3AUWB

Cytoplasmic domain of inward rectifier potassium channel kir3.2 in complex with cadmium
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
175
structure length
175
Chain Sequence
TLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium inwardly-rectifying channel, subfamily J, member 6
publication title Inverse agonist-like action of cadmium on G-protein-gated inward-rectifier K(+) channels
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 29
structure length 175
sequence length 175
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3auwB00
1U4FA 3ATAA 3JYCA 3AGWA 3SPIA 2GIXA 2X6CA 2QKSA 2WLIB 2WLNA 2WLLB 3ZRSA 3SPHA 2WLJA 1P7BA 3SYPA 3SPJA 3VSQA 3SPCA 5KUMA 4LP8A 3AUWB 3AT9A 2E4FA 3SYQA 2WLIA 3K6NA 3SYCA 3ATEA 2WLLA 1U4EA 1N9PA 3SYOA 3ATFA 1XL4A 1XL6A 2WLKA 3SPGA 3ATBA 5KUKA 3ATDA 2WLHA 2X6AA 2WLMA 2X6BA 3SYAA 4KFMA 3AT8A
chains in the Genus database with same CATH superfamily
2DWXA 4HUCA 5KJ7E 3QZMA 2IC2A 3EHBB 1HL5A 4TL4A 1MFCL 1K2DA 4XO5A 5DHDA 5F7AA 2J1KA 2DZEA 2JI3A 5IMLA 4A7TA 2NT0A 3SDDD 3QH3B 3WFDL 1FVEA 3MOBH 5CEZL 2QLYA 4AVKA 3SJVA 4YHML 3QDHA 3VFOA 5JR1H 1ESOA 4P2RB 2EC8A 4C57C 4WFED 3H2QA 2R29A 1G7PA 1G7JB 2EUZA 5DJCA 3H9ZA 5MEOB 4CVXB 2B15A 3NH7H 3AREB 3EYOA 2BWDA 1E8ZA 4JRXB 1UD8A 1IGMH 4W9LC 5FKPA 2MNJB 4G43A 3BGMA 4IKIA 4O02L 4WNQB 1AOZA 4HKBB 4YFLI 5ITBH 3F83A 3IJ8A 1FL5A 5B4MD 3EGSA 1PG7H 3HNVH 2X70A 3MSPA 3L7EA 1XGQA 3OX8A 2YD7A 4FLRA 3TJPA 7PCYA 1C7SA 2A6IB 4EI5B 4HAKA 3F6IA 1BREA 3HG1B 3CUPA 4JO4L 2MCAA 4I0KA 3VUAA 5JHDD 1K4CB 2R9HC 2BNQE 2GKIA 5DA0B 5AAWC 1H0DA 1JGDB 1G94A 1J8HE 4KHXH 1ZLWK 4IK6A 4XMVA 4O2FA 4TTGA 5GS2H 3U36B 1NGZA 2Z4TA 5JXEC 3G5ZB 2UZXA 1UATA 1IFRA 4BZ1L 3P9MB 3U4KA 2IQ9L 5AB1A 3BT2L 3K6SB 4NNPH 1SEQL 1P5VA 2NXZB 4JFXB 5DURB 3U9PL 5HYEA 3MYJB 3O3BA 5D1XE 1EJOL 1HHHB 2EE9A 4ZXBC 5GGVY 5IB5A 5ISZD 1OAUL 5EIIB 5CJXC 5C07A 4F3FA 3BKYL 4K9EL 5KJ4A 1SDDA 3U4EA 2AI0H 5ECJE 1PGRB 3CLEH 1F5WA 4GH7B 1GIGL 1O75A 2H0JA 4XNUH 4N8VB 3AS0A 1D5BB 1CD1B 1G7QA 2R4SL 1PAZA 4R7NB 4QDGA 4XVJL 1L5GB 1DO5A 1XTMA 2G4GA 4IEFB 3GHEH 1MH5A 4NPJA 3REVA 3E1ZA 4YSEA 3LSOB 1X6NA 4NP9A 4PVLA 4XGZA 1MCEA 2DI7A 2SEBA 4YK4B 3WJMA 1PDKA 3FQWA 5HI4C 3P0VH 3TEUA 1RK1A 1TQCB 1CD9B 1JBJA 4FXGB 4Y5YB 4TNWK 2AJVL 2IIJA 4W9KC 1MNUL 2A5UA 3HC3H 4N2BA 1NCGA 3D07A 4YLCA 4Z7OB 4LFHG 4FTVA 2FR4B 1OL0A 5EZIL 1FJ1A 4H40A 1TQWA 4CVWA 3KH3A 1PIGA 2C26A 2CJUH 2WM0A 5H35A 5D4HA 4F93B 2VIRA 3U83A 3QUMB 4RFEB 4TSAH 4XBMA 5HYJE 4FF9A 4I9WE 3HC4L 3BVNB 3VRLE 1KIPB 1NIBA 2R27A 5KUKA 4JCLA 5KSUB 1LQBC 1BQ5A 1ND0B 1OD9A 3S96B 2G3ZA 3CXDL 5C0AE 2APTA 4EF3A 3W82A 2Q7NA 4XNQB 1RUKH 1YC8A 4DP4X 2V17H 5J1SC 3WJJA 3ZTDC 3WTXA 2IG2H 1QFUL 1MLBA 1ZVSB 1GGTA 3MROA 3KL5A 2QVFB 2VXTL 3IFPA 4NBYB 4NHCH 3LNGA 4D9QE 4EUPA 3FQUA 2IBBA 4AOFA 3PWVA 5K59F 3OKYA 4NKOA 3ZKXB 3D3VD 2OYPA 4S10A 1AR2A 3GTVA 2B1AL 2R2BB 1SQMA 3BP4B 3K1KC 1IGIL 3G6JA 5T3XL 3MJ8B 1SFDA 2WTRB 4BUQA 3O3EB 5HHXL 6FABL 2HX7A 4IMKC 2YD8A 1YMMA 4GAJH 3IRZA 3OGCB 5KVFH 3LV3A 3DMMD 3BUYA 3VX1A 4DZ8B 5IESL 1TO5A 2QQQA 4N6QA 2YKLL 4YDJB 2PXYC 4L1TA 1H9DA 1EAPA 4ORGB 3RWHA 4B50A 4RFNB 2HRPH 2VDLB 3E80A 1PG7X 3OAYK 1NAKL 4QY8B 1AGDB 3ECUA 4H0HB 2UUDK 1CDGA 1J1PH 4Y9EA 3WEXB 4E0RB 3CHRA 4L1BA 1S5HA 4OF7A 3NIFB 2HXAA 2ZE0A 4LOUC 4L3CA 3ZRFC 1RJYB 3FU7B 5F0JB 1HH6B 4V1DE 4MJHA 5HHOE 4Z7VB 1B4LA 2A9NL 3K6DA 2UWEE 3IE9A 3TO4C 4GBXB 1H8NA 4CVZA 3BLBA 2NX5B 3V0HA 1IT9H 4TUOA 1U8HA 2C9PA 2ESVB 4TOYL 4YX2L 1Q72L 1YEWA 2A4EA 2Z4QA 2WZ6A 2C9RA 3OPZL 4MQXD 4PLJD 2R29L 2XTLA 2B14A 5LG1A 8PAZA 3QFJD 5FC9A 5IOPB 5JORA 1IZKA 1DVYA 4JFEB 5EU3A 2FT7A 5I1JH 1X9LA 3VFMA 1HIML 1UCBH 4LGPB 2B7DT 1KBWA 5EH1A 3B7UX 4KMLB 1KN4H 3MAWA 3BOVA 1XSOA 2DQJH 1J9SA 3VD7A 1KYAA 5D7SL 1MFBL 3K81A 4JJHA 4YL9A 4IU3A 1J1OH 1W9XA 5ALBH 5AFAA 3QI9A 4PJEE 4X5WA 2IV9A 1I1CA 3LH2L 3T77A 3EJQA 3M8OL 3GJFH 3T4YB 5F6HI 4FP8L 4N86A 4IMLA 1XVSA 4UMSA 4AQEB 4PJAF 3D2UD 2EEFA 1W72B 4PJ9B 1QKZL 2P8MB 4HUKB 3QNYB 1LO2H 2RFXB 4J23A 2I32A 4KV5F 4RMRA 5C08B 4PBWD 3IKCB 4G8FB 1FH5L 3W81A 3O9WA 1DSWA 2R0KH 1RMFH 3MRCB 1TFPA 2MPAH 5TH2A 1QATA 5HI3C 1RZPA 2J88L 1JNHB 3NN8B 3VXSB 1IFHL 2C3VB 4HQQL 4RGND 1U8JB 4IJ3B 2ORBL 4PIBA 5E2TL 4DEWA 1CFTB 1T83C 4XAWL 2OKMA 4LZKA 4EKXA 3MLUH 5CN3A 3QSKB 1IBBA 4LSUH 4ALAC 3MHZA 4GRWF 3BSGA 5IJBC 2FZ3A 3X12B 1EEYB 1Z5HA 2KL6A 3EFFA 4XPBH 3CFEB 3OLIA 4PJHE 5IW1B 4TNVF 3GSUB 5IVXA 3P3RA 3TZVA 5EU4A 3L3HA 4NQVB 4XCCL 4G8EA 2H41A 1MJ7L 2CDFB 4DKEL 5IB1B 3MA9L 4IKNA 5A7EA 1RHFA 1L9OA 1QUPA 4PR5A 2OULB 4I77H 1CLCA 2AF2A 1F1GA 4LNRB 3RBGA 3D9AH 1RHHA 1KACB 1KWKA 2DDQL 3OC5A 3SBPA 2F19H 1CC3A 2VLKE 1CL7I 4B9PA 4DP9X 4GG6F 4ODXA 2VDNH 2AJSL 3IGLA 1TJIL 3OKNB 2E6QA 1ZGLM 4E5XG 1Y07A 4QD2E 4EXPX 2A2QT 5HD8D 2MSPA 4MA7L 5EWIH 1BM3L 3DX6B 3HRPA 1A2YA 2HG5B 2XICA 4UINH 5FO9A 5KS9E 5CLTA 3V4VH 1FUNA 5CEXA 4HD5A 1V55B 4ZXBB 1MFEL 1BLIA 2WXNA 3V4LA 4U6YA 3UYPA 4J1UA 4LEXL 3UTSA 3ZKMC 1YNTA 4AQOA 2OL3L 2XRAL 3FQNA 1P5UC 1CICC 4BK5C 3SDXE 3TIDA 1TJMA 3IDMA 3CLFH 1I1AB 4IDLA 4C56A 1WBXA 3MGAA 4S1SL 1L9PA 3T2PA 3P77B 3NJFA 3SO3C 3I6GB 4ZO6A 3GMRA 5KBLA 3DLQR 1BLNB 4X6EB 2EE3A 4HIIA 1NDGB 3ULAB 5C0RL 2D7MA 2JB5H 3ASNB 3H7BA 2NY0C 3MRHB 3O8XC 3CN4A 3RGHA 4XR8C 5DFVC 3LH8A 3R0NA 1AAJA 2JH2A 3KM1A 5DD0H 3SDAB 9CGTA 1TETL 4WI0B 2A9AA 1MFDH 1SVBA 2VQ1A 2IANB 4NCC1 3EYUH 3OR7A 3C6LA 1S9YB 4X4KA 5EO9A 2PTTA 1LNUB 2R2EB 2RIKA 2OK0L 4QJ3B 3WN5C 4P2QE 3DX1A 5DRXA 4F91B 2YGVA 3ZKNC 2OMWA 2OSLB 2JJTC 4OZHF 1J8SA 3VWKC 2ZX8A 4PS7A 2PP7A 4OBRA 4U33A 1FVCB 3REWA 5LQBL 2R0WL 1YEHH 4AMXA 1G6VK 2NSQA 3L1OL 4P46D 1BPVA 3TFKC 1DLFH 3KPLB 2BS71 3O0RL 3C5ZD 4YE4H 4KKBD 1HZHH 3WIFA 4WI4A 4EAEA 3C6EA 3QDJB 1NQBA 1PZ5A 1NBZA 3H0TB 1GYWA 2WN2A 3WLBA 4NCC2 5IFJB 1E3FA 4G6MH 4WIQA 1WWCA 3VD9A 1YMHB 2VLJB 1SXBA 2ZAIA 3MLSL 4P4KA 1DO6A 3PU7A 4BWTA 3QEUA 3FB5B 2F53B 1NGQH 2V0AA 4QT5B 3N41F 5DLMH 5B39G 2EXYD 3O11A 4FZ8H 4M6MH 2VZ1A 1IAIH 2PXYB 4NQDA 4OI9A 5FO2A 2GT9A 3UC2A 3D4YA 4A55A 2EILB 1N26A 5T1LB 3R18A 3HPJA 1TJHH 3MBEC 1LWRA 3OG6B 3KPMB 1UT2A 1VPOL 3SO5A 1DFBL 3UROR 4BFRA 5CLXA 3WFEL 4ZO7A 3FH7A 4GEIA 4MJID 3LVEA 2FIKA 3RWGA 5JOFA 1E2ZA 1U8PA 4GY4A 3TO4B 3VFGH 3B56A 3ATDA 1L0QA 3V6FA 1WBZB 2BIPA 4NBXB 4PS4H 1J1XL 2NMSA 3L3IA 2JB6A 2KLTA 3UAJA 1KJ2A 5J5EA 5IJKC 4XN9A 3T3PE 2LTQC 4AL8H 3HZYA 2WYIA 2Z7ZA 1KLGA 4PLOB 5IQNA 3TYFA 5H4ZA 2CKBB 3KLKA 1C7TA 2FEJA 1BIIA 2D3VA 4MXVE 2WLKA 1RZJL 5DK0B 4YSSA 1TLMA 3RU8H 1QBLL 1JGVH 1HHKA 1NEUA 4RSVA 2VAAA 5D1ZD 5EEZA 1YN6B 3NJHA 3I9PA 3PYCA 1HWWA 5ICXB 3SKOB 1GHFL 4IBWA 4XXCA 1LEKB 3RGVD 3IAGC 1FHGA 2DIEA 2VDQL 3E8UH 4JFVA 2X9YA 3QDAA 3AMLA 2CHXA 1NANI 1ZT1B 3MO1B 4V33A 5AYUH 1IVTA 5DD3H 2GI7A 3S35H 2NZIA 4KAQL 3JVGA 2FQGA 3V0WH 4X6CB 1A14L 3EDFA 4LSPL 4C47A 4HCIA 2YMOA 1QQDA 4ZFOA 3DSFL 2WQUA 1U91A 4Z7WE 5HDBF 4B95C 3MA7B 3SDDA 4GO9A 1BQUA 4X83A 4X8JB 4YC2C 4HIEA 1IGTB 1V3JA 2AEOA 4JDZA 4MCYB 3F04A 2IBZY 4RAUA 3G5VB 4UTCA 4LAQH 3D4GA 2XXGA 1RKRA 1YN7B 5LNEA 2EDKA 1T7ZA 3NJIA 3AG4B 5LUMA 5DHEA 2OTPA 4NZ8A 1MNNA 3QO1B 1BQLH 3RWCB 3TNNA 4WFFE 5JIQA 4LBEB 5F7DB 1T1XA 4TM9A 5IG7B 4PJ7E 3BN9C 32C2A 4NZRH 1KDJA 4FN0A 3T0AA 1PNDA 1ZTXE 3VDAA 1CTOA 4UQCA 1ACYH 4P3CH 3VG9B 3CZNA 2DMGA 1LK3L 2DLHA 3HNSL 1Z32X 3EYQD 5DJ0A 3BP5B 4MJ2A 2YGQA 2E59A 4PWHA 4AGPA 4WO4C 3B4NA 5HI4D 1DJGA 2D7PA 3ULSA 4R8WL 3PREA 5CLWA 3MJWA 1ZTXH 1A9EA 3OM3B 2R0LH 4R4BA 3VGFA 4FFYH 5FHAH 4G8IB 4UDTB 4NO2A 4K5LA 1ACCA 4DGVL 1L9TA 1R5IA 1ZTMA 2Y9RT 3VNYA 1JYVA 1SDAB 1WVZA 1P5UB 1CICB 2VRAA 4HC1A 3B9KD 1NMAL 5ISZA 1ONQA 4Z7QF 4XO8A 4S1RH 2OXHB 4X4YB 1EPFA 2J57A 5TQ2H 4F27A 3P4OB 1IBHA 4PLKD 1Q0XL 4AQ1C 2QT6A 1PTZA 2JKXA 4H26A 3BWAA 1QLRA 4CN6A 5ITFB 3WIHH 2CUIA 3X14B 3WMSA 4IOSA 4LSQL 3O8XB 3PV7A 1A1NB 4GSRA 1TCMA 2HJFA 5CWSA 4JANB 1JFQL 5BO0D 3TV8A 4AEEA 2Y5QA 3D85B 5C7ZA 2RD0A 2AQNA 2CO7A 2GTZB 4HIJB 3FO2B 3APFA 2I07B 1JL8A 5KVEH 1IZJA 2X6CA 4O5LH 1I7ZB 2BP0A 4XNXL 5DD1L 1XGTB 3D7PA 4EQ3A 2WYTA 3V6OE 3H54A 2XACC 4UMGA 5E9NA 3NA9L 1ZVYA 4KXBA 3WN5B 4HBCL 1AD0A 1KGUA 4F57H 4HOWA 1EFXA 1P7QD 2YQ3A 2X87A 3E6HB 4JHAL 4PUBH 5IHUH 3RUGF 1CDBA 3GIZH 2VXUH 1K85A 4DP7X 3VWKB 4XRCA 3S8GB 5E24E 3QRGL 4RISH 3LZLA 4AYBA 2HX9A 3IDXH 1JDAA 4MA3B 5AZUA 5BVJB 1JNLH 1I85C 2IO5A 2DLTA 3L16A 3RVUD 1WZLA 3BYTA 1CGSH 3RNKA 1OO2A 1JZFA 1A8JH 1QVOA 5FM5O 5FK9A 1JPGA 2XYCA 5KYUB 3ULUD 3GI8L 1KJ2L 4HP5A 2NZ1A 4WK4B 3HZMB 3LQAL 2XG5A 3LRMA 5I16B 3SQBB 3CC1A 3EBIA 3C08H 3TCLB 3L1GA 3ARSA 4UQ9A 3DGCR 2DQHH 3VXNB 3ZVVA 3RDTD 4QXWA 5ES4B 4UZGA 3VAEA 1M6OA 5IQOA 2V37A 5SWZB 3INOA 1T20B 3QDMB 3CE1A 4Z7UA 1JV2B 3E8VA 3ZQXA 4PS8A 4A37A 3VFPA 4QRUA 5IY5B 5JNYB 1XEUA 3MNDA 4L1SA 5FYJL 2AJ3A 1SXSA 3NSYA 4A6YB 5F1OB 1PYWA 1LXMA 1XT5A 3D5OF 1ASOA 2NOYA 2WXIA 3IXTB 3NJKA 3CN1A 2DBLL 3STZA 1VSCA 3VYOA 2YAMA 2B1OA 3IN0A 2V7HB 3N50A 2FJUB 2ZSWB 4UOJA 1MZYA 1K3IA 2LE9A 4GMTL 1YEDB 1MWAH 1LEGA 4PY7A 5DI8A 4M8VA 2YD2A 2NUTB 4KGJA 4AEHH 4ZUUB 1F0LA 1WZ1H 5DVPA 1ZT7A 3RDJA 4QRTB 3MUGA 3L5JA 4CSPA 5FW7A 2NQDA 3R19A 4U2YA 5IBUG 4ZFOL 3ZGIA 3I6KA 1WEJL 2LTQB 2X44D 4GXUN 3OV6A 4BRJA 4NJAL 4WWPA 3QHZH 3N1GC 4PEEA 3U7WL 4KNSA 1KCRH 1QSFE 1BGXL 4H1LG 4QCIB 5DD5H 3N40F 1TUPA 2FHBA 4HUMB 5A16B 4MD4A 4HT1H 3VD4A 5KBNC 4OFIA 4DW2L 5EU6B 2QL1A 4XMPH 1NBYB 4P2RA 4NFCA 2ITEA 5FV2A 3MLPA 2ED7A 1NUGA 3H6AA 3QXWA 4JJ5B 5CKGA 4FQ2L 3IGUA 5E5MB 5MEOA 4N87A 4EBQL 2YD3A 1UXSB 4PJCE 4PJ5B 3AREA 3EGXA 1CN4A 4I18C 4TVSa 2DMCA 3WN6A 4L4VD 4WUUE 3O0LA 1NM9A 5I76B 5EUOF 5EF1A 2QV2A 1J86A 4HKXA 4NQQA 4EZMA 4GMSH 5D55A 1N6QH 1E5UI 3F7YB 3GBML 3MLYL 4CU6A 5C9KA 2JQZA 4JLRB 5KZCB 4AI7A 4XPTH 1LE9B 4BSWB 4W81A 1L9QA 2CGRH 2O6CA 2Y0SA 3ZE0B 4Q14A 4ONOA 2A6IA 4CU7A 1CK0L 1BAFL 3HG1A 2YFNA 1MRDL 4YC2B 3O41B 4ZUSB 3ALXA 1CLOH 1AXTH 1K4CA 3E0GA 3UADA 1BPLB 1JWMA 3HNTL 4X7CC 3KDMB 2XA8H 3E9TA 2Q2EB 4JM2F 3U36A 3UPRB 4HS8H 1HXYB 3HBQA 2WBJD 4OKDA 4HC1L 5E9DE 4QRPD 4Y4HD 1M71B 4L2YA 3SE3A 3B2DC 5IFHH 1RY7B 1DE4A 1VACA 3K6SA 3LKNB 4B96A 1E40A 3MYJA 3RKDD 4ENZA 1BF5A 2ROYA 3QJSB 3MFFA 2VXSH 5EIIA 4C55A 1UWFA 2WVVA 5EZJB 3W56A 3HI6H 4M7ZC 1OT4A 2NY0D 4N8VA 2O6EA 3GIVB 1CD1A 5HYFA 5DFVD 5E99L 1T0OA 4WO4B 4YXKH 3OXSB 4U7KA 4IEFA 1S5IL 4WHYG 3MX0B 3AY2A 3LSOA 1FHNA 2X4NA 3CHOA 2GJRA 1DVFC 2DLFH 1ULVA 4PRPE 5BQDA 1WP6A 4YDVB 5G55A 2YQGA 1AKJB 4JR9H 3GZOA 5E1HB 1SOKA 3WENA 3HCVA 1FC1A 2X10A 3L5HA 4XH2B 1VFAB 4JM4H 3BAXA 1E0OB 2WXRA 3FO9B 3LKSB 2AGJL 5C1MB 2K1MA 2FR4A 2H7WA 2XKUA 4ODWB 1BV8A 3A4FA 3LMJH 1NWOA 2FEDC 4RFEA 2D0GA 3BZEB 2H0PA 3QG6B 1P7KA 3BFWA 4PGEA 3FRUB 4AQ1B 1UA6L 4I1PA 1X5JA 1ZXQA 3EH2A 1PLCA 3C9NB 2FNBA 2G2PA 4P5TC 4XNQA 4AT6B 5E6IB 1KXVC 1DBKH 3T08A 1ZVSA 2MPVA 3HUJB 4KK9C 2E7LC 2B4CH 1WUNT 4XVUC 5AVTB 3HFFA 4HS3A 1KJ3H 2B9BA 3MRBA 3IYLW 2RQ8A 5CBEB 1JN6B 1Z1WA 1GC1L 3VGBA 1KLUB 4RRPM 2J6EA 3IDYC 4BD4A 2EO1A 2EYTB 2YA2A 2BOBB 2WTRA 1TSHA 5AAMC 1RU9L 3O3EA 3N40P 4EUPG 5A6LA 1UEYA 2CLZA 1EBPA 3KLHC 1SJVA 1UJTA 3SYAA 3W5NA 3T09A 5I5RA 3OGCA 4MNGE 3VH8A 4P3DB 3SCMC 1LEIA 4DZ8A 2BIQA 1BXAA 2QADD 3MBED 5CGYD 4YDJA 4N68A 3R06A 3WS3B 2PWDA 1EEUA 3SPJA 3FCGA 3S37L 1RURL 3T0VA 1SMAA 1XDTT 3CNKA 2ZOKB 3L81A 3WEXA 4GW4B 1KB9J 4YHLH 2LU4A 4LVHB 3S3DB 2QPSA 2FL5B 2TRHA 4P46A 3QJXA 3OAUH 1D5IL 2YAQA 2WLZA 2MOVA 1ITCA 3C5ZA 4QXVA 4Z7VA 1BZEA 1HEZB 1UH4A 4NFBA 2FT8A 1OAXL 1PCSA 4OCXH 3AU1A 4EDWL 2FGZA 1MI5E 3TBSB 1O6SA 4PJ8B 3DSNB 1UQSB 1UA7A 3L3OC 4BZ2A 4LPYA 2P43B 5GGRY 4FI8A 5ETUB 5T3ZE 1HHIB 1NEPA 2K4WA 1QA9B 5IOPA 1EVUA 3SKNB 4HJJL 4WI8A 4JFEA 1VFUA 2WO3B 1EO5A 5DGQA 2OYMA 3NRQA 5IQ7L 1MHCB 5TGBB 3QQ9C 3IDJA 1IFGA 3PRZA 1H3WM 5IBLC 2Z35B 4YHKL 4YEFA 3AWFA 4ICXA 4QRSB 5BRZE 3CFKA 1OZUA 2YLHA 4CW1B 5E4EC 2I60H 2UXFA 4P9HL 2XIDA 1TVHB 1F6AB 1HEJC 3DXAB 2ZX9A 1X5FA 4AQEA 3ZPDA 1WCQA 2F58L 5D6DA 2CIKA 1W72A 2R15A 5K59E 5D7IA 3QNYA 5IQLA 4OZIE 3Q2LA 4FXLA 1F2QA 1QWHA 4LOVA 3PWLB 3ZGHA 4PVMA 1B6DA 5GXBB 4G8FA 1UM5L 2Y36H 3GSRA 1M2VB 4HCFA 3NQIA 2GFBA 2FO8A 1YA5A 4F5CA 2WWKT 4B7IA 4PRNB 1JNHA 1G5GA 3NN8A 5DU7A 2C3VA 5JDJA 4I18B 1YSOA 4Q6IC 1J0JA 2X6MA 5D1ZA 1CFTA 3ZHDA 3V5DB 3UCQA 3HS0A 1RCYA 4Y9BA 1R24B 2VN6A 1INEH 4G7YH 4X9FA 1E6OL 1OPGH 3X12A 1A3QA 2BP5M 3CFEA 4PV1C 5FUCC 5IW1A 4JFDD 3GSUA 4UNVA 1YECL 3MXVH 3AW5A 5I1LB 3NZSA 4NQVA 4L8BA 5AW1B 4U1MB 1OTUC 4WUKH 3RWFA 1BZ7A 1FL3A 3BZFA 3IDUA 4MCNA 1T1WA 4KQ3H 5AAWA 2FNWA 3EJYC 1VF5C 2KBGA 4DJMA 4XB8A 4LNRA 5HHVH 3ARWA 3X3GH 4Z3HA 8FABB 5IREA 1A02N 2BVUA 4BE6A 2XV6B 5JXEA 3NFSH 5I8EB 1PJWA 4GRLC 1BMZA 3FFCB 3PFQA 3PGCB 4K3JL 4HFWA 3VA2C 4IBTA 1XGPA 1A5FH 2FSEB 3BP6B 2IGFH 5DUBB 5DQDH 5KW9L 35C8H 3GZPA 2HG5A 4U49A 4KKZA 2YIHA 4R2GD 5AVWB 1T03L 4ZXBA 1MVFA 2YWZA 3EYFB 5CJXA 1ROCA 3ZTJG 4W6WB 2LHAA 3N9GH 2Y06L 1A3ZA 1QBAA 2W0PA 4WGKA 3PWPD 3FHEA 1LP9A 3G6JF 4APQD 4GT0A 4M7ZB 1FNGB 4X7FC 3FMGL 1MAKA 2WIIB 2XTSA 4OB5H 3I6GA 5TF1H 1XIWC 2VW6A 1FH2A 3ZL2A 2HKAA 4X6EA 1A1MA 1NDGA 2F5AL 4K3DH 3AB0C 2EUVA 1AY1H 1GXEA 4PJAE 3MRHA 5B8CC 1GJUA 4POYA 1JV5B 1J05B 4WW2B 4CU8A 1V54B 3A4EA 3L6FA 5DEFA 1DVFB 4KV5E 1ITBB 2NNXA 3IAQA 1F4YH 4DAGL 5MI0C 3CXFA 1KG0A 2DQUL 2NY5C 2VMFA 4ZSOE 1DJWA 2VRKA 1EAJA 1C8PA 1X5ZA 4AVJA 1SJHA 1JDCA 2NY6C 1KEGL 3H42H 5BS0D 3U48A 4EDXA 4YJZL 1S9YA 5KAQG 1HCFX 4GP5B 2ZUVA 2VDLL 1DQTA 3BKML 4G71B 3IBEA 1O7DC 2H1PL 2IPKA 3JV6B 5F7BA 2IEPA 1EGJA 1HXMA 4P5TB 5BQ7A 4MMZC 3VB8A 4ELMB 4GRWE 3P11H 1HS6A 1DLHB 2WXHA 3CJJA 4U6TA 1J0IA 1U3YA 2BIIA 1FVCA 1SLUA 3GXMA 2ZXCA 4LHUD 3GI9L 1WQVT 3SD5A 4BUHA 4W4OC 3FH5A 4RLDA 1RZIB 4ZOEA 3T3MB 4S0SD 1XCQA 2XWRA 3GMNB 4IRSD 2ENYA 3KPLA 2ZCLH 2X9ZA 3ZUNC 1WA2X 3QDJA 4XP5L 3IDYB 3ZDZB 4BZ2L 4ODSH 4OJYA 2WO2B 3EADA 2NNRA 3F12B 3IJYB 3ZO0A 2ICCA 3G6DL 1U41A 5CIPB 4GRWH 4IMKA 3U4BH 3UMTA 2PETA 1YMHA 3ZL4L 4AK1A 1VEMA 2JCCB 3RAJL 3GGWB 3FB5A 2F53A 2X0UA 4GG6E 5CD5C 2X2IA 2R1WB 3DRQA 4QT5A 4HJ0D 2WLNA 3X3FL 1P7QA 2G75B 4ZI8A 3HI1A 3LXCA 2QFRA 5IBTH 2GJ6E 3FQTB 2PXYA 4NQEB 5D93C 3QA3B 2LU7A 1T4WA 2BSEA 4ZTEA 1A7PH 2B8OT 5F7FA 3VXME 2NW3A 1A4AA 2WZ5A 5T1LA 5LGJB 1JPSL 5E2VL 2WAHA 5DUMH 1J0KA 3N6YA 3WO4C 1X5XA 3EBHA 3KPMA 2H9GA 4TLTA 1FBIH 1MQKH 3QUZD 3VGDA 1WHOA 3WL9B 5DMYA 3D18A 2OJZL 4OGXL 4R5TA 5FV1L 4GSQA 5DZVA 3TO4A 3OLEA 4RBPK 1WBZA 3O6KL 2QTVA 3BQUC 4R90L 2IGTA 4AKQA 2RQEA 3H55A 3L3OB 5MEND 2LLNA 4PBXA 5LWYL 1I8IA 2AV1B 1M53A 3WGVB 5LHDA 1C12B 4QR7A 3DX4A 3VXOB 3AITA 3IJSB 4J28A 5A6MA 1P53A 4KXZI 2Z64C 3MOQA 3QDGB 2BPBA 2NNAB 4ZPTA 4JUTA 4AIEA 3ZQ9A 1QI4A 5DK0A 3CFDB 4YGAB 3V7AE 4F58H 1T0NB 4G3YL 4NWUH 2ZUSA 1JK8A 4RBPH 3VI4B 1RZKL 3T65B 2BC4B 3SKOA 2BY2A 4FGMA 1LO0H 3MU3A 3N3EA 2AZAA 1LEKA 4GRMB 4OZHE 2Z93B 1PX8A 3L5XL 5DJZB 4U2ZA 1J8KA 3IM1A 4FABH 1JZGA 3CCHB 4QI3A 5AOZA 3UBXB 3GEWB 2AK1L 4KO7A 3RVXC 1QRND 3NJLA 3FT9A 4LHJB 3CDYA 5CM1A 2JJSC 1ZT1A 2ZYHA 5E4OA 3X17A 5MERB 4G6FD 4GLRI 3L17A 1INQB 4X6CA 3I6SA 1Q4NX 3VFNB 4IOIA 3VG0H 1YQVH 5E8NB 3GSNH 2ZP8A 3ASOB 1YNTF 3MA7A 4GO6B 5HJ3A 3RWIB 3FHAA 4X8JA 3EW3B 1IGTA 3JWDC 1O5DT 3GXFA 4KJPC 1U3NA 4O2EA 1OF2B 3CQFA 4MCYA 1FNHA 1HWGB 4Q6IB 3G5VA 1W0WB 4E9XA 3ZL1A 1T83A 5F8QC 2OMNA 4Z8FL 3SPVA 4L4VA 1FRGL 4HIHA 5E2WL 2VH5L 1JOIA 4R7VA 5KAQF 3QJFB 1BW8A 4R7LA 4IBZA 4LF3A 3RWCA 2OR8A 1CFQB 4LBEA 5F7DA 1EMTL 3NRPA 5IG7A 2DM4A 2WCGA 5H4YA 5TE6H 2IMNA 4R0LC 4X0KA 2F7IA 1IGFL 2VDML 4LIQL 3BKJH 1H5BC 4XZUA 3SD2A 1DQVA 4NNXA 1FVDB 2JV6A 4K3EH 3WHXA 2VR8A 2UXGA 4GIPD 4FFVC 4GRLB 3HBZA 3MOAH 4JGNA 1EWHA 1PLGL 3IMRA 4KJWD 1CLYH 2F61A 5DA4A 2B39A 2WQXA 4X7SL 1G9MC 1IKFH 4YXLH 3LPGA 3R0MA 3APCA 3BW9B 5GGQL 5KN5B 2G9HA 2WBJA 2PCFA 1HT6A 1GTFA 3K6FA 1RD6A 4G8IA 2ARWA 3C2SA 4M5SA 4I2XB 2EIEA 2HYMA 4UDTA 4YQXH 5I23A 1CL7H 1INDL 3EYSL 4KPHL 4Z0BL 2Z8VC 3CV5A 2FJGB 1DL7L 3JWOH 2FEDD 1UZ8B 1P5UA 5DEZA 4BK5A 1X5YA 1F2XK 1XL6A 1WJ3A 3B5HA 2OP4H 2J3SA 1CPUA 2BLFA 1UC6A 4JPKH 2OXHA 3QZLA 4I3RL 1FIEA 2WLHA 1JPTH 1ES0B 2F08A 1XIWB 3LIZA 2QMKA 3QJHA 3A67L 5LAPA 1QYGH 3AB0B 3FW6A 5B8CB 4KXDA 3IRCA 1XCXA 1BF2A 5ITFA 1S6NA 5HHMD 3O8XA 1TO4A 1Z9LA 5DMIH 3QYMA 4JANA 5EG6C 2HRHA 1DZBA 3MRKB 2K3HA 1Z3GL 2AFNA 5MI0B 3FO2A 4QMEA 5HDBE 2X2YA 4EVNB 1VEOA 5FF6B 5JDSA 4C8XA 2NY6B 1U8KB 2FBRA 4N0RA 2MRYA 1ZHKB 5HDLA 3OKMB 1PD1A 4JFWA 1CFSB 4Y5VA 1UACH 3SDYL 4NKQB 1DBAL 1HCVA 2BCKB 2GJJA 3K74B 2NX5E 2Z31B 1XH0A 4YDLC 4GAGL 3WN5A 1JJUA 3SCMD 4ZUWB 3FTXA 2ESVE 4D3CH 4EZLA 4OGQC 5LBSH 1R5VB 2DH3A 1T1ZA 4Z7NF 2GIXA 5LDUA 2CAKA 2JJTA 1H3GA 3T8XA 1DJIA 3ABLB 4XPHL 3VXUB 2JKLA 2GIYA 5BVJA 1ZLSH 3JBG7 4G6JH 5EU7C 3MCKA 5FHBH 3ULUL 4HSCX 3FUJA 2BX5A 4CKQA 1HSAB 1NL0L 3DROB 3MLXL 3VGHA 1U3HC 1I9JH 1HU8A 1CIUA 4YOKA 2BNRD 3P30H 5K33A 1J9TA 4M7JH 5KYUA 3GKWL 5J9PA 2HT3D 5KJRH 5G4MA 2UZIL 3HZMA 4YNYB 5I16A 3SQBA 5JQ6L 3BPOC 1SHWA 4PAZA 3MREB 3TCLA 3NCJL 4N0FA 1BXXA 2P8LA 3VXNA 1QTSA 4EZJA 3SB3A 3HZ3A 3AUWB 5SWZA 1L7TL 1T20A 3QUXB 4WW2F 2PPCA 3KZ8A 5C09D 1JV2A 3TP4A 5HHQA 4KTEL 3POCA 2VZOA 1GZQB 2OR9H 1IC4L 4CVUA 5TQ0H 2QKIC 2FGWH 3JTTB 4RFOL 3MBEA 5CSZB 1UZ6F 3T9WA 2WUCL 4EIZC 2R1XA 1WD9A 3IXTA 3WO4B 2H3NA 4BHUA 2C9VA 4X7EC 5DWUH 2BRRL 1GGCH 2V7HA 4FLQA 3L3KB 4KY2A 2ZSWA 4TQEH 5E2JA 1TKWB 1FZOA 3OZ9L 2R0ZL 4QTFA 4XNAA 5EO0A 1AJ7L 1SYVA 1YEDA 3FAXA 5C6WH 1DQQB 3ARDC 3VW3H 2NUTA 1L7IH 4HJUA 4ZUUA 2P44B 4QRTA 5CSBA 4KK6C 2BZDA 1MHHB 3FSVA 1ZLDA 3EFDH 4ONHB 5IJKA 1TYJA 3D4CA 2YK1H 4QO1B 3EJRA 4BH8B 2Q8BL 3MN8A 1FA4A 2B59B 3WKYA 2VLRD 4Q89A 1ZA6B 5E4IA 5CZRA 4FMKA 1IAMA 5AYTA 3M17A 5FECB 4M5ZH 2X4OA 5A16A 3I2CL 4WGWB 4KRLB 1VHPA 4OGYL 4IBYA 4P5MB 4NKDA 1L9RA 5F9DC 5C0JB 4HWBA 2E7MA 1ICTA 1XX9C 1ID2A 1KCSL 4JJ5A 3RUGE 5C86A 5AKSA 4XN4A 2PCPA 1QHOA 5D96C 3SKMA 3DIFB 4WFHD 5I2IB 1P4LB 4GXVL 3QBTB 3NIGF 5ICZA 1NCOA 2IAAC 2G3XA 1FSKC 1QLEL 3EFOA 1S7TB 5I76A 2XSKA 1SEBA 1UM6L 1YEEH 1E65A 1RSFA 4HK3N 3F7YA 5GPRA 3TBTA 3PQYB 4DPBX 3Q1SL 2R2CA 5GS1C 1EAOA 2VWEC 2VTFA 3BE1H 4BSWA 1VERA 4OZGF 5KSBF 3L48A 4HSQA 2N1TE 3HZVA 3V6ZA 3HE7C 4ZUSA 1NANH 3AT9A 2V6HA 4RGMC 3U7YL 3IMTA 4ZZFA 1NIEA 1K6QH 5IB2B 3GJEB 2ZAGA 3KDMA 4RMQA 5JXAH 4N3UA 2OM5A 3KYMA 1U9KA 5CILL 5DJ8A 4KVNH 4PV8A 2OZ4A 5EZOH 1T0MA 1YNKH 1DN2A 3BUTA 1M71A 4J39A 1MAML 5LAXB 2N7BA 5IKCB 3FT2B 3A22A 4XNMB 4AV4A 2QZQA 4ABVA 5C7XL 2BJMH 2DQTH 2G60L 3LZRA 4X5PA 1I7TB 3VD2A 1FYTD 3LNEA 3O4LE 2PTVA 3CZLA 4AG4H 4R0LB 2CIIB 3KPSB 3QK0A 5EZJA 4PRAB 2XG4B 4OM1H 3UDWC 1H5BB 1YO4A 2WWKO 3K71A 3W3BA 5CEZE 1MJUL 3DX0A 1IGYB 1E6JL 5FOBB 4UUJB 3GIVA 3EOTH 2Z9TA 1OSPL 4TVUA 3HG0A 4B3EA 4WO4A 1PZ2A 2J20A 5EIIG 4PTUB 5B1CA 1OP5K 2BWIA 3MCYA 3D34A 3RJOA 3MX0A 4BFNA 1SZNA 1QPKA 2V5RA 1MFCH 1AC6A 3CFJA 1WFUA 3GLEA 1C5CL 3GBDA 4N8VG 1OW0C 1MFUA 4YDVA 1JD9A 2XXFA 3WFDH 5CEZH 4URKA 4D0CA 4YHMH 3UFIA 3K2MC 4XH2A 1VFAA 3ZHKA 1U8OB 5HHNA 1XGUB 3LKSA 4G8GB 3BPCA 3PWJB 1Y6MR 5I0VA 1OP5H 3PIQB 4V2BA 5DZAA 3QG6A 3BZEA 4APQA 2F54E 4AQ1A 5EUOE 4O02H 3C9NA 4GG8B 3Q2NA 4W9GC 5J6SA 4AT6A 1KIQB 4QIRA 5JLZB 4K15A 3VXRD 3HUJA 3D05A 2ZXGA 1IJ9A 4DP1X 3DK2A 3QJZA 2CCVA 4F2MB 2Z3FA 4FQHB 1CI3M 2R4RL 5CBEA 1JN6A 1QI5A 3DVGA 2ICES 4JO4H 1I3VA 2EYTA 5GGUA 2BOBA 1LWJA 3BVWA 3GM0A 4OIIH 3QPXL 1NFDF 4YDLB 4F24A 4LMQI 3BP7A 2CPCA 4I88A 2P5WD 5C6PB 2EVIA 2AQQA 3WIIL 3DDGA 4R84A 2D2OA 4U4IA 4MKMA 2QPFA 4P3DA 4NDMB 5GSRA 1VB9A 2Y2YA 4GI8A 2EDNA 1I85A 2ENJA 1OGAB 4HETA 2A9BA 3FOLB 4BZ1H 1X3DA 3UTQB 3FT3A 5G5DB 2IQ9H 3GK8L 2QPUA 3BT2H 4U3HA 2GITB 1SEQH 1U3HB 4GW4A 1P2CB 3U9PH 1EJOH 4LHUA 3VH8G 3BD3A 3ARGC 2FL5A 1OAUH 3QORD 4LLQA 3WNNA 4Z5RB 1AOHA 4A2HA 5HBBA 3QUKB 3BKYH 2IFGA 1D3CA 1JUFB 3BPOB 4K9EH 3UG5A 3BQUD 4FI7A 5H37A 5B1AB 1HEZA 2X40A 2YPLE 1R3KB 3MRQA 3OKLB 3MR9B 2DLGA 1IM9D 1GIGH 2Y1VA 4ZG1A 4L4TB 3ZYIA 4WTXA 1G0DA 4F37K 4OD1L 1OD7A 4XMXA 3TBSA 2EINB 3HB3C 2R4SH 3DSNA 1IC5L 1UQSA 2R1YA 2P5ED 3ABGA 3Q5TA 4GUPA 4JDEB 1P6AB 5D2LB 4XX1G 4HWBL 5D9SA 3IETA 1I7RB 3TT3L 3F7LA 2FYYA 1AR1D 3PAVA 4BDVB 4HK3J 3ZXAC 1ORQA 1CBVL 4RRPA 1QA9A 4FYRA 5EUKB 4ZFZA 2F2HA 1QI3A 3SKNA 4UTAL 1QEWB 3FB7B 4QHNB 2VDKB 3GTTA 4JG1L 3H3PL 5C0BB 2AJVH 1FO0L 4IOFD 1HNFA 4EO5A 2OCCB 1MNUH 1W91A 3MNMA 4M5TA 4OLUL 5DHXB 5TGBA 2Z35A 4KI5D 5TPWL 5EZIH 1R0AL 3ARDB 1CTMA 4PREB 1WYJA 3MJ7B 3HLKA 5A2IH 3QUZA 4CW1A 3ESMA 4D0DB 4H8QA 3RVXD 3MRFA 3HC4H 4YIQA 4S1QL 5FLUA 3DOIA 1TVHA 5LNDA 5T3XE 1H3PL 1F6AA 1TQVA 4OJCA 3BZDA 1ZS8A 3QRFM 2PN5A 2C4XA 4W70A 2R8SL 2JSFA 2N3JA 3Q8EA 1QFUH 5C0CB 3MV9B 4JY4B 1JF6A 2VXTH 2YSSB 1ROWA 3F58L 3BUQA 3QQDB 5MENA 1XF5B 2O6FA 1UWXH 2DQIL 5MHSE 4JY5L 4I1NB 1BJ1H 4IKJA 4KJPD 3PWLA 5KG9B 3WNKA 1UXLA 2B1AH 3F05A 4MWFA 5GRXG 3I02B 1IGIH 1M2VA 4GKZB 3GMOA 3NEOA 3QQ3A 1FFQA 4PRNA 2HWZL 5HHXH 5D96B 4QHLB 6FABH 1H19A 3BXNA 4HX1B 2P28B 4I18A 1F4HA 1V7ML 4KNUA 1A6ZB 3VI3B 4DNLA 1FSKB 2NUPA 3RI5K 5B21A 2LAGB 5IJVB 3G6AB 4RGOL 1D7BA 2BOCB 5HGGS 1R24A 4AK2A 4JKKA 2JJWA 4XHJC 4IBSA 5IESH 2YKLH 2A74B 4UB0L 3VRIB 1NCBL 1QRNA 2EXWC 3E6FB 1NAKH 2EZ0C 2BM3A 1I9RL 4EN3D 2YHGA 4H1LH 3HE7B 4U1MA 2A4ZA 4RGMB 3T0WA 2AC0A 2Y5TA 4POZD 4KZEL 4P49A 1PZBA 2J5LC 4LCWD 2A9NH 2WBKA 1O9VA 1TQTA 3SE4C 3MJ9L 8FABA 4LDLB 4K9JA 4J4PD 4F33B 5I8EA 2BS9A 4L3EE 3KDPB 3QIBC 3J07A 4Y1AD 5D1ZI 1A6TB 4OAWA 3JUZA 4TOYH 4YX2H 4W9HC 1Q72H 1TITA 1U93B 3WOVA 4KO9A 4AVIA 5ACLA 1HAUA 3OPZH 5HPMB 5DUBA 2R29H 2DMKA 1KPVB 3P3TA 1DUZB 1M42A 2F9BT 5EEVA 4ELKB 1HIMH 5A40E 1A4KB 2ZUYA 3FCTA 4E41D 1FQ9C 1SN5A 3RJDA 1B3IA 4FG0A 2KT6A 5D7SH 1MFBH 1FNGA 1LDPL 2FD6L 4HUVA 1TQSA 5BZWB 3GUTA 1GSKA 4N0UE 4WHTB 5C9JB 4N2KA 5L8LB 2D0FA 3LH2H 3KM2A 3M8OH 4NRXA 4HULB 2EICA 1GGBL 4X42A 1JV5A 1J05A 1HYSC 4FP8H 1CGVA 4ADJA 3BPLC 4G7VL 1DVFA 3J8F7 2Y07L 1QKZH 1TQBC 2MTAA 3A21A 3FSZA 4JKNA 4Y4FC 5DJDB 2JXMB 2B77A 5FXCH 2CBTA 2Z92B 4U6XB 3V10A 3KJ4C 2YKKA 1VFOA 1ADWA 1FH5H 3AUVA 3KVDD 3QZPA 5HVHC 5I74B 1NAML 1CVSC 1ORSB 1CVRA 3PAZA 1GKOA 2J88H 3CU1A 3HE6B 2EADA 1IFHH 4FNRA 3RWEA 4HQQH 4KO5A 4BFGA 4KROC 3QC6X 4YSCA 2ORBH 2DS4A 3FT0A 3DUSA 5E2TH 5EPMB 2NY3C 3UJTL 1EUTA 5EBLB 3VO0A 3JV6A 1R47A 3X2QB 3ZRCC 4XAWH 3POHA 2D8KA 5JW4Q 2YWYA 1SXNA 3VU2A 4ELMA 2C1OB 4NPKA 3AY4C 3QR1A 3K3QA 4WHYH 4I5BA 1NCHA 2E7LA 3SSGA 3RIFF 1Z5LB 4L8CB 5HYSB 5I6PA 1ZWIA 4MNQE 5K9QG 3LCYA 3MBWA 3NSCA 1XF2A 2GAZA 3GMNA 3RURA 1QNZL 5AOKA 4FTVE 1RZFH 3WKPA 2A73A 3MRNA 4XCCH 3OMAB 2P4AB 1MJ7H 3MKGA 1WAAF 4DKEH 3MA9H 3F12A 3IJYA 5AAMA 5JHBA 4ABUA 2RR3A 3OJ2C 3PL6C 3L4XA 3TN0C 3TPKA 2QBWA 2JCCA 1A4JA 3GGWA 5H8DA 1A4BA 5K9QI 1WA0X 2X09A 2R1WA 2DDQH 2AAVA 3SCMA 5DHMC 3L9EA 4ZW8A 2DYPD 2AJSH 3VFWB 1TJIH 3FQTA 3FTYA 4P2YA 3TNMB 5IGXL 3QA3A 5HY9A 1AFVL 3PDOB 4MA7H 1BM3H 3NGBC 5D7IF 4EIGB 5F3HB 4DUVA 5LGJA 1IEHA 5DS8B 4LPWA 1MFEH 5DQ9B 3ARGB 3BLPX 2QFPA 4U3SB 1ZLUK 3L8QA 3G6JE 3PJSB 4LEXH 3QP3A 4OW6A 3W0WB 3KPQA 4DZBB 2OL3H 2XRAH 3HTLX 1TYRA 4L29B 2OMYA 3WL9A 1CGTA 4XO3A 1JHLL 1FE8L 1MCPL 3KL0A 1ZLEA 4NQCD 4AC2A 2Q3AA 1TVBB 1U8LB 6PCYA 4Y4KD 5I1KL 4WTWA 3RHWF 4EUPH 4S1SH 4HUXA 4HUWA 3HB3B 3L4TA 3VWJC 5TK2A 3EDEA 2BS8A 1Q1JL 3L3OA 5E8PB 4D9LL 3CSYB 1FFPA 1I1FA 2K0RA 3LPFA 2AV1A 4X7TB 2H6OA 4PWJA 1NKRA 2A4CA 4X6DB 3IJSA 4D2NA 2C4FU 1XF4A 1TETH 3QDGA 4JCMA 5AVZB 2WQ8A 4MDIA 2NNAA 4FAAB 2ETWA 1MY5A 1AANA 2J71A 3QULB 3QO0B 4WSJA 1T0NA 2QHLA 2VDPB 3TEYA 3FTWA 4ZDHB 1X7SA 5D1QE 2GCYB 2DI9A 3AROA 3OKOA 2H32H 1KT2B 2OK0H 3PHOB 4JRFA 2W07A 2VC2L 3ALPA 2Z93A 4AYDC 3H7LA 5DJZA 2GY7B 3OZKA 3CCHA 3L9RA 3UBXA 5L0QC 5C3LD 2OXGB 4ZJ9A 4PWEA 2ADFL 2VDRL 5MERA 5LQBH 2R0WH 5DS2A 3L1OH 5SV3A 1INQA 2P24B 4PV9B 1ASPA 4K4KA 2CA3A 4PGDB 3DIVA 1K8IB 4WRLA 2APVA 2NRDA 3VFNA 5DO8A 5E8NA 2QLVB 2BSTB 3O0RH 4NKMB 1QZNA 3IJ7A 2XBDA 2IADB 3I6KB 2AQRA 1LP9F 1A22B 4IIZA 1OF2A 5EOTB 2DRUA 2VJXA 4Q6IA 3TYGL 1U58A 3MLSH 1KCWA 1AGCA 4J12A 2J73A 3ML8A 1UWEL 4JFFE 1PU0A 2FCBA 5EOCL 1WFTA 4MVBC 3X13B 2WD0A 1HHJB 2GBAA 5DUPL 5D1XC 3QJFA 4DVRL 1I75A 3U82B 2M1KA 1CFQA 1OSZB 2JI2A 1W0VB 2FJHB 4TNFA 2GY5A 4APXB 1DN0B 4N9GB 1B4RA 1EQWA 1M1XB 1VPOH 2C9AA 1DFBH 3FYIB 3WFEH 2J5LB 2Y2WA 3T2QA 3GRGA 3VQLA 5K39B 4L1LA 1TEFA 1NCCL 4ZPVA 1OSYA 2HVJB 3T04D 1WHPA 4L2LA 5GRVL 1J1XH 1R3JA 3QIBB 4GRLA 4WDIB 3FONB 3OKEB 4GI6A 1IL1B 4YDIL 4YBHA 1PX4A 3IWUA 2IPUG 3VVWA 1THAA 1KUMA 1KXTA 2P47B 4RQQB 4KMTL 5JPMC 3ULVC 3DUUB 2G5BA 1KDIA 2L7JA 4RX4D 4XZ4A 3NJNA 3QIWC 3E7JA 3U0WL 2L04A 1RZJH 1JPST 1BMGA 4RWYL 1QBLH 4LKXA 3NACL 2XU9A 5AWNL 2WB7A 1GHFH 4PP2B 3IDGB 1ES0A 1XIWA 1ED3B 3CFCL 3HHSB 2VDQH 5B8CA 1T21B 2DWSA 5ESVB 3LD8C 4NOFA 1G0YR 3BPLB 1QD0A 1S78D 4HCRA 3VQ1C 3HKFA 1TQBB 4U6VL 3HR5B 4KAQH 4Y4FB 2HVKA 2K78A 3WEAA 1JZ2A 2CRZA 1A14H 4LSPH 3UTSE 3KJ4B 3S48A 4EVNA 4K2UL 5AD0A 3AU0A 4I0PC 5FF6A 1S7WB 3DSFH 3FSAA 1KGWA 5D70L 3OKMA 2CJTA 3KCPB 3HKZA 3ZTJH 1CFSA 1MRCL 3P2TA 3L5WB 3C60D 4LARL 4M7LL 3U79A 1VCBC 5I6NA 3ULUF 4G80A 3UJJL 4AUJA 4JNXA 4KROB 1RP8A 2X3BA 3ROLA 2ZWNA 1S7RA 1GOFA 3CVHB 5TE4L 3N1QC 1PY0A 4LCYA 2ATKB 4MMZA 3WFBL 2A6KA 3VXUA 1CFNA 3S5LA 4AUYA 1G9HA 2AABL 3TA3C 2DJSA 3PP4L 4W4OA 2DWEB 1HXKA 3NEEA 3DROA 4NZUL 3IGKA 1Q9OB 1A7BA 5BUAA 1A21A 1OB0A 2BSCA 4YDNA 4YNYA 4K23L 1OAKL 3ZDYB 4A68A 5ELIA 1LK3H 3TN0B 4BM7A 3HNSH 3H9SD 2AXHA 4DOHE 2H45A 1S9WB 2J12B 3X1FA 1WGOA 4JFHE 5CJ5A 4LOEA 4J3TA 2VKXA 3RG1C 4KZDH 1J5OL 2BRQA 1P1ZA 2X6BA 2Y6SD 4FRWA 2CHZA 3NGBB 1AHWC 4R8WH 5D6CB 1GZQA 1N0LB 4A04A 2X9XA 5E6YA 1DJHA 1KPRB 3BHBB 3JTTA 4F8NA 2VR5A 4G72B 2Z0UA 4DGVH 1NUNB 1QBML 5I6XC 1THCA 1QLFB 2JK5B 1OP3K 4N0YL 3L3KA 1TKWA 2PNDA 1NMAH 4X80L 1DQQA 5F70A 4KXCA 2E9JA 4MMXC 5F93C 3BQUA 5IW3A 2D7TL 5T5FA 1Q0XH 1Z5YD 3TU6A 2L0DA 1NUDA 4KI1A 4ONHA 3GC3A 3TESA 1NLBL 2BHZA 3FB8B 4HZAA 3LX9A 4OH2A 4LSQH 2KDGA 4KX7A 1IM3B 4WWKC 3TO2B 2B59A 2AEPL 3B9EA 1JFQH 4L8DB 4ANWA 4HFUL 4WWNA 5HDWA 2OTWB 2P5EA 1IE4A 2GTWB 1OP3H 3TF7C 2XKNB 5IB3B 4OJAA 3DHMA 4XNXH 3IKKA 5DD1H 5JPNC 4HK0B 4ERSL 2J8UB 5I82A 5I1AB 2DM7A 4BHUI 1J9RA 2EJ1A 1MJJA 2IAMD 3NJXA 3V9FA 1XSJA 4ZUVA 1AZVA 3NA9H 3KWWA 4Z7NE 2FVNA 2APWA 4FXKC 3FFCE 4HBCH 1ZV5A 5E0FA 5FYKE 3GUFA 3DIFA 4JHAH 4JPVL 4LLWA 3ZKSD 2VQUA 2JNZA 4XHJD 2BVPB 4NIYE 1X9RA 3OJDB 5DC9B 4NRYB 2R56L 5L0QB 4C4UA 4JREC 3QRGH 4KITB 4ONGL 3LKOB 5DFWH 3BJLA 3ZTCC 2WW8A 2VM3A 3PQYA 3FU6A 5TK4A 3KBFA 3TLRA 3W39B 2WOBA 1ET8A 4N85A 2BNQB 2PYED 4Y9FA 5J89A 1J8HB 3ZIMA 2WAQA 3PNWB 3GI8H 1KJ2H 2XQBL 3QEQD 5EMYA 3MJ6A 3ME0B 4NPYB 5FYJE 2FBJL 2GIMA 3LQAH 3PXLA 4GLRH 1BZQK 1HL4A 5IB2A 2Q5BA 4YBQC 3GJEA 4XTRC 2WWOA 2X4SB 4YAQB 1RFDL 2DIJA 3WDHA 1MREL 4NC2B 2V9QA 4K7PX 1MXGA 3DO3A 2JKJA 4LAJH 2PUQT 3BH9B 5D1XB 4LRNL 1EDYA 2E4FA 4AW4A 1RVFL 4LCUB 5IKCA 3NCYP 5JMOC 3EO0B 1C08B 3TURA 3RTQD 1YEIL 4UM8A 3Q9PA 5ANMA 5EA0L 3WE6B 5F3FA 1CYWA 2X3AA 4HGWB 4NP4L 2DBLH 4R0LA 4UNTA 3M1CA 3DX9A 3KPSA 2WXQA 3FXIC 5D4JA 3RPBA 4PRAA 2XG4A 3QXAB 1EJ8A 1N59B 4GMTH 3G9VA 1MJ8L 4WFEE 4HCRL 4NOBA 1IGYA 5FOBA 3VFUA 2AJUL 4RNRB 4UUJA 5DMGD 1IC7L 2UZPA 4QHPA 3VA6A 4AM0A 1TG8A 2NY5L 4ZMAT 4LCWA 3T0ED 3ERXA 3ZY7A 1MCKA 4PJIF 2VDOL 3RTLA 1WEJH 5CJOL 2LLGA 1U4EA 1LJMA 1MW1A 1ZIAA 4NJAH 4Y1AA 2JTDA 1KBGL 1QPPA 1HKLL 3U7WH 1L6PA 5L2KB 4HW6A 2VUKA 1BGXH 3FJTA 1M6UA 3QIWB 4PFEA 1F11B 2V2WB 3RJQB 4DW2H 3DA0A 1U8OA 5HYJB 4G8GA 4KK8C 1NCUA 1IBYA 2NY3D 2W38A 3G3LA 1G6RA 3PWJA 1U92B 4FQ2H 5JHDE 4EBQH 3PIQA 3NIGE 1BD2D 5D7LD 2X2HA 4FFWC 3HHRB 3NSFA 2VR6A 4FQQA 1SLXA 2ZXEB 4NQEE 4GUQA 4NUJB 3LD8B 1KIQA 2XN9B 4ABWA 3ZKQD 1MPAL 5EDXA 3GBMH 3MLYH 3TBVB 1BZOA 4JUSA 4OCRL 4L18A 4OZGE 4YSPA 5KSBE 4I0PB 4J6RL 3ES6B 4OFYA 4DN3L 4G6FB 4BZYA 3RL2B 3PL6D 1CK0H 1BAFH 5ISZE 4ZMOA 3I9AA 1MRDH 3CPLB 1F90L 2IQAA 3CX5K 4R3SB 4H0IA 5KUMA 1MDAA 3IRPX 3MV8D 4ISVB 2HVBA 4TTDD 3HNTH 2CCWA 43CAA 5B38B 2AXWA 3QJTB 1HILA 1HN1A 1Q0YL 4MZ2A 2YXVA 3N42F 3D0VB 4HC1H 2FX9L 3QARA 4MSWA 1JI2A 4WU7B 2D03L 3FOLA 4JZJC 2CBQA 1IGCL 3UTQA 2OMTB 3CBKB 5G5DA 5B3SB 2BHUA 1U3HA 1CDUA 4NHUA 3ABZA 4N2HA 1VZGA 5HHOB 3VI4E 4P4RA 2HUEA 2UWEB 3IDIB 5EBGA 4Z5RA 3UABA 1N2RB 2EDTA 5KBKA 7FABL 2J56A 2JQAA 5IMKB 5IR1B 3TEWA 3BAKA 3VWJD 1DVUA 1QFWM 2X4UA 4FJYA 3TCXA 4AYSA 1F6FB 4ZNEE 2TSAA 2C7UA 3UEZA 2QPDB 3BUDA 4MZ3A 4XPFL 1BM7A 1IMHC 4FQLL 4LHUG 5E99H 1GMEA 4KKCC 1NC4B 2NXYB 4QRRD 2RHEA 1HJCA 5D2LA 4DP6X 3GRWA 3N04A 4Y7OC 5HGDB 3GJFB 1S5IH 3HAEH 1HHGB 5I0ZA 1AHWB 5H37G 1UOWA 2NYYC 4FOMA 1CMOA 1KY6A 2QKIA 5DZNA 1GYAA 4UU9B 1PF3A 1QEWA 3FB7A 5SWSA 1HK6A 4KMQA 3LDBB 3UTZB 5DUJA 3LKRB 5I6XB 1M56B 3V5HB 2DTML 4PRDA 3D3VE 1I4FA 1JNJA 3MTRA 3EJZC 3IDNB 2IOIA 2AGJH 2V9RA 3O6FC 4JPWL 3ARDA 4PJEB 4JKWA 1ERNA 4PREA 1JNLL 4MMXB 4RRPG 1VJSA 5CHNA 4D0DA 4DGIL 1KCVL 3NZUA 3PNRB 2JQMA 5C8JB 1UA6H 4I9XA 1JIBA 1NEZA 1ECZA 3MNZA 1UXMA 1WK0A 1VADB 1ZJBA 2ED9A 4N28A 3UYRL 4WWKB 2EDWA 4U3XA 5FWRA 3T1FA 3CK0L 5KSAD 2HP4A 3ZRSA 3JWDL 3MV9A 4JY4A 4YDKL 5H94B 3QQDA 3P0GB 2K9FB 2ZOWA 2Q8AL 1XF5A 1G0XA 4KDWA 1VEPA 5HHMB 4ENEC 1AQHA 1BVNP 5JPNB 4ZFQA 2ZXDA 3RBSA 2XT1B 5KG9A 1F97A 3V0IA 2YAPA 1ZY9A 3I50L 1NFDE 2NR6C 1GC1H 2X6VA 4GJTB 4GKZA 4QOKD 4Y16C 1NOFA 4DVBB 2IH9A 4HU2A 1RU9H 4FXKB 4M00A 1BVNT 3G5XB 1EJ6A 2CLRA 2G9KA 2H2SD 2MMXA 3I6LD 4MVBD 3RL1B 2AEWA 1A6ZA 3VI3A 3SGEH 3P9WB 1KWGA 2XWJB 5EBMB 4AMWA 5IJVA 2ADIB 1ZT4B 2VDNB 3EYVB 4PJHB 1OEZW 2C5DC 3FAWA 5GS1A 1PVHA 3S37H 3KGRA 1RURH 3E6FA 2G4EA 2JVUA 2IF7A 3QFJE 4QKTA 1WZ1L 3RB5A 1AQKL 5DFTA 3V4VB 1Q38A 2AJXL 3ZTEA 4GOSA 4ZMXA 2ZOLB 1CLZL 2HSIA 1D5IH 3HEIB 4TNEA 1GY2A 1VESA 5E8OB 3UP1A 4G6AC 4M62L 1T7YA 1OAXH 3ARBD 2OYKA 2X38A 2LOEA 3KGTA 4EDWH 4F33A 2XC8A 5FW8A 3OHXA 2ZXQA 2EIZB 1ZLVK 3ULVD 2Y7OA 5BV7L 4PI0A 2DJUA 3STLB 1CZ8L 4U1NA 1A6TA 5KS9B 4YHYB 3ZYOA 5IWLC 4FJZA 2QEJA 1RERA 4X98B 2PPAA 1IIIA 3OQ3B 3QYNA 3BISA 4I4WA 3AADB 4XNDA 1G6RL 1E5CA 1A6WL 1A7OL 1I8KB 3PAUA 1KPVA 4HJJH 4I9WD 1DUZA 5FB8B 4ELKA 3SDXB 1ZCRA 5CMAB 5IQ7H 5C0AD 3SODB 3UDWA 4F2FA 1XFPA 4YHKH 1QFOA 3ZTNL 2CM6A 1ILSA 2WZPD 3DOSB 3KS0H 3SDCD 3Q05A 1JTOA 1F4WL 3WY1A 1JP5A 2EDRA 2VUYA 5C9JA 3H1ZA 4P9HH 4RGNE 4WTQA 4YR6B 1QSEA 3MGTB 3S34L 2DQGL 3FUKA 3QQ4B 1AZZC 2XPYA 1QACA 1DFXA 2F58H 3ZDXF 5KYWB 2CMRL 1OW0A 4YZFE 3DJRA 5DJDA 4OLVL 3RGBA 3MUUA 4XVTL 3V6OC 2XN1A 5AVQB 4G9DB 2H0FA 2WK2A 5FM4A 3OF6D 5K9KB 3FB6A 4OD3L 1UM5H 4P2QB 3BMWA 5MEPA 1MVYA 1ORSA 2ZOUA 2VL5B 3BWUC 3NZHL 3J27A 3SGJC 4FFTA 3KBHE 4R5VA 1UB6A 3TA3D 2EUXA 5L2JB 2V3EA 2CWRA 1ANUA 3BESR 2ADJB 2BOLA 1N6VA 4NI6A 3RVWD 3KPRD 3T4AC 5F7KC 1YYLL 2JLPA 3F3HA 5CINL 1NLDL 5JZ7C 2J7LA 1E6OH 3U2SB 3MRMB 2CG9X 4RMWA 5C0DB 4JFYB 2E5EA 1ODUA 4OUOA 1YECH 1KIRB 4LDCA 1EEZB 4F8TA 3SYQA 5CUSL 1BFVL 4TLKA 3GRWL 1AC0A 4ETQB 2EVFA 2OQJA 1I1RA 3E38A 3QIUC 3UZVB 3GF8A 2H1XA 1N8ZA 3C60A 1E4WL 3KD4A 4G1EB 4N24A 2VDKL 3BX7C 4KY1L 2XVLA 1LO5A 1B3JA 2TSBA 1ET5A 2IWKA 1IEBB 3LB6C 4K3JH 3TNMA 2WGXA 4JZJB 4YVNA 4X9BA 4J2QA 2HRGA 1RV6X 3AFLA 5KW9H 1G4RA 1NFIB 1FG9C 3S37X 3KXFD 5F3HA 1IV8A 5DS8A 1T03H 4M61B 5DQ9A 1HNGA 3ARGA 4U3SA 4N3TA 1RJLB 3W0WA 4AGNA 2Y06H 4FLSA 1E28B 1R33A 2ENSA 2X1OA 2YD6A 4L5FL 4H88L 3K0YA 1TVBA 1U8LA 3IXAB 5FUOL 2Y4SA 3RLSA 4YHIA 3FMGH 1KNOA 4CMHB 1MFNA 3T3PB 2QVIA 1OCCB 3MV7B 1Y0LB 3FUEA 4FE9A 4A39A 3V4UL 1I1YB 1SOSA 3QHTC 2F5AH 2DI8A 2FX7L 5GGRB 3H9SA 4LU5L 4ZMTA 1BJ1J 4X7TA 1MEXL 3NJVA 4BJLA 1SRDA 3DETD 3DGDA 1S9VB 1QP1A 2BWQA 1ZE3H 3MPCA 1AZUA 2IH8A 4U0QB 2WLIA 4DAGH 1FL6B 3BAYA 1G43A 3RVVC 2DQUH 4D9RD 4XP6L 2BK8A 1MRFL 4XVJH 1P9MA 3FKUS 2E3VA 3O6FB 1KEGH 4YWGL 4ZDHA 2GCYA 2XV2A 1NKOA 2W9LA 2VDLH 1L9MA 1R34A 1GCFA 5E23A 1YDPB 3BKMH 4LNVA 2FEEL 2PO6D 2A0LC 4AMKL 3BKCL 2FJFB 2NZ9D 2H1PH 1AXIB 5FFGA 4ZW6A 5AW2B 3U6XA 4RMUA 3ARXA 4ZMWA 2UX7A 3GI9H 4J3OD 4Z7WB 4Y19D 4B9CA 4UM9D 1K8IA 4LLDA 4RWHA 2AV7B 5F71A 1WAAE 4LRIC 4NKMA 4XTRD 4YBQD 3UBXG 4A7GA 5FS5A 4ZFFB 3PP3K 4XP5H 1QBBA 2IADA 4BZ2H 2FJSA 4JE4B 4Y16B 4OQ1A 4DERA 3M46A 5EOTA 4UILL 4MJIE 2NW2B 3ZL4H 1KBVA 1ZK9A 3CPUA 4UQDA 2D7QA 3RAJH 1Q9WB 1C1EL 3CIQA 3LQMA 2XFXB 4LQFL 3X3FH 5ADOL 3NYKA 4XPGL 2XTJD 3VD5A 4QLRA 5BNXD 4L1HA 3HZKB 3GBLA 4XCFL 3UBXI 3TX4A 3VGAC 3X13A 1N7ML 5AUMB 3K4ZA 3DPDA 4GQQA 3IPBA 4JZNB 1A25A 1W0VA 1JPSH 5E2VH 4KQ0A 2HLAB 1JYNA 4N9GA 2DB8A 4UOQA 1M1XA 1KB3A 5I75B 1FGVL 4PJGF 3T6ZA 2AS5M 4TL5A 2YPKA 5KVMC 1R6VA 2PYEA 1WPCA 4JHBA 4PCKA 2OJZH 3PHQB 5K39A 1G5AA 2YPVA 3ETSA 4OGXH 3WY2A 3QEQA 3SE4A 2HVJA 3PDGA 2Y1AA 3O6KH 3QIBA 3X1NA 4R90H 1EANA 3FONA 1T66C 1A8ZA 1IL1A 2MHAB 5C3IA 2X12A 2KKQA 1IM9B 5LWYH 2IALB 3EJCA 4N2AA 5ID1A 1LHZA 1MSPA 1T5WA 3PCYA 2HJKB 1AQDB 2PW2B 5M94B 1PFCA 5ADPL 3DUUA 3S3SA 3NCYS 1TT6A 4OIAA 3FQ2A 2ZX7A 5BOPA 1UOKA 4KK8D 5IF0B 3S0PA 4GQ9L 5D7JC 2OX5A 3UZEC 2L7EA 3IN2A 4G3YH 2CNZA 4L48A 1QW9A 1UH2A 1XZWA 2ALAA 1IBGL 2IH3B 2Y24A 1RZKH 2VLMD 5IUCA 1WIOA 1EBAA 3IDGA 4M8QA 4PP2A 5I1IL 5CZXC 1ED3A 4PGCB 4MFHA 4P57B 3L5XH 3EOBB 1T21A 4Y2DC 1GKEA 4FLOA 4XPAL 2AK1H 5ESVA 1O9ZA 2JKSA 1LVEA 4PJFA 4WUKL 2MIZA 4KGLA 4PU2A 4RAVB 4Y4FA 4IQHA 3LRKA 3NCWA 2MCPL 5B1KA 4CC4C 4HU8A 3GSXB 3X1GA 3CGTA 3CSGA 5GS0D 3CFNA 1E2VA 3LN4B 3L5WA 2PTUA 3KYNB 1G4MA 1UD5A 3H53A 3HN3A 4J3SA 1KEMH 3CSTA 3DVNB 2ZWYA 3SJVD 3SGKC 2Q9OA 3TXAA 1SOXA 2JMRA 1A6UL 3K6IA 1J10A 2ATPB 4HWZA 4MD5B 2ATKA 2GG1A 4PB0L 4LIQE 4ZFGL 5BRPA 1BD2A 5D7LA 4Z8FH 3VFVB 3AY4A 5A1AA 5BMFL 2CQVA 1FRGH 4PWKA 5E2WH 1NGWB 2VH5H 2WSDA 2V4LA 2YEVB 2DWEA 4MJ5B 4UT9A 4M48L 1NUFA 2EEDA 1NZRA 2P9RA 2XZCL 4PRHD 1KIUB 4EMZA 1LK2B 1QR4A 1EMTH 5F3BA 4KUZL 4WV1C 2QVKA 1IGFH 2VDMH 4J8RA 1TZAA 3O3DB 1B0GA 3QIUB 4LIQH 3MRLA 5GGTA 2YO3A 4ATWA 3PL6A 1B6UA 2OMXA 3TN0A 1CG9A 1MWAB 5IJDC 1HDMB 1W16A 1JXGA 3VXQB 2ZJSL 1DQIA 3MV8A 1PLGH 5AKRA 2NCEA 1KGXA 4X7SH 1SNRA 1QFPA 3U6RB 5GGQH 1H6UA 3OL2A 4OCNC 4G7QB 4GS7B 1N0LA 4QAMB 4CRPA 1WICA 2DWYA 2CCLA 2NTSP 4H0GA 3V0GA 1KPRA 2CR3A 3BHBA 2FYVA 4KNTA 2E46A 2K7PA 2B5IC 3KWVA 3B7RL 1INDH 3EYSH 4KPHH 4Z0BH 3RNQA 1QLFA 1DL7H 1UT1A 1UEMA 3KEDA 5JW3L 5I6KA 1V3KA 4ESKA 1MDTA 3ZE2F 4WWOA 1BP3B 3O6ML 4P23C 2J43A 5F7NC 3T1WA 3ZYZA 3U9UA 4PP1C 4FQCL 4DH2A 2CRIA 4I3RH 2P7TB 4LPTA 5C0GB 3TVMD 3ETTA 3VWJA 5C07D 1XXFC 1GA2A 3B3BA 3UX9B 3QG7L 3A67H 4OCMC 2CXKA 5DRNB 3EJTA 2ARJB 1E3ZA 4ENED 1PZUB 3IMBA 4M1DL 1QSFB 5AOLA 4NENB 2H0EA 1IKNC 3QVAA 4RDQG 2A9CA 3MZTA 4H0LC 1XBRA 4FQXC 1Z3GH 2GTWA 2VM4A 2QSTA 1FZKB 2XKNA 5IB3A 3MRRB 2VE6A 3QEHA 2QZ5A 4JEGB 1H8SA 4XVSL 1NDMB 1TYEB 4PJCB 5I1AA 3ULUE 3SDYH 4HJGA 1DBAH 4NWTL 5EN2B 1WFJA 1QO3B 4GAGH 5DR5L 2Z65C 4NLHA 4MRCA 4IM8A 4ZS7L 2VJ8A 2BVPA 1V5JA 3OJDA 2WMPA 1C5BL 1JWSB 1IQWL 2I9TB 4F7CB 4XPHH 1ODAA 2JFCA 4U1KB 1WCBB 1AS6A 3ULUH 5C6TL 2YPVL 2HKFL 1NC2B 2VMEA 1NL0H 3B9DA 4R4FL 1HFUA 3MLXH 5HHPB 3W39A 4BFIB 1SBBA 3JV0A 2KZBA 1SUJA 1J8HA 3GKWH 3RPIA 2WWMD 4N2IA 4EI6B 4C4BA 2UZIH 3Q43A 4U1JB 4F15B 5SX4I 1D9KB 5JQ6H 2AK4D 3STBA 2X4SA 1S9KC 3LPWA 3NCJH 4YAQA 3OHMB 4G82A 4M7LT 3EBAA 4KTGA 1BJ8A 1FP5A 1F3JB 3NK4A 1TZHB 3P4LA 3IU4L 3NCMA 2Y5EA 4PJBF 1L7TH 3QWOB 2ZYSA 4ZS6C 3BH9A 2G3MA 1RUAL 4KTEH 4NZTL 5D1XA 1PQZB 3S8FB 4LCUA 1YMMD 3OQRA 1ID5I 2CR0A 4NAQA 3DV6B 1IC4H 1C08A 1G1YA 2TAAA 3F84A 2D9CA 4RFOH 4NO5A 3B3IB 4HHAA 1DQML 2WUCH 4JDVB 5KYXB 2F8OA 2BRRH 1H15A 3UCRA 1RZQA 3ARTA 1N59A 3HJEA 2R0ZH 2V9TA 3OZ9H 3TBWB 1AJ7H 3H56A 2NYZA 3W11D 5AG8A 5IJCC 4KU1A 2J55A 4RNRA 1JTPA 1U2HA 1J9CT 3SBQA 4O51A 5I8CB 4M3HA 5TDNB 5IROD 2WQVA 3ARBA 1UJ3C 4PJXA 4Y4KB 4PRPB 3GMMB 2AHIA 4ADGA 2Q8BH 4ETYA 3I74A 1ZVHA 5JPMA 2G30A 3WKNA 4KZCA 1XGZA 3EDDA 5DTFA 1URIA 4P59L 1F3RB 3QIWA 5D7JB 5INCB 5IHZB 1I3GL 1F11A 3I2CH 2V2WA 4NO3A 3DGGB 2GK2A 4OGYH 5HYJA 2HFFB 4AGMA 2HT4D 3SQOL 4PLNC 1KCSH 2ZIDA 4AGOA 3IAPA 4TVPD 1U92A 5T33L 5C0AA 4PH8A 3WFHB 4OZ4A 5D7EA 4UT9L 1U8NA 2NDGA 5SX5K 4F92B 4MRBA 1CI5A 5JZ7D 4GXVH 1XH1A 5A3IC 5JW4M 4Y2DB 5GRJL 4NUJA 1QLEH 3SDCA 3DURA 1UM6H 3VXTA 3ARPA 3MRDA 4HUNB 3TBVA 1WZAA 4C54A 4QRPE 1NA8A 3FN0L 2ZZUT 3OB0H 4KWUA 4AIXA 3Q1SH 2D0HA 4MYWB 5IV2B 4C83B 2J2ZB 1D2OA 2XHNA 1JXKA 3QAZC 3QWRA 3IE4A 1TZIB 1GOGA 2Q7AA 5F9OL 3RL2A 5HJGA 3I9GL 1OTSC 4LK4A 3RZCC 1GZPB 3U7YH 2ICWJ 5KEZA 3D2TA 4MNGB 3IMSA 4ISVA 5DVKA 4MQ7B 3BAEL 1DJSA 1R9FA 2GHZA 5CILH 1NGXB 2Q6WB 2YXFA 1PZCA 1EHLL 3MRIB 4X6DE 3TA3A 1XSIA 3D0VA 4M6NL 4WU7A 4G1MB 4R96B 1MAMH 3NESA 3JZYA 4QNPF 4YSDA 5IB4B 3L4YA 2CJSA 4JFSA 4X2UA 3DV4A 3ZR6A 5C7XH 2G60H 3K0WA 5IM7B 4V1DA 4UIMA 5HHOA 4HLZG 3EO1B 1BX2B 1QWNA 1ZA3A 3VSUA 4WEEA 5IMKA 4KXAA 1OGPA 3WUWA 1MI5B 1TMCB 1MJUH 2YGPA 4AWJC 2XWTA 1E6JH 3TZVD 3NPSC 1ZV9A 4KI5F 1Y1UA 4PJIE 1OSPH 1S9XB 3WEOA 2J21A 2W65A 4LL9A 5F7YC 2WVUA 4PD4J 2H3KA 4H44C 5GGSB 2JIXD 4XN8A 3GJFA 4EI5C 1HHGA 3D52A 2GW5A 3RVVD 4YO0B 4D0BA 1WT5C 4B53A 1U8IB 3CMOL 2A3TA 3CHQA 2B5IB 1C5CH 1E67A 3UTZA 3LKRA 3TV3L 5GJSL 4WUUD 3V5HA 5BRZB 1M9SA 4B0MM 5FGBC 2E8YA 1SMOA 3IDNA 1HZKA 3OZLA 4LSSL 3NDZE 2DQ6A 4PIRF 2A0LD 4XX5A 3V0JA 4MMXA 3KG5A 1CXKA 2IMMA 2FWLB 3NA4A 4NO0B 3DTXB 2DH2A 2HTKC 2NXZC 3NCXA 1PLAA 3CVIL 3HVNA 3RVTC 4U1HB 1VADA 5LXVA 4M7JL 3OAZH 2WN3A 3ILQC 4WWKA 4KJYB 1WH0A 1X4XA 3GB7B 4C56D 2YC1B 1I9IL 1HYRC 5CZVL 1RUML 5TTRA 5EZLB 5BZDB 2Q3XA 3VXPB 5GJTL 4K8RD 4C59B 2QV4A 4JAMB 3GMPB 3H9HB 5JPNA 3CSPA 1NEZG 2R4RH 2K6ZA 2W9EL 4AKOA 3NZ8B 2BO0A 5K9OA 3DVFA 4H7VA 3EJSA 5E9DD 3ARFB 1BZ9B 4DVBA 3QPXH 1KTDB 3FRPB 3OD3A 4FXKA 3G5XA 3PUUA 2OCFD 2NDFA 1UD4A 1GW6A 1X4YA 4JFZL 3WIIH 4FHBD 4M03A 4CC1A 1QTPA 1J48A 4F7PB 2XWJA 1DSYA 5EBMA 1I53A 4FXGC 4Y5YC 1JGEB 3TH2T 5CCJA 1ZDQA 2ADIA 2NY2D 1ZT4A 2QR0B 3EYVA 3VJ6B 5DSCB 1OPOA 1YJDC 1GGIL 5AZ2L 3GK8H 2YSTA 4DO6A 1KPUB 4AENB 3FUHA 4JX0A 3WNIA 5FA3B 3GMLB 3FH8A 4W9IC 2ZOLA 1UKSA 4B9KC 4LE8A 1NOLA 3OC8A 4WKXA 4UM9A 1KGYE 2CUHA 1TF4A 3QUYC 3JWOC 3HA0A 5E8OA 1SBSH 2AANA 1I3RB 2VLKA 3ULVL 4X4MA 1A6AB 2IWEA 3QPQD 4JY6A 5JQHC 4OD1H 4PJDA 4S1DC 4MHHG 1IC5H 1KXQE 2QQKL 3LRSA 5KS9A 1E9QA 4N1CA 3TT3H 3U0PB 4HWBH 3VCLB 1WS7A 4P4KD 5A2BA 2CO3A 5DC2A 5C97A 3VSTA 1CBVH 5DZJA 4HIQA 1TZ8A 3GO1L 1MCQA 3HLAB 3KNBB 4OKVA 4UTAH 4YHNB 4ZW5A 3SPHA 5FB8A 4GQRA 3H3PH 4JG1H 5F7MC 2DJ4A 1N10A 1FO0H 2FEEI 3B8SA 3ECBA 4NQDD 5CMAA 3DX2A 2YRPA 4OLUH 4K07A 3HMWL 1AXSA 3CBRA 4MHHI 1D6EB 2I5YL 5HGAB 5TPWH 5CR8A 1R0AH 4BE5A 1JHTB 4GFXA 2J1WA 4PJAB 2EYSB 4PB9L 1VDGA 4RFNC 1AG6A 4S1QH 1H3PH 2HAZA 2OJEA 2MQGA 3FQXA 4QGYA 4ODVL 2Q86B 5GISL 3MGTA 4B60A 4KDTC 2X4RA 5CFHA 2R8SH 4ZSOB 1SJMA 2N0MA 4F7TB 3F58H 4MZRA 4B9ZA 3I75B 4AV0A 1LE5A 4JRWA 2ZNXA 2DQIH 4CMMA 2FUQA 3D39D 4JY5H 3CWGA 3NP4A 2OMZB 1BF8A 1ET7A 1GSMA 3LPPA 4G9DA 2KS0A 4GBXC 4JFDE 5K9KA 2IGLA 4Z0XA 2YZ1A 3AG1B 4KRPD 1PY4A 4N0CD 1CE6B 3RQ3A 5DJXA 3O45B 2UYLA 3AMKA 1L3WA 1OLZA 2VL5A 2HWZH 2C9XA 1BEYL 4GRWB 2E9GA 1OWRM 1V7MH 1HSBB 2HRLA 2GK0B 2ADJA 3NMEA 4YSRA 3OB8A 3JT0A 5HYIA 1IVLA 3IVKB 4RGOH 4OZFB 3PGDB 2CO6B 2CU9A 2ERJB 3U2SA 1D7FA 5EFIA 1I7UB 1I9EA 3MRMA 4UB0H 3WLWC 4DEPC 4NRZA 1R4XA 5C0DA 1NCBH 1CYGA 1F45A 3LN5A 4LLYB 1I9RH 3P3UA 5BW7C 2WXLA 1KJMA 1KIRA 3EGDB 1EEZA 1JWUB 3GHBL 5FR3A 1FFNB 4JPIB 4QHKJ 3RZCB 1ZHNB 1AO7B 1TPXC 4KZEH 2WB1A 4GG6B 3VU1A 4YSOA 3PWPE 3UZVA 3QJQB 5T3ZD 1TTGA 1T04B 4Q52A 1IAKA 2GJ6B 3DWTA 3MJ9H 4PJ9C 5E5RB 2G5RA 3VXMB 3VFTA 4XBGB 2OSWA 4KOBA 3EXLA 1GYVA 2FQFA 3FSWA 4WI9A 1YY9C 3IF1A 1NFIA 4NGHL 2FO4A 2VZUA 1B4TA 2J8UE 3JV4B 2X4QA 4EZKA 4M61A 4P23D 5T1KD 1NCWL 4IJ3C 1IBDA 2Z1PA 4MA1B 5J7CC 3B1UA 4A38A 4PRHA 4H5SB 4MZIA 1E28A 4PRID 4LEOB 4XC1L 1CIDA 5BS0E 5DGRA 4PCTA 3IXAA 1PKQA 1LDPH 2FD6H 3NPSB 3SBRA 2EVGA 5PAZA 4K5OA 5GZOD 1QFWL 1MHPL 1Y0LA 4HMEA 4HEME 2D9QB 1JK9B 4FQXD 5D72L 1GGBH 2TRYA 2C3WA 2RB8A 3ZDXE 2MTPA 2ZG2A 4MDJB 4YVUA 1LO3L 1M7IB 1AIFB 3LZQA 3VM7A 3B6SB 1I8MB 2YAOA 1S9VA 4OIIL 5BPPA 4G7VH 2Y07H 4N2CA 3BZ4B 4NUGL 1RSYA 5FA4B 3BC9A 3O6LL 4ZO9A 5E1AA 4XCYB 4HXBL 4ZQKA 3U0TB 3GSNB 3O6FA 2VISB 3LKQB 3VTTA 1MXDA 1NAMH 4OZHB 4QAWA 1MG2C 2W1NA 1NGYA 1CGUA 2QDVA 4OFKA 4LCCC 1ZPUA 4BXSV 4AGLA 1YDPA 4KKAD 4GKNB 4ZBJA 3UJTH 4FTDA 2FJFA 4Z77B 4O00A 3MLTA 4UQ2B 5AAPA 4D94A 3TVMA 25C8L 2PP9A 5C71A 5CGMA 4XAKD 3QNFA 4OVVA 4XMLL 2ED8A 2FLRT 4Z7WA 4CL7A 2GSIB 4G5AA 3P4NA 1I1AC 2AV7A 3BVXA 2APXA 4JRLA 4LCVA 2BVOA 4KK5C 1QMUA 1QNZH 4IOSD 3CTTA 2NR6A 3UTTB 1AZRA 3WO3B 1W8EA 3N41B 4LVOC 2CDGA 2VLLA 4DK6A 3F5WB 5LDSA 4P5KA 3VDCA 1OARL 2EC9U 5L8KB 2GSMB 1Q9WA 2E27L 4LB8A 3OXRA 3SDAC 1F4XL 3K2UL 5CP7B 1G7LA 1MKFA 3B2UC 1HZLA 5I0WA 5MENE 3QFGA 5L2KE 1BAGA 1EFXD 2VN3A 3BO8B 3P2DA 3MGOB 3TGXA 5IGXH 1AFVH 4PJ7A 4N8PA 3EAKA 4JZNA 3SKUD 4FFYA 4MX7B 1Z3RA 4M3JA 1BMWA 2NY1D 1H9VA 4PW3A 4XCEA 4HAFA 3QUYB 3KS0J 1L0XA 1FAIL 2CSPA 3VFRB 1T6WA 5DK3A 4HJ1A 1JHLH 1FE8H 1MCPH 3RFZA 2V7NA 4FG6D 3FPYA 1DYZA 5I1KH 1O6VA 4XN1A 5KVFE 5L9DL 2DKUA 2BIOA 4H2AA 4DCQB 1N6UA 2L8AA 2BW5A 2PPDA 2AK4A 2XN9E 4PHXA 3KW8A 5I73C 2ZPKL 2MNUA 1Q1JH 3V2AR 4D9LH 4AIZA 5IWLA 2IALA 2AXGB 4ONFL 1QRNE 2HJKA 1AQDA 2PW2A 1O7VA 3GT6A 4E5XB 4QRRB 2A6DB 3L4WA 3PHAA 3VVVA 2VW4A 1TTUA 1T0PB 2HJLB 4W93A 2C9QA 4XB3A 4YFLF 5AB0A 5JA8B 2E7CA 4PYHA 4JRYD 2IH3A 1KLFB 2WSPA 3TCTA 2F5BL 1E27A 4B9GA 2KYIA 4BK8A 1HWHB 5CS7A 2VC2H 4PGCA 3K1DA 2EH8H 3UTPD 3A6BL 4HUUB 1RIHL 1S7XA 5IHBA 1CT8B 2OMVA 4O4YL 1OCZB 2EIBA 1X9QA 3O2WL 4YHPB 2P26A 5HDBB 3BAWA 2ADFH 2VDRH 2XWBB 1T1YA 3DI3B 3HI5L 1ETZB 4UOW0 5IROA 1TTCA 5GS0L 2CK2A 3M7OA 2ZYIA 1YEFL 1OQOA 5A2CA 4P2OB 3EHBD 4PBDA 2WJ5A 4JM2C 1EH9A 3ARRA 3MUHL 4MJJA 5L88L 2FECI 2OYLA 3NTCL 1BECA 4EKJA 3A47A 3GJFK 3TYGH 4K7FA 5DEGA 1PIFA 2QQNL 4FL4C 4MD5A 4P2RD 1UWEH 1GAFL 2A9ML 3T4AA 3V8OA 4WU5B 2DF3A 3OGOE 4UF7C 4L23A 5EOCH 3A4DA 3GTNA 4Y5XB 3ARED 1NGWA 2JKIS 2X1QA 4JRXD 5DUPH 3FOMA