3AUUA

Crystal structure of bacillus megaterium glucose dehydrogenase 4 in complex with d-glucose
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
262
structure length
262
Chain Sequence
HMYTDLKDKVVVITGGSTGLGRAMAVRFGQEEAKVVINYYNNEEEALDAKKEVEEAGGQAIIVQGDVTKEEDVVNLVQTAIKEFGTLDVMINNAGVENPVPSHELSLDNWNKVIDTNLTGAFLGSREAIKYFVENDIKGNVINMSSVHEMIPWPLFVHYAASKGGMKLMTETLALEYAPKGIRVNNIGPGAMNTPINAEKFADPVQRADVESMIPMGYIGKPEEVAAVAAFLASSQASYVTGITLFADGGMTKYPSFQAGRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided mutagenesis for the improvement of substrate specificity of Bacillus megaterium glucose 1-dehydrogenase IV
pubmed doi rcsb
source organism Bacillus megaterium
molecule tags Oxidoreductase
molecule keywords Glucose 1-dehydrogenase 4
total genus 100
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 1.1.1.47: Glucose 1-dehydrogenase (NAD(P)(+)).
pdb deposition date 2011-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3auuA00
3WQQA 4XYGA 4P22A 3WGGA 1TVEA 5HM8A 1PJQA 1IY8A 5DBIA 3WS7A 3I6IA 2AE2A 3ROPA 1GR0A 2J6IA 5I7VA 3HADA 2VYVA 3JYOA 1KOLA 2BHLA 4EI2A 1W73A 1S7CA 2PD3A 1KBZA 3NTRA 1JWBB 3PHLA 3NJ4A 4AJNA 3H6KA 3H65A 4FFNA 3S55A 4K6FA 4MVJP 2H1SA 1QYDA 2HMUA 2X0IA 4AFNA 1CF2O 1P45A 3GVHA 1Z73A 2ET6A 2C2XA 3ANNA 1OBFO 5MDHA 1RYDA 1PGJA 3V1UA 3DAPA 3TDKA 1U3TA 4DLAA 4XGIA 4YRAA 1UAYA 5C7LO 2PZLA 3MJVA 4DTIA 2A4KA 5BSEA 4B4WA 1GADO 5L3ZA 1ML3A 3GHYA 5A9SB 1H5QA 1HE2A 1L7EA 5ES3A 1SEVA 2Q99A 3K92A 2IZZA 1QLHA 4XDYA 1PIWA 2O3QA 2JFFA 5MGBA 3ZNNA 2HKIA 2VHVA 4ZQBA 1F12A 2CMDA 1CJCA 4ND3A 1YKFA 1OMOA 2DBRA 4FC6A 3T4XA 4FB5A 1F8FA 5JNLA 3I5MA 1FK8A 1HDXA 1SB9A 1P77A 2VZ8A 4FD3A 3INRA 4IDDA 5AXBA 4DQXA 5A05A 2WYVA 3HDQA 1BDMA 2VWPA 1YB5A 4UVIA 2AG5A 2YDXA 3FSRA 5EJ2A 2FSVA 1NVGA 4DC0A 4FFMA 1L7DA 2PKRA 3W8FA 1LBEA 1LEHA 4OQYA 1PZGA 2D0IA 3DOJA 3AI1A 4HY3A 2VWGA 3U62A 1GZ3A 2YYYA 4DL9A 4Y98A 1K89A 3MOIA 3DZIA 4R3WA 5ILOA 4BO8A 1R37A 3M2PA 4UEKA 3RWBA 4B7CA 3H7AA 4CR6A 5B4VA 1WNTA 1ENYA 2JFGA 3AI3A 4FPXA 4WLUA 3RUCA 3UCXA 1TI7A 2RBEA 3D5QA 4JP2A 1ZKMA 5G2OA 4CV2A 3C1TA 4INAA 2W2LA 5CEFA 3Q0EA 3JTMA 3NGLA 4BUCA 4J0FA 3PHHA 3LYLA 1U2GA 4BGIA 2UDPA 4IDFA 1T2FA 2XAAA 1YB1A 1EUCA 4J7UA 5THQA 4M49A 1NX6A 1PJBA 3UF0A 3X2FA 3EK2A 3S2GA 4GMGA 3DBHA 2WM3A 2YQ5A 4GGOA 3W1VA 5K9ZA 2A35A 3A06A 3TJRA 4BMNA 3IUSA 4IJWA 5I9LA 1KEWA 4M86A 3VDQA 1GYPA 4ONEA 3ZW9A 3RC1A 2HSDA 4CQLB 4FQ8A 4PLFA 3JSAA 2O7SA 3RKUA 4B7XA 4DWVA 2O3SA 3KYCB 1ULUA 2OUIA 1OZAA 3B70A 1AN9A 4J90A 1I3LA 4OKIA 3JD3A 1J4AA 2CFCA 3OIFA 4CQMD 1GDHA 3MCVA 4CLRA 4XRRA 4A5OA 3HB5X 1E3LA 1I01A 1LLCA 2R6JA 3LC1O 3WYBA 4IQGA 1BVRA 3HFSA 4P4GA 4AJ2A 4D0RA 2Y1OA 1DC5A 3SJ7A 3WFIA 1EQ2A 3RQSA 4OGWA 3MJEA 4UVHA 1PGPA 1U4SA 4DLLA 3OA2A 4TZTA 1LRKA 2GN4A 3NDIA 1U3WA 3SBOA 5CAEA 1RM5A 2NVBA 2UUPA 3FNEA 5U4QA 3UICA 2WTBA 5KKCA 1UP7A 5CG1A 3DOOA 4I5DA 5KJFA 4CMIA 4DIFA 1A7AA 1FXSA 1PS9A 2VUTA 5KNLA 2FPPA 3WLFA 1ZK3A 3FPCA 3IQDB 1GCOA 3U4IA 4XA8A 4UAGA 4J9UE 3PQDA 4BO1A 2P68A 2Y1CA 4J43A 1PWXA 2HJSA 3PGJA 4CM5A 2ZATA 1RWBA 4IS2A 5JS6A 4W9NA 4WASA 4E2XA 4PG5A 1LLQA 3TZKA 3EZYA 3PFFA 3JQ9C 5ILGA 3Q2IA 3L4BA 2NU8A 3RU7A 2ZCVA 1XR3A 1E7MA 1AXGA 3I9KA 4IZIA 1PTJA 1C0KA 1XCBA 3VC7A 4NFHA 4BO7A 3KZVA 2IEBA 5FI5A 4IINA 5C7OO 1M6WA 3DC2A 1QG6A 1UZLA 2AQHA 3LF1A 4M54A 4Y8VA 3L6EA 4NH4A 3VZPA 2B0JA 2AEFA 4PLYA 4UUMA 4XYEA 5TS3A 5G0VA 3ADPA 1P31A 1X1TA 4R68A 3HFGA 2P9EA 4DXHA 5JCXA 3Q3CA 4WE3A 2JAPA 2BFMA 4IGEA 1KEVA 1Y9AA 4ZICA 3KB6A 4HNGA 2PV7A 1WVGA 5IJZA 2P2SA 3DZHA 3K73O 1LSOA 3G1UA 3S2IA 3UOGA 4TRRA 4MKZA 1U3VA 2JD0A 5IFLA 5LCXA 3PWSA 3VTZA 4WCDA 4RVDA 3QVSA 5HS4A 1C14A 4CM8B 1R0SA 1DJQA 3VTFA 2WYWA 2OO5A 3G0OA 3PWKA 4YJHB 3VZSA 1B26A 1SBYA 3SVTA 2VUSA 2EKLA 4GVXA 1GU7A 2R00C 3HG7A 4KQXA 3O03A 4RV9A 3I9NA 1LU9A 2WMDA 1UZNA 3ZWNA 3JQ9A 3H3JA 3NAQA 3UH1A 2GD1O 5JYEA 4CODB 1Y5RA 1R0KA 4JBHA 5T6BA 3DOCA 5TC4A 1A4UA 3QV1A 2FY8A 1B8UA 2ZTLA 4HUJA 3WYEA 2PR2A 1LLDA 1NVTA 4ALMA 1YBMA 1R0LA 2CF6A 3RBXA 1E3WB 2EJWA 4CM4A 1LDBA 1AHHA 3PIIA 1J6UA 2FZEA 2HAEA 4PLVA 4C7JA 4BKRA 4FSHA 1MB4A 1Y6JA 3PZRA 4RF3A 1H6CA 2YHIA 4KZPA 4B4OA 4CV3A 4PVDA 2C82A 3WQSB 5COAA 4IUYA 3D4NA 4XX0A 3C7AA 4NJOA 2Q2QA 2X8LA 1VPDA 4Q3DA 5KVVA 3P7MA 1NFRA 3BMQB 3PJGA 4DC1A 1LDGA 3ZNPA 1LQTA 1M66A 1U4OA 2DBZA 4BNGA 1NTOA 1DAOA 1P0CA 2C29D 3A14A 4OXKA 1BRMA 3HN7A 4HX5A 3TF5A 3GVPA 3QVOA 1YGYA 3F4BA 3A28A 1PJ3A 5A9SA 5JXWA 3MWEB 2IYPA 1KVQA 4RPJA 1MXFA 3B6ZA 4RLSA 3RUDA 3D5TA 3K96A 3QWHA 5JO0A 2Q1TA 3AM5A 4WGGA 3TWOA 3BTSA 4KWIA 3PEFA 2CDCA 3BMNA 2NVUB 3ZW8A 3SC4A 3OA0A 4A26A 4CM7A 3GZNA 3PGXA 4CUZA 4ZQGA 1Y5MA 2I76A 5L7WA 1ZJYA 2WWRA 2WE7A 1R4MB 2G17A 2B4RO 3BMCB 4CM9A 2HRBA 2DTEA 3D3EA 2HMVA 4BKPA 3PQFA 2YJZA 3R3JA 3R6DA 1B8PA 1HDZA 1PQUA 4MVJA 3CMMA 1XA0A 1ONNA 2VNAA 2E37A 2ZB7A 1CQIA 1WDKA 4FC7A 4WLVA 4YT2A 5FWNA 3MJ4A 3BHJA 1NWCA 4M55A 4OIMA 3RFXA 3CKYA 3U0BA 1PEDA 2O2YA 3OEYA 2ZB3A 1I3KA 1ZEMA 2VNSA 4DIOA 1DXYA 1HYEA 3L9XA 4QO8A 3ETDA 4RLHA 3INGA 4AJIA 5IDWA 4OOFA 4EITA 3RIHA 1EE9A 5L7TA 4GX5A 4PLHA 4UEJA 3HJAA 3DTTA 5KCZA 1MX3A 3K9QO 4E4YA 1ENZA 2P4QA 2B5WA 3TFOA 2QRKA 4FS3A 1NFQA 5JY1A 4XJSA 3FI9A 1JVBA 3GEMA 4D42A 3BTVA 4KUEA 5KKAA 1ADFA 1GAEO 3AWDA 5FFFA 1PQWA 3OQ6A 1FF9A 1ARZA 5F5LA 3ITDA 2WEKA 5FYDA 4YEDA 2IE0A 2EP5A 3PYXA 1V0JA 4BNIA 3ASUA 2QG4A 2Y1EA 5KVSA 5HTOA 1YDWA 3KVOA 4OSOA 3VH4A 4PLCA 3PZBA 4RPGA 4BNWA 3MOGA 4B3JA 1HDOA 3WGIA 7MDHA 3ZWVA 1F0YA 1H9BA 3T7CA 1R6DA 5IZCA 3TOZA 4DPKA 5CG2A 4R9RA 2YW9A 6LDHA 1PR3A 2D2IA 2PGLA 3I3OA 2Q4EA 4PRLA 4RJTA 2VHWA 5L9AA 3ZU3A 5BNIA 3VH1A 4AJHA 1YWGO 1PR9A 1PJ4A 3GAZA 4QSMA 3B20A 3RAJA 4RVFA 3WIEA 4R69A 3GEGA 2DKNA 3FR7A 4UREA 4KTTE 5IF3A 1VL6A 2O50A 2NVUA 2WSBA 1XGKA 5BSFA 1QYCA 2VYND 3N74A 1QR6A 3H4VA 4R16A 3VPXA 4M8SA 4XIYA 2V6FA 4S3MA 1AGNA 4TVBA 1SOVA 2H6EA 4QECA 3IKVA 3FCOA 2X1HA 2FR0A 4PLWA 3F3SA 1ENPA 1H9AA 1ZEJA 1DAPA 4RPLA 1DEHA 3KBOA 4XYLA 2X5JO 4Z0TA 3ZCXA 1V3UA 3BHMA 4GBJA 1GEGA 4Y9DA 3QE3A 5T8KC 4CL8A 2ZB4A 4J1QA 4Z3KA 3GDGA 4UULA 3DZJA 1SO8A 3GK3A 4PZEA 3WMWA 2WD7B 1P1HA 2IZ1A 1ISHA 2QZ9A 2PD6A 3WSWA 4YXFA 3D1LA 4EJMA 1PWZA 4UUPA 1UDCA 1RPNA 4NU6A 2ZYAA 4O0LA 4WLNA 4YWJA 3ROKA 4D45A 4GX1A 3ONFA 4QX6A 5DCWA 2Q1UA 3NEPX 3QSGA 3U5TA 3ON5A 1B14A 2Q45A 2X0NA 5FI3A 2C5AA 1ZO8A 4WCFA 3TZQA 3ZV5A 2CDAA 3V2HA 5ICMA 2YZ7A 3QVXA 3WJAA 5EERA 2OP0A 1LSJA 1W4ZA 3JQ6A 4IJUA 4OMUA 1QORA 4PIVA 5DCYA 4RL6A 3P19A 4RVUA 3LVFO 3ENKA 2VZ9A 1HDRA 2GNAA 3U4HA 4J7CA 3GAFA 1E1KA 3OSUA 4JBIA 4PLGA 1Z74A 3I9LA 4B7UA 4MVJM 4A10A 1E1LA 3PQEA 5DBFA 3QW2A 1V3TA 4XD2A 3E1KA 5ER6A 3VPFA 2EWMA 1QYXA 1UXIA 3SX2A 3ZWXA 2RAFA 2VUUA 3AM3A 3EUWA 4IPTA 2X7HA 3LSYA 4BNFA 4DBVO 3JQAA 4ND1A 1ID1A 3VAZA 5A9RA 1LA2A 2E6UX 3VPHA 4J1TA 4DBZA 5EPOA 4ZQFA 5JYDA 4R4JA 2ZIZA 5H83A 1OC2A 2X9NA 1T2EA 4GWKA 1OAAA 4E33A 4NG5A 2E82A 3AFNA 4BNZA 2Y1FA 4C7KA 5KJ6A 2YV3A 3ZV3A 1LSUA 4NJMB 2O3UA 1N1GA 3C24A 4OYRA 1ZUD1 1T4BA 4Z6KA 4MKXA 4A73A 2FRDA 4DQVA 3G1TA 3I52A 1Q0HA 1C0PA 4NBUA 4AG3A 1OFGA 2W8ZA 1U3UA 5JLAA 2BFAA 3DBHB 3E9QA 2GR9A 3ST7A 3ZV6A 4E31A 4RF5A 1DLJA 1K6JA 2WJPA 3OJ0A 1GZ6A 3GVIA 3OICA 1PGOA 2FHSA 4LISA 1IZ0A 1R15A 2BLLA 4QUKA 5JFOA 2C20A 4WOKA 3GF4A 4DMLA 4W4TA 3PHGA 1MG5A 1NP3A 4L4XA 1JDJA 4GSLA 2Y0DA 4U5QA 4BB5A 3A9WA 4II3A 1YONA 3ZWCA 1VE9A 3GGGA 3KLPX 4TRMA 1O5IA 4J4BA 3PLRA 1FDVA 3DL2A 4G5HA 4CV1A 1I0ZA 1FDTA 2BF7A 4EUHA 5FF9A 3K8ZA 2BGKA 5JY6A 3JCZA 3PJEA 2GGSA 4LVUA 3WQRA 3AUTA 4YT5A 4F45A 3D0OA 3IJPA 4OH1A 2Q46A 1HWYA 3GNQA 1DOHA 4E5PA 5L4NA 4G65A 3G49A 1RYEA 5IDXA 1GQYA 3LF2A 4XDZA 1G0NA 3WGTA 3K30A 1C0IA 2BGLA 4I08A 4PG8A 2RHCA 1YBAA 1DFIA 2Z5LA 3HDHA 4BV8A 5T67A 3OBBA 2P9GA 1NR1A 1GCUA 4Y6PA 1SPXA 3I9MA 3AOGA 3K31A 1E3IA 4BO3A 1SMKA 2JHFA 3ZGYA 4TMFA 3SLKA 2ZTVA 1ULSA 3L07A 3ZU5A 1T25A 3QWFA 3IL2A 4BGUA 3GFBA 2X58A 3PYMA 4Y6SA 2C7GA 4IJKA 1E3EA 1X7GA 4GH5A 4YVFA 2Y67A 2JCYA 1TB4A 4OO3A 3U9LA 1V6AA 4BNTA 2VHXA 2J3KA 3L4SO 4B3IA 1B16A 4AJKA 3R1IA 4YAJA 4D44A 3S2FA 3WBBA 2NADA 5L95A 1CWUA 1QRRA 1H2BA 1H93A 3TZ6A 3NX4A 3VH3A 5KWEA 3DWFA 1Y7TA 1CYDA 1EDZA 3O8QA 1WMAA 2O2SA 4KMSA 3F1LA 4WPGA 3GPIA 4RPHA 2ZYDA 3AJRA 3GA0A 5B12A 3NGXA 3QVTA 5G4KA 3ULKA 4HFMA 1V35A 2RCYA 4YRDA 5KOIA 4B4VA 4BL5A 3STHA 2AG8A 4BKQA 3HB4X 1GY8A 2O3TA 5DULA 4WLFA 4JCOA 3V2UA 4KOAA 4BO5A 2DPGA 3DMYA 1XHLA 5DP1A 1KY5A 3AOEC 2EKQA 1DPGA 4QFCA 4ALKA 1HZZA 3UAGA 1R4MA 3SXPA 2P9CA 1KC3A 1DC3A 1XG5A 1ISJA 3L6OO 3TN7A 4FOOA 2CVOA 2NSDA 2X5KO 5A3JA 3ZI0A 3BIOA 5HBRA 2WD8A 3N58A 4DGSA 3OETA 1UZMA 3B1KA 4J1NA 3WWZA 5L40A 1I5RA 1U7HA 4CMEA 5KJEA 4TROA 4BKOA 1IE3A 3ZHXA 4E21A 2I3AA 2UVDA 2ZQYA 4OQZA 3F5QA 1LRJA 2FR1A 2HMSA 1LQUA 5JDCC 1VJ0A 1HF3A 5U9CA 4ALJA 2E48A 2PZMA 5GZ6A 5EMHA 3CZMA 3L4BC 1IZ9A 1Y8RA 3KRTA 3EMKA 4KQWA 3ITKA 5DF1A 1UH5A 2AA3A 3PWZA 4CLXA 8ADHA 3ZZNA 1YJQA 4D79A 3QVWA 3WGQA 1LDEA 4NBTA 2CVZA 5DZSA 4RCVA 1U7TA 3GQVA 2CDBA 5B1YA 5L45A 4FJ0A 4CM1A 5BR7A 2NQ8A 2QQ5A 4BO2A 3H9QA 1BW9A 4YR9A 1XU9A 1Z45A 1ORRA 5EL0A 2PKQO 4EGFA 1W8DA 4UEOA 4B8ZA 5CPFA 4YJFB 1J0XO 5L4SA 1A71A 2I66A 5A5EA 3I9OA 1BVUA 3BZUA 5HA5A 3ZHYA 1ZMTA 1A9ZA 3GH3A 5CDTA 4ZN6A 3JQGB 1T1SA 4ZQHA 2B83A 3D3WB 3RUAA 3VVBA 3FN4A 3UHAA 5KVQA 1MC4A 3JQAD 3I4FA 3OIDA 2Q50A 4JBGA 4AL4A 1CQJA 5JMPA 4RF2A 3MJSA 1HLDA 4LRSB 1CDOA 3LZ6A 4FFRA 1JAYA 5G0TA 3CSDA 3UVEA 1ZK0A 2GN6A 2GERA 5DNAA 2PH5A 3ONDA 4K1LA 4E3ZA 3Q2KA 2IODA 2WYUA 1FJHA 2C5EA 4J91A 2VTEA 1VJ1A 1IL0A 4CMJA 1EUDA 4M89A 2RHRA 4BHTA 4GQAA 2DUUA 2CD9A 3AI2A 1F14A 3IIEA 4Z3DA 2ZJ0A 4L76A 2YHUA 3GDOA 1C1XA 3M1LA 1E7SA 4J4HA 4PZDA 3ZWBA 4F6CA 4PFJA 3PTZA 1F06A 1AE1A 1ZBQA 3SLGA 5L7YA 3W6UA 3AU9A 2NQTA 3TRIA 4E0BA 1MP0A 2Y68A 3EZLA 4DPMA 1ZCJA 1O0SA 2Q4BA 3VH2A 2DBVO 4QQRA 3LC7O 2JAHA 2JKVA 3UCFA 1I8TA 4RVHA 5GZ3A 1SCUA 3DZBA 3RI3A 4MVJD 4RDIA 1EBUA 3IOYA 4N5LA 3RFVA 1A72A 2VRCA 3U3XA 4Y6RA 3GG2A 2GASA 3TQHA 4CL3A 1V3VA 4J2HA 4ZVVA 1VSUA 1ZSYA 2W98A 4BNKA 1KYQA 2Q1WA 3JQFC 4DYDA 3TFQA 2FSSA 4JN6B 1G6KA 2V6BA 3JQ7B 4RO0A 3RJ5A 3RUFA 1D1TA 2POQX 1DIAA 3EVTA 3JYPA 4KWHA 2P5UA 3DBVO 1R16A 4OSPA 5LC1A 2DC1A 3L0DA 3NDJA 3NDRA 4GLOA 1N9GA 1Q7BA 1LI4A 1GFSA 4G2NA 4D7AA 4HFNA 3QLJA 3TL2A 3OQBA 4RQTA 1B7GO 2EKPA 4N54A 3EDMA 3H9UA 4TWRA 3JQDA 1R12A 4WLOA 1NASA 3WGYA 5CHEA 4CM3A 4XGKA 1C1DB 5COQA 2YUTA 4HWKA 9LDBA 4LSMA 1NHGA 2HLPA 4DPLA 2J8ZA 2FR8A 3GR6A 3VZRA 2J5KA 1ISGA 3AFMA 1DRVA 3HSKA 1UDAA 5A06A 4JX8A 5DP2A 2DVMA 3T7EA 3HDYA 1S6YA 1B2LA 5JAZA 3V2GA 4Z9XA 3CTMA 2BFOA 2PNFA 3NRCA 5DBGA 3M2TA 4JJIA 2HU2A 1NQ5A 1NXQA 4J9VA 3DR3A 4TQGA 3DZGA 1E7WA 1PX0A 4YCAA 4U7WA 2F1KA 5EINA 4RDHA 3C3XA 4L4SA 3WMXA 1EVJA 1MGOA 3E9MA 4WKGA 1WZEA 1MFPA 3RSHA 4CMAA 3AW9A 1G0OA 5IDYA 1BWSA 2FP4A 3PJFA 1UXGA 3EAGA 4CLEA 3D7LA 3HWRA 1KS9A 3RROA 4PLZA 3C7DB 4TRJA 2GSDA 4XKJA 4R3NA 3OF2A 1FMCA 2Z95A 1EVIA 4GI2A 4CV0A 1LC3A 1EQUA 4YAGA 9LDTA 3H2SA 3I1JA 2O48X 1M67A 4NHEA 4DREA 5F1OA 3WWYA 2A92A 4RZHA 1YXMA 4BNMA 4D0SA 4NZ9A 3GRKA 2PD4A 2OXIA 5BNFA 4TKLA 2J5QA 7ADHA 1DIHA 4D46A 4BNNA 2OORA 3ZWOA 4WNCA 2G5CA 5IDQA 5C37A 4CLHA 2D1YA 3ROQA 3FF4A 2CF5A 1D3AA 1XU7A 1I3MA 4TRNA 5BSGA 1C3VA 1R4NB 1O95A 4BNUA 4U8GA 3QY9A 1I10A 3FRJA 4E5MA 1PU2A 4RVSA 5COBA 1P0FA 4WCFC 1ZH8A 2OZPA 1YQGA 1ZNQO 4MVJH 2X22A 1E92A 3T4EA 4O5OA 1N8KA 3W8DA 1Q0QA 1XYGA 1D1SA 2HK7A 3RC9A 4DA9A 5EN4A 3K2EA 3PXXA 1ADBA 1I2ZA 4IGFA 4N5NA 3DZKA 4ND2A 3VZQA 1ZXLA 4I9HA 3WOHA 5H82A 1HRDA 4WUVA 4IMRA 1Z82A 3UKOA 5B4TA 3I83A 4ZQEA 4CMCA 3DXFA 4LVCA 4J3FA 1UDBA 4QFDA 5C5IA 4I8XA 1QYVA 3LLSA 4LMPA 4AVYA 4DUPA 4LW8A 4YRBA 5I9NA 4CLRB 3K6JA 1EBFA 5TSDA 3O8QB 2FMUA 2I65A 4TZKA 1CEQA 1EDOA 2Y1GA 1HZJA 3ZWAA 1JVSA 5JW6A 2G82A 5CDGA 2W4QA 5BT9A 1DIBA 1XEAA 4L73A 4QT0A 3U4CA 4DMMA 4H16A 3COSA 1EK6A 5C3MA 4NBRA 3VKUA 3QQPA 2VWQA 3TSCA 4O63O 5I7EA 3PYLA 1DLIA 3L77A 1BXGA 2B4QA 4BO6A 4UVGA 4XRGA 2X4GA 1DSSG 2VZ0A 1SC6A 4FBGA 1PZEA 3U49A 2DAPA 5T57A 1X13A 4GL4A 1SAYA 3CUKA 4ZHSA 3A4VA 2GPTA 2VHZA 2JD1A 2EERA 4MO2A 3SC6A 3GNTA 4WOJA 5IAAA 2JFHA 2PA3A 5A5FA 3PHJA 3W4JA 1KVRA 3JQCA 3OIGA 4U6SA 3ZV4A 2Q2WA 4EUFA 3VPGA 1XWFA 3LQFA 4BNJA 2C59A 4B4UA 4BQPA 3PJDA 3ETEA 4KP7A 2EHDA 4UUOA 4D41A 1Z7BA 5K6AC 2G1UA 5DOZA 3ROMA 1DO8A 2YQ4A 1NQTA 4YBZA 2HCTA 5AXAA 4Q3AA 3UCEA 5DN9A 3AK4A 2NV6A 1WLYA 4CUJA 5F1PA 2NM0A 4C4OA 1VLLA 5TRTA 3I23A 1I36A 3JQBA 1PJ2A 1ZVMA 1Z7EA 2BI8A 3PFWO 3ANMA 2Q1SA 4Z0PA 4N18A 2VN8A 4HP8A 3RFTA 1P1JA 1LDNA 2Y93A 4IS3A 4B8WA 5H81A 4EZBA 3KEQA 1T2CA 4R1TA 3TOXA 4L8VA 1F17A 2P4HX 1NYTA 1XLTA 3MJCA 3TZCA 2R00A 3ETGA 3KOUA 4ND4A 4JGBA 2AW5A 3FNHA 1BMDA 1ZXBA 1LJ8A 2AQIA 3OFSA 4PG7A 4EDFA 4ID9A 1P1FA 3OJLA 4YTEA 5I9MA 2VOJA 3F1KA 3AM4A 4EJ0A 1M6HA 5JCJD 2DQ4A 1SNYA 1VC2A 4F3YA 1JKIA 5JAMA 1JAXA 3OMLA 4FJ2A 1E7RA 1ADCA 4FIZA 5JAQA 4TSKA 2GN8A 2DTDA 4ALLA 5G0UA 1XKQA 1VL0A 1B3BA 1E7QA 4XCVA 3CZRA 3KV3O 4W7IA 1DFHA 4PLPA 4P4NA 4ZJUA 3PP8A 4IIVA 1HDGO 1GYQA 2PLAA 4F46A 2I99A 5J23A 3H5RA 3HDJA 3HUDA 2B5VA 4CM9D 3ZWWA 4FDAA 1Y81A 1IPEA 4NFSA 2ZJ1A 2VRBA 3FBGA 4GSKA 1KVTA 3G17A 3I6QA 1BXZA 1BXKA 3BMNB 3EVNA 4K6CA 1E3SA 4ITUA 4NR0A 3DO5A 4IXTA 4CR8A 1NHWA 4CUKA 1IB6A 2Q3EA 3JQAB 4R01A 3WTCA 3DBRB 4IDGA 1K3TA 3TZHA 4S1VA 3WYCA 4BMVA 3RU9A 1N1EA 4GVLA 1DHTA 1HTBA 1OOEA 1ZSNA 3AUUA 1U9JA 2JL1A 4AJ1A 2Y0CA 3BA1A 4A27A 3C85A 2YV2A 4ESOA 5AQ1A 2VQ3A 3E6AA 3NTOA 1U28A 4URFA 3ZHBA 1O9BA 4W7HA 3ZHZA 3OJEA 6ADHA 3CH6A 3L6DA 3V5NA 2ZTMA 2BFPA 3WICA 4CMGA 4TKMA 1MLDA 5T8KA 3LC2O 3MEQA 3H5AA 4KDFA 2QX7A 3WLEA 3NTQA 2VT3A 2ZTUA 4GX0A 2PFGA 4JQCA 4BNLA 5I7SA 2B69A 5L4LA 1HSZA 1JWAB 5IXYA 2HK9A 2C2YA 1EVZA 4LGVA 2FOIA 4I9NA 3E5MA 3VOSA 3I4CA 2D59A 4IBOA 1EVYA 5ER9A 1UXJA 2Y99A 1BHSA 4R54A 1HYGA 1Q7GA 4J49A 2BELA 4BS9A 2DFVA 2Z1NA 3AY6A 1JW9B 4PCVA 1PZHA 1VRWA 1HXHA 4E5NA 4W6ZA 1ENOA 2CNBA 2DUWA 2FPIA 2QRLA 4MKRA 1HE5A 2G76A 4OAQA 3ICPA 4NIMA 4R5HA 4DRYA 1D8AA 4KDEA 3PVZA 5JMWA 1JU9A 5TT0A 5JAIA 4E2WA 3DMTC 4BO0A 4MP8A 5I8ZA 1GV1A 3DBLA 3ANLA 4Q9NA 5CPBA 4FW8A 1BTOA 2I9PA 3KHUA 3OEWA 2AXQA 3LU1A 2X86A 4MINA 1KIFA 2HQ1A 4LCJA 1SOWA 2AE1A 4Z0HO 1Q1NA 1SZJG 3E5RA 1H2HA 3AOEA 1ISMA 3WGHA 1HDYA 3D64A 3RCBA 4BQRA 4Q39A 8LDHA 1Y8QB 4CMBA 3K2BA 1OC4A 1UXKA 1I24A 3GMSA 3S8MA 1NPTO 2YFHA 5LDGA 3F47A 1NBOA 3GN2A 1AUPA 5A03A 2V65A 3LT0A 2AHRA 5IZ4A 1E6WA 2PZKA 4IJVA 1ZK1A 4E2ZA 5A1TA 5AVOA 4ROSA 1JQBA 3QWAA 4D3SA 2GZ3A 4J7XA 1DDOA 4I9UA 4MVJI 4IQ8A 3MTGA 3S2EA 1YS4A 5LDHA 3C1OA 1D7OA 2QYTA 3ZU4A 3RBZA 2VYVD 4QEDA 5G0SA 5TIIA 5I7FA 2YHIB 3X2EA 1RM3A 4GMFA 3UGKA 2NTJA 4UUNA 3KYBA 4XR4A 2BD0A 1JN0A 2GF2A 3GG9A 3ORFA 3VHRA 1V8BA 3C1AA 5KTKA 1IHXA 3WGOA 2GCGA 4MOWA 1T2DA 3E8XA 2BGMA 2Y66A 4P8RA 4WEQA 3HN2A 3GN1A 4AJPA 1PL8A 3BHIA 3V1YA 3WFJA 4CM8A 2Q49A 2NUAA 3OJOA 4KUHA 3BMCA 3QA9A 2ZB8A 4XQEA 4YAEA 5G0WA 2H63A 1C1DA 4HADA 4ALIA 4BO4A 2D5CA 4I5EA 4D3DA 4IDEA 1BXGB 2X9VA 2XF8A 3QWIA 3GT0A 2EGGA 3QP9A 2QRJA 3QRWA 3OM9A 4U0JA 3WX0A 1LXCA 1RKXA 2XPCA 4I5FA 2YY7A 1PJCA 3KSZO 3LDHA 2CZCA 1WXDA 1I32A 4H3VA 5F5NA 4JJGA 3SEFA 1NPDA 5CEEA 1EMDA 1H6AA 1ONPA 3CINA 3GC6A 3UXYA 1HT0A 3OH8A 5JE8A 2Y05A 4PLTA 4ILKA 4YJGA 3EGOA 4MIOA 1EZ4A 3KO8A 1RJWA 2YV1A 2O4UX 5ICSA 2B35A 2BH9A 1Y9EA 3IP3A 3KYCA 3LK7A 3GHHA 1DIGA 3GVCA 1KC1A 2DPHA 3NT4A 2ZK7A 5IN4A 3NKLA 4NU5A 3LT1A 4E2YA 4YJDA 4E6PA 4H15A 1B15A 1YB4A 5ITVA 3FTPA 1PL6A 2IEDA 4R1UA 3MTJA 4FFPA 4JJFA 4Z9FA 1H6BA 1P1RA 4MP3A 1DRWA 3QJ5A 2NTNA 3CE6A 3PDUA 2GZ1A 4A2CA 1YJ8A 4A0SA 1J49A 1NPYA 2UYYA 3ICCA 4YDRA 3AY7A 2QW8A 3H3FA 3DFUA 4R1NA 1LC0A 4CM4B 5CP8A 1QP8A 3DMTA 4UVEA 5EESA 1N5DA 3CPSA 2HRZA 1P3DA 2I3GA 2IZ0A 1EFLA 3H2ZA 4IMPA 4XEHA 1CIVA 4XYBA 3NYWA 2CUKA 1KEPA 1U2DA 1AXEA 5ENVA 1E3JA 1QKIA 2OGUA 2RH8A 3Q9UA 2EGHA 3DBRA 4ZRMA 4QO7A 1FDWA 1BW9B 2Y1DA 3Q9NA 3IDSA 1C0LA 2NACA 2I6TA 1YL7A 4Y67A 5KVCA 5A9TA 2IXBA 4CLDA 4LCEA 5JDIC 1HLPA 3FPLA 1TEHA 1QV6A 2ZCUA 4LMRA 2HMWA 3JD1A 2IDZA 4RZIA 1JLLA 4WCFB 2NU6A 4ALNA 5K0ZA 1I30A 1U8XX 3P2OA 4CMEC 3E48A 3OQ1A 2HMTA 3JD4A 3WIDA 2Y0EA 2IYOA 2HUNA 2R2GA 4NBWA 2FWMX 2PTGA 4NK5A 3BXXA 4J1SA 3D4PA 3D4OA 4YT4A 1O8CA 5JDCA 3PPIA 3U09A 4IIUA 4QTZA 3MJTA 4HXYA 1GQ2A 2QZZA 4NDNE 1MA0A 5DOVA 2BKAA 2RIRA 3E03A 5TJ9A 3ZDFA 3GMDA 4EUEA 2X0RA 2IXAA 3RD5A 4YAKA 1N92A 2VTDA 1H6DA 3TNLA 4DQUA 3ZU2A 3P5SA 1R4NA 2YFQA 2UV8A 2LDXA 4F6LA 5DCUA 4CLOB 1EE2A 1YE3A 4BKUA 1IOLA 4ZGWA 3QIVA 1T2AA 3KSDO 3JYNA 1YOVB 1NAHA 1O94A 5TF4A 1T4DA 3OP4A 4OJNA 3DEYX 4GKBA 4ND5A 1P1KA 2C7VA 4MJLA 4Z9YA 4GWGA 2PK3A 4BV9A 1K6XA 1D4FA 3M6IA 1YQDA 2OMEA 3GY0A 4DYVA 5TQVA 4TVOA 1X7HA 2GRAA 1QMGA 3RUHA 3IJRA 3BMQA 4PG6A 5JDIA 5HRUA 1A27A 2GLXA 2EV9A 3B1JA 3Q1LA 4YQZA 4PVCA 2FZWA 5AYVA 3I9JA 2WD7A 3LT2A 4NJMA 5KJ1A 3BTUA 1LNQA 4CMHA 2AEMA 2H9IA 5ITWA 1P1IA 1X14A 3A1NA 4YT8A 4MIEA 3KETA 3FWZA 5L53A 3DFZA 2QIOA 3MWDB 1E3WA 1E5QA 3IMFA 3ZWMA 2W90A 3F4LA 4NQZA 4JK3A 4A7PA 3JQGA 4GLLA 1EUZA 2EJVA 2GDZA 4DLBA 1B8VA 4ZD6A 3R0IA 4GPD1 4MPDA 4NI5A 3G79A 5EIOA 3W4IA 3EC7A 3DQPA 4WNIA 4I5GA 1NR7A 1X0VA 4YJGB 1HYHA 1O89A 3F6YA 3WDSA 1DJNA 4JROA 4OXYA 4YYZA 4XYMA 1LLUA 1MV8A 4FFOA 4D43A 5JO9A 4XZ3A 5A3VA 1SEPA 4XB1A 1ISFA 1HEUA 3OJFA 2NU7A 1VKNA 1Q0LA 1CERA 1P9LA 1NWHA 1FDUA 1HE4A 2X0JA 2VCYA 3PDJA 3EW7A 2EW8A 3RUEA 5GY7A 1ZIDA 1JKFA 1G1AA 1QSGA 4Q3CA 4L4RA 3NJ8A 2YDYA 1WMBA 4YQYA 2X6TA 1P74A 4X54A 4CPDA 4W99A 2B4TO 1HL3A 4AJEA 2I5PO 3ZWYA 3KSUA 3GEDA 5U1PA 2AQKA 1DB3A 3UW3A 1R66A 1P33A 3GZ4A 5IG2A 3WBFA 2ZKLA 3RASA 5AXDA 4YA6A 1I2BA 2UUOA 3CXRA 3JD2A 1TA4A 1LX6A 4KUGA 2OBNA 5TT1A 1KEUA 2FPGA 3M1AA 3KYDB 1E77A 1RM0A 3H5NA 4OL9A 1U5AA 4BGVA 4BNHA 4E30A 2VHYA 2NTVA 4IDBA 1BSVA 1JKJA 3WB9A 4Q3EA 4G81A 2O3JA 3KUXA 1CRWG 4XQCA 1VKOA 4R1SA 4XJTA 1PS8A 3GRPA 3PK0A 3E9NA 2NU9A 3UFXA 2Z1MA 4XGNA 4FGWA 3HQ4O 3OECA 1NQAO 4FFLA 3C8MA 2J5RA 2CVQA 1PJTA 4J2OA 4H7PA 3H8VA 4PRKA 4EYEA 5TJHA 1ZK4A 3WNVA 5K6AA 1P44A 3JQFA 5TGDA 3HHPA 4NFYA 4RVGA 3AUSA 1T24A 1ZSVA 3C7CB 2W2LD 1X7DA 1ZJZA 3IC5A 3DBLB 5JSFA 2RH4A 3F46A 3WJ7A 1DIRA 3AUAA 3O4RA 1PZFA 3R3SA 1N7GA 2EG9A 2PGDA 1GUYA 4JLWA 3ZNQA 3MZ0A 3GVXA 1GYRA 1E6UA 4PN3A 2FN7A 1VM6A 2BMAA 5AXCA 4BOYA 2A94A 5T64A 3ZH2A 1UUFA 5CDSA 1Z75A 3GGOA 3PLNA 4MVJE 2W2KA 4YAIA 4FR5A 5EQDA 4U6QA 4L74A 3GUYA 4WLEA 1T26A 4IDCA 1B0AA 4DVJA 2BRUA 1I3NA 2G0TA 1E6EA 1KVSA 4E5YA 1MXHA 4ZU3A 4Q3NA 1TXGA 3GDFA 4O6VA 4K9DA 1I2CA 5F3RA 3WR5A 4YACA 3AU8A 3F9IA 1ISIA 3FWNA 5JCJA 2VYNA 4MIYA 3DHEA 4NPCA 5BQFA 2PZJA 3W8EA 3P2YA 1LTHR 1WDMA 3DAGA 3PHIA 4IZHA 5JPIA 3UUWA 4E32A 1U1IA 1X0XA 2D5AA 2CY0A 1WAMA 3DDNA 4XB2A 1A7KA 1A5ZA 2F00A 2ILTA 3HZZA 1PSDA 4BVAA 2HDHA 1JA9A 1Y8QA 1DC4A 5C7IO 3IP1A 3GFGA 1KY4A 4II2A 3E18A 1A4IA 2X5OA 3HNPA 1K2WA 4RF4A 1LSSA 1MG0A 1PGQA 1QXSA 2OL4A 1EFKA 4GX2A 3O38A 3IS3A 2O4CA 3NV9A 5ADHA 1GEEA 2TMGA 3JYQA 3JQ8B 5TX7A 4L0QA 1GZ4A 3CMCO 4IQ0A 3Q11A 5JC8A 2B36A 1K6IA 4CQMB 3G3EA 1ZK2A 3K5PA 3WTBA 3O9ZA 1PL7A 2C0CA 3GPDG 4BIIA 3RC2A 1UXHA 1KETA 1VI2A 2HO5A 2LDBA 1ONOA 2DT5A 3FD8A 4BO9A 4BMSA 2J3IA 1K0UA 3FHLA 1E0DA 2D8AA 5EQFA 4J0EA 1WW8A 1U8FO 1VSVA 4BGEA 1GD1O 3W4KA 5A02A 2GYYA 1M76A 4JXKA 1IUKA 3BMOB 3BTOA 1E1MA 3CIFA 1BGVA 4FN4A 4GKVA 4XQGA 4CQMA 1MFZA 1KVUA 4N7RA 1YRLA 1C1XB 5HWSA 2D4AA 1IPFA 2NNLD 4ZA2A 1XQ6A 4MVJG 4PG4A 4OKNA 3WSVA 1CETA 3FNGA 2J3JA 2DBQA 4J6FA 5CEJA 5I8WA 3Q6IA 1Y8RB 5IZCC 5CFZA 4K28A 5THKA 3ABIA 4M1QA 1EEHA 2XXJA 1NNUA 3BYZA 2VWHA 4J16A 3W6ZA 1RM4A 2EP7A 1V9LA 1T1RA 4AICA 4GAEA 4AJOA 4FCCA 5A04A 4JP3A 1W0CA 3FBTA 1UP6A 2ZQZA 1YO6A 3PRJA 5T5QA 5GZ1A 4RQUA 1BG6A 3GNSA 1XSEA 4L9RA 3GUCA 1TT5A 4XIJA 5A4DA 1HDCA 1WPQA 2O3RA 1X15A 1XQ1A 1PJLA 4HBGA 3O26A 3KLMX 3JQBC 1GV0A 3IAHA 1WP4A 3D3WA 3U4DA 3IKTA 1ZW1A 4KTVE 1UAGA 4HKTA 4R5MA 1GQQA 1KERA 1LDMA 3FR8A 4OHUA 1DHRA 4P38A 4E12A 3JQ8A 2PKQP 1ZMOA 2C54A 1YQXA 2IRWA 4QXMA 2CSUA 3KEOA 4AJLA 2QHXA 4MDHA 5JC1A 3V1TC 1HE3A 4J4TA 2C07A 3VDRA 1GUZA 4HV4A 1PGNA 1TLTA 2SCUA 3DHYA 4MVJF 1Q7CA 3EHEA 4BNVA 1A9YA 3TL3A 2V7PA 4HFJA 1XIVA 3KTDA 1ADGA 1GL3A 5KIAA 1M75A 1QLJA 3NT5A 4WECA 3RC7A 3KXDA 2EIHA 4EEZA 4W82A 1K5HA 2OFPA 3GZNB 1NM5A 4FGSA 5IXSA 5JBIA 1DFGA 4JNKA 2OBYA 3AY3A 3E82A 1F8GA 4CLOA 2VT2A 1L1FA 2X9GA 3L9WA 3VKVA 1M2WA 3VPSA 1IULA 1EK5A 1IHYA 4NMHA 3WGZA 3GOHA 2ZYGA 1DRUA 4OOEA 3RKRA 4YJHA 1I33A 5G4LA 1E7YA 1E5LA 4L75A 1WDLA 3LLVA 4LRTB 3RUIA 3RVDA 4IY1A 3JD0A 3ASVA 1YDEA 1E1NA 1W6UA 2AQ8A 4MP6A 1GPDG 4PZCA 4NBVA 5ENDA 1H0KA 4XR9A 1O6ZA 5F1KA 4CQLA 4EBFA 3NUGA 4FJ1A 3PI7A 3HE3A 4AJ4A 2D3TA 4PGFA 1JTVA 5BSHA 1YVEI 2X23A 3BMOA 3KYDA 3N7UA 4OM8A 4WEOA 5DT9A 4BNXA 1UR5A 4YPOA 3WNQA 2E4AA 3F5SA 2VRCD 5CDYA 1PS0A 5G4KB 4EJ6A 3JV7A 4RPKA 5KJCA 2NWQA 5TLSA 5GMOA 4CM6A 2E49A 1GUFA 1VL8A 4U0KA 4EW6A 1N2SA 1U5CA 1AHIA 3WXBA 2I67A 3UN1A 4E13A 3IUPA 4BB6A 1ZZEA 2JD2A 3H9EO 1ZFNA 2QYSA 3ZWPA 2PGJA 1PJSA 3FNFA 1HSOA 4YB8A 1YOVA 3B1FA 4YJFA 5F21A 2GUGA 2WDZA 1XDWA 3DAFA 1J5PA 3DZFA 3GLQA 1MC5A 4Q3BA 5BNTA 2EW2A 4RGBA 1FDSA 2EEZA 2Q2VA 2BI7A 2O7QA 2EXXA 2AEJA 2P5YA 1HETA 2DLDA 3ONEA 4WJZA 3QHAA 3RBVA 2J3HA 3ZN2A 4B79A 4JIGA 3ENNA 1SB8A 2GO1A 4WK6A 2P91A 2JCVA 1YL6A 3DHNA 4XWYA 2VOEA 1DBVO 3S1LA 3WG9A 2JCXA 3PIDA 4IXWA 4I1IA 1IYZA 2H5LA 3KM0A 4RORA 3CEAA 1BDBA 2W2KB 1B3RA 4O1MA 2JJYA 3JQEA 2AMFA 4R9SA 3JQ7A 4R51A 4HFRA 4LK3A 2UAGA 3FTNA 5AOVA 5FEUA 2PH3A 1Z6ZA 2OOSA 2WE8A 4D3FA 3H9JA 1Y1PA 2OHXA 4XQ9A 4NK4A 1LRLA 2GZ2A 4P4LA 2V6MA 3NT2A 1N7HA 1QV7A 1TT5B 3RJ9A 1H94A 1LDYA 2NVWA 3EY4A 1VJTA 1WWKA 2A9FA 2NLOA 4CMKA 2OP1A 4R41A 4LSWA 1PQPA 3DTYA 4E5KA 5B4UA 5L51A 4CR7A 4OXNA 1XELA 4NNJA 1UP4A 1QYWA 4A03A 4K26A 3JYLA 2XOXA 1NFFA 4GGPA 3SJUA 3TPCA 4CJXA 1DC6A 4W9NC 1YL5A 3GGPA 3H9GA 2PWZA 2B37A 2HK8A 4O59O 4ZRNA 3DB2A 4UVDA 1LUAA 2V6GA 2XXBA 1MUUA 3BAZA 3EYWA 4FOSA 1WZIA 4LN1A 4B3HA 2HJRA 1YBVA 3ADOA 4DIBA 1YH3A 1NAIA 2EF1A 2TMDA 5CDUA 4IDAA 2PY6A 2JHGA 5DDIP 2DFDA 3OHSX 3QWBA 1Q2XA 3ZNOA 1TT7A 2O23A 5B37A 2DM6A 1UJMA 5TNXA 4BNYA 2GN9A 4IM7A 5HS6A 1NVMB 1NQOA 3VVCA 4M87A 1OI7A 3INTA 3V8BA 1GPJA 1X1EA 1N9GB 4HNHA 4N5MA 4AJJA 5IN5A 1GTMA 3DONA 4EEXA 2DU8A 2DTXA 3LT4A 4CMIB 1HKUA
chains in the Genus database with same CATH superfamily
3MTEA 1YK1A 4NE2A 3I6YA 4H7IA 4WBNF 1W46A 4X3CA 1PYOA 2QPLA 3ML1A 3ZY5A 3HY3A 2VHQA 1J2RA 3HGMA 1L4FA 5E9AA 4IJQA 4V0SA 1KQNA 4HDAA 4UPEA 2Y76A 3QFFA 2I6FA 2OAGA 4ZT6A 3LUFA 4KH1A 1I6LA 2I55A 2Q8PA 4OFBA 2MSCB 4EGQA 5DTJA 5AI5A 2PD3A 2R0QC 1UC9A 3PI6A 3NYRA 2GARA 5K6RA 2I3BA 1OVMA 3H6KA 3M6XA 4FFNA 5IVKA 4Z86A 2QKYA 1SZCA 3TLCA 2H1SA 2ORIA 3KUDA 1JLRA 1ML4A 4BFVA 5JI3E 3N86A 4AFNA 2VDJA 4DCVA 2EYUA 1Z73A 2ET6A 3IUEA 3RREA 4CEIA 3O31A 3ZVLA 5MDHA 1F5SA 5LZ4A 1II0A 4HGRA 1HNZB 3RVJA 3LBAA 3DPIA 2AYZA 2GZSA 4BLPA 5E7IA 2G9ZA 2Z0MA 4AWBA 2SICE 1ABBA 1UAYA 2IK8A 2PZLA 1H0SA 3CF6R 2E1RA 1FVFA 1RWXA 2P2LA 4JI6B 4DMRA 4TXLA 5MHTA 3AVOA 4EFKA 4Q9KA 4MMYB 1FRQA 2HIAA 3GHYA 1H5QA 3DEZA 1QHHB 2XUQA 4D80A 3PF8A 3SZGA 1NJ6A 3Q7PA 4X95A 2O3QA 4MWBA 1CUHA 1G2QA 4HEJA 5ES3A 3RSSA 4MR8B 5FTKA 1Z63A 1CB0A 2JFFA 3HFRA 4PX9A 3UXEA 2H0QA 1Z5PA 2JFNA 5CTJA 3WADA 2AC4A 1IBKB 2CMDA 4MUIA 1ABEA 1HLFA 1XD8A 3SR4A 2OXEA 3TNJA 1UKZA 4EVSA 1YHYA 1P77A 4TL7A 2ZM6B 5E8RA 3KV1A 3ZH9B 3GIDA 5F7XA 2PEZA 2WYVA 1CY1A 3DMPA 1ZP6A 1OLSA 3TAHA 3LPNA 5K8TA 1U2TA 4OBXA 4UVIA 2HF7A 3QU4A 2HU7A 2C4TA 4C43A 2IEYA 2P9BA 4ZWNA 2FSVA 4AKEA 4CF3A 3T38A 3S2UA 2IQ5A 3GWGA 3E9ZA 1TCVA 2PKRA 2E4YA 2REXB 2WKRA 1UJBA 4OQYA 1CZKA 2D0IA 1K7YA 3RS3A 3VR4D 4CI9A 1N3IA 4QUBA 2VWGA 3U62A 6AT1A 1F6WA 3HU5A 4OXIA 3HJHA 4BO8A 4Q5IA 3SBEA 1QGUB 1R37A 4B81A 2PMCA 4DYHA 4WDQA 1QZUA 3H7AA 3MAJA 2QL5A 3HWX1 4M76B 4WLUA 4XTCS 4UCXA 5JAPA 3RUCA 2IWHA 5AVYA 1TI7A 5LLTA 4MICA 2JFUA 3SNHA 1XQYA 4AY6A 4RD2A 5F98A 4RHXA 1A1SA 4ZYUA 3HXTA 4UE6A 2QENA 5E4TA 4HZIA 2Q5HA 4B33A 4R9UC 5CHYA 5CEFA 2Q9UA 3TSYA 3JTMA 1MH9A 3NBZC 5EKTA 5B53A 4M83A 1G5IA 4J0FA 3TCXB 2WQ6A 2LIVA 3PUKA 4NY1A 2WJGA 4KSBA 3UW1A 2C3YA 4IDFA 1T2FA 4QC2A 4DKXA 1O9GA 4PC2A 4KODA 1QP4A 4ZZ2A 3ZOZA 5THQA 2PTHA 2CYBA 1PJBA 4LI3X 2IT1A 1ORIA 3EK2A 3UF0A 4ZU6X 4YNBA 1TMKA 3FKQA 1YA4A 4HEA1 4OU4A 4QLBA 1SVNA 2A35A 2ODTX 3A06A 4KK3A 2QTLA 2WICA 1BGXT 2WZCA 4NYMR 1XB2A 4HTFB 3VDQA 5I9LA 5K3EA 3RC1A 4NZYA 2Q21A 4FQ8A 1RE1A 1Y3HA 4DWVA 3KYCB 3LFHA 1AA6A 4G26A 1U2PA 1OZAA 2PGNA 2DWCA 1V41E 3B70A 4REMA 4B6GA 2GFIA 4WXRA 3TR0A 3JRXA 2KHZA 4GRAA 1JEJA 4B74A 4CQMD 4WFKA 1TPZA 2C57A 2CJPA 3QXGA 4D9HA 4CLRA 2PMWB 4XRRA 4X66B 1E3LA 1I01A 1LLCA 1F5NA 2R6JA 1LS6A 3R3YA 4IQGA 3UB3A 2Y1OA 1DC5A 1CE8A 5FUXA 4ARZB 4O2BA 4E5UA 4YRFA 3KVVA 5TE9A 3CE9A 3DKIA 2MMGA 2ES4A 4H3KB 3T3IA 3U7QB 4KE8A 5C53B 4AU1A 2DQSA 1T29A 1U7XA 4MQ6A 3ROFA 1RM5A 2NVBA 4LXQA 1IXKA 2ECFA 5BSUA 5KTRA 2HA6A 1A76A 1PJAA 4KXUA 4TL6A 3SEQA 5CG1A 2P9FA 5IUKC 4M6WA 3VO8A 4TTJA 3RS5A 1SUEA 2XRMA 1Z47A 5IX8A 4WN3A 1FXSA 1PS9A 1YVUA 4A16A 2FHPA 3KZ1E 3MB8A 4AIRA 3SQDA 1OASA 3L8EA 3EGCA 1FE8A 4BZXA 1RZUA 5CITA 3IQDB 5LBTA 4RKRA 5JZVA 2V0CA 5D6OA 4ARSA 4MGEA 5ITZB 1W5EA 2P68A 2Y1CA 1BAPA 2HJSA 2X0KA 1O94D 1TZKA 3PGJA 4CM5A 4KRFA 4RTLA 2BH2A 1SKUA 1XVUA 1IDOA 4FEAA 4IS2A 3PUVA 4KWTA 4M22A 3G5UA 4W9NA 5DEIA 5JS6A 2AMJA 4GU5A 4QJ5A 2HLHA 1FZQA 4PG5A 5HDQA 4KQ2A 4BZWA 4H0CA 1F1BA 2XVXA 4GZLA 4EHDA 2CN1A 3JQ9C 1B76A 1SWVA 2CFOA 2I7DA 1NX9A 3NTLA 3PFBA 4YDHB 3UAVA 3L4BA 3RU7A 4E07A 5FAKA 3AVTA 1XR3A 3MBIA 1U7OA 1P60A 1AXGA 3FE2A 2J87A 1QK3A 5EEGA 1XCBA 1DQSA 3OLQA 3LPLA 3KZVA 2FPGB 3OVMA 5FI5A 1TCCA 3PNYA 1RXIA 4MKFA 4EL5A 1PI3A 1Z5WA 3F9RA 4A8PA 5C7YA 4KYVA 3DC2A 4HD8A 1UZLA 2AQHA 2PX0A 2VK2A 3DEAA 3L6EA 4GF5A 4J0HA 4RDXA 3WL6A 1V26A 3ABQB 2B0JA 1ZN2A 1LBTA 2AEFA 2XGGA 3BXFA 4PLYA 2QZJA 4UUMA 5TGTA 5JSZB 1N36B 1X1TA 4KXLA 4R68A 2WC1A 2FX5A 3DTVD 1ZH4A 5A6SA 4JB3A 1PCXA 4DXHA 3NAZA 3GPLA 4UM5A 1PAUA 4UDNA 3TLGB 2R6AA 3LJKA 4DV0B 2VJBA 2EZTA 5HUHA 1XJ0A 1M1UA 1Y9AA 2PX8A 3FHCB 3PPWA 4HNGA 2RAVA 2PV7A 1GSHA 4G1CA 2FLVA 2TMYA 1BO6A 1G7RA 1XZFA 1IZ7A 2GD6A 2P2SA 5AKEA 3DZHA 3G1UA 4QQFA 4TRRA 3BGOS 4JOCA 5KYYB 2H7VA 5K4AA 5LMCA 5JV5A 1U3VA 2JD0A 2BR4A 3PWSA 2GB4A 1ULBA 3AVQA 4FIDA 5D86A 5FPTA 2CZGA 4ZIRB 1GO2A 1DV2A 2G07A 3PPYA 5IJ0B 1IY2A 1R0SA 1KE2A 3G0OA 1E2NA 2FU5C 1CUAA 4ASUD 3VZSA 5LDDC 1SBYA 3IUJA 1JIQA 5BWNA 2D06A 4D5EA 1GNPA 2VUSA 2BJVA 3BM5A 3AETB 1NLMA 1E1RD 1UWKA 3GAAA 3QI7A 2Y1XA 2NYRA 2PSDA 3BFXA 2I4NA 3QUAA 3ZTTA 3U44A 2V7XA 3SHTA 1D04A 3KJIA 1F20A 4ITRC 4MR9B 4RV9A 1ZINA 4W8OA 1LU9A 1Q7TA 3RS7A 1XZIA 5JYEA 4G37A 1RWMA 1XZMA 2IPLA 3FOBA 1S9DA 3SDBA 1R0KA 4JBHA 2QSZA 3CH5A 3VV2A 3DOCA 5EC8A 3TMKA 2JAXA 3N0RA 2X40A 2ZTLA 4S1NA 2JJ8A 5LXTF 3WYEA 4KH0A 1VXOA 4B6JA 1LLDA 1PR6A 2ZRLA 3C5CA 1JNXX 2J0VA 1N5RA 3T5PA 2E4VA 1CLEA 1YDFA 3RIGA 1RT9A 1T6NA 1CCWA 1OFUX 3PIIA 3OESA 4C7JA 4KQ1A 4DUYB 4BKRA 1FQJA 2Z83A 3FUXA 3IDZA 3KC2A 4RF3A 1DUSA 1ZN8A 3DC7A 5K3SA 4CW7A 1H65A 1ZGJA 3GLKA 4B75A 1WHTA 5EIBC 1R3DA 5COAA 4LNUA 4E5DA 4UMFA 2ZIGA 2QYOA 3D4NA 1JHXA 3GYBA 4B6RA 3ZCQA 4NJOA 2VKTA 3LTNC 2Q6TA 3D2BA 5DNDA 2IU3A 3O8OB 3BMQB 2YBDA 1Q1BA 2VP3A 3K35A 4KK4A 1SHTX 1SN7A 3BHNA 2DBZA 1RHKA 1XD2B 3FTDA 5IH3A 3T0FA 3A14A 1NMYA 3R8FA 1BRMA 1UBCA 1M2OA 3TRJA 5IJ9A 4LDRA 3NHKA 3IOCA 2XKJE 3MXOA 5ERYA 2PZ8A 3N6RA 2R1TA 1GTRA 5JXWA 1WB5A 1IZ8A 4RKWA 3BD9A 2VF5X 3N70A 3L4KA 2Q5IA 4OQPA 2WKPA 1MXFA 1E4OA 3EYAA 4CQNA 2CNWD 4ZC8A 3B6ZA 3BWXA 4P3NA 4RLSA 5EGNA 3CNOA 4HQNA 3A3KA 2Q4TA 3K96A 4EZIA 2D74A 1F3LA 3AM5A 4Q1CA 4WGGA 1TJYA 2XUIA 4KWIA 5DLYA 3PEFA 1VE3A 4EKDA 3BMNA 1UC8A 4DMHA 3F49S 4IRUB 3E4DA 4OBBA 1QKJA 1TD1A 3AEUB 2F8SA 3OA0A 3ZS9A 4G56A 1FXWA 1DT3A 2OILA 3L02A 3PGXA 4MI1A 3HV0A 3KEMA 4TV8F 1U1DA 4LRUA 2IBMA 3MQ4A 4ZQGA 3ZS8A 4QT4A 4HAOA 3NHRA 4YH1A 1R4MB 1PT6A 1SVLA 4GICA 3BMCB 4BFXA 1IY0A 4UJ5A 2HRBA 3RUPA 4CM9A 5KWSA 4DLWA 3D3EA 3MCZA 4A0HA 3EVCA 2YJZA 2V3VA 3R3JA 3W5CA 2QE6A 3R6DA 1T8YA 4L4UA 4ZDWA 4QBHA 4E7OA 1HDZA 3SHWA 1QWOA 2NZJA 1CY6A 4MVJA 1XA0A 3PIRA 4FBMA 2OMKA 3RGWS 1SVOA 5M34A 1JG7A 1EBBA 1WDKA 1DG3A 5D8DA 5FWNA 1N2EA 2QN6A 4PNPA 5AVKA 5KOYA 3CKYA 3G2LA 4K9PA 1BMFD 3VR6D 1KY2A 3C6MA 2PYDA 2ZB3A 3DP7A 1ZEMA 1E3MA 1KJYA 3PHCA 5BW8A 2IZOA 4DUGA 3L9XA 4UHHA 4YUZA 4P3PA 1ECBA 2WU1A 4KPUB 1UJ5A 1XJCA 3M6FA 3NG1A 1VMKA 5B2EA 1ATIA 4DSTA 3GROA 4EITA 1M1YA 1J8MF 1XZQA 5C34B 5L7TA 3RM3A 2WSIA 4KLNA 2BEKA 1TK2A 4C4AA 1X77A 3FWYA 1MX3A 4E4YA 2IZ5A 3D6VA 3WLJA 2P4QA 2ZVDA 3WY9A 3PNLA 4Q4HB 3CT6A 5E6UA 3WL3A 9MHTA 2VP9A 5HNKA 1OTYA 2JGJA 1V4BA 2E3JA 2P79A 2RHLA 4GZ3A 4MEJA 3PXGA 2FW6A 4MWZA 5JY1A 1JVBA 3ZVRA 1G38A 1P19A 1PR1A 2NUAB 1GARA 1NI3A 4OQEA 2PFKA 4RZ3A 1XTVA 3W2GA 1G6OA 2NXJA 3RAFC 1XTPA 1PQWA 2ADFA 1FF9A 3NNSA 1TYBE 1ZICA 2CE7A 2JRCA 2WIAA 3UBMA 3ITDA 1H0HA 1NF9A 3NHUA 4D9FA 5IJXA 2O8NA 4LQLA 3U3OA 2EATA 4PPYA 3ZQ6A 2HSGA 1WCWA 3H17A 4HQRA 1GITA 2XDQA 2QG4A 2FZLA 2Y1EA 1VFNA 2JEYA 2Y3IA 3HKCB 4MTCA 5KVSA 1YDWA 3KVOA 4HYTA 4OSOA 5CB4F 4LHZA 2B8JA 2H16A 5AW1A 2WWTA 4BNWA 3MOGA 1SWWA 5D00A 1HDOA 2FF7A 2VK4A 5E6RA 5B36A 5LR6A 3NOXA 7MDHA 4DV6B 3K9BA 3ZWVA 4GFDA 5DYYA 3AYZB 3T7CA 1IQPA 2ZZKA 1R6DA 3NCTA 3WLMA 1TAHA 5CG2A 4R9RA 3NWEA 4XVHA 2YW9A 5DHQA 3VR5A 2D2IA 1RBQA 3RTEA 5JZMA 3HXOA 4D98A 2W4IA 4FUQA 5ALQA 3CHYA 4HLNA 1W35A 4TS1A 1B6RA 3IMEA 1CY2A 1T2UA 3V4ZA 3VH1A 4YC7A 4Z4CA 1PJ4A 3GAZA 1N0HA 1NQVA 1KZ4A 3B20A 1E61A 3HRHA 4QUIA 4F3CA 4Q19A 4R69A 1C3JA 1ZLYA 2ADOA 2DKNA 4UREA 2Q7OE 1UMBA 3MTDA 4KXVA 1Y7LA 4PPGA 2WSBA 1H3FA 1VGRA 1SUSA 2Q4DA 4P35A 1YCDA 2I3DA 2HI0A 2VYND 2JAUA 3TSZA 3KLOA 3OE7D 1MQSA 2OOKA 3OZBA 2QMZA 3R5XA 1SJ9A 2ZBRA 4GLFA 3VR6A 721PA 2IIPA 4XIYA 3FYTA 5T4HA 3IMGA 3DT9A 2C4WA 4MW5A 1SHZA 4IIJA 1AGNA 1RI1A 2GJKA 4TVBA 1AV6A 1L4UA 1GGEA 1Q6ZA 2HRQA 3FCOA 1TM4E 4PICA 2F2TA 3VOAA 1U2DC 1AKUA 1E4EB 2XYGA 4ZDJA 4TOIA 1ZEJA 3VYSB 2H92A 4RPLA 2DLCX 3KBOA 1KAMA 1Z16A 2OHOA 5C18A 5GVSA 2I4TA 4MWEA 3HJUA 3BHMA 3A05A 1OAOC 3BRWD 4Y9DA 3GLFB 2R48A 3GRYA 4WK0B 2ZB4A 4GMHA 4EYGA 3THYA 3K1AB 1QO9A 1M1XB 3EQ2A 1NLZA 4P34A 1SO8A 2Q5OA 4LRYA 4PZEA 5IAJA 3NVKI 4N76A 4PU0A 2VYQA 4BJ5A 2Z08A 1RYFA 1ISHA 1P7CA 3WSWA 3SS8A 1UKAA 1QNLA 1WXXA 4EJMA 2HHHB 2YRXA 4YV1A 1FMFA 3F78A 4N9WA 2Q7DA 1RPNA 3CEPB 1DX9A 2VDQB 2ATIA 2WV7A 4HAVA 3RNLA 3T15A 3A2LA 4H59A 1TAUA 4AQYB 3IRUA 4G0PA 4K6MA 1W0KA 4OP1A 2PT9A 2OGWA 4QBFA 3ZEAA 3T3MB 3PENA 1F2DA 1V8PA 3QSGA 4DNOA 3U5TA 3D6AA 3A1EA 3IODA 3DAYA 4FU0A 2X0NA 3QYPA 4M1EA 4M7OA 5D3MA 2QNRA 3M1IA 2A84A 3O21A 3WK5A 1ODKA 3W2EA 1KZYC 4OYHA 5H4GA 2IOFK 3NYQA 4IJUA 3PX3A 4OMUA 4PIVA 3M6MD 4ZFNA 5BN1A 4F5EA 1WY7A 3P9NA 3ENKA 3TVTA 1A0OA 2NQ2C 3CLRC 5K3BA 1NW5A 1T2NA 3U4HA 4J7CA 3CLVA 1E1KA 3OSUA 3QNUA 2M6KA 4C6HA 4B7UA 2C95A 5JNTA 5KTYA 1L5MA 4P5EA 1NRXA 1P1BA 3CX6A 3H2BA 4RD3A 4UCWA 5DBFA 3LXMA 2DERA 4Q05A 4W5JA 3Q8LA 2QUHA 5ER6A 2PS0A 2AX3A 2EWMA 5CGZA 1ZM3A 4MS1B 3GJ8A 4COOA 3J81k 3AF6A 4ZCQA 2A7XA 3EUFA 3C6XA 3KB2A 4F3RA 4I1OA 3EUWA 1DTWB 4OH7A 1RLJA 5B58C 3HJRA 3LKZA 2QZSA 4DT1A 2ZRDA 1LK0A 2IYXA 4IF6A 3W8RA 1CS0A 1WNFA 3KZNA 3U3JA 4RK5A 3RVLA 5H83A 1FFWA 3TQQA 1OC2A 1USVA 4GWKA 4JQOA 4E33A 5HIIA 4F92B 2CCKA 2W2MA 1VIYA 2P0EA 4TVSA 5LUBA 2KS6A 5IBCA 1KE1A 3ESBA 3ROTA 4HWGA 2JHAA 3QUTA 5DEOA 4MYDA 4R83A 5KJ6A 5DHAA 3ZV3A 3RSQA 5FV7A 2H52A 1MBZA 2B98A 3WV4A 1KH2A 2CB9A 2F1JA 1UFRA 1T4BA 5IT9A 5EXSA 1T1GA 1X7XB 4QHYA 2DEUA 1IWBB 2O54A 4DQVA 2DZDA 3I52A 3SJCA 5IM4A 3EXAA 2XX3A 2W8ZA 3UA4A 3NWOA 3U48A 5JS7A 1W9HA 4L07A 4HBZA 4IHKA 1EINA 5FPYA 5TPZA 3A3OA 4CL0A 4ZHQA 2L2QA 1XE3A 3O74A 3KR2A 2WJPA 5AKXA 2QX6A 3EVEA 3GVIA 3UB4A 3QXHA 4M1ZA 4C9BA 1APBA 1PFYA 1ODLA 3AIMA 5CBPB 1WKVA 2HBYA 4EAAA 1YZKA 3HB7A 4TT3A 3UT5A 4Q3OA 4WGFA 1JT2A 4JUIA 5E7JA 5G40A 1WR8A 2L42A 3KG2A 1NP3A 4X84A 2G5TA 4L4XA 4GSLA 2XTNA 1E32A 1L7XA 2Y0DA 1NXXA 3TXYA 2P27A 1YVPA 2GM5A 4X71A 2W00A 3EGDA 1Q0PA 3AG5A 1JBEA 2IXTA 3GGGA 4KIFA 2IXFA 1Q91A 2GBLC 4GIBA 3TNDA 2HA7A 1ISPA 4ZHQF 2HHAA 3I37X 2RI1A 3GRZA 5AM4A 3WIBA 3IBCA 5IU6A 3KD2A 3GA5A 5FF9A 4KL8S 1C8VB 3HYRA 1E8MA 4M98A 4G41A 5EEHA 4ZU1X 3UKJA 5JD4A 2AZXA 3F3MA 5NLLA 2R97A 1EHCA 3AUTA 4Q4CA 1N6KA 3WLNA 1U90A 4F45A 5FL3A 4OH1A 3QNWA 2Q46A 4RTJA 2JK1A 2HFJA 3X1DA 4F7DA 4CKEA 4ZAFA 3FYDA 1NQWA 1OU4A 1L4EA 1W1IA 1GQYA 3WRXC 1QH8A 1T36A 3TNFA 4JJ6A 3SE0A 2PUWA 4RHTA 3WGTA 5CIYA 3DZCA 5DYGA 2IYEA 2RHCA 3I5AA 4AUNA 1E2IA 2Z5LA 1Z0ZA 3QXXA 1MX1A 1GKIA 5KWIA 4YCSA 1HM5A 3T9FA 1RW4A 3C6QA 3W2IA 2P9GA 3AF5A 3PRKE 4A6XA 4B34A 4C7OB 1C4OA 3LUBA 1XX6A 2GM9A 5KYWA 4F2PA 4U4AA 3AOGA 4MVCA 4HXFB 4P3YA 3RYIB 3DMRA 3U7IA 3ZWDA 1CR6A 4DRXB 2JHFA 4Q9LA 1Q5PA 4C5CA 1J23A 4JDUA 3LECA 3V8MA 1XDBA 4H4EA 3TW6A 4BMXA 2R60A 1FTYA 2GBGA 5B3KA 5AMXA 5FD8A 3QWFA 3IL2A 5K3OA 1JI3A 1ZI9A 3PYMA 2QDKA 3BF8A 3D7SA 3FYHA 3IPXA 3QLUC 4A6DA 4C4RA 1ABFA 5T3UA 5C5CA 2JCYA 3TLJA 3P2JA 3DDHA 3H97A 4OHOA 1F38A 4F72A 1V6AA 4KXFB 4P0QB 3TIVA 1KPIA 2VHXA 4B3IA 3L4SO 1F1JA 4HDSB 3R1IA 2QRHA 2ZI3A 3AETA 1B4DA 1NLFA 7AT1A 3Q3EA 2A9OA 2NADA 5HEKA 3A1TA 4P7FA 3I8SA 5L95A 3TGLA 4OHVA 1VDMA 1Z0FA 3DWFA 4NCJA 4QBGB 4QRIA 5KWEA 2IS4A 4I1SA 2HJ9A 1Y34E 2ENUA 1WMAA 2YWEA 1XDDA 4KMSA 2R62A 3OE4A 4WPGA 4P7BA 4RMIA 5C81A 2F1IA 4U5XA 4RPHA 5FOTA 1QIMA 5EE3A 4QJ3A 2IX3A 4X62B 2C7RA 4BX0A 1FSGA 1G16A 2BFBA 4HFMA 4WOCA 2RCYA 3JAKA 4YUVA 4UKDA 2M1ZA 2FOLA 4R7TA 3D7KA 1THZA 1RRKA 2AVNA 4AROA 3ER8A 2OFWA 1RQPA 1LVUA 1VLMA 3GQBA 4HWTA 4H6VA 4JC0A 3ZBUA 1R8YA 3ZCPA 4BO5A 4KOAA 3FOWA 1TQDA 2IUFA 3H2IA 3N9IA 3K0AA 1DPGA 5DHUA 4QFCA 1LPOA 3DMNA 1Y3CE 3UAGA 1R4MA 1V1RB 1XG5A 5A3JA 3TN7A 1AZSC 2WAYA 1N8SA 1GOTA 2I0FA 3SXJA 1E2JA 4DEVA 1LJUA 2WK1A 3OETA 5L40A 3ZK9A 5ADWA 1QONA 2NUBA 3AEUA 4OXRA 1FP6A 5KJEA 4TV9F 4B3GA 5AK3A 1I1QB 2O8VA 1DGQA 3L0YA 1VTKA 1Y1SA 2BEVA 2N47A 4HAYA 3ZHXA 5IMSA 2VRWA 4YXWA 2ZQYA 1MAWA 5G3YA 2FZKA 4PS1A 4BQOA 1RAIA 1LRJA 1NW3A 1RC1A 4IG9A 4OQQA 1WB4A 2BCJQ 3P0JA 3IIMA 4ALJA 5K7SA 5ALVA 1EFVB 2GD0A 4H4DA 3CZMA 3SC2A 3VKHA 3KRTA 1L5YA 3PVCA 4FDLA 1C9EA 2BFDA 1Z28A 5DF1A 3OQOA 3PWZA 4C01A 4Z1MD 3L8MA 1AUVA 3FH0A 3WB1A 3ZZNA 2WSYB 3L7LA 2XXAA 4D79A 1PWEA 2NZ2A 1K66A 2AG1A 1V39A 1NV8A 2JI9A 2C58A 2CVZA 2Y77A 3ZDXB 5BSVA 4RCVA 2CDBA 3RRYA 3T4UA 4J29A 3H7IA 5BR7A 2NQ8A 2QQ5A 3AR7A 3CUVA 1EJ6A 4BO2A 3JVEA 2I7CA 3COJA 1ORRA 1MTZA 2PKQO 4EGFA 2ECKA 5IKXA 5K05A 2RHHA 4YJFB 3G0BA 2BISA 3HJTA 5C1PA 3LHIA 3I9OA 3QPCA 5HA5A 1W59A 3BZUA 2D13A 5JVDF 4DE5A 3GH3A 4ZN6A 3EWSA 4R2MA 3DP9A 4ZKDA 2IP2A 3M6LA 1HPLA 3EEBA 1GAJA 3Q0IA 5JEEA 4F3TA 1KYYA 2YWRA 3K09C 1MC4A 1W49A 3KQTA 3MC1A 4OPMA 3I4FA 3E9RA 3LVQE 2FWAA 4PQFA 2WU3A 4JAVC 1MT3A 1NJSA 1U3CA 2FMTA 1E62A 4JYBA 3LY7A 2QUKA 3AP3A 3RNOA 3UJCA 1KQ3A 3A3YA 1Z2AA 3MJSA 3FB1A 4GRDA 4UHCA 3R9XA 1NW9B 1OREA 3LGAA 1HLDA 4HYYA 1K7EB 5EQTA 3L7KA 2D54A 1J8QA 3R76A 3ZHSA 1W25A 4XPZA 1TUGA 2VXYA 4OD0A 3UVEA 3UJPA 4EIWA 2JBAB 2IH5A 1O4WA 1IEVA 1SD2A 2GN6A 4L08A 1BC5A 1J39A 1AQLA 2V5AA 1D2CA 2HH9A 2BLNA 2PJUA 3H2JA 1M6EX 4WZAA 5AP9A 3OQIA 3U3KA 3BGDA 1FJHA 2AVDA 2C5EA 1DO2A 2VTEA 2Z5GA 1IL0A 1I2AA 4J91A 4KAFA 4X6XA 5T4EA 1TTHA 4BHTA 1R6TA 3OZCA 5LOVA 1BX0A 1JA1A 1U1GA 3F98A 4GQAA 3M83A 2VHUA 4KDCA 4UFNA 1NNEA 3UXHA 1Q19A 1JDVA 3GEPA 3IIEA 2BMEA 2YHUA 4PZDA 4J4HA 3MD9A 5EZ6B 4F6CA 4I1UA 5F5XA 3KTAA 1F06A 4FYVA 4NCXA 1AE1A 1ZBQA 5AO9A 4BJ3A 5LQAA 4W9MC 2FUNB 2JI4A 3EF1A 3TRIA 1U0JA 4E0BA 1WZUA 1MP0A 1OIVA 2IHZA 5E2IA 1VB3A 4QLOA 4HATA 2BFFA 2DBVO 2UYGA 3LC7O 2JKVA 3UCFA 1I8TA 1Z4MA 1YTUA 5P21A 3HKDB 3RVKA 4N48A 1Z62A 3RI3A 4MVJD 1SU4A 3LQRA 4RDIA 4XX1A 2EDAA 3K53A 1CR4A 4N5LA 1RI5A 3TKAA 4KWCA 2BI4A 2JW5A 4AMUA 1G9XA 4HS9A 4YRMA 2Z6AA 4IILA 4HH0A 1ZSYA 2FW9A 4GS5A 4BNKA 2FEWB 2I29A 1KYQA 3A25A 2HMYB 1C7FA 2IJGX 4DYDA 2ZBVA 3R44A 4Y2SA 4HAXA 3F7MA 1UBTS 4AN4A 1ZI8A 5CFZA 2PWAA 2M6RA 1SZPA 1TYEB 4M4SA 1OKKD 4V1CB 3RJ5A 3EVTA 1NNLA 1KJWA 1BE0A 2P5UA 1JFFA 1R16A 4WXEA 4CHTA 2H59A 1IFXA 3C6BA 1NMZA 5H3CA 2DC1A 3K1AA 4RHYA 3CUYA 3SX4A 1ZUNA 3LPCA 2PU5A 1Q7BA 4GLOA 1FLVA 1LI4A 4QDOA 4WTOA 2DF8A 4AKIA 3BC1A 5PNTA 3UANA 1Z2OX 4OLJA 4HFNA 3CO5A 1GQFA 1I1OA 3LW7A 3FPEA 2Q41A 3QLJA 3OQBA 4MMZB 3WKDA 4LXGA 1MJ5A 3V1MA 4EFDA 5LP6A 3G89A 2EKPA 4Q4LA 3F6BX 4YBRA 5DM0A 1NXTA 1Y82A 4RY8A 1V8OA 5J2TA 1GKYA 4WLOA 3L7CA 1ZD1A 1PNRA 2FCAA 3WGYA 3DXXA 3JAWB 1AY0A 1M10A 4CM3A 5CVDA 5KC8A 5COQA 3RRFA 1TTTA 2HLPA 2V5UA 2R65A 4J03A 5EHIA 1G19A 1Q17A 4UMVA 4YO8A 4DPLA 5IMBA 4WZAB 4Z2YA 1YCFA 4X94A 3LKDA 1IIRA 4OJYA 1ISGA 4G1EB 3AFMA 1WD7A 4DOMA 2QSJA 1U2RA 3NWPA 2VQFB 5ALSA 3CJRA 5KSWB 4JX8A 3GJQA 5DP2A 1JTEA 3T7EA 2QMYA 3HDYA 1S6YA 1B2LA 5EHGA 2AFRA 3O3NB 3ZHQA 3OE5A 3RIYA 5JAZA 3O2SB 1GTSA 2BFOA 4C5BA 1XEXB 1L5VA 9ATCA 3DCNA 5CB0A 3QLEA 3KPYA 1PG2A 1U8TA 1NXQA 2HPVA 4J9VA 4IIFA 4I9GA 4JB8A 4G8BA 3B48A 2FPLA 2NOAA 4TQGA 4E51A 3DZGA 2EYQA 3RO7A 4WV3A 1ZM9A 1G66A 2F1KA 4EF5A 1KFKB 4F2WA 5K8JB 2MTBA 2IU0A 1M2HA 1PLKA 1WA5A 3C3XA 1P6QA 4RANA 3GO4A 5IKOA 3EIHA 1MFPA 2L0XA 1PR5A 1U0EA 3AZQA 3DEIA 4XIFA 3WYGA 1BWSA 1K8RA 4C30A 2QTRA 1ZNXA 3MWFA 1XVLA 3H8WA 4RIHA 1W36B 3D7LA 2EOAA 3R9XB 1QRDA 1YNOA 2FCRA 1P0QA 2ODWA 1L5QA 3PD0A 4PLZA 4QDTA 1ZJ6A 3QEMA 3HLTA 4F4DA 1M72A 1UBUS 4TQAA 2DJ5A 4M9ZA 3NAGA 3U37A 1LC3A 1YDMA 1EQUA 2WTMA 4LC0A 4LRWA 1LB1B 1QRAA 1M8JA 9LDTA 1SBTA 3B9RA 3LQQA 4NZZA 2DRIA 3SZOA 1NVEA 4D81A 3T7JA 2GCOB 3VTKA 1ZHFA 3WWYA 1MPXA 1EDDA 4KVFA 3IBFA 1SXJC 1YXMA 1THTA 1ES9A 2GZDA 2EP8A 3CRZA 2PGAA 4LK3A 4NZ9A 1OW3B 2PD4A 3GRKA 2I03A 2OE2A 3IJEB 5F52A 2OXIA 4D02A 4TKLA 1MW8X 1QAMA 4LUCA 3T7AA 3PEWA 2J5QA 1MOZA 3NNNA 4D46A 1GGVA 4BNNA 2QL7A 3I62A 5CBPA 2FQXA 2IHTA 4B84A 5J1TB 5B57C 5IM5A 3VNUA 5IDQA 3UT0A 2WSSA 3FF1A 1SU7A 1VHLA 1Y3FE 2CF5A 1D3AA 1XU7A 1I3MA 2HLDD 2WUDA 4FYPA 4TRNA 1O95A 3N28A 4PZAA 5KEIA 1U04A 3QY9A 5DE3A 3R24A 3QHPA 2UZ3A 4RYDA 1T0IA 1FBNA 3T9EA 1VI6A 1ZNQO 1DKRA 4MB0A 1N6HA 1ZR2A 2GN1A 3LHKA 4O5OA 1N8KA 3T4EA 3DE7X 3ZC3A 2X3FA 1I4TD 4XUGB 4RULA 2XCQA 1O58A 5LQRA 2HK7A 2JBWA 2AR7A 3STWA 1V7CA 3PXXA 2EIXA 4TLDA 1I2ZA 4IGFA 3NHLA 4ND2A 4ARBA 3KOXA 3LHSA 3SFTA 4IRXA 1AKMA 1N32B 1HRDA 3DCIA 1DQZA 4WUVA 4IMRA 4WINA 5JWRA 3QVUA 3UKOA 5B4TA 3S3TA 3NBQA 5AI9A 4NWIA 1UK6A 3OFVA 2W6NA 3EQ9A 4ZQEA 4TWIA 4CMCA 4YMWA 4QBIA 5I6DA 2PUFA 1MO2A 1JEQB 3UWPA 1UDBA 1S8NA 1VMIA 4UU1A 2BBWA 3I34X 4AVYA 4QYWA 4LW8A 2AWNA 1ECLA 3AEXA 3RS0A 4CCYA 4Q4DA 5A7HA 4K87A 4YRTA 2R3SA 1AO0A 4ZJZA 1CEQA 3ZWAA 1Y4AE 2Y1GA 3OKPA 1G1MA 1W5AA 2RGYA 5FLKA 2KSQA 3OKCA 1ZXXA 3OPNA 2MIIA 4HEQA 1P7VA 2PLNA 4KMOA 4L73A 3EXIB 1T9ZA 2XYHA 2IW3A 1WQ1R 4MA4A 4QT0A 4KJXA 1J33A 2GZRA 4H16A 4KMRA 5KYUB 4RC9A 1Q3HA 4NBRA 5CVCA 3QIAA 1KYTA 2PVPA 2HTEA 2WA1A 4CF5A 4O63O 3UMBA 5I7EA 1C3LA 3EA4A 1KAHA 1OH8A 3IUMA 1Z6XA 2B4QA 2OGZA 4MWSA 2UKDA 4H27A 5FCDA 1YMQA 2JAQA 1ZGAA 2RJOA 2RHBA 1LY1A 4FBGA 5DYIA 5DW3A 1PZEA 3R3WA 1VBKA 3JXEA 1SHJA 1TUBB 5FHQA 2V7QD 3IUBA 4HH1A 4ZHSA 3KAPA 5CB8A 2JD1A 1UFQA 1VLHA 2BFNA 3SC6A 2O1XA 2HSZA 5JNVA 1XYYA 2H48A 4I2VA 4LWPA 1CY7A 5HF5A 2OFFA 4I3FA 4C4XA 3EFOB 2AJ8A 5E6RB 1XF1A 4BWFB 3I30X 3ZV4A 1QIKA 2JGFA 2F64A 4KEAA 4R1UA 1XWFA 2DHCA 4UU8A 4MQBA 1B6GA 3VPGA 4EUFA 1WBDA 2J4FA 2X2PA 2C59A 2LRHA 3PJDA 4KP7A 1SBIA 1I9GA 2EHDA 3AC0A 4KSYA 4D41A 3A4LA 4X24A 1DO8A 5KYXA 4MDYA 1XP8A 3G6KA 1E94E 3DE1X 1NQTA 5KTKA 4IOJA 3WIOA 4ZOLA 4JI7B 5CYGA 1A8SA 2COKA 4TZ6A 3VYTB 5DN9A 5JSQA 3WKCA 2FFBA 1L8LA 1O54A 2NV6A 1U2QA 2OB1A 2XD4A 4HOYA 5AW5A 4YQFA 3C0KA 2FPUA 4PAQA 4TMTA 2SHKA 5KQLA 1I36A 1IMOA 1JRLA 1XDUA 1Z7EA 2M2IA 2ZROA 4MPJA 3ANMA 4YJKA 5JUWA 3L7YA 3DA8A 4HP8A 4MHSA 1LDNA 1LV8A 1V45E 1GPNA 1OLXA 3LQKA 1YQEA 3ONNA 4LJ9A 4EZBA 3KEQA 2O14A 4R1TA 1IIBA 4L8VA 3ET5A 1XTIA 3G9XA 1F17A 3MAAC 3MJCA 3M3DA 3FOCA 1RJFA 4MRVA 4IP0A 4BRUA 2YVQA 3ZGXA 3LRXA 1O1YA 3FNHA 1E0SA 1ZXBA 2BFCB 4DA4A 1IB0A 2NXEA 4EDFA 3R3VA 1R2QA 1W5BA 2PGIA 4CLHA 5BMVA 4G5FA 3OJLA 1FFEA 3G5LA 1L5NA 2A3RA 4N0MA 4I4NA 4EJ0A 2WAOA 3KB1A 4A0GA 1SNYA 2NZXA 5KYYA 2QB5A 2REQB 1FYFA 4R7GA 3SEAA 5JAMA 3UTCA 4LNAA 4MV9A 4D92A 4EB0A 4M1WA 3IT0A 5FOVA 2J0UA 5L3RA 2GN8A 3T3EA 4PYIA 4EA9A 2QBYB 1MJNA 2QTWB 3OZRA 4RH0A 2QN1A 5ALRA 4PBSA 5FPSA 4YCLA 1DG1G 3N76A 3CZRA 3KV3O 4X20B 1N0WA 4ZJUA 3MRVA 5CFNA 4HAZA 4E1AA 2C9CA 1W0JA 2J9GA 2JGDB 1HDGO 1CR0A 2FRXA 3IB6A 3PP8A 1GYQA 2J5BA 1TJ3A 1X39A 3C97A 4WBSA 5M2QA 2V0NA 4ZCPA 3HUDA 3HKBA 1E2EA 2JS7A 2O2DA 4L16A 3BB3A 4P80A 5EIHA 1LBQA 3RT1A 1SIWA 2A6PA 3U3ZA 2R6R1 3KOMA 4GSKA 2JLSA 1X19A 1KVTA 3KR1A 3NOVA 3H1PA 4N8EA 2B1JA 1VA5A 2XRFA 2AJLI 2GJAA 1KYZA 4K6CA 4MV6A 3TOVA 1E3SA 1TMOA 4CR8A 2WYHA 3EODA 1E96A 4ZPJA 4IJ6A 2GOYA 1XZAA 4ZEMA 1IB6A 5CLJA 4R01A 3A9TA 3HJFA 3OCVA 4YRCA 2Y1WA 4IDGA 2XTJA 1PL0A 3AERA 2Z8ZA 1Z2PX 4S1VA 3UK6A 4BMVA 4ZCSA 4EI9A 4GVLA 1DHTA 1P4SA 4KR6A 4C2UA 2L69A 3JAWA 3UJNA 2RSLA 1NUHA 1ZN9A 3RADC 3ELUA 4A27A 4ESOA 2YV2A 3ER9A 1O77A 1ST2A 5E6SB 1OYWA 3U44B 4RBNA 3NHBA 1QIDA 1T43A 1SUPA 1DX4A 1O9BA 4CNQA 5C2JB 1L8AA 2ID4A 4Z7OB 1IRIA 3N53A 4HN9A 3CH6A 3L6DA 2MYNA 3FIJA 2GESA 1Q50A 2YW2A 3DNFA 4CU5A 5EIXA 5C5DA 1QDUA 2PSHA 2QP4A 1MVNA 1P3JA 3H5AA 1MAAA 4KDFA 3NTQA 5LVAA 4RELA 5MGNA 2PWBA 2OV2A 1SA0B 1W96A 4AO7A 2PX5A 4BNLA 2PFGA 4JQCA 3ZY6A 2IX9A 2OM6A 2O5RA 2ZPUA 4C1BA 5IXYA 8ATCA 1L7AA 4LGVA 2FOIA 4NG4A 5JWHA 5E2BA 3ZK7A 2FPRA 1CZUA 2JBHA 2D59A 4UHEA 1DV1A 3E9YA 4JQSA 3LRTA 5KI6A 1D0VA 1HYGA 3X44A 1GRNA 2GMWA 3OT1A 2OBFA 5IC6A 3WWPA 1FDIA 4LF6B 4N6NA 3C4VA 4PCVA 4PRZA 4XUCA 4BX2A 3TJZA 4AF6A 5SZIA 2QAGA 1VRWA 1HXHA 4EPWA 4W6ZA 3DUFB 5DLEA 1E0AA 1HFJA 3JVDA 1YD7A 2DUWA 4QXOA 3PFHA 2I9KA 2V0GA 3LOUA 3E05A 3ICPA 4UTVA 3FOAA 4RL4A 2ZVPX 1PZMA 4HQKA 5TMEA 2WJYA 4YAFA 5K8IA 1RTTA 3Q5DA 3JQPA 1EP3B 1BCSA 1LNSA 5JROA 1J0CA 1GV1A 3ANLA 4P4TA 2CLHB 1E9EA 4Q9NA 2ZVJA 1BTOA