3AUWB

Cytoplasmic domain of inward rectifier potassium channel kir3.2 in complex with cadmium
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
175
structure length
175
Chain Sequence
TLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Inverse agonist-like action of cadmium on G-protein-gated inward-rectifier K(+) channels
pubmed doi rcsb
molecule keywords Potassium inwardly-rectifying channel, subfamily J, member 6
source organism Mus musculus
molecule tags Transport protein
total genus 29
structure length 175
sequence length 175
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3auwB00
5KUKA 1N9PA 3SPIA 3ATAA 1U4FA 4KFMA 2WLIB 3AT9A 5KUMA 3ZRSA 3SPHA 3ATBA 2X6CA 3ATEA 3JYCA 1XL6A 2E4FA 2WLNA 2WLLB 3SYCA 2QKSA 2WLIA 2X6AA 3K6NA 2WLKA 3SPJA 2WLHA 3SYOA 3AUWB 3ATFA 3ATDA 3SPGA 2WLLA 3SYQA 3VSQA 1XL4A 3AGWA 2WLJA 1P7BA 3SYPA 3SYAA 2WLMA 1U4EA 4LP8A 2GIXA 3SPCA 2X6BA 3AT8A
chains in the Genus database with same CATH superfamily
4PWIA 4RQQA 2EXWD 4ABWA 1YEGH 1RZ8A 3U0TA 5C0NC 1A6WL 2QPEB 4JY4B 5HD8C 1QQDB 5D4HA 2M26A 3U4KA 2H7WA 4M43H 2BOCB 5SWQA 4JJHA 4F7KA 3AREA 3ZO9A 1NAMB 1EXGA 3RVWC 1WZ1H 4IDLA 4FFZL 4OCNC 1UXWB 3O3EA 3O8XC 3AFLA 5C0JA 2O6PA 2V5TA 4RAHA 3L6FA 4CC1A 5BV7B 3VGBA 3MLVH 4TVPD 3T08A 4ZPTA 1G9MH 5IW6B 4ICXA 4P23D 1CU4H 3MNZA 3WKMH 5DZPA 3B2VL 1OAZL 3RWDB 4YJZL 4XO8A 1MFEL 5IT2L 5KVMC 3VXNB 3VWJD 3W9DB 4XCEA 2IGFH 4YZWA 3DYOA 3QE5A 4KTYA 3UC2A 4HOWA 2VLLA 3CFCL 5CJOH 4OGXL 3LKSB 5I19L 4ZBJA 1RU9L 3R7QA 4XCYB 2YZ1A 1RZGA 5DS1A 3C2SA 3VWJA 1RXLA 2VC2H 4KQ0A 4WTQA 4L5FH 1PMYA 1T5XA 4GQ9L 2Z4QB 2CJTA 1GYWA 4FQCH 2J1ZA 4JFHD 5IMKB 3EO1B 4WHTB 4QRPE 1J8HD 5B22A 1F4YL 1M05B 3HE6C 3NZ8A 1S2EA 4RAVB 3UG4A 3CN4A 4MGXA 4QEGA 1AY1L 3QQNA 4WU5B 3E0GA 3GHBL 1P4BH 1RUAH 2GPZA 3KDPB 3IS0X 1MREH 4AQEA 4FE9A 2VLJE 5C0RH 1J8HA 1TTCA 3OKDA 1L3WA 3BSHA 4HLEA 2X4RA 4X5WB 1T66C 5D2NA 3MBEB 2H0PA 3G6JE 4LIQH 3LDBC 2VKWA 1BXXA 3HZMA 2NQCA 4KHXL 4R90L 5CILL 2A74B 4HLJA 1ND0A 3BHBA 3HI1B 4JANB 4Y5XB 5FGCB 1FO0H 1D2OA 4LBEB 4O51B 1KJ2B 4F7EB 1QZNA 4XNAA 4CVZA 1D6VH 5A2FA 3E80A 3LRKA 5B1JC 1XGQB 2QTEA 2Z31C 1FVDB 2ZCZA 1O9VA 3FH7A 4CBPA 5T5FL 4ZTEA 2VR8A 3T09A 1RUMH 3BP7A 4TV3A 4GW5A 1KTJA 3LIZA 4HZAA 3KYMB 5IMMA 2OMNA 3PJSB 2OL3A 5E5MB 5I5MA 4E5XG 1S9VB 3N91A 3OR6B 1S9WB 3VMOA 3L1FA 4OLXH 2P5WB 3GD1C 4JFFE 2BPBA 5IGXH 4LIQE 2NLJA 5DJZB 1CICC 1OGAB 2LLLA 1EK3A 3F83A 2WLLB 1MVFA 2A6IB 1Y1UA 1B0WA 2YN3A 3V4LA 3GBDA 1T6VN 4Y2OB 3UZQA 3OJDA 1SOSA 4B5EA 3COOA 3IFLH 1NAML 3EFFA 1VPOL 1N64L 2IXQA 4HU2A 4QTHA 1XSKA 4N86A 5BV7L 4A39A 4GI6A 4LESA 1B9KA 4GRMB 5C7XL 2VM3A 2Q8BH 4FG2A 5DEZA 1JPGB 2JQAA 1S7QB 4JM4H 3GK8L 1HZHL 1A7RH 3QDMD 4RDBA 4YNYA 5B7FA 3L2MA 1KIUA 2BMKB 5I1IL 4AGMA 1J18A 2QKIC 1SBSH 4PP2B 5HDQL 2AKRA 4PRNB 3RVTC 1JHKH 3S5LA 3ZTDC 4OUOA 4F3FB 2X6AA 3KPSB 5I1HH 2XG5B 5EG6C 3GSNB 5FWQA 5JPNB 2DM7A 1P5UA 4K5MA 4F33B 1J0YA 2W65A 4G7YL 3QDMA 1L9SA 1V3LA 1OWRM 3MV11 4K2UH 4IIZA 1W6LA 3DX6A 5IQMA 4KFZC 1JZ6A 4J5VA 2P7TA 3QJTB 5D7SH 3UPRA 4NNXB 2Q7YB 1ZXKA 4X8XA 2NNRA 3NIFE 3VI4A 2AABL 3D48R 1SYVA 4FNPA 1HDMA 4GO9A 2WK2A 4PWGA 3JYCA 2FECL 3MLTA 4QHMB 4EI5B 3W2DH 1AO7B 3IU4L 4XH2B 1I3RB 5F1IB 4KRPD 3HUJF 4LCWE 1G4MA 4KX8A 2QBWA 4QY8A 5F7AA 4F8OA 1A3RL 2HFGH 5FYJL 1GW0A 1H9DA 4UIMB 1G6RB 1G0DA 1PKQE 4HUXB 3SDCD 3FFCE 4KVCH 4K8RL 1EUUA 1Q9WB 2EE9A 3MRKA 4GXUM 4Z3IA 5L2KE 1RULL 2MWCA 3QBTB 1KJ2L 3IBOA 1WUNT 1ETZA 1MEXL 2JELH 3G6DL 3BP6A 3P0VL 4W1TA 1V10A 3SDCA 4J2QA 3VD4A 1J0JA 3AY2A 1I1AC 4F8LA 1F4AA 3M17B 4IOIB 4QRTB 5CNHA 2CJ3A 1NDMB 1H3UA 4YQXL 4K5LA 1FZOB 2WYIA 3AWGA 4Z7VB 1FBIH 3H9ZA 3HAEB 4M7JL 3V0AC 3AQDA 1LMKA 4HFUL 3RWEB 3UO8B 5I8CB 2XBZA 4K23H 3KLKA 2QQKH 3AG3B 2YKLH 4PV1C 2V9UA 1IGFH 4NN5C 2R7EB 2VLMD 4EIZC 4JPVH 5IVXB 3T2LA 4JAMA 5ITBL 5HYJE 4ZO9A 5C0GB 3FO0L 1ZOXA 4X98B 2OZ4H 2OYPA 1NSNL 3L08A 4FLHA 3CIQA 3MNMA 5AVWB 3HPJB 1UB6B 3NSXA 4K7PX 4RWYH 3WY3A 2NTFB 3JT0A 5JYMA 1MG3C 1XGPB 2R1YA 2PYED 4B9JA 1UXLA 2WLMA 1R3JB 5MI0B 1WBZB 3FQNB 4DAGH 4GUCA 4JG0H 3ZL1A 5L4FA 3DGGB 2PCFA 4LSQL 4CC4C 1RPUA 3NCFB 1HN1A 5HY9A 2BRRH 1OW0C 3V5DA 2Z35B 4BKLA 2CCWA 1KBVA 2E9WA 3C75A 4OF3A 3QQ3B 4LOFA 4UDTB 3ZXAC 4JPSA 3BC9A 4NHUB 1ZIBA 5KSAA 4UB0H 4OKVB 3GSNL 1TNMA 1XQ4A 4D7BA 1XB6A 1NCWH 3ZGIA 2MSPA 3KXFE 4JRXD 4TKWA 1T04B 3RHWK 1MAML 5IW1B 2ZZUT 5L8LB 3LS5H 3VVWA 2AEPL 2OMVA 2ADIB 2BIPA 4LLQA 3GRGA 3LRHA 1E2VA 5A7EA 3EGXB 2J7LA 4HUUA 4FI8A 5I1LB 1FI8C 2CO3A 3ARSA 4GLRI 2I5YH 2COVD 2H6PA 2FEEL 2WTRA 2CZNA 3I6SA 3IJSB 2XXCB 3E7JA 2IBZX 1I3UA 1TKWA 1U33A 2QQNL 5JHBA 1ACZA 5MEPB 4YHOH 1I7UB 4OJAA 4KX7A 5BJTA 2C3HA 3IMUA 4WWOA 1NIEA 3CFEB 4QRBA 3BZ5A 4BK5C 1QI3A 4ATWA 1OIOA 3RQ3A 4C4BA 1G6RL 5JUEH 4AEHH 5KVGL 1QACA 3MJ6A 1BIHA 3G6JF 3PL6D 4NQED 2ICEC 1AP2B 2XQ0A 1J0HA 2NY6C 1G9EA 3X13A 4P4KD 4LVHB 5AOLA 5JDJA 3S3PA 4U3CA 3RAJL 3PL6A 2YD0A 2IIJA 1I8UA 1MZZA 4NQEA 1KN2L 4UOQA 2XQYK 3RB7A 1QRKA 1P0SE 2Z9TA 3P3UA 4LOVA 3BIKB 4P4KA 5KYWB 4P3DB 4QXUH 4DOHE 4AH2B 1ZT4B 5IFJA 4EQ2A 3F5WA 5HTSA 3L7FB 3HCVA 1F4HA 3AXLB 4U1HA 2IPUG 1HESA 2VXVL 2EH8H 5DJYB 4A2FA 1E90A 2P1YA 5AW4B 3ATAA 2VE6A 1NLDH 5CWSB 1G6VK 3U4AA 1JZ3A 4MXQC 4WUUE 5AW2B 3IDJB 4HWNA 4QJ5B 5F7NC 3ZN6A 1E42A 4W4OA 4B9CA 3STZA 2DN7A 1INQB 2P80A 3IDXL 4AK2A 3HBQA 2QLVB 1DQTA 3AADB 4OTXH 3RFRA 3L1EA 3NABL 4LGRB 4GINA 3V0WL 2GJJA 3KPRB 4J3OD 4XXCA 2H9GA 1YEDA 5ETUB 3WTYA 1LO5A 5IR1B 2VH5H 3BGMA 3GMPA 1LE5A 1LO2L 5E9DB 2JJWA 1KEMH 4M6OL 3F01A 3GKWH 3M1OA 2BY3A 4MNQB 4XHJD 1BXAA 3GSUA 5J12B 5F89A 2LFEA 1H0DB 4FG6C 2OJZL 4IHOA 4YUEL 3LHPL 1UCBL 1Z5HA 1RSYA 2BP0A 4MB4A 1JPSL 5AKRA 3ZKNC 3DX9B 1KCRH 5J6SA 4PN6A 2OMYB 3SY0B 1SHXA 3A47A 5DUMH 2DQ6A 2I7OA 3S88H 3RY4A 4BRVA 3AG4B 1KTDA 1JGDA 3O41B 4JRYE 2LE9A 5DYOB 4S1RH 1CXEA 1YY9D 4GP4B 4EZMA 4FA8A 1ZGLA 3T2NL 4P46B 4PJCA 1U91B 1B4RA 4L05A 4WTZG 4G83A 5FGSA 2DL9A 2XV3A 4OQ1A 3FSAA 4R0LB 3QQ4B 1GPOL 3NIFF 5TDPB 5MHSD 1OY3B 2QV2A 4MKMA 1J05B 2GUOB 1R3KB 3IDIA 3N85H 1NBVL 1LMIA 1FP5A 2LR4A 2X53A 5MEQB 1IAIM 2OMBA 5EF1A 4OM1L 3EOTL 3UH8A 1G7HB 2WP3T 4HWUA 5FFGA 3ARZA 1I7RB 5B3NA 5HDBE 1BM3L 5IJCC 5E6SB 3SSGA 1NCOA 4YXKL 4ZODA 4EF3A 3BEVA 4BDVA 4HKBB 4Z0XA 4P2QD 3NRPA 3MV9D 4NKMA 2V0AA 1QHQA 2ZXGA 2IDQA 3MUHL 2P24B 3RVXC 1TFHA 4DPRA 1BQSA 3VB8A 4ZJ9A 2XX1A 4XO9A 4E9RA 5F9WB 5I1AA 1G9NH 1BD2B 1FHNA 3II1A 2ZKHL 4P2QA 4N0UA 4EQ3A 4F91B 5A3IC 4OBRA 4YSDA 4Z3EA 2BDNL 4OCRL 1XR8A 4FMFA 1RZKH 4O58L 2FSEA 4NEHB 3QRBA 4JFOB 4IBTA 1S7SB 1N67A 2BVOB 2I07A 3V0HA 4KKPA 2VN5A 3RJQB 3NCEB 2AJYL 1VENA 1NLBL 3B56A 3LY6A 1KT2B 3OKMB 4PJ6A 3BT0A 3BT2H 3LD8B 4QRFA 3WFCH 2CBPA 1U8MB 3EG9B 5C6TL 2F68X 3U30C 4L18A 1TTFA 2ROXA 1L9TA 3N9GL 4R2GC 3MUZ1 5DJ8B 4QXGL 4H1LG 3QWNA 1FNFA 4QXWA 3T6XA 2V7NB 3PP4H 3BPOC 5BXFB 3RNQB 5DLLA 3VXMB 1UXSA 3TT1H 1OAQL 1H3WM 3AY4A 5F96L 4N8VB 1AD9A 2B1OA 2BJML 3C5ZD 1JP5A 1W91A 5GGVY 1FL3A 2EADA 2H1PL 3HG2A 1U4FA 1D5RA 2FNWA 1JGUH 5B1AB 3PQYE 3B2MA 3P2DA 1CF1A 2V2XA 4NAJA 2MOVA 2EVFA 3C5ZA 3WFHB 1TJHH 1LEGA 2BHYA 4G42A 2DWEA 1A14L 4F24A 1KEGL 1WPCA 2G5BA 2WLYA 1RZ7L 3QJXA 1U30A 4H8VA 3ISRA 3A21A 4AVIA 4P9ML 1O6TA 3DRQB 1MRFL 3N06B 2R0ZL 4XX1G 4AWJC 1M7UA 2Y1ZA 1HSBB 1DLHA 2P8MA 3CFKA 3ZE0E 3EH3B 2XQYG 4FXKC 1BZQK 3MNVA 3WEMA 1XF5B 3SKJL 5KAQF 5D7IA 3GI8L 4BH7B 1XIWD 1ZSHA 2HX7A 2JI3A 3GJFK 5BS0D 4Z7QB 4MJID 3U6RA 1MCPL 4PW9A 4NP9A 4OLVH 3A3YB 3QEGL 5DQJA 4HHGA 3QUMA 1YUHA 4Z8FH 4XNZC 5IJBC 3B9AA 1SPDA 1W2KT 4HJIA 1QBBA 1XIWA 3H6JA 3CU7A 3I2CH 1KCSH 2I24N 5BS0A 4HQQH 4MJIA 1KB5A 4M7LL 4Y8AA 3SIKA 3RWCA 3UGUA 3BRFA 2FGWH 1BZ9B 3HG0A 3SJVB 2EDLA 2GEEA 1JMZA 4ENEC 5I1GH 1U41A 2H0FA 3GNML 4TL5A 4YSQA 2MH4A 2AV7B 4UIKL 4M56A 3D30A 1DN2A 4G71B 4NBZB 1VA9A 4ZPVB 1JVOA 5CS7A 2Z7ZA 3SYOA 5I8OL 4OCWL 2V9QA 1C7TA 4HIJA 5EBGA 4HCRL 4W9IC 3O6MH 2AJXL 1QFPA 2A6KB 5FYKH 3SDAC 3SGEI 2H26A 4Y1AB 1W9XA 4ODTL 3WNPA 2Y36L 2JI1A 2V2WB 5CZVL 5IHLB 1OALA 1DL7L 4TPRH 4UYQA 2PO6D 3EJCA 4LL9A 1Z9SB 1YJDC 1U3JA 1IEAA 2MNUA 3CZKA 3F7YB 4KKRA 3U7YL 2EDWA 2E7HA 3GBMH 3IGUA 2BVPB 4Z3HA 5EA0L 2FT6A 4ODXA 1KWGA 1BQLL 4JO5A 4JK0D 1QD0A 2PO6A 2NPLX 3WS3B 3OKOA 2P48B 1SJVA 1GSKA 1THAA 2XDHA 4I9WD 3TYGH 3EOBB 5J6GA 3JWNH 4PJCE 2FO4B 2PW2A 3ABLB 3HB3B 4XE0A 1JN6A 1MHHB 5EDSA 1WAAE 2P8LA 3ILPB 4EBQH 4YDZA 1BAGA 3VA2C 3OB8A 3UTOA 4DEUA 4I1PA 3VI4F 3FCGA 4JCWA 3BXNA 4MA3A 4FXTA 2C3GA 1EZSA 1F6AB 4HHWA 5D1XB 1GTNA 4P5SA 1I1FA 1RQ5A 4LOUD 2H47C 3LPPA 4DKFH 3OAUL 1HT6A 4PMFA 4FNLH 2FB4L 3S0PA 3CNKA 3F7LA 3T1FA 3TH3T 4E41B 1BXVA 4MD5B 4Z76A 1K5WA 2F8VA 4DN4H 4KH2A 3GIVA 4LSTH 5GS1B 4NUJB 1K85A 2QADC 3P4MA 1J0IA 1CFNB 1Q90A 2EINB 3CC1A 3JWNE 4Y2NA 2QSVA 5IROC 3S97C 3WY1A 2NY5H 5E4EC 4L8BA 1WWWX 4MBOA 2DQTH 1OK8A 1UD4A 2NXZD 1MLBA 2BLFA 1TENA 4QHUA 3CDFA 1LK2A 1FE8H 3QO0B 3BZFB 2MQ3A 4HMEA 3IDYB 3MRDA 2G9KA 2CBMA 5CFHA 4MRBA 4XNQB 1O5DT 2PKDA 1F8TL 1S9KC 4QHLA 3OKKB 3G7TA 3Q6FA 4C83A 2FX7L 4DQOL 1DR9A 3RL1A 2FLRT 4OVUA 2ZOUA 5EBLA 4U1KA 3IJHB 4Q14A 1K8IB 4Y16A 4KQ4L 3VWKC 1I7TA 2J6EA 1TTBA 1NL0L 2OTWA 3HMWL 3V6ZA 1WT5A 3TJHC 2VQ4A 5GZNC 1NCIA 2QVTA 2AJUH 1NZRA 4X8GA 3ZYIA 4D7PA 5C0BA 1SFDA 5HGAA 1KTRL 3P30H 3MU3A 3O0LA 2FTAA 4IRJD 1WBYB 5I1KH 4HMCA 4RMVA 4WI9A 4HJ0D 3V0VB 1KIPB 3KYKL 1F42A 4JZJC 2FUQA 4J6RL 3FHAA 1A7OL 3V7AE 4ZZKA 3L7EA 1GGBH 2VDPH 4HKXA 1XD0A 3H9HA 1GTFA 2DYPA 4PJ8B 4JZOB 4UQ9A 4OZGB 4NO0A 4APQB 4NQTA 2Z7WA 4J3SA 4WSJA 5EOQL 5IREA 5I0XA 3OR7B 2BP3A 1J0ZA 1U95B 3JV6A 4WU7A 4HZLA 5JOEA 3BWUF 3CQFA 3L95A 3ZMRA 1ADQH 1Q4NX 2A6DB 1OCWL 4EZJA 4DTGL 3LEVL 3MRFB 4BFJA 2NXYC 1U8PA 5K33A 1BF8A 1I9JL 5I30L 3MRRB 3A22A 2GCYA 3MBXH 1L9NA 1EQWA 3TBWB 4P5MB 1SVCP 2GIMA 3A4DA 1IU1A 2K3TA 1YEEH 5LO7A 1OD7A 1ODAA 5SWZE 5EU7E 5EUKB 1JZFA 4JFZH 2Y6SD 3TCLB 2CGRL 2OK0H 1TJGH 4ZS7L 1IAKA 5EC1A 1RJLA 1N6QL 1DQJB 1KIQB 4DW2H 3T0DA 5JNYB 5JA8B 2VWEC 1TQSA 2GEQA 3U46A 1HNGA 1U0QA 1YG9A 3DXAE 3E6HA 1MW3A 3Q6GH 5JW3L 2V7HA 3FRUB 4KO7A 4MAYC 4S1SH 5IB5A 1P2CB 1QA9B 3HC0B 2IADB 3TZVC 5L6YH 5IKCB 2O61B 4FADA 4AM0B 3DTUB 1IT9H 2E86A 4V11A 5I18L 2D3NA 3MQIA 1EDHA 4XVJL 3GXMA 4N8CH 1MJUL 1MHEB 4RNRB 3ZE0F 5TE4L 1PBYA 3ATEA 4ZUUB 5I15L 4MNHB 3TVMD 4YBHA 1NMBH 2X1OA 4HKZB 2H2PC 3PDGA 4Q9BA 4KMTH 1E4KA 3WFDL 2WIIB 4F7TB 1Q0XH 4ZFFA 3ULUE 1YEIL 3NPSB 5J06A 3T6ZA 4X7SL 4ABUA 2X38A 4XO4A 4UTAL 1ZLUK 3TVMA 2JTYA 3QEQE 4PGCB 3VH8A 3HRZB 3B3IB 5HJDA 4FXGA 2N59A 1Z5YD 1EUTA 2UZYA 2DV6A 4RFOH 4D0DA 2XZQL 1AXTH 3QNZB 3VTTA 4OFYD 1BQ5A 2EE3A 3SE6A 3OKEB 1P4LB 3SO3C 1O7VA 3HW7A 2B0SL 5IB2B 1QUNA 4U0RB 5TE7L 4D0BB 2K45A 1VEMA 3LZFH 3NN8A 2FQEA 4OFYA 1WP6A 4ZNCD 4X0NA 5D8JL 4WLCA 1OE3A 5IJVB 3DX1A 1VADB 1ZANL 4UOZA 3WHE0 1Q72H 4BE6A 1ZVSB 4HH8A 3BWAB 3DIFB 4H5SA 1J8KA 2AQNA 4YHML 1A1NA 2WXIA 1JGEB 2XTSA 4J3OF 4P5TD 3EBHA 4PQXA 1QSFB 1FNGB 5E1AA 1T4KB 5FHBL 1UWXH 4X9GA 3ULVC 3TONA 4HA1A 1H3TA 1OV8A 4P5TA 4EOWH 3CZGA 4C58B 1MSPA 1A1MB 5TK4A 2WLZA 1T5WB 2ITDB 3IJYB 2IDCA 2IEPA 1AGBA 1RJYA 4PJCF 2UX6A 3SDXA 1WTLA 4ES8A 4TQHA 1WBXA 2DQEL 3SN6N 4X4YA 5C0CD 4RVBA 4F8QA 5EEZA 1NBYB 2KLTA 5HYIA 2ZKYA 3Q8FA 4MA8L 3DUSA 4G8FA 2V8MA 3NSCA 4BKSC 2FGZA 3K2MC 1F2QA 2I26N 4RSVA 4TMPA 3UTZB 5C0CA 1JFQL 1FJ1A 2CO6B 2PP8A 4L3ED 1AJ7H 1HC1A 2RQ8A 5GGUA 2JQMA 5KYUB 3CG8A 1DBKL 4LCUB 5DWPA 4FCHA 5F7EL 2WVVA 4FEIA 4XE5B 2DWYA 4TNWF 1F1AA 4YDJA 2EABA 3C6LD 4L3EA 2CPUA 2GSIA 4IRSC 3UYPA 2BZ7A 5TGBB 3MRCB 4ZUSB 3TA3B 1WICA 3LZRA 1UWGH 3FFDB 3V0JA 5FO8A 2ZKXA 3SKMB 1H3VA 2VDKH 1A4BA 1JL8A 5BO1L 4NUPA 3FOLB 3FQ4A 4G8GB 3IJ7A 4JE4B 4YPGB 2L7UA 4GEIA 2JMRA 4MXVE 5CJ5A 4KNTA 1GCFA 4OD3L 1KXVA 2WSKA 4HXBL 5FPIA 1HI6A 4N3TA 4NYLB 4TSAH 3B6SA 4JPWL 1G7MB 4WHYG 5JW5A 3M07A 4F27A 5HYQA 3HNSL 4PJAA 1BW8A 3D39D 4MQXC 4XP4H 4FI7A 3WIAA 2R2HA 3KPNB 3V6OA 2DD8H 3LKRA 4RX4A 1V5JA 1IGTA 2G3NA 1NKRA 1C5DB 4YGVB 1KCWA 5I6OA 5IIEA 5FO9B 4U05A 3UMNA 4TRPH 5D7JD 1E27B 2Q8AL 3VFMB 1WDAA 1AR2A 1L6ZA 1WC7B 1HHHA 3DMMD 4TUJB 1WWAX 3KEDA 1XH0A 2BSBA 1TLKA 4H2AA 3WFEH 1N10A 5D7JA 4Z3GA 5LCVH 2HVJA 5EZIH 1UURA 4PYHA 4BK4A 4OLUL 1E4XI 4OVVA 2VJ0A 1L7IL 4OFDA 3SZKC 2NQDA 1NCGA 4B50A 7PAZA 1E30A 3DMMA 1HILB 2IMMA 4HV8A 5JO5B 1TTUA 1WFJA 4M7KL 2X9XA 4QOKD 3QJUB 1CI5A 4YHZH 1KTLB 1I8IA 1R5WB 2D0HA 3AMLA 3D1MC 3L9RB 4PP1C 5A16B 5L4IA 2R23B 2KDGA 1E65A 4N68A 2HT2C 4EN3C 1G1KA 1X7TA 3B2UD 2WP3O 2R2EA 3PWVA 4PCTA 2JQZA 4MCZB 1LDSA 1A6UL 2GG1A 4LEOB 3T4AA 4DPBX 1ZRUA 4ADIA 3C5JA 2F54B 4BQ6A 3FUIA 1IZJA 3FBKA 5AD0B 1NGWA 4XPGH 1OQXA 3VMPA 4BD4A 2DJUA 3QARA 1DDHA 1E8YA 5D7IF 3OPZH 3QCUL 4JHWL 5INCA 1DJHA 5FM5O 3PE9A 5CD3A 1XCQB 5BMFH 2J4WH 5EEWA 3AG2B 4OZFA 1T83C 3RGVD 1YQVL 1XGRA 4KK9C 3ZKQD 1S5IL 5E7BA 1SEQL 3KPTA 1MAJA 3ESPA 1RD6A 4UDUB 4CC0A 5KBKA 1A6WH 5HGHA 4DSYA 4JM0A 1LILA 1LQSR 4K9EL 4MD0A 4J12A 1T20B 4IGBD 1BV8A 1XV8A 4GAYA 3HR5B 4IEFA 1ZLVK 3HC3L 5JYLA 5DHVA 5E95B 2M8XA 3NQKA 4JFQA 3UO1L 4BZ2A 3CFTA 3QUXD 3RJDA 3DRTB 1R24A 1TZGH 1CYWA 1F90L 1ZT1A 4IGBA 5ISZA 3RI5K 4GMTH 5HHXL 1G1CA 4N6RB 1NBZB 4XCCL 7FABH 5T1MB 1WFOA 3M7OA 3ARDD 4E36A 3B2VH 3ULUF 1OAZH 4L3FA 3TPUB 2VR6A 1UUNA 2J8HA 1ZAGA 3QUXA 5BOJA 3EO9H 4JJ5B 2JI2A 3ECBA 4QT5B 5EB9A 1X5GA 3SKNA 1QR4A 1P84K 1OM3H 3CFCH 3L5WB 3NFNA 5I19H 4PG2A 1RU9H 3L1GA 2YXVA 4XO3A 4GAJL 3ZTCC 1PIGA 2X4SA 5HGBB 1DTUA 1L0YA 2M1KA 5F7YC 5TDOA 4GQ9H 1P7HL 1B3JA 2A7BA 1JGVL 3D5OF 2A6JB 2X6MA 4ZXBB 3KLDA 1WCBA 3IJEA 5DJDA 3IGAA 1USZA 2XTLA 1EMTH 4FFVD 4Y4HA 2ZOWA 3JUYA 3O8XB 4JO3L 4BQBA 5BRZD 3RB5A 2NY0B 2OZNA 3R06A 1X5XA 2QPFA 4XAKE 3WJMB 1HNYA 5F7UA 4F2MA 1ICTA 4JREB 1OTTC 2YOAA 3QZPA 3L3KB 2QMJA 4L8DB 3N1FC 3NK4A 4L9LC 2HRHA 4W9EC 1MH5A 1CF8L 5ILTL 4JKPH 4G9DA 4YDLC 4YDIH 5BRZA 1BYPA 1CYXA 2AEQH 4ELKA 1BQUA 4RZCB 1IARB 1H6EA 3EO0A 4R90H 4WKZA 4BFIB 1Z1WA 4FZ8L 3K0WA 4KHXH 3I02A 3Q3GA 1CL7L 1HXKA 2YFNA 4XMZA 2CUHA 1BJMA 3SKOB 2LVCA 4PBVC 1KY7A 3H9SB 4MCYB 1HHIA 3TH4T 1RVFH 4E2OA 1XZ0B 3SPVA 5AOKA 4F58H 3RGHA 3LEYL 3CZFA 5LBSL 2Q10A 4U2ZA 3RA7L 2I85A 2NCEA 4B27A 3RIKA 1U8QB 5IM7A 2IQAB 2Y7QA 3H7BA 4OW6A 4Q2ZB 4X6EB 1MVYA 3HE6B 4RGNE 3UBXA 1HWHB 3AUVA 4AMKL 4UZSA 5INDB 4PJHB 4ZO6A 2MQCA 3OHMB 5ITFB 1Z5LB 3GUTA 4X7TA 1MCIA 1BFOA 1FZKA 3EFOA 4HIIA 2AI0L 4KRMB 4LNRA 1E3XA 2R29L 2DOCA 1IJ9A 3LDBB 3G08B 3W11D 4ZMYA 1L5GB 4ZFZB 1UEMA 3OKLB 2O5NA 3I6KA 4HUKB 3IU3A 3QO1B 5AUMB 4KXCA 2AK4B 3P9LA 3QCTH 2CU9A 2YGVA 1N64H 1AGCB 3UAJC 5IQ7L 2Z31B 3MA7B 4YHNA 1AZVA 3FFOA 2K8QA 1LEIA 3JTTB 1KGJA 2YRPA 3JV5A 4NGHL 1OGTA 3TT3L 1HZHH 1W0VA 2X1WL 2YA1A 1XD1A 3HBPA 3AMKA 2PPCA 2AJ3A 3MV7B 4GRWB 3WJLA 1W8EA 3SE9H 4JMXA 3HS9A 1BG9A 4JFEB 3HI5L 1D6EA 4JFFD 4H8WL 3L3JA 2C1OA 4IOFC 4A7GA 5I71C 4R7DA 3Q5OA 4W9LC 4IKKA 2BSRA 1YMMB 5G55A 3PV6B 2DM2A 4Z77B 3D85B 1OK0A 5EU5B 2GJZB 4JHVA 3WNKA 2YAFA 3VCLB 3TBBA 3NJXA 3B5TA 2NUTA 3KL3A 1KLUA 4IYKA 5TQ2H 1VRSA 1FO0A 5EFIA 2EC8A 3DVGA 5GZOC 4FHKA 3O3BB 1IC1A 5DFTA 5SWSD 3FF8A 4H20H 3IU4H 4R97C 2DQFA 2UZIL 5BRPA 1HHKA 4ODVH 2MPVA 3CLEL 1NFIB 4K73A 3F7QA 4A7TA 2B1HL 3AREC 5FYJH 2D0FA 5F2FA 2QKIB 3DSFH 5SWSA 3LZOA 4LLYB 4KZCA 4C4UA 5GS2H 4QI3A 3SPJA 1MHCA 43C9B 3QR1A 4QRAA 2CO7B 4X6DA 3NFSL 1T1WA 4A2MA 2QMKA 4A2EA 2RCSH 4YZFE 1B4JH 1KJ2H 1ZLDA 1ZVNA 3AS0A 2EE0A 3G6DH 2X89D 3I6LE 5ESAA 4YBQD 1L0PA 4LEXL 4PY7B 3BKJH 1UHVA 4IRZL 4XAWL 1XH3A 1S8DB 4PV9A 4NCC2 3HMXH 3RE0A 3MRQA 4WRLA 1XX9C 4JQVA 4ZTPH 1S5HA 2GFBA 4N5EC 3QI9C 1YNTB 3OC5A 4JFWA 1I3VA 3MLZL 3QFJD 1KB9J 4M9OA 4Y1TA 3VWJC 5GGTH 3CH1B 3FT9A 1NBQA 4DIXA 4ZMQA 5FYJE 3WE6A 2GK0A 2Y07L 1YCSA 3OX8B 5E6IA 5F93C 1DUYA 1PL3A 1ZHBA 1CFQB 2Q6WA 2WBJA 1SXCA 3QFJA 5CR1A 1ZEAL 3FO0H 5T5NF 4AYFA 3FSZA 1NSNH 2SEBA 4NZRH 1EBPA 1MFCL 3U4EA 4KZDH 4H8QA 4ONGH 3CUPA 3BUYB 4L4VB 2R15A 3T65A 1ZK9A 3VFWA 4Z3JA 4FRWA 4PS7A 1KELL 2K7PA 3FO1B 4POUB 4GG6A 1O6SA 4ISVA 5KWYC 3BDYH 4JZNB 5H35B 5HPMB 4XZUA 5ACZB 4PJ7B 1C12B 5JW4M 3QQ9D 4F9PA 2IANB 5IUCA 1D5ZB 4PJ9D 4TOYL 4J3UA 4Z95L 2ZPKH 1NBCA 1GAFL 1WJ3A 4GAGL 4M1GL 4XBMA 4AJ0A 5DMYA 4L3CB 1KB3A 1A6AA 3HS8A 1LP9A 3P4NA 2NY7H 7CGTA 1FH5L 4WFEE 4PJ9A 2ODHA 4LKCA 3FSWA 3T6WA 4BA8A 5IWLA 1H9VA 4CRPA 1S7VA 2SODB 5AAWA 3U0PA 2Y5TB 5I17A 5HYJD 1MVUA 1AR1D 5CCJA 1FG2A 3RX8A 2E7LC 4QWWD 3BWSA 3U48A 1RK7A 1IFHL 3G9VA 4A55A 1JYXA 1G7PA 2BVUA 1OCZB 3X3FL 2HMID 4ZW7A 2BOBB 4HXAL 3VD1A 1I8MB 2ALWA 4X4XA 5MP6L 4W9FC 3SDDC 1KV3A 4AXWB 4Y2DD 3H55A 4OGYH 5AW9B 2WB1A 3HKZA 1LDPH 3QWOB 5KN5A 4ZMOA 4BUQA 1TTGA 1JV2B 2X1QA 1VDGA 4GQPH 2DW5A 2H32B 3RVUD 4LAJH 2V2TA 1UKTA 4ILDA 4Y2DA 3NFPB 2Q5BA 2VNCA 2HFEA 4YLQT 1G6RH 5KTEL 2NX5D 2I9TB 2X4UB 3LQZB 5IF0A 4PW3A 3W0WD 2X4PA 2XZAH 5E4IA 2IAMC 4G9FE 1II4E 4XPTL 5T3XL 3VG9C 4H1LB 1SM3L 2NX5A 3T4YA 5A2KH 3RAJH 2E8ZA 1MNNA 3W0WA 5IOKA 3KBEA 2K1MA 3UL4A 3VXRD 3EJZC 1I1YB 1FPTH 4U6XB 4OI8A 2VQ1A 1MFBH 3HAEH 2JB6A 1AO7E 1BCIA 5E24E 5K9OA 4J4PC 1U8KA 3HZVB 5EIQA 4TN9A 3VXRA 4NENA 5C97A 4KTDH 4Z3TA 2VXVH 4ZK8A 3VG0L 1TETH 3S37L 2ERJC 2VJXA 4MJ6B 3O6FD 4BFNA 3I9AA 1IBDA 5KVGE 4PJAF 4I77L 4XNDA 2XG4A 2OTUB 4MD4A 4X5QA 1JXJA 2YJQA 2IOOA 4YIQA 2ICEB 4WAFA 4JPIB 4EXKA 1HQ4A 3O6FA 4OJCA 2CJSA 4DUWA 1HWGB 3NABH 3WI9A 3MSPA 1CBJA 3IKKA 1TEGA 5IVNA 4NM8H 1N0LB 1QLRA 3MYZA 1KXQE 4M6OH 2KI6A 2WUCL 3FBQA 4Z7VE 3SCMD 1EERB 1IAMA 2VUOA 3DBXB 4EI6B 1HYSD 5F7KC 3LHPH 4KI1A 4LL1A 4MFHA 3MACL 1CLZH 1JPSH 5D1ZB 2OM5A 4BJLA 3OF6A 2NQ3A 3LH2H 4PJFE 2KZKA 4QJ3B 1FGNL 4QYOA 4D9QD 1N3NB 1F3DH 1J1PH 2ATKA 4GRLD 4PS8A 3SDCC 4IBWA 3SCMA 5KUKA 4Q97A 3C6EA 5IVXE 1I4FB 3T0WA 5EZLB 1EAQA 2MOQA 4X6DE 4IDJL 4YWGL 3QUYA 3FTGB 2J57A 2DJSA 3EOAA 3WTVA 4CUCA 2XV6B 4GRLA 3P2TA 1HSAB 3IPEA 4WGVB 3HNTH 3AS2A 4ODWB 1MELA 5CCKL 3MRLA 3QEUB 4XRCB 4YHIB 5CKAA 3S5ZA 4X6BA 1JNJA 1IFGA 3VRIA 1YA5A 4AL8C 2BS9A 3PHOA 2GBAA 3L5XL 2XN0A 4LAQL 3X1GA 5KVFL 5AKTA 3ZIMA 5IB3A 1X5HA 2CO1A 4CAGA 4K3EL 4Y4FD 4V2BA 4M4RA 3VYOA 1M57B 4B9FA 2EO9A 5EZJB 3GEFA 4UILL 4FLSA 5JHDA 4JHZA 4UM8B 2R56H 3RWGA 2BFVH 1JDAA 1AFVL 1PQZB 2YGPA 3FT2B 2CK0L 1L7TH 2DKSA 4Y19E 4Y4FA 4CNIB 4EJ1C 1KV7A 4YXKH 4Y4KD 1IBYA 2Q2LA 2Z91A 2YRZA 4UV7L 3LV3A 4HJUA 5LNDA 5DFWH 3LKQB 4XPFH 1HH6A 2MPAL 5B7MA 4GO6B 1A1OB 2OX5B 3VXUE 2R1WA 2JFCA 4PV8B 1CZ8L 4GG6E 4ONFL 2CDEB 3EJSA 2UYLB 2ZKHH 3MRBA 4HDIB 4YHPA 5D6DA 4XN1A 3HC4L 5TTRA 4NZ8A 4I9XA 1JZJA 5KSAC 2J5LB 3SQBA 4HCIA 4O58H 5H2BA 5B21A 2ICWI 3CN1A 4LP4A 3BWUC 3H2PA 4WK2B 3HLAB 1RP8A 1IV8A 4UM9B 3VD2A 2B4CC 1LP9E 1DQDL 4AKPA 4G8EA 2AJYH 4Z78A 3NYKA 3AU1A 1G7QB 1JZGA 2ZKWA 4AT6B 3KJ4C 3MRNA 2WN2A 4FYTA 3V4VA 3UTPE 4H0GA 1WFUA 2A2QT 3K1KC 2VLRD 3IETA 1A66A 2VO8A 5DA4A 2QSQA 2JKNA 3CVBA 4A04A 2DAVA 4W9ZA 4JL1A 3QJQB 5KAQG 5EF2A 3EYSL 3Q05A 1YN7B 3IRPX 1PD6A 3HS0A 2R0WH 5I2IB 1MY5A 4X7CC 2VLRA 4L23A 1WRFA 2UY7A 4UBDD 1U93B 1OAQH 4JM2B 1YEKL 2V6HA 5F96H 2BJMH 4HKJA 1VACA 4BWTA 1LK3L 2H1PH 1JPFA 5FF6B 3FZUC 1BX2B 3RGBA 3C12A 1O7DE 3VUAA 3K74B 4HGWB 2D0GA 5ANMB 2Y7NA 1KTKE 4JL2A 5CF3A 3TBYB 4YHLL 2DIBA 5B38A 2PP7A 3K2UL 1ID2A 2H3NB 4XOCA 3KWWA 1ACYL 2JKJA 2C3VA 4P5KB 3KE0A 3GLZA 3VJ6A 1RZ7H 3H3BC 5KZCB 3MREB 4P9MH 2R8SH 5GSVA 2BCKA 1TFPA 2R0ZH 3U30B 3OSKA 3I9IA 2CK2A 4KPHL 4WW1A 3NSDA 2RA1A 2FIRT 4QAMB 4R2GB 3GRWL 1DBAL 2ZOOA 3KPRE 2DF3A 2ZSVA 3LS4H 1F58L 4YSUA 3GEWB 5ESVA 4H88L 4XOAA 1JWUA 2HJKA 1VESA 4MNQE 3KWVA 1MCPH 3S5LG 1F1GA 2XIBA 2HH0H 2D7MA 2PR9A 3H2QA 2PTVA 4W4OC 3V95A 3WSQL 2EAEA 4N0FB 4A6YL 4MMYA 5CMAB 2DMHA 1MF2L 1RIHL 5DHYB 3B2XA 4JO2L 5D7EA 4G8IA 4JG5A 4LDCA 4HS8H 1CTMA 4HOMA 4M7LH 1A4CA 4OI7A 1CT8B 4UQIM 2P45B 2P44B 4G6KL 6CGTA 3DGDA 3FL7A 3MGOA 1KLGA 4R8WL 3GNMH 1P7BA 1CWVA 4JFYA 1SY6L 4UIKH 1TJMA 2QHLA 1X9QA 3V10A 2O1AA 2R69H 4KXZI 3JV4A 5IEKB 1T4WA 4OCWH 4PJ5A 3PDOA 1EEQA 4Q6IC 4XN8A 1OZUA 3HTLX 2DJ4A 1SUHA 3MYJB 1KYFA 3EHBD 3ATBA 5DZLA 1P1ZA 5AVYB 2HPOA 3U9UA 2ZX6A 4W93A 2DQDH 2HJFB 4RISL 4QXTB 5DVMA 1DL7H 1UT2A 4KKLD 4QLRA 3WY2A 5AENA 5LNEA 5E8EA 3U7YH 3ML8A 3L4WA 3QWQB 1RUKH 4XNZB 3S48A 4HIXH 5EZPA 4YK4C 2EEAA 5EA0H 2JKSA 4AJVA 2UY6B 3LYRA 1CD1B 1UXMA 5J6HB 3FMGL 2MQ0A 2BNQB 3BQUA 1XF3B 3CSYB 2G75B 1G7JA 3MJ7A 5BZDA 4HLZH 1VKXA 1Q9KB 1TMQA 4EE2A 2ZG2A 1SN2A 3REWA 4CVXA 3KAAA 4P2RD 2OCJA 2MFNA 5FWRA 3WKPA 3PHQB 4NZTH 1BD2E 4NP4L 1KSRA 3ME0B 4DCQB 3EYOB 4WGKA 2YD8A 5ICXA 3FQWA 1HE7A 4RAUA 2P3YA 1OAUL 1BAFL 3WL9A 5AWNL 4UU9A 2FUTA 3SDAB 3E1F1 4P2RA 3ABMB 5KS9B 1JGLH 5LAPA 2GAZA 2FATL 5JHDE 2MCPL 2Q76A 1JYNA 1NUGA 1QATA 2OMUA 3DSNB 3AGVA 1KPRA 3KYOB 3TNNA 4PJFF 1J87A 1QFWM 1FFQA 3IXAB 5F0LB 3VW3H 3FT4B 5DQ9A 1XF2A 2Q1EA 2FX8H 1T1ZB 3RWFA 4X6DF 2BC4B 1I8LC 3TEZA 1C16B 32C2B 2XVBA 3GSQA 4LLVA 2AVGA 4OT1L 4FZEL 1GZQB 1SJEA 2WBWB 4U31A 4XI5D 4XVUC 2FJSA 3TTYA 4BSJA 2CLVB 4OAWB 5KJ4A 1PJWA 4LCYB 1JJUA 1I3GL 2DQHL 3D05A 5D9SB 1E5CA 1NCHA 1W0WB 3HNVL 3KCPA 4G6JL 5DS8A 1SRDA 1NCBL 5FYKD 4Y9GA 1DQQA 3QGVA 1O6VA 1XEDA 3REVA 4CU6A 1X5LA 4JQXA 3RWJB 4PR5B 2XQBL 1MHPH 3CHXA 3EYQC 4Z7UB 3X14B 4JFDD 5GJSL 5JHAA 2V3DA 2GTWA 3EH2A 3IVKA 1FZJB 3NZHL 4KQ4H 4LVOC 5K9JL 1NL0H 2JB5H 2CR6A 2XWTB 3AY4C 9PCYA 1KZQA 5DFAA 1TVHA 4NS0A 1WISA 4JFDA 2QADB 1QASA 3WU1A 5DK2B 2C1PB 1TT6A 5ESQB 2HJLA 1B2YA 1TCRA 1ZHNB 1ZLUH 2EVHA 2JLPA 5T1KB 5DZAA 2Y3NA 4GG6F 2PR4H 5BOZG 3TN0D 2WLIB 5FOBB 1H5BA 4NKDA 3M1BB 1EXUB 4R4ND 3G5VA 2ZKMX 4CA4A 4U7KA 1UM4H 4KROC 4HK3J 4PWHA 3IAQA 2Z6FA 4Z7QE 5K39B 2BNRD 3L8QA 4O4YL 5HVFB 4N3UA 3D12B 5F7DB 2Q7NA 4YMPA 1X9LA 1FNEB 3BGAA 1LP9F 5EPMA 5EOQH 2BNRA 4GT7A 1N8OE 3DJZA 1Y0LA 4MKTA 3K6SA 3VWKB 3WTTA 1FN4B 3MV8D 1OCWH 2VDOB 3IXTA 3K6FA 4PRHD 3L3DB 3L2NA 1A4JB 3LEVH 4RMTA 3ZVVA 2EIJB 3QJVB 1SJHB 1I9JH 2XWJB 2WQXA 5I30H 4WDIB 4DK5A 1C5CL 4WGWB 2OS7A 3QH3B 5HXMA 3MV8A 2XPYA 3BPNC 1GY2A 1T5KA 4PRHA 3S9DB 4Z9KB 4Y1AE 4YXHL 4JZJB 4K94L 1IGCH 4H4NA 1IO4C 2VW4A 3V0IA 3CIAA 1S9YB 5KYYB 4PLKD 4ZS7H 5FKPA 4E9TA 1JI2A 2CMRH 2HRPL 2L8AA 3QXAA 5ELIA 1JNHA 3ULSA 1OSPL 5DK0B 4LSDA 3SQRA 3MCKA 2F5BL 5EBMA 1IM3D 1A7BA 3H53A 3Q2VA 4P04A 4Y9FA 2QDVA 5DK3A 1FFTB 5JW3H 2MNWA 1XH2A 1E4HA 3P77B 4NC1C 3DC0A 4WV1C 2H2SC 2K9UA 1QSED 3TJPA 3TF4A 3ULUC 4PREB 1X44A 1GOGA 2BHFA 4ZUTA 4ACTA 3ECQA 1C08A 3VFRA 4XVJH 3U2SA 2XKNB 1MJUH 1KFAL 4PJ5E 3SE4A 1CGXA 4HISA 1U3HC 1GC1L 4PWFA 1K8DA 1T2JA 5HGDB 4A37A 3D6GA 4B53A 4J3OG 5AVTB 1IC4L 4DN3L 5E8DH 1E9QA 3RZCA 1AKJD 1U8NB 1YEIH 1RZIA 4OB5L 3BP4B 4MB5A 3NDZE 4X7SH 3RFZC 3PREA 3LPGA 2CIIB 3RWIB 4URKA 1F56A 2WWMD 5C0AA 3KM1A 3VNZA 1AKJA 1URLA 3ALXA 1OLLA 1U8OA 4E41E 4OH2A 4P9HH 2FR4B 5CINH 4LHQB 2Y25A 4CW1A 5F9JB 5DR5L 5GJTL 1HX0A 3OLGA 3CSFA 3FU3A 3CLWA 3GXNA 4U1MB 4XCNA 3MLXL 5CIPB 4NNPL 4WO4B 1PYWA 3QA3B 4MAYB 3TFKD 1DEEA 2YPKB 1A9EB 3IDNB 1X6LA 1U8HA 4LP8A 5KANG 3BYYA 3TZVB 5TE7H 4BFOA 5GIRB 1DJZA 5EU4B 2NNAA 3OV6A 4G6AC 2DWTA 4P4RB 2P43B 1RUPL 5MEOA 3MI6A 1K4CB 1ADQA 4IU3B 4HPYL 1ZANH 1AIFA 1M1XA 2H3KA 1CGVA 3G9AB 2YEVB 4LVEA 3IFPB 1RPQA 5HJGA 4L0ZA 3VSTA 4YHMH 1QG3A 5AVVB 3UTTD 1NGZB 5A2AA 3QEQD 1JHTB 1MPAL 4XODA 2E7BA 2AJZA 4M61A 5CCGE 2H41A 4ZUWA 5FHBH 3BVWA 3W1ZA 1DDTA 2Y6TE 5DTFA 1UASA 2WCPA 1LEKB 4YDMA 3UTTA 4KJPD 1D7DA 4HUWB 4FQXC 2X5PA 3MRJA 1KJMA 2VDOL 4W9HC 2J21A 3D18B 3SO3B 2R4SH 1AGEB 2DQEH 2X12A 4ONHA 1J5CA 2EKSB 4RMWA 5E0QA 5KJRL 1NEPA 1E6JH 4JMNA 4FDWA 4NQCA 2JKIS 2X2YA 1KYUA 5HGGS 3MKGA 5I0DA 2ZX9A 1U8CB 3TF7C 4H40A 4MA8H 4U4IA 3WEXA 4Y16C 1NAKH 2FD6H 3KVDD 1N4XH 3A6CH 1HOCA 3UOAB 1NEZA 3FN3A 3PY9A 4IW4C 3S3BB 2AHIA 3S6CA 1EVUA 3WFBL 4OZGE 5FB8B 3H7LA 1DBKH 4DP9X 3T0BA 3BLKA 3V4PB 1T03H 3EDEA 1ET5A 2A9NL 3Q1EA 4I5BB 4NRYA 3ZUNC 5HI5C 5DD6A 1D9KC 1F4XH 3CSPA 4YHKH 1ZPLA 4ZD3L 2IFGA 2JK5B 4NRZA 3NK3A 4GW4A 4ZTOL 1GSMA 1QLEB 4YX2L 3WN5A 2HRLA 5T8IA 4NT6A 3MRIA 5BO1H 3OTTA 4J27A 3CFDA 2VR4A 1UWEL 2VXQL 4P06A 5KBNC 4KZEL 3DETD 2VAAA 4AUUA 1U2HA 4OD3H 3PWPD 2VM4A 1J8SA 5DI8B 1GKEA 1MIEL 5TDNA 2DEXX 4GG8B 2MCMA 1B0RB 4JDTL 2QLYA 4U1SA 3TV3H 1UD5A 2B8OT 1VGEL 2VMJA 4KK8D 2WO4A 5IB4A 3S96A 3PWPA 2D7OA 2YJLA 3US0A 4JKWA 4E9VA 4MQ7A 3CK0L 2FBJL 2ENJA 3ARGD 2WHVA 4OF8A 5JORA 2DMBA 3O4OC 1A6VL 1TITA 3S3CB 1XB3A 3ECUA 3ZKXC 1FA4A 4IRSB 5H8DA 1U8JB 4F5CA 3GMNA 3ES6A 4UMSA 3SO5A 3ARGA 3U2IA 3DUUB 2QT6A 1A8ZA 1BOYA 3FQXA 3U4BH 1B3IA 3I84A 2NT1A 1FFPA 3LNDA 3MRMA 4YC2C 4JFVA 4OLUH 2DIAA 4UV4H 4BRJA 4QRUA 1ZA6A 1FSKC 3ARBB 3WV0A 3EJRA 1HKLH 3U83A 3A6BL 1TQWA 4YH6A 3NCYS 2FWLB 2HTLD 3L4CA 4PW4A 1S3KH 5HPOA 1FGVH 1CXLA 2WMPA 4J8RB 4O02L 5EBWA 2IF7A 4LLAA 2WZ5A 4BM7A 4CBZA 2CBTA 1A6TB 1C8QA 1E4KC 1M2VB 4ZG1A 5I8KH 2VSCA 4N2LA 4PH8A 4HIHA 5LXGL 4NQXA 3FQUA 4HYTB 5AVQB 2MTPA 1SQ2N 1P6FA 3HUJB 4PRID 4WI6A 4DZ8A 1U8IB 2FJFA 2AW2A 4ODHL 2IVFC 5F9DC 5EWIL 3VXOB 1M7DB 2YPLD 1UM5L 4FXGC 4Y5YA 5F6IC 3LEXA 4JHWH 1BIIA 1THCA 1ZE3H 3L3GB 3U36A 5C0FA 4WUKH 3WEAA 3PNWB 1SXAA 1E8XA 5C0AE 1QSFE 2J1XA 2YPLA 1YQVH 2BFGA 1RZFL 3CE1A 2GYSA 3O9WD 1DSFH 4NZUH 1Q94A 4G5AA 3V4PL 1IGMH 2TSBA 5CSZA 5B3JE 4PJIA 4K9EH 4ODSL 4EN3B 4NQUA 3W81A 3ATDA 2OMZB 4N5UA 3O9WA 4RGMC 3AM8A 2DLFH 3RWHA 3HC3H 1QLEL 1V3MA 3I75B 3BPCA 5JPMC 1EGJH 1JZIA 4MQSB 3UYRL 3U82B 2G4EA 1OSEA 3D3VB 4GFXA 2C7UA 1P84J 2WAHA 1JCVA 1LWJA 3EJUA 4LNVA 2AAAA 1FL5A 2D7NA 1KZYA 1TQCC 4F7CA 3IJ9A 2XXMB 1YNLL 2WAQA 2OCFD 4NSKA 3T8XA 3QZLA 5CR8A 3BKML 2QEJA 3IN0A 1O0VA 2NY2D 1T0MB 3CX5K 4XXWC 4CADB 4GKLA 5ERWA 3FN0H 1JZ8A 2QJDA 1WTGT 2ZSWB 3E3QE 1R3IL 3C60D 4QKTA 2HVKA 3DHJA 3WLBB 4FP8L 1A7QL 3UYOD 5JOFB 4DGWC 5IMOB 5E1HB 4PLJC 1KTBA 2X0WA 1P4UA 1JGVH 3MLYL 1Z3GL 4C55A 3VU1A 4I8DA 3C60A 3MUGB 3QRGL 2PXYD 5AZUA 1EXHA 4NCDA 4G8GE 3WHXA 5D7LD 3NCMA 4NQCE 1OP4A 4D3CL 4M4PA 2W60A 1NFDA 1IEBA 2DMKA 3ZDXE 4B9KC 4UINL 4E42B 1H15A 2JCCA 1I7ZB 3KPLA 1TTRA 4HUNB 1PEWA 5D7LA 5IK3A 5ILTH 2ID5A 1KGXA 5TPWL 2XV0A 1JK9B 2YD7A 5AZEL 2OXHB 2EIDA 1Q8MA 2D73A 4FZ8H 2ZUSA 1M7XA 1YAIA 2CKBB 5IQOA 4NO5B 4N9GA 4ZDHB 1GGCL 1KG0B 3KYNB 1WAPA 1E7VA 4OM0H 1BWWA 1KXVC 3KNBA 1PZ2A 3BSZH 3ZMEA 2K78A 2LTQC 4N0CC 4RGNC 3W82A 4YE0A 4KU1A 4ZAKC 1RJZB 5JDSA 5LBSH 2ZQKA 3GSXA 4GLRH 3IGLA 4RH4A 4N2IA 1A7PH 1TZIA 2NR6D 4NUGL 3G6JB 3HZKA 4QGTA 4AMKH 3F85A 4ODUA 4OFKA 4QO1A 5E2JA 4A2GA 1QKZH 4I3SL 1MDAA 4FL4B 4CSPA 2NR6A 4L9LB 2F1EA 3K91A 1NGPL 3GSOA 4J3VA 1BFVH 4E9QA 4EDWH 4YDLB 3CFJA 3NBNA 2AI0H 2X6CA 1IAIL 5JA9A 1N8ZA 2G9HB 2I9LA 3RBGA 1ZVHA 1X4XA 2X4NB 4CMHC 1SEBB 3GINA 4G72B 2DKUA 5D7JC 4F37F 2HT3D 2IALB 2K9FB 1YVLA 4AW4A 3DPBB 1P7QD 4ZS6C 4U1GC 3EFDL 2G30A 1QBAA 3HG1B 3KLAA 3SYQA 4DP7X 2WINA 2HT4C 4F5CE 3TYFB 5HYSA 4AZ8B 1GH7A 4AGPA 1AHWA 1N18A 4KOBA 1P7QA 2EIZA 7PCYA 2XN9A 2YGQA 2ICWB 1LWHA 3QZOA 2EC9U 4ELMA 1HKFA 1A3LH 2FWOB 3T4AC 2N4IA 5EU6B 3HR6A 4A7VA 3AITA 3V5HB 1GJWA 4ABQA 5I6LA 3KR3L 1UB5A 5EO9B 2AQPA 5BV7C 2GC4C 4Z7NF 3HE7A 4LQ1A 1LO3L 2EZ0C 3HC2A 3IDGA 4M6ML 2AXGB 3TBSA 5HI4D 5GGRA 1IM9D 3BH9B 1EJOL 3PGDA 2AV1B 2ZG1A 4FERA 1SHMA 5DJ6B 3MROB 1A5FL 1A9BA 4R4FH 4UWQB 4FA6A 2VERN 4FFYL 3LSOA 1IM9A 2FJGB 3VH8G 4HULB 2YEZA 4PBWD 3LPOA 2OXGB 2YA2A 4X5LA 5T5NG 1ZMYA 4Y7OC 1IC5H 3VGAC 4DVBB 1MWAB 1OE1A 3V0FA 2Z34A 3D2UB 5A6IA 5I76B 2N7BA 3NIFB 4UUJA 4ETQA 3NFSH 4G1MB 4XBGA 1OF2B 2CKBL 1UZ6E 3F8UB 3Q48A 2VO5A 4BSWB 3AQYA 1H3PL 4XC3L 1USQA 3V4UL 3K71A 4IMLA 1OP9A 5D7KD 2IH9A 3JWDL 1U36A 3LMJL 2YMXL 4XAWH 3TX4A 3GZKA 3O2DA 3ELQA 4BYHA 5DZOA 4PTUA 3DYPA 4P3WA 5JHLH 4RQQB 4K8RC 2OJEA 2A74C 4PG2C 4Y5XC 1RZ8B 4X6FA 4AYBA 3U0TB 1B4LA 1EFXA 4R97B 2VMFA 1GZHA 3OGCA 4X83A 2JJSC 1UT9A 4L8SA 5EO0A 3ZUCA 1ZHKA 4LQFL 2LLGA 1U8LA 2B20A 2WM0A 3AREB 1XXFC 4RDQF 4HAKA 4Y4HC 1HHGA 1K72A 3O3EB 4U1LA 5C0JB 5L7XH 3L6FB 5B3JF 1MFCH 4P0DA 4ZPTB 3ARVA 1SJMA 3U2JA 3H9SE 3PV7A 2ESVA 2NNFA 4BCYA 1I9RH 4WFHE 3MNZB 4FFVC 5E56A 2ADFL 5HHMD 2GJ6D 4CDGC 1T7YA 3MLSH 2O6EA 4YDVA 3I9GL 1FG9C 2WB7A 3FKUS 2O5XL 4LRNL 4K7FB 2E0PA 4XCEB 4LXFA 2JH2A 4GAGH 1XO8A 4M1GH 1XL6A 5GRJH 4XVTL 2GJ6A 3IFOA 4PJHE 1A7NL 4QF1A 1RZGB 1E8ZA 3GZOA 4I1RA 3VWJB 1XGUB 4POZD 2X05A 1KNOA 4XP9H 3Q8CA 5IVZA 4K3DL 1OT2A 1T5XB 1G7LA 2APXA 5FYJD 4CVWA 4C57C 3QR2A 4Y9CA 5GS2D 3QUZD 2BSED 3N6YA 4GSUA 1NWPA 4J3XA 4HOZA 3PPEA 3MXWL 1GYUA 5GGQL 4DGYL 2VZ3A 3NZ8B 1IFHH 4Q52A 5A40E 3QUZA 2AK4E 5TF1H 2X4TA 5FR3A 3GBNL 2A5UA 4AQEB 3PWJA 4F7MA 2XN2A 4N8UA 4YSEA 1J9RA 2ADJA 3OKDB 1UA6H 2KHAA 1XGZA 2X4RB 3U25A 5JPNC 5D2NB 1TXKA 3TWCL 5GRVK 3HZMB 4N90E 5AZ2H 3ZDXF 1ND0B 4KGJA 3KXFB 2WCSA 3MV7E 4NO3A 3HMXA 4GRWE 1CD8A 4CVZB 4EKJA 2DLTA 3FTYA 1QBLH 1GGIL 1MWAL 2P5WD 2WYZA 5H37H 3UERA 1FAIH 1G7IA 2D7PA 3BPLC 3INOA 4OQTL 4XGZA 2Z93A 1WQVT 3PJSA 4JR9L 1OGAD 2R0LL 1RZJC 3ZE2E 1YMME 2JE8A 4IIQA 4XPTH 5GGTA 5T3XH 1UKSA 3X11A 3BP7B 2P5WA 3LZPA 5DWUL 4GW5B 5I74B 3QULA 1JZHA 5LN4A 2XQYA 1BZ7A 2ZCKH 1AQHA 5IMMB 4YFEA 2OL3B 1OGAA 3L3OC 3ILQD 4X42A 3SE8H 4DP4X 3WJLC 4HSCX 1YO4A 2QHRH 2A6IA 4NZJA 5DMIL 2EIMB 3B34A 4NKIL 1UJTA 5I0ZA 1VERA 2XN9E 3MJ8A 3NP4A 4JUTA 3VXPA 4G80A 2XA8H 2CHWA 2NLJB 4HW6A 3T3PE 3ZDYF 2GKIA 2W95A 4UNVA 4KMQA 4MMZC 5DJAA 1MCJA 3VG0H 1F00I 2H0EA 4QHNB 4KK5D 2HFTA 3S37H 4MSWA 3UZQB 5IY5B 3OJDB 3BKYL 3KPSD 3BWZA 2QPDB 4S0SD 5LWYL 1W0YT 1JPGA 3EFFB 1YAZA 4NZFA 1KJ3L 1CGWA 2IXQB 1PAZA 4QTHB 3QCVL 2IAMB 1F0LA 4HWBA 4QRSA 3NDYE 3QB7C 4DOHB 3RU8L 5E4OA 1MRDH 1IRAY 3BYTA 3VG9B 4CKVX 4F3FA 1BG1A 3X2QB 4A7QA 5EU3A 4AGOA 1KIUB 4CGTA 3SGEH 5LQBH 4O9HL 3CH8A 4DKEL 3S5LB 2WUCH 1DN0A 5IHZA 3MMEB 4OZFG 4EI5D 1DVFA 3L1OL 1D3CA 4DPAX 1BHGA 1P5UB 3MACH 4NNXA 3T77A 2W65B 3QDMB 2WY3B 5BVJA 2DQGL 2Y9RT 3MO1B 3DX6B 5LBVA 4AI7A 1FL6A 2CSPA 2J73A 3B2DC 2P7TB 3QS2A 2BP8A 2IV9A 5DQDH 5TK2A 2ERJB 4XMPL 5C9JA 3VI4B 4XXDA 3GSWB 4N2DA 1ZCRA 4TSCH 2ZNXA 3MTRA 4B3EA 4RMUA 2IOMA 3UG3A 3IMSA 4HIEA 4WIQA 2ITFA 4O2EA 3MLTB 4RFEA 2RBLA 4KUZH 2W1NA 1ZTXH 2G3MA 4G5ZL 2ZTBA 4DGIH 5G4NA 2EDDA 3I3DA 4AYDC 2RFXA 1NCCL 4EKXA 1Q9WA 5DRXA 2I60H 5EOTA 4QY8B 2F7IA 4PJ7E 5DVPA 5KVFH 4DZBA 2IANE 4XX5A 5E6IC 4PM1A 1RCYA 2WBJC 4L3AA 5K9KA 1J5OL 4HH9A 3KWUA 3MRKB 2H32H 2ZUYA 1HXMA 4JLRA 1KJVA 4KQ3L 5C70A 2CK0H 4FABL 1NDMA 2AEWA 5I1DA 2GABA 2YA0A 3BP6B 2EDTA 4R5VA 4P07A 3SDCB 4UV7H 5HSFA 3WN6A 3X1EA 1QNZL 4PJXA 2QGEA 3HJ0A 2HLFD 1CFSA 2IDSA 3CBJB 1ZWIA 4PJIF 2AQSA 1Y18B 1CZ8H 2ESVE 4IU2A 3ZLQC 5J5EA 3LIZL 4K3HA 1QNIA 1UA7A 1ZA3A 3O3AB 2OL3L 3UADA 1Q1JL 4H25A 5KVFE 2VN4A 3W39A 1UB6A 1IQDA 5FYLL 4JAMB 5FEBA 4IK6A 2O5YH 4S1DD 3VQ1C 2YPVH 4D8PA 2NDGA 3G6AA 1DQDH 4U3XA 1AI1L 3ESVF 1GMEA 4FQHA 5CGTA 1S7UA 1LO0L 2ZOKA 1H8OA 1N26A 1NIDA 5CGYC 1RFDL 4BA0A 2C8NA 5J56B 3QG7L 1JYVA 1RK1A 2R1YB 5DMGD 4KK6C 4FF9A 4FI6A 1I31A 3TO4A 3E1ZA 2D9QB 4RIRA 4DF9A 4JDVA 3QPXL 4ZSOA 1DVQA 1O7DC 2E6QA 2WZ6A 3LKOA 4JFXA 4RLDA 1DFBL 5HY9B 2QVKA 3V5DB 3QIUA 4WFGE 3UBXG 3PG2A 4BKLB 4RRPM 3DARA 2VDRL 1X5ZA 2ZJSL 2VR3A 3IF1A 2BX5A 5KSAB 1EHAA 5F8RC 1JPTL 2IV8A 1UOKA 3CXHJ 3WD5L 3FK3A 2E4FA 1NFDF 4QRQA 3EGXA 2NYKA 2A0LD 3F58L 4Q9RH 2W0PA 1P9MA 2XVKA 3ETTA 4HBCH 1JTPA 3PABA 3DIVA 2GY7B 2OMVB 2V5SA 4LLQB 3DO4A 1WLHA 3KJ4B 2QSCH 1ACYH 4AGQA 4HUUB 1I7UA 1S3RA 4KDVA 3WIIH 1ZD6A 2H6PB 4XX1E 2WTRB 4D94A 5J12C 4DEWA 4KPHH 4GXVL 1TKWB 2B59A 4KY2A 3LRSA 3WMQA 1UFGA 3GRWH 1W6WA 5DFVC 4GI9A 2ZYSA 5BJTB 4OSUL 4WI8A 3F00A 3GJFA 4MDIA 4X0KB 4F2EA 4L1TA 1G5AA 4EMZA 2YUXA 3VO0A 2VR7A 1L9PA 4R7XA 3C9NB 1O9WA 1DVXA 2QV4A 2ITCA 1ED3A 1MF2H 2ZOLA 3D0AA 2J8OA 3X13B 1DQLH 1E2WA 3W37A 5AKVA 5GHWH 4ES9A 2O93L 3BEWA 4R0LC 3ZE0B 4XWGL 2NY1D 1CDBA 3PL6B 1OB0A 2CG9X 4X80H 4NQEB 5IFAL 1CUOA 4LCIH 3WLWD 4L29A 3GHEL 3WJJC 4P4KB 1SY6H 2FECI 3ZE2F 4PLNC 5IFJB 3F5WB 5EC2A 3UAEA 3Q8BA 1JNNL 1UGNA 2NZ9C 2XRAL 5E6RB 3HCVB 3ARTA 3IDJA 4FKHA 4U1HB 5IVOA 1R0AL 3D9AH 5F3HA 1N70A 4NDMA 3ZR5A 4LB8A 3L4UA 2K6WA 4K0OA 2VE6B 1FZMA 4RISH 5E9DD 5DUPH 1ZDSA 4MNQD 3KVQA 3QUYC 3PIQA 2LU3A 3T3PF 3FRPB 3QUKA 1XWVA 3DV4B 4BK8A 3SB3A 3STZB 5DRNA 5I28A 4FQIH 3ZK0A 1RV6X 5E9DA 3B7TA 1MCHA 3FMGH 3EDFA 5F21B 3GKZA 2H9GB 1LL1A 1YEDB 1LO5B 1SDDA 3BGMB 3G5ZA 3GMPB 1LE5B 2Z1KA 3QQXA 4AE1A 1BBJB 4P46D 3GSUB 3HEIB 4XNYL 5F72S 1GHFL 4IHOB 4LSVH 1QX1A 4N2BA 2BP0B 2DI9A 5DYOA 4M48H 2C9SA 5AWNH 4S11A 4KXDA 4XBEL 4P46A 2V4LA 4ZNEA 4DQAA 3ZZ1A 1OOAA 3AAZA 5KJ7E 2JSFA 1KTDB 3PCYA 1JGDB 2O30A 3UZVA 3PGFL 4N2OA 4L0PB 3D25A 2A9ML 3T1WA 1ZGLB 5EEUA 1I85A 4PJCB 3ZL4L 3CDYA 4YK4B 5D72L 5D6DC 4UQAA 2ARJA 3WDIA 1MFAL 2N01B 4ZMXA 1AYRA 3FB8A 4H0HB 2OBGA 2XY1A 3FQTB 1MFNA 2WXFA 4ERSL 3IDIB 1P4IL 4OT1H 2DZEA 4FZEH 4FQQB 1SBBA 2OR9H 4UOW0 4KKAC 3LN9A 2YO3A 1IQWL 2H6OA 2ARWA 4TTDC 2VZSA 3HNVH 4G6JH 2Y7SA 4UNUA 2F8XC 5CN1A 5D5ME 3B7YA 4Z23A 3SBWA 2CHDA 5GPRA 3CCHA 1F97A 3BEVB 2KBGA 5IBLD 2R69A 4BDVB 1NUDA 1JF1A 1NM9A 1WA2X 2HLEB 5JIIA 3OB0K 4MVBC 2DLEA 4KTEH 1BZ8A 1AQKL 2J55A 2JVUA 4BZYA 3TU6A 2L7QA 3HS0C 3CXDL 1WWBX 3VXSD 3ZKMC 1MXDA 5I1AB 2XKSA 5K9JH 3KL0A 3HKFA 4N0UB 1SLWA 4MNGA 4W9JC 1E50A 3WTSA 2PP9A 2FWUA 1UYWL 2FEEI 1XSOA 1XR8B 4Z7WA 1YMHA 2BHZA 4OD1H 1MIML 4YSRA 3VXSA 3UCQA 3L3HA 1FFNA 1E5UI 5BRQA 4D9RE 3S34H 2IC2A 4LHUD 1DJSA 3VXMD 5AAPA 1OTSD 4X5XA 4QGYA 5CD5D 3KJ6L 2JJVA 4O4YH 35C8H 4TSBH 4YAQA 3CHPA 2HN7A 2KLSA 4LHUA 5DD0H 4DGVL 4ZYKA 4EIUA 4P59L 3SD2A 1R4XA 3ETBF 4N8VA 1MCNA 4D2NA 1T2QL 4BQ9A 2W94A 3HVNA 1I9IL 1MUJA 4GKZA 4LVOB 3RHWF 1UXSB 3LN4A 3FTVA 1TIUA 5FUZH 3ZDZF 1AD9B 4NX0A 4B9ZA 3DX4A 4JBSA 1FL3B 4K55A 3LRGA 3WFHA 1EO5A 2XWXA 2W0LA 5AVUB 5GISL 3QUHA 2IWGA 3B2PA 5A2BA 3CDZA 2V2XB 1IUZA 2RGSA 1TVBA 3C5ZB 2F7OA 1LEGB 3ILEA 1E4XH 4G42B 2DWEB 3DTDA 2A9BA 3V79C 3MLUL 1CLOL 3RNKA 5CSGA 1YJDH 3HB3C 4Y5VA 5F3FA 1LLAA 4KAQL 1OSPH 4XMVA 3B7UX 2F5BH 4NM4L 2P8MB 3CFKB 4M00A 2J8UA 5D1QA 3NIDF 5HHVH 1CG9A 5F7BA 2Y69B 3EUUA 3MNVB 3SJVD 3VRLE 1QEWA 1S7TA 3AT0A 1AXIB 5D7IB 1FRGH 1SXZA 3LNIA 2EDRA 4G6FD 3FAWA 3QPQC 4W9DC 3U6RB 1OVZA 1URIA 4I2XE 2J3SA 2QDWA 3KEHA 3WFZA 1RH8A 5DQJB 3QUMB 1YUHB 4N25A 4O2FA 3EZ8A 4UTBH 2CIKA 3DTXA 3CC5B 3VXTB 3ZYZA 1BMWA 3JWOL 2DQCH 2EJ1A 3NH7L 4KX9A 4XVSL 3DKHA 2BSCA 3BPNB 5BS0B 4WVRA 4MJIB 1BLIA 1ACCA 1TJIH 3BQUC 3DXAB 3C09C 3GXFA 3PUUA 3RWCB 4NZDA 2G5RA 4XMKL 5GS1C 2QVIA 2GTQA 4MMXA 2LABA 4WI4A 4M5ZL 1WZMA 1CGYA 2WWKT 4YSAA 1OCOB 1C5BL 3OQRA 3KLHC 1KBKA 2ZCHH 4G1EB 3QJFA 5IQ9A 3A24A 3X3GL 4BZ1H 5DR5H 4WEUD 1KBWA 1T89A 4HIJB 2EH7H 1UENA 1HH9A 2F18A 3C5SA 2FRGP 4DK6A 3H0TA 2H26B 3DHMA 3VU2A 1XCTA 4RMQA 2BIMA 4NQDA 2HKFL 3I74A 3PF2A 4PD4J 4U6YB 4ZW5A 3WNJA 1IEAB 2ZAHA 3LKPA 3LX9A 3OWEA 2B5IB 4HPYH 4S1QL 4G3YL 1SZNA 4KJQC 2RMNA 5D1XD 3CZSA 4ODXB 2ZAIA 4M1CD 1NGQL 5E99H 4AMWA 1VHPA 2PO6B 2BY1A 3PJLA 3RFZB 2D4FA 2AGJL 3WTXA 3FU9A 3OGOE 3OKOB 2HTKD 4ICWA 4Z7UE 1CURA 5J6GB 2ORBH 1ASOA 2PW2B 4I13B 3S2CA 1JN6B 1GXEA 4M8UA 2P8LB 5D1XA 2ZG3A 5ICYA 5A2LH 5EV7A 2F19H 3T0ED 1ADWA 1W15A 3I6GA 4HG4J 4LARH 5DC2A 4Q8BA 3BXNB 1MNUL 4MA3B 1B6DA 5FFLA 2VDOH 2PYFA 1Q38A 2BNUA 3QIWD 1FNSH 5L4MA 4DK3A 1OAKL 3BZDA 1MI5D 5KVDL 4JQXC 3T0EA 4JN1L 1I1FB 3O81A 5KJRH 3DK0A 4PJ8C 3VGHA 1JCKA 3K2IA 1CXKA 4K5PA 3P9MA 3LHAA 1YECL 1CFNA 3QIWA 3RILA 3FOMA 1MI5A 3T1FB 1ZXQA 3VFVA 2EC9T 4WW2A 4ZI8A 1M4KA 1Z9NA 3QDJA 5JZ7D 3GIVB 1OWWA 3QT2A 3P4MB 1J9TA 1UJ3A 3QFDA 4O2CA 2GIYA 3Q0HA 3D87B 3N42F 4QNPF 1KIRA 2YAEA 4LVNB 1FV1A 3G5YB 3NIGE 5DRWA 5CBAA 2YQ2A 5CJQL 3TIEA 3K81A 5HJ3B 3L4VA 1PG7L 4XNQA 1H5BC 1QW8A 1WYJA 4BCXA 4K3JH 4A7SA 2A9NH 1FWXA 4MNGE 5TF0A 5B39A 1MLBB 3H2WA 4QHUB 3T5WA 4PJXF 1LK2B 1S9XA 2UVEA 4ZD3H 4NWTH 5C0IB 1UVQB 4EDXA 4ZTOH 3MRDB 4YX2H 5JIPA 2KZ1B 2NY4C 2HVBA 2BOLA 4W6WB 4QHLB 2ITEA 4WNSA 3Q6FB 3QUML 1UWEH 4C83B 2CO4A 2XKUA 3RL1B 1UD3A 5HVHC 1M9WA 3H6AA 1PZUB 3MOAL 3L5JA 1A0QL 2EDBA 3MBWA 5EBLB 4U1KB 3IE9A 5D5MF 1KB5L 3UCRA 1HCFX 5B38G 4Y16B 2P47B 4PJGA 1I7TB 4LHJB 1TQBC 2OTWB 3V6ZB 1FIGL 2EEBA 1WBYA 3B5GA 5A1AA 5C0BB 4TUKH 1MDTA 3WIHA 1HAWA 5DO2D 2E4TA 4LE8A 5F0PB 2IPTH 2XFXA 4GB9A 3DROA 5CIPH 4K15A 4OZHE 3M7FB 5E1IA 4EZKA 3ABKB 4M02A 1URZA 1AMYA 3L7EB 4KKNA 4HKXB 5HHNA 2YKKA 3GPEA 5DEGA 5C3LD 2GT9A 3H9HB 2DYPB 3F7KA 4NO0B 1B2WL 1T1YA 3PWNA 4Q0XH 1U9KA 1I8KB 5EEXA 3A5VA 1MAKA 5I82A 1UEYA 2N56A 2ZYHA 5C07D 3JV6B 3BAEH 4UT6H 4HZLB 4WI2A 2J88L 3TBWA 5C71A 3A6BH 1TTAA 3L95B 2X3CA 2J5WA 5IW3A 3US1A 5GGRY 1DSYA 5KW9H 4MDRA 5EOCH 1UWFA 3RY6A 2WXKA 2IH1A 4CN4A 4ENZA 2ZWYA 1U8PB 4AIXA 2YAHA 4WFFE 4TNEA 5D1QE 5C07A 2CDGA 2GCYB 3GIZH 5FKAB 1TSRA 4D0CA 1BBDL 3RZCC 4OV5A 4ORGA 1PNCA 1OKEA 5LXGH 1HEHC 2CDFA 5JNYA 3TNMB 5KSUB 3ZKXB 3DOSB 1PFOA 2APWA 3RRQA 4GQRA 5EC1B 1RJLB 3ZRSA 1QA9A 5DEFA 2DICA 1PU0A 2IBBA 5CEZH 5FCUH 2C9RA 4PEEA 3U46B 4FQJL 4YC2B 5D6CA 4JS7A 4KY1L 3S35X 1K9TA 3E6HB 4LU5H 1CR9L 3K72A 2V7HB 3I50L 5IB5B 2W88A 1RERA 4U6VH 3KPQA 2NYYD 3WNIA 1SHSA 1XL4A 2F74A 2E75C 3UJIL 4QRRD 4OLYH 3V4PH 3V52L 1CD0A 4LL4A 3D34A 4EAEA 1J1OH 3TFKC 3ULVH 4ODSH 3CFMA 2JJTA 3S7GA 2VDQB 4Y2LA 2VUYA 3CBKB 4ZFFB 4H0IA 4QRRA 5CEXA 3HRZA 3GF8A 1WHOA 4PRPA 2ZWZA 5L9DL 1EVTC 1D5IL 3CX5J 1QHPA 3IPBA 5C0EA 5C8JA 3VH8B 2WXNA 5E8OA 4KI5D 3E3QC 4Q74A 4X6CA 3SBRA 4FXGB 1BJ1J 5F6IB 3BKMH 4D0DB 2J6EL 3DI2B 4S0TD 5ADOH 3QS3A 5J13C 1QUNB 2Y22A 5E2UH 1R3IH 4UCFA 5HHPA 5ABZA 5I26A 4CJ1A 5EEVA 3TOPA 2BCMA 3NN8B 4ANUA 5CP3A 3LOWA 5TFSL 4QCIA 3QXDB 3BH8A 5DD1H 4F8NA 3MLYH 3PUCA 3HG5A 1F4WH 3QORA 4MS8D 3PAZA 1KBPA 2Z7YA 2HUEA 5G5DA 1AGDA 3QRGH 4H5SB 1A1NB 4HETA 3GXTA 1M9SA 5E1AB 2Y7LA 2GUYA 1A1MA 1WEJL 2XZZA 2ITDA 4MBRA 5HI3C 2Z8VC 4UINH 2VLKD 5GGVH 4XTRC 2KPWA 4I89A 5FXCH 2WQRA 4A66A 1PZ5A 5AZEH 2VISA 5C0DA 2CGZA 1AACA 2D31A 2VAJA 3K6OA 1AGBB 2ZT9C 1RJYB 2VLKA 5B8CA 3T2PA 1A4KA 1AZCA 3O2VH 4M8QA 1MN4A 1WBXB 4X4YB 3TV8A 5I24A 5FFOA 1GGCH 3HFML 3FU0A 3MCLH 1EEYA 1RHFA 4AC4A 1CD9B 1WUZA 2XWEA 3RVVC 4LPWA 3TA3D 2XC8A 1KGCD 2DY2A 3DUSB 4G8FB 2MHAA 4FLQA 4M8RA 1LTXA 1FJ1B 3K80A 3Q5TA 2YR3A 5JQIB 4NUGH 1FYTD 2R0KL 1T22B 5CZXC 5GGUB 4KKBC 5TGBA 1A21A 2DJMA 4PJEE 4DEPB 2WVVB 3GO1H 4UZGA 3ROLA 4YDJB 5K59E 3PXJA 1EGJA 1INDH 1H6UA 2GSIB 4F2FA 1NGPH 3UEQA 3OZ9H 1AANA 1FYTA 1CN4A 3UYPB 5MEND 3ARGC 1JZEA 4LP5A 3RDTC 4TQEH 5FO8B 3NIGF 3WG7B 1P6WA 4GBXD 1UZ8A 1F11A 4AV4A 4QR7A 1UWXK 2W9EL 4CMMA 4WHCA 1HZKA 2VDQL 5MENA 3EFDH 1OL0A 4XMUA 4Z7WF 3HUJE 2LTQB 4RGNB 4GBXA 4BKTC 1HI6B 1BFSA 3P4OA 4ZAKB 3B6SB 2IPKA 3VSVA 3EYVA 2GK2A 3ALWA 2AC0A 5F6HJ 5JW5B 2XWDA 5HYQB 5IFHL 1JZ7A 4KKCC 4PJAB 4GO8A 1OHQA 2BWIA 2R2HB 4PVLA 3UC0H 3ARFA 3DI3B 3EJPA 3BKCH 3O4LD 1A6ZA 5IIEB 5CP7B 2W9DL 5C09D 3PWLA 4JN2A 1CK0L 1KN4L 2FH8A 4XNMA 4Y0GA 1XCXA 3LRMA 2VL4A 1B6UA 1HHHB 3X12A 3KS0H 5ES4B 3O4LA 4X5PA 3L4XA 2HKHL 4GUPA 3J2PA 4DPCX 1LO3H 4MA7L 5C09A 3W9EB 2WLKA 3BOVA 4LSUL 4M6MH 2F53D 1EBAA 4N2EA 5D7JB 2BWQA 2HVJB 4PRAA 1QBML 1F86A 2BW5A 2C3WA 3U9WA 1EJOH 4F57L 4OZHF 2J12B 2W59A 3F64A 3DMMB 1H8NA 1DO6A 2F54D 3MLWL 4HV8B 4M3JA 2MNJB 3D3VE 3EJYC 2F53A 3MZTA 4C56D 2YK1L 2J6WA 5LG1A 1I9EA 4LRIA 1I8IB 1ID5I 4LEOA 3BSZA 4JDEA 2E6JA 2TRYA 5E5RB 3CMOH 2DLIA 2F54A 3F7VB 4RDQG 1UQSA 5JIMA 3B9KC 2R2EB 4MRCA 3PWVB 3Q2WA 4ZXBC 3N0AA 4BHUA 4C56A 3ZTNL 5I1CH 3T4AB 2EYTA 2AQ2A 4OCLC 2WNGA 5DLML 3C5JB 4N0YH 3CAFA 2CXGA 5JXED 1NGWB 2J8UF 1XCQA 2NY0C 3BO8A 1TYJA 4PS4H 4JB9L 1J88A 1RY7B 1PZAA 3NCBB 1C1EL 4X4KA 1DDHB 4JREC 4PRPE 5INCB 1RUQL 3FTWA 3LMJH 4P2OD 2YMXH 5E6ZA 2WNKA 2YD2A 4JY6A 2W0FA 1VIWA 1RK0A 3C8DA 3CVIL 4OZFB 3TGXA 2P8PA 5CZRA 2WNXA 1XGRB 4P23A 4IBQA 5CJXC 2J1YA 4P2OA 2IOIA 1LO4H 1EPFA 5HGHB 5JLZA 5E9AA 3KPMA 4BEIA 4ZRGA 3KL5A 4MD0B 5E0FA 1MQKL 1XBDA 4GAYB 3VGAB 5EO1A 1RIVH 2X70A 4I0KA 4ZMTA 4IEFB 3GSRA 1NH6A 5D4QA 3WO3B 4NO2A 5DHVB 4JFQB 1E9OA 1IBGH 1R24B 2IH3A 1ZT1B 2XX0A 4IGBB 4FEMA 2K4AA 5C0ND 5ISZB 2FYVA 2W8CA 1TLMA 3DO7A 1JRHL 5EORH 2ADFH 4P49A 4OZIA 4UT7L 3VFPA 3QUXB 2O5XH 3RVWD 2VDLB 1NEZG 3QZNA 1HYRC 3DVFA 3O8XD 5E1QA 3SKNB 1HK6A 1RSFA 3UZEA 1ZHLA 3NFNB 4FQPA 1TQVA 2FAUA 1A7NH 3F05A 2YD4A 5B7EA 2WQVA 3AT8A 3Q44A 1ML0A 2X4SB 3O8XA 3MKKA 3K4ZA 4FTVD 4KO9A 3P3SA 4AGNA 2AQ3A 4NRXA 1EANA 4O00A 3ZRFC 1WCBB 3IJEB 5DJDB 1YN6B 3IGAB 5BNXD 2R1XA 4Y4HB 5D70L 1AYOA 2JLLA 2VZ1A 1DLFL 3ZQWA 3BLPX 3MXWH 3II3A 3R06B 1E0OB 4FTVA 3HG1E 5ALBH 1IB5A 1SMDA 3UBGA 4F2MB 4J1UA 4BFIA 1G0XA 2VSMB 3FO2A 4PUBH 3GBNH 1RL1A 4HALA 4AENA 4J8QA 5BRZB 2ATAA 4G9DB 3WCYA 5CAYB 3UP1A 4JY5L 4XWOC 4ELKB 2DBLL 1MOEA 5HHOE 4WKZB 2H5UA 1MLCA 4WW2F 3HE6D 2C9XA 3EUDA 3QNFA 1SN0A 5EU6E 5I1EH 1NMAL 3WE1A 1E3ZA 4DFIA 2OP4L 2IQAA 4Q2ZA 4UQ3A 5JHLA 4FS0A 3SPVB 3V6FA 2D7QA 4IMKA 4YHYC 1T66D 4X4ME 3CZFB 3TH2T 2DTML 2NY3C 1ZSDB 5K1VA 2N3JA 1AHMA 2A9AA 5T1LB 1X7SA 3GWJA 1OP3H 1JGIA 4KXAA 4G6ML 5IM7B 2Y7QB 3H7BB 2AK1L 6FABH 4U1NA 6TAAA 3S4SA 5JQ6L 4NXSA 4OJFL 3FF7A 4NJ9L 3EJTA 3S36X 4QMEA 5DMIH 3ARUA 4NKIH 4DKTA 1BFOB 3MA9H 2Z31D 4N9OB 1FZKB 2CJUL 4HIIB 4HC1H 1Q0YL 4LNRB 4JGJA 5L88L 2E9BA 1PZDA 1NEUA 2VR5A 3UPCA 3HE7C 3V6BR 1S7WA 2UXGA 4LPVA 4PJEF 4C54A 4G7VL 4PJGF 4G9FB 5K59F 2Z31A 3I6KB 3CFBA 2YGOA 3MJGX 3IU3B 1G1YA 3BKYH 1B88A 4O5LL 4JFED 2F0CA 3O2WL 4HEMA 2PWEA 3P9LB 5DT1L 1WE5A 3EBIA 3BPLB 1R5IA 4BZ2L 4AG4L 1KJ3H 1A9VA 5JW4Q 2VKXA 3QCVH 1CICD 3EKCA 4YPJA 4YHNB 4YDKL 3SGJA 1YMMD 3OKNA 3NA9L 3DVIA 3LZQA 1HINH 3D85D 1LEIB 4KXZH 4JFEA 1OGTB 5E23A 1PKOA 2G0LA 1BF2A 1W0VB 4TQIA 3V9EA 4A68A 3U1SH 1RPKA 2ZXWB 3EADA 1CICA 2WXGA 3FQRA 2AJ3B 3L3OB 3JTBA 4O9HH 2WN3A 3BP5B 2VDLL 2VQTA 4P48A 3RL2A 3BN9C 2J71A 5BVPH 2GJZA 5F7LB 2E9GA 3N1QC 3O3DA 1D6EB 4U6HA 4ZOEA 2BSDA 3L3JB 2C1OB 3IKCA 4FNQA 5EUOA 4OCSH 2BSRB 3AXHA 4MMZB 1CJYA 5KVEL 3NEEA 3WKYA 3GJEA 4ZX5A 3GMQA 3E9TA 3RVTD 1UOWA 2XTJC 2NUTB 3QDGD 2DH2A 3MODH 1KLUB 1C7SA 2BIIA 5GRUL 1YNKH 2VMEA 1FQ9C 2WKOA 1FO0B 5EFIB 3VFNA 3DVGB 1EHKB 4M6NH 3ABZA 5T3XD 4G5ZH 2XNAB 5H37A 1HHKB 3QDGA 3VI3A 5T3ZL 3KGSA