3AUWB

Cytoplasmic domain of inward rectifier potassium channel kir3.2 in complex with cadmium
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
175
structure length
175
Chain Sequence
b'TLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium inwardly-rectifying channel, subfamily J, member 6
publication title Inverse agonist-like action of cadmium on G-protein-gated inward-rectifier K(+) channels
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 29
structure length 175
sequence length 175
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3auwB00
3ATEA 2GIXA 2WLJA 3AUWB 2WLHA 3SPGA 2WLIB 1P7BA 1XL4A 2WLIA 1N9PA 3ATFA 4KFMA 3JYCA 3AGWA 1U4FA 2X6BA 3SYOA 3K6NA 1XL6A 4LP8A 2X6AA 2WLMA 3SPJA 3SYCA 3ZRSA 3ATDA 3ATAA 3SYAA 1U4EA 3AT9A 3SPHA 3VSQA 3SPIA 3ATBA 3SPCA 5KUMA 3AT8A 2WLNA 3SYQA 2WLKA 5KUKA 2QKSA 2WLLA 2WLLB 3SYPA 2X6CA 2E4FA
chains in the Genus database with same CATH superfamily
1NDMA 2NXZB 1L5GA 4JDZA 4OF5A 1C5DB 1X9LA 3GJEA 4U3XA 2ZSWB 1EHNA 1QLEH 1E5UI 4OH2A 1UWXH 2HFFB 5DQ9A 2P47B 4APXB 3D18A 3QGVA 2OX5A 4JN1H 3W9EA 1NSNL 2QSQA 3ZT7A 1W6LA 3B6SB 5C2UB 1R0AL 4HMDA 2HJLA 1N6QH 5CJOL 1RURL 1I82A 3N41B 1AGCB 1PIGA 2FD6L 2KL6A 3QUXB 4X6BA 4BDVB 5D7HA 3EYFB 4IKLA 4LDCA 4D9RD 4LFHG 5F1IB 4ZUTA 2WB7A 2DI9A 4TLTA 3CN2A 4PWKA 1Q9WB 4F15C 4Q0XL 5DVKA 4MBOA 4AVIA 2GSGA 1CLZL 2A0LD 3L3OC 3UROR 5IKCB 2IC2A 4KJWD 1BD2E 1QW8A 1EZLA 2BIMA 2DKUA 2F58L 1DQJA 2FGWH 4WU5B 1MCWM 5KEZA 5MHSE 5JIQA 4NXSA 2XOTA 2FBRA 5TQ0L 2ZCKL 2OTWB 4HWZB 4JG0L 2HRHA 1SPDA 1X9RA 5A16A 4ZD3H 1Z9PA 4S1RL 1WZKA 5KZCD 2B59B 3G6AA 4KDVA 4DK5A 2EDRA 3NACL 1ZWIB 5GGSA 2XG5A 4LSPL 1MCKA 4LVEA 4M62H 1NINA 4NUMA 5EMYA 5B3JF 1R5IA 2A0LC 1U3NA 2G2RA 2V3DA 4PBDA 3NTCL 4FF9A 4KJWC 2XDHA 1ECYA 4KKAD 4HZ1A 1DQKA 3JTSA 3QDGB 1Z3GH 2KDYA 1XX9C 3UADA 3S34L 4BA8A 2DKMA 2WYZA 1UJ3C 4I3SL 3NJGA 1RLBA 1XBRA 4QHLA 4L8DA 3CXFA 5BNXD 1G9EA 5GS2H 4NERA 1A5FL 4M1DH 3TNMB 5C9KA 3H9SA 5DXWA 2WQAA 3GSQB 2V9TA 4JDZB 1H0DA 5AVVB 3GJEB 4PCTA 1XH1A 2W07B 3MKKA 2VR6A 1S3RA 2VCOA 3ABGA 5MEPB 3K6DA 2XUWA 3R06A 5DQ9B 1HCVA 1MCPH 3D18B 2N7BA 2P80D 3L9EA 3ZW3A 5IW1A 1AQKH 5C92A 4KKAC 3V95A 2OX5B 2KLSA 5F7EH 1BF5A 2IH3A 3W9EB 2NY5C 2WWKO 3CSPA 4U6XA 4LU5L 2DI7A 3VSQA 3GYRA 2AXJA 3FH5A 3QEQA 2HJLB 4UT6H 3WEXB 1BBJA 1A9EA 1DFBH 1JZ5A 2YGQA 3RP1A 1IBZA 4X6BB 4WWKD 5F9OL 2K6WA 1RUQH 4I13B 5F7FA 5EOCL 3AWFA 1UTDA 2IPKA 3GDCA 1RMFL 1INDL 4RQQA 1OANA 1QMUA 1NCBH 2YBGA 1TQTA 1FYHB 1IC5L 1JI2A 2Q5BA 5L4FA 3VX1A 3FUNA 4LVNB 4ODTH 4G3YH 3OMNB 5BRZD 2DQTH 3O11B 1DQJB 2N3JA 1MFAH 3NABH 4MCYA 4LSRH 1IGIL 4K94L 2DJSA 5DFTA 4N2HA 5DHEA 1CXKA 4K7PX 4WWKC 3C6SA 2V9UA 3MRBA 3EFDH 3OZ9L 2KKQA 1WAAA 2YLKA 4PJ5E 2CHXA 4OZGE 4WJG3 2MOVA 2AZAA 3K5RA 3G6AB 2ICES 3SE3A 3C8HA 4NZTH 2MPAL 3WS3A 1MCOL 4XT1C 3VJ6A 4PEEA 3LZOA 4IKKA 1E5YA 1Q0YH 2GPZA 4DPCX 2D7TH 3VVWA 1H9DA 2XG5B 5FGCE 2H0PA 4ALAC 1P9MC 2OZNA 1XTLA 1R5IB 1PZCA 1MCCA 4WFED 4W70A 4C4KT 5BXFB 3CVHA 3MGOA 3VXNA 3ZE1F 3F05A 3JTSB 4R4BA 4H8PA 4OM1L 1W72A 3UJTL 2B9AA 4FL4C 4QHLB 5I6MA 3JZ7A 3HE7B 4MZ3A 2F1EA 4NKIH 4FCHA 4XBGA 3PDOA 3BYTA 1HCYA 1MOEA 3H9SB 2VLKB 1LE5A 3T2NL 1H0DB 2F08A 5A1AA 1LEIB 1JPST 3QR2A 4UTAA 4XAWL 3CZGA 3T08A 3Q9QA 3R06B 1AO7D 1UXWA 2AQQA 5KVFL 1EO5A 1G1YA 5IW1B 3ZDZB 1NIAA 3QAQA 4AYID 4RAVA 4AXWA 2Z64C 2IH3B 3ULVH 4U6XB 4YDNA 2IG2L 3LIZA 5F9WB 3ZMRA 2YGVA 3QEQB 2A6JA 5I6XB 3HPJA 5FS5A 1BBJB 1A9EB 5CCKL 1SDYA 2OJEA 2IDUA 1OAQL 2J21A 1E28A 3MLXH 2UXTA 3EH1A 3QYCA 4NC1E 2P8MA 4Y9BA 2PW1A 4P23D 3EFOB 2GIXA 1ACZA 1YN6A 3RY6C 1HSBA 4RQQB 3DOIA 1AHKA 5D6CB 2XVBA 2XZQH 3NCYP 3Q9PA 3R19A 2FBOJ 1Z0MA 2FX8L 2YMXH 4MB1A 1EEUA 1UA3A 4NZFA 4YXLL 2NZ1A 4RGMB 4UAOC 1BQ5A 2AABL 4MCYB 3WTUA 4QHNA 1MRDH 5D7IF 2ZTBA 4GS7C 4TUKH 5DHVH 3C6SB 2P48B 2VC2L 2R23A 5D1ZD 1HHJB 3FT9A 3PDGA 4P23C 2HMID 5KANG 4CVZB 4X4YA 5B39G 3WS3B 3SD5A 7FABH 3S88L 3W5MA 4QUOA 2QPEB 3MAWA 3LNIA 5EWIH 1UVQA 2WUCL 4LCVA 2DQGH 4MDIA 1RPQA 4LPUA 3MGOB 3VXNB 4GUCA 3TBVA 2JNZA 4R4BB 2PTVA 5D1XD 5H94A 1W72B 2BP5M 3MV7D 4HWUA 5DT1L 5E9NA 43C9A 1H15A 5KS9F 4RFNC 2Y22A 5D1ZC 5HGHB 1B4LA 4XBGB 2ZCHL 3PDOB 2HMIC 2DIBA 1TO4A 3ARBA 2WK2A 3V0AC 1XWVA 4TYUA 2X9XA 4QKTA 3MZTA 1LE5B 3A6OA 1UOWA 1XSIA 1KGXA 4LASH 3JTTA 4PRHD 1FVEA 1UXWB 4HBCL 3UBXG 5C2BH 3S36H 4JGMA 4NN7B 1DLHA 3WENA 4ZFZA 1J1OH 5D1XC 1DJXA 3ZZ1A 5I1KL 1HKFA 3TH2T 2VDLH 3DI2B 4I3RH 2A6JB 3HPJB 3VI3F 3NSJA 3NZSA 3LH2L 1E28B 3OPUA 1ORSB 1OSYA 3TXAA 6PAZA 1OAKL 4F9PA 2PW1B 1A66A 1AQMA 1JPGB 1RIHH 1SDAB 1U2YA 1MIMH 1S9XA 3GXMA 5EBWA 1NC4D 3IETA 1EJ8A 3CFMA 2SODB 2IBZY 3MI6A 3SE4A 1RQ5A 4DGIL 5FM5M 4ZFGL 2XZAH 3BESR 5D7LD 2LFEA 5A7BA 3KWUA 3RHWK 1F8TH 3K6NA 3P1VA 5T33L 3WY3A 3G5XA 4BUGA 3VFRA 5IZ7A 4QHNB 4LGSB 5CCJA 4PJBA 4TNEA 1SM3L 2R29A 4JMXA 2OR8A 5DD1L 2R23B 4M4RB 1AYRA 4IEFA 1DBKH 2ZX7A 4KU1A 2YQ3A 4X4YB 4Y9CA 2VSDA 4FQ2H 4WI7A 1GPOL 4AGMA 4MDIB 1NBYA 4MRCA 3UIZA 2X4QB 4XBEL 3TBVB 4F2FA 3GBNH 5H94B 43C9B 3OZLA 3V52L 1H15B 5E9DD 3U7WH 2IGFH 3QIWA 4FJZA 5TDPB 1WEJL 2IO5A 3A67H 5HBBA 3V6ZA 3WFCL 2XY2A 3VNZA 3ATEA 1UD8A 4MNQB 2CKBA 4QXWA 5EZJA 4Y5YA 4M9PA 3VXTB 3QZWG 2EILB 4Y8AA 2OMBA 3JTTB 2WZPD 1FVEB 1I1AC 4YSDA 5DUBA 5I6KA 2XETA 1TNNA 2VN6A 1DLHB 4ZFZB 5EOTB 2CAKA 1GGIH 5BS0D 1MCQA 4FG4A 4FNPA 4UQ2A 4U7MA 3ARGD 2PPEA 1KLUA 1BXAA 1AZRA 4HIJA 1G7QA 1TZHA 2KH2B 5EF3A 1TDQA 4PRPA 2VDKB 2QZ5A 1AC6A 4L4VD 3H9SE 1S9XB 4HIHA 2EDXA 5EBWB 3IETB 5KG9B 1JE6A 2BSED 1RZIA 4IW4C 1VFMA 1CGUA 1J9RA 4ECNA 1X7SA 2JI3A 5SV4A 4DVRH 3D0LA 2BNQE 3GZKA 3G5XB 3VFRB 3FTWA 4MQTB 4NX0A 5FW6A 4JO8A 4PJBB 3QEQE 2DJ4A 3VU2A 1WIOA 1GYVA 4HH8A 4KK5C 3UP1A 4YMPA 3F64A 3TLRA 4I77L 3X1EA 5FYKD 1E9PA 4IEFB 5PAZA 2AK4E 5FK9A 1S2EA 2GK2A 4HLZH 3ULVC 3KL3A 4E0RB 4CILA 2ZWLT 3HRPA 1D5XA 3L4WA 3G6DH 3WI9A 4HG4J 1L0XA 4N8UA 1V05A 2FEEI 4ZZKA 5AYUH 1TR7A 1QLEL 1NBYB 2VLRA 1P2CA 4W68A 1AZVA 4P4RA 2EXTA 2Z31A 4JN1L 1ZLEA 5CD5D 1IX2A 1F6LL 3QIWB 5HYQA 3IDIA 9CGTA 4PJFF 1N6QL 3CZKA 4N68A 1WAAE 3TN0B 2CKBB 2CE6A 3PJNA 3CMGA 1OGSA 3BUPA 3P9MA 1YNTF 3S4SG 5DUBB 2VZVA 4HISA 1F4WH 1G7PA 4PJ9D 5CR1A 3ROLA 1L7IL 2ZOUA 2QPDB 1MRCH 2K3HA 3TM6A 1KLUB 3RIFF 5CD5C 4HIJB 3F58H 3EYVA 1TZHB 2PPCA 1S7WA 1ET7A 3QPQD 2FECL 4RSYA 4YBLB 5IOKA 4PRPB 2CMRH 4XNUH 1TQBB 3BXNA 4HIHB 4ZD3L 2J3SA 4YL9A 4KJPD 2OAAA 3CN3A 4PS3A 4O2EA 2EUXA 1CCZA 4A66A 4H13C 3BVXA 1EFXA 2N0MA 3DX0A 3NAAL 1BZEA 2YPVH 5HYIA 4M62L 3D0LB 2ICWI 5L6YH 3T0BA 3ZYIA 2RALA 3QRFM 4J4PD 4CKQA 4KROB 3AITA 3N50A 2X10A 3QPQC 5CUSH 4N85A 3RIFK 4JN2A 1KGIA 3T77A 3UGEA 3T0EB 2UY7A 4J6RH 2Z8WC 2J88H 1L3WA 1M1SA 3VACA 4M8VA 4M1DL 4LCWD 3FCBA 2YKLH 2WSKA 4X9HA 4TUOB 3U1SH 2OS7A 1M6OA 4H0HB 5LBSA 3ZL2A 1J5CA 2VLRB 1P2CB 2E6QA 2IH9A 5I6LA 1MCPL 4DEUA 3GBDA 2D0GA 3EOBB 4KNQA 2SEBA 5D93B 1C12A 5F7EL 2Z31B 3F7YB 5HHXH 3EJYD 3TASA 3NDYE 5HYQB 2IH1A 1HSAA 3IDIB 4BK8A 4UT6L 3VFMA 4AX3A 3L6FA 2OJZH 4J3OF 2AQSA 1JNNH 1RLWA 4WTXA 3ZZLA 1CPUA 2F7PA 3LH9A 4ODXA 5ALCH 1A25A 1YMMA 5EDXA 3FTVA 2D0FA 3RAJH 1A2YB 2OXHA 1RUQL 2Y7SA 3P9MB 5JW4Q 5MI0C 2XV3A 4MJHA 3E2HB 3BKYL 3AG1B 4U3SA 1JHLH 4Y1AD 3ROLB 2KHAA 5F7UA 3MUHL 5I23A 4WFGE 2H6OA 2GVYA 4J28A 4B41A 1CLVA 1A9BA 3AQYA 3QZWB 4M6NH 3T4YA 4EI0A 1GY1A 1WA1X 5JIIA 4G3YL 4GRWE 3EJYC 4N8VA 1I7UA 2DQTL 5EPMA 1ZTXL 4LE8A 2X87A 2HLFC 3NABL 3V0VA 2ZKMX 3GF8A 4LSRL 3VWJD 5BO0D 5F7DA 5ADPH 1N8ZB 3V0JA 1GYUA 5BW7A 3BXNB 3EFDL 5HYJA 4P5TD 5D70H 4IGBA 1BZ9A 2AJUH 4BFJA 2YWZA 4O2EB 5HGBA 1D5BA 2Q7NA 3MCKA 2BWDA 1IU1A 5C0DA 1Q0YL 2D7TL 1EFXB 1GTFA 3HHSA 4KDTC 2OMYA 5LUMA 2O93L 2Z8SA 2YD6A 1UD3A 4GMTH 3RWIB 3MODH 1RJLA 3GJFB 4NYLB 5FM4A 4OZFH 5D1QA 1EDHA 3VWJC 4HUXA 4JN2B 4LLWA 4OQTA 5DZAA 3T77B 2UY7B 4WWPA 1P6AB 4NKIL 5GZOD 1AHWA 3O0LA 4P5TC 5CP3A 1LHZA 2OYPA 2ZWSA 5GSVA 1YZZA 1JTTA 1KJ2H 2RJMA 2I07A 3JWDH 3FFCD 3DV4A 2VXQA 1M6OB 2EDKA 2VDQB 3BP5A 1XL6A 3QIUA 3NIFF 1U8OB 2J5WA 4N1EA 5CIPA 2VDRH 4RH4A 2X12A 2SEBB 1DBBH 1XF3A 2UZPA 3IXAA 1C12B 4AYEC 3NCBB 3ULVL 4AYMC 4Z3GA 4L1BA 4PJBE 2IH1B 4GFTB 3NIGF 3VFMB 1UEYA 3L6FB 3FT1A 3M88A 5EO1A 5GZOC 4ODXB 5MEND 1TVDA 1YMMB 5D2NA 3MLXL 3SBWA 2OXHB 3QORA 4OD2A 4NQCA 3CQPA 4U3SB 1IEHA 3OSVA 3N43F 1OHZA 2XZQL 4YHLH 1A9BB 3VXOA 4G43A 1KNOB 5SWSD 3T4YB 2YMXL 3BPLB 4F27A 5FO8A 2ADJA 4GIOA 3FN0H 2UXVA 4N8VB 3L8QA 4MRBA 4PH8A 1I7UB 2A77H 5EPMB 4OIAA 2CGZA 3TF7C 3KL0A 1ETB1 1OF0A 4MJID 5F7DB 2K3TA 1MRDL 2IBZX 3C8KA 3NPSC 4LMQI 3H42H 4AZ8B 3RDTC 5HYJB 2JB6A 1PJWA 3VCLA 1T6VN 4IGBB 1BZ9B 4KTGA 3QI9A 2A73A 1D9KA 3O3AA 4V11A 1BV8A 3MCKB 4HDIA 5C0DB 1WTGT 1U8HA 5CJXA 3HHSB 1JGEB 1NUNB 2OMYB 3QNYA 5EWIL 1H6TA 3QUYD 1NCOA 1TYRA 1KFGA 1N7MH 2DQGL 1T0PB 4LAQH 5AVXB 2CCVA 3P40A 3VGHA 1P7HL 3D52A 4Q97A 1RJLB 3F6IA 2VSCA 5D1QB 4A2LA 3X3GL 4LLWB 1PG7H 2YZ1A 4PRPE 4U2YA 3TT1H 4OUOA 2ZQKA 3QUML 1EAOA 4Y88A 5DZNA 4C8XA 1UA6H 5GSVB 1FLRL 5D8JH 2I07B 1JZIA 4N0RA 4NAMA 3DV4B 5CEZL 4LASL 3QIUB 3QUYC 2AJ3B 3ZKMC 2WMPA 5CIPB 3S36L 4POZD 3DXAA 1XF3B 5IP4A 5JHMA 2EO9A 1X5IA 3A0OA 4RMRA 4MNGA 4I3RL 2XBTA 1SJHB 4JO5A 5EA0H 2WO2B 3ZK0A 3CC5B 2D4DA 2HVKA 5EO1B 3EH4B 4NS0A 4ODVH 4N6RA 4TQIA 1DQLH 4GG6B 5D2NB 5LXVA 4HH9A 1RXLA 3QORB 5CBEA 1RIHL 4M61A 4XWOD 3OLEA 2OFQA 1F4XL 3ELQA 4BE6A 1PZ2A 5J13C 3S37H 1FCCA 2V9QA 2A6KB 4Z8FH 4POZC 4CRPA 2XZAL 1F58L 2VLRE 5JHBA 1E5ZA 3VXOB 2CQVA 4LSQH 5FO8B 1TETL 2VQUA 3SPIA 2EC8A 5KAQG 1OARH 4AK1A 5GGVY 4M4PA 3FQWB 4FEMA 3QRBA 1HHKA 3ZGHA 3QC5X 5LAPA 4OGYH 3H4FA 4FZEL 1WFTA 3VCLB 3F12A 1DBKL 3A4EA 4XWOC 3FBQA 5EUOA 2A73B 1D9KB 5ICZA 2EEAA 4N2KA 1DVFA 5FXCH 5C09D 4HDIB 3RGBA 4AE1A 3IPEA 2BCMA 3V4VA 4FQ2L 1KJVB 1B2WH 4FOMA 1VFAA 3QNYB 3U79A 2ZXQA 4OCRL 4AGPA 3EYSH 3JYBA 1MXGA 3BP7A 1SEQH 1T7ZA 1EBPA 4GFXA 3GBNL 1P4IH 1ZJAA 3QA3A 3IAQA 4JFSA 5FHBH 2ZKHH 3HAEA 2A4ZA 2ZXGA 2P8LA 3VG9C 5J9PA 1HOCA 2DM3A 1MFMA 1AQ8A 2NX5D 5DVPA 3A67L 4KY2A 4YZFE 1AG6A 1MCBA 1E40A 3JZYA 3V6FA 4PJ8C 1GGUA 1PD6A 4XRCA 1OTTC 5EORH 2YD1A 2YD2A 3AG2B 4UI2A 1QOKA 1A7BA 4NNXA 1MCIA 3V4UH 2YRZA 4JFED 5EU7C 4F7EA 3FB6A 1TTGA 1GGIL 2E76C 1CIDA 1U33A 3UYOD 4R0LA 3HG0A 4W9IC 4MNGB 2B08A 2DI8A 1DVZA 3D39D 1J9TA 1KYAA 2QDVA 2CLVA 4JRXA 1QASA 4N6RB 4K9EH 3R4RA 4HH9B 4ZOAA 4M9OA 3APMA 4M61B 1UADC 3G9AB 3QJXA 1B4JH 2R15A 4N0UA 2X05A 1HL8A 4XVSH 4AGQA 2NNFA 3D50A 2BOLA 3W39A 2LLGA 1HVXA 3MOQA 1YEDA 1P5VB 1ZLWK 2VWEE 4OT1H 4DVRL 4L3ED 5B4MD 3NZ8A 1HHKB 4PFEA 1JRHI 3JWDC 5ID0A 3OD3A 1OCOB 3O6FB 2GFBA 3K91A 4Q6IA 4BZ2L 3F12B 2NY6C 4FG0A 1MAJA 4NHCH 4ZI8A 3TH3T 4LF3A 4J3OH 4QNPF 1DVFB 2JKIS 3TBTA 1T7YA 4MLIA 3V4VB 1Y6KR 3EO9H 3IJEA 1VFAB 3BQUD 3G6DL 1K5NB 1WC7A 5AYUL 2BLFA 3QUZA 4FQPA 3STBA 2VDMH 3BP7B 5B4MC 5CN3A 1WA2X 1IARB 3UTZA 4JZOA 4BZYA 4Z78A 2J25A 3HAEB 1HXMA 3ARWA 1EGJL 2P8LB 3MLVL 5J9PB 1HOCB 2BSRB 2DWDA 2W1NA 5T1MA 1TNMA 4KK8D 5HYJE 3OG4B 5F6HJ 2BP3A 3ET9F 3V6FB 1FIEA 2LFGA 4B3EA 4TQHA 3KYNA 4XRCB 4KNSA 2H1XA 4YHMH 1ROWA 1YAIA 2KMWA 3BQUC 4BE5A 5C0RH 4BCZA 4NNXB 4XVUC 1F4WL 3WUWG 1T80A 1N19A 2IPUG 2XQ0A 3FZUD 4F7EB 1MRCL 3FB6B 4NNPH 1PLBA 1OF2A 2BC4A 4R0LB 5BUAA 2X1XR 3MRMA 5J1SC 2WLYA 5D1QE 3F58L 4Z95H 3WIFB 1UFUA 3MBWA 1IE4A 4ABVA 4JRXB 3WNNA 4HLJA 3IBEA 4MJ6A 2P24A 2CMRL 3UBGA 3UO1H 4YPJA 4XNUL 4U1HB 4WI0A 4N0UB 3ZDYB 3DHMA 4EVNB 5K1JA 5LCVH 5C1MB 1IT9H 3IU4H 5AENA 3FZUC 2VTFA 3QWQB 3W39B 5AD0A 2GW5A 1YEDB 2YPVL 1CDYA 2JKXA 3ZKXB 1F02I 1KN2H 5L6YL 1OO2A 1KCUH 1BVLB 2XN1A 1PY4A 4XNMA 5ID0B 1JRHH 1MHPL 4D8PB 5I19H 4UQBA 5CUSL 4Q6IB 2GFBB 5EZOH 5HHVH 5D2NE 5JPMA 4WEBL 4J6RL 5SWZD 3CHXA 4IDLA 2J88L 4LF3B 3K8LA 5JR1H 3TBTB 2HG0A 2XC8A 4NQCE 1OLZA 1I4FB 4KX9A 4XP1H 1MFDH 3K4AA 4OKVB 3IJEB 3GLDA 2YKLL 5KSBA 3VGDA 4NXKA 3DX1A 1WC7B 3HB3D 5AW9B 3U1SL 3QUZB 3M1BA 4RA3A 4QPEA 2FEEL 2L04A 3ZT5A 4C83B 1E9QA 4QHMA 3UTZB 4JZOB 1K6QL 3T6QC 1JOIA 1KYFA 1B3JA 4U1NA 4BELD 4CC1A 1J8HA 4Z78B 1A21A 5C0IA 1HXMB 3BZEB 1FZJB 4XCFH 1JF5A 2IAMA 2DWDB 3ETTA 4AZUA 5FO2A 3T1FA 4GUOA 1JNNL 4CGTA 4NBZB 3GIVA 3Q13A 5ALCL 5BZWA 3RAJL 3SB3A 2ZKYA 1A7RH 4L2YA 4LPCA 2NY0D 4KVNH 1RHFA 5F6IC 3STLA 4BM7A 5E08H 1PJ9A 3HB3C 3UL4A 4HCFA 1KBVA 5F2FA 1SUJA 2O6DA 3UTTA 2RFXA 4XODA 1OF2B 2BC4B 2CIIA 4M6NL 4KZ0A 3MRMB 2FHCA 4LIQE 4RDQG 2OL3B 4NO0B 4GQQA 1J87A 5TTRA 3VO0A 5KVEE 1TTFA 2Q0ZX 3B9KD 1I9RL 3MBWB 4WO4A 2BSTA 4WZ9A 3SDCD 4MJ6B 4FG6C 2P24B 3MJ7A 3H3KA 3GUFA 1S78C 5ADPL 4XVJH 5DO2D 4WI0B 3G5WA 4QXGH 2NY0C 2WVUA 3MRFB 3SN6N 2YUWA 2A74A 2K7QA 4OJAA 5D70L 3SHSA 5IMOB 4Q56A 2AJUL 2YD9A 1MRFL 4ANKA 1M56B 3FO0H 5AD0B 3DXAE 3CK0H 3O9WD 5T1KD 1JFQH 2FLMA 1IIIA 4HWBH 4WV1C 4ANXA 3R0MA 1I3GH 4MNGE 4GMTL 2X2HA 1R47A 1UM4H 1VGEH 1WS7A 1CJYA 2J43A 4XNMB 5ACMA 4ELMF 3SDCC 4OVUA 5E2UH 3PE9A 4DCQA 2RQEA 5JPMB 1B90A 5L9DH 5DO2C 1JYXA 3BHBA 3DVFA 1I1YA 4WJ5B 3N3EA 4XNQA 1TPXB 2FUTA 4ZMOA 2D8KA 5KSBB 4NLAA 3F7PC 2FL5A 2VZUA 3UPAA 1Y1UA 1L0QA 2M1KA 3M1BB 4HOMA 3MOBH 2ZAGA 4QHMB 2VDRL 1PZDA 5C0IB 1DBBL 1K85A 1J8HB 1Z9MA 2MQGA 4J3OD 3PREA 4PJIF 1CDCA 4GKNA 4OFYD 2YGNA 1PNDA 5ISZB 1U8PA 2ZWNA 3S35X 3ABZA 3VD1A 1KC5L 3PRZA 5EUOE 5BZWB 3WTWA 1KB5B 5FECA 4GSXA 4G6ML 1QRND 1XR9A 2VMFA 3TVMD 5JIKA 3BCDA 3LD8C 3VXSA 2BNRD 3WGUB 2RFXB 1CD0A 2DMHA 2Z1PA 1MVYA 2CIIB 4U7KA 1SFDA 4YHLL 1HAWA 2IOOA 1RD6A 4I3GA 4J3OC 1JNJA 3MX0A 4QHUA 2A77L 2GJ6D 3WUWB 4WO4B 2BSTB 5HHMD 4J3XA 2PWGA 3MJ7B 2IWKA 2WXFA 1HZHH 5IT2H 2WLIA 1TJMA 3H42L 3JYCA 4JVWA 3CSGA 2A74B 2LR4A 4FYSA 3QDMD 5IUCA 3QH3A 3C09C 2UWEA 3K72A 4R97B 1TJGL 4WNJA 5HGAA 3DETC 4M48L 3V7AE 3M1CA 2OTUA 3CAFA 4LAQL 2C3XA 1N7ML 1C8PA 3SO3C 4LPXA 1EO8H 2YEQA 3BT0A 4FFTA 2HFGH 1A14H 1ZLVH 4B9FA 4KFZC 3VXRD 4JRXE 1SVZA 3KLAB 1NGZA 2WZ5A 3BHBB 3N1FC 4NUGH 3TT1L 5CD3A 1HILA 5DMJB 2E5EA 5DEFB 3QFJE 4X9GA 1KTDA 1U4FA 1I1YB 5KSAB 3P3SA 4YBQD 1CGXA 1UA6L 4N0UE 5D8JL 3U30C 2ADFH 4MAZA 2FL5B 5JYMA 2YARA 3L3KA 1FFPA 1JGLH 1LMKA 3GS0A 5AOZA 4C56A 3WXVH 3DV6A 4LLMA 1HEJC 1FJ1A 1QHPA 3RJOA 4ZSOA 2TAAA 5DUJA 5BVJA 1S4IA 4GKNB 3RWCA 5EA0L 4F9LC 4BSVA 4WKXA 4ODVL 2MFNA 3MO1A 3BE1H 1JZFA 1DQLL 4LHUG 1MQKL 4YBQC 2VKXA 1KEMH 2QHLA 1FE8H 3N1PC 3L5WA 1F2QA 3DARA 1VSCA 3SBQA 2QFRA 5FECB 3RVUD 1XR9B 5DRNA 3S37L 3SDDA 5KVDE 2C3HA 4KTYA 3VXSB 4ERSL 4K7PH 4Z8FL 2BVYA 3CMOL 5B1AB 4LSQL 3HIZA 5DI8A 1I9IL 3MJ6A 4TTDC 2BK8A 2V5RA 1OARL 4OGXH 3MX0B 4LVOC 5J89A 1M6UA 3VFPA 3WFEH 4ZNCD 1M7IB 5DMKA 4OGYL 2NY1D 2EDQA 3QDJB 1GYWA 1DO5A 2WLIB 1WZLA 4FJYA 3SEPA 2XN9D 2ZUWA 1OE2A 3JQOB 2ENJA 4GOSA 3LJ3A 3RVUC 3S2AA 1C7SA 3QH3B 2UWEB 3W2DH 2EVFA 3NEEA 1PLGH 2IEPA 2XACC 3ARUA 2NQ3A 3K72B 1IM9A 4LDOB 2MWCA 4ZS6C 4I85A 5HGAB 4XPBL 5T3ZE 1BF8A 2OTUB 5F9DC 1VHPA 3D09A 3EYSL 1TYEB 1KIRA 1SEQL 4Z18A 2J44A 4LO9A 5JPNC 4R7XA 1P4IL 4X9FA 3IBOA 1CL7I 1COBA 2ZKHL 4QOKA 3RX7A 2NY1C 1TFHA 4YVNA 3JWNG 1SY6A 4G6AD 4AENA 1NGZB 3WLBA 3WJLA 5CD3B 1NAML 4QO1A 1KTDB 1PBYA 3DUSA 3UJJH 3UMNA 4U33A 3BVUA 4FN0A 5EORL 3LDBB 4DHLA 5MHSD 3LHPH 5KVGH 1W9XA 5TDNA 3LNGA 3UZEC 2XN2A 4C56B 3AT8A 1Z6JT 4YK4C 3V4UL 3DV6B 4LLMB 3T2LA 3HE6D 1FJ1B 2IXQA 4ZSOB 5BVJB 1RZ8A 2APVA 3DJ9A 1MY5A 4M29A 4G6AC 1FN4A 3RWCB 4JQXA 2PLTA 4LPVA 2K9UA 5I1LA 2KLTA 4EEEA 1A6WH 3MNDA 3MO1B 3MV01 5FCUH 4EZKA 4K9EL 1Z9NA 1UD4A 3GMQA 4G6KL 1QSFA 4KRPD 4KHXH 3EBGA 3L5WB 4WSGA 1W8NA 3GLAA 1ZK5A 4OLXH 4FXTA 3ZQ9A 5DRNB 5KSBE 3SPHA 2OKMA 4LCIL 1B4JL 3SDDB 2Z65C 3JV0A 4QAMB 4S1QH 1ID2A 4QRAA 4F58H 1KY6A 5F8QC 1M42A 4K71B 1BYNA 4D9LH 5DI8B 2YOCA 2E6JA 1BJ1H 2C1OA 4PJGB 3ZZSA 1CF1A 3ML8A 1FORH 3T4AB 1TZ8A 3VFPB 3O2WH 2R4SH 1CXLA 4IJ3B 5DMKB 4G7YH 5IB5A 1E50A 2W0FA 4Y4HA 4XN7A 4HJTA 5TF1H 4Y19A 4KRPC 2I60H 4E41B 2QGEA 4NHCL 4X6DA 5AKVA 4GSDH 3D87B 3SGJC 4Z0XA 3NGBC 1LJMA 1RUAH 3EOAA 4X7TA 1IM9B 3SQBA 1FO0H 1W15A 5INCA 4ZXBA 3EO9L 3VRLE 4KI5E 2AJXH 3UTTE 1XGRA 2G9HA 5E8NA 3NSFA 3DJTA 1A0QH 1KIRB 2VDML 3FUKA 4Y1SA 4XO4A 4XCCL 4EI5D 1RK0B 1OCRB 5L4JA 2AMGA 1QW9A 1CL7H 4ETYA 1XGYH 3T8XA 1V7MH 3WLBB 3AQXA 2B2XL 2HP4A 1INEH 4FDWA 4PAZA 1CICC 4QO1B 4PJEA 4JM2B 2DWTA 3DUSB 3AXHA 2Z35A 4JG5A 4LRIC 1M9WA 3A24A 3TC9A 3APDA 2JIXD 3ZY7A 4YHML 3DDGA 3HEIB 2VN3A 4KRNA 1NEZA 5TDNB 1DJWA 4ATWA 2DYPD 3N44F 1KYOK 4EI5C 3VFVA 2B0SH 1T5XB 2J4WL 3KVQA 3PWNA 4NNPL 4TQ8A 1XO8A 2XJLA 4NPKA 1RZ8B 4Z95L 1XIWD 1FN4B 4AW4A 4X98A 1YC7A 2JJTA 2ZYHA 5I1LB 1EWHA 2HLAA 4K7FA 1UUNA 4MQ7B 1QATA 3GMQB 4HCGA 4YHYC 2BIIA 2B5IC 3UO1L 4UB0H 1FZKA 4LNRA 4JHBA 2E7LA 3L3GA 1G7LA 1AZCA 1TMCB 1Y0LA 3CDGA 4IK7A 3SDXA 1FQ9C 4IRSC 4PWFA 5C0BE 3WFBL 2IPTL 5LCVL 1IT9L 3BFQG 3IU4L 4PY8I 3E8VA 1T1WA 1A6VH 1QFWM 2QV4A 2CCLA 2C1OB 3GSRA 1KXVA 1MNUL 2LU5A 2Y5TA 3RLSA 4V2BA 3TTSA 4XC1H 1XIWC 3BKCH 3GSNH 15C8H 1KCUL 4NQXA 5IB5B 1JRHL 4Y4HB 5I19L 2AJZA 3QS2A 5EZOL 2WXMA 4MTMA 5HHVL 4Y19B 4LCCB 3FAXA 3PP4H 1OK0A 3BP6A 5JR1L 1P84K 3WJJA 1QVOA 4Z0XB 4TTGA 1RJYA 3EOAB 3RWJB 4X7TB 3SQBB 4XP1L 3WHE0 1MFDL 4H1LH 2ZYIA 5J5EA 1XGRB 2XHNA 2G9HB 5HJGA 4IYKA 4WUUA 3A21A 4JNXA 3EGSB 4CMHC 1WBXA 4MD0B 3FTYA 3COOA 4FMVA 1MCFA 3ML9A 1KLFA 2HWZH 2BRRH 5JIPA 3DBSA 2NXZD 5AOKA 1IV8A 4U6HA 4ZTPH 4XCFL 3PAUA 2CO3A 4PN6A 3PXJA 1FGNH 4WW1A 3FCSA 4C59B 2Z35B 4ONGL 5I1CH 4DGUA 3B5TA 5JHDA 5JO5A 1A7RL 2UWEE 3QRGH 4J8RA 2W0KA 4KVNL 1CLYH 4IBZA 2X4OA 2Y6TE 5E08L 4AC4A 1URIA 4G8GB 5DJ2A 4NQQA 1BGXH 4B5ZA 1IQWH 2ZOWA 3CN0A 2D7PA 3VFVB 3LNEA 1OOAA 4GBXB 3AUWB 2ZXEB 3BAYA 2R1XA 3TO4D 2H32H 4X98B 4EI6A 2KZWA 3B5GA 2HLAB 4K7FB 3POHA 4JZNA 5TE4L 3D4YA 1ZVNA 2CO2A 4R2GD 3BP4A 3V0GA 3MJ9H 2VRAA 3BWAB 3MREA 4XVJL 1DSWA 4LNRB 1FNFA 2QBWA 2ZG1A 3F85A 3L3GB 5DLML 1Y0LB 4QXGL 3RKPA 3SDXB 2C9SA 2DV6A 2YAPA 3LY6A 4KZCA 2PABA 2C34A 1T1WB 1AIFA 2GBTA 1J0HA 3FO0L 2ITCB 3GSRB 2Y5TB 1JFQL 1V55B 4HWBL 1Z9OA 2BPBA 4PJXA 1I3GL 2VM9A 4ZSOE 4J3WA 4RX4A 1UM4L 1VGEL 1PGRB 5EC1A 4BWTA 2XZCL 2WQRA 2NR6A 2GYSA 1I31A 4R2GC 3MJ8A 2WYTA 5E2UL 3S9DB 1GOFA 5I75C 3BP6B 3MDJA 2N7SA 1WISA 2A9DA 1QVOB 2BSBA 4P2RA 1RJYB 3DVGA 1NUGA 4V33A 5HDBF 4YSOA 3K2UH 3F7VA 4WUUB 1GR7A 2CGRH 2DTMH 1WBXB 2W92A 4FYTA 3MOBL 3VG0H 5FDYA 1KLFB 5B7MA 4JRWA 4LSSL 4AJWA 3GZQA 4MVBD 4U6HB 3RX9A 5J1TC 4XPTH 4PG2C 3RZCA 3FO1A 1QABA 4WW1B 3VGAB 1JAEA 2EDLA 5FM8A 3DVNA 4XMPH 3IRZA 2KPNA 1F45A 5ESAA 5FYLE 5JO5B 1SLXA 1X7TA 4J8RB 4N2AA 3VFSA 5JHDB 5DURD 3WE6A 5JQIB 2X4OB 4KH9A 1QNIA 3A4FA 3ARFD 3R7RA 1I8IA 3I75A 3S8WA 2N56A 3LRSB 1ZMYA 3TJPA 5JOPE 1W0YT 4TSBH 4JE0A 2ARWA 4BHUI 3ZR6A 1QP1A 3QR0A 4ISVB 4L8SA 4MVBC 4QOKE 4ZFFA 1UUSA 1D5MA 2R1XB 1J12A 5AB1A 4CC4C 4YZWA 4BKLA 5I30H 4ETQA 2Q20A 4JZNB 4O2FA 5I1JH 1AD0A 4AV0A 4AI7A 3BP4B 1HZHL 4WUKL 5IT2L 3MREB 2C9PA 2CUHA 3CHOA 4ABQA 4M3KB 3CX2A 4XP6L 3ARFC 3GXDA 3AY2A 2J6WA 3ETSA 1WK0A 4RISL 5I18H 1AIFB 2DBJA 1MJUH 4X99A 4L37A 3BLKA 1JG9A 5DJZA 1YEFH 4HETA 5JLZA 3E3QE 4PJXB 1HNGA 3EDDA 1FYTA 2YQGA 5EC1B 4WGKA 5DO8A 3ROOA 3W57A 4YHNB 4R8WL 4MQSB 3LAFA 4R4FH 3MJ8B 1QSFE 4NUGL 1B3IA 3GHEH 2D3JA 4YIQA 3DVGB 3MMEA 2J71A 1IAKA 2A9MH 1GXEA 5LDSA 3MA7A 4JFVA 1OQXA 3SPVA 3GSXB 4AH2B 3ESOA 4NBXB 4JO2H 1P4BH 4ZW6A 1JGLL 2WPGA 4BH8A 4FMFA 4PV8A 3CFEB 2IGTA 2VM3A 3HRZC 5EO9A 3KWVA 1U36A 1GH7A 1SYVA 2WAQA 2F53D 1SLUA 1CVSC 1SXBA 4C4BA 2AJYL 2D2OA 3ULUF 3ZE0F 3RZCB 3GTVA 3FO1B 4HUWA 4Y19E 2ED7A 1JCKA 5AAMA 1B9KA 4X6DE 3Q48A 3BE1L 3DVNB 5AG9A 5ESAB 3NRQA 2BNQD 1FE8L 3VFSB 5E8OA 4ZZFA 3WE6B 3IE9A 4ZOBA 4AGOA 2AXFB 3QEQD 5D6DA 1I8IB 2BHZA 3I75B 1YMHA 3L1FA 4K7PL 1OAZH 4L05A 4BZ1H 2WNXA 2AK4D 2DEXX 2HRLA 3JWOC 1BAGA 4PJDF 4N1HB 5DZLA 4ZFFB 2C3GA 3O4LA 4OGXL 4P07A 4BKLB 1XB3A 3WFEL 4ETQB 2K6YA 4O2FB 1AD0B 1SMAA 3ZX1A 2NCEA 4DEWA 3B2VH 4FX5A 1Z3RA 1ITBB 4PJEE 5C6TH 5JW4M 5JZ7D 4M3HA 4KXDA 5CSBA 3TEYA 3WDJA 1CVRA 5AAWA 1DQVA 2XY1A 4H2AA 4OI8A 3WY1A 3W2DL 1PLGL 1LEKA 2GSIA 5DTFA 4GXUM 4TVPE 4TUUA 4L37B 1UASA 5DJZB 4R5XA 1SHXA 5JLZB 3MVSA 3FQTA 1IBBA 1YECH 4M7LH 1FYTB 2WBJA 4BCYA 1I85A 3LRLA 3SO5A 4Y7OC 3ROOB 1UH3A 5F93C 1CDGA 3LB6C 4UU9B 4BRJA 4ZMPA 4XX1G 3I85A 3V10A 5JZ7C 3MTXA 4ZX5A 4ZMZA 3ECVA 1P6WA 5GRVK 5DYOA 4KVPA 3BQVA 4GYBA 1U21A 1P0SE 4MA3A 3KGRA 4YIQB 1MHCB 3MMEB 2OYKA 3RIAF 3SDXE 3V9FA 3WFDL 3UJJL 3UBFA 3MA7B 3ZRFC 4B9GA 3SPVB 4AITA 5IJKC 4J6IA 1SOXA 3BH9B 3LHPL 5KVGL 5JIDA 1NKRA 4PV8B 3F62A 5HJ3A 2KZKA 3MRKA 1H5BA 3H2PA 2ORBH 1A1NA 1NL0H 4Y2LA 3CDYA 3DBXA 4HUWB 5L7XL 2NY3B 5AVUB 1MY7A 1A6WL 1XGZA 4ODHH 5FCUL 3UABA 5I74B 4OLXL 4GAGH 3PAVA 3QK0A 1YMHB 4HIIA 2GSMB 3KBEA 1G0DA 3OC5A 4HD5A 4Z7QF 4MD4B 4S1QL 2NY4B 4WUUE 1IJ9A 2AAAA 2BIPA 4MCMA 3OMZA 4D9LL 5DF0A 2KLRA 3KPNA 4UIKH 2LTQB 3O4LB 1WVZA 4KMQA 2KBGA 3SOBH 4XOAA 1M7UA 1FORL 2R9HD 1SRDA 3T6VA 1S7UB 3O2WL 2R4SL 2YEZA 3HMWH 1DSYA 5AUMA 2GUYA 4G7YL 2XYBA 3CU7A 3OAZH 5IFHH 4QIRA 5TF1L 1UFGA 3WAJA 5T3XH 3SOTA 2I60L 2JKJA 2VJXA 3MRIA 2RMNA 4AQZA 4KJYB 1Q8MA 5JHDE 1G7HA 3T3MF 4NM8H 1MPAH 2GEQA 5DTFB 4GI9A 4RFEA 2AJXL 2ZOTA 4FTDA 3FQTB 3G5VA 2EDTA 3KYMA 3BC9A 2WBJB 4HA1A 2R9HC 4UQIM 4JPIA 2IDTA 2V9RA 4F7TA 1CL7L 4JFZH 1XGYL 3Q2WA 5A2CA 1V7ML 3SGDH 1SHWA 2H2SD 2K45A 1INEL 4XBPA 1MZZA 1NOFA 5IQLA 5I6NA 4MA3B 3MOAH 4G8EA 5C6PB 2NQCA 2E7DA 3GRWA 3GRBA 2C5DC 3E6HA 4S10A 3EDJA 1FNEA 4K8RH 4MB3A 1AKJD 3ARBD 1LO4H 3NCEB 1T03H 4ONHB 2F5AL 1O5DT 5HJ3B 3MRKB 5K5YA 2QMJA 4PJXE 4H5SB 2E46A 2PPDA 2B0SL 1A1NB 1BQHG 2GI7A 5GGQL 1LP9F 1N9PA 5ITFA 2GITA 3DBXB 1TQUA 3BN9D 3IJSA 3L3OA 5DEJA 2H2SC 4L5FL 1PMYA 1H6UA 4HS8L 3ZHFA 4Y2DC 2I9LA 1UCTA 3GS4A 4P2RE 5E4IA 5HD8D 4UB0L 1HJCA 3Q5YA 2Y5QA 1JXJA 4FNRA 3HVNA 5K9JH 1A6VL 2D73A 1N64H 2APFA 3Q5OA 3KPNB 4N87A 4O02H 4X8CA 1DQQA 2NW2A 1JVOA 3N1QC 3BN9C 4XC1L 1PU0A 1R3HB 3GSNL 4A55A 5AUMB 2CK0H 3KWXA 5DVMA 1SXSA 3PHOA 3PPSA 3ABMB 1DQMH 5A3IC 2MNUA 2ALAA 1EZUA 2ADYA 2WTOA 5HD8C 3MRIB 4LNVA 1UJ3A 4Z7OE 4N6QA 1HINL 1G7HB 5LAXA 4KC3B 4F2MA 3IDXH 4TVUA 4EDWH 3RWDA 4H88L 3RZWA 1WBYA 3ARVA 5I9QB 5DC2A 4G7RB 4G11A 1AG0A 3M86A 3GMPA 3MLRH 3FRUA 1F86A 5AVWB 1F3RB 3H2QA 3KYMB 3S2CA 4XR8C 4ZX4A 3FCGA 4JPIB 1DLFH 2F15A 2BRRL 2HWZL 4F7TB 4ZTPL 4OCWH 5F70A 1AD9A 4TULH 1AS8A 4DN4H 1FGNL 1WZ1L 2CHWA 4G8EB 2WWMD 1KGCE 1OB1B 3EJPA 3HMXL 5ESVA 3QRGL 4NT6A 1OKEA 1CLYL 1FNEB 4HAKA 3RY5A 1BGXL 4A63A 1INQA 1IQWL 4IIQC 2BVUA 1UZ6E 4NQTA 4F15B 2CBMA 3V8OA 1FYTE 2VIRA 4MXWH 4XXCC 2QVMA 2GITB 1D5IL 3IJSB 2ZF8A 3L3OB 2P7TA 4PMFA 4U1IA 4LOEA 2A6DA 4AIXA 3ZUCA 2WO3B 4WEEA 4UIMA 2I9LB 2H2PD 4H7VA 1ZLUK 2WWMC 5L0QC 3MJ9L 2ADGB 5F3HB 1K2DA 1U8CB 4W9DC 4WWKA 2CDGA 4UBDD 4N2OA 4QAWA 1O5PA 3U7AA 2QTVA 3WO4C 2WBKA 3F3HA 3QJQB 4G80A 4UAHA 3ZTJH 3I6LE 3H7LA 2X4TA 2ROXA 4Y5YC 5DJ8A 3KR3H 4TNGA 2Y2WA 2X3BA 4JANA 5I0WA 1P9MA 5D5MA 2IF7A 1SVCP 5CZVH 1Q1JH 1GC1C 4JFHE 1NEUA 1PTZA 2VDNH 2X89A 3H2WA 4CSPA 3PHOB 1IQDB 4X4ZA 2H2PC 3ZHDA 4KUZH 3ULUH 4FTVA 4UBDC 2OW6A 1JPEA 5LAXB 4H20L 4F2MB 3QEGH 4KROD 2FNBA 5KZCB 1WBYB 2B9BA 5EBMA 5D4JA 4WKZA 3LTVA 3WIAA 3GMPB 5BOZG 3FRUB 4TNWF 3LN5A 3KLLA 2CGRL 2DTML 2X88A 2BY3A 4LL4A 1T2JA 1KELL 5T3XD 1HL5A 1XHHA 5H35A 1WUNT 4ZDHA 4UM8A 1CDHA 1AD9B 3FBKA 2VLRD 4YSAA 2B1AH 1ERNA 2Q6WA 3GMLA 4JFTA 4P9MH 4PJHB 1L6ZA 4UQEA 3TYGH 5HDRA 4NT6B 3T04D 4NM4H 1FFOA 2JV6A 4HJIA 1U3HD 3MLUH 1RZJH 1YC8A 4W81A 3RY6A 4HLEA 3U0PA 1INQB 4M5YL 4TSBL 4XPAH 1AO7A 2WQSA 2Z34A 4GW4A 1JD9A 1M53A 2I69A 2VIRB 5DJYA 5CZRA 3MRQA 5EC2A 3BVTA 5KN5A 1MAMH 4AV5A 5FFOA 2MHAB 2DLEA 2P7TB 3OKOA 4NENB 4U1IB 1I3UA 2DTSA 4X9IA 3WFZA 2NUTA 3N04A 5I30L 5BQ7A 3BSZH 5I1JL 2DMKA 2HJFA 1K2DB 3FQXA 4WWKB 2CDGB 2H6UA 2XN0A 2VERA 4I89A 5T1DH 3OKEA 1NCTA 4P23A 3RL1A 1AZUA 1U3HC 2D03H 4A7GA 4BXVA 4G80B 4LSDA 1DBAL 5I18L 4L1SA 2X0WA 4MJJA 1MJUL 5EEVA 3RUGE 2X4TB 3JT2A 5DJ8B 1WFNA 2AGJH 1YEFL 2EDNA 4JANB 1WCQA 4G8IA 5D5MB 2EEFA 4RZCA 4Q4EA 3RBGA 3BT2H 4KI1A 5BRZB 1L0YA 3NCWA 4UTBH 4Y9GA 1SJXA 2H8PA 4R4FL 1KLGA 1GGBH 5ID1A 4AQAB 4GT7A 4FTVB 4FL4B 5CJBA 3EHBD 5D1ZA 1ROCA 2NW3B 1JGDB 5I76A 3GHEL 2BINA 2ZT9C 1A3RH 4CU6A 4RFOH 3TIEA 4WKZB 2A9ML 3L7EA 3LN5B 3HBPA 1QLRA 1UKTA 4ODSH 4JO2L 1P4BL 1YEIH 3DX9A 4IBLT 5DJDB 5TH2B 4NUQA 3WCYA 5IHZA 2HH0H 1M4KA 3BVVA 2C7UA 4CC0A 3INOA 4JDTH 4TRPL 2MCAA 4AYSA 2H5UA 2WIIA 3HN5A 5D1XA 5D4HA 3MV7A 4UM8B 4ZDHB 4D94A 1E5CA 1KTLA 1OCZB 2YKKA 5DS1A 3T65A 2NQDA 3EHBC 2Q6WB 2ENYA 5KVFE 3GMLB 4FFZL 5FPIA 3G7TA 5J1AB 1E9OA 4Z77A 3LXCA 3MLSH 1I9JH 1FFQA 3AXIA 3U0PB 4DOHE 1OAZL 1AO7B 4KO9A 4QWWD 4BZ1L 2Z7WA 3B2DC 1ILUA 4GW4B 5DJYB 1ZGLA 5C0JA 3MRQB 5EC2B 2VXVH 5KN5B 5LGJA 1F3DJ 3TS8A 5JXEC 3OKOB 4YX2H 2YFNA 2NUTB 4PGZA 5BQ7B 5K69A 1NFDA 3VD2A 4DWHA 3JBG7 3B2VL 5C6TL 3FQXB 2E4TA 2VWEC 4GS7B 1MJ8H 3Q6FA 4QY8A 4KOCA 4M5ZH 4AM0Q 4Z7NF 3K6SA 3MGTA 3OKEB 4CAGA 4P23B 3RL1B 3L5JA 3WDHA 3ES6A 1IAOB 2E56A 2XX1A 4G7VL 2V8LA 2Y7LA 2DJUA 3CVCA 4QWWC 1YNLL 4POUB 5HYJD 4G8IB 2X4RA 1NGPL 3VXMA 2J8HA 1UT9A 4RZCB 3ZR5A 4FAAB 1UJTA 1YECL 1KTBA 3IKCA 2EVGA 2B4CC 4JGJA 5KYXA 1KLGB 1MG3C 5ID1B 3GO1H 4NKOB 1YNKH 3BW9A 1LILA 1SXZA 4YEEA 1Q94A 2R0LH 5D1ZB 3V2AR 2VR7A 3UTQA 4PTUB 4OLEA 2ZOLA 4ZRGA 1KENH 3W1ZA 4BUHA 1MCRA 3TIEB 4ANUA 4XN2A 3U6XS 3ZQXA 3L7EB 5E0FA 1IFRA 1QLRB 4DQOH 4AM0A 4N90D 3R18A 5HDBE 3QDHA 1I1AA 4JKNA 1BQUA 3TJEH 2ORBL 1SN5A 4KY1H 4GKSA 1FVDA 1HX0A 4QJ5B 1NL0L 3C12A 2WIIB 4KQ3L 5D1XB 2NMSA 3MV7B 1KTLB 1MF2H 3AXLA 3UO8B 3KLSA 4E9SA 3HPLA 4M1CD 3ZDXF 5EEUA 5IIEB 3T65B 4FE9A 3AVEA 4X7SL 4EAEA 2J57A 1E4HA 1E9OB 5E2JA 4F2ME 4Z77B 3FDWA 1JSYA 4GAGL 3TGXA 3ZMNA 1RVFH 3PFQA 5D7SL 1DL7H 1T1XB 3BJLA 4PGEB 4PRHB 5IB1A 3VH8G 4D7BA 3ULUC 2AXGA 2R51A 4L3CA 5C0JB 1ZGLB 3QORD 5LGJB 4UIKL 2X70B 3KJ4C 3PUCA 4NQCD 5BS0A 4MAYC 2E7HA 3SOBL 4M1CC 3IJ8A 1NFDB 3HMWL 4EQ3A 2X1QA 4RSVA 4Z7VF 2I32A 5FKPA 3PJLA 2XPYA 3Q6FB 4QY8B 5T3XL 4N22A 4BH7A 4OD3H 1F1GA 2CSPA 4E42A 3NYKA 3ES6B 1ECZA 1HOEA 1NC4B 4NM8L 4JFXB 3HKFA 1MPAL 5DQDH 3RX8A 3DUHA 1AGFA 3AQZA 3LMJH 1BX2B 1TEGA 4NBYB 2IV8A 2X4RB 4LPYA 3VXMB 3CX5K 1CLOH 3ZU8A 2XPGA 3QI9D 1E6JH 1D9KD 4WI8A 3IKCB 3SDAC 3T6XA 1BAWA 5BRPA 4JGNA 5KYXB 2DM4A 4HEPG 4JFZL 5IBTH 3FRPA 4U3HA 3NMEA 3WKQA 1RZJC 1W2KT 5FYJH 3BW9B 2P5EA 3WU1A 2IWEA 3IGFA 3UTQB 4JW3A 2ZOLB 3MOAL 3T3PE 2YSTA 2ITFA 2BRQA 2A4EA 1G7JA 3N41F 5FUCC 4O51B 4PS7A 4GQZA 1BYPA 4AM0B 5J12C 4FMKA 4K8RL 1CE6A 4TLUA 1V3JA 2JKWA 1I1AB 1LO4L 5FWQA 5CGMA 3T2QA 1U8NA 2BHYA 1KPRA 1XF5A 1G7MA 2E7BA 5DHVA 2ZX8A 4GKSB 1FVDB 1X44A 1CDIA 5E9AA 3BUDA 3AXLB 3B7RL 2X4SA 3RQ3A 4N26A 3HPLB 2AQ2A 3WIHH 3WXWL 3WN5C 3DXAD 4FTVE 4GW1A 4K0OA 4MA8H 2P3YA 2V7HB 3RI5K 3FUEA 4YLCA 1OCCB 2D31B 3QHTC 4PS4H 1BWMA 4FZ8H 4JUTA 3VMPA 2JLLA 2QLVB 2Y69B 1P1ZA 2AJVL 5IESH 5IB1B 1TVBA 1FFNA 1S5HB 3MBXL 2YK1H 2EKSA 3FN9A 5ECGA 5K9JL 2JCCA 1JVKA 1N64L 4WWID 5BS0B 3I3BA 1UGNA 4OF6A 4O02L 4WFEE 1FSKC 3MACH 5HI5C 2P26A 3KPQA 3P69A 4UOW1 3I9GH 4CMMA 3CFDB 1U6AH 2CK0L 1A6AA 4I0CC 5FKPB 4K3HA 4BH7B 3MRLA 4JHAH 3NZUA 5GGUA 4L4VB 3TO2A 4E42B 1VDGA 3DNKA 4XPGH 3DX7A 2YSSA 5ICYA 2JJWA 1EHAA 3IDXL 4EDWL 3M7OA 1AGFB 2MOQA 1AO7E 2W0LA 1P7BA 5DHYA 3HNTH 3MQIA 1I1FA 4KXBA 1R6VA 2XPGB 4WWOA 4ZMYA 1CFTA 3KPLA 4XVTH 3UGUA 3LPGA 1NMCC 1ADQH 4M7JH 4E9LA 1KYOJ 4E36A 2CHDA 2GBVA 5I0DA 5BMFL 3K4ZA 3FRPB 5E6YA 4NWTH 3RB7A 5ABZA 5E5UB 3L5XH 4K23H 4OCWL 2VZ1A 1WUZA 4I8DA 4TULL 4AMWA 5H37G 4DN4L 1KBPA 2CR6A 1ACXA 4NLHA 1G7JB 5EU6A 3AC0A 5DJ6A 2EZ0D 5FWRA 5EIIG 1CE6B 3ILQD 1A6UH 2FTAA 2A7BA 4DP5X 2AQNA 1U8NB 1IRAY 1KPRB 4OUUB 4YSEA 1G7MB 5DHVB 4OGQC 4F57H 2G2NA 4DJMA 2WXJA 1KN4H 3IJHA 4MXWL 2OMUA 2X4SB 3PV6B 4UZUA 3KEDA 4YLBA 2H7WA 2E8ZA 1QSZA 1T3FB 5LKNA 3OLDA 4BWUA 5F3BA 1G87A 4PMEA 4EKJA 2OR7A 3OAWA 2VL5A 2EZ0C 1BPVA 2Z1KA 4OB5L 1P1ZB 4R7VA 3ILQC 4Q52A 2G2PA 4JRXD 1P84J 1FFNB 2EKSB 3CVIL 2JCCB 3GZPA 5K9KB 1S7SA 3HHRB 4CNIB 4JM0A 3QFJD 3KR3L 2FO1A 4KDTA 4AQ1C 3VM7A 3KPQB 5D1XE 4CMMB 5CZVL 1CF8L 3MV7E 1GOHA 2VDNL 3TJHD 3VH8B 1A6AB 1SLVA 2VUYA 3FQ1A 4JRLA 1PD0A 4NQDA 2OMVA 4YE4H 2H26A 5AG8A 3VWJA 4URTB 1N68A 3MRLB 1ZV2A 1IILE 4KUZL 5GGUB 2VSMB 3ULUL 3OLGA 3TO2B 1Z9SA 2X41A 2YSSB 3QEGL 1N59A 4P5TA 5IQOA 1FG9C 2XV0A 2VDLB 4EMZA 3LQMA 4AIEA 1AXIB 1IEAB 5LVEA 3PGCB 1I1FB 5KTEL 4OZHA 5JDJA 1YY8A 4K3DH 1CFTB 3KPLB 3BX7C 5CWSA 5KYNA 4AKQA 3MNZA 2Y6SD 3OHMB 1N0LA 4PSRA 3CPLA 1HH9A 3QYMA 1NFDE 3EDKA 3ZDZF 1HE7A 1KB3A 1HCZA 2DN7A 2JCWA 1UEMA 2MPVA 3BKJH 5D55A 4JDVA 2B1AL 4LQ1A 4MB4A 4UCFA 5I8CB 2Y07H 1RK7A 4NP9A 5I1AA 2HZHA 3VFGH 5GZOA 3GBEA 3U0WH 4P9ML 3LIUA 5EU6B 5DJ6B 4LCWB 3BOVA 2AEOA 3Q8BA 4NM4L 3ASOB 3MLUL 5MI0B 1BZOA 4MLSA 1RZJL 2CGYA 1OB0A 1YYLH 3VXME 4XPAL 4YHOH 3CZUB 1HE8A 2W60A 4HGKC 2W0PA 3RNKA 5E4AA 2OMUB 1MAML 2J8UA 1UM6H 2FJHA 3JT0A 2YD8A 2W95A 3MNMA 2WP3O 3L4TA 4GH7B 3QCUL 3WUZA 5ABDE 5T3ZD 5F3BB 3BSZL 5F0LB 3X12A 5E1GA 1TEFA 2HRPH 3IFOA 1G6RB 1JPFA 2FJFA 1UOLA 1TSRA 4ZX3A 5CJ5A 1FWXA 3A5VA 3RDTA 4NQSA 2DY2A 5T1DL 5GGTH 4RWYH 4WTZG 5JA9A 2D03L 5E8PA 1WAAF 4NN6C 4NZRH 2LLLA 4ZTOL 4QTFA 4Y1AB 1EMTH 1S7SB 1YLBB 4I1RA 2YBRA 2PCYA 4IK6A 4NP4H 4F33A 2RR3A 2AGJL 2YRPA 3GLZA 1I3RA 4HOZA 1XDTT 5SWSA 3P0GB 1BCIA 4LCYA 2YD4A 3BT2L 2RB8A 4PJAF 2YJLA 5AVRB 3VD3A 2DPKA 3IMWA 1T83C 4NQDB 1HL9A 4UTBL 2OMVB 2X6UA 4DP2X 2H26B 1MW1A 3SY0A 3VRJA 3VWJB 1EJFA 4LOFA 1GGBL 5FGRA 4PRBB 5CGTA 2VR3A 5J3HC 2JSFA 1Z9SB 5CHNB 1YEWA 4MBRA 2VOTA 5AAPA 1N59B 4P5TB 3Q2LA 4RFOL 4S1SH 5BO1L 1F3JB 3QXWA 5G4NA 4OZHB 4BK5C 4H40A 4ODSL 1YEIL 5BS0E 2L7JA 2HH0L 3MNZB 2BY0A 2DLFH 4Z9KB 3GSOA 5PCYA 1XSJA 4QRSB 3G08A 4JDTL 5KBMA 1BMGA 4XB8A 3K4DA 4XMLL 1OAXL 1XXFC 4HS3A 2M8XA 1JXGA 5I1AB 2QKSA 4NSKA 1QZ1A 2YPVA 3D69A 3ULVE 3MLSL 4OCSH 3TPKA 2IAMD 1N4XH 3FFCB 1ILSA 2BVOA 4GUQA 3NBNA 3ETBF 2K78A 5EUKA 2W60B 2CJ3A 2HKFL 4NRZA 4L29A 3RNKB 2E8YA 3VTTA 2VXVL 4DIXA 4ZMTA 2J8UB 4BSJA 3DYMA 5F89B 1QX1A 2TRYA 1YYCA 2YN5A 4YX2L 4KI5D 3UTTD 2P5EE 5EF2A 3X12B 3CFIC 4GRMB 3VD4A 2K9FB 3DMMD 3IFOB 4OV5B 2FJFB 3PS6A 4XNXH 5MENB 5LBGA 1MJ8L 1OOWA 4OM0H 5L2JA 2EIBA 4M5ZL 3RDTB 2CLRA 2IAMC 35C8H 4UV4H 2VLJD 2Y4SA 4ICWA 1H3GA 1DVQA 1J1PL 2DIEA 1G1KA 1H3TA 3O3DB 2YBRB 4F33B 4GQ9H 2JH2A 1I3RB 4OF7A 1OVZA 5SWSB 5F1KC 2HXAA 1BLNB 3QCVH 4LCYB 2A83A 4N86A 4PP2A 4IRZH 5D7IA 4NJAH 4Y4KD 4KI5C 3SY0B 3KYAA 3VRJB 3DMMC 4NQEA 3GO1L 1T66D 4YC2C 1YNKL 1MI5D 5F9JB 2WSDA 4RGOH 5T5FL 2KZ1B 5I5MA 2R0LL 4K5NA 3BUYA 1DEEA 4F7PA 1KENL 2XA8H 1TJIH 5FF6A 3NCXA 4PJ8A 2WJ7A 4NFCA 4DQOL 2JCCE 2AKRA 3SE8H 3DYPA 1MEXH 5GQBA 4UMGA 3QUYB 2B8OT 2G0KA 3BD4A 3WEBA 5KS9A 4LOUD 3VFNA 3GSOB 3TJEL 1QWHA 4KY1L 5I1HH 1FL3A 3DK2A 3G08B 4Y4KC 4YDIL 4X5RA 5C0BD 5GS0D 2EUZA 1V8HA 4CKVX 1KBKA 1MF2L 1YHPA 4HS3B 1UB5A 2V8MA 1HIMH 1UA7A 4UILH 2NX5A 2H0FA 4RRPA 3ZHLA 2Q3AA 4RMVA 3D69B 4JHZA 2PO6D 4OAWB 4W9LC 1L9RA 1RVFL 3RTLA 5J13B 2WTPA 2O1AA 1DL7L 3T5WA 1QBMH 4I1NB 4OZFA 4L1TA 3IF1A 3RB5A 1IBDA 4L29B 4JFEA 4LOUC 4P2QD 3LPFA 3VI3A 4IU2A 3DHPA 4YJZL 5GS0C 2XBDA 3IPFA 1IVTA 3D39A 5FUOH 5KJ4A 2N4IA 1KJ2A 2AP2A 1BYOA 3QWRA 1UWGH 3VMOA 3U0TA 2VZOA 5L2JB 3PGFH 4PJBF 1KF9B 2PO6C 3BGMA 4OD3L 4R7DA 2CLRB 4O4YH 5EU6E 4DEPC 3NDZE 3D0AA 2DAVA 2LABA 3DO3A 3LMJL 4X6CF 2FSDA 4LHJB 1CLOL 2YEVB 4JX0A 2A83B 4RVBA 1E6JL 5D7IB 2G3XA 3SSGA 4L3EA 1C7TA 3KEHA 2DQUH 5C86A 4IIZA 4OV6F 5AL8A 3UMTA 4O00A 5FYJL 1R9FA 3HUJF 4LVHC 3BUYB 1D7DA 4U1MB 4KUCD 4MKMA 3BDXA 1AVAA 4G8FA 4UNIA 4P3WA 1ET5A 5E6IA 5FF6B 5C09B 3IDYC 3ZKND 3ATFA 4ZJ9A 1AAJA 4PBWD 2AKRB 1Y1DA 4M7KH 3BQUA 5F1OB 1WA0X 3AY4A 3SE9H 3VFNB 4JKLA 5IUSA 1MFCH 4HWNA 4X0NA 2X0VA 3TU6A 2MOGA 4NQDE 1RH8A 1UB5B 3MRNA 1VEPA 4FKHA 4OLWH 4E5XA 3WIHL 2NX5B 3N1MC 1EUUA 3ESUF 4MA8L 3L4VA 3VVVA 2DQMA 3PWUA 3VDAA 4JEGB 4PS4L 2MQ0A 6FABH 3NCCB 3OR7A 3ZKNC 4U0QB 3OHXC 4MNHB 43CAA 1D5ZA 2I5YL 5B3JE 1JWMA 1IFHL 1H3PH 3IF1B 5IESL 3V79C 2FE0A 4OZHE 4A2DA 5DD0H 2CCWA 4JFEB 3ARDD 5FHAL 4IU2B 4O5LH 2APWA 4WCYH 3OBAA 4M7ZC 3MACL 2OJ1A 3I9GL 2GIYA 3D39B 1QFPA 1KJ2B 4TSCH 4I2XA 5EF1A 3U0TB 5J06A 4EIBA 2PWDA 4JHAL 3QJVB 4QR7A 4QJ3B 2XVLA 4XPGL 3H55A 1R3IH 1WWAX 4HKZA 3AWEA 2BP0B 3NQIA 1XCTA 4WI5A 3ARDC 1MUJA 3HFFA 3WNIA 3HNTL 1AR2A 1EQWA 2Q1EA 5FOBA 5FYLD 4XVTL 4OCLC 3OAYK 4L3EB 1ADQL 2BIQA 3KD4A 3BSHA 4M7JL 3FKUS 2ZXAA 1G0XA 5CSZA 3IMVA 5JOPD 3RA7L 3L5XL 5CZKA 3KPMA 2JXMA 3FFDA 2CJUH 2FUQA 5SWZA 5I1IH 2R8SH 3ERXA 3KDMA 4QOKD 5TDOA 4G8FB 1M7DB 1OLLA 5KSUB 4Y1TA 4JFUA 3N40F 1G94A 3FU9A 3BQUB 1ONQA 1AXTL 3OKDA 3ZO9A 5SWSE 3GEFA 5FV1L 4F57L 1DJSA 1KN4L 2IDFA 2OI9C 3FT3A 3CZJA 4PJFA 1TU2A 4E5XB 3QZMA 3FUMA 3MRNB 3D12B 1JNHA 2Q2EB 2D4FA 1BZ7A 2AZUA 3CUPB 2F1BA 4LK4A 2NSQA 5HYSG 4M1GH 5SX5K 1CFSA 4Q4IA 3PWUB 1YNTA 4FNTA 3OPZL 4XP5L 1W72H 4CJ1A 1P6FA 43CAB 5FFLA 1JWMB 3NN8A 3WJLC 3ZE1E 1U8MA 5IQ9A 1XCQB 3ZRSA 1QSFD 3FU8A 3OSKA 1OALA 1LXMA 1S9WA 3KBHE 3D85D 4FI6A 4M3JA 4RIRA 4WV1A 1SF5A 3OVUB 2ITEA 1CDBA 2IAND 5IVZA 1HI6A 3TBYB 1T0MA 2NY7H 2OULB 4L3FA 4YE4L 3SDCA 1QBLL 5E94A 1GCFA 2OSXA 2Y3AA 2OM5A 2E0PA 3LN9A 1NJ9A 5IHLB 1EZVY 1YJDH 2VN5A 2Z8RA 32C2A 3KXFA 2X53A 4FCAA 4HKZB 4NOBA 4X6EA 1JZ8A 1XCTB 2LOEA 2GTWA 4FERA 3AM8C 1EAJA 4ENED 1AOZA 1MUJB 4S1DC 2VQTA 5FOBB 2Y1YA 3ECQA 4K3DL 5ANMA 5T1KA 1D2PA 5C0EA 2QQNL 2G60H 2IWGA 2H9GB 5IY5B 3OGCA 4ZXBD 5CSZB 2JQMA 1HEHC 2PXYC 4YNYB 5IBUG 3L3DA 5DZOA 1KBWA 3BKJL 5HYFA 1LL1A 4X9BA 5J4MA 3KPMB 4NRXA 1RZFH 2JXMB 1G4MA 2GTZA 1OWWA 3FFDB 5SWZB 1J8SA 2Y07L 4YSQA 5TDOB 3KDMB 3VFGL 4U0RC 1A64A 1GHFH 4GKZA 4M93C 2VDPH 4KFMA 3OXSB 1QFWI 5LJYH 5F6IB 3HB3B 1I3VA 3OKDB 3MNWA 5DEZA 1YYLL 3QG7H 1KYUA 3AMLA 5D7IE 4ZXBC 4PJFB 2HKAA 3FT3B 4ODBD 4D0CB 1TU2B 3VSUA 4U49A 1JNHB 4WHTA 1TJHH 2DMBA 1UM6L 2UXFA 4NQEE 4QRQB 1BZ7B 2HPOA 4TVPD 5ES4B 4JBSA 4LKCA 3U9UA 1CFSB 3NJNA 1LLAA 4OFYA 2HRPL 1PDKA 1YNTB 3S5YA 2FH8A 3H7BA 1PX4A 3MNVA 4FQCH 5I16A 1ULVA 3NN8B 5GGTL 2NY0B 5HI3D 3AADB 4LLUA 1RERA 5LN4A 1U8MB 1F5WA 2F7IA 3CU1A 4NZRL 1S9KC 5IQ9B 4YXHL 4TKWA 1EMTL 4LVNC 5C6WH 2BNRA 1EERB 4NP4L 5KS9E 4HUVA 5EU7E 3KLHD 2CNZA 4WV1B 3PQYD 2J56A 4UQDA 3S5LG 5IVZB 1QI3A 3HR6A 1HI6B 4MYPA 2GJ6A 5GSRB 4WU7B 1SZNA 2NX5E 3SDCB 5E94B 3DDFA 2Y0SA 1MW0A 1NIBA 1NJ9B 1LMIA 4R3SA 1CLZH 3DGGB 3HI6H 32C2B 5HI3C 3KXFB 4X6EB 2F58H 3EBHA 1BQSA 3QDMA 2GTWB 2NSMA 4JJ5A 4P57A 5ETUB 1KIUA 3V8CA 3IMUA 2W9LA 4D9QD 1A4KB 4D8OA 4JG0H 9PCYA 5E4EC 1VADA 5T1KB 3VI3E 5C0EB 4U6YA 1CTMA 3O8XD 4S1RH 3OGCB 1EAPA 4X5QA 3OR6A 3PABA 3GHBL 3D39E 1UG9A 3NJFA 2CK2A 4N8CH 4PCSA 1KXVC 4NRXB 1F42A 4WUUD 5HJBA 4EUPG 2NNAA 5LCVA 2V17H 5IQ7H 2L8AA 4F9LA 1A4BA 4OGAD 3Q0HA 4YBHA 4UT9A 2ICEC 4P9HL 3H85A 3RX5A 1RJCA 2R29H 1O7SA 4GG6F 4OCSL 3HC0A 1N4XL 2ZUXA 3QJHA 1QFWH 3ZRCC 2XWCA 3MNWB 4FYRA 5A6LA 3WJJC 3LD8B 3O8XC 3SGEI 5EO0A 1A5FH 1K4CA 1CYGA 3BDYH 3QS3A 2R59A 4L3EE 4DZBA 1JMZA 1KDIA 4WHTB 1N2RB 1XGQB 2O6FA 3C6EA 4PY7A 3BWUF 3O81A 4LKCB 3U9UB 3AZUA 2ADIA 4L9LC 2ED8A 4PLKC 3PL6D 1PDKB 2X4PA 4LL9A 4OGAC 5GHWL 3V7MA 5HPMA 3MNVB 4XNXL 3PWVA 5I16B 4OM0L 2VDMB 4NC0B 1CQKA 4L1LA 2UZIH 3SCMA 5HYSB 1A3LH 4UV4L 4Z5RA 3F00A 3RPKA 2VUKA 4H8HA 4OIFA 5L4IA 3C09B 4IMLA 1P53A 3TVMB 4LT7A 2YAHA 3TL5A 2BNRB 1M57B 1QBBA 4E9QA 1UWEH 4ZQTA 1QA9A 3QCVL 4ZFQA 4HS6A 3SIKA 5C8JB 1MFEH 4IRZL 4NJAL 4WDIB 3SO3B 4DK3A 2GJ6B 1KWGA 5JPNA 5HHMB 3DO7B 3PL6C 1JZHA 1J7VR 5I1EH 4KKCC 4RGOL 4WWNA 4MQXD 4R3SB 3WV0A 2XN9A 4HFWA 3CBKB 3LQAH 1NCUA 1TSHA 4RX4D 1JZ3A 4N20A 5EN3A 1FPTH 3QDMB 3QVAA 4JJ5B 1TJIL 1KIUB 3OTTA 3U30B 5KOVC 1EJ6A 2KZBA 3SE8L 1VADB 2QKIC 1EPFA 4P2RD 5LQBH 3IWVA 3OAYH 3UZEA 3ZKMD 1EAPB 1XD0A 2FIRT 3CHSA 3OM3B 3OR6B 3PABB 4ANVA 5I1HL 4G71B 4MS8D 4TNFA 2VQ1A 4I2XE 4BFGA 1PPIA 3VXRB 2W9EH 1HIML 4UILL 1U91A 1KFAH 2YPKB 4MQXC 2GBAA 1YUHB 1UWXK 2QSVA 2D9CA 2V6HA 1OW0C 2VB5A 3R0NA 4FFWC 3ENEA 2J2ZA 1NCNA 2OCJA 4HWBA 4OM1H 2B77A 3LYRA 4LLYA 3UJTH 4YSCA 5C97A 3HC0B 2D7OA 1NC2A 3QJHB 2JQAA 5BQDA 4NJ9H 1UWFA 2WCPA 4KX7A 5DHXB 1URZA 2D7MA 4W9CC 4FNSA 5EO0B 4HPOL 3NIGB 4L48A 1W0WA 4MS8C 1UENA 4IRJA 4DVBA 3PCYA 1FL6A 4LVOB 3GMRB 5TE7H 2ZWYA 5FUOL 2ADIB 3L1GA 1U2CA 2XWBA 4ZW5A 4R6UA 2UVFA 2X4PB 4KMTH 1UWGL 3DJSA 5HPMB 1S9VA 5SWZE 3PWVB 1IZJA 2YAFA 4PRIA 2L0DA 2F0CA 4KAQH 3N43B 4OCNC 4O4YL 4ZYKA 2X28A 1BZQK 1XTMA 4QTIL 3SKJH 2PUQT 4IMLB 3SGJA 5HTSA 4NOFA 4LKXA 1QA9B 2CIKA 4HS6B 4PJFE 3DTDA 3O6KH 1KPVA 1V3KA 2DQUL 5JPNB 5KW9H 3FQUB 1R3JA 3RVVC 4OLYH 2AQ3A 2NY1B 1VB9A 3TEWA 3BISA 4W9KC 1NGXA 3V0EA 2XN9B 3TBCA 4M03A 3S5LB 1CICA 3APFA 4UT7L 2AABH 5AB2A 2VL4A 5AVZB 1N70A 3VXUA 1ZLDA 2XICA 4LRIA 4YHZH 4Y5XC 5IMLA 3OJMB 1XF4B 4M7KL 3SYAA 5A2AA 2VC2H 3EYQC 4R9HA 5IVNA 3D5OF 4YK4B 4OTXL 3SE9L 2NXYC 1NDGA 1MFCL 5DRZA 2OMTA 3P9WB 4EI5A 5CEYA 5B1KA 2VQ1B 5SX4H 4WRLA 4OLWL 1U91B 2QZQA 2ZWKA 1HQRA 1U58A 3TBBA 2DQFA 3GJFH 2F19L 2J2ZB 6FABL 2Z4QB 3KXFE 2OCFD 4M43H 1RUPH 4LLYB 3RWEB 1XZ0A 1NC2B 2A9AA 2JIXA 1URLA 4MD5A 5KWYC 4IRSA 3U6RA 2DYPA 4PM1A 5DD0L 5ANME 3ZTDC 4JQIH 4BFIA 1JWUB 3ZDYF 4QD2E 4DK6A 1BIHA 1W0WB 1J86A 4O5LL 1LO0L 4WCYL 5IMMA 4OZGA 4TXVB 3FU0A 4IOIB 4DVBB 1FL6B 3CX5J 3G5ZA 5HY9B 3CFBA 1XIWA 4MZRA 4PCYA 4TSCL 4A6YB 4U31A 4YOKA 4BGDA 1S9VB 1DN2A 2VXTH 1XAUA 3K71A 4KRPB 1JS4A 4HJEA 4ZYKB 5KAQF 2QSCH 3CDZA 4KXAA 1GGTA 5DUMH 2AV1A 3NGBB 4NAJA 4RZKA 2CO6A 2BCKA 3ATAA 3P9LB 5EZPA 5FDWA 1TXKA 1OAKH 4TM9A 1A7OL 2XTSA 2VUOA 4LKXB 4GMSH 2Z7YA 3DO4A 3G5YA 1VCAA 2DB8A 2XYCA 3H3PH 4UQCA 1QWNA 4DP1X 1NM9A 2WY3B 2YGPA 1EZVX 1BXVA 1FZOA 1G9NH 3LHAA 3ESMA 1NGXB 4EDXB 2AEPH 4K07A 4BCXA 4DW2H 1CICB 2CJUL 3ZIYA 5I1IL 2R8SL 5TFSH 5AKTA 2H1LM 2X6BA 1BVNT 2VQ4A 1SM3H 5KOMC 1W91A 2BNRE 3ARYA 3MRPA 2QQKH 3PU7A 2CPUA 3ILPA 4UTCA 1QI4A 1NDGB 5DRZB 2OMTB 2NUPA 4EI5B 1XGPA 2BHUA 5DZJA 2GJ6E 1IFGA 2QHRH 4R83A 1XR8A 3G6JF 4N25A 3SY6A 3P0VH 1TYJA 4M1GL 1HQRB 1U58B 2V37A 1I85C 4XBEH 4YHYB 2B5IB 2WLZA 2YC1A 1W72L 2GK0A 3D6GA 4NAQA 4W1TA 3QCTH 3QDME 3V52H 4U7SA 3C5JA 1DANT 2JIXB 2R0WH 3FOLB 4LL1A 4MD5B 3ZN6A 1OL0A 2DYPB 3KPOB 4BFIB 3OZKA 3FB5A 1WIPA 3AUVA 1UURA 2ATKA 3QXUA 4B27A 4GKOA 5IMMB 4OZGB 3HN8A 3G5ZB 4PWIA 4Y2OA 3CFBB 3F7LA 3L9BA 3PXLA 1XIWB 4K94C 3KGTA 3T6WA 1I8UA 5ADOL 4KKPA 2NY7L 1H5BC 5FGCB 3QFDA 4KKRA 2EDDA 3K71B 1RCYA 1ZKAA 3FSVA 2RCSH 4OZIF 1M1XA 3D05A 3NIFE 3P3YA 1GL4B 2FX9H 1LVEA 3CDZB 1Y18A 4KGLA 1YJDL 4FLHA 1ZVSB 2AV1B 2Z9TA 2CO6B 2AV7A 1IEBA 3DGDA 5BRQA 2MJWA 3B4NA 3MLTA 5D9SA 5KSBF 3NIGE 4D0BA 3G5YB 3BZ4B 4CMHB 3L4YA 2G60L 2FT7A 1HESA 3S96B 5CINH 3I3EA 1FZOB 4N0YL 4G82A 5EFIA 1ED3A 1RZFL 4HAGA 3QQNA 4DP4X 1BEXA 4PG2A 2EDFA 4FC3E 3Q1EA 4EN2A 2ETWA 1GHFL 3EJQA 3CBRA 5JUEH 1WF5A 3GI8H 2VDPL 3TBSA 5AOJA 1EUTA 3BZFA 3C8DA 1HQ4A 4I77H 3DK0A 3MRPB 4ZBJA 2XZZA 4IKIA 3ILPB 4Z6AT 1GYCA 2DEYX 3QG7L 4HCRH 1TCMA 4GRLD 1V27A 4MDJA 2RGSA 1XGPB 2L3BA 2YQBA 4ADIA 5LNEA 1OTUD 1AZBA 3QULB 4WSKA 2WN2A 5C0GA 1TJHL 1J0KA 1XR8B 3ASWA 1YQ2A 4G2AA 4G5AA 1KG0A 2PWHA 1FO0A 3EGXB 2WZ0A 4CC4A 2XN9E 3PF2A 5EG6C 4U4IA 5K1VA 2FVNA 1AMXA 2QVIA 4W9GC 2GK0B 2XV2A 4FQCL 5JOEA 3HI1A 3C5JB 3UGXA 5GRXG 1UYWH 4BQ6A 1B0GA 2EH7H 4FXKA 4KK6D 3ARFA 1FCGA 1LGVA 2JJVA 3OMIB 5F97E 1GSKA 2BSCA 3IDGB 1EEYA 2ATPB 3FB5B 4GRLC 4R4ND 2ATKB 4PJ7F 1DCLA 4W93A 2FR4A 3Q2NA 3VG0L 1OTUC 4R5VA 1YPZF 2QV2A 3HG1A 2EADA 3LN4A 4NPYB 4XCNA 4Y2OB 5CKGA 1QSED 3TO4B 2B16A 2YZ8A 2EIEA 3I50H 5IB3B 3QFDB 1L7IH 5TGBA 2K4WA 3FTGA 3ECBB 4R2GB 2K8MA 1SJVA 5ALBL 3WJMA 1M1XB 2QR0B 5DC4B 5I75B 4XN9A 1Y18B 3HI6L 3MFFA 4JFFA 1BXXA 1OCWH 3A22A 4KK6C 3CV5A 1E6OH 2AV7B 3LKPA 4GT0A 4YHKH 4R4NC 3UIYA 3MLTB 5D9SB 4F5CA 4D0BB 3FU7A 2Z3FA 5J11C 4LSTH 2I9TA 4ELMA 4WNSA 1R46A 2OYMA 2NOYA 3EBAA 3B5HA 3HRZA 3ME0A 3C08H 4N0CD 4AVJA 5EFIB 4N8CL 3B9EA 3NAAH 1ED3B 1PIFA 1TO5A 2HRGA 2PNDA 4PRIE 2V17L 1UXSA 4HIEB 2HCZX 5IQ7L 1IGJB 5I24A 2EEXA 1QUNA 3HR5A 4XNYH 3TBSB 2R29L 3BZFB 1HQ4B 2GCYA 3MC0A 3GSNA 1S7QA 2CH8A 2H3NB 1QFWL 1NANH 2XXFA 4XMUA 4DO5A 2A99A 5I71C 3LZPA 4H0IA 1GIGH 4PJIA 1VFBB 1ESOA 1ETZA 2V2XA 3BDYL 1NDMB 4F91B 3KJ6H 4N0CC 2DW5A 2F53A 1L5GB 5C0GB 5I5IA 2NT1A 5FO7A 1G43A 1KG0B 3TEUA 1FO0B 1GYAA 2Q86A 4JL2A 4H1LA 3GLEA 4WI9A 2DJMA 2XFXA 4O2CA 3E7JA 4X8GA 5CP7A 4HZLA 4AIZA 7PAZA 3HI1B 1GZQA 2HX9A 2BNQA 3VXUE 5DURB 1BHGA 2UZIL 1DN0A 1A3LL 1FIGL 4JJHA 3ARFB 4RDQF 1G9NC 2VR4A 4Z7IA 2WXPA 1EEYB 1VZIA 2PPFA 4ADGA 2FR4B 2AK4A 4AVHA 2EO7A 1JI1A 1NLBL 3WKMH 5AFAA 1UWEL 3LN4B 4XCNB 4ZUTB 1RZKH 1E65A 1MFEL 3VI4F 4P06A 3BKYH 3MRHA 2WW8A 5TGBB 4ZUUA 3FTGB 5I1EL 1DBJH 3WJMB 1E4KC 3ZT6A 1XGUA 2EDMA 2GSGB 4B95C 4X7CC 3V0FA 3O41A 3LQAL 3MFFB 2X89D 4JFFB 1TEYA 1R3LA 4M6OL 1ZTXH 1FPTL 5ENWA 1M3JA 1UKQA 1ML0A 4NZJA 3RYMA 3RWGA 4FRWA 2XWZA 4FTVD 3FU7B 4KPHL 5IJKA 2I9TB 5A16B 5CNHA 2PKDA 5LQBL 3EJZD 2FB4H 4RLDA 3MJ9A 3HRZB 3ME0B 1TTCA 2AHIA 2UY6A 2N1TE 3E9TA 5GGSB 1ZANH 3B37A 1E0OB 1MH5A 2W9EL 5IHWA 1MHHA 25C8L 4QRTA 5CFAA 1KFAL 3KS0J 3UEQA 4NO2A 3PLYA 3VXQA 3O4OC 2G2RB 3DGCR 3VA2C 3HR5B 4GIPD 4OFIA 1S9YA 2MCMA 4HHAA 5LGHH 3T09A 2BS9A 1KCLA 2GCYB 1S7QB 1O9WA 4NJ9L 5CU9A 2V7NA 3IDNA 4L8DB 3FQRA 4DGWC 2XXGA 3EJCA 2EDYA 2R4RH 3EJZC 4IOSA 4PG9A 3CXDH 3HI5H 1ETZB 4PJIB 4WI6A 2WAHA 2F53B 2WWKT 5FO7B 3C9NA 3DTUB 5TE7L 5A2LH 2ENQA 4FLSA 4QNPE 4JGUA 4PJGF 2Q86B 4H1LB 5IEKA 2P5WA 4KMTL 1JYVA 4O2CB 1WYJA 4AIZB 3I2CH 2VR8A 1J9QA 1GZQB 1WFMA 2AITA 2BNQB 4KAQL 1DN0B 2EIJB 5GRJL 3F04A 3SKJL 5KBPA 1IBYA 2JKNA 4GSQA 2WSPA 2VYRE 3BWUC 2AK4B 1C8QA 2PR4H 2IPKB 3C6LC 5SV3A 3O6KL 5IBLD 5F7BA 3SKNA 3MRHB 3AJ7A 5I8KL 5KW9L 5AKSA 4OLYL 1J5OH 4YSUA 5E1HB 5C3LD 1WE5A 3O41B 4UMSA 2OL3H 3DOHA 4ZT1A 5FGBC 2WWNA 5E51A 1WWBX 4K3GA 4FFYA 4MCZA 4QYOA 5L8KB 1H3WM 1NCJA 4JM2F 4YHZL 2XNAA 4XN8A 3MRBB 1G4RA 3LRHA 5CN1A 2COVD 5E56A 5IB4A 3T71A 2EIZA 2O6EA 4MXQC 2QGCA 5IBLC 3QJTB 5MP6H 2BP8A 3LKNA 3CFCH 3VJ6B 2UY6B 4HT1L 4JKPH 1MH5B 2YIHA 4JO1L 1MHHB 3FYEB