3AUUA

Crystal structure of bacillus megaterium glucose dehydrogenase 4 in complex with d-glucose
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
262
structure length
262
Chain Sequence
HMYTDLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYYNNEEEALDAKKEVEEAGGQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIKGNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPINAEKFADPVQRADVESMIPMGYIGKPEEVAAVAAFLASSQASYVTGITLFADGGMTKYPSFQAGRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided mutagenesis for the improvement of substrate specificity of Bacillus megaterium glucose 1-dehydrogenase IV
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Oxidoreductase
molecule keywords Glucose 1-dehydrogenase 4
total genus 100
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 1.1.1.47: Glucose 1-dehydrogenase (NAD(P)(+)).
pdb deposition date 2011-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3auuA00
1P45A 2I5PO 3LT1A 4A03A 3AI1A 1PGJA 3GY0A 1NHWA 2I3GA 1CETA 4BNLA 2ZTVA 2DC1A 4PLWA 1AXEA 3I4FA 2Q49A 1R15A 1UUFA 3JSAA 4WASA 3VKVA 2I9PA 4FFOA 4NJMA 4DYDA 4F3YA 1PU2A 3A1NA 3GPDG 1HEUA 3P2OA 5BSHA 1A72A 1GZ4A 1U28A 1J6UA 3D3WB 1SAYA 4O6VA 5L9AA 1WW8A 2X23A 4DXHA 3M1AA 1P74A 4AJKA 1PEDA 4J7CA 1BWSA 3GC6A 4WLNA 5HTOA 1RM3A 1J0XO 3FD8A 2YW9A 1EFLA 4NBVA 5IF3A 5HRUA 2Y93A 3SVTA 1B0AA 3E03A 2B36A 1Y8QA 1DC5A 1ZFNA 4EBFA 4BUCA 3QWIA 2ZTUA 4U0JA 1PWXA 3EAGA 8ADHA 1QYVA 1F14A 4FB5A 1C14A 1T26A 4CUJA 2Z95A 4GAEA 1ADBA 1O0SA 5T5QA 3OQ6A 2X6TA 4P8RA 3ZN2A 3HDYA 4ILKA 3KYDA 4JJIA 4YACA 1ZJZA 1A5ZA 5IN5A 4AJJA 3GVCA 1X0XA 1J5PA 2PH3A 3NV9A 3TZKA 4PCVA 4AJHA 1XR3A 4L74A 1YKFA 4D41A 1I5RA 4YRAA 3E9MA 3IJRA 2YZ7A 3HSKA 1UAYA 4PLVA 4YWJA 4J7UA 5A9SA 3UW3A 1EK5A 1Z82A 2VZ8A 1JKIA 3DBRA 5EIOA 3FWNA 2OOSA 4DC1A 1ZIDA 2PH5A 3KYCA 3FRJA 3BMCA 4FBGA 4B79A 1GFSA 2ILTA 4JP3A 2ET6A 3W8EA 5ILGA 3CE6A 1FDTA 3QWAA 3IUPA 3ZWCA 1FDSA 1KY5A 1GU7A 1R4MB 1HSZA 3F1KA 3ZWMA 2NVBA 1R66A 1Z73A 3B70A 2R00A 3DMYA 3NRCA 1YE3A 3GGGA 4LCEA 4XYEA 2WD8A 3PJEA 2Q2VA 3QY9A 1XWFA 2CVOA 4WCDA 4YJFA 3G17A 5JDIC 4RLSA 1GV0A 1NPDA 1DPGA 4MKXA 3TN7A 4E2XA 1HT0A 4MP6A 5DCYA 4OIMA 4UVDA 3ZNOA 2AEFA 4YJHA 2O3QA 3W1VA 3W4IA 2VWPA 5ENVA 3RU9A 1J49A 4AJPA 1EEHA 2X9VA 1LRLA 1X15A 5KKCA 2VRCD 2CVQA 5I8ZA 4IXWA 2Y66A 5C7IO 1DOHA 5KJ6A 1JN0A 2VWGA 4YJGB 4XQCA 3ADOA 1IPEA 1E3SA 4D0RA 4P38A 3E1KA 1LLCA 2AEJA 2GD1O 4M8SA 3JYQA 2X4GA 1EE9A 4ND2A 2JCVA 4CV1A 1LTHR 1DEHA 3FNFA 3ZCXA 1OOEA 1GUFA 4UREA 5DOVA 1PJ4A 3LU1A 3IUSA 1R0LA 3S1LA 3DHEA 3F1LA 1DB3A 2JHGA 4XB1A 4EUHA 4IBOA 2GERA 1YWGO 1VE9A 1I2CA 4EJ0A 2VT3A 5KKAA 3I23A 3KSDO 4DLAA 1AUPA 3L4SO 1PZEA 5FYDA 2QRJA 3C7DB 4W6ZA 3UAGA 3SX2A 1BVRA 3KLPX 1K89A 4YAGA 4BGEA 2EP7A 1I10A 2D1YA 3K92A 3JQ8B 4PN3A 3F6YA 1QSGA 4Q3AA 2JCXA 4RVSA 3RJ9A 4BNTA 3ROPA 1R0SA 3ROMA 1V3UA 1BXGA 5K6AA 4LMRA 4DL9A 2P2SA 1SEPA 1LSJA 2PD4A 3OJOA 2OL4A 3HN7A 4YT8A 4M1QA 5JCXA 3WNQA 1NASA 1XKQA 3GDFA 5A1TA 1M66A 2BHLA 4J91A 5I7FA 5HS6A 5EN4A 1T2FA 3GH3A 5THQA 3RC7A 1P9LA 3HDHA 3RJ5A 3ZNPA 4D42A 4A5OA 4CPDA 5B37A 3V1UA 4CLEA 3U0BA 3LZ6A 3MZ0A 4H7PA 3WLEA 2WSBA 3MWDB 1O6ZA 3FSRA 2C54A 3OEWA 5CPFA 1M6WA 4UVIA 4Z3KA 3H9EO 2O2SA 4R3WA 2X58A 3V2UA 4CR7A 3FPLA 4K1LA 4R16A 3WGZA 3TZHA 2WD7B 1WXDA 3H7AA 2X5JO 4PG7A 4PLZA 1JWAB 1YQXA 4M49A 2Z1MA 3PHIA 1KVQA 2FHSA 3DBLA 4BGIA 3JQAD 4WLVA 1GPDG 4YRDA 4CQMD 4WCFC 1NP3A 1T2AA 2O3TA 2VRCA 4RCVA 1QXSA 1GCOA 1ADGA 4OH1A 4Y6RA 4J1QA 4CLOB 8LDHA 2UUPA 1EVIA 1GQQA 5H81A 1DAOA 4AJ1A 1CIVA 4H15A 4WCFB 4BKQA 1BMDA 1IZ0A 2Y1GA 3GRPA 2GN4A 4JROA 1C1XB 3UF0A 4CMEA 3RUEA 4DPKA 4M87A 2Y1FA 1HYHA 3LYLA 4HP8A 1E7QA 2Q4EA 5A9SB 3PYXA 1QYXA 1KS9A 4BHTA 4IINA 2RBEA 3DOCA 2V6GA 3P2YA 4PVCA 1N1GA 2CSUA 3GEMA 2B35A 3DTYA 1E1LA 3MJVA 1U3WA 3E9QA 4CR8A 3RI3A 1X13A 3AUUA 1NTOA 3DFZA 4CUZA 4ZGWA 1H5QA 1ZK3A 3GUCA 4LMPA 1NAIA 4R69A 5BSGA 1UZLA 2RH4A 1H6DA 3ICCA 3INGA 5T57A 2YV2A 4YAEA 4RO0A 4E5MA 2PFGA 3DAPA 1HE4A 3DDNA 2WWRA 5A02A 2P9EA 3C1OA 3D5QA 1B14A 4ZVVA 1NFQA 3GRKA 1LLUA 1Q0QA 4BNUA 4IY1A 1GL3A 2VTEA 3GOHA 4XA8A 1Q7GA 1DC4A 3WQQA 2DPHA 1EBFA 1MX3A 4HY3A 2DM6A 3HDJA 3C7CB 1V3VA 1N9GB 4HUJA 3AI2A 4CQLB 1EQ2A 1IUKA 1ISHA 3JQBC 3GDGA 4XQ9A 3JQ8A 4FS3A 4HNHA 4J4TA 4U5QA 2HRBA 4YDRA 1LEHA 1ID1A 4TVBA 4AVYA 3WYEA 3U9LA 2EKQA 5A9RA 4CM6A 4IDAA 1T24A 1FDWA 1XGKA 2NU7A 1M76A 1HF3A 2AEMA 3CH6A 3NTRA 4PLYA 2EIHA 1LDYA 1DRVA 2AE1A 2YQ4A 3EZLA 3WFJA 3WIEA 1ZMTA 2D4AA 3LT0A 2X86A 2GN9A 2HMSA 2B83A 3AUTA 4J90A 1UP6A 5ER9A 1MLDA 4R1SA 4E30A 2NU9A 1H0KA 1R4NB 4LCJA 4XGIA 4XIYA 4CM9D 4DWVA 3OICA 5A05A 2PY6A 4MIYA 3WTBA 3ZGYA 2EERA 1QP8A 4DQVA 5CEEA 1VJ1A 5TX7A 4EUEA 4CUKA 3I52A 3ZU3A 4B4WA 4XKJA 4GX0A 4CL3A 4ZD6A 1K5HA 2Q4BA 3LLVA 4R9RA 1B16A 3CXRA 1LX6A 1ZK1A 3ZWXA 1YL6A 4D3DA 4RVGA 4AJ2A 3MTJA 5IDWA 2GPTA 4MKRA 4OSOA 4LW8A 4XQEA 4WOJA 3P7MA 3ICPA 4RZHA 3RC2A 1L7EA 2PD3A 4UVHA 5AXDA 5EMHA 3JQDA 2DQ4A 4XRRA 3WS7A 3OIGA 1LXCA 4Y67A 4KTTE 4FW8A 2WJPA 3BTVA 3CMMA 1MFZA 1EUZA 3KYDB 4WEQA 3IOYA 4H3VA 2OXIA 2Q2QA 4MJLA 4R3NA 1P33A 3EZYA 3ZDFA 4ALJA 4X54A 3Q3CA 3K73O 1VJ0A 2VOEA 3JQGB 1ZXLA 1YBAA 4HBGA 3B1KA 4PG5A 1ML3A 3OQ1A 5CDGA 4LVUA 2WYVA 4E0BA 1JTVA 5IN4A 4F46A 2BI8A 4W99A 3T7EA 3IS3A 4Z0HO 4PLCA 4YB8A 4Q39A 2VYNA 2WM3A 4FFPA 2OBYA 2PNFA 3DAGA 3R6DA 1LSSA 3HUDA 1MV8A 3H2ZA 3RU7A 4NFYA 1O95A 3C24A 2ZYGA 3AFMA 4N7RA 1LDMA 1OZAA 4ND3A 3NDIA 3L6DA 4RDHA 3VHRA 3C85A 4PG6A 2G76A 2Y1EA 3ZH2A 2IZ1A 4MIEA 1RM4A 1ZVMA 4J9VA 4PRKA 5KOIA 5JY1A 1D1TA 3UCEA 4CMHA 4E5PA 1A4IA 3DBHB 3JD3A 2R2GA 1UDBA 1PR3A 3PWKA 2B69A 1ZJYA 5LCXA 3W4JA 2PV7A 2ZQYA 4S3MA 3WYBA 3HB4X 2JFFA 3PYLA 4TRNA 3OH8A 5JBIA 1NR7A 2X8LA 3Q11A 1NWHA 1XHLA 1GZ3A 2GLXA 2VHVA 2ZJ1A 1NFFA 1U8FO 3CTMA 3QJ5A 4JJGA 1ZNQO 1D4FA 4CM9A 2ZYDA 1KEUA 5ILOA 3IAHA 1BW9B 1HE5A 1SNYA 3GN1A 4OM8A 3D7LA 3ZHZA 2JD2A 3WGGA 3WSWA 3BA1A 3PQFA 4MVJF 4NR0A 4IZHA 4L73A 4CMIA 4QTZA 3K6JA 2BLLA 3PHLA 1XSEA 3I9LA 5T64A 4GX1A 5JPIA 2DBRA 4YAKA 1U5CA 4PG4A 3GVHA 2IE0A 3SXPA 2QRLA 1K6IA 2Y05A 3MOIA 4Z3DA 2HMTA 4E4YA 3LSYA 1V9LA 5LDGA 3ZV4A 4HKTA 1R16A 4TROA 4U0KA 5TLSA 1ZK0A 4NNJA 2J5RA 4GWKA 1O89A 3OA0A 1X7HA 1Q0LA 4M55A 1LDNA 3JD1A 3FN4A 1T2DA 1A27A 3KEOA 3ONEA 3OJLA 1VPDA 3T4EA 3GA0A 1LU9A 1PL7A 4C4OA 2E49A 3F4BA 1YB4A 5AQ1A 3C7AA 4IS3A 1LLDA 3DZFA 3JQFA 4UVEA 3D4PA 2LDBA 2Z5LA 5AVOA 1WMBA 1CYDA 4FGSA 4FDAA 2AE2A 3OBBA 4Z9FA 4HFNA 1CQIA 4P22A 2HK8A 5T6BA 5JDCA 5BQFA 1DIHA 1Y8RA 1NVMB 4NIMA 3V8BA 4K6FA 1MC4A 3RKRA 4BNKA 3UXYA 3RFVA 4QECA 4F45A 1LC0A 2JJYA 5L3ZA 1SO8A 1WLYA 3DOOA 4BNZA 5MDHA 4R1NA 4ALKA 4GBJA 3W8FA 1U2GA 2X0IA 3WJAA 1LDEA 4YXFA 4CMCA 3F5QA 3N74A 4Y6SA 1CQJA 4CODB 2PKRA 3GT0A 4GVXA 3NKLA 4XZ3A 4EEXA 3NJ8A 3BMCB 3HFGA 5TJHA 4ND4A 4PFJA 2Q46A 3GNSA 5L45A 4FGWA 3OF2A 1PZFA 5DZSA 4B7UA 4OYRA 4ZJUA 3WMXA 2BKAA 2J6IA 2W2KA 4N5NA 4NBWA 1KC1A 4XDZA 4XGNA 5A3JA 4CQMA 3WTCA 2E4AA 5CG1A 1SCUA 4DIOA 1VL6A 3Q0EA 5THKA 4S1VA 3VDQA 5KVQA 4QSMA 4IMPA 3V5NA 1JLLA 1YRLA 2NLOA 1TA4A 1EVYA 2V65A 1T4BA 1GUZA 3DZHA 1U1IA 5TRTA 3DHNA 1K6JA 1MA0A 4MOWA 2D59A 1X7GA 4BO2A 4YVFA 3NTOA 2JHFA 3UKOA 3BXXA 4MO2A 4RPGA 1DIAA 4JN6B 3FPCA 1QYDA 1HDRA 1PS8A 3UH1A 4D3SA 2V6BA 3H4VA 4TQGA 2H63A 3ZWBA 3WNVA 4E2ZA 3WGOA 2ZJ0A 3KXDA 4D45A 4RDIA 1LA2A 1EBUA 1LQTA 1TT7A 3EYWA 2IZZA 2EV9A 3JD2A 4B4UA 3TZ6A 3GMDA 3DAFA 2VUSA 3I9OA 3JV7A 5JC8A 5JW6A 4CLDA 5FWNA 3H3JA 4DLLA 1WZEA 1HKUA 3O8QB 3H3FA 3PVZA 2NACA 3INRA 4XDYA 2I99A 3H6KA 3CZMA 5I8WA 1S7CA 3E9NA 4GQAA 1X14A 4RGBA 3KYBA 4R5HA 3P5SA 1IY8A 2OMEA 1WMAA 5JNLA 3D3WA 5CHEA 1NQTA 2EHDA 1YGYA 4YRBA 4JBGA 1LC3A 3ZV5A 1M2WA 3V2GA 5L53A 1DHRA 2GGSA 2Q3EA 4AJOA 3RC9A 1U4OA 2YUTA 2AHRA 3WWZA 4XWYA 3PZRA 2W90A 3PRJA 4NK4A 3JYPA 5L51A 2EF1A 4GI2A 1L7DA 2DT5A 2H5LA 2NWQA 3QVSA 3GNTA 4KDFA 1LRJA 4IDFA 4NJOA 4CV2A 2DAPA 2HKIA 4MKZA 1JAXA 5H82A 1JA9A 1PL6A 1FJHA 4WEOA 3ANMA 4RVFA 2HDHA 2BF7A 3DOJA 4WNCA 2O23A 4Q3NA 4UEKA 4NJMB 1R4NA 2Q99A 3TL3A 1SEVA 2OUIA 3NJ4A 3WICA 1D8AA 4J6FA 3BHJA 1DSSG 4CLRB 1A7KA 5C5IA 3DMTA 4OAQA 2QZ9A 3QIVA 2HK9A 4BV8A 4UEOA 3UGKA 3BMQA 3D3EA 1M75A 1YBMA 2PLAA 3PZBA 2JAHA 3JQ7B 3QHAA 3VPHA 4I9NA 3KV3O 2OZPA 3OQBA 5I7VA 1WZIA 1OAAA 3QWFA 4MPDA 2GN8A 1Q1NA 5JC1A 5L7WA 3WYCA 4IQ8A 4MVJH 1Z7BA 1UXKA 1I36A 2AA3A 1XELA 7MDHA 1RKXA 5CAEA 3LVFO 2UYYA 4JBIA 1PJLA 5DBIA 1UDCA 4AJIA 3WOHA 3OP4A 3JQ6A 3PHGA 3RC1A 4HFRA 1PGNA 3CMCO 4M89A 1HYGA 2I66A 1DIGA 2PGLA 3ETDA 4JNKA 3QP9A 5CFZA 4U8GA 1VLLA 3EK2A 3GFBA 1XYGA 1N8KA 4A0SA 1GADO 2H6EA 1E1NA 3RBXA 4TRMA 2Q1WA 1NBOA 4Z9XA 4W82A 4R54A 3PJFA 3L9XA 4DBZA 3EC7A 4CV0A 1BTOA 2J3JA 4OOEA 3HADA 1QLJA 5F1OA 2CNBA 1GQYA 1E7YA 4BO3A 1JQBA 4CL8A 1P77A 3AFNA 4UAGA 5B4TA 1UZNA 4FSHA 2ZB3A 3RUCA 2VHYA 2PKQP 1I24A 3PI7A 2OGUA 2Y67A 2OFPA 2JD0A 1ORRA 1XG5A 5BNFA 2C59A 6LDHA 1ZCJA 3KSUA 3AM4A 3TF5A 4BO6A 1EVZA 4J3FA 4JXKA 4LSWA 2QHXA 3C1AA 2D5CA 3JYOA 5EINA 3FNGA 1E5LA 5JY6A 2ZYAA 4J49A 4JGBA 1PIWA 2GF2A 4RF2A 4RPLA 1I01A 3TQHA 4KUHA 3WGTA 3UCXA 4L4XA 1PJQA 2YV1A 3ENKA 3GMSA 3ENNA 3VPXA 1I3KA 1BW9A 1R0KA 4JP2A 2DU8A 4K9DA 1FXSA 2FZWA 1CJCA 3DZKA 4BKRA 2C07A 1P0FA 5I9LA 3VOSA 2GR9A 3FI9A 2FR1A 1ADCA 1GCUA 3VAZA 1HDGO 4AFNA 4E13A 1RYDA 2EP5A 2J3IA 3A28A 1EUDA 3OJFA 3I6QA 4BNNA 1ISJA 3EHEA 4U6SA 2AMFA 3RWBA 5TC4A 4AJNA 3F3SA 1FK8A 4RQUA 4I5FA 3NX4A 1HE2A 4IDGA 5GZ6A 3AM5A 1GD1O 1D3AA 3OA2A 2BI7A 3JQCA 3JYNA 4YAJA 3AWDA 4BO7A 4J2OA 1EZ4A 1ZUD1 4G81A 5A5EA 3SBOA 3U62A 3ZZNA 1H6AA 3NEPX 4YAIA 1BSVA 3E18A 1MXFA 4NBUA 5DT9A 1XU9A 1A9ZA 2AQ8A 4XYGA 4YT4A 3GF4A 4YEDA 3G1TA 5G0WA 1Z6ZA 1LLQA 1PJBA 2IZ0A 3DZBA 2OP1A 2G1UA 4ZRMA 5IFLA 2Q45A 1YJQA 4IXTA 1Y7TA 2UVDA 4JX8A 4PZEA 1DFGA 1PJ2A 5DBGA 4BB6A 2GASA 2NTVA 1VSVA 3OMLA 1CWUA 2B37A 4OO3A 4PZDA 1P31A 4NDNE 4OKNA 4AL4A 1KEPA 2B4RO 5G4KA 5TS3A 4EJ6A 4ZA2A 4KUEA 3L0DA 3DZGA 3ON5A 1Z75A 2UUOA 4GGPA 3SJ7A 3L6EA 1UDAA 3DR3A 3G79A 4HWKA 3U4HA 3VC7A 5IJZA 2UAGA 3QVWA 4CM5A 1NHGA 3INTA 4FFRA 2X0NA 2RHCA 4R01A 3CZRA 1N7HA 3JQ9C 3H8VA 3QLJA 1GUYA 1NPTO 4MVJI 3RFTA 4CMEC 1DRUA 2BH9A 3AK4A 5L40A 3RUHA 4LK3A 1QORA 2WYUA 4WUVA 4BNWA 5ICSA 4B4OA 3HDQA 1DAPA 4PLPA 1HRDA 4IDDA 4BNFA 4UUOA 5JDCC 3D4OA 3VZPA 3GNQA 1EUCA 1SZJG 1BDBA 2VWQA 1PGQA 4R4JA 2P4QA 4BNXA 2C5EA 3DBHA 4RVDA 1PZHA 5IXSA 1XIVA 3QVTA 1E3WA 1E7MA 1PJCA 1LSOA 2R6JA 4RVHA 4KMSA 1K2WA 1DO8A 4EITA 1I33A 3DHYA 1E6WA 4F6LA 3TJRA 1NVGA 3D64A 5CDTA 4E32A 3ZW8A 2FPPA 1YOVB 3VH2A 4J0FA 2AG5A 2YYYA 1ISFA 3FTPA 1XU7A 4OQZA 2O2YA 3TPCA 1KOLA 1YBVA 2D8AA 3O38A 4WJZA 2OORA 2W2LA 1ULSA 2PGJA 2B5WA 2X0JA 4L4SA 4O0LA 2CVZA 4CMIB 2CF6A 3K2BA 1DRWA 3Q1LA 5KIAA 5DN9A 1C1DA 1QR6A 1E3EA 3RSHA 1LDGA 1MGOA 1PQUA 1YXMA 2YY7A 3V1TC 5A04A 5IZ4A 1B3BA 3ZU5A 3IMFA 4DPLA 2VRBA 3GVIA 1WDMA 5J23A 3JCZA 2SCUA 1K6XA 1ZEJA 1C0IA 1U5AA 4BQPA 1NXQA 2WEKA 3QE3A 1SB8A 1CDOA 3KVOA 1NM5A 2AQKA 4YT2A 3QWHA 1Y8QB 3FCOA 3H9JA 2CZCA 4BV9A 2E48A 2EJWA 3JQBA 3RUIA 1VM6A 7ADHA 3GZNA 3PHHA 4J1NA 1EQUA 4J2HA 3TNLA 1Y5MA 5C37A 4DBVO 4LRTB 2B0JA 4NI5A 4Z0TA 3WGQA 1RWBA 3MJEA 1NQAO 1LJ8A 1BRMA 1ARZA 3K5PA 1EDZA 4N18A 2B4QA 3LDHA 1K3TA 4QUKA 1G6KA 4LRSB 3RFXA 1XQ1A 1DFHA 3ITKA 4FJ1A 1WVGA 4L76A 4RORA 4BGVA 5A06A 9LDBA 1X1EA 1HSOA 1F8GA 3BYZA 5IXYA 3OJEA 5A9TA 4D44A 4GKVA 1UAGA 4Y98A 1KYQA 4NQZA 3KM0A 3GK3A 3I1JA 3KLMX 4C7KA 3ONDA 3BHIA 1U7HA 4OSPA 3WR5A 1EDOA 3OECA 2TMGA 4EUFA 2O7SA 4XQGA 4B4VA 3EW7A 4I5GA 1E3JA 5U9CA 3OM9A 3H9QA 2AQHA 1RJWA 3D5TA 3HFSA 3OIDA 1UP4A 3CUKA 1GDHA 3VPGA 1KEWA 3MTGA 3LF2A 4J4BA 1HDZA 2E37A 2J3HA 4OXNA 2V7PA 1YO6A 2VUTA 4JBHA 5I7EA 3GQVA 3S2GA 1P1RA 1Q7BA 1QG6A 5IAAA 4BB5A 2BD0A 3K8ZA 3GDOA 3G1UA 5KJFA 3S2EA 2GCGA 2POQX 4YCAA 1X0VA 4KUGA 1TVEA 3WSVA 1Z45A 3NGXA 1YH3A 3WIDA 2RCYA 4EJMA 2FSVA 2FZEA 2X5OA 3HJAA 3KBOA 4IM7A 4MVJP 4WE3A 3VDRA 3EDMA 4URFA 1WDKA 4GX2A 4ALMA 5JCJD 5KVVA 1OMOA 3NAQA 4ND1A 4PRLA 3JQEA 4UUPA 2O3UA 4DPMA 1YOVA 2C2YA 4K6CA 4LN1A 3F4LA 5BNTA 4NU6A 5ES3A 1U7TA 3ZHYA 1HL3A 1IZ9A 1XLTA 4IQGA 3FBTA 3PXXA 5G2OA 3AOEC 5DBFA 4ALIA 2PZMA 3KTDA 4J1SA 1PR9A 4I5DA 1EMDA 5GMOA 4FQ8A 2CFCA 1E7WA 2G82A 5TT0A 5JYDA 4O5OA 4I08A 1DC3A 4OKIA 4UVGA 4HADA 3RCBA 2I6TA 3M6IA 2YV3A 3DONA 2EEZA 4K28A 2HLPA 3COSA 5IDYA 5F5NA 4BNGA 2QQ5A 4GLLA 1KVUA 1DJQA 1G1AA 1T1RA 2GYYA 2RAFA 4TZTA 1PX0A 4E5YA 4YR9A 3FBGA 2BMAA 1H93A 2ZB7A 1ZH8A 3GEGA 5CEJA 5CG2A 3SLGA 5ITVA 2EWMA 2X0RA 1KVRA 2PD6A 2JL1A 3BMOB 3C1TA 3UICA 3R3JA 4N5MA 1RPNA 4CLHA 4Y9DA 4E5NA 4YJGA 4BMVA 1PGPA 4W9NA 1NQOA 1UJMA 1XCBA 1U4SA 5FF9A 4MDHA 1HZJA 3RKUA 3STHA 3IKVA 2RH8A 3ZWOA 2GDZA 2PA3A 4XIJA 3E6AA 1XA0A 4L4RA 3VZRA 5FI3A 1ISGA 1Q7CA 1VL0A 2Q1UA 1C1DB 3GHYA 2Y1OA 3VH1A 1Y8RB 3CEAA 4YJDA 2OP0A 4GPD1 4RPKA 1AGNA 2XPCA 3Q9UA 2CUKA 1ONPA 3F5SA 3O03A 1HLPA 1ULUA 3BMQB 4GMFA 5ENDA 4XEHA 3GG9A 3ZU2A 3ULKA 3KB6A 3DQPA 3JQ7A 4MVJE 3ZWWA 4D43A 1SB9A 5A03A 3HN2A 1B26A 1QLHA 4L8VA 2DTXA 1WPQA 4KOAA 3WBBA 1BXGB 3HNPA 3JQAA 1HDYA 1VKOA 3I6IA 4J7XA 1YB5A 1O8CA 2NU8A 3VZSA 4F6CA 1UXIA 3X2EA 5L4SA 2PZKA 4O63O 4YQZA 3B6ZA 5JDIA 2DBQA 1ZBQA 1I3MA 1LSUA 2CDAA 2J5QA 1JVSA 4K26A 1I30A 5MGBA 2P9CA 1EE2A 2VOJA 1HDOA 2NSDA 3MWEB 3R0IA 4IZIA 1W0CA 1EFKA 4BKOA 2X7HA 3L4BA 4FJ2A 4WCFA 5LC1A 4ZQEA 4PIVA 3RROA 3U4CA 2GO1A 4BO0A 3DEYX 2BFOA 3H2SA 4IIVA 1OFGA 4KQWA 2Q1SA 3TOZA 2PZLA 3TZQA 1SC6A 3FNHA 4LVCA 2VHXA 2WE7A 2WDZA 3DBRB 3BTSA 3PEFA 4EEZA 5COQA 4DMMA 3RUDA 1V35A 3RASA 4GKBA 4E5KA 2FN7A 4NBRA 2O4CA 2YHIB 1H6BA 1NYTA 3D0OA 3PQEA 1KVTA 5KNLA 3B20A 1IPFA 4II2A 1JKJA 2GUGA 5G0SA 4J9UE 4GX5A 2IRWA 1Z74A 2HJSA 4ZRNA 5F1KA 3BHMA 4OL9A 3RD5A 1GPJA 1IYZA 4XX0A 1WP4A 1KBZA 5CPBA 5CDSA 3RQSA 4QX6A 2VN8A 4YJFB 1U9JA 3G3EA 4DTIA 1PQPA 4R5MA 2VYVA 4JJFA 2QG4A 4DRYA 3N7UA 1F12A 2WE8A 1NAHA 2GN6A 3GGOA 1QV7A 4CM3A 2Q50A 3CINA 1GZ6A 2IYOA 3BMNB 4KTVE 1CERA 1N2SA 5JE8A 4FIZA 4DMLA 3F47A 1H9AA 2FR0A 1GEGA 1PJSA 2VUUA 1VJTA 1E77A 4YA6A 1VL8A 2HQ1A 5JO9A 5ITWA 3GPIA 4BO4A 3H65A 1LUAA 2VZ0A 4O1MA 1PS9A 4W7HA 5L4NA 1DJNA 1YVEI 5EJ2A 3IKTA 2AXQA 3HHPA 1UP7A 1YL7A 2G17A 2NTJA 5A4DA 2NVUA 4OXYA 2CDBA 6ADHA 4NMHA 2HMVA 1DLJA 4DREA 3FR7A 2FY8A 4HFJA 2FSSA 1IL0A 2EKLA 3U4DA 3K2EA 1V8BA 1YDEA 3CPSA 2D0IA 3PPIA 1V6AA 2D3TA 1T25A 4RL6A 3LC2O 5U4QA 3ZU4A 3BTOA 5G4LA 4RPJA 5TT1A 1X7DA 1MFPA 3WB9A 1SBYA 5JSFA 5JXWA 2NU6A 3KEQA 4R9SA 4ZQHA 2OO5A 1Q0HA 2C82A 3JTMA 4P4NA 4CR6A 4IGEA 2H1SA 1PZGA 4Q3CA 4XYLA 4BOYA 1TI7A 2GZ1A 2R00C 5C7OO 1F8FA 1LBEA 1T2CA 2GZ2A 2ZCVA 5DDIP 1TLTA 1HWYA 2W8ZA 3I9KA 4CM4B 5EQDA 2ZTMA 2JKVA 4IDEA 4Z0PA 4AJLA 4JQCA 1SPXA 2ZK7A 4RF4A 2E6UX 2VNAA 5AOVA 5L7YA 2NTNA 3I83A 4CMGA 4NG5A 4W4TA 3ZI0A 3WX0A 2NNLD 4DGSA 1R6DA 1O94A 1G0OA 4BO1A 4CLRA 5IDXA 2XOXA 2HJRA 1UH5A 2EG9A 1QKIA 1PGOA 1QMGA 4FFNA 5AYVA 1H94A 3ASVA 3MEQA 3F46A 3ETEA 1ZK4A 1Y1PA 1OC2A 2F1KA 3F9IA 3JD4A 4R41A 1IHYA 2P9GA 4NK5A 4W7IA 3BIOA 4FOSA 1C0PA 3LQFA 5T8KC 3VVCA 3I9NA 4GMGA 4TVOA 4YQYA 1IB6A 1U3TA 1NVTA 2Z1NA 5EL0A 4KWIA 3VPSA 3ZWPA 5IZCC 5TIIA 1Y6JA 4WECA 4B8ZA 2YHIA 3BZUA 4N5LA 4ESOA 5GY7A 4B3HA 4OGWA 2A92A 1EVJA 3LC7O 2PK3A 1BDMA 3ROKA 5F21A 4P4GA 3SEFA 3ZWVA 5L4LA 4PVDA 3K30A 4CV3A 2AG8A 4BNHA 4AICA 4FCCA 5IZCA 2IEDA 3PQDA 3PP8A 4HFMA 3ZW9A 5C7LO 4LGVA 2E82A 3BTUA 1E7SA 2ZB4A 3VH3A 4TSKA 4A7PA 3N58A 1HTBA 1B8VA 4E2WA 4YT5A 5DNAA 2VZ9A 3WJ7A 2VHZA 1BXZA 3ABIA 3NUGA 2O4UX 1ISIA 4RF3A 5G0TA 5BNIA 3AUAA 4PZCA 3S2FA 3SJUA 2WTBA 5JAQA 3PJGA 2HUNA 1E0DA 4FFLA 4Y8VA 1LQUA 3H5AA 3BAZA 3GR6A 5LDHA 2FP4A 1OI7A 2FWMX 3PIDA 2ZATA 1JWBB 2O50A 3L9WA 4J16A 2ZIZA 4E6PA 3SLKA 4IJWA 5JS6A 1YQDA 1WAMA 2ZQZA 3DMTC 3M2PA 4QO8A 4B3IA 4ZHSA 5B12A 3WGIA 3Q9NA 1YB1A 4DYVA 1ONNA 3ETGA 4IJVA 1A7AA 2J5KA 3G49A 2BGLA 3HB5X 3JQFC 5C3MA 4Z9YA 5IDQA 4B7XA 1F06A 1LRKA 1E6UA 2P5UA 2CD9A 3I3OA 4A26A 3PJDA 4LISA 4FD3A 5EESA 5TJ9A 4RV9A 4CQLA 1TEHA 5DULA 3E5MA 4BO9A 1Y9AA 3QSGA 1ZKMA 3PGJA 4YTEA 3AY7A 1R12A 2B5VA 2NUAA 4EYEA 3RBVA 1GY8A 1E1MA 3K31A 3R3SA 1B8UA 1C3VA 2GSDA 4IJUA 1CEQA 4NHEA 4I9HA 4BO8A 4A10A 5ER6A 4PG8A 4MVJD 4RZIA 3KETA 3LC1O 1H6CA 3ZWNA 4E31A 2ZCUA 4Q9NA 3W8DA 4TWRA 2GRAA 2XXJA 5BT9A 5DOZA 2IDZA 1MG0A 1T1SA 3DTTA 2EJVA 4WLFA 3DBVO 1E7RA 1HDCA 5JAMA 1U3VA 3GG2A 2QYTA 2YHUA 5JAZA 2BRUA 3U4IA 2I3AA 2D2IA 1E92A 1PTJA 1ZXBA 4NU5A 3OETA 1TB4A 4H16A 4YYZA 1NPYA 2HU2A 2PR2A 3W6ZA 5JFOA 4G65A 3C8MA 3I9MA 3KUXA 2NVWA 2BELA 4E3ZA 2VNSA 5JYEA 2Y68A 2A4KA 1IULA 2P4HX 1CRWG 2Y0CA 1BGVA 2Q2WA 4FC6A 2QW8A 4MVJA 4IIUA 3WWYA 3IDSA 2O3RA 2BGMA 4C7JA 3ANLA 1RM5A 2JAPA 4NZ9A 1MB4A 3AW9A 4AG3A 3LF1A 4QXMA 3IJPA 3QRWA 4CM8B 2Y0DA 4MP3A 3WG9A 1ZW1A 1CF2O 1OBFO 3IQDB 4O59O 4DUPA 1AN9A 2DPGA 3ANNA 5B4VA 3JQGA 3PFWO 4FC7A 3CIFA 2FRDA 5FI5A 1KVSA 3FHLA 1WNTA 2VQ3A 1I0ZA 4Q3BA 1PL8A 5BR7A 1B3RA 3O4RA 1VSUA 4YBZA 4HNGA 1XQ6A 3NYWA 1A9YA 3I5MA 3NTQA 3RBZA 3L4BC 4P4LA 2EW2A 5KTKA 5L95A 1NR1A 3EUWA 3K96A 3EY4A 4BNVA 4OOFA 1JAYA 1E1KA 3ZV6A 1A71A 3GAFA 1YQGA 3NT4A 4IDCA 3DB2A 4ZU3A 2IEBA 1HE3A 2IODA 3UVEA 1H2BA 2Y1DA 2PGDA 1X1TA 3AM3A 1WDLA 1F17A 3JYLA 1Y9EA 4A27A 4BS9A 1NWCA 2G5CA 1UXGA 4OQYA 3PWZA 3O8QA 3PLNA 4ZQFA 5FEUA 3OSUA 1AHIA 2HMUA 2C7GA 2QYSA 4GVLA 3AI3A 3WMWA 4QEDA 4GSKA 1QYWA 4RQTA 4TRJA 4MVJM 4EZBA 3QVOA 2W98A 1PSDA 3E48A 4AJEA 4D3FA 3LT4A 1G0NA 5BSFA 1H2HA 2UDPA 4IMRA 2FR8A 3AY6A 5G0UA 3RUAA 4RPHA 1ENOA 1T2EA 3ZWYA 3AUSA 1W8DA 2ZB8A 4IPTA 4OXKA 1ENYA 2YFHA 2FOIA 3A06A 5COAA 5EPOA 3DL2A 3VPFA 2O48X 3FTNA 1KY4A 2VHWA 3VVBA 2DBZA 2GNAA 1K0UA 4DA9A 1GTMA 3MJ4A 3RVDA 4BKUA 4ZN6A 2QX7A 3O9ZA 3R1IA 2DVMA 3GZNB 4XD2A 4Z6KA 4IGFA 3IL2A 1I8TA 3PWSA 2V6MA 3RAJA 2NQ8A 2HMWA 1AHHA 5H83A 1FF9A 3WBFA 1PJ3A 1SOVA 1MXHA 4XRGA 3DFUA 4QT0A 5A5FA 4CLXA 3PYMA 1I2BA 4Y6PA 5ICMA 3GVPA 1NNUA 5DCWA 5BSEA 2OBNA 4M54A 3AJRA 4B7CA 4D79A 1EK6A 3Q2KA 4QFCA 2CY0A 1VI2A 2VT2A 3W6UA 1DHTA 4BQRA 4JIGA 3NT5A 2VYVD 2A94A 2WYWA 3FR8A 2O7QA 4ZICA 4IJKA 3TDKA 1GEEA 1ONOA 4UULA 1B7GO 2EGHA 4UUMA 3DBLB 3E8XA 3QW2A 2TMDA 5U1PA 3ROQA 3JQAB 4A2CA 4CM4A 1QRRA 2FPGA 1GR0A 3RIHA 4CQMB 5F3RA 4EGFA 5L7TA 1F0YA 3M2TA 4DQXA 4CLOA 1JU9A 4KQXA 3GEDA 1OC4A 4AJ4A 1ADFA 4TKMA 3FF4A 1TT5B 1GQ2A 1KETA 4B3JA 1JDJA 2O3JA 4FFMA 1UXJA 4J4HA 2W4QA 4RF5A 1V0JA 3QWBA 4XR4A 2YQ5A 1YJ8A 4FOOA 5B1YA 1BG6A 1KERA 2H9IA 2QIOA 4BVAA 2RHRA 1P44A 4EW6A 3LLSA 3VH4A 2DFDA 4ALLA 3HZZA 1AXGA 4BNMA 1W6UA 5F5LA 4DC0A 3KYCB 1LNQA 3MJSA 4D46A 5AXAA 3D1LA 3NDRA 5I7SA 3E82A 4CMBA 3L07A 2P91A 1NX6A 2VCYA 3H9GA 3MCVA 4CMKA 4QFDA 4RJTA 2BGKA 2C2XA 4E2YA 1AE1A 1D1SA 2C29D 3PDJA 2DBVO 4KDEA 2C20A 3DWFA 4DIFA 4MINA 4L75A 4QQRA 2X9GA 1UR5A 3TOXA 1HZZA 1V3TA 5KCZA 2I76A 3H5NA 4ID9A 3T7CA 4E33A 2LDXA 1U8XX 1O5IA 3AY3A 1Y5RA 2HCTA 2CDCA 1B8PA 2HAEA 1HETA 1P3DA 3NGLA 1UXHA 2PTGA 3ZV3A 1Y81A 4U7WA 4CM7A 4D7AA 1C1XA 1ZMOA 2X5KO 3ZHBA 3HWRA 4UUNA 3DXFA 2HSDA 2NADA 3BMNA 4WLEA 2G0TA 2DUWA 3U09A 1N7GA 1A4UA 3A14A 4NFHA 5KJ1A 3BMOA 2DUUA 3TWOA 5KVSA 3ADPA 1W4ZA 3QQPA 3PTZA 1GYRA 1PQWA 2JFHA 1QV6A 3WGHA 1FMCA 2EKPA 4CJXA 1VRWA 4XB2A 3PK0A 1R37A 4R68A 1PJTA 5JLAA 2JFGA 3NDJA 4QO7A 4W9NC 3OFSA 2NV6A 3MOGA 1DBVO 4B8WA 2Y0EA 3GGPA 3GAZA 1ENZA 3S8MA 2V6FA 5HWSA 2NVUB 1LDBA 2XXBA 1PS0A 3U49A 1SOWA 3AOGA 4NPCA 1GAEO 5DP1A 4WKGA 2F00A 3U3XA 4BIIA 4DLBA 3GN2A 3AOEA 4BMNA 4RLHA 1KC3A 3LK7A 1WWKA 1MP0A 5B4UA 3TFQA 4BKPA 4L9RA 1RM0A 3JD0A 4BNYA 4MIOA 5K6AC 2J8ZA 1B2LA 2X9NA 2BFAA 1XDWA 3WFIA 1W73A 5EQFA 2IXBA 5DF1A 4XR9A 5I9NA 3NT2A 4BNJA 4E21A 1VKNA 3I9JA 1U3UA 1ZK2A 2EXXA 3LT2A 4KZPA 4PGFA 4WLOA 3A9WA 4WGGA 3KRTA 4L0QA 2P5YA 2X22A 3TL2A 4CMAA 5HM8A 3DZJA 3KHUA 4I5EA 4MVJG 5KVCA 1TT5A 3OIFA 2CMDA 4BGUA 2IYPA 3HG7A 5G4KB 2HK7A 2QZZA 4FPXA 3CSDA 2BFMA 2A9FA 3FWZA 3GLQA 2DLDA 3H9UA 3GFGA 1C0LA 4XJTA 5JCJA 4BNIA 5CEFA 3AU9A 1ZZEA 4IS2A 3GUYA 4OMUA 1B15A 2EGGA 3WXBA 4JCOA 1TXGA 4HV4A 2FPIA 3EMKA 3G0OA 1DIBA 3FNEA 1FDVA 1KEVA 1Z7EA 3DO5A 3QV1A 5HA5A 5ADHA 4FR5A 4ROSA 1BXKA 3I4CA 5FFFA 3IIEA 1JW9B 3WQRA 4PLGA 4G5HA 4CM8A 3IP3A 5JAIA 2YJZA 3JQ9A 1DDOA 3OEYA 1R4MA 3TFOA 3A4VA 3SC6A 1C0KA 4WOKA 4KP7A 3C3XA 2VTDA 3QVXA 1QYCA 4Q3EA 1ISMA 4G2NA 1J4AA 4OHUA 1L1FA 4ZQBA 4IUYA 1DC6A 5CDYA 4I1IA 3UOGA 2NQTA 1D7OA 2C0CA 2J3KA 3MJTA 4FJ0A 1ENPA 4LSMA 5A3VA 4DQUA 2X1HA 3WDSA 3WQSB 4A73A 3KO8A 5TSDA 4BMSA 1SMKA 3KOUA 3M1LA 3PHJA 3D4NA 1FDUA 4D0SA 4DVJA 3L77A 3MJCA 4M86A 2DFVA 2HO5A 3TSCA 4WLUA 1DXYA 1I3NA 5TGDA 5I9MA 4ZQGA 2JCYA 4BO5A 1E3IA 4GSLA 1JVBA 3V1YA 5JMWA 1N92A 2QRKA 5CDUA 1P1FA 2YFQA 2A35A 3HQ4O 3PGXA 2D5AA 5CP8A 4DIBA 3ORFA 4WNIA 5COBA 5TF4A 4R1UA 1E3WB 3EVTA 3ZWAA 3IP1A 5GZ1A 1HXHA 1N5DA 3ONFA 4GH5A 1I2ZA 4I9UA 3UCFA 1ZSYA 5DP2A 1VC2A 3S2IA 1MG5A 3VTFA 2ZKLA 2DKNA 3AU8A 3PDUA 5K9ZA 4XYBA 2P68A 2C5AA 2Q1TA 1I32A 3ITDA 1NQ5A 3TZCA 2PZJA 4BL5A 4OJNA 4ITUA 5GZ3A 4TRRA 4Q3DA 1KIFA 3PLRA 5G0VA 1S6YA 4N54A 2Y1CA 1N1EA 4GGOA 4NH4A 1M6HA 2DTEA 1H9BA 3OJ0A 4GL4A 2PKQO 1DIRA 2EW8A 2PWZA 5TNXA 3P19A 3VKUA 9LDTA 4FN4A 3W4KA 3KSZO 2NM0A 1E6EA 4J0EA 2VWHA 4R51A 3WLFA 4XGKA 1GV1A 3ASUA 2BFPA 1P1KA 2XAAA 4GWGA 4INAA 5AXBA 4U6QA 1NFRA 4MP8A 5T67A 1MUUA 3PIIA 4HXYA 3VZQA 4JLWA 2VYND 2Y99A 1YONA 2RIRA 4UEJA 3UFXA 3EGOA 3TRIA 4ONEA 4TZKA 3ZHXA 2DTDA 3GHHA 3PFFA 4NFSA 4EI2A 3GZ4A 1LI4A 4WPGA 1HLDA 1O9BA 2AQIA 2WD7A 1T4DA 4II3A 3B1JA 2XF8A 4ND5A 2O3SA 3B1FA 4WK6A 4PLTA 3KZVA 5TQVA 3U5TA 1PWZA 4J1TA 4JK3A 3ST7A 5KJEA 3E5RA 4XYMA 4CM1A 2I65A 1ZSNA 1IHXA 3T4XA 1IE3A 2OHXA 4PLFA 1E5QA 1HDXA 3QA9A 1XEAA 1Q2XA 4NBTA 1YL5A 3WGYA 3L6OO 2HRZA 4J43A 2ZTLA 4I8XA 5HBRA 2CF5A 3S55A 1U2DA 3DZIA 1M67A 5F1PA 4CMJA 3ZNQA 5IG2A 1JKFA 3DC2A 1HYEA 3ZNNA 3UHAA 2YDYA 4KWHA 1BHSA 3UN1A 4TKLA 2YDXA 5K0ZA 4YPOA 4XJSA 1DLIA 4R1TA 2WMDA 2FMUA 2W2LD 3GVXA 3CKYA 2UV8A 2AW5A 1P1HA 3EVNA 2GZ3A 5T8KA 1P1IA 3UUWA 4IDBA 2B4TO 2W2KB 1GYQA 5AXCA 4HX5A 2JD1A 3HE3A 4IQ0A 5KWEA 5DCUA 2IXAA 1MC5A 1ZO8A 1ZEMA 3Q6IA 2C7VA 3VTZA 3X2FA 4ALNA 4PLHA 1RYEA 3O26A 1I3LA 1P0CA 3IC5A 1GYPA 5HS4A 1BVUA 4TMFA 4E12A 5EERA 3Q2IA 2I67A 1IOLA 1YS4A 3V2HA 1ZSVA 1P1JA 3RUFA 3OHSX 5JO0A 5KJCA 4YJHB 1N9GA 1E3LA 4RVUA 4EDFA 3H5RA 3K9QO 4XCVA 4GLOA 1YDWA 3SC4A 1UZMA 1DFIA 5JMPA
chains in the Genus database with same CATH superfamily
1JNYA 3I2KA 4QPZA 5BUSA 3E61A 4CIYA 4PV7A 5KOJA 1PGJA 1JUDA 3S28A 4CCYA 1FZQA 2CGEA 1Z2EA 1CETA 3SBEA 4Q1AA 3ICWA 1OY1A 3PQ3A 2YJNA 3Q7PA 5CFOA 2BSQA 3RC8A 2Q49A 1ZLYA 2AFIA 5GONB 5C1OA 2XVZA 4GP6A 5BO5A 1HGXA 1O4VA 4FFOA 2Y9PB 1PJRA 5CA0A 4F3YA 1F51E 1KNXA 1PU2A 2XUHA 3AEYA 4HDKA 3AEKA 5MN5A 2Q27A 4KQFA 1AQUA 1NVKA 1X3LA 1GILA 2X23A 3RR2A 3FMFA 4NMMA 3L7LA 2WKSA 4J7CA 3UXMA 2WABA 4WLNA 3HJRA 3VR0A 3NAMA 4NMLA 1AKEA 1GAXA 4YIHA 1J0XO 1Y8ZA 2YW9A 3BSYA 5KX5A 3SVTA 2DG2A 2CXUA 3OIVA 2FVXA 1R3UA 1T36B 4XM2A 4EHAA 1DC5A 4EBFA 3HCBA 4KO1S 4X8LA 1SR8A 1H0HA 4HSGA 3DE6X 5EA2A 1VG0B 3F2VA 2RKOA 4H60A 2RHMA 5HF5A 4AZ3A 4TSRA 1F14A 1OWMA 3UB2A 3Q5GA 5EVJA 2AH5A 4D4MA 1P72A 2HN9A 3LQQA 4KI7A 3RRMA 1AUVA 2YWRA 3FRIA 3LDAA 4FQ5A 1QU3A 3FGPA 5T5QA 5BURA 3PNMA 3B3JA 3NHSA 4P8RA 5JV5A 1VB5A 1CZRA 2BHRA 3HDYA 3ZN2A 4DS3A 3KYDA 3OLQA 3PD0A 4BRWA 3HO8A 1ZJZA 4YACA 1AN0A 2KB0A 1J5PA 4XARA 3TW8B 1XD2A 5CXXA 4I1OA 5JPDA 2HT1A 4RNCA 1GSIA 2FQWA 1Q16A 2W0MA 3WISA 5JECA 2IBTA 4AJHA 4EVRA 4EPYA 1BFKA 3GEIA 4NEGA 4YJ2B 4JWTA 1YKFA 4WBXC 5FOQA 4R3UC 4FGJA 4YRAA 4MB6A 1UAYA 5ALLA 3KQWA 3TCXB 4PAOA 5HCIA 3UW3A 1EK5A 1BWPA 3MMSA 1XZLA 1VJDA 4EJSA 1T5BA 1XMIA 3KQNA 2OESA 4M99A 5EIOA 2XRZA 3VC3A 3SHWA 1WCWA 2O5RA 2OOSA 4G84A 1ZIDA 2PH5A 1OH6A 3FHJA 3KFVA 4F5EA 5JVDF 1AGPA 1GFSA 2ILTA 2VAPA 2XYVA 3GGDA 2ET6A 4GEGA 4WA7A 3W5AA 3CE6A 3H11A 3ZWCA 2VQ6A 1NXTA 4BP9A 2R8EA 1W9HA 4ZDKA 3MJRA 3N8GA 4CKZA 3BCHA 4ID3A 4MRVA 5FBRB 1HSZA 4XLZA 5HEKA 2PSSA 3TW0A 1Q0TA 4OU5A 4XYEA 2WD8A 4L9AA 2QVYX 4ZV9A 4BP8A 3IJ5A 3PJEA 1EGAA 2PL9A 4X91A 5AICA 2WVAA 4BNDA 3RSQA 4KO2S 4P58A 1XWFA 2C95A 3EB9A 4P9NA 1U94A 2HTFA 3AYXB 4W9RA 1MGPA 5SYMA 2RK3A 1L7XA 3Q9LA 4MKXA 4LJKA 5KPDA 2C5HA 4OFZA 5EMMA 3NUZA 4N0MA 3PPXA 4E2XA 3ZY5A 2CNKA 2A5GA 1K4KA 1FSPA 3N2NA 3OZ7A 4UVDA 3QYAA 2WJJA 3ZNOA 5EIEA 2GH1A 5KYNA 1ZM7A 5ENVA 1AO0A 2FN9A 4AJPA 1V16A 2GNPA 4BECA 5JCOC 2X9VA 5GAJA 1LRLA 1X15A 3UHFA 3W05A 1FFSA 2CVQA 2RB4A 1QCZA 2H65A 3O73A 4OUDA 2Y66A 4UMFA 5TEVA 1D6MA 1JR3D 3ZE9A 5C7IO 2VWGA 1OFVA 2HRQA 1A2BA 1W1UA 2Q3HA 3S2YA 3IUYA 2PUAA 4D0RA 3WRXA 3E1KA 3IE0A 1QFJA 2ISSD 1ECLA 2GD1O 5B3JA 3TW4A 2X4GA 1D0IA 4GGMX 3T0IA 2ISQA 1SCQA 3FNFA 5K45A 5GWXA 1OOEA 4AF8A 3KOWA 2X15A 3L2OB 3LPMA 3T95A 3V00A 5C52B 1EZZA 4X6UA 3W04A 4KOEC 1R8QA 3Q5DA 5C81A 2AOTA 5EP2A 3WGLA 3K09A 1NE7A 5KQMA 2JHGA 2A5FA 4EUHA 2GERA 3AFHA 5F1YA 1VE9A 2ZAMA 4HGZA 5KKAA 5GV8A 1PZEA 4P3NA 3BDIA 3EAFA 5AJWA 3LUKA 4RTSA 4C4RA 3CWQA 2WB4A 4YIKA 3EDQA 2FH5B 1BVRA 2EARA 4G2TA 4LJ6A 4M9ZA 4NJEB 1K89A 1Q15A 4YAGA 2C7OA 2EP7A 4P98A 3T7TA 2ZJZA 4D9CA 5DIZA 1G2PA 1OX4A 1Z25A 1W96A 3MIIA 3OEHA 4I50B 4X3CA 2PMFA 3V4FA 5KTMA 4OM7A 3TD2A 1IQPA 2JAOA 2BONA 2Q3CA 3ZC3A 2G5TA 3QEAZ 4LMRA 2FEAA 1H1TA 2JJ8A 2WYHA 3N87A 4JLPA 3TDNA 3B8HA 1SEPA 4RZQA 4XOIA 4ZEWA 3ZU6A 4DOMA 3KSBC 3D6NB 2ZRHA 2C98A 2HY7A 2JEOA 4EO4A 1Z2AA 1U0SY 3FFWA 3KJQA 2OL4A 3L7JA 4RC9A 4KR3A 3I9V1 1K5DA 1ZNYA 2QORA 2DY0A 1LZLA 1T2VA 1FFGA 3GDFA 1WW2A 3RS9A 3VYVA 2OZKA 2HA4A 5DNYB 5H4HA 1AKRA 2ZIAA 3KSMA 4FHZA 4BFUA 3GH3A 1FX0B 3KWLA 1P4AA 1P9LA 2FEPA 4GOMD 3EOAI 5DXJA 3RJ5A 3ZNPA 4CPDA 1XZIA 3SZOA 3LPNA 3MZ0A 1Y5IA 4UD2A 3EN0A 2JVKA 3MWDB 1BMFD 4MQBA 4MWZA 3U16A 3WWPA 4BRSA 3EULA 2XGSA 1RCUA 3KL4A 4IKPA 1G3MA 3X1WA 3I5AA 1Q7TA 3V2UA 3M3HA 1BNCA 4MLDA 3H7AA 1WXDA 4XXHA 1I6LA 4COOA 2AUTA 2UVQA 2ZKIA 1C2TA 1YQXA 1AGYA 2NPIA 5EWLB 3C4QA 3K16A 5FAKA 5IPFA 1XQYA 4Y2QA 3MT8A 1HT1E 1T1EA 1XNJA 1LPBB 1T2UA 2AMJA 2CVPA 3IXMA 4J0CA 1C80A 1DO2A 4WLVA 2GF9A 3LLCA 4IEIA 1M2GA 1PDOA 1OLUB 4YLYA 3ELYA 1ZH0A 4OHKA 3K0AB 4YRDA 4WCFC 5JHGB 5CFPA 4C0AC 1NP3A 2ZJ3A 4RCVA 2VRCA 1D2AA 4J6EA 1QXSA 2QRGA 4OH1A 4ZGBA 1AMOA 3NHYA 8LDHA 3K9FC 4FLFA 1RYZA 2WU4A 5H70A 3CW2A 1CNMA 1CIVA 4GR4A 2IITA 1NKSA 1IOWA 1BQ4A 1FOEB 1E18A 2NV0A 4F2PA 1SXQA 2QQFA 2AYYA 2GAFA 3HKEA 4JROA 2VH5R 1WMDA 5ES4B 3BQ9A 1KEZA 1ZWLA 4M87A 2JIZD 4Q47A 2QTTA 2ASVA 2Y1FA 4EA7A 2ZE8A 2XUQA 1WUIS 3CZAA 3HEBA 3BCSA 5A9SB 1XTBA 1ZM9A 3RSSA 3I9V6 2V6GA 1QIDA 2A57A 1N1GA 2CSUA 3GEMA 5G3ZA 2B35A 4K40A 3M7IA 2FSPA 4M0LA 2QU7A 2AJBA 2I62A 4AKGA 3N05A 1KQNA 4D96A 1OH7A 1WU7A 3GUHA 1X13A 4QTYA 1GTG1 2IYSA 1SXJB 3DFZA 2R8BA 3BPSA 3P4UA 4ZQCB 4JYZA 4MRSA 4GC5A 1ES9A 1OREA 3FYTA 2VYQA 3L6CA 3OOEA 3SS9X 3ZD9A 4ZGWA 5EWMA 5BVGB 1VKHA 4IO1A 4D9BA 4CEJB 2AZ4A 1SCBA 2RH4A 1SVLA 2PVSA 4YO7A 1H6DA 2CSXA 4P82A 3M1IA 3I53A 1HE4A 4GPIB 1NW9B 1E9FA 4ZOQI 5A02A 5I3ZA 1XMOB 5EUCA 1L4FA 4RMHA 1L4BA 1NFQA 4DG8A 4PO8A 1BU8A 3EFOB 4Q4HB 2EKDA 1QO0A 1GGEA 4MS1B 1DC4A 1RXCA 2DPHA 4RZ2A 4HY3A 1CR4A 1Z6XA 2DM6A 3NOQA 4BLOA 4UTVA 1UFRA 4WZBA 1B41A 1E9SA 3IDFA 4HUJA 5E6UA 1A95A 1IUKA 3MWKA 4D4HA 4I19A 2DWUA 1XTZA 5DSXA 1Q1GA 4HNHA 4J4TA 4FX5A 5ESRA 3E3OA 2ERCA 4TVBA 4V38A 2OECA 4OQXA 5HCUA 4F91B 3BB4A 5HJ5A 3TGPA 4RD6A 2PX5A 2CXPA 2EKQA 3PQ5A 5LIRA 2WYOA 4YRNA 1HDEA 1OV4A 1OKKD 4MWCA 4L9WA 5IC5A 3WIOA 2NU7A 4NZNA 5BWMA 5K8IA 1DI0A 2MSWA 2HI0A 5GONA 4QOEA 3WIEA 1DRVA 2AE1A 2XE6A 2D4AA 2B2CA 1PD1A 3LT0A 2ZJ8A 2X86A 3OZRA 2HMSA 4GMKA 2HRRA 4UM5A 1DMSA 4QT4A 1MLDA 1WVMA 2NU9A 5DHQA 1X80A 1XRLA 2JVJA 3KTOA 3C48A 3KFLA 3OICA 4Q01A 2X41A 5F7XA 4MIYA 1SG6A 2Q2OA 3EA0A 2EERA 1QP8A 3E23A 1LK5A 2ZVPX 3WDKA 5CEEA 1VJ1A 1GAQA 1NOJA 5K5EA 5A9SA 2ID9A 4I3HA 4C0KA 1CUDA 5LQJA 2RJNA 1K5HA 1NLZA 3FX2A 3M8KA 4FI3C 4INOA 1MAWA 1Z5GA 2QVLA 2WZDA 2TSYB 3ND5A 4YP5A 3SR4A 4MUNA 2PZEA 1T91A 3OU2A 4O5AA 4QXQA 1XQVA 4QL3A 1JQLB 4FR0A 4M9RA 1EP1B 4MKRA 3ZE7A 2ZZKA 2GBPA 3NKFA 3VOTA 3HZRA 3GAAA 3MA0A 2HNKA 2DYKA 4WOJA 4XQEA 1A97A 3P7MA 2B9EA 4H7IA 3NBAA 2PD3A 3OJXA 3N53A 3ROZA 3DV0B 4G0PA 5EMHA 1GG5A 2FZVA 1TUBB 3BGIA 3JQDA 4JJ7A 4Q7LA 5E1OA 3WS7A 4O4LF 4Y67A 3DCIA 4NCIA 4FW8A 1Z8FA 3UMSA 2WJPA 2JRCA 1R5JA 1QQ7A 3MQ4A 1MFZA 3X1KA 1ND5A 4H3VA 2WT9A 4FDVA 3DDSA 1P33A 1VXRA 2JFXA 3AIIA 3L01A 4OQLA 3PF9A 3UK1A 4ALJA 5EXSA 4WXHA 3CUYA 2ZJ4A 2ZRCA 2O2IA 4XX1A 4UHEA 1CY8A 3NRBA 1A82A 4UNNA 1B8NA 1FDIA 1RQ2A 2EYQA 1JTVA 4S1WA 5SY6A 3NYQA 2DE0X 1N3IA 3DXYA 1YHNA 5FXMA 2PXAA 3KPVA 2IC5A 1BHQ1 1KDYA 3SZLA 3IS3A 3WAJA 4KPYA 4MRNA 4DRZA 5EP4A 3LD9A 1W36D 4EJSB 4FFPA 2Q29A 3LHIA 3EZ2A 3IOCA 2OBYA 4X1IA 1JALA 3ZJYA 5E4JA 3SZGA 4DMFA 3R6DA 3W2EA 5E7MA 2WVGA 3IODA 3HUDA 2F3RA 3L0OA 4DDKA 4EM6A 1MV8A 3H2ZA 4ZHQA 2HHHB 5JCZA 2WOJA 3KEFA 1C7JA 1X42A 2JZCA 3VGJA 2R5NA 1FRZA 1M0EA 2BCGY 4N6OA 4NEQA 3G0HA 2IUYA 4RW0A 1JPUA 4F7DA 3NDIA 5BXYA 1QCYA 2PUVA 3KYJB 4IX1A 3WKAA 3TSAA 4AUMA 5CBKA 1Q20A 2G76A 2Y1EA 3O4IA 4B33A 2HJGA 2IZ1A 5FBHA 1RM4A 1J9EA 2EX1A 1S8FA 4PRKA 1V8OA 2K5UA 1RW4A 3G0IA 1D1TA 5FHQA 3N2KB 2R62A 5EMKA 3UCEA 4EMSA 2YCBA 5KTKA 1OIWA 2PNJA 4UMEA 5IBCA 3HJFA 1U4NA 3GRYA 5SZKB 3HTXA 5LCXA 1ZJYA 1RLOA 3C3JA 2PV7A 2GK3A 3RG8A 3CZQA 3HB4X 4CU2A 4CXMA 2WWXA 3RRBA 1J70A 1MX5A 3PYLA 3KEMA 3SFVA 5I9SA 2X8LA 1FTWA 3DYIA 3QIAA 1GZ3A 1PAUA 2GLXA 4DA4A 1Z29A 3UJCA 1P7CA 4NE2A 3HLYA 1U8FO 5KDLA 4JJGA 3N6XA 1ZNQO 2J9GA 3IAHA 4A8JB 3CA8A 2JD2A 4Y1FA 1AX9A 3KJNA 3R75A 1FYDA 3RHSA 3TVYA 3WGGA 1AC5A 1ECJA 4RIHA 5DTIA 3EEOA 1UMCA 4W8OA 4CMIA 2HPAA 4TGLA 1AKWA 4CN8A 3R5FA 3WWEA 3VNUA 1YR9A 1YS7A 2D7JA 3I9LA 1KFBB 4OL0A 1DTEA 3QPWA 1XZAA 2K2WA 5E95A 1NBIA 4PG4A 5AI9A 3GVHA 3AKYA 2Y4NA 3O91A 2PXCA 3TJZA 1DG9A 3HP1A 3HV0A 4JT2A 4KVGA 3T5MA 3AVWA 2EAUA 2JKYA 1DCFA 1PVDA 3HSSA 4QDKA 1NE2A 2WG1A 1V9LA 5LDGA 4TN5A 4LOHA 5CNIA 3IT3A 4X61A 4XCXA 4UNIA 4ZALA 2YWHA 1J1IA 2QUHA 3JD1A 4FKMA 3FN4A 2QTFA 4LDNA 1CD5A 3S29A 1N2JA 1Q74A 3OJLA 1VPDA 1J24A 1K8YB 2R9VA 5JH7A 2PE5A 5ICGA 3Q8KA 3REOA 2X4LA 3G7SA 4O29A 3TIXB 3VYUB 5C5CA 1PL7A 3NVMB 3GFVA 4M7PA 1JA0A 3QUAA 4XSHA 1HQKA 3F97A 2PKEA 1YB4A 2BDEA 3AVUA 5BQXA 2ATVA 2FUNB 2JA1A 5HMLA 3NTUA 2CZGA 2EBHX 2GPAA 1O5OA 5TARA 4BYGA 2H0RA 4B44A 3K3PA 4BP1A 4X62B 5JZVA 2Z5LA 5AVOA 3ETHA 3L02A 1H8HA 3BSWA 2O8NA 3R2JA 1N6HA 3ND6A 3T1HB 2A3RA 2ZRJA 2AE2A 4Z9FA 4CKWB 4HFNA 3O82A 9GPBA 4B3TB 4BFVA 1BXRA 5B7GA 2HK8A 2G0AA 5T6BA 3HBMA 4D82A 4Z4HA 4CL2A 1U7XA 1LK0A 1Y8RA 2I8CA 3V8BA 2AKAB 3CX8A 3DKIA 4G9BA 2CB0A 3UXYA 4GUDA 4WK2B 2QMZA 4EZEA 1LC0A 2IVZA 5AHWA 5KTTA 3DOOA 4F5DA 3QLVC 1N2GA 3WLIA 1E0AA 1RC0A 5DMXA 1JMVA 5IKEA 3WJAA 5EE5B 1OI2A 1LDEA 4B48A 4CMCA 4AURA 3CNOA 2IS6A 3RHZA 2QRHA 4L51A 4XZ3A 3NJ8A 4GPTA 2IUSA 5HIAA 3I4LA 1E58A 5TJHA 1CX9B 3MWYW 2Q46A 1WUTA 1T0JB 4N6NA 5L45A 3U7HB 3L1IA 4OYRA 1JKJB 1FMTA 1Z6YA 2J6IA 2ADMA 4S1OA 4XDZA 1KC1A 4OKSA 1QRTA 4O4JF 4Q16A 4TMWA 4AMZA 3WTCA 5F3DA 2ECKA 2E4AA 4CQMA 5A3JA 3ENWA 2QXYA 3GJSA 1ZU5A 1S1CA 1QTNA 1U8UA 5THKA 4S1VA 5KVQA 1KQ3A 2YV5A 1LJUA 4WGFA 4KDRA 1EIZA 3RS3A 1EU1A 1PFUA 4UU0A 1NUPA 1YRLA 4YRSA 5AD1A 3W3ZB 3HCAA 1JFFA 1EVYA 2XVMA 1EP9A 4HYTA 4LJSA 2P8SA 1DQNA 4H0CA 1EFAA 3DHNA 4MOWA 4KQ2A 4RFSB 1X7GA 3LIPA 4JWKA 4JT9A 3KDSE 5FA6A 3BXXA 3ZD6A 3KVVA 2BHSA 1DU4A 1DIAA 2EC5A 3C6QA 1HDRA 5CLIA 1WXIA 1DKRA 1YUBA 2RCNA 3ZEAA 3H4VA 2H63A 3ZWBA 3BGOS 4DSOA 1UPTA 1ZI8A 3N6VA 4TLAA 4AM8A 4E2ZA 3O9MA 4GFDA 1L7AA 3CN9A 3EYWA 1LQTA 4FYJA 5CB0A 3VVMA 2EV9A 1KYZA 2FKNA 2IGTA 3T0GA 4FMCB 1GFWA 1OXSC 2BGUA 2VUSA 4CCYB 1OCEA 2I22A 5K0EA 4DLLA 3VR4D 4XWTA 3O8QB 3H3FA 4OGLA 1Z6TA 2NACA 4CEJA 1RQNA 2ZI3A 1TK2A 4Y0NA 5I45A 3T3IA 3IHLA 3INRA 3PFHA 3QX8A 3CZMA 4YONB 3K1ZA 5FBWB 3NFRA 1I94B 5JQGB 5HBGA 1V26A 3L7NA 5LZ5A 1BJRE 1XMJA 2A9QA 1IY8A 3UPTA 3K0SA 2GT1A 1NQTA 2B2XA 4KWCA 2IIQA 3BOSA 4MA0A 4YRBA 2HHAA 1GFIA 1Y4DE 1Q22A 4LRYA 1M2WA 4N12A 1FYFA 3V2GA 3WKBA 4WKPA 1DHRA 1TQ6A 2BHTA 1ZJJA 4OB6A 2GGSA 3DEFA 1NXWA 3KQSA 1YR6A 1DTWA 2WJ4A 1U4OA 2YUTA 3MCZA 4R9NA 3OM1A 3RC9A 2PLRA 2ZIXB 4URYR 3F5FA 3H5LA 1LS1A 1IHUA 3PSHA 3PZRA 3PRJA 4UE2A 3BWXA 1P4SA 5C8YF 2FZLA 1Y9DA 5TMEA 5L51A 3PENA 1U6JA 4ZT5A 3UOWA 1L7DA 1FC0A 3R09A 4LOIA 1SCKA 2Q5IA 4FHFA 4BN4A 2HM7A 5IVDA 1WG8A 1LRJA 1XNRB 2W6OA 2Z9DA 1YSCA 3EVAA 3JSXA 4KMOA 1V48A 4DW8A 3SDSA 1XTUA 4ENVA 2VPYA 1RP7A 1JA9A 3OCCA 3SNKA 1CY2A 2AWOA 3E7FA 4XVUA 1CLUA 1QIJA 2HDHA 3BCRA 1E3QA 3ELWA 3ACDA 1JLSA 3L8GA 4W5OA 4HTFA 1SEVA 4V03A 1H2FA 1TVKB 2WG2A 2C1EA 3SX4A 3TL3A 1BMFA 4J6FA 5LYJA 1SK8A 4PHHA 1MEJA 2WYIA 4OQNA 3DMTA 4AO8A 4OAQA 5KSYA 1ZGAA 3DQZA 3P0JA 3O3NB 4F38A 2HK9A 5IXJA 2AKYA 2JI9A 3R41A 4ZZ0A 2GCNA 3D3EA 1JXAA 2R8RA 3LSTA 4M7OA 1QR2A 4ZWNA 3RWOA 5JJ5A 1IZ8A 2HSEA 8OHMA 5L6MB 2F55A 2VTBB 2FPXA 3VSBA 1N32B 3LO8A 2Z5FA 3AGQA 2WM9B 4XEUA 1LVUA 2OZPA 3OQBA 5K6TA 2V3WA 1WZIA 1OAAA 1IY1A 2YV4A 4WSOA 4P31A 2UKDA 1ODTC 5ABPA 4ZAGA 1M5UA 5BYKA 5JC1A 3DMNA 4IQ8A 4MVJH 4QFBA 4EQZA 4AUEA 1GLGA 3H6HA 1EVLA 2AA3A 3FZEA 1XELA 3ED1A 4KO3S 3WKEA 2JK0A 3LVFO 2UYYA 4JBIA 3IQXA 1RZ3A 3H2YA 3IT2A 2JJ2A 4OYYA 4AJIA 3OP4A 5GM2A 1T9ZA 3ZCUA 4KE9A 2GKOA 4OQFA 1NUSA 3F8TA 1KY3A 3A4NA 5FX2A 1PGNA 1O5TA 4UHJA 5ALEA 3IP7A 4RPIA 5CFZA 2XUPA 5CITA 1E4OA 3GDHA 1NR5A 5E9WA 3EK2A 4C3VA 3R20A 1NVVQ 2P41A 2RC6A 3DB1A 1N8KA 2H4YA 3R5JA 2PWPA 4A0SA 1GADO 1XTRA 3QG5A 2VJDA 3D02A 3RBXA 2C7QA 2BRUC 1UIRA 3H1GA 4Z9XA 3A9VA 2GEUA 2ZSKA 3L9XA 2MOKA 4LSGA 2QBYB 1OLOA 4FOPA 2ZS8A 3EC7A 3PV0A 4CV0A 1BTOA 3WLSA 1DXOA 1IHDA 2FGKA 4YMWA 4BC1A 2J3JA 3EIXA 3ESAA 4ZHQB 2AG0A 2XQIA 5B36A 1QLJA 1KJ8A 1WB4A 4XIIA 5F1OA 2HBZA 2RGXA 3E8MA 3NW9A 2YJ4A 3QUTA 4OYHA 5L3SA 2ZDQA 2O54A 5CCEA 4BO3A 3AF5A 4RULA 2VYCA 3CX3A 4CL8A 4PGHA 2N47A 3AFNA 2HF2A 4KAXA 3HB0A 421PA 1KZ4A 5CBPB 2PKQP 4Z2YA 1T0HB 2J30A 4GYYA 1PK9A 1PT6A 1ORRA 2FPOA 2K7ZA 4JB3A 1E4EB 2XWQA 3V4RA 1JG3A 1XG5A 1ZGJA 5BVHA 4V0SA 2GXUA 3I8OA 1EP3B 3KSUA 4EB8A 6LDHA 1UJNA 3SMVA 4PFSA 1Y6FA 2J3DA 1W49A 2BMVA 3BWYA 5J4KA 2IGBA 4EP1A 1LF5A 3O0DA 3U4MA 3JYOA 5EINA 5JY6A 4QGHA 1T10A 4N3GA 3HBJA 4YV0A 4NBKA 1J0AA 4GZLA 3C45A 4PQFA 2WRZA 3UBMA 3SX0A 2AGVA 1UOEA 3TQHA 5BPHA 3RGWS 2A9VA 3I12A 4Z51A 5LOVF 4L4XA 3ENKA 3GMSA 5DN6A 1O1YA 4JUAA 2APJA 1V2GA 1XCJA 4P2GA 1L1QA 1RI2A 4JC8A 2DU8A 4K9DA 2A0WA 2YN2A 1FXSA 2IHJA 1CJCA 4HRAA 3REQB 4GL2A 4GOJA 2GJ9A 4B4DA 2J5BA 4MS3A 3FI9A 2X19A 4Z9AA 3VDNB 2FR1A 4ZI7F 3VAZA 3NVAA 3FCXA 1RYDA 2EP5A 3OJFA 4JP5A 5FQNA 1UK6A 3I6QA 2R25B 1R6AA 3KD3A 2VI5A 3SEAA 1JKMA 4E22A 5HKOA 1FSZA 1DGQA 3PTAA 2IY8A 1PFYA 1R1DA 2P2GA 3RWBA 4K5QA 2B1JA 1XDBA 3C3EA 3GBSA 4DUGA 3NBMA 1L1RA 2AFVA 4HWGA 3FTFA 4TVKA 3TOSA 5JNRA 4XJVA 1RRKA 4NXNB 4AKIA 5B64A 1JQJC 3ORQA 5C8DA 1HE2A 3CLKA 5KSPA 4ZOLB 2CMFA 4FHGA 5F4ZA 2OM2A 1N2HA 2HUPA 5HW0A 3Q4GA 1RE0A 2Q4RA 3BD7A 3OA2A 4RK5A 5FJJA 2GF0A 3KFXA 1C3OB 4K1XA 3UK2A 3SWWA 1CUAA 2BN4A 1GLNA 4BO7A 1ZUD1 4LMAA 2ZTSA 2UUCB 5C8YA 2EU8A 1XQ9A 3ZWAA 3FDXA 4XIGS 4RDXA 4I50A 5AVVA 1U3FA 4V0OA 2YXLA 4ANFA 3B6EA 3NEPX 3RODA 4A16A 2CBZA 1QVRA 1JPVA 2IYNA 2ZR9A 1RQXA 1MTZA 2P67A 1FCJA 4TQ9A 1L4NA 4X7PA 3U44B 1F4LA 1SD2A 3BERA 1ZOLA 4NBUA 4JSRA 1R0CA 4HQLA 4LXTA 3V8QA 1OLUA 1NSTA 3KJZA 4BLUA 3K0AA 3G2IA 1GPMA 4XM1A 4ER0A 1NMXA 4OP3A 4XDHA 4YY3B 1ZL2A 3RAFC 3AMVA 1WTAA 5EXDA 2RHTA 5H16A 4EFMA 4TS1A 2QZJA 1KFEB 3EQ7A 4HGOA 4LISA 1NBMA 1Y7TA 4PZEA 4O2BB 1DFGA 2QN8A 1IATA 2GASA 3CN7A 1VSVA 1GNQA 1W59A 4ZOBA 1T8UA 4OO3A 4PZDA 1YZKA 4NDNE 4RM2A 3MWEA 1WXEA 2A30A 3WHLA 4UBMA 5G4KA 3HYRA 4WFQA 5TS3A 5DXFA 1U9YA 2A1TR 5HNKA 4F4IA 2IKQA 2LUOA 1L5OA 3P96A 1M72A 3E4DA 1XZDA 3DZGA 3FOAA 2VHTA 2XMQA 2GK4A 4ZK6A 1KZ1A 2UUOA 4ZI3A 4GGPA 4UD6A 1BRTA 5CYPA 5BRJA 3C3DA 4F2HA 5DLPA 4A3SA 4P32A 1NHGA 2BTQA 1HFKA 3P2KA 5KBYA 1FLNA 2PH7A 5KOYA 1YQTA 2DUNA 4TMTA 4HLCA 3JQ9C 1G21A 3TE7A 4HDOB 3W1WA 3A70A 4UMVA 4MVJI 4A8PA 4CMEC 1DRUA 2FSVC 2Y6VA 3FPJA 4JBYA 4PXAA 5IJ9B 1MR3F 2OWEA 4ER7A 4WUVA 4L78A 2HA3A 2C4NA 4NNPA 1FVFA 1O95C 2WK1A 1P2GA 2V7QD 2MSNA 2ZJBA 3HWSA 4IDDA 3ZV7A 4BNFA 3T3EA 4BB9A 5KMGA 5JWHA 4N76A 2GARA 1I14A 1QHIA 4BU1A 3GNQA 2GXAA 1Z28A 4ZOLF 1BDBA 2VNHA 4Q4CA 4YMTA 2C5EA 5K0NA 4W9MC 3PKZA 1SZDA 1Y3AA 1XIVA 2CLHB 2P6PA 2ZIWB 1RXYA 3WK5A 4BQOA 4DARA 3HVKA 4LAFA 3WYAA 1E7MA 4EITA 1LSOA 3HJGA 4RVHA 4KMSA 3EMBA 1DO8A 1E2LA 4D8VA 4RD0A 4F6LA 5JNWA 5ADWA 3TJRA 2O7RA 2LR0A 1TUGA 1GCAA 4LF9B 4UFNA 1GR1A 1FNMA 5I47A 4PGAA 2FPPA 2E1PA 3PFGA 3D2LA 3VH2A 3N8IA 5D6NA 1N2OA 4J0FA 2G4CA 3Q2OA 1ECPA 4PC6A 4DXAA 1ISFA 3JATB 4UMDA 2X3YA 4O8CA 1G7CA 2WUDA 3BSFA 2K4MA 1G4AE 1H1DA 1KOLA 1VCOA 2QX8A 3O38A 1SXJA 5D3KA 2W2LA 3FGZA 1J8QA 1JQKA 2B5WA 4OJMX 4XOUA 3AP3A 2QXTA 4H1UA 3FSJX 5ALNA 3PNOA 4US0R 3W2FA 9MHTA 3C87A 2H4FA 2GNOA 1EFVA 1ND6A 4KE7A 4RAOA 5BMVA 5KIAA 1G55A 1TUEA 1C1DA 3VYRB 2HWXA 1R00A 3ZK9A 4MDEA 3V8MA 3BJZA 1QR6A 1T3SA 5SYNA 1EINA 1MPXA 5LP6B 2AS0A 1T8RA 2I2CA 1JT2A 1KEEB 2GD0A 1DAMA 1EFRA 1DQYA 2Q3DA 1U0HC 5FEMA 3V1TC 5IZ4A 1OF1A 4DPLA 5ALQA 3I2YX 3R9XA 2J87A 2C9OA 1W85B 3AF3A 3P9QA 2BC9A 1TK3A 1N2XA 1K6XA 7REQA 1IJEA 1NJSA 2X9QA 5C0OE 2WEKA 3QE3A 4YC7A 2X8JB 5A0TA 2OM6A 2HF8A 1XZJA 3PXDA 5HM6A 1T36A 2OHJA 2PM8A 3OKFA 3FCOA 4A82A 4BMCA 4DZRA 2E48A 1Q0PA 7ADHA 4DLYA 2QEQA 3GZNA 5EXTA 2R7AA 4J1NA 3T35A 2GILA 4TXMA 3D1JA 3J81A 1EQUA 2NN3C 2VJPA 2W6QA 1D04A 3C3KA 3BRSA 3F4KA 3L04A 4HYEA 4CF3A 4DBVO 5BSVA 3G5AA 3B82A 4Z0TA 4IYRA 1EFPB 1RWBA 2RGDA 3AO0B 2X7XA 4V1CA 2WV7A 1EFCA 2HXGA 2RDMA 1LJ8A 4MVXA 2BGJA 2QROA 2OEPA 2BFFA 1TDJA 5E0KB 2FMTA 5FL7D 3WRWA 2DB3A 4UUAA 1EDZA 4WHMA 2Q8QA 2YWJA 2ZYSA 4UXJA 5AK5A 3W7VA 3HK2A 1U0GA 1X8JA 4Q24A 3EVBA 5CM8B 5CA0B 4E94A 3EXFB 4Q6BA 2YASA 3AZPA 4BX0A 4U9IS 3P26A 4L72A 1XJWA 3ITKA 4ZZ1A 3G8BA 3N2ZB 4DR5B 9LDBA 2DWQA 3DHWC 3OMWA 5F2OA 3KB1A 1F8GA 4ZXPA 3FH0A 3OJEA 3FOBA 4H7JA 5CMLA 3TJMA 4JXXA 1K2VN 5H80A 1SUPA 1UAGA 1JJIA 1PWEA 1KYQA 2RBKA 3LCVB 2QJTA 3O7WA 1E2FA 3LCCA 5HFNA 2OK7A 3ZVLA 5KNCH 1JLKA 4JQOA 4TPKA 4EUFA 5K4GA 2CB9A 3KR2A 1C0EA 5HF8A 4XQGA 4D56A 3CUEF 1ORVA 5TS2A 2LE0A 3EW7A 3VRHA 2QY9A 2AQHA 4M1KA 3P9IA 3OIDA 5EHXA 2FQXA 4J4BA 3LF2A 4IICA 3F8WA 1IY2A 3HVUA 2QZ4A 1T3GA 1Z8DA 4FE4A 2QMYA 2V7PA 3G8YA 5I7EA 1HA3A 3AB8A 1E79A 1IHPA 1U0OC 1QG6A 3EODA 3VUFA 3KTFA 4BNDB 5SV2A 1VFNA 5J5VA 4URVR 1FS5A 1JE1A 3S2EA 4D4JA 2GCGA 2POQX 2PX6A 1GQSA 1XPUA 2FMHA 4F4HA 4M22A 1ZCBA 4NX2A 2CNWA 4QUJA 3WIDA 1IBMB 2FZEA 2VLIA 2X5OA 1ZHHA 2YIMA 1T6ZA 4IM7A 2A5LA 3BVPA 4UHDA 1L4YA 4JVSB 4AS3A 4EELA 5KVVA 1I0LA 5F9FA 5CHYA 3LBYA 4ND1A 1YA8A 4UUPA 3SJZA 4P3KA 4UNPA 3QBJA 5F78A 5TV2A 1YOVA 5JADA 4LJLA 5ETJA 3M5WA 4K6CA 1RADA 3DMGA 2DQKA 1P1BA 4LRQA 1OKKA 1U7TA 1WULS 4TT3D 4BZWA 2V54A 4YMLA 1NJ5A 2VEDA 3DEKA 1IZ9A 1XLTA 5HKBA 5MHTA 3RLFA 1VJ5A 2F59A 1W581 2BY4A 4MW9A 3ZD8A 1T8SA 3H11B 1CSEE 3PXXA 1NRIA 4EGQA 3KTDA 4QYSA 4R9UC 3SGLA 4D4IA 4URZR 4D9MA 3FSGA 3VX4A 2X9LA 3U4QB 2VH2A 3QPAA 4X8OA 2JLXA 4C14A 1R5OA 2V7UA 5TT0A 1MBZA 5JYDA 1ML4A 3NHPA 4WOPA 1DC3A 2ADFA 2WICA 4M1EA 1E2UA 3PQ2A 1QZXA 3RFCA 3P0EA 4CE6A 1Q11A 1R0WA 1JHUA 1PI3A 2V7XA 4K28A 3A1VA 2XSZA 3CEJA 4PS0A 1VIMA 2REQB 4UFOA 1KVUA 4P53A 2GWHA 3UWMA 2PJRA 2EATA 2R0QC 2J4FA 3AJDA 4W1SA 1H93A 2KLBA 3DXXA 3NANA 3Q3IA 3L8MA 4X45A 3CW9A 1RLMA 3WIVA 4LZJA 1TM2A 5ITVA 4AI6A 4RWEA 2X0RA 3T06B 1OE0A 1KVRA 2PD6A 3BMOB 2AW3A 1SVKA 3NBFA 3AEQA 5IVIA 4AZTA 1MT3A 2V7BA 3K53A 4UHBA 1T0IA 4BMVA 3O75A 1T9CA 1KPHA 4ICIA 1E2IA 1I3OA 1W94A 1PGPA 1LKZA 5DHTA 3A27A 2QPTA 2PS3A 3NTVA 1UJMA 2G1JA 1D8TA 4TSFD 4HQNA 5FF9A 4MDHA 1HZJA 2GYVA 2QT1A 5F52A 1U28C 4E1VA 1W4RA 2I91A 4K9QA 2MYPA 2GDZA 3P97A 4N5DA 3WXMA 2N3ZA 4HLNA 1XA0A 1I13A 4MTCA 2P4SA 3VZRA 1E1DA 2CEAA 1VL0A 3QEOA 3X1YA 1LZKA 2MSKA 1UEIA 2ZT5A 3LXXA 1Y8RB 3KSAC 1DZ3A 4KQ9A 2OP0A 3IURA 4RPKA 4QYXA 3VR5H 1Q6ZA 2MINB 2X2EA 4G4IA 3SICE 3UQZA 3K05A 2CUKA 1ONPA 3OQIB 2QMQA 1JAZA 3F5SA 3HFRA 4GYKA 4N7JA 4NF2A 4DCSA 2I4RA 1QV9A 3PXUA 5AUOB 1K4MA 1M8JA 1T6XA 1SU8A 1YZQA 3IVXA 4IOKA 3FVQA 4MCJA 4WV3A 2X0DA 2JRLA 1Y5NA 3DQPA 1OBCA 3JQ7A 3ABQB 3VZDA 5HZHA 3INNA 4X0EA 1B26A 1T8PA 4C6HA 3MB5A 4KL8S 5KWVA 1T6YA 5BQ5A 4KOAA 1T9AA 2AK2A 4J7XA 3JQAA 2CNOA 1C2YA 4LDAA 2A6PA 1FUUA 3BE8A 2J3MA 3GRUA 3IIKA 4MEAA 1H3NA 3QE2A 5HJ7A 4CTOA 3THWA 3AG6A 4F8EA 3QXXA 4F6CA 5DM70 4V24A 1G18A 4BZPA 4KITB 4RM3A 1N0IA 3B6ZA 5BOSA 4LJ7A 1NXSA 4UU8A 1KSJA 1LSUA 1ULAA 2EL7A 2Q07A 1FLVA 5E7QA 5I5EA 1I80A 3IMCA 5SYAA 5KX5F 1OH5A 4C2UA 1P0MA 5MGBA 2P9CA 1KAHA 1EE2A 5EJAA 5HFJA 3A2KA 2ORYA 1VCIA 2J6CA 3R0IA 4IZIA 4BKOA 4B3GA 1W0CA 4TTVA 1AA9A 3JR7A 1WHSA 3EDYA 4ZQEA 5LC1A 3ZTTA 3RROA 4YRZA 5C4GB 4JVMA 2C8VA 3LBIA 1GKYA 4LJRA 2H7CA 5AWFC 5GGYA 2O2GA 2W2TA 1OFGA 2QWXA 2Q1SA 3C6YA 3IUEA 2GEDA 1M1YA 4PBTA 1X1CA 3CYFA 1W5AA 3HUTA 3TOZA 3NWOA 3TZQA 1IMJA 1P61B 4TMXA 4OHVA 4IEEA 2WY2D 4Y2VA 2QNBA 4GT1A 4G5FA 1C9DB 5DX8A 2BTQB 1DBWA 2AC4A 4BKMA 5COQA 3FA2A 4Q9LA 3EH2A 2BWJA 2GBIA 4N9QA 1CDZA 1GXSB 2HO4A 2Q4TA 1T9HA 1JFLA 2QLNA 1KVTA 2GEBA 2VS1A 3B20A 3D0OA 3OSZA 3PUWA 3QX9A 4XM0A 1ST2A 4Z53A 5I5GA 2VDLB 4YRQA 3RYCA 1J07A 1Y1LA 1A9SA 3C14C 3DFKA 3PS9A 3BFJA 1GARA 4LXQA 5DU2A 4Z54A 1SCUB 3K8OE 3RD5A 1WP4A 1KBZA 5CPBA 1DWQA 2X3UA 2ZYTX 2FMKA 3GAMA 4INZA 3GJYA 4KR7A 2VN8A 4JU9A 4YJFB 1JRLA 2IPOA 3EZXA 4L6IA 2OBMA 3N39C 5C5EA 3G3EA 1U2SA 2VYVA 4IRUB 1FTYA 1YFZA 5REQB 3N7UA 2QVZX 1L3BA 5EZYB 2WE8A 1RMYA 1NAHA 1PWHA 4QTTB 1QH8A 2D4HA 3CINA 2WPDA 2ZBRA 1GZ6A 1P8JA 1TMGE 3ZY3A 4DWOA 2WW8A 1U7PA 1N2SA 1Q3TA 2QI9F 4FKZA 1B76A 2DFNA 4K9MA 5JE8A 1SUIA 4GMDA 4L1KA 5K0FA 2FDXA 4HDSB 1GEGA 1PJSA 1SZPA 4X5OA 3CY6A 1N7IA 3ZLUA 3BXGA 1E77A 2JI4A 3GPIA 4BO4A 1WV0A 2C2GA 2KPOA 3L7YA 2W6MA 3WZMA 4Z99A 1B00A 3S81A 2D06A 1WOYA 1AY0A 2AXQA 1SD1A 3HJBA 3M9XA 2TMYA 3DLAA 2VF4X 1JR3A 1L7QA 4OHRA 1WNFA 2DWCA 3AEXA 3TNYA 3UMCA 1L5SA 1IH8A 1QGOA 3L93A 4ZVUA 3GLRA 4DREA 1RP1A 4MQEB 5EXEA 5AW0A 6Q21A 4LWOA 4EQ6B 2D0IA 3B9RA