NTOA 2B0JA 1OMOA 1W0CA 2VOEA 4B7XA 1XGKA 3T7CA 1UZNA 3TZHA 2JAHA 1YWGO 5JAMA 5DP2A 4DA9A 3B1FA 5C7LO 1JVSA 3EDMA 4MIEA 3SBOA 2AE2A 1DHRA 3NRCA 4ZQBA 3RWBA 2FR0A 5CDGA 1R0KA 4D43A 1H2HA 3HFGA 1PQPA 1E1KA 1TI7A 3ANLA 3JQ6A 3QWHA 4JJGA 5TLSA 1PGJA 2YV2A 1HLPA 5JMPA 2JCXA 5JO9A 2EWMA 4BNVA 3OF2A 3GFGA 3V2HA 4FPXA 3ZCXA 4R01A 1G0NA 3KRTA 3SLKA 1C0LA 1KY5A 1E7YA 2VWHA 2OXIA 1BSVA 2HUNA 2P4QA 5HS4A 1DIGA 1GV0A 2OO5A 2RHRA 4CMJA 3FI9A 5DNAA 3JQ9A 3JD2A 3DONA 3RUAA 1QYCA 3O26A 1MC5A 5IN4A 2FOIA 3FBTA 4MVJH 1ZZEA 3ZWMA 5AXDA 3O4RA 1EUCA 3OIDA 4IDBA 2ZK7A 4AJLA 3ZWVA 1MFPA 5JO0A 4CM4B 3FPLA 2GZ2A 3I23A 1B3BA 2X5JO 1GCOA 5IF3A 2Q2QA 2E49A 3AOEA 4L0QA 4PLTA 3GOHA 3Q2IA 3RBZA 1E1NA 1YL7A 1TB4A 2B37A 3KV3O 1VM6A 1XQ6A 5ILGA 3DHEA 4YRAA 1GYRA 1MGOA 3RFVA 1TT5B 3PWSA 4OXYA 1PL7A 2VUSA 4KUEA 4BS9A 5EPOA 1KY4A 4Y6PA 4DQUA 2O7QA 3HG7A 4ZQGA 3M1LA 1ZIDA 1Q7CA 1SZJG 2JJYA 3H5NA 3OA0A 3WMXA 1B8UA 4BO2A 1SC6A 2FRDA 4QFCA 3ZZNA 3AM3A 1E3LA 2E4AA 1IPEA 3W6ZA 1FJHA 3LDHA 1D1SA 4OH1A 3ROQA 3TFQA 2BGKA 2A4KA 3L4BA 4D46A 4GWKA 5TRTA 3ICPA 1NVGA 3OICA 3MWEB 5TJ9A 5JLAA 3RUHA 1BDMA 3GDFA 4GKVA 4HFMA 3G49A 3WWZA 1PEDA 4AVYA 1Y5MA 3JYQA 4U0KA 1YOVA 3NDRA 4FIZA 1OOEA 2Q50A 3BHMA 1DC4A 2HCTA 1UDAA 3ITKA 4BMNA 1HYGA 5CDYA 2X4GA 2B69A 3D3WB 1NHGA 2JCVA 2O3JA 2ZB8A 4XKJA 2POQX 5U9CA 5I9NA 2AQ8A 2FZWA 4IGFA 4EGFA 3ETEA 6ADHA 1DHTA 1MXFA 3MZ0A 3QWBA 4Y6RA 4OMUA 3RSHA 4KUGA 2W2LD 3DL2A 3ONDA 4XDYA 5G0VA 3ZW9A 1X1EA 4CM4A 1XELA 3TZCA 4ALNA 5ICMA 2C2XA 1EBUA 3INGA 2D1YA 3ORFA 3ZWXA 1DJQA 4WLOA 1O94A 2EV9A 4FC6A 3TSCA 1BHSA 3Q1LA 5CP8A 1HSZA 3UAGA 3FNGA 1YQXA 3D4NA 3H3FA 3VVBA 4EJ0A 2CVQA 3PFFA 1F14A 1QKIA 3JYOA 1BVRA 3IQDB 1TT5A 5LC1A 1ZVMA 4YJGB 3X2EA 1RM4A 1A4IA 1R4MB 3IIEA 1KVUA 2BFAA 2P9GA 4KZPA 1MB4A 4XYMA 5TC4A 4L74A 4W7HA 4B4UA 3DAFA 1JKIA 4GBJA 4J7CA 4B3HA 3GFBA 4UEOA 5IZCA 2VYVA 3GNQA 1GCUA 2O50A 5DOVA 5L9AA 1CETA 3E6AA 4W4TA 4CV1A 2OP0A 1YE3A 4ALJA 4YA6A 1ZNQO 1SOWA 5F5LA 3SC6A 3KM0A 4R1UA 3COSA 3CPSA 5MDHA 1JLLA 3AFMA 3H2SA 5KCZA 2P2SA 1Y7TA 1ZK2A 3DZJA 1DRUA 3WGZA 2J8ZA 2X22A 4FJ0A 3P2OA 3K2EA 4IXWA 4EUFA 1EDZA 4FFMA 1OZAA 3K92A 1JWBB 4MVJF 2VT2A 3D3WA 2J5RA 4BHTA 4ZU3A 2Y93A 3JD1A 3CTMA 4OAQA 5THKA 1ISMA 2VHZA 3KB6A 3QV1A 4IQ0A 1P1FA 1PIWA 4MPDA 4Y9DA 2OMEA 1NASA 4XYBA 2GN9A 4CMIB 4E31A 4WLNA 1PJCA 4YTEA 3PIIA 4TRMA 4A0SA 3UCFA 1PGQA 3CEAA 7MDHA 4IJUA 4IMPA 5CG2A 3OHSX 5B12A 2J5KA 4EITA 2X9NA 1GPJA 3EHEA 4IDGA 3F3SA 3RU9A 4ITUA 2P9EA 1A72A 4YAJA 1U2GA 4YEDA 5IZ4A 5A3VA 4YJGA 1U3TA 2C20A 1O0SA 2Z1NA 2H63A 2C29D 4WEOA 4N5NA 3WGIA 3ENKA 1LNQA 3TZQA 5C5IA 3ZI0A 4DC0A 4X54A 1V35A 2UYYA 4RV9A 3C85A 1QYWA 4CM3A 1DIAA 1BTOA 4WE3A 3ZWWA 2AG5A 2NQTA 2P5YA 4H15A 5CEJA 1JAYA 1U3WA 1W73A 5ES3A 5CEEA 1P44A 5CPFA 3JD0A 1NBOA 3DAGA 4IZIA 2Y99A 1M67A 2EKQA 1ZSYA 3MJ4A 3PYMA 1QV6A 3CSDA 3I3OA 4JJFA 5DOZA 3VZPA 4E21A 3M1AA 4C7KA 4EW6A 4ZRMA 5ITWA 1T1RA 2DPHA 2Y05A 4XYLA 4EZBA 5DCWA 1PGOA 3FWNA 3RUCA 1UXHA 2PLAA 3EYWA 1J6UA 2BGLA 4W99A 3WIEA 1VJ1A 3ZU3A 1DLIA 3GDOA 5K9ZA 4Y67A 5EERA 5BSEA 2FPPA 2OL4A 4YT2A 1M75A 2FP4A 3ZHBA 1LDNA 3KYCB 1PJ2A 1VL6A 1A27A 1WPQA 1HWYA 2Q1SA 3A1NA 4ND4A 1L7DA 2FR1A 2WD8A 2C07A 1OC4A 3LLSA 4XEHA 1GADO 4O0LA 5A05A 2X5KO 4NJMB 1Q7GA 1EK6A 4QX6A 1JDJA 3WBBA 2H6EA 4NBVA 1Q2XA 2IRWA 2BD0A 1RWBA 3ZWYA 3D3EA 1E92A 3F1LA 3RBXA 2X0JA 2PK3A 2CDCA 1V9LA 3CMMA 2ET6A 4GSKA 3H65A 3FNEA 1XR3A 5B4UA 4HP8A 3TWOA 2G82A 1KERA 2OGUA 2FSVA 1LI4A 3K5PA 4R1SA 4D79A 1BWSA 1ZK0A 2Q1TA 1NQAO 1BW9A 2FN7A 2EW8A 1HYEA 4PVDA 4LCEA 1XA0A 4DIFA 2W98A 4WLFA 1AE1A 1LQTA 2VWQA 3KETA 4RPGA 3GMDA 1BXKA 5BNTA 1WMAA 4CV3A 1ONPA 2YW9A 3VPFA 5JCJD 1JWAB 5EIOA 4CQMD 1BG6A 2AEFA 1Z7BA 4OXNA 5JE8A 4MVJI 3RJ5A 1F06A 1AN9A 5IN5A 1WZEA 4R51A 4RVSA 4DTIA 1N9GA 2Y1GA 4E3ZA 1V0JA 3U4HA 2B4RO 2HQ1A 3KYCA 1VSUA 3HADA 4PLHA 4OQYA 3PFWO 1H9BA 4IY1A 3W8DA 2J3IA 2WYVA 2XXJA 4DLBA 2AQHA 2R00A 1PJ4A 2FZEA 4TKMA 5FFFA 3RKRA 2I99A 1FDUA 3E9NA 4NG5A 1UP4A 2EERA 3VPHA 2V65A 3KLMX 1O8CA 3TFOA 2CDAA 3Q0EA 1IHYA 3ZNPA 4CMAA 1EVJA 3PPIA 4NJMA 4BGEA 4YRBA 3F1KA 1EUZA 2C5EA 2FMUA 2NADA 1NM5A 3NJ4A 1N5DA 1DIBA 1K89A 3INTA 1O95A 3MEQA 4FB5A 3SVTA 1JVBA 4PCVA 3TQHA 4R1NA 1SOVA 5GY7A 3WIDA 3W6UA 2UUPA 4G65A 4CM9A 5BNIA 1YL5A 4UUMA 2VCYA 3I83A 3F4BA 2ZYAA 3JQDA 4CODB 2GN8A 1T4DA 3PIDA 4B4VA 4CLXA 3H8VA 4OXKA 1FDTA 4Q9NA 4BQPA 2OUIA 2FPIA 4OKIA 2Y0EA 2DBZA 3OFSA 4RZIA 5A9RA 4B8ZA 5HS6A 1HE3A 3V2UA 4Q3CA 4RORA 3MCVA 2NU8A 2H5LA 3UW3A 4KP7A 4WJZA 4BNTA 3RD5A 1HE2A 1GUYA 1ZCJA 3IC5A 5A9TA 4I9NA 3ON5A 1UP7A 4J49A 3QY9A 1KYQA 1JAXA 3ABIA 4QFDA 3SJUA 4H3VA 3IJPA 2HRZA 1SMKA 4YVFA 1GZ4A 3DTTA 5KIAA 4J4BA 2EKPA 3H7AA 2WE8A 1RPNA 4E4YA 3P2YA 4DL9A 1R6DA 5FI5A 3WNVA 4WLEA 2HMSA 4YAGA 4IQGA 5KJ6A 1IB6A 1NWCA 4OSOA 2OORA 2D3TA 1GEEA 2Q1UA 3PZBA 4EJ6A 1PWZA 1ZXLA 5L7WA 3FR7A 2O23A 2ZTLA 4BOYA 2VZ0A 4EEXA 1WWKA 4PG5A 4KQXA 3TL2A 2GRAA 3MWDB 3PHGA 4YJHB 5TQVA 1CRWG 1Z73A 1XHLA 3TJRA 1QYXA 4A5OA 3ZWBA 1U4SA 4CMGA 1HETA 2YDYA 1C0KA 4K6FA 3V2GA 1J0XO 4XGKA 1LDMA 4MP8A 2DBQA 3N7UA 4IBOA 1NPYA 3QWFA 1PR9A 4RJTA 1MG0A 1BVUA 4ZJUA 3DB2A 3JQ7B 2CMDA 4XWYA 3BTOA 4N5MA 3K31A 4CMEC 3F6YA 3C7AA 4CQLB 1QLJA 4PZEA 3NJ8A 1VC2A 4R41A 3V1TC 4IS3A 3WGTA 4YR9A 3UVEA 4MOWA 2YJZA 3GK3A 4GGOA 3DMTC 3FBGA 4QUKA 2B5VA 2ZYDA 1E3SA 4H7PA 2D0IA 3GGPA 3LF1A 3QIVA 4Q3DA 4GGPA 4URFA 4FSHA 2NTNA 4RF2A 4NBTA 3TRIA 1MX3A 1Y81A 2Y0CA 2X6TA 4N7RA 1F8GA 4E2ZA 4NK4A 4YQYA 3RIHA 3CKYA 4LRTB 1MLDA 4GX0A 3U3XA 1DFGA 4IDAA 1A9YA 4EEZA 4E12A 7ADHA 4L73A 1NHWA 2Y68A 4M1QA 4DQXA 3P7MA 1SEPA 2PV7A 4WUVA 3I1JA 4JBHA 1I30A 4CLDA 1G0OA 1E3IA 4RO0A 1YQGA 4P22A 3GN2A 2VTEA 4LMRA 1HE4A 4CUJA 3GN1A 3GZNB 1PZEA 1H93A 2GD1O 4M8SA 2GERA 3S2FA 1BDBA 2PH5A 4CMCA 3BTVA 3U62A 1M6HA 3IKTA 3I52A 4FD3A 2O2SA 4YJHA 4BNZA 1CYDA 2PY6A 3INRA 2X0RA 3NTOA 4HFJA 4A26A 5DT9A 4Z9FA 3I4CA 3S2IA 1XCBA 3PP8A 2HU2A 1PR3A 2QQ5A 5IDXA 1BMDA 4ZD6A 5JYEA 3ZWAA 3LT2A 3DOOA 3WDSA 1TLTA 2AXQA 1ZJZA 1KC1A 3JQ7A 3VPXA 1I33A 4RPJA 2WD7B 5JW6A 3LC7O 3VDRA 3OBBA 1VL0A 4OIMA 4DPKA 2RCYA 3GA0A 1YVEI 3SC4A 3PJFA 3WQRA 1PS9A 3WGQA 3WFJA 4RL6A 2J5QA 3QA9A 4UEKA 1SO8A 4I5FA 1ZJYA 3LYLA 5G0UA 4OM8A 1QRRA 3JSAA 4JJIA 3PEFA 1N1GA 4OJNA 4TRJA 1HDZA 2W4QA 4MVJM 4P4GA 4BNWA 1P9LA 1WDKA 2Z95A 4CM7A 1CQJA 4E32A 1IHXA 3V1YA 2HSDA 1GTMA 4YRDA 2XF8A 2PNFA 3GEDA 1YO6A 4GAEA 4IPTA 2GZ1A 1EMDA 4NI5A 3GAZA 1NAIA 1O89A 4QECA 1H0KA 5L4NA 2DTXA 4GL4A 3EZLA 4ALKA 1WDMA 3SJ7A 2ZKLA 4YJFB 4GMGA 3Q3CA 5CDSA 3T4XA 5TGDA 5JCXA 1Y9AA 1ZUD1 1ISFA 4CL8A 1C3VA 5ER6A 3FTPA 3EVTA 3OJOA 3GZNA 4KDFA 3DBRB 3BAZA 3R3SA 4P8RA 1N2SA 2CZCA 4QT0A 4Q39A 1ADFA 1PZGA 3PDUA 1MUUA 3PLRA 1Z82A 3HDQA 3RASA 4IJWA 1I36A 4R16A 3GNSA 5EL0A 4BB5A 4IDFA 3OJ0A 3RKUA 2C2YA 4BNHA 1RM3A 3WYEA 1QG6A 2A94A 2UV8A 4O1MA 2JFHA 2AQIA 5IJZA 4JX8A 2VYVD 2OOSA 3LK7A 1PGPA 3LU1A 3OH8A 3AFNA 1QR6A 3CMCO 3K8ZA 2YY7A 3BA1A 3HNPA 4J16A 1QSGA 1DC3A 2WD7A 4BKUA 3NEPX 4BNMA 5HWSA 1NR1A 4ZA2A 5EQDA 1R0LA 3RAJA 3WLFA 4BKPA 2PZMA 3SEFA 2Y1EA 1G1AA 3IS3A 2DU8A 4AJOA 4NBRA 3AU9A 1YOVB 3SXPA 2RH4A 4MJLA 1VL8A 4FOSA 3ONFA 4YT5A 1M76A 3IP1A 3QLJA 2NU7A 1U1IA 2HRBA 3NGLA 3IKVA 5JFOA 4GI2A 1O6ZA 1M66A 1K6IA 1KS9A 4MKZA 1IULA 1H94A 1GL3A 4DLAA 1JKJA 2NWQA 4RF5A 1WVGA 5G4LA 4R3WA 4JP3A 3TL3A 3VPGA 1Y8RB 4XGNA 4E33A 3B6ZA 4YJFA 1RYDA 4DVJA 3ZW8A 5JSFA 2ZJ0A 4J0FA 3AUUA 2PFGA 3JQGB 4PG8A 3CUKA 3PQEA 3DBRA 3PWKA 4NHEA 3R0IA 4BNKA 2Y1OA 2Q4EA 3WJ7A 1LA2A 4EDFA 3QWIA 5T57A 5B4TA 5TT1A 1QP8A 3JQFA 4HXYA 5KTKA 3TNLA 3UCEA 3GGOA 4II2A 4CMHA 4CLHA 3DBLB 3GUCA 4BV8A 2AEMA 5K6AC 3NGXA 4OL9A 5F1OA 2D5CA 1JU9A 4S3MA 1XU9A 3DXFA 4WLUA 1YDEA 4PIVA 1ZW1A 3DDNA 2GO1A 1EVZA 2XXBA 4IUYA 4DXHA 2B35A 4BO8A 2IZ0A 1P0FA 2XPCA 2DTEA 1EVYA 1AXGA 3EGOA 1PL8A 2B4QA 2EEZA 2X0IA 1WNTA 2QX7A 4CM6A 4WGGA 3DMYA 3PQDA 4XGIA 2O3QA 3JQBC 5KKCA 4UUPA 5AVOA 5L4LA 3FN4A 3NDIA 1LSOA 2PD6A 3E18A 3JV7A 3GVHA 3VAZA 4BIIA 4DIBA 1UZMA 2RHCA 2P91A 5T8KA 3D7LA 3ST7A 2C82A 4U5QA 4TQGA 3IMFA 4BKQA 1K2WA 2GPTA 4Q3NA 1VE9A 2HO5A 4JNKA 2NVUB 2FWMX 3IUSA 3ZHZA 2IYPA 4RPHA 4KTTE 4R9RA 3WICA 3GC6A 3HN7A 4XYEA 3UGKA 1QXSA 2BGMA 2RBEA 4Y8VA 3G1TA 2PD3A 3Q2KA 5DZSA 3WTCA 4DBZA 4O63O 5JDCC 1Y8RA 4MKRA 3VTZA 1E3EA 3VDQA 5G0TA 4Z9XA 1DPGA 5KVSA 4G81A 1W6UA 4NMHA 1R12A 2X9VA 3RROA 2PR2A 2VOJA 1ORRA 5I8WA 4NJOA 3JQGA 3WNQA 3ZV5A 1R0SA 4XIJA 3RQSA 4IINA 3DZIA 2AQKA 2WSBA 5FF9A 4DPMA 3NYWA 3H9GA 3JYLA 4DQVA 4Z6KA 3K30A 4Q3BA 4QO7A 1P74A 3DBLA 4DUPA 4BL5A 2PTGA 3F5SA 1HKUA 5KKAA 3RFXA 3AUSA 3GLQA 5A02A 4KMSA 3NT4A 3VHRA 2GLXA 4JGBA 1FK8A 1E77A 2V7PA 3N58A 4GLOA 1UAGA 1LBEA 4FGWA 1GUFA 4TZKA 3KEOA 5A9SB 2QRKA 4HFRA 3KBOA 4B3IA 4BGIA 8ADHA 2Q2VA 4FGSA 5I7EA 4YACA 4XDZA 5DULA 5A04A 4FFPA 3TOZA 1ADGA 1KC3A 1LDEA 4S1VA 2ZB7A 2FR8A 4M55A 1YJ8A 1I2ZA 1S7CA 5IDWA 3S8MA 3O03A 2VRCA 1UP6A 2DUUA 3R1IA 4IIVA 5IDQA 1TEHA 5TSDA 1J4AA 3LT1A 2JAPA 5HRUA 5I7VA 2NVUA 1PJLA 1E5LA 4F6LA 4FFNA 3U0BA 1B8VA 2EGGA 5ITVA 2W2KB 2NM0A 3H9JA 1U2DA 2B5WA 5KOIA 2EF1A 4XR9A 5FI3A 5F3RA 3OA2A 2GUGA 1HL3A 3QVXA 1JN0A 4JXKA 4OOFA 2AEJA 2ZYGA 2OBYA 3GNTA 1Y6JA 3K9QO 1KOLA 1UJMA 2BRUA 2CUKA 1B15A 1FMCA 4YB8A 3VZSA 2VWGA 4D44A 1HDGO 2SCUA 4BNLA 3VH2A 5C7IO 1B14A 2BKAA 3ANNA 4R4JA 5I8ZA 4BO0A 1T1SA 1UXKA 4RPLA 4CV2A 1HLDA 2G0TA 2Q45A 4TRRA 4YAKA 2PKRA 1DSSG 1RYEA 1PSDA 1HSOA 3BMOA 4GH5A 3H5AA 1X15A 9LDBA 1EUDA 1RM0A 1LRJA 4WCDA 1K5HA 1J49A 2YQ5A 2WYWA 5GZ6A 2DUWA 4XB2A 4CM9D 4PGFA 3H6KA 2DKNA 5A4DA 1AHIA 3KYDA 2O2YA 2VYNA 3PJGA 5JBIA 1XDWA 5AXBA 5L95A 2EP5A 1T25A 2EJVA 3NUGA 2O4UX 1YXMA 4OSPA 3L07A 1V8BA 3ZHXA 5A9SA 4D3DA 4I8XA 1MG5A 4P4NA 1P1IA 3FCOA 4WPGA 4FW8A 1I3KA 4PG4A 5JAQA 3B1JA 5BT9A 4AL4A 1BW9B 5LDHA 4CR8A 5TX7A 1GFSA 2WJPA 5COQA 3QP9A 2GYYA 4J3FA 4E5YA 3BTSA 2RIRA 2Q3EA 1ENPA 4D45A 3BMCB 2W8ZA 4UVHA 2OP1A 3ZWNA 1D8AA 3HJAA 1UXJA 4XA8A 1AXEA 5U1PA 2Y0DA 1IE3A 1N9GB 2W2KA 4MKXA 4N5LA 1QLHA 5TNXA 5KJCA 2BMAA 2O3RA 1VJTA 4BO9A 3WGYA 4KOAA 4O5OA 4Z3DA 4A03A 1U3VA 4II3A 2NNLD 1VI2A 1GQYA 3C24A 3GRKA 1ENOA 1ZK3A 1YJQA 3QHAA 4MIOA 1LSJA 1X13A 5TJHA 3VPSA 4PLGA 4NZ9A 2PD4A 4B8WA 1A71A 3V5NA 3R3JA 3GEGA 5CG1A 1EZ4A 5G4KB 1B26A 4DMMA 2ZATA 3PWZA 4G2NA 3GG2A 2I3AA 5JAIA 3B20A 3KLPX 3QRWA 2FY8A 1KEVA 1YH3A 1ZSNA 1DBVO 3IAHA 1I8TA 3WGHA 4AJ4A 3GPIA 3OJEA 2GDZA 2I6TA 2QRLA 1YRLA 3ETDA 4XB1A 5FEUA 4ALMA 1E1LA 3AY3A 1KEPA 4YWJA 1P1HA 4Y6SA 1NQOA 4LW8A 2ZCUA 3WBFA 1LX6A 2R2GA 2Q2WA 3CZRA 5KVCA 3ZU5A 3CIFA 2OBNA 3MJTA 1T4BA 1LEHA 1WXDA 3JQAB 1CIVA 3DC2A 4XRRA 1LRLA 3PJDA 2DLDA 1GV1A 4RPKA 3AUAA 2BH9A 3L6DA 2V6BA 3KYBA 1V3VA 4QSMA 1L1FA 1AGNA 4AJHA 4J90A 3F5QA 3KTDA 1VJ0A 4RVGA 5DBGA 3HDHA 1E7MA 3LZ6A 2Y1FA 1A9ZA 1ISGA 2R6JA 3ZNNA 1EQ2A 2VN8A 2H9IA 2RAFA 4Z9YA 5B37A 1DJNA 1ARZA 5IG2A 1YBAA 4BO1A 2EXXA 1ID1A 1F17A 3BMCA 4J9UE 4J6FA 2GF2A 1R15A 1EDOA 3C1OA 2DPGA 3BTUA 4BO5A 1DDOA 3A28A 3FNFA 2CSUA 1QORA 3DWFA 5DP1A 2GR9A 2JHGA 2FPGA 4ALIA 5JDIC 1A5ZA 2NLOA 3D5QA 4M49A 3PYLA 2WEKA 2NU6A 4IDEA 3E03A 4R5HA 5EINA 4BO7A 1PZFA 1C1XB 3P19A 3KO8A 4P38A 4MVJP 3UUWA 5G4KA 3DHNA 2Z5LA 1PL6A 4AICA 2IEBA 4LMPA 3ZV4A 2JFFA 1NNUA 3HHPA 1HF3A 3S2GA 4WOJA 4MDHA 5DBIA 3O8QB 4XQCA 1GZ3A 3ZWCA 4XCVA 2VT3A 1WZIA 1UR5A 1XSEA 4K6CA 4O59O 3NKLA 1LLDA 1X7DA 1I3NA 1EFKA 2A9FA 3S55A 1F8FA 3AY7A 4DC1A 3WG9A 1RKXA 3JQAA 4RVDA 1PQWA 4CR7A 2I76A 4W9NC 5HM8A 4WK6A 4BKRA 2WTBA 2DM6A 1DXYA 3DZGA 1GZ6A 3LT4A 1F12A 3K2BA 4PG6A 2VWPA 1LC3A 4ESOA 6LDHA 1CDOA 3HSKA 3E9MA 2NV6A 3ZN2A 1SEVA 3LVFO 1UDCA 3KEQA 1ADBA 5ENDA 3FWZA 4E0BA 2JD2A 3UFXA 1HEUA 1ZSVA 1ENYA 3ZWOA 2HK8A 3GPDG 1U4OA 5KJFA 5BR7A 3C7CB 4JCOA 2GN4A 2YZ7A 5B1YA 1IYZA 1VKOA 4KTVE 4PLYA 3IL2A 2PZLA 4K28A 4P4LA 4FFRA 3RFTA 1FDVA 1GUZA 2UAGA 3MOIA 2IE0A 3RC1A 1DFHA 4PZDA 3PHJA 1MP0A 3ROMA 4OYRA 4HNHA 4MP3A 1LDBA 4CJXA 1NR7A 3GQVA 1PQUA 2NQ8A 3WX0A 1HDCA 5COBA 3RUIA 4NK5A 1C1XA 4WCFC 1LTHR 3EUWA 3O9ZA 2H1SA 2O48X 2PGLA 3OIFA 4CM8B 4EI2A 3CXRA 2UDPA 4JK3A 4ONEA 1H6DA 1PGNA 4WASA 1HDYA 4XD2A 1YBVA 1DAPA 3QVSA 5H83A 4YBZA 1E3WB 2BI8A 4NFYA 4AJEA 4BO3A 3O8QA 4PLFA 3ETGA 1P1KA 4U6QA 4GKBA 3HWRA 3DZHA 2B83A 4IXTA 3I9OA 3EVNA 4QTZA 3WOHA 1ULUA 4PRLA 1ULSA 2C0CA 5EJ2A 4FFOA 3G3EA 4F6CA 5C37A 4N54A 3WTBA 3ASUA 3F4LA 4J1SA 4RDIA 1Y8QB 2I66A 3G79A 4L4XA 3ZNOA 4AG3A 4J7UA 4J2HA 2G1UA 4GPD1 2NUAA 1ADCA 2DTDA 4ROSA 3DZKA 1I0ZA 2E48A 2Y1CA 1IPFA 3RUEA 2PKQP 3NX4A 2JCYA 4AJ2A 1PU2A 4U8GA 2C5AA 4YXFA 1SBYA 2E37A 1I10A 4A7PA 5FYDA 1E7SA 1I2BA 2VNSA 3RI3A 3W4IA 3GVXA 1YDWA 1J5PA 4H16A 3VKUA 3D1LA 1O9BA 1R4NB 3PVZA 3UCXA 1WMBA 2I5PO 4FC7A 1I3MA 3DHYA 4NFSA 1R16A 4Z0HO 1ISJA 5B4VA 3GAFA 3L9WA 4A10A 3PRJA 4WNCA 2BF7A 1H9AA 4RF3A 1MXHA 4QXMA 3JQ8A 4XIYA 3I9NA 4CM8A 1X0XA 2D59A 5AXAA 4NDNE 3U9LA 4D3SA 2IDZA 2WYUA 3VVCA 3QVOA 3S2EA 3PDJA 3UF0A 1E3WA 4OOEA 3AY6A 5DDIP 3WQSB 4A73A 2IXAA 3W4KA 2DBVO 5IAAA 2PZJA 1PJTA 1I3LA 3AI2A 3DQPA 3OQ6A 2BFOA 3Q11A 1SB9A 1D3AA 4CUZA 4BO6A 1ZK1A 1WAMA 2X9GA 2O3SA 3JQ9C 3W1VA 2Q46A 5T64A 2AE1A 4XJSA 3TZKA 4RF4A 4B79A 4CR6A 3DFUA 1UXGA 4PN3A 1HT0A 1Y8QA 1FDSA 2QYSA 4XYGA 2NTVA 3DO5A 1EBFA 4HFNA 4WKGA 1PS8A 4W82A 5F1PA 3EY4A 5LDGA 3K6JA 5JXWA 2JL1A 1I32A 3RVDA 2YFQA 1KVTA 3AOEC 4HWKA 4KDEA 3SLGA 2DBRA 1F0YA 1NWHA 4MVJG 3BHIA 3LT0A 3IOYA 1A7AA 3KUXA 2VUUA 3QQPA 4K26A 4LSWA 4L76A 3LC2O 1CJCA 1Q7BA 1LDYA 1EEHA 2YYYA 1U9JA 5IDYA 2VNAA 2YDXA 1XU7A 1OC2A 3KHUA 4PLWA 1D1TA 1QYDA 4PVCA 5T67A 4IZHA 5L45A 3OETA 4CMEA 3ICCA 1R4NA 3GZ4A 4JLWA 1CWUA 2AMFA 2VHXA 1UAYA 2BELA 2DAPA 2RH8A 3FPCA 3RC9A 3F47A 4E2XA 1ZMTA 2VHYA 5I9LA 2BFMA 1R66A 1B2LA 3DMTA 2G76A 3WLEA 1PJSA 1DOHA 4BNYA 4NQZA 2AW5A 4IJKA 2ZCVA 4NPCA 3GT0A 5CPBA 3L4BC 3RBVA 4DMLA 3I5MA 4ZGWA 1M2WA 1U28A 3KVOA 4TVBA 1LSUA 4PG7A 3PHLA 2A35A 4UVGA 1IZ0A 1YS4A 4IGEA 1DC5A 2FHSA 2TMDA 4FS3A 2Q4BA 4K9DA 5T8KC 4XX0A 1ZBQA 4UREA 3CH6A 4E13A 1T2DA 1B0AA 4XQEA 4XQGA 1PZHA 3KXDA 1H6CA 3SX2A 2EP7A 2QW8A 4BGVA 3M2PA 1Y9EA 3AK4A 3EZYA 5DF1A 2VRCD 4XQ9A 3ONEA 4LISA 3AM5A 1C1DB 3ZH2A 4JP2A 3E9QA 3UN1A 4M89A 1EE9A 3GEMA 3WJAA 2QIOA 1VLLA 2P4HX 5A5EA 4BNGA 3GVIA 4L4RA 2HMVA 3AUTA 4JN6B 5DN9A 4BNNA 4DBVO 5DBFA 4C7JA 2B36A 1VSVA 3AM4A 5TF4A 3HB5X 3D0OA 4HKTA 3T4EA 2CVOA 1GQ2A 1LXCA 2J3JA 4RZHA 2CVZA 3AU8A 2CFCA 5L3ZA 1GU7A 1YONA 2ZJ1A 1YB5A 3D5TA 1DEHA 4WLVA 3OECA 2GASA 2HLPA 3ADPA 1SNYA 1JQBA 1W8DA 3TZ6A 3C7DB 4LK3A 1P45A 1XYGA 2B4TO 4MP6A 5IZCC 1WP4A 4RLHA 1DIRA 1I01A 3H2ZA 4U0JA 3U5TA 4BQRA 4EUHA 3H9UA 4ZVVA 2Q99A 1T26A 1P31A 3DEYX 4BV9A 2IEDA 2ZB4A 1FDWA 2VYND 2GN6A 2Y1DA 2Z1MA 1GY8A 3TN7A 2IYOA 4J4TA 3GRPA 5L4SA 4RQUA 1WLYA 3E5RA 3BHJA 3C1TA 5EN4A 1GEGA 4MVJA 1X7HA 4O6VA 2IZ1A 3VH4A 1H2BA 1XG5A 4CMKA 2CNBA 1LLUA 4C4OA 5JC1A 1LJ8A 2VRBA 2ZQYA 5IFLA 1K3TA 3U4DA 2I9PA 4UUOA 4AJPA 4FDAA 5TS3A 4PFJA 3DZBA 3QSGA 1UH5A 2UUOA 1TXGA 2LDXA 1Y5RA 4Y98A 3AOGA 1BXZA 3AI1A 1Z74A 3GUYA 3HQ4O 3JQEA 5EQFA 3C8MA 1C1DA 4KQWA 4ND1A 3OM9A 2HDHA 2Y67A 3Q9NA 2IODA 4FJ1A 3WGGA 4BO4A 4FFLA 4E2WA 5BSHA 2VZ9A 3E48A 3KSDO 2CD9A 2YV1A 3GVPA 4NU5A 3UH1A 3TOXA 1H6AA 2EW2A 3BYZA 4W6ZA 4U7WA 4E5MA 1Z6ZA 1U5CA 3WXBA 4CM1A 1DFIA 3PHIA 4Q3EA 2VUTA 5JYDA 3R6DA 4TSKA 2YHUA 3TPCA 1KETA 4CV0A 4ZHSA 2JD1A 1S6YA 3OSUA 3Q9UA 3QE3A 3VOSA 1JTVA 3OMLA 1BRMA 1RJWA 1UXIA 5JS6A 1HXHA 5KJ1A 2D4AA 4M86A 5A1TA 4IDDA 1V3TA 5BSGA 3ZU2A 3WFIA 3BMOB 2V6GA 4QO8A 2A92A 4K1LA 4DWVA 5KVVA 1ZK4A 2VTDA 3G1UA 3FNHA 1U5AA 1EQUA 1K6JA 2Q1WA 5F1KA 4DLLA 3P5SA 3I4FA 3KYDB 3TDKA 4MIYA 4I9UA 4FQ8A 3H9EO 1N8KA 1DLJA 5LCXA 4L4SA 3JQCA 4OHUA 2X0NA 4CL3A 3GHHA 2HJRA 1GYQA 3JCZA 3DZFA 3L4SO 3OJLA 4NH4A 4RDHA 3VH1A 1YGYA 3WYCA 2D5AA 4B7UA 3U09A 4GX1A 3DOJA 1PJ3A 3BIOA 4WECA 4AJNA 4BB6A 1Q0QA 5CAEA 4ID9A 1KVRA 4LVCA 3IJRA 4XZ3A 3RJ9A 2C7VA 3WGOA 3DBVO 3V1UA 4EBFA 1GPDG 4I5EA 1GQQA 3E82A 3H3JA 3HDJA 3KSUA 4JROA 2ILTA 4ND5A 2WDZA 1KBZA 1K0UA 2BHLA 3N74A 3WWYA 2NACA 4XRGA 1I5RA 4OGWA 5BSFA 5K6AA 1U7HA 3HN2A 4NBUA 2P68A 5AXCA 2QHXA 5EESA 4FR5A 1XKQA 1E7WA 4BUCA 1SCUA 5JMWA 3B1KA 4I08A 3LLVA 3IUPA 5GZ1A 2P9CA 4AFNA 3PZRA 3QW2A 4NIMA 4BNJA 2X5OA 5L7YA 1XWFA 3H4VA 4D3FA 1E6WA 1GAEO 2OHXA 3ZU4A 4DPLA 1UZLA 1E1MA 3A06A 3H5RA 5U4QA 4ZRNA 2GZ3A 3G0OA 5L53A 3ZDFA 1L7EA 3JQBA 3RC7A 4ZICA 3VZQA 4CUKA 4D42A 5CFZA 1XEAA 3ZWPA 1UDBA 4LGVA 1E5QA 5COAA 4KUHA 3WSWA 4D7AA 5K0ZA 4B4WA 3HFSA 2EIHA 1DC6A 4LN1A 5L51A 4R68A 3LF2A 4L75A 1IUKA 4RVHA 4I1IA 1LSSA 1ZH8A 2NTJA 1N92A 3BMQB 1AUPA 3GDGA 4U6SA 4HY3A 1D7OA 4R54A 4NBWA 2W90A 3JQAD 3WSVA 4FOOA 2PA3A 4E30A 3I9KA 2CDBA 1PTJA 3DAPA 1B8PA 1W4ZA 1HYHA 4Z0TA 4ZN6A 1QYVA 2J3HA 4PLVA 4CM5A 5A5FA 2J6IA 2DQ4A 1U8XX 5JDCA 3CINA 3HB4X 4JBGA 3ITDA 1DB3A 5AQ1A 2VZ8A 5H81A 3ZNQA 2PGJA 4BNXA 1R4MA 1B16A 3HDYA 4D41A 4I5GA 5I7FA 1K6XA 1A4UA 5DCUA 1QV7A 3EC7A 3I6QA 1HRDA 4W7IA 2WWRA 3W8EA 3VKVA 1YB4A 1ZEJA 3E1KA 2NVWA 2PZKA 2R00C 2ZIZA 1TA4A 2F00A 4TKLA 4QQRA 3ENNA 4IDCA 3W4JA 3WMWA 1T2CA 2Y66A 3QWAA 4KWIA 3UICA 3ASVA 3PI7A 3FD8A 1CERA 2GNAA 3FRJA 4PRKA 1KVSA 3ADOA 4GVXA 2LDBA 4AJJA 3MJVA 5DCYA 2XOXA 2PH3A 4UEJA 2PWZA 2HAEA 4TROA 4AJIA 4GLLA 4R5MA 3FHLA 1OBFO 3NT2A 2JFGA 2JD0A 4FN4A 1KEWA 2EKLA 1X1TA 3WS7A 1P33A 3DFZA 1ML3A 1IZ9A 1HE5A 3C3XA 4GSLA 2GCGA 3OQ1A 3OJFA 2O3TA 3FR8A 1B3RA 1XIVA 5J23A 1ZEMA 1V6AA 2F1KA 4AJKA 5C3MA 4D0SA 1Z75A 1HTBA 1YB1A 2AA3A 4ZQEA 4ZQHA 4CMIA 3BMQA 4J43A 3JD3A 3L9XA 3MTGA 1XQ1A 2W2LA 3NTRA 1GYPA 3PGJA 3KZVA 1GD1O 3FSRA 4EJMA 5CDTA 3NV9A 1DIHA 1P77A 4RQTA 2CY0A 4MINA 1PJQA 2ZTUA 4J91A 4BMVA 1SAYA 3D4PA 4RCVA 4BKOA 4KWHA 4TMFA 4HNGA 5ADHA 3A4VA 4DYVA 4AJ1A 4J4HA 4EYEA 1I2CA 3ZHYA 4YDRA 1E3JA 4QEDA 3PXXA 1PX0A 3BMNB 3NT5A 3WB9A 3RC2A 1C0IA 4HV4A 2IZZA 3UKOA 1KIFA 1YBMA 4UUNA 1VRWA 2X23A 3GY0A 3RUDA 1FF9A 4F3YA 1B7GO 1Q0LA 1DAOA 4GMFA 2E6UX 5BQFA 4XJTA 5F21A 4FBGA 3L6OO 3LSYA 1FXSA 1NVTA 1OAAA 2WM3A 4ALLA 2X1HA 1SPXA 1V3UA 3PLNA 1C14A 3AI3A 3VC7A 3L0DA 3UOGA 2D2IA 5JNLA 4I5DA 4R1TA 5ENVA 3GGGA 2G17A 2ZTMA 5HTOA 4YCAA 2P5UA 3EAGA 4MO2A 2O7SA 4NNJA 1DRVA 4J2OA 5EMHA 3F9IA 5A3JA 1T2FA 5CHEA 3MTJA 1LUAA 4B3JA 1N1EA 4RLSA 1X0VA 1XLTA 4F45A 1T2AA 1HZJA 3BXXA 3QJ5A 4UVEA 1NXQA 2WE7A 3LC1O 3JYNA 1I24A 5HBRA 1MFZA 1P3DA 1ONNA 1ZFNA 4J1NA 4RVUA 2AHRA 3CZMA 3HZZA 4TWRA 3PTZA 1T24A 4LSMA 3U4CA 5ILOA 3ULKA 4E5PA 3EK2A 1IOLA 1EFLA 4NU6A 2I67A 3PHHA 1JKFA 1GR0A 2X7HA 4YT8A 3Q6IA 1NYTA 3NDJA 5TIIA 4F46A 3E8XA 4TZTA 1QMGA 1TVEA 2HMTA 1SB8A 1NP3A 5T5QA 3ZV3A 4FJ2A 3I6IA 3KSZO 3TF5A 1LC0A 2ZB3A 2D8AA 2NVBA 1IL0A 2ZTVA 3BMNA 4J1QA 4M54A 1CEQA 4OKNA 4WNIA 5KWEA 4CLEA 3IDSA 5JAZA 4CLOB 3ANMA 1WW8A 3U49A 3HE3A
chains in the Genus database with same CATH superfamily
3VYWA 4DGQA 1GDHA 5C1OA 5KYNA 1A5AB 3OPNA 2P2ZA 2BT4A 2YMMA 2IXBA 1U7OA 2XADA 5BUCA 1P91A 1PV2A 2CF5A 1NJ2A 1NX6A 1Y4SA 2XEDA 2WU4A 3DTYA 4UHHA 3R7AA 1A7JA 2ZUFA 3MJEA 3N8GA 1IUOA 3KKLA 4KQFA 5EIEA 5CK4A 1U63A 3H6HA 5KO2A 3SAJA 1S2NA 1FNDA 5FXMA 1PT6A 2OWDA 3DZDA 4RESA 2B8WA 4L7VA 4M7OA 1Q15A 2EDAA 2PLRA 1IZ8A 2V58A 1JA9A 2XAUA 2E85A 1CC1S 3V7WA 3CS3A 1D6JA 2NO6A 2XODA 2CCKA 5HA5A 1TZKA 2P2DA 3ZQ6A 3HR8A 2C5FA 4R8VA 3FMIA 5D7BA 5AMXA 2OCIA 3MGBA 3N9IA 5TT0A 3FOEC 3U7FB 3L6EA 1CJBA 2C54A 2LXNA 3CW9A 2RJ3A 4HXFB 3GLHB 4IDNA 4ZYZA 2ZM5A 2JCGA 5J4YA 1YI8A 2RGEA 1PWXA 1NC1A 2DC1A 4HDRA 4MB2A 3TIIA 5AYVA 3H5WA 4A0HA 5A4MS 4FQ5A 3AWIA 1I6KA 3A4LA 1CU1A 4D6XA 2HF2A 1Z33A 4TTVA 2XE4A 2IHUA 4PPNA 1E3DA 2F43A 3QVVA 3H11A 4I50B 4C04A 3VSDA 1QDLB 2ORIA 2OZVA 3PFCA 4BWFB 1C2TA 5L40A 4K0RA 4N7JA 5ITSA 1O5IA 3ONNA 1YBHA 1W0KD 4Y9TA 1LVHA 3ZHOA 2WWTA 4NDAA 3M4JA 3C6YA 4OGLA 3ZHTA 1VMAA 5CM2Z 1PJBA 3RS3A 1RBZA 2XMRA 3SS7X 3GQBA 2PFSA 3BCUA 1RJ9A 4M0LA 3D64A 3DR3A 5EP4A 4URXR 2FJPA 1ZOLA 2HSGA 1F6WA 3UHAA 1U0FA 4EHBA 2EWVA 5LD2C 2ZDHA 3NANA 4JD5A 1JSZA 1ZM7A 3QVTA 3L1VA 3RVLA 1IN8A 4CPDA 4HQNA 1IG3A 1E7QA 4N18A 4F56A 4WKCA 2Q49A 4HH4A 3KUUA 1EK5A 2ECQA 3BZUA 3OY7A 3BS4A 4G5HA 3QXSA 4GP7A 4LQDA 3EF0A 3DSRA 3PUVA 2OE2A 3GDWA 1GN9A 2VHEA 2I4RA 3HM2A 1K7SN 3G2IA 4J1TA 3WHIA 2AZMA 3NUZA 4QXAA 2G67A 2G7ZA 1G6KA 3FDFA 3NETA 3OKAA 1ZMOA 4OXXA 5KJ6A 1ZKMA 3NZEA 4GWGA 4YYZA 1VHQA 3FMVA 1NNLA 1PUXA 1V1MB 1Y98A 2PWPA 3C6BA 4L5AA 2JBAB 5HF8A 5HKAA 5ALOA 1K4MA 4JGGA 1NPTO 1IHDA 5JC8A 3F8TA 5FBHA 4W9NA 3DDZX 4C43A 1HDXA 4Y6LA 3CFYA 5J4LA 3WRYC 4EG3A 3EGXB 5G2OA 3O38A 1EVKA 2R1ZA 1MC4A 2X8WA 6REQA 1N7GA 1RI1A 2XQKA 3HDTA 1T2EA 4TVOA 1ETHA 3A27A 4ZT6A 4ZEXA 4IOJA 5AVUA 3C0KA 4OXRA 1TF7A 5DFAA 3HH8A 1UBRS 2DT5A 2ZS7A 3W5BA 1X1CA 3PR3A 4IRXA 2QVYX 3NIBA 5IC4A 5IJ0A 3EA4A 5IXSA 2XAAA 5H82A 1KZGB 2CCGA 4DLWA 4EDHA 3ROFA 3FCUB 3KWFA 1XJ0A 1ISHA 3I9MA 5KVQA 4DV5B 1W34A 2JFBA 4HWSA 5AOVA 5IYZF 3MOGA 4TZ0A 1A95A 1CF2O 3MQFA 4JR1A 4AUEA 1MQSA 1ENZA 1W0JD 4MR7B 5FRDA 4KAFA 1B43A 2DXIA 2FNAA 1D2EA 2XWJI 4E5NA 2FZLA 3OZTA 3OEYA 3UXYA 5G0WA 5IHPA 1YASA 5CCEA 1NVMB 3AVWA 4W63A 4EHNA 1N0VC 2XCQA 4KODA 1RPZA 2QUAA 2YWDA 1S8OA 4O3MA 1SQSA 3FVRA 2HMWA 1DQYA 3DXXA 2PTHA 3NBUA 3OF5A 4P80A 1T36A 3PCXA 1NFRA 4RCZA 3IT1A 3TIGA 1X2EA 1DS6A 4WCFA 4JQCA 3AKDA 2XVMA 1RWOA 1XMJA 1ZM9A 2GNOA 5AOBA 5GMOA 3PTAA 2YFHA 4O4LF 4WNAA 3B7PA 4GNKA 4LG1A 5LQKA 5H68A 4C0SA 1TZ2A 1G7RA 2VRNA 3E23A 4JBIA 1ST2A 1PK9A 4WY2A 3A9WA 3TINA 4D8WA 3T1TA 3KHKA 4IXDA 3N2IA 1HEIA 1NFFA 3VHXB 2BFPA 1Q0HA 4MRAA 5JROA 1FP6A 2AD1A 4JKYA 1TO6A 1XZKA 3AFGA 4BRWA 5GGYA 1R9MA 3D6NB 3LKDA 4QWMA 3K9WA 4A3SA 3T3OA 4E08A 4XDHA 5FADA 1H2EA 2PZ8A 5LXTA 3OEWA 5BNFA 3SVLA 1M6WA 1U8FO 3VQTA 9GPBA 4N76A 3HR7A 1OFUX 5E6RB 3HGTA 2O0HA 4TUYB 5KJEA 2I2WA 4BVAA 2G25A 1QHGA 2XF2A 4LJRA 3KHTA 1LF0A 5BQPA 1SY7A 4F4UA 3GH3A 2EHJA 4HH3C 4R9SA 1YL6A 3FE2A 4MUHA 3PYXA 2PXXA 2FPUA 1ZO8A 2WQZA 1DQRA 4UZSA 3T99A 4C6RA 2PQ2A 3NPMA 1LRKA 4RZ2A 2E5FA 3EMKA 2EJWA 5K51A 4B33A 4CIDA 5HOEA 1X87A 3W3AA 4ZCMA 3CR7A 4I55A 4LRSB 1FFAA 1CUJA 3KOUA 1F5SA 3PDIB 2ZJ3A 2HL6A 3F46A 1LU9A 3HDVA 2ZUEA 2HXSA 3GWGA 3RIXA 5KNBA 2X76A 4DUZB 2ZR7A 1HOXA 3C5WP 1KZHA 1DBRA 1WXXA 1JG3A 3MCTA 1BN7A 3TSWA 3ZGYA 1CBUA 3GVCA 3EIXA 1ZU4A 4ZI3A 3V8BA 1NXVA 5AHWA 1UPBA 3U4IA 5AVVA 4HBZA 3JU3A 4IIHA 5E8RA 2PLFA 1OMOA 3G5UA 3NHPA 5GONF 2VOEA 3ZEIA 1GG8A 1JZQA 2C8LA 3B6IA 1Q14A 3CCBA 3OPYA 1YWGO 5DP2A 5DXJA 3U7IA 3DGFC 5F2NA 1S89A 4URWR 4X8MA 4EO9A 1SUCA 3LQYA 3GBSA 2FPRA 2YXDA 1SK9A 3MJHA 2BGNA 3LUBA 10MHA 1S7GA 5J2UB 2F67A 2VAVA 2CWWA 4N7BA 4F5EA 2J85A 3LP5A 3OTQA 5J2TF 1C4KA 3I39X 4JGIA 3V00A 5CW2A 1X92A 3ND6A 4MV1A 4Q7QA 1R0KA 3GCGA 4M0EA 4D43A 5JEDA 3HFGA 4FDVA 1GU0A 1TI7A 3QWHA 1X74A 4B3CA 1TMGE 2HUPA 4JJGA 3ZVLA 4CKWA 1I7QB 3WAGA 2YV2A 1HLPA 1WBJB 1SHTX 3HXLA 5JMPA 1QF9A 1FVXA 1T1EA 3AEKB 4L4YA 3T9AA 2HH9A 5KPDA 1JECA 5KAMA 1SVOA 1JYFA 4M9UA 1SCDA 5E7QA 4TLEA 3KELA 5LMCA 2R48A 2IBMA 3H5LA 1G0NA 3FHCB 4PE5B 2YYAA 1IM8A 5JPCA 1C0LA 3R3HA 2VWHA 4F9GA 1BSVA 1FVOA 1LGYA 4ZU1X 3QXCA 4ZAZA 1FJGB 5JECA 3O4HA 2GEDA 3FI9A 3C8HA 3LWBA 3JD2A 3DONA 3RUAA 2YWEA 1OR8A 3CZQA 3NHZA 4R9NA 1MC5A 2BGWA 3MS4A 3KAJA 2FOIA 4FFBA 4IWXA 3O4RA 5EMJA 4GLFA 4DJDC 4IDBA 2ZK7A 3ECCA 4AJLA 1USWA 4HAOA 3CM0A 3BRWA 3D6JA 1MFPA 5DHFA 3ZWVA 3CLSC 4OG2A 5JO0A 1MOPA 1JDZA 5EMLA 4X91A 4PIPA 4HLUC 4TYQA 5BW6B 3UK7A 2ZYSA 1KZ1A 2X5JO 4MROA 5IF3A 2ZDGA 4JOQA 5EA2A 5FYQA 3GOHA 3KQWA 4C1BA 2FW6A 1L3IA 4H0CA 2O1SA 3IJEB 3PKIA 4YGYA 2G88A 4XWAA 3OF3A 3KV3O 1XQ6A 3OCXA 4MLZA 4PPFA 5KPJA 1ST3A 1JTEA 4N0EA 2NO9A 3BOSA 3PT5A 1TT5B 4L5CA 1KY4A 2HNAA 1EAMA 2O7QA 1V95A 2YC2C 3FH0A 3GEBA 3CNHA 4DCTA 3CU5A 4DLPA 4YP7A 4G9EA 5F5XA 1Q7CA 1SZJG 4P2BA 3TLYA 3OA0A 3L1UA 1XNJA 4BO2A 4G26A 2UZIR 2EFJA 2HJHA 5K2OA 4I9GA 1E3LA 1EXWA 3IAS6 4YECA 3ZY3A 1IOWA 3UJ7A 4UOQA 3UKJA 5IUNC 2BRUC 1Q0SA 3P2KA 4HAVA 4QQKA 1VE6A 1SU4A 2D5BA 3OOJA 4N47A 5EXDA 4B6OA 4ZK2A 2WILA 2P1ZA 3VC3A 3IE2A 1YJAA 4GWKA 5TRTA 1CS0B 3EXHA 2VJBA 3RE1A 5G41A 1COWA 3I2YX 5AI4A 4GPZA 5EZSA 1KK1A 4POOA 1JLLB 2NW6A 5IAJA 3QOYA 4ZK6A 1EB8A 5AVKA 2J67A 1R0WA 1YOVA 1NW5A 2UZ0A 5AW6A 1NQVA 4V0KA 3AXTA 1KAMA 2Q50A 1IAQA 4BMNA 1NHGA 2V59A 1T0PA 2VNKA 2FQ1A 2R1VA 2DECA 4MKFA 4ZIRA 4C0AC 5B36A 3TECE 3I58A 1N8NA 3IJ5A 4QBTA 4EG1A 4LCBA 3EEYA 1FS5A 1FOEB 4E09A 1G55A 2VCEA 1CIPA 2FZWA 3AV0B 1P39A 1TQ2A 2XMDA 4IGFA 1DHTA 1OH8A 1C7FA 4JYCA 3ZW9A 1DKOA 3DL2A 4KUGA 4ZVSA 2WF7A 2BSQA 3BL5A 4FZVA 4QRHA 3FYUC 1Q0TA 3G0GA 1XELA 4RXTA 1QZZA 4ALNA 1NXSA 1ZGHA 3ORQA 3AIIA 4G1VA 4LTMA 5IKOA 1QF6A 4FC6A 2EV9A 1CR6A 1ECGA 1Q91A 3PRYA 3Q1LA 1AN0A 1HSZA 4ZOLB 3UAGA 1OT3A 4MJXA 2ASVA 3PFFA 1F14A 4CETA 3QHQA 1RP7A 1D4ZA 1T9DA 3JYOA 1QRDA 1Y5IA 3MBKA 4N3CA 1X7WB 1Z7GA 4YP5A 4MVYA 4NOJA 3DM5A 4KR2A 4DDKA 1RM4A 5BWNA 3II6X 4DARA 4DCMA 3N2LA 2BFAA 1T9GR 3QTBA 2ZBGA 4LPSA 5KYWB 1MB4A 4B4UA 2UKDA 4DMCA 4W7HA 4TL8A 1JKIA 4GBJA 3JZFA 3OP1A 5EJ6A 1UOPA 4B3HA 3UJCA 2QL9A 1VRCA 4EGAA 4KQMA 3R24A 1RRCA 4ZVNA 1SR8A 2C4KA 3P9XA 2VYVA 4HN4B 4C4XA 5HIIA 3GNQA 2XW6A 5DOVA 4EHLA 4CV1A 1VL5A 1QH9A 1SUWA 1Z8HA 3TLJA 3KUDA 5F73A 1G3RA 4UNPA 2XUGA 1YE3A 4ALJA 1BHQ1 1WF6A 3IUNA 4H1HA 4YA6A 1P2UA 4DCNA 5J9FA 3SC6A 3MWEA 2AGVA 1IY2A 1YV9A 1GZ5A 3COSA 3CPSA 4FR0A 3HV2A 3TRHA 1XX6A 4F1WA 5MDHA 5AKLA 2VAPA 2QRUA 3DQQA 2P2SA 3LBHA 1EXVA 2EATA 4J0QA 4DR7B 3G9XA 4JJZA 1JA1A 4G4IA 3U0VA 4ZP1A 1XA4A 4DMRA 3EASA 4IOLA 2JLXA 2J3MA 3K2EA 3OCWA 1G8YA 4OREX 4EUFA 1L5YA 4KHZA 1E2EA 1JWBB 2DHCA 2VT2A 2XJ9A 4FS8A 1W2HA 4BHTA 1R6AA 2O2IA 5EHZA 1SIOA 4ARVA 5E2IA 1FZQA 2Y76A 4R3UC 3TTYA 1KI6B 4DBLC 5FPKA 3PIRA 4OAQA 2F8LA 2N1MA 2W6QA 2VHZA 3LUHA 2J7PA 1KHTA 2ZJAA 4GI5A 3R9KA 4ZZ0A 4KE8A 2VJCA 4WI1A 1VL1A 4XYBA 1HFJA 3QA3E 2JI7A 2O1EA 2Q9CA 1M8FA 4YTEA 3KKPA 2ECKA 3CR3C 3L46A 1RYHA 4IJUA 4LRXA 4QYSA 5AVZA 3T1YB 3G02A 1EFCA 1H8EA 4DKXA 5GJWC 1UPUA 2XTJA 5JH7B 3EHEA 1AHNA 1N32B 4G0VA 3S8YA 4IDOA 2J09A 3I2KA 2HHJA 3TI9A 1E99A 4NQRA 1O0SA 3MT0A 2PLWA 2C29D 2WMOB 4N5NA 4WEOA 3WGIA 4GRDA 3ZG6A 3ENKA 1AK1A 5C5IA 2IJGX 1IXKA 4KIWA 1V35A 2YFYA 3WWPA 3C85A 1P75A 1ZNYA 2KLBA 2W83A 4Q7KA 5HDQA 2M6RA 1RC0A 2WOJA 1DIAA 1JR3D 3G8BA 1BTOA 3GLTA 4X85A 3PNMA 4YFYA 1NSTA 3WWOA 3LXUX 2AYYA 5C34B 3W5VA 3PT9A 1M54A 1N8SA 1AB5A 1D6NA 5DHPA 2QX6A 1ZR2A 3R9IA 2ACWA 4ZYXA 3IIIA 1JR3E 2N46A 3GAAA 3S99A 3I92A 5ERXA 4CF4A 1F8XA 4Q82A 3CSDA 3I3OA 3A26A 3M1AA 4C7KA 1HM5A 4UC0A 1T1RA 2DPHA 4HQOA 4JHXA 4GKAA 1V39A 5EIXA 3OUTA 3GFVA 5DCWA 2IV2X 3C3YA 1GPUA 3FWNA 3QMMA 2V98A 3IFSA 2ZT6A 3RUCA 3WK7A 4BBJA 3QZUA 1CRQA 4LRWA 1BA3A 4RXMA 5J43A 4AZ3A 2XH8A 2QR3A 2IU3A 3G8DA 4BEVA 4Y67A 3MUOA 3W5SA 1V5EA 1QFMA 1J8MF 1M75A 2OL4A 3G8CA 3RYTC 5LMUB 4TV8B 4DJAA 3T38A 3C5CA 2GN1A 2ZROA 1QKJA 3NS7A 3RTAA 1P6XA 4XLLA 2VDVE 3E15A 1WPQA 3TZBA 4HEJA 1EYZA 1T5SA 2FFQA 3A1NA 3L7KA 3DVLA 1L7DA 2RGNC 4Q24A 1SCNE 1WXEA 4PHGA 2H29A 1NW3A 1LF5A 1OC4A 2EF0A 2II6A 3LKVA 5D5HA 5DGCA 1YS6A 2CBGA 2NSJA 3Q40A 1LKZA 4N8DA 3S3TA 1GADO 3ODPA 1KEKA 4O0LA 5K5EA 3KJXA 4GPAA 4QX6A 2WKSA 4KR9A 3I04A 2Q1XA 1IHPA 4L8GA 4HVAA 4WGFA 5SICE 1L5GB 4G0MA 2BD0A 2JEOA 3LGAA 1GCIA 2LUOA 4RZSA 3ZWYA 5GIPE 4AWAA 1OV6A 1RT9A 1VE5A 3QUBA 1FA9A 4UFOA 1DINA 5ALTA 5EI5A 3T5DA 3I64A 4YV1A 4KLNA 4DJTA 3MTEA 1YFKA 4K6OA 4YPFA 2J9RA 1BE6A 2PK3A 3HO8A 4S1NA 3ROGA 2HA4A 5LMNB 4G25A 5IC6A 5D1HA 5KVAA 3CMMA 2ET6A 4DVGA 3EIHA 3F6EX 3F67A 3DDWA 4KPUB 4O2AB 4W7SA 5KSPA 3G2MA 1ZL0A 1KERA 1JZSA 3ROEA 3ZHQA 2FPIB 2FSVA 1ELOA 4PX9A 1W52X 1K63A 4DLYA 3Q88A 1U0RA 3CA8A 3CLKA 4X61A 4DN6A 1L6IA 3DYVA 4R1SA 4WX2B 1W35A 1C7EA 2Q1TA 1P29A 3QQ5A 3TD9A 1WDTA 1PO7A 1XLVA 2FN7A 4G0YA 1XA0A 1Z4MA 4DIFA 3MHPA 1IEXA 1FXWA 4ZJPA 4Z4FA 1KMCA 1QANA 2WWVD 2O6HA 3GMDA 1BXKA 2RBGA 5HMMA 5FA5A 5AW9A 5BNTA 1AB6A 1GFWA 4EARA 3F7NA 3KLOA 4EKEA 4J0HA 1NNEA 2PO5A 1A2BA 5DHRA 2CZGA 1VYTA 2NSHA 2WJVA 2YS7A 3MGGA 4B9AA 1FU4A 1NZDA 2E4UA 5GJVC 3UWPA 1T0JB 3PE3A 3SGLA 1NVEA 5C31A 3W2IA 2C9YA 1ODCA 1XKXA 1RMYA 1YZLA 2ZI5A 3IQWA 5AHOA 2P65A 2QQEA 4KQIA 4E3ZA 1U8EA 4LJ5A 1V0JA 2QUJA 5FWAA 3CF2A 3KQPA 4DFDA 1EA5A 4Q1FA 3OBIA 3I42A 3HADA 3A2KA 1NN5A 1M2FA 2DF8A 3B5JA 13PKA 3JWEA 3W8DA 1J8FA 2WYVA 3IXLA 2PMEA 4M1SA 1OWOA 5KQMA 4X3PA 1WD5A 3CNBA 2I99A 3RKRA 3TRKA 3TZLA 4NG5A 1UP4A 1N3LA 4MEBA 4WXEA 2V65A 2VHTA 2HJVA 1XTZA 5TGZA 5LN1A 1VPLA 3BRCA 5GV7A 1IHYA 5IT4A 2VPIA 2WKQA 4I4IA 3U7GA 3HCEA 3IODA 4C89A 3DLAA 3RSLA 3ZJYA 1JQKA 2X42A 2I22A 3NJ4A 3JR7A 3V55A 5D8DA 3C43A 2AT1A 3LOQA 3INTA 2IUSA 3MEQA 2Z56A 4KNVA 5HG0A 2VZEA 5AW5A 2GOYA 5HW0A 1VDZA 1CQWA 2AX3A 4A0QA 4DR1B 4WY8A 3VO8A 5GY7A 3W6UA 1G8FA 3ZH9B 5F51A 1QGOA 2DULA 1N2IA 2HCBA 2PEZA 3KE8A 3CEHA 2BBOA 5EHQA 3SOZA 3USES 2ZYAA 5BN1A 3OCZA 4CODB 2GN8A 5FHQA 2R85A 4BYGA 4OKIA 2Y0EA 4G1BA 2DBZA 3AJ9A 1GL9B 1NKVA 1MT3A 1A50B 4MQFB 1FFGA 3UB2A 1NMQA 3UXMA 1C30B 5EE9A 2BMFA 2IYZA 4XVUA 1L0BA 2Q21A 4B8ZA 2WHQA 3REQA 3OFNA 2G3YA 1HE3A 4QPCA 4Z7NB 2FZVA 3U3MA 2CNNA 2H5LA 1VBFA 3MVEA 2RC6A 2YS6A 1ZCJA 1DBSA 2XVAA 2QMUA 1RKUA 3QF4A 3ABIA 3QY9A 4QFDA 5TE9A 3SJUA 3TXXA 1BEEA 2HRZA 5EWMB 5T4BA 3EFEA 4Q16A 3FMOB 2IV3A 1RPNA 1Z16A 3FLEA 4PBSA 4DCUA 4ZI7F 4YJ3B 1I6WA 1R6DA 3FBWA 5D6NA 1KYYA 1VIYA 1U81A 3GLIB 2J9XB 2XSZA 4IO1A 1NWCA 4OSOA 2AKYA 4DQLA 3EQZA 3ZHRA 1PVOA 5D00A 1GEEA 3PZBA 4Z7JA 2HFKA 2PZFA 3ER6A 5FV7A 4UNRA 3C3KA 3ZVKA 5CT5A 4YQFA 3HJFA 4Y2QA 2ZBUA 4BOYA 1RI2A 1ZMBA 2WVJA 2VJDA 1QVRA 4LY9A 5FI1B 4C88A 4EEXA 4ZT3A 3BRSA 1AZTA 2EDCA 4PG5A 3U48A 3STWA 1MJHA 3ND5A 4IO0A 3PHGA 2NV0A 3FETA 2FCRA 2B3TA 1Z73A 4EG5A 2POCA 1QYXA 5MFZA 1P81A 1VYUA 1WXGA 3NTXA 4PC2A 4HB0A 1J0XO 4WZ6A 4L57A 1VCMA 3N7UA 3KZXA 2QRQA 4IBOA 4TYNA 4GMKA 2XMQA 4RJTA 2WAMA 1MG0A 221PA 3QVJA 4QT4A 4WBNA 1CUDA 4KQ6A 3EVDA 1ABEA 3S28A 4DWWA 3HO6A 4MUEA 5C8YB 4JQSA 2YWRA 3K31A 5FBWB 1IVNA 4CMEC 4L5YA 1U9IC 1GKIA 1T9AA 2QROA 4B3XA 5IHXA 2OVBA 3RARA 4IS3A 3WGTA 4ZCTA 1PR6A 1V4VA 3UVEA 1L7AA 3K15A 4UOEA 2J6CA 2YJZA 3GK3A 2C8JA 3I12A 1E3SA 1VGQA 3QIVA 4XFDA 2EC5A 4GGPA 4YMTA 2ICAA 4KYTA 2C2BA 2NTNA 4NBTA 1Y81A 1GNTA 2Y0CA 4PSCA 2QX4A 1X1BA 2Y1LA 4YQYA 1QO0D 3O4GA 1WF3A 2OLEA 1JR2A 3CKYA 4OLAA 1GG9A 5AKGA 5CVTA 2ID4A 4HPWA 4OJQA 5D87A 3J81k 4C4PA 2VQFB 5L3QA 1AT1A 2N75A 2F2TA 4ISCA 1CUCA 2GFQA 2R6HA 3AHCA 4M1QA 3I73A 3HGQA 4JODA 3A32A 1R6XA 4KI7A 4EH1A 3TLBA 3I1JA 3HCBA 4JBHA 1JHZA 5CJJA 4CLDA 1UEJA 5DHQA 4L3OA 4Y7DA 5BN3A 2CLSA 2FMKA 2EYUA 2IYFA 3NTLA 4DV7B 1FP2A 2V0GA 5DMHA 1P7CA 3PX7A 2DWOA 3N3AC 1W4AA 5EUQB 1KPIA 4PS0A 3GZNB 1OX4A 2D5LA 3AKYA 3OTHA 4MCIA 4WOCA 3EIQA 1RADA 5EWJB 4ZDIA 1PZEA 3UJPA 4HN2A 2R4UA 2IZOA 2O8BB 2GD1O 1TMKA 4B6QA 5CLFA 4OTZA 1Q1EA 2VLIA 2GERA 3GCDA 1BDBA 1POWA 1ZQ1A 5GADl 4V38A 5DU2A 3U62A 2XCTB 5C4MA 1C5KA 3IT0A 5KKNB 1K9VF 3RF6A 4JLUA 2VP0A 4R2WA 3ECSA 4OJYA 5CR9A 1NSFA 1CUVA 2GBLA 1UC5B 3DLIA 3DVAA 3PNOA 1C7JA 2PVCA 1XCBA 3O2NA 3PP8A 4Z8YA 3FPGA 4EFLA 3UMVA 1PL0A 2WPDA 3PVSA 3TLZA 5EP1A 1BMDA 1RYFA 4ZD6A 2B9EA 3LT2A 3WDSA 2HA6A 5BUZA 1KGDA 2AN3A 1ZJZA 2JFVA 3I0NA 1N25A 3IAS1 5TMBA 4D9BA 3JQ7A 2Z08A 4PNPA 3H2JA 1EHCA 4NPHA 3SFZA 3VPXA 3VDRA 1X1AA 4OIMA 4RY9A 3GLRA 3GGJA 2BEWB 1I1OA 1CUBA 1NOIA 4Z99A 5JT1A 1D0VA 1YVEI 4EB6A 2XLCA 3QPBA 1AMNA 4KMOA 4ENWA 5B7PA 2J5QA 1XFAA 3M5DA 1SO8A 4JZKA 2NGRA 4QUEA 4UEKA 3RLIA 5F9MA 4AQ7A 4PY2A 3DAHA 3JSAA 4EA9A 5JJKA 1H0SA 1CQXA 3W1EA 3M6WA 1HDZA 4O4IA 2ZUTA 5JV5A 3D7NA 2HBZA 3IVXA 1KAGA 2V55B 3N0TA 4AP5A 2CK3A 2PT6A 3IO5A 3O84A 1KK3A 4QU5A 4KMMA 5FPYA 3V1YA 3T7IA 4RY8A 3VAAA 5B64A 2OESA 3I5XA 1GTMA 1TD1A 3JRWA 5G1PA 3CNNA 4RM3A 3OFJA 5IMSA 4GAEA 4IPTA 5KNBH 4RSRA 3RS4A 2I34A 1N2CE 3DTNA 1NAIA 3CNOA 4RIFA 1YZGA 4G1EB 3T0IA 1MMFB 2J6BA 3IERA 4WH0A 2GVNA 4WESB 4QECA 5M5BA 3I6ZA 2DTXA 4TLLB 2ZI6A 1RYZA 3SJ7A 4M1OA 4OU4A 4V02A 4BZZA 1Y48E 2V7WA 4PQEA 5TGDA 1UINA 2FWNA 4C7BA 5BW4A 1ZUD1 5JCXA 2X15A 4WW0A 5CXQA 1C3VA 2P6OA 4HYTA 4U2EA 2RARA 4G86A 4C2UA 4LJAA 2FRDC 3I0ZA 1N2SA 3KQHA 1KMHA 1BRTA 2AS0A 1II8A 1MUUA 2G40A 4OXQA 1EI9A 3CJTA 3GNSA 4DS3A 1Z47A 4DMHA 3EZXA 5BSWA 5SYAA 2C2YA 1JYEA 4KK3A 5DHTA 1TRHA 3VZDA 4ZJZA 5JNSA 3DPIA 4KR3A 3N3BC 1W5SA 4KXWA 4O1MA 5FTMA 2JFHA 3AJAA 2QRVA 2ETVA 2XD4A 2OOSA 3LK7A 4ZVKA 4YRJA 5IVHA 2BP7B 3R5KA 4X20A 4Y1GA 1T5BA 2GUWA 1CLUA 4QZVA 2ZPTX 1OWPA 3BA1A 2CE2X 2BM1A 3NBQA 2WD7A 4MUBA 3IVAA 3HJCA 5HWSA 4B73A 1XF9A 2HQRA 1N1MA 4NH0A 4UAJA 1R0LA 4IUCS 4ZC1A 3SEFA 3W5AA 3PENA 1YJBA 3FTFA 2JEYA 2AUNA 4EMSA 5K8LA 2DU8A 4AJOA 2DPXA 2Z83A 2OLKA 2IH4A 1U8ZA 3AU9A 3T1VA 5INTA 2HHLA 1T6NA 1EVLA 1X8LA 3KAKA 3SEQA 2QIPA 5ALUA 2HGSA 1FQKA 3GJZA 3RIGA 1NT2A 1T35A 3G8AA 3QLJA 1BAPA 3EE6A 3L18A 4J75A 3V8VA 3PDHA 4GI2A 4Q9HA 1Z07A 3A58B 4B5LA 4B40A 2BBSA 1F5NA 1VIMA 1KS9A 2JH9A 4TLMB 4X41A 4MKZA 4CZ2A 2CV2A 4MRVA 1GL3A 1E9AA 4DLAA 3TM4A 2EFEB 3VR6D 1JKJA 5LP1A 1VJDA 2DP4E 2IX9A 3DL0A 1O9GA 2OG1A 4JC4A 2CNKA 1DAFA 1PFGA 3QOFA 1Y8RB 2BFFB 2REBA 4I50F 4LSZA 5TARA 5HX7A 3B6ZA 5K6RA 1NI4A 4G1FA 3EH1A 4PBRA 4YJFA 1RYDA 2VLBA 3HBJA 3SE0A 1VJ5A 4C29A 3G0HA 3ZZ0A 4FLFA 4RH3A 5WRFA 3IDZA 4A8HA 1ILEA 3X1XA 3PFNA 4KAXA 2WJJA 3N8KA 2AFHB 1XZPA 3DVRX 3ORRA 2F48A 2H4WA 2OFOA 3LUGA 4NHEA 5ETJA 2Y1OA 2Q4EA 1NX9A 4PYQA 2GJ8A 3WJ7A 3QWIA 2C0QA 1YI1A 4ER7A 4M4SA 4EG7A 3CPHA 2VDLB 3JQFA 2B3DA 3HEBA 5KTKA 4W9MC 2CKMA 3TNLA 1JGTA 3HFRA 4II2A 1FJXA 3VMFA 4EFMA 2AEMA 5K6AC 4LMAA 3NGXA 4TTPA 3DL4A 2D5CA 1OKKD 3CLTD 4D6YA 2RSLA 2OYCA 2Z9DA 3DXFA 1I7NA 1LPMA 1S4MA 3T4PA 4ID3A 1II0A 3FZQA 4IHJA 3C16C 3ZJUA 1CHDA 1ECLA 4GMXA 4UKDA 4X66B 5K3BA 2GO1A 2BTQB 3EGCA 3G0BA 4PZZA 4X97A 5TS2A 3OTGA 2RAUA 2JIRA 3TRFA 5C1BA 3HY4A 2PBRA 2MSCB 5B58T 2HJWA 4JLVA 1YFZA 1AXGA 3TVYA 3UJNA 3UM9A 1WNTA 3GEEA 4QXOA 1HG1A 1PEAA 3SYRA 4WGGA 2AMJA 2Z6AA 1SVNA 1FRQA 3PQDA 4O3FA 4R9UC 3U2QA 3LA6A 4I1RA 1KMMA 2PD6A 5E0KB 4JL5A 4GGMX 4DZZA 4MAFA 5DGDA 1P4GA 1G9SA 1UADA 2XE7A 4L0MA 4OA8A 5E2AA 4US2R 1AS0A 3L7CA 4LJ9A 2QVXX 1UZMA 4I8DA 2RHCA 2P91A 3FGNA 3GJXC 5T8KA 2HI0A 1DX6A 3QLTA 4EY7A 4KREA 4HDKB 2ZRHA 4A15A 1MQ9A 3SJBA 3NOVA 1QP0A 1A7UA 1K2WA 4LZOA 5FNVA 1BQ4A 3KK0A 2IS4A 3A6GA 1I4WA 3EC2A 2FWMX 1DQNA 4FZJA 3B9RA 2BN4A 2I1QA 4KTTE 4R9RA 3RS9A 3UGKA 3HN7A 3PA8A 2RBEA 4RD2A 4NFLA 4BWVA 1IBMB 1KXZA 2DLNA 1REQB 1UK7A 3IILA 5DZSA 1ZAYA 2Q9UA 4HRAA 1QB8A 2JIQA 2WRZA 3D3JA 4PGAA 1V7CA 2GHRA 3K2QA 3UFBA 2WU8A 3VDQA 5G0TA 4ZGGA 3V6LA 1WB9A 1ZN2A 1CZOA 1Y6RA 1K7XB 2I2FA 1Z25A 5FV4A 1Q17A 3RROA 4I1OA 2PR2A 1VCOA 4R1LA 2VOJA 3RTBA 3C98A 4K81B 4NJOA 1S02A 4RZQA 1OWLA 1XN4A 1QK3A 2QUHA 4DQ0A 4RKFA 2GARA 2PKEA 1MAUA 4OH7A 3DZIA 4A9AA 3GRFA 3NVKI 1GZ7A 1L7BA 2C9MA 1G4UR 1SKUA 1TJPB 2XOKA 4DQVA 2C5BA 3A1SA 4AMGA 4CYMA 1IU9A 1UBEA 1D5WA 2IIPA 4Q3BA 1KYWA 3L05A 1N5MA 1XMOB 5DX8A 2PMBA 1E1QD 2PTGA 4YALA 3TOVA 2C5HA 5F7ZA 3UAXA 4B3SB 3KYJB 4YLGA 1Y8AA 3AUSA 3GLQA 3U1TA 4DAOA 3BQMB 3VHRA 4JGBA 1RC8A 2WU3A 1FSPA 3KJHA 2V7PA 1M1UA 2QA5A 4GLOA 4BZQA 3O83A 3GJ3A 4N0QA 5IJ9A 1SUSA 1XD2A 4BMCA 2HCFA 3QLUC 5SY4A 4B3IA 5LLSA 4IQ4A 4BY9E 2KB0A 4BNDB 5DULA 3PD1A 3VC1A 2QK4A 3NIWA 4QUBA 2PBFA 5BSKA 1Q2UA 1ADGA 1KC3A 1T9ZA 2WABA 4TUYF 1T6BY 3TOZA 1LDEA 4MS4A 4NCKA 2R8OA 2NVOA 5DBOA 3QM1A 2FR8A 4UU8A 1I2ZA 4R2JA 2HCRA 3E3OA 2P6RA 3U4MA 4XI9A 2CUTA 5EEHA 4DM7A 2O2EA 3KV1A 1C9JA 5LZ5A 4KV7A 2ODWA 2YXBA 4QL3A 5LQCA 2FZGA 4ZCRA 5IDWA 3NGMA 1OYWA 1NULA 2G6BA 1P2GA 4W8GA 3S8MA 4PQYA 3OIUA 2VRCA 3M7IA 2A0XA 3PGVA 3CY6A 4MDFA 2H8KA 3R5FA 3ZGLA 2V0CA 3LT1A 1T4MA 4RDXA 1J9EA 5HRUA 4QICA 3TBHA 1QAQA 3ZE1B 1O58A 1KYIA 1PJLA 1Z88A 1E5LA 5I7VA 3E7DA 4F6LA 3BDVA 3EAFA 4AO7A 3EC1A 4DTCA 3DBIA 1U2DA 2X6QA 5HKOA 1U0NA 3VSEA 2YRWA 3RTCA 1XEFA 3UJ6A 5FDFA 5IULC 4C0QC 2F1JA 4QIHA 3TKYA 4G0PA 1X8XA 1WB6A 5JRDS 2HHAA 3CIOA 1ZH4A 2OBYA 4YUAA 2NTEA 2ALJA 3OY2A 1G16A 4HLDA 1FLNA 3E27A 4DLVA 4PXAA 2H0QA 2VWGA 2NPFA 2WW8A 5C7IO 4R1OA 2BKAA 3AUJB 4GKKB 1VHLA 4ZYWA 4F2WA 4QLOA 4ZOQI 1E60A 1M34B 3SF0A 4CV2A 1HLDA 2JNWA 3C6XA 4BP8A 5ADVA 5KOHA 1KI9A 4UBIA 3OD5A 1O95D 2I7DA 4GH5A 3FWKA 2EQAA 4F86A 4FK8A 4K2AA 3OZIA 4U3JB 1EWQA 2ON6A 1EUDA 1PX2A 1FX0B 1KYXA 4N8EA 4WCDA 3L04A 4IRMA 4ZYTA 1YTUA 1B1CA 1OXBB 2ZT7A 4PGFA 4QXQA 1AHIA 1I2MA 3KYDA 4TWJA 4W1PA 1L4BA 2VYNA 3DWIA 3I28A 4IEFB 3Q12A 2ZI9A 5HP4A 5JU6A 1UQRA 1MW8X 2WQ6A 2EP5A 1V2HE 1W4BA 3NUGA 2O4UX 1A1VA 3IPYA 4F7DA 1BH2A 4OSPA 1OIXA 2BFDB 3L07A 4Z1MA 3ZHXA 1TEZA 4E6EA 4F11A 3D8NA 4MQUA 2OCYC 2PKWA 3DZ8A 2WFMA 4UM8B 1GARA 2I55A 2FQYA 3EVAA 3GZJA 1BW9B 1PBTA 1A5BB 4C4ZA 4FFDA 2LIVA 4KXUA 3MRTA 1XLTC 4JJAA 1G1MA 3P9YA 4PZ9A 3AF5A 4B44A 4ER3A 1YQWA 3ANXA 2B1GA 2DJIA 4AI6A 1XXHA 4EYKA 2B8EA 3BTSA 1ZNXA 2A9OA 4HWOA 2I2CA 1SVUA 1ENPA 3LH5A 3M4XA 2W8ZA 2AFIE 3LDUA 1PK8A 2WJHA 2QEQA 2HSWA 2PX0A 1K1EA 2HSJA 4XSVA 3R5HA 4XA8A 4AMYA 1AXEA 1OZHA 1V1JA 3MRVA 1IY1A 1IE3A 1PLJA 3D02A 3NXKA 5FEMA 3ADDA 4D26A 3NH6A 2VHUA 1NBWB 2WIJA 2B4AA 2W2KA 4WK2B 1MAAA 5F33A 5TNXA 4HUQB 1MDFA 2BMAA 2ZWVA 2P9QA 4FNGA 4HLCA 2KS6A 3WADA 3WGYA 5FFMA 5KQRA 1EPUA 2EEPA 1BS9A 2QQFA 3GIDA 3OPYI 3IE0A 3CBGA 4Z3DA 3SIPA 3AXSA 4A03A 3KL4A 3IOCA 1T5TA 3A9RA 3NHJA 4PIMA 3C24A 4R31A 5ES4B 5IKEA 4B6FA 4DHEA 2Y1KA 4MIOA 1LSJA 2GPSA 2CJPA 2Z3WA 4KO2S 5TJHA 2PD4A 2RBKA 3VPSA 4D9MA 3KVYA 3KOXA 2CJWB 3TXYA 5GP1A 2BCEA 4RM2A 4UAUA 2H1WA 2JAOA 3V3TA 1QZ3A 3LYHA 2F9FA 3ZIDA 3PWZA 3CVXA 3DTVD 3GG2A 1WBBA 1RBQA 3KLPX 2FY8A 1TCUA 1KEVA 1TCVA 1ZSNA 1DBVO 4XWOA 1OLOA 2BAGA 1U2QA 2WYOA 1TM1E 3BSYA 2GDZA 3EQ7A 2I6TA 3B6EA 3DE0X 1XPUA 1FNNA 4CCYB 1V6CA 3LG2A 4L6IA 1R8JA 1MHPA 5FEUA 1E1LA 4KZKA 3AY3A 5ECYA 1KEPA 4ZCIA 3SJAA 1Z22A 2D7DA 3LHKA 4Y6SA 4Z0NA 3WBFA 1Q0PA 2B98A 2Q2WA 2QXUA 1SVLA 2FUEA 1OYOA 3CZRA 5EE5B 4UTPA 2PL3A 4R2IA 2J0UB 1YUNA 2ZTSA 1VG1A 1WXDA 4MV7A 3DC2A 4ZVQA 3MINA 2RH5A 2ZJ2A 3ZY2A 1XTSA 1GV1A 1SZPA 1QM5A 2DLDA 2O8EA 1IZZA 3LTEA 3ZUPA 1CB0A 1E8MA 1F8YA 2IP2A 1OLSB 1V3VA 2V6BA 1CPYA 2EU8A 3QKIA 5JFTA 1B8NA 1SKYE 1Z5NA 1XAIA 3K9GA 3OO0A 4GS5A 4AJHA 1E0KA 1RIFA 1P5JA 5GIOE 3AESB 1D7AA 1Y9JA 1VJ0A 3DULA 3F5QA 1H3FA 2VL7A 2FH5B 2OKGA 4H60A 1E7MA 2DPMA 4RTMA 1A9ZA 5LWHA 2R6JA 3ZWKA 2QL7A 2AKAB 2H9IA 1E2JA 6PFKA 2MINB 1DJNA 5D6OA 4REOA 2AN1A 3UT5B 4BO1A 4G67A 1YZFA 3ZKWA 1KH3A 3P0HA 3CH4B 5HK8A 2R84A 4XOUA 2GF2A 4L9WA 3TLGB 2GAJA 1R15A 4OV6B 5HJ2A 2A9QA 3C1OA 4I6JA 1JAZA 4BO5A 1XI2A 1DDOA 3LRPA 3WMFA 1T8TA 1QGUA 2F62A 3S7TA 3C4QA 3UG7A 4J29A 4RETA 1RLMA 2CSUA 1BN6A