3AUWB

Cytoplasmic domain of inward rectifier potassium channel kir3.2 in complex with cadmium
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
175
structure length
175
Chain Sequence
TLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIRAKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLPKEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETYETSTPSLSAKELAELANR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Inverse agonist-like action of cadmium on G-protein-gated inward-rectifier K(+) channels
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Potassium inwardly-rectifying channel, subfamily J, member 6
total genus 29
structure length 175
sequence length 175
chains with identical sequence D
ec nomenclature
pdb deposition date 2011-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 3auwB00
3ZRSA 3SPCA 2WLIA 2X6CA 2WLLA 5KUMA 3SYAA 2WLKA 2X6AA 1P7BA 3SPHA 3AGWA 3AT9A 3ATFA 1XL6A 2WLIB 2GIXA 1XL4A 3JYCA 2WLMA 3SYCA 3ATDA 2WLNA 3ATEA 3AT8A 3K6NA 3SPIA 3ATBA 3SYOA 3SPGA 3VSQA 5KUKA 3SYPA 2WLHA 3SYQA 1U4EA 2E4FA 1U4FA 2WLJA 2X6BA 3AUWB 4LP8A 2WLLB 1N9PA 4KFMA 3SPJA 3ATAA 2QKSA
chains in the Genus database with same CATH superfamily
2E3VA 4PRID 2WB7A 2UX7A 1D6VH 2ZSVB 5DUJA 3LQAL 4XH2A 3ARQA 5FGBC 3IRCA 1AGFA 3GJFH 3T4AB 4GXUN 3OR7A 3KPPB 1KCUL 3U30C 4X7CC 5F7YC 3TO4B 4WJG3 3P54A 3RWCB 2RH0A 4LP5A 1U58A 4PTTA 3LNIA 1WISA 3BUTA 4MYPA 1KLFB 1SJXA 3QJXA 4MA8L 3QNZB 1YUHA 1AXSB 4HWNA 3ZQWA 3SDCA 1X6LA 2O5YH 2NT1A 3U46B 1FPTL 2YBRB 2XSKA 4U4IA 4LHQB 3ATAA 4PJ9B 4UV4L 3V6ZB 4A2GA 1NGYB 4Y4KB 4BDVB 1ILSA 1YEJL 5ICXA 1FFPA 4J28A 4GSXA 5G4OA 4GJTB 4BFRA 4OI7A 1RJLB 1UUNA 3FSWA 4G2AA 4B96A 5J89A 4OLWH 1QQDA 3DIDA 4OZIA 3LS5L 3F7PC 4FG2A 3MO1A 3QHTC 3FQ1A 1QNZH 4PCYA 4YHIA 5ICYB 1YMHA 4J6RH 1HHIB 3RY4A 2Y36L 2PXYD 3FHEA 3O3DA 3NN8A 3KYNB 3K4ZA 4KRLB 4YXLH 4U1LA 4L48A 3D0LB 4ETQB 1WV7T 4PREA 2XU9A 1JZ7A 4APQB 3V5HA 2OP4L 1RVFH 5L6YL 2CK0H 3LD8C 4NUGH 3FH5A 1WGOA 3QJVB 2C5DC 3Q2CA 1XH3B 3IDIB 1W72H 1XZWA 5C3LD 1IC7L 3KPTA 4IDLA 5GSRA 1ZVYA 3KL3A 2ZUQC 2FSDA 2J25A 1MCDA 2MPAL 3IDJB 4UV4H 5EUOF 1HAUA 4PJIB 4WNSA 3CH8A 5D7SH 4GAYA 2XZAL 1FHNA 4F33B 1CR9L 1A4AA 4E41E 3HG0A 2FGWL 5GGVH 1I1AD 1UJTA 3QCUL 1KCUH 1PG7W 4Z77B 5ESAA 3OPZL 2A0LC 2D3VA 4FTVB 1N6QH 4M8QB 5DJ0A 4ZQKB 2QADC 1G87A 4YLQT 2WNKA 2VR3A 2GTZB 2DWTA 2IDQA 3B7TA 1QPXA 3VD7A 2DAVA 3EYUL 1EMTL 1Q9KA 1WFJA 2Q5BA 4K15A 4RAUB 2VN6A 1A7QH 1UZ8A 3WJMA 2ESVA 1MG3C 3BC9A 3QGVA 3BAEH 1ZGLP 2GPZA 3NFNA 5JXAH 5J6HA 3D69B 3NGBB 3QO0B 3DNKA 2P49B 2OJEA 2BZDA 1RIVH 4B9IA 4G1MA 5BCAA 4O58L 2MCAA 3SDXA 4RSYA 3D33A 3B9KB 4OQTH 3S96B 2QKIA 3L3JA 3ZMNA 4Z7NE 3IMBA 3MYZA 3QUXB 3U2SA 2YAPA 3UTZA 4BFOA 3IMVA 2QR0A 4PJCB 1YMMA 3PWNA 4XAWH 4APQC 1AGBB 4YGVA 1E2VA 1TZHB 4PLKC 1MUJA 2EIJB 2R56H 3D3VA 3SY0A 3WFZA 3ZKXB 5GGVL 4DO5A 1MQKH 1YPZA 4XMZA 4X7FC 3QUZA 2A74C 3MXWH 2H2SC 1JRHI 1B9KA 3CFEB 3ZDZB 3MOAH 1TNNA 4BK5A 3HOGA 5C6TH 1E4JA 5GS3A 3R06A 1JXDA 1PX4A 2YEQA 4HJIA 2PCPA 2F53B 2OL3A 3COOA 1GGBL 3KLQA 1BQSA 3PAVA 3IJEB 2UWEB 2PW1B 4HWUA 1D5BA 4KOCA 4KPHH 4MXVE 3D0VA 4IBZA 2YK1L 2VQUA 1U6AL 2K78A 2Z6FA 3T0XA 4F20A 2WKOA 3S3SA 4MAYD 2B2XH 4WFED 2AC0A 4PV9A 1YQVH 3K5RA 4GMSH 3V6FA 1B6DA 4L4TB 4FEIA 4OIFA 1E67A 1DBAL 4HMEA 4QAMB 2KBGA 2XFGB 5KVDE 4D0DB 1DUZA 3QNXA 2YD5A 1S8DB 1ZGLM 2HFEA 2BS8A 1DJSA 5L4MA 3L1FA 3CC5A 4HAFA 2YAEA 2FTAA 3D18A 4NUMA 5DJAB 1KCLA 1RIHL 3GBNH 2F8VA 3D34A 1NCWL 2BO0A 4YHKL 3BKCL 4GRWH 1OP3H 5DI8B 1MW1A 3MLUL 3TFBA 5IB3A 3PV6B 3TBWA 3EHBD 3C2AH 2R29L 1BAWA 2NXZC 3K6NA 4EZLA 2X2JA 1ECZA 3O6FB 3RKDC 3A4FA 1RY7B 2V3FA 4R26L 1A3ZA 3VXUB 4AGLA 5GS1B 4XB8A 4IKJA 3GTTA 5DHVA 5KAQF 4UU9A 4X0NA 3H0TB 4TNWF 4E9RA 4RMWA 1YAZA 4ALAH 4H88H 2G2RB 4RGOL 4GKSA 4WY7L 3TVMA 1T5KA 1MHCB 4E9VA 5FUOL 2H2PD 3RIAK 2XXCB 5C2BH 1EHLL 4NBYB 1GYUA 4G42A 1XIWB 2ATKB 1RUMH 1L9TA 3L3DB 2A9AA 2DQMA 5TFSH 5IV2B 4JZJB 5HGAA 5CEZE 3EG9A 3S2CA 1YEFL 4OGXH 2VLMD 4NI6A 3O4LA 4FDWA 4A2HA 2D31A 5LAPA 1QVOA 3MBXL 3BIKB 4M61A 4OD3L 2BW5A 3FN0L 2PWHA 2VKWA 1QKZH 4PRHB 5D4HA 1WSST 5FEBA 2MIZA 3O8XC 3ARRA 3V4VH 3ETBJ 4L0PB 5ALBH 3WS6C 5I74B 2XQYA 4KU1A 3H2QA 3LRHA 2I7SA 3NOIA 4Y1AD 4A7GF 4YAQA 1G9NC 3MI6A 1JZEA 4HS6B 1MWAH 2XYCA 5E99L 4HIXH 3DJTA 5DDHB 4JQXA 3KYOB 4PW4A 4UOJA 1UJ3C 4ELMA 1MLCB 3H8NA 5C0EA 4AEEA 3CXDL 5K9QG 4WJKB 1JNHA 5HYIA 4R2GD 3V9FA 3IFNL 4BD4A 1R0AL 3KPMA 5CLYA 4LL4A 4KMQA 3DSNA 3MUGB 4TLKA 4RGNC 4F8NA 3V79C 2EVJA 4YAQB 5LG6A 1NBZA 2CBOA 2FHBA 4UMSA 4JQIH 5CD3B 4RGMC 1KLGB 5LG1A 3V5DA 1V27A 3HUJE 1AD0A 1KEGL 3BZEB 3VWJA 1LO5B 4N6RB 3NK3A 5HPMA 2J2ZA 4AUUA 5E2TL 5CEYA 4A7VA 3HTLX 2EC9T 4H0GA 4S10A 4HYTB 2D7TL 4XCCH 4YBQC 2ZOLA 4LBEA 1KN2H 1ZV2A 3H3PL 4Y7MA 5E99H 4WF7A 4WQOA 4R7XA 1FNSL 1NL0L 2QTVA 4NQSB 2FUQA 3EJRA 1HU8A 4KTDL 3HNVL 3QDHA 3UH8A 1DQLH 2YAOA 3IDUA 3VI4A 3VO0A 3TVMB 3JWDH 3P0YH 3NPSC 1CDBA 4QIRA 1EQWA 1HKLH 4LU5H 3GSOA 2X7LB 5T33H 2ESVB 2YRZA 5A16B 4AXWA 1Z9LA 4W9EC 4YC2C 3MQIA 4NP4H 4M6MH 4N5UA 1JFQL 4X7TB 2CA3A 4FQCL 2VE6A 1FDLL 3MXVL 1MH5B 4O2FB 5D7LB 4LMQI 4HEPG 5LJYH 1RK7A 4RMTA 3RIFK 3ASWA 3U1PA 2G9HA 3VXUD 3H2WA 1MF2L 1JRHH 3QJRB 1WT5C 3CZFB 4PLNC 2E4TA 4P5MA 2IIJA 3FQRB 2ADJA 3D8MA 4A7TA 4X6BB 1CD1A 1YN6A 4KUZH 4OCRL 3FT9A 3WLWD 1BECA 5CZRA 1DCLA 1YYLH 5FUZL 4BZ2A 1H5BA 3N9GL 1L7TL 4GLRH 4ZNEE 1MJ8H 1GPOH 3VGHA 2LU4A 2ZWNA 1IU1A 3NYKA 3V6FB 1UM4H 3OAZK 4I2XE 3DMMA 3U4BH 3EOTL 1MXGA 1KJVB 3APDA 4ANUA 4HOXA 1AZCA 5D1XE 1PIGA 2FZ3A 4LOEA 3OXRB 4ETQA 5GISH 5CJOL 1HKFA 2XLLA 4JM2A 4Q0XH 1MCFA 2OV0A 1SJEB 4CILA 4E68A 2XHNA 1O7DC 2EP6A 1NBYB 2IPTH 1SVBA 1X7QB 2FYYB 2TSAA 2Q1EA 1T83A 4XO4A 4FLRA 2F08A 1A02N 4X80H 3RDTA 3GHEH 4NNPH 4YUEL 2BNRA 2EZ0D 4QLWA 2YXVA 4UTBH 2G5UA 3C6LB 4UZUA 4DP7X 2IOOA 5ICXB 1SN5A 1U8PB 3FB8A 2QKSA 2YPKA 3K5SA 2F58L 3L3IB 2OLDA 3P4MA 3T1WA 2BSTB 4KDWA 4P2QA 1E0OB 2W0FB 5T1KD 3OVUB 1DDHA 2J7LA 2LLLA 3ZGHA 4DOHE 1JFQH 4XMXA 4EMZA 2DKMA 4V33A 5I0XA 1P5UA 4ELMB 1UC6A 5C0EB 4UT6H 3KPRD 3S34H 3WUZA 4EI6A 3C12A 3MRQB 2X53A 2R83A 2X9WA 3ISYA 3LPFA 4FF9A 2I9LB 1GYWA 2EDNA 3MLSH 3QFDA 4JDEA 3NPZB 4G7RB 4Z78B 4FL4B 1QFWM 1N8ZA 1MSPA 2ORBH 1SUJA 3QFGA 4MDJA 5F6IC 4AC2A 5GGRB 3WDJA 2BXYA 3RUGA 1M42A 2BIOA 5ESAB 3IF1A 3W57A 1JMZA 1U41A 1OGAD 1WFTA 3B8YA 5DVMA 3UJTL 3GLEA 3UZQA 4UINH 4B5EA 1KPRA 5E00B 5IHUL 4L8BA 3UERA 5IOKA 3RVXD 3RWIA 1FG2A 3VSQA 4JFTA 5JTWA 1IV8A 4LSTL 3EH2A 2HX8A 5I6XC 2QV4A 5CMAA 3MX0B 4OCSL 1YEIH 5FYKD 2H32B 5E8EA 3ZL2A 2P44B 4XVUD 3MV7B 3FTGB 2PCFA 2OSYA 4IRZA 3QRLA 4DIXA 1QLRB 4P46C 1WLHA 5DS1A 1RUAL 3RYMA 4DZ8A 3V5HB 2P80D 4YDLB 1KIQB 4Y2DD 1Z9SA 1JN6A 1QTYT 3FONB 4AGOA 1TVHA 1F90L 2L3BA 4J2QA 3AADB 1RZQA 4KK6D 2FX8L 5CGYC 1T7VA 3MVSA 4UT9H 1A6AA 1HHIA 3SDAB 4A39A 5M95B 4XP1L 3VB8A 3T3PE 1X3DA 4PD4J 5T3XE 1Q38A 4PS4H 4HHAB 2A7BA 3ARYA 2OPCA 4PVLA 5GGQH 4Y5YA 4MQ7B 1HYRC 1QI3A 3MZGB 3T2PA 1IL1B 4DW2H 3L45A 2WNGA 1BLIA 5IB1A 2Z4QA 3K8MA 4Q4IA 1J9CT 3ULVH 4K3GA 4L9DA 1IZKA 4UZGA 4Y9FA 1FCGA 4URTB 5GRXG 1PZCA 2I9TA 2N01B 1WT5A 5CD5D 3VH8A 3RGVC 5HSFA 4N8CL 5A3IC 2PTVA 1AXSA 1XB6A 3VFUA 2HMIC 4RA0C 3GSRA 3UYPA 4DFHA 4EO5A 3RWCA 5DEFB 3P3UA 3U4EB 2BS71 3CZUB 3QCTL 4MJ5B 3FH7A 4M8UA 5AW7B 1USZA 4V1DE 1MFAH 1TF4A 2BSRB 2ZYRA 4X7DC 5C0ND 3W82A 4Z7QB 2XICA 3MJ8B 5K1JA 1WCBA 2YAQA 1NA8A 3T0ED 3O9WA 1T4KB 1LWRA 2EIEA 1XD1A 4XT1C 4B3VA 2ZQKA 4H8UA 1UCBH 4ECNA 1A6VH 5EN3A 2VAAA 2V2TB 1AZZC 2YWZA 4N26A 4M5YH 2WYIA 3EYQC 3K6IA 4PRIB 1WUZA 5EU6A 3KLSA 2CM6A 4ZG1A 4WK4B 1A5FH 4WCYL 5IHWA 3I6SA 4WTQA 4I5BA 5I71C 1ZY9A 2AXFA 3OMZA 4HDIA 5TDNA 1OAYL 5L0QC 3VXQA 2VQTA 2X6UA 1OM3H 2IAMB 3CZGA 3UJJH 2XTJC 2X41A 4Z7WE 1KB9K 3X13B 4XP1H 5KYWA 4JBSA 4GG6A 5MERA 4XXCA 1JGEA 4MCYA 3RGVA 1U8KA 4BV1A 5H94B 1U8OB 4FTDA 4H2AA 1X5ZA 3O2DA 2Q2EB 1JP5A 25C8L 2K8MA 1AGCB 1VGKB 5HHME 4YDIL 4K9EC 5BZXA 4H25B 1JZFA 4LIQH 4ZFGL 3MRQA 3O6LL 3ISWA 1OHZA 2F7OA 1MOEA 2MOVA 1KBBA 1T6VN 2P48B 4E5XA 4WO4B 1CDJA 1W72A 3U7YH 1TTBA 4TM9A 1A3RH 2AGJL 3H9SE 4NKIH 4TL4A 1DSFH 5DGQA 4DWHA 5CD5C 1NCJA 1J1OH 2C34A 3IPBA 5E8DH 5I66B 5ACZA 4HPHA 5HYFA 4S0HA 2C3HA 4PEEA 1SHXA 3P4MB 3ARGD 5ETUB 3G6JB 3FO9A 3MRLA 2WD0A 3WOVA 1XDTT 2EO9A 4E41D 4X6DE 2Z7UA 3A4AA 4HUMB 1UXSB 2F5BH 1EZSA 2VM9A 1SBSL 4CVZA 1YNTF 2FEDD 2GUOA 2QZQA 2WIIB 2GJPA 4JFDA 2X4OA 3VVVA 1J0ZA 3ZKNC 4IHBA 1ZVNA 3A22A 2CHXA 5D5MA 4HKZB 3RZCC 5AUMA 3WJLC 5CJQL 3L6FB 3ESMA 4JO1L 3W9EA 1AXTL 3RI5K 4B9GA 1SLXA 4JUSA 4OR1A 4UZSA 1JZDC 2XKSA 3NA9H 2IFGA 1OSPH 1KBKA 4Q7DA 3OXSA 1JPEA 5BVPH 4GO9A 3HJEA 1JNJA 4YE0A 4WRLA 5E2WL 4FQ1H 1EMTH 4P48A 4TSBH 4NQUA 1NAKL 4KY1H 3SPIA 1EXHA 2H1PL 3TWYA 4JEGB 4EIUA 1J8HE 3BN3B 4JR9L 2CDGB 3WEBA 2EICA 3U6XS 3Q9PA 4JFWA 2J4WH 3DXAE 2L8AA 4PW3A 3PQYA 1AS7A 4GXVL 3IFLL 3F84A 3T9WA 2E7MA 1PLBA 3X1NA 1O0VA 4U49A 4MA1C 3ESUF 2J8UA 4X6BA 1P4BH 3X11A 1ORSA 3TH4T 3ES6B 1K3IA 2VDOH 5D71L 2R0WL 2PYED 2F7RA 3NZ8B 1Y18B 3T71A 1KTCA 3TH2T 1EAPB 1XMWA 4ONHA 1GHFL 4PGBB 2VZUA 2IDCA 4HBCL 4LNVA 2I26N 2IPUG 1E8XA 3WEXA 4QJ4B 1C08A 1D9KD 1FG9C 4HT1L 4JPSA 3CFCL 1QSZA 1PY0A 2YAMA 2CAKA 4ODTH 2GJ6E 5FO2A 2J20A 3FUNA 2G2NA 1C8PA 1GC1H 3INUL 1HCYA 5KSBE 3N41B 4LO9A 4KRPB 4LLDA 4IOSD 3FOMA 5BUPA 1D5XA 2CHWA 1KIRB 4C83A 4Z76B 3L7EB 2J44A 2UX6A 4YIQB 4GMSL 2AJVL 4JUTA 5KJ4A 2ZKHL 3ATEA 2YGQA 1Y6NR 3LVTA 5LGJB 4Q9RH 1EZUA 2HFFB 1INEH 4L3EB 4RIRA 5AOIA 1H15B 1TTAA 2Y7LA 3AS2A 4YC2B 3QJFB 3QORD 1XGPB 3UTTA 3DBSA 2PCXA 2VR8A 3NT0A 2KPWA 1M7DA 3VUAA 1KPUA 3D39A 5E9DA 3BE1H 3TYGH 2HG5A 5CKAA 4MQXD 4ZTPL 3QUMB 4N2GA 4Q6IB 4QUOA 1N19A 2YSTA 4LFHG 2OMZB 3ROLB 3S97C 4WI3A 1D5MB 1JWSA 1BBJA 2EUVA 4N0CC 4FKEA 2NDGA 4L8BB 2OXGA 3MUGA 1XD0A 2CIKA 3K2KA 1CXEA 4NKMA 2W65A 2YQGA 4Y1SA 1UGKA 3SJVA 3VWKC 4F92B 1KULA 3N0AA 3L08A 3ALWA 4FG6C 4WDIB 3IJHA 3QDMD 4R4FH 3MJ6A 2P28B 4OLVH 4R4BB 3GRBA 1EHAA 5JXEA 2NY6B 3NJGA 4BXSV 1RHHA 4PTUB 4U6VH 4W9CC 2RMNA 2QPEB 4MMZC 3LPWA 3WTXA 2OW7A 3FTVA 2GAZA 4JY5H 3C6LC 3VXTB 2R59A 2ADIB 4KK5D 4JRYD 2W91A 1P5UB 4PJXA 3QJUB 4HEMA 4WFHE 3LB6D 2D8KA 5BUAA 1ZTXL 1HXYB 1X9QA 4HZLA 4OF8A 5FW8A 5K33A 3DX7A 3LKOA 1GVIA 1FO0A 1QVOB 2AEPH 4M1GL 3BAIA 4IRZL 1A22B 3BHBA 2ZX8A 4FABL 1R19A 2GJ6D 1N0XL 3BVNA 4KRPC 5IROA 3FB8B 2VXQA 5LNGA 1G9ML 2ADGB 3AC0A 2UXVA 2V2WB 1ZSHA 2X4NB 3BP5B 3BT2L 5C0BB 2Y23A 5D7KE 1QWHA 1ZT7A 1OAUH 1P4LA 1YECL 2AMUA 2NTFB 4FQLL 4R2GC 1I7ZA 4Y9EA 5DF0A 3U0WH 4OLZL 3B34A 2X4TB 3TNMB 5ADOH 3LV3A 1HNYA 3H0TA 4FFZA 4RRPG 3GKWL 3DOSB 4AH2B 2XN9A 3VXRE 2CO6B 1EHXA 1UACH 3NJNA 3O6FA 4GW5A 4X5XB 3OXRA 1KCSL 4OD2B 3E8UH 2EXWC 3FCSA 1E7VA 3ABMB 3MR9B 5FV1L 2VKXA 3FCTA 5EU5A 1CGSL 3FTUA 3VXNB 4E2OA 2MTAA 1BM3H 5DQDH 3UBFA 5HJGA 3GTNA 5IFHL 3SYOA 1MAKA 4YXKH 1I8KA 5DTFA 5B3SB 4OZGE 4HP5A 5IB2B 1CVRA 1DO5A 4HIQA 1E4KA 3FKUS 3RVUD 5BO1H 2OMTA 2BP3A 5DMIH 3H4HA 2K9UA 3GWJA 3KLKA 4JFHE 4NQED 2AAAA 5CLTA 4IIZA 4MMZA 3R0MA 1OVZA 2BNQD 3L9YA 4ZDHA 1R1CA 1K5NA 1H6UA 3FTSA 5EZLB 4LLVA 4QKXB 3D0VB 5IHHA 3O4LD 3X14B 2X4SA 2FIKB 4ZUWA 3ZTJG 3MLUH 3IN2A 1ZJBA 2GIYA 2NZIA 4KPHL 4IOIA 4NHCL 3GBNL 2VRAA 2C9PA 5H4ZA 2ZSWB 3PHAA 1LWHA 1DQQB 2P5WB 1QEWA 3GSXA 2FRGP 2JKNA 3SGKA 3BIBX 4OGYH 1CICC 4N22A 1CE1H 3RBSA 2A9DA 5ID0B 4UAOB 3OAUH 4Y1AA 3OWEA 5C0BA 2H6UA 5TQ0H 2Q9OA 4P2AA 3D48R 4PJ7E 3JWNC 5SWQA 3U4AA 4TF4A 3AT9A 3JVGA 4MZIA 5MI0C 2QKIB 3DECA 3L3JB 3GIVA 2JKTM 4TUUA 1EO8H 2VWEC 3O2DL 2EDBA 3PY9A 1CXIA 1FFOA 2IQ9L 2KHAA 1HXYA 3VFVB 3HVDA 2HT2C 1ERNA 4HKXA 4YX2H 1LO5A 4N6RA 1NUGA 2JKRM 2ZXBA 3N43B 1FNAA 4L4VD 5PCYA 3EOAA 3STLA 4ANKA 1WWBX 1T2JA 3FYEB 1D6EB 3KYMA 1E2WA 1T80A 4QXUH 1XQ4A 4MBOA 2AF2A 1PPIA 4YWGL 3NJHA 3QZNA 2R0KH 1TJGL 4X5WA 5I1CH 4QRSB 2H8PA 3J2PA 1CFBA 3Q8CA 1MFCL 3RUGE 4KJQC 1EBPA 4FTVA 4UQDA 3MLPA 5ICUA 2H2SD 2WSPA 4ZT1A 1JHTB 4FC3E 2W65B 3SJVB 2DPKA 4JVPA 4E41A 4LIQE 2ZPKH 3BWSA 1L6XA 2C1PA 1PAZA 4LLMB 1PD1A 1Q1JH 3CAFA 1E4HA 1YEDA 2O6EA 3LEYL 4PWJA 5E8NA 2J88L 4PP2A 2WWKT 4XRCA 4NKIL 1E8WA 2UUDK 3M07A 5KSBB 4Q9QL 4FFWD 5D7JA 1FBIH 3QUMA 4I9WD 4MCNA 3F5WA 1MNUH 4JDZA 1LO3H 1KBGL 2P47B 2VIRB 2NY2B 1TTFA 4M4RA 4WNQB 1RMFH 2EDDA 3HRZA 1H6EA 2FX9L 2AK4E 2D31B 5IJBC 3NJIA 1NFDA 2LLNA 4Q8BA 2P8PB 3WN5C 5IV2A 1GXEA 3BUIA 5C2UB 1YEIL 1P4IH 2F5AH 3DROB 3EH3B 3FQ4A 5ACLA 4RDBA 1J05B 2J6EL 4IOFD 2UY7B 3K4AA 1EERB 3FSOA 3UABA 5C9JB 1KBWA 2ZXEB 4IGBD 3H3PH 1SJHA 4DEUA 3T0BA 1NCTA 5AD0B 5FYJD 4HGWB 3UJTH 2YD1A 2V2WA 2XRAL 1EVUA 3UMTA 3LD8B 1EZVY 4PJ7F 2PYEA 3NESA 3QQ3B 3QIWB 3GJFA 4YX2L 3SGJA 3TVMD 1UZGA 2H45A 3PV6A 3TBWB 4I3SL 5JHDE 3LKOB 3FC8A 4X8XA 4PGJA 1XWVA 3EGDA 3WNOA 4M56A 3QNZA 1PZDA 1QHPA 5GGSY 3FT3A 1YDPB 5AYUH 3WNKA 1BV8A 3EKCA 3GK8L 4JCLA 5HHPB 3B9VA 1WZAA 1HHJB 2YJLA 3FFOA 4LQFL 5EEWA 4IRSD 4L9LB 2RQ8A 4LEXL 3RZCB 4N2LA 2XV2A 3ENEA 1N5YH 2OMYA 3O4OC 2E7HA 1B2WH 5SWSA 2EH8H 3UYRH 3STZA 4QRPE 4UB0H 3MLXL 1KPVA 3PAUA 1OAQH 1PU0A 2WLMA 1QR1A 4XWOC 4X2UA 5FCUL 1HESA 2PO6D 5TF0A 4A2EA 3B56A 4WHTA 3OG4B 4I3GA 4ODUA 2DM2A 4R6UA 1T0NB 4IMLB 4LVOC 2ZKXA 3LNGA 5D7JC 1GAFH 2IPKA 5BZDB 2F8OA 3QORA 2AJ3A 5F7MC 1CMOA 3OXSB 5DZNA 1KYAA 4ORGB 1SDDB 2PCPB 3I6LD 3OB8A 1J5IA 1KCKA 2WWMD 5EWIL 3I9AA 1MCOL 3GJEA 3OL2A 3MJGX 2MTPA 5ADPH 4Q0XL 1ZSDB 3S5LB 1NEZA 1WA1X 4Y0GA 3F7YA 2V7HB 5J6GA 4PUBL 4KO6A 4M7ZC 4AEIL 2W8CA 3QNFA 4AYEC 5AOLA 3SY0B 3ZE1F 4DP1X 4Z3HA 1XEDA 4P99A 4GAAA 2VO8A 3F58H 4BQ8A 4L37B 3ULSA 2A9NL 2VZOA 4NC0B 2FJFB 4ZW5A 2M26A 5ACZB 2AXJA 3EDJA 4GBXD 4AQ1B 4D9RD 2Z8RA 4W9KC 3R8BB 4Z76A 5ECGA 3CFDA 3DOHA 4PU2A 4FZ8L 3T77A 5I6LA 5IBLD 3SEPA 3O0LA 4U0RC 2HRPH 2N3JA 1BQLH 3N1MC 2NNRA 5DUMH 4KXBA 2PPEA 4XI5C 2IBBA 1LDPL 1KJ2A 4JO4L 5I8CB 3S34L 1X7SA 2AK4A 3O11A 1CLVA 4M3JA 2IXQB 3H1ZA 3O45A 4NFBA 3T08A 3T0EC 2DJ4A 2QDVA 3R4DA 3PG2A 1JGLH 4FQXC 4X5QA 3FB6B 1G6RB 3NIDB 3P0VH 5E6SB 4GKNA 4LCCB 2ORBL 1M6UA 3TC9A 4XMUA 1GJIA 5DUPL 2P7TA 1J8RA 3AG1B 5B4MD 5DJ8B 3IVKB 3I9GH 3TZVB 1F86A 3L4CA 5CINL 3NACL 4OBSA 2X12A 1TSRA 3P4NB 4YSDA 5A3ID 1V7MH 1E5CA 1UB6A 4RMBA 1QLFA 2GUYA 5DZAA 2HRHA 5MEQB 1J9SA 3KYKH 2P8LB 1V7NH 4KGJA 3ULUF 3H7BA 2VDRB 4J8QA 2YMXH 4OJEH 1NFIA 1T3FA 2R4RH 3ARXA 3BT2H 3E1ZA 4ILDA 3VJ6B 5LWYL 5JOEA 3NJJA 4QY8B 3NAAH 4JFSA 4Y4FC 3W11D 1PZBA 2K6YA 3C8HA 1ITCA 3VFTA 4WSKA 4KROD 3BQUC 1EEZA 2Z91A 3SDYL 1HZHH 2PYEE 1SXZA 2F53D 1U4FA 1R3HB 3HC0A 3GMLB 4E0RA 3NFPA 2CHDA 5AKTA 3MROA 1M2VB 3M88A 3GM8A 2Y3NA 1XGQA 2NQCA 4MKMA 4NUQA 4ODSH 3VNZA 2Z4QB 1XCXA 3ZKQD 4D94A 4P59H 1RAMA 2BSSB 4MVBD 3GMRA 4TXVB 1H6FA 1XMEB 2R2EA 3HE7B 4Z3EA 2D4DA 2IWEA 1ASQA 1DL7L 1CL7L 4X6FB 1F56A 2F9BT 4FQQB 5TK4A 3MC0A 3AS1A 3SDAA 5EEYA 5LQBL 1SLWA 4C57C 4RFNB 3WIHH 1RZ7L 4N87A 1IEHA 4XCYA 3W0WE 1L5GA 1WYJA 5C0BD 3HC2A 5J11B 3U9UA 2L7QA 4PB9H 2F68X 2F61A 1DJWA 5I73B 4GG6B 3VYPA 2QKIC 3BPNC 3MV7A 3LS4H 3F7YB 3O0RH 3OKKB 3ARBA 3LZFL 4RSVA 4NHCH 1MI5B 4BQBA 5JA8B 3W5NA 3K1DA 4JM4L 4L1BA 5IQ9A 2G4EA 4R7DB 3QDJD 4G6KL 4HSAC 4LGRB 4XBMA 3ZY7A 5DK0A 3BZ4A 2JKXA 2OA9A 2YLHA 1E5YA 2EUWA 2R4RL 2P5EE 5E2TH 5EZJB 2GEEA 3WXVL 2C3VB 2K4WA 5DZPA 3U7AA 2ARJB 1JUFA 3QIBC 2H9GB 1YMME 4Y4HB 1KCVL 1KZQA 1FNSH 4QJ5B 3GRGA 3P40A 5I82A 1L5GB 2DIBA 2VLKE 4XPAL 3MOBL 5J7CC 4FQIL 3SDYH 3VI3F 1FJ1B 4ZMZA 1XR9B 4NQEB 1IT9L 4DH2A 4JDEB 2GJRA 2CGYA 4U1IA 5BRZD 4G9FA 1QX1A 4UQIM 2JXMB 2IOIA 2E6QA 1ZIBA 3TJHD 1RFDH 1Z6JT 4NPYA 3WNIA 4AJWA 5AG8A 4NX0A 3M7OA 1NCBL 2FWSA 2W0FA 2R7EA 3HKZA 5MENE 3L3IA 3U9WA 3DO7A 3MJ9H 1FL6A 1PZ3A 2ZXQA 4U6TA 1LE5A 1M9SA 3ECVA 1BAGA 1B0IA 2VZVA 3FHQA 1RUPL 2E56A 3HUJF 3K91A 3QK0A 4X4XA 2XC8A 2JMRA 3E8VA 4FA6A 5KSAB 1B2YA 2VABB 4MJ4A 4BIKA 2H3NB 5GXBB 2VC2L 1YPZE 3T6ZA 2E46A 1JCKA 4PJGF 3GB7A 4HALA 4K3EL 5H37A 5TDPB 4CNIB 4MKTA 3CIAA 3VSTA 2OBGA 1KWKA 1A6UH 4K9EL 3LZFH 3RVUC 4DVRL 4H20L 3U4BL 3SKJL 3AY4C 1AQDA 1UCTA 4G6ML 2FZ3B 1GZHA 3BUQA 4WUUA 4NFCA 5CWSB 1JSYA 3H85A 3JT2A 1RUQH 5GRJH 4F7EA 1IAOB 2CGRH 4WNQA 1QFWI 3BEVA 3CDZA 4GKOA 2Y25A 5H37G 3VSVA 1F1DA 2IH3B 2UZPA 4JM2F 4CBPA 3GF8A 1OK8A 4DP0X 4ZMLA 4WEEA 1VERA 1I9RH 2XG5A 1YNLH 2KZ1B 3SKOB 3VXMB 2BY1A 5D7IB 3UPCA 4GFXA 5FUOH 5A2FA 1GJUA 2WYZA 5IVXB 1SJVA 1PLCA 4W9IC 2VL5B 1HHKA 5TE4H 43CAA 2Z8VC 3RTQB 5CP7B 4BINA 1WICA 5LNDA 1Z5YD 4CADA 1DP0A 1Y07A 2FX7H 4GB9A 3NCYP 1E42A 2H8PB 3J07A 3FJTA 4OCYL 1KTDA 3EO9H 1M7XA 1Z9PA 1I8LA 1MCWW 3G5VB 4MJID 4JKMA 4HS3B 4MRBA 2CSPA 1NMBH 3O8XA 3BUBA 2G3MA 2VDPB 2C1OB 2ITCA 2VR7A 5BRPA 4QRPB 4BE5A 3TGXA 3KL5A 1W91A 3VFSB 4ATWA 3OKOB 4LLYB 5FA4A 2DBLH 2PW2B 1J0KA 3MNWA 1ACXA 4MRCA 2PPCA 3RX9A 3WFEH 2AERT 4M29A 5FO7B 4G82A 5TE7H 2LAGB 1HHHB 1CD0A 5IJDC 4TRPH 4PJ7A 1ZKAA 1YSOA 5ENWA 4QO1A 4EIZC 4JDTL 2NNAA 2X88A 4L23A 2XKNB 2F19H 4WLCA 1OAUL 5EF0A 1ZDQA 5AAMA 5J13B 1G0XA 2ZKHH 1VACA 3SPGA 3H3BC 3TA3D 5CZVL 2ICWA 2BJML 4NCC1 5AZEH 4AQZA 2E4FA 2D0FA 2WBKA 3B9DA 2J8OA 2Y36H 1XZ0A 3GSUB 1MVYA 3D06A 4HUXA 4MNGE 4L3ED 3VMOA 3PP3K 1KLGA 4QOKE 4H8WH 4EDWL 2NT0A 3GI9H 3U79A 3UTQA 3F01A 1CFSB 5F3HA 1ZOXA 3MRMA 3FULA 4X6CF 4YK4B 3QEUB 4NZUL 4OAWB 5TDOB 2Y5TA 4JZJC 4P4KC 1UOLA 5FX3A 3UJIH 4K8RD 3M45A 1HXMB 4H8VA 1HX0A 5HYJB 2WCPA 1NJ9B 1H8SA 2Q0ZX 1BCIA 5ABAA 1HEZA 1JNHB 3DJRA 2VXQL 2ZIDA 2GCYA 4TUKL 4M6ML 4IU2B 4QR7A 1A7PL 2E9GA 5I17B 2H32H 3MLWL 1YEGL 3KPOB 3K8KA 1SYVB 2YD4A 4FZEL 3Q3GA 3DDGA 5A1AA 4WUKH 1UM5H 2IAMD 1CS6A 1HWHB 4BKSC 4GAGL 3WTUA 5BRQA 2K9FB 4FFZL 4JFEE 5F6HJ 1R24B 3CVCA 1JPFB 1PY4A 2Q3XA 1I8IB 3P9LB 3R7QA 4EOWH 2E59A 2YFNA 1KEMH 4LVNC 1JHKL 5DMJB 1T7YA 4JL2A 3P73A 5DC9B 4LLWA 1BFOB 1FRGL 2EKJA 4KHTL 5HJ3B 2XNAB 3MODH 3MFFA 2LE9A 1GOFA 4X5XA 3UBXG 4UCFA 4I77H 1KYOJ 3NH7H 4AH2A 1J0JA 1ZE3C 4AW4A 4BH8B 3QZWG 4RZCB 5D6DC 3V0VA 5C0CD 4PJFE 5JW3L 1GOGA 3X12B 5INCA 1YPZF 4E9WA 2PXYB 3BI9X 1JZHA 3NACH 4NZTL 4X4ME 2J3SA 5AWNH 3KPQB 3O3BA 4JVUA 1TNMA 3WEOA 3QFJB 1T83C 1CYWA 4TQ8A 3CBJB 2IPTL 3AWFA 3OKYA 3DMMC 3QUGA 4QMEA 3KM2A 3BHBB 2NR6A 3KPSD 3DVGA 4EJ1C 1T0MB 4EI5C 2HTKD 3CLFH 4MNHB 5IROC 1JGVL 1QA9B 4FERA 2EEXA 1EHNA 4G71B 4FKHA 2QQKL 5EORH 4TUOB 3A4EA 1GCYA 4WNJA 5KYUB 3GMNA 2CNYA 4MLSA 4GT7A 4NT6A 4UNIA 5KSBA 1HQ4A 3AZUA 4HXBL 2DJSA 2WXNA 3BKMH 4HXAL 4PTUA 4KZDL 2EXTA 1QKZL 5IBUG 4GS7C 3JV5A 3MBED 4F3FB 2WQSA 3TIDB 1CQKA 5IEKB 3IJHB 3LOWA 4ZX6A 5JIDA 4X4YA 4N1CA 4XC3L 5IEKA 3GUTA 5D1QC 4PI0A 2A2QT 3FUJA 2YZ8A 3MV8D 4ZUTB 3ZKMC 1JDCA 4ENED 5DDHA 4HIIB 4XX5A 1D5BB 5FM8A 5JUEH 1NPNA 2X2YA 3VGFA 2J12B 4NP4L 3CN0A 4NSKA 1OTSD 1HJCA 2DQFB 1ICTA 3ARDD 5I76B 4WEBL 3RWGB 3W56A 3FRPA 4JFFB 3WSQL 4K23H 4X8GA 4Z7OB 5TH2B 4J6IA 1Q90A 4LVEA 1S7WB 4ZAKB 4ZD3L 35C8H 3DPDA 5L2KE 3UPAA 5DHEA 3HAEG 5LXGL 4Z7VB 3RJQB 4GIOA 5C0DB 3JTSA 1JVKA 3L3DA 3WTWA 2ODHA 5FYKL 1INQA 1FE8H 5BO0D 1JDAA 7PCYA 1GS6X 4YOKA 3QYNA 4HJTA 4EN3C 3VRLE 3S35L 2ZJSH 5INCB 4ATTA 3NRPA 3T6QC 2FQDA 5BRZA 3WI9A 3BRDA 5IQOA 1H3TA 3ARVA 15C8H 1CURA 3WG7B 3MA7A 2DQDL 4MXVF 2O6CA 3EYVB 5EZOL 3ZTEA 2VXUL 3BLBA 3I50H 5FK9B 3ZZLA 3GSQA 2WLYA 1J9TA 1J1PL 3EO0A 4JFYA 3HAEH 4XNUH 3U36B 4UMGA 5IB3B 3DX6B 2L7JA 4XP6H 1LEGA 1GMIA 2R4SL 1I8IA 1UH3A 5DHDA 3ROOA 4J2XA 3FUHA 1RZJC 2JCCB 3AABA 1FUNA 4R84A 3AFLA 3ES6A 3TEWA 1UWXK 5HDQL 2VDQL 5GHWL 3P11H 5D8JL 1JNNL 3GMQB 1DLFL 3BN9C 2VLLB 5DZVA 2ZG3A 4ZOCA 1XVSA 2DICA 3IDNB 1TCRB 3PUUA 1B4LA 5L88L 3DRQB 2VDLB 3QARA 3DX8B 5KOMC 4FNSA 1KENL 2CG9X 1HEZB 2OJZH 1NCOA 2IQ9H 1FZOA 2JB5L 5SX4H 1A21A 1M9WA 3C5ZD 3I9GL 3FCSB 2ADFH 4JHZA 2ZF9A 2DQDH 4HIPA 4XPFH 1FZJB 4XTRD 5EU6E 4L29A 4TPRH 1A9BB 2YR3A 3AY2A 1LGVA 3GD1C 3MOQA 3AT8A 4PHZA 3DOSA 3O4OB 3LS5H 4C4UA 4L0ZA 4JO3L 1OL0A 2D7TH 1TFPA 2IADA 2X4TA 1A4KB 5EU3A 5C07D 5FO8A 3SE4A 4Z3JA 4HCRL 1GGYA 1MCPL 3T09A 1KGWA 4DO4A 1SDYA 4KK9C 3D1MC 3H9YA 5A7BA 1SHSA 2X4NA 4DZBA 1MUJB 3II3A 3BJLA 3CMOH 2XKNA 1UENA 3OF6A 3WV0A 2R8SL 3TP4A 1NGZA 3POHA 1IM3B 4IBUA 5I66A 5K59F 2EADA 1UWGH 5F70A 1YUHB 3OV6A 3Q8BA 1TETL 2CLVB 2E86A 4WFEE 3LPPA 4M7KL 1Z0NA 1U8LA 2VW4A 5F9JA 3H6JA 1CE6A 3LX9A 3JV4A 5I1LA 4N3TA 1W0YT 1NUFA 2UXGA 3KZ8A 1KG0A 4PJGB 1G6RH 5JW4R 4J3VA 1M71B 4WSGA 1SN2A 5DZLA 1IQWL 1D9KC 2OMXA 3HZ3A 3QDGB 3GMPA 4OZGF 4M8QA 4QOKD 1FIGH 1DVFA 1SOQA 4GMTH 2BIHA 2UXFA 3GMMB 2X0WA 5E8OA 4ZAKC 3U25A 3RGHA 4JO5A 1NLBL 3TLRA 2J8UF 2R9HC 3A0OA 1I9IL 4CVXA 4XPBL 4OI9A 1WFIA 1JOIA 3CDGA 4OVUA 2CR6A 4OJAA 5HGBA 5IMLB 2JKLA 4PG9B 4QGYA 1AKJA 3BAKA 3PE9A 4JE4B 4GSUA 4L4VE 4DQOH 2X1PA 3WKQA 4LOUD 1TDQA 3VG9B 1RZ8A 4NNXB 2O61A 1GGTA 3D39B 4AV0A 4B6ZA 4NIYE 1CFTB 3SDDC 2EXYC 2XKUA 4LVHC 3X1FA 3QS3A 5JHBA 1DL7H 5KVFH 4Z0XA 2AEIT 2J5LC 4JPWH 3UIZA 1A3RL 2CO7A 1MCPH 5BS0E 3WGVB 3ZK0A 3OZLA 1XGRA 2ZXGA 1MAMH 5F3BA 2W9EL 4S1QL 1BZOA 3CGTA 5I23A 5LXVA 4R2GB 3TEZA 1NEZG 1UOVA 4MNQB 4GI8A 1ZLVH 2NUTA 2ZNWA 2C9XA 1JK9A 3MUY1 3ILEA 4A2LA 2VAJA 4LCYA 4PJAB 1CK0L 4MLIA 4JLRB 3MRJB 2RBLA 5GGTL 4F7MA 5A2LH 4GXVH 4Z3IA 4HHGA 5CS7A 3VXOA 4M7ZB 3FU3A 4ZXBC 2EDKA 3ZKMD 1Y6MR 4MHHI 3OAYK 3OKDB 2WYHA 4F7KA 3UC0H 1I85C 2J43A 2NY3B 1OGAE 3MYJB 1MWOA 3GSWA 3QUHA 4GSQA 3EJUA 5AYTA 5IMMA 4AQEB 3OAWA 2Q7YA 4HA1A 3ELQA 1DBAH 2ZWSA 3HS0C 3LY6A 4GRWF 1JWUA 7CGTA 1MFEH 4JO4H 5DJXA 4JE0A 5IWLC 3LZLA 4Z95H 1LK2B 1VF5C 4P3CL 3KJ6L 5E4AA 1CGWA 4N2DA 4OF5A 3H2PA 5JPNB 4LHUG 5A7EA 5IMOA 1BX2B 3NP4A 3DX9B 3OLEA 5FWQA 3OJDB 1ZT4B 2F5BL 4XNQA 4Y4FB 3L5XL 1T1YA 3DX0A 2ZXCA 3IDGA 5LBVA 1Z9SB 2BSBA 5E6IA 4F7TA 3SJVE 3W3BA 4ACTA 3S37H 1IGYB 1P2CB 3QCTH 4FFVC 4EVNA 2K8QA 1JZ3A 1L7IL 3I9PA 1SM3L 4J5VA 5JNYA 5SWSD 1S3KL 3IJSA 4AYMC 1J1OL 3VX1A 3HPLA 4XVJL 3OPZH 4XOBA 3WJLA 2N0MA 1ACYH 2Q7NA 3HHMA 2W88A 5D1XA 1CLZL 1XFPA 1MI5A 4BFIA 4MTMA 2Z93B 4N24A 1QRNB 3KLLA 4ZRGA 3HPJA 4E9QA 4XBPB 1UKQA 4FFWC 3TTYA 4PY7A 2JWYA 3JYBA 2GUOB 2WIIA 5IF0A 5DVKA 1FVEA 4OSUH 5AVTB 3QJOA 1ZK5A 1TQWA 1CBJA 2RCSH 4MS8C 4PJCE 1U95B 3QQDA 3NCXA 1RK1A 4QRTB 4W9GC 1OM3L 3UAJC 2GY5A 3N50A 2QFRA 1TG8A 4L5FH 2NY7H 4LRNL 5HYQA 1ACCA 1NSNH 1Q0XH 2K6ZA 3ZTNH 3PNRB 4PH8A 1HK6A 2BCKA 1YMMD 2MKLC 1WTGT 3BISA 3K0WA 4P2QE 2M1KA 3DV6A 1TZGH 3HEIB 1S5IH 1LQBC 1Z5LA 3TYFA 3QDJA 1IC4L 1PL3A 3B83A 2YC1B 3B43A 1Z3GL 3EOBA 1HH9A 4B9FA 5TGBA 1J88A 1FNFA 5I1DB 3ABZA 3MCKB 5LQBH 2IAND 3C5ZC 3MJ7A 5FKAA 1AIFB 1S5HB 4K2UL 1T5WB 1UWXH 2FLMA 1FPTH 4Y19D 1JGDB 1AIZA 2AKRB 3D25B 3HNSH 3MV9D 5F7WC 2TRYA 3Q2LA 4NWUH 3BUYA 4YE4L 4BWTA 1X6NA 1QW9A 2AK4D 1G9NH 2ATPB 1A6PA 3EGXB 5FFGA 4U1KB 2H3KA 1QLEB 1PZSA 3ZE0F 2ZX7A 2QSTA 2CBPA 4HF5L 1K8DB 3KBFA 1QFWL 3BFWA 1K4CB 3AM8A 1AO7E 4Y2DC 1K85A 3ULVD 2VAAB 4H2CA 2VISB 2PP8A 4KFZC 1R5IB 3MSPA 5BQ7B 3EYSH 3O6FC 3HG3A 3P3YA 5CCHE 3VCLA 1H8LA 2D7QA 3MBEB 2FGZA 3WBDA 5DC0A 1EZVX 2LU7A 2IALA 3FBQA 3CPLB 1NLDL 1JDDA 2FB4L 2PWEA 4TOYL 4NZFA 1VKXA 4UDTB 4NO5B 1D7DA 3SO3C 2MHAB 4K2UH 1BFSA 2VXVH 3S4SA 3UEQA 2JK5A 1CXKA 3HN8A 5E9NA 3DA0A 3NVQA 5G4NA 5CCKH 3TL5A 2G75A 2OMVB 5TQ2L 5DD3L 2X5PA 1A2YA 2QELA 3P4LA 1AYOA 1BQHA 2GJZB 1BD2A 4PRDA 1QSFD 1X4ZA 1KGIA 2XWTA 3RY5A 3WNLA 5L8LB 5CHNB 1E4KC 3LPGA 4XNUL 3O2WH 5D4JA 32C2A 1KBPA 1GSKA 2NW3A 4AQ8A 1L9PA 1P4IL 2X2IA 1UB5A 2B1OA 1P4UA 2IBZX 3D85B 3TN0C 3U30B 2BHUA 2GK2A 3S98A 3UP6A 1R5VA 4O51A 2FJGB 4TSBL 3CFDB 4JG5A 3A47A 5ISZA 3VGGA 3QQNA 4PVBA 4UANA 3QUYD 3KXFB 1J0HA 1U8HB 4U1GC 4UB0L 4B9YA 3MGTA 2OYPA 5F96L 2FJFA 1A7RH 2X1XR 1F6LL 4PAZA 4BUHA 2GEQA 1QHOA 4M5ZL 3MCLH 2ED7A 2AK1L 3QA3A 3V4VB 3VXPB 2OTUA 2NYYD 1TQTA 4MMYB 5FGCE 1I3RA 5DO2D 1LE9A 3AACA 3NIDE 5B4MC 4R8WH 2V5YA 5TQ2H 5D7EA 4LDOB 2XTJD 4DGUA 3VXSA 2RGSA 3KL0A 3OF6D 2LHAA 1WBYA 4PJ9D 4G9FE 3E6HA 4JM0A 3NCJH 5CZKA 1BLNB 3EHBC 3G6JF 2IO5A 3BKCH 3C5XA 3EFFB 3O8XD 5FV2A 5KVDH 2X1OA 4KGLA 1HCVA 4JMXA 2OYMA 4XBEL 4WI6A 2BVEA 4UI2A 3MRPB 4FD0A 2AJ3B 4DOHB 4YSUA 1CUOA 4KHXH 5C3IA 4GUOA 5L4IA 3ARWA 4KRNA 1FFTB 2JJSA 4OGZA 3VFNA 3VU1A 1SRDA 4P5TA 4R90H 1M3JA 2BVOA 1IGML 2HA1A 3QJSB 3A6OA 1NOLA 2ZCLH 1QR1B 4IIQC 5T8IA 4WFHD 5DD3H 3A21A 1DQLL 4KVPA 2XWZA 2BP8B 5HDWA 3AS3A 5KVGE 5LBGA 2FBRA 1UACL 1HEHC 2D7PA 4FQXB 4UM8B 3II2A 3VWKD 1HIMH 1A47A 2FT8A 2OTWA 2BOCA 2JIXD 2WLLB 5DUBA 4Q9CA 4JHWH 4PRHA 5F7BA 2WAQA 1TYRA 3M6DA 1JYWA 1FYHB 1WAEA 3TN0A 4G8GB 4ZPVA 1S7XB 5KSUA 2HTLD 5HDLA 2O5ZL 2WXLA 1Y6KR 2CMRL 3FZUD 4X6DF 3G6AA 4YHYB 3PNWA 5T3XL 4DF9A 3MGOB 4W9LC 1HXKA 3GMPB 5HI5C 4JY4A 5F1IB 1GW0A 4K5OA 1PQZA 4R90L 5HY9A 1AZUA 5KG9B 1KLUB 5AENA 2YPLA 3Q01A 5E9AA 5SWZB 1DSWA 2HVJB 4TV3A 4GI6A 4AGPA 4P23A 4W68A 2XVGA 5DO2C 5E5RB 1R0AH 4U6YB 4ZMVA 1MF2H 3MRHB 3VFMB 4WU5B 4J39A 1D5IL 1N6UA 1JK8B 2SODB 2V3EA 4NBXB 4QAWA 1YECH 3ZIYA 4IRJB 4RZKA 5F0JB 2EEDA 3GGWA 2DMKA 3MACH 4Y9CA 5KN5A 1VCAA 4PGCB 1RK0A 4X4ZA 5JMOC 4JHBA 4PCKA 4G6JH 1ASOA 1IIKA 1I9JH 4P2OA 1JE6A 5GJSL 4KKPA 1CLOH 2J6EH 2VMDA 3S3JA 4H44C 4NO3A 4XRCB 1F4XL 2R0ZL 1FN4B 3I9IA 4QNPE 4DPRA 3SHSA 1AD9A 3K2UL 1U92A 2Z1KA 5GGQL 4S1SL 5CN2A 4YDNA 3FQRA 4NPKA 5ES4B 4TNVK 2BZ7A 3HG1E 3ZRCC 3GNMH 4JM2D 2GKIA 2EYRB 1B3IA 2VCOA 4RNRB 3FU7B 3VMNA 2X38A 3U2JA 2XFXB 1BPVA 1HH6A 4OF7A 1ZHNA 3LNEA 2X4UA 4OLZH 2YLKA 4HQQH 1ZHBB 3AQYA 2J88H 2J1WA 4IRJD 2JKSA 2YSSB 3ZT6A 4AYFA 2QPUA 4LVNB 1GKEA 1A0QH 2Z92A 1DQDL 4B27A 3GEWB 4N0YL 4RRPA 4WHCA 4QHNA 1FL5A 3WHE1 3Q9QA 5IG7A 5IFAH 2QQLL 3SDCC 1K4DA 3DUSA 1BZEA 1L3NA 2EYSB 1KXQE 1NGXA 1T20B 2DQHH 2XT1B 3IDNA 3MV9B 1Q9OA 4POUB 1TU2A 2BOBA 3C2AL 4Q56A 3SN6N 1U91B 3VQ1C 4H0HB 1BFVH 1CGYA 1YPZB 3ULVC 1MI5D 3ZIMA 4P57A 1MRFH 3SE8L 2WZ0A 4DSYA 4WKZA 5DJCB 3S37L 2OSWA 1GGUA 3CDFA 4BA8A 1FNLA 2CGZA 2F58H 1IFRA 1CCZA 1UUSA 2HJKA 3HIZA 1AO7B 3MV01 5CEYB 4ZFGH 1ET7A 5IJKC 3D6GA 3FO2B 4JM4H 4E42B 1QEWB 6CGTA 2MKWA 4YFDB 5CD3A 4ICXA 2VN3A 2B1AL 4QHLB 3ZHKA 5CP3A 1W8NA 3VWJC 3MBXH 5JOFB 3RKDD 1G7QB 3QB7C 4RGNE 3S8FB 3AQZA 4AYBA 1M57B 3DHUA 3F2LA 3QRGH 3WFCL 5J12B 4PY8J 2LOEA 3TBSB 1PNDA 2E0PA 7FABL 4PN6A 2WLHA 5DJCA 4X8CA 1X4YA 3LS4L 2FBJL 4KKBD 4LRNH 3I75A 3PL6C 1EHLH 3C6LD 1KBVA 1MWAB 4LHUD 3BKYL 3WTTA 3DLQR 4FNTA 4PS7A 1E7UA 3KGSA 1FIEA 4MXQC 4FHBD 5K39B 3QI9D 4LSPH 1Q9LB 4KXAA 4QHNB 4OZGA 1GAFL 3BXNB 2YOCA 1F4YL 5F89B 4AMKH 3E0GA 5I0DA 4MAYC 4K71C 5AKVA 2DQGL 4EAEA 1ZHBA 4GIPD 4GIAA 2J4WL 1BHGA 2PN5A 1IAKB 4P46D 1N3NA 3Q6GL 4R5TA 4YDVB 3T3ME 5DSCB 3T4AC 4G42B 3WFCH 4HX1B 4UILH 3VGAB 2OQJA 4ELKA 4L9LC 4K3EH 1MRFL 4D9LL 4UOW0 4P0DA 1MVUB 2VXSH 2AHIA 5J3HD 1OSPL 5LXGH 3BP6B 4XODA 3D85D 1FFQA 1P7QB 1Q0YH 2DS4A 2FX8H 1A1MA 3O41B 4NT6B 3V6BR 2P24A 3R7RA 2FL5A 4JN2A 5I0YA 1RSFA 4LKCA 5JHMA 1U8QA 1T7XA 1VFBA 3AAZB 4QTFA 3U4KA 1BJMA 3LKNB 4D8OA 4YPGB 5CINH 2F74A 2DLIA 4PWEA 5D2NA 4Q58C 2ZXAA 5KZCD 4MSWA 3LNHA 4EBQH 4GRLD 5B7MA 5C86A 1PFCA 3PAZA 3G5YA 2P5WE 4XCFL 1S7UB 3UC0L 1RP9A 2NR6D 3KPSA 2CUHA 3UCQA 2Y1ZA 2DQIL 2D3NA 3TXAA 3P2DA 4QF1B 3PGDA 5AZ2L 2CDEB 2WCSA 1N6QL 2IWGA 4N2IA 3FB7B 2DI7A 2VDQB 4HUUB 1YHPA 3O3EB 1ONQB 5EBMA 4QKTA 2XNAA 4NKMB 1HNGA 3QHFL 4YFLI 1MY7A 2HN7B 2Z7YA 2N56A 4OZGB 2QHRH 2OW6A 5JHLA 1IBFA 1BJ8A 2HX7A 3T6WA 3QG6A 4K7PY 5FGSA 3ZR6A 1QBAA 5INDA 4IOFC 4PJFB 4BFJA 1OT1A 1IIIA 2BP8A 2WMPA 1OK0A 1YZZA 3A5VA 1XCWA 2D7OA 3KPOA 4BFKA 3LN5A 2CIIB 3HG1D 3OR6B 4FQHB 4N0FB 4NGHL 2GCYB 5EUOE 2K7QA 2F54E 5E4IA 5I18H 3AXIA 3QUXA 3U2SB 5ADPL 2X6CA 3KYAA 4YDIH 3VFNB 2NY1B 1OCRB 5HJBA 4BHUI 1JPGA 1J48A 2WHVA 1AC6A 5JMRA 4NDMB 5FM5O 3RZCD 3VM7A 3JZ7A 2BW4A 1IM3D 1YJDH 4IK6A 4KQ3H 1UZ8B 3WJMB 1Q8MA 1F58H 4AGMA 1D5RA 4PV8A 1GGCL 4NHUA 1VPOH 1BZQK 4EI5B 2BIQA 1G7JA 2NX5B 5HGGS 4BCZA 3VD5A 1DJGA 4YNYB 4G11A 4GP8B 4ETYA 1IB5A 5FIEA 3HG1B 4TUJB 1ZANH 4Q6IC 1J8HB 5CGTA 4F1ZA 1TCMA 3AS0A 3LTVA 3RL2B 5DU7A 3GZKA 3WE6A 4Z77A 4MQXC 4J3WA 4W6XB 3W5MA 2APVA 3WUWB 1O5PA 3ULVL 5D4QA 4YXKL 1OSYA 4KMTL 4EPSA 3QPQC 4ZTEA 1QNZL 4GAYB 3IMTA 3IJYA 3GS4A 3L3HB 3V6OC 1BQ5A 4LEOB 4WO4C 4I3RL 1IVLA 3WNNA 2GVYA 1VZGA 2GBUA 1SOSA 5J1AA 5T1LA 3HMWH 3SKMA 3TCXA 1TJHL 5BZZA 1XO8A 1IEBA 1HQRA 4IIQB 4YDZA 5GSRB 1HC1A 3VB9A 5EC1A 1TVBA 3WLWC 5GZOD 1X44A 1UTDA 3C8KB 1RI8A 1KIPA 1UWEL 2VDOL 3HRPA 4JJ5A 4OGAC 1FAKT 4ZFOB 3RFZA 3MMEA 2FQEA 3GXIA 4JKWA 2NY2D 3EH4B 1KJ2H 3NN8B 4L8SC 2VSDA 4NUJB 2ED8A 2NY5H 5E6RB 5IMKA 2JK5B 4P2OD 5BOPA 4TQIA 2YEZB 4FTVE 2AJYL 4KX7A 3FFDA 4JO2L 4S0TD 3D2UA 3VD2A 2X4OB 4ISVB 5C0GA 2NY2C 4K9EH 4NQCA 3NZHL 1JHKH 1MRCL 3IFPA 4FMFA 1J8KA 4JFXA 1KGXA 1XCTA 2MMXA 5C07A 3DUUB 3TBYA 4F80A 5D2LE 1E27A 5KAQG 3JUZA 3P77B 4PJEB 4BSVB 5ALCH 1NEUA 4NXKA 5D1QB 3I6GA 1X9LA 5EC2A 4WO4A 5AOMA 4A6YB 2IGTA 1WS7A 3CFNA 3MTRA 2W60A 3NABL 4G70B 2DWYA 3PF2A 3B5GA 4JNXA 1RQ5A 1OTUD 5EZPA 2KYIA 2M8XA 4GO8A 3ZW3A 1IAMA 3QWOA 3UBXB 5J8OA 3TF4A 5EO1B 3L48A 2BK8A 2XQYK 4JY4B 3QR2A 3E9UA 1KGCE 5F1IA 3RGVB 3V8OA 2J55A 3HUJB 1CFNA 1DBKL 3BDYL 1HNFA 1UH4A 5IVXF 1RLWA 4FLSA 3UAFA 1OD7A 3MRIA 3UZVB 1G5GA 2NRDA 2XWBB 2AV1B 1WVZA 1WD9A 1XF5B 2I7OA 2OMNA 3QI9B 1J5OH 4ZSOA 3B7YA 4D0CA 2GITA 1N0LA 4A6YH 1L7TH 4WHYG 1T7ZA 2EO7A 4WJ5A 4GQQA 5CZVH 5E6UB 5KVEL 3BCDA 3K6SA 2HLFD 4AQ1C 3DETD 1NDGB 1WD8A 4N8PA 3FFCA 1JZ6A 1R34A 1KNOA 3MAWA 4MA3A 5H35B 2XIIA 3LHPL 4BSWB 1DTUA 1RZFH 4TRPL 1HJBC 3RHWF 2XVBA 4ZMNA 4JM2C 3TNNB 2DMGA 1NLDH 3DHJA 2VLRA 3DTXA 4R4FL 2NXZD 4MB3A 4H5SB 4P4KA 2IQAB 2VC2H 1OAYH 4AENB 2VLRB 2C4FT 5AW6B 2F18A 1KIUA 2AJVH 5KS9A 4B60A 1M05A 2O5YL 1SEQL 3QXDB 1HINH 1RURH 3ELAT 2OL3L 2XPZA 4LOUC 3G6DH 4MASA 3ESOA 5EOCH 1FNGA 1C5CH 2WK2A 4L4VB 2MQCA 2WXJA 5IROD 3QIUA 3CDCA 4WWNA 2GJJA 2OXHA 1KMGA 1PYWA 5TFSL 3MA9H 3V52L 3FT4A 4R7NA 3BE1L 3UG5A 2XZQL 2ITEA 1Y7VA 1LYQA 3F6LA 5D72L 1EGJA 5T5FH 2BVPB 3K2MC 2JQZA 3B3IA 5E23A 4NZUH 1IL1A 4AV4A 5IHBA 3T1FA 3WEMA 3P9MA 4OJCA 2VDRL 3FQNB 2H3XC 5IFHH 2OP4H 4D0BB 5EG6C 3N85H 1SN0A 1XF4B 5F93C 3OKEB 3DX9A 1VFMA 5D70H 3DWTA 1FLRH 1BAFL 2DW5A 2NOYA 2MCMA 5DEGB 1IEAA 1BOGB 1YN7B 3T8VA 3L8QA 4I7ZC 3PDOB 5IVOA 3VI3B 4BYHA 3SD2A 1A1OB 3FHAA 4CSPA 1JF6A 3D30A 4YHPA 2NXYB 4G7VL 1LHZA 1VEMA 4YEFA 5JHDD 5DVLA 1BZ9A 4FNRA 5FFLA 2Y7NA 2BSSA 4OKDA 5EF3A 2Q7YB 1UB5B 1UT2A 3D85A 1DJIA 4L3FA 4PBWD 2XJLA 2F8IA 2OSXA 3OG6B 4PS8A 1BD2D 3GKWH 4P9HL 2K1MA 2DLFL 1F2XK 2NY4B 5J5EA 1GCFA 1YCSA 3RHWK 4LCCC 5AVUB 1BM7A 3VXOB 4KV5E 3KLAA 5HDQH 2FE0A 4AK1A 4B53A 1ZDSA 2VN7A 3HFMH 1WBXA 2DRUA 4TQPA 3W38A 3QZWB 5GZND 2MHAA 3GEFA 2ZCLL 4ONFL 1ZLUK 4B95C 1AE6H 3LN4A 2QSCH 2B5IB 4S11A 3E38A 1N5AA 5HGHA 4HH9A 3BZ5A 5DJ2A 4HHWA 4LKXA 4AM0B 2Z31D 3LYRA 2ZWKA 4L8CB 2D9QB 1TVDA 1ZCRA 1D5ZA 1SXNA 3VCLB 3BPLC 1T2QL 2FDBP 5AVXB 5E1AB 5GISL 5HYSB 2VISA 1NGQL 3KPNB 5DGRA 4I18C 2I9LA 2C26A 3QFDB 4JQIA 2CJ3A 2NNCA 1DEEA 5T1LB 3REVB 3WFBL 1MHPH 3B3BA 1XTMA 3EUUA 2WPGA 2Q6WA 4U1KA 2BRRL 5IB5A 2F54D 3UBXI 1KTJA 4JKLA 3KPLB 5JW4Q 2GTWB 5FW6A 5TTRA 2P7TB 4DGYL 2ZUVA 5DJZA 1ZA6A 5ANHA 4ZSOB 3F7VB 3SPVB 2V7NB 1RERA 3HC3H 3KBHE 2YGVA 4QRRD 4FYQA 4JK0D 4ZMWA 4NAMA 5JDJA 3LIUA 1NC2B 2YPKB 4TVPH 5I6XB 3HS8A 5CR1A 4G43B 3P3RA 4QRRB 4OF6A 4X9GA 4YHOL 4P5TD 4L3CB 4NNYA 2XTLA 2B59A 3BO8B 3ARPA 4XCEA 2ALWA 3ZYIA 2JVUA 4XHJD 3UTPE 3US1A 3QUXD 1NAML 5FOBA 3SYAA 5A2AA 4YMPA 1H19A 4UDUB 4Z8FH 4GXUM 3NJKA 2PXYC 1T2QH 4FE9A 3NRFA 4JFQB 5AW1B 5F9DC 5SV4A 3IU3B 4HQQL 5HJDA 3BVXA 2VJ0A 1IBDA 4QXUL 3UG4A 4CN6A 4B7LA 4F7CA 4JFPB 1R3LB 3U1SH 3JV6B 4U1JA 2DLFH 4PBXA 4FADA 4A7QA 2FEDC 4GQZA 1JTOA 1T6WA 3HZVB 3P0YL 5EF1A 1COBA 2B5IC 1S7RB 4PRBB 1F3JB 1MI5E 5GRVK 4JKPL 1WAAA 4N90E 3MRBA 3UADA 2QMKA 4NQCB 1QBLH 1E9QA 3OB0H 4HIHA 4LCWA 4H1LH 3CU1A 1J12A 4OFIA 5CUSL 3HS9A 5DEZA 3X1EA 4F8PA 3DX3A 4XVTH 1FC2D 4XZ4A 4OQ1A 4DQOL 2J56A 2P3YA 1MCBA 4R7VA 4WTXA 4Y9GA 1K2DA 4QXWA 3SDCD 3ZSTA 1UZ6E 1HOEA 3QORB 4TNFA 3BKJH 1XH2A 5T3ZD 1I1FB 4MMXC 4Z23A 1KIPB 4M6AA 3GXNA 3C8KA 3GTVA 3UDWC 4KDVA 4XNMB 2XV0A 2AEWA 4G8IB 1YEEH 5GZOA 4J27A 4IIQA 2LVEA 3NTCH 4I0CC 1V5JA 4CW1B 1QI5A 5EOTA 2YK1H 4LF3A 1QSFA 2R15A 3DARA 5SWZD 1MEXH 3WUWG 1IARB 3R1GL 4J3OG 3HE6C 4PSRA 5E5UB 3S5ZA 1OF2A 3QR0A 1CZ8H 1JBJA 5DRXB 2Y5QA 2BFGA 1NC4B 4XVTL 3PGCA 1PEZA 4MX7B 2F74B 4IRSA 1V05A 4EDXA 4YNYA 2GI0A 4M5SA 1MPAH 2X4QB 4GW4B 2PYEB 3QQ3A 3LRLA 3PWUA 4P3DB 4HIEA 2WY3B 3MNMA 2RA1A 2JB5H 3C9NB 4W9JC 1QSEA 4PRNA 2IVFC 4OGXL 5I1IH 1K8IB 5HYEA 3BP6A 1NGWA 4FQ1L 4ZUSA 5HHMB 3S3CB 4HCRH 5F1NA 1I31A 1JV5B 4WO4D 1KELH 2MWCA 2WWMC 1BOYA 5PAZA 5ABDE 3KR3H 4PJXE 2EDLA 4OKVA 5AW5B 4FLOA 1QACA 3MREA 1UT9A 4HUNB 4ONOA 1CG9A 1QTPA 4H88L 1WAAE 1NKOA 4EUPH 2BC4B 2DM4A 4LGSB 5AVRB 3ESPA 3MUJA 1K3ZA 1MJ7H 5DRWA 4DN4H 4M4RB 5D7IE 3M7FB 2FUTA 1LMIA 2HLAB 1LEIA 1BD2E 1BDYA 3LKPA 2OJZL 1EFXB 4X6DB 4NKDB 2VXUH 4DJMA 4KJPD 1JF1B 4BA0A 1DQDH 4OJFH 3DK0A 2FCBA 1H6TA 2YUZA 3H42L 4L1SA 5E8DL 3SPJA 5F21B 4NC2B 4M93B 1KTBA 1IGTA 2BMKA 3B2VL 3MCG1 3T65A 4AEIH 1T22A 3PLYA 2FR4B 5A2IH 5AKSA 2AJSH 1OCOB 3BAXA 3D3VD 4APXA 3P3TA 1CG9B 3QEQD 4YDMA 5F7DA 4Y16D 5E1QA 1D2OA 4KKCD 2EC9U 3VFGL 4PCTA 3KCPB 4P4KD 4S1SH 1IFHL 5GSVB 3SCMB 4NQXA 2X70A 3L2MA 1TKWB 2EDQA 2YFOA 3B37A 4E36A 5IGXL 4AQOA 4F7PA 1F4HA 1XGTB 1GZQB 5DHVB 5I1HH 2X42A 1G9EA 5I1KL 1S9WA 3GMNB 1F4WL 3PWUB 4JB9L 4MWFB 5HHXH 1FGNL 4HJUA 3E9TA 2DD8H 4XVSH 5C0BE 3FO0L 3N43F 1UVQB 4PY8I 4Z1PA 5E8PA 5KSVA 2ZUSA 1H3PL 3DJSA 4OZ4B 1F02I 2KPNA 1FVDA 2F7PA 3VRIB 2NYYC 3KWWB 5AVVB 5FB8B 1B90A 3HC4L 1DVZA 2D7NA 5D2LA 4OVVA 4U6XB 3RWJA 2A77H 4PB0H 5IJKA 5IOPB 4BH7A 2ZOUA 2AJZB 4P4RA 5EIIA 4KVNL 1OP4A 5H37H 1G7PB 2CPCA 1A4KA 5FO8B 3DETC 5IWLA 3LCYA 1KTKE 3LKRB 4FHJA 3MLTB 1BEYH 4IS6B 3JZYA 4LBAA 3SB3A 3FTZA 4JFEA 4ODWA 5CJXA 1HDMB 5HVHC 1T89C 2APWA 5HI3D 4JR9H 2DEYX 1L4IA 4WW2A 4ZSOE 5I75C 1QSVA 2X4UB 1AGEB 1P6FA 1BYOA 2YAHA 2Y4SA 3REWB 3CTTA 2F53A 2OL3B 2EXSA 5EEXA 5IW1A 2Y1YA 3AROA 2G5BB 1V7NL 4GRLA 3DSFL 2CKBL 2X0UA 3IM1A 1QR4A 5GGVY 2A6JB 3UC2A 4OJDH 4JX0A 4PB0L 3OMIB 4ES8A 3MRBB 2A4ZA 1M6OA 2YD8A 4NAJA 3KH3A 2JLLA 3VXRA 1CD9B 2L7UA 3VGBA 5GHWH 4GAJH 4EI5D 5I8EB 2VUYA 5E2VH 3N44F 5C92A 4XPTH 3HZVA 4Z7WF 5JR1H 4MXQD 1PGRB 1QABA 2EH8L 4ZO9A 1L9OA 3DVNA 1MRCH 3DVIA 3V55A 4AG4L 4TQEL 2DL9A 2CO6A 2NLJB 5IZ7A 4QHLA 1QEXA 2ZXWB 1XGTA 1CICD 4K5MA 2WUBL 2WKLA 2X6VA 1ADQA 4RAUA 4O58H 3DIFA 4XNXL 3HHSB 1CWVA 2P5EB 4X6EA 5FDWB 2BP0A 4R96B 1PEWA 1WGVA 2APXA 3MCLL 4RWYH 4FZ8H 4I0PD 2JNZA 4TUKH 3DX2A 3ULUC 2WUCL 3FBKA 3S9DB 4RQQB 4DVBA 5KYYA 2EDMA 4OLWL 5A6IA 1A9EB 1A9VA 1ZLUH 2JB6A 4WWOA 3CSTA 1U3HB 4AZ8A 4PIRF 4KK8C 3G5WA 5TH2A 2B9BA 4F33A 1R3KA 3UPRA 1QZ1A 4PJDA 4B0MM 1CL7I 2Q6WB 1WZKA 3VFSA 2CRIA 4R7LA 2WO4A 3VWJD 4BHUA 3QAZB 3Q5YA 3US9A 3ARFB 1OTTC 1HL9A 3QZPA 4HAKA 1EFXA 3PPSA 3TTSA 4GG6F 2LV4A 3TA4D 5J1SC 4K9JA 4M7LH 2I5YH 4TVPD 5B3JF 2FO4B 1F3DJ 4QYOB 4TMPA 3WHXB 5T3XH 2EIZA 4KKLC 4L8CA 1NMCC 2XPGB 5EU4A 5JDSB 3NCFB 4H1LA 2O6FA 3OB0K 3ZBMA 4EUPG 3ZZQA 4CSTA 1T1XB 4N8UA 1KOAA 1BVKA 1U42A 5I2IB 2VL5A 4OM1L 5FYLH 5FDYA 3WFHA 3OLGA 43CAB 2WXRA 4PUBH 4G9DA 4NWUL 4YE4H 3OAZH 3G5ZB 4DPAX 2NYKA 1AR1B 1FZKA 5KBPA 5HDRA 3BPOC 4L2YA 4HIJB 3Q6FB 4A55A 2D03H 4XOCA 4EUPA 2R2BB 4YDJA 4HIEB 1ZHLB 5HVGB 1AC0A 4K8RH 4RAVA 4UBDD 2BCMA 2UYLB 3AWGA 1PZUB 5KBNC 2G3XA 3GDCA 1HSBB 1XGPA 3TA3C 1BZ8A 4ENEC 4H4NA 4MMXB 3T3MB 1LE9B 4XHJC 5D1QD 5C0AB 1YG9A 2R69A 4ZS6D 4HK3J 4YQXH 3KGRA 3UXFA 1MDTA 3CSYB 3QULA 1GZHC 2Q3AA 5KJRH 4WUUD 1A25A 1IEAB 5TD4A 4L8DB 4C83B 3MLZL 4MA7H 1IBGH 3WE1A 4Y2OB 2JKJA 2R0WH 4TNGA 1PNCA 2W07A 5C9KA 3D4ZA 5JQ6H 1WZ1L 4N0UE 2CLZA 2WQRA 1YNLL 3CFKA 1OCZB 3BGAA 3LH2H 1Q72L 5GQBA 4N68A 2NW3B 3BLPX 1YY8A 4JPVH 4ODHL 4F8OA 1VB9A 1S7XA 1C08B 5KSUB 4QGTA 3V4PA 3CQQA 3ZDXF 4I87A 1DQVA 3KVDD 5B8CC 5G55A 1Y18A 1KB9J 3VFWB 3CX5J 1N67A 1K2DB 1HAWA 4FXLA 3I02B 2BWQA 1BG1A 1NIDA 4UM8A 2P45B 4NXSA 3QBTB 1QATA 4G8EA 5TE7L 3S37X 5CEZL 1G7MA 5E24E 3H7LA 4OUUB 3OX8B 4NYLB 3D52A 5KS9B 1RUPH 2FNBA 2EE6A 2A73A 2UYLA 3EBGA 4JG0H 1WBZB 1A1NB 1OP3K 5I8OH 4K4KA 3CN2A 3KWUA 4AYSA 4YHML 4P2QD 2PKDA 2MSPA 3BH8B 3DRTB 4XP9H 5CGBA 5T1KA 3GXDA 1UD4A 4IBSA 4R97C 2C3VA 5KVMC 4KX8A 2ESVD 4J3OF 1AH1A 1XL6A 3FFCB 1F13A 5ADOL 4FULA 2B1HL 3RWEA 3BAEL 1T4WA 4XNZC 1CFQA 1WIUA 1EH9A 1ZT1A 5DD0H 1KACB 3EGXA 4JREC 3ASOB 3SGJC 1DE4B 3TA3A 4U1SA 3ZL1A 3PYCA 1E9OB 3VM5A 4HK0B 4QYOA 4PWHA 2ZTBA 2CJUH 1L0PA 4L05A 2WLZA 2CXKA 1GTNA 3BO8A 5F97E 3OM3B 3WY2A 2Q8AH 2WLKA 4TVSa 1PCXA 2K45A 4RFOL 4AT6B 1QPKA 2GT9A 1N26A 4DP9X 3EOBB 4XMVA 5B8CB 1B0RA 3SQOL 5C0RL 1E6JL 5FO7A 5F6HI 4FEMA 2A6KB 1Z5LB 2RR3A 1YO4A 2AJXL 2EEFA 2ZP0T 1A4JB 3DGDA 4LCWE 2GQHA 4YHNA 3NFSH 1SJMA 1FYTE 4RQQA 4P2CG 4P9HH 3NCEB 3JWNH 3QIUD 4M1DH 3RX5A 3IXAB 4D3CL 3S48A 4H25A 3TIEB 4NZRL 1S9VA 1GH7A 1LTXA 5E94B 2P80A 3ECBB 3HAEA 3S36X 3VFRA 4F8QA 4JQXC 5FHBH 3HHSA 1ZV5A 3RX8A 5K9KB 1D5IH 2Y7QA 2WM0A 4W9ZA 1EIBA 5FHAH 1FVEB 1ZTXH 1OB0A 4IBWA 4LLUA 5CP7A 2PP9A 4F58H 2L04A 1OLZA 5CF3A 4ALAL 1BQHG 1Z3GH 2G75B 2KS0A 3VQLA 3W81A 4IK7A 4LDEB 5DLMH 4YH6A 2KUTA 1QSFE 1ZVHA 2CHNA 4XX1G 4D7PA 3IKKA 1BMGA 3ULUD 4BK4A 2JF1A 3H9SA 1TZAA 2VO5A 3N04A 4B9ZA 5BO1L 1JPSH 3CUPB 5EZOH 1BVNT 4YHKH 2FB4H 4R3SB 3HJ0A 2ZUXA 4EIGB 3FTWA 2PLTA 12E8L 1JNLH 2IFFH 5E94A 2NQ3A 5CWSA 3Q7JA 1Z9NA 4KDTA 4KZEH 5BJTB 1U21A 2CLZB 5HHOD 3IDGB 3QJQB 1WPCA 5JHLL 1MCWM 4JPIA 4XC1H 1AJ7L 5GRJL 3ZUNC 1A4JA 3EYFB 3SCMD 1K9TA 2MOQA 3FMGL 2HFTA 3ULVE 1PS3A 4OV5A 3AITA 5D2NC 3BPNB 5AWNL 3PFQA 3T0EA 5DEFA 3O9WD 2LGNA 2JSFA 4HJGA 4ZMAT 2P42B 3WE6B 1A7NH 1QFPA 5DK3A 3IGAB 4QTIH 2BNRD 4NAQA 2ZZUT 4BZ1H 4JDVA 2R0LH 2AABL 4LL1A 4KXZH 5FS5A 4J7RA 5HDBB 2DQEH 1JG9A 8FABB 3DO7B 1QLEH 3SBRA 5I15L 5DURD 3S36H 1R3IH 2O5XH 3ARDB 3JT0A 3UX9B 3MA9L 5CLZA 3V52H 4Z7UB 3APFA 3TX4A 3IMWA 1AFVL 4HHAA 3C2SA 3QJZA 5JIMA 5FHAL 4X7EC 1W2KT 2PTUA 3VRIA 5LBSL 4MJJA 1I4FB 4FJYA 4JHAL 1MFCH 5DJYB 3BRGC 3FQYA 1WWCA 3CMOL 3QEHB 1H5BC 2HP4A 4JY5L 4M1CC 3MV11 4LP4A 1Z9OA 1KV7A 2UWEF 3H53A 4N0CD 3RNKB 3BPCB 4M3KB 2B4CL 2YD6A 5IHUH 4XCNB 4PY7B 2XBDA 3FNKA 1Y1UA 4XCCL 5F7EL 1G7MB 2QHRL 1IBYA 1ASPA 4IU3B 5I71B 4Z7VF 3DURA 3U6RA 5IQ7H 2HRPL 5D1XB 2OYKA 5E5LA 4WJ5B 4NI3A 2Y06H 3FU5A 3HR5A 1ILUA 1E9PA 4I4WB 2XX0A 3C08L 4OLEA 1PDKA 3MUHL 4CGUB 1M7IB 4PV1C 2Z8SA 1ZE3H 2CQVA 2FT6A 4LZKA 5DYFA 1XF5A 3D2TA 1FFNA 2Q8BL 3DGCR 4JVWA 1O6SB 4PYGA 3B9KD 1GZPA 2YEVB 4AEFA 4JFDD 2Q87A 5MEPA 5A2BA 1SYSA 3KEDA 1A5FL 4MAYA 5EFIA 1ESOA 1CO1A 2AXGA 3JBG7 4HCFA 2VQ1A 3EFDL 3S35H 4X5PA 3SKNB 5LNEA 2EVGA 3HBGA 3FT1A 1CE6B 1UWYA 1M4KA 1S7UA 3MPCA 3OLIA 4NNPL 5FYKH 1NC4D 3SPHA 3GZPA 3QXUA 3GBDA 4H13C 4MJIB 2I60L 4AKPA 4WV1B 4QT5A 2VL4A 2BNRE 2BNQB 3I50L 5J6SA 5C7XL 3ERXA 3AG2B 3RDJA 2V9QA 1NGZB 3PDGA 3KVPA 4JPWL 3U48A 4XX1E 1R3JA 5GIRB 1DFBL 1YY9C 2BFVH 2F1AA 3MROB 4U3XA 1H3VA 4N2MA 4L1TA 3WELA 1WS8A 3IAQA 3ARFC 2YRLA 2QZ5A 2WXFA 3B2VH 4HUVA 1FFRA 4XN4A 3EYOA 3FUDA 3D2UB 3FK3A 4N28A 3I3EA 5K1NA 1FZKB 2V8MA 1N5YL 4ZOEA 3HHRB 4P05A 4QXTA 1HT6A 5CLWA 3N9GH 3ZGIA 3QIBD 4NM8H 1HHGA 3IDMB 5FKPA 5I1GL 3T2OA 4ZYKA 3QH3A 3QW9A 4WFGE 3ZDXB 3CN4A 5JDSA 4QT5B 3E6FA 4H8HA 2Z7ZA 3WD5L 2PNDA 1U8IB 5G4MA 2VTFA 1YRKA 1VZHA 4I3SH 2FO4A 1KJVA 3WS3B 1SNRA 4GW1B 5EC1B 3OAUL 1FO0H 3TOPA 1FZOB 4N1EA 1BVLA 1ZIAA 1LXMA 2XY1A 3LRGA 2MOGA 4IOSA 4XPHL 4C56B 3BYTA 5J11C 3SKMB 4C4KO 4UQ3A 1RPUA 3ML9A 2PR4H 1A6ZB 3WIFB 4KTEH 3HBPA 5EOTB 2WSDA 1CDUA 4OBRA 5IEHB 4JJOA 4DP2X 2FATH 1C12B 2B4CC 4K5PA 3BGMA 4LSSH 4Y4KD 5ISZE 4NJAL 4AIZB 2ZD0A 4ZPTB 1F4XH 5KTEL 2Z0BA 5T3ZH 1KYDA 2EIDA 2W0PA 3KWXA 4HXAH 3V8CA 4A68A 3P0VL 2ZYHA 5KBMA 4NWTL 4V2BA 5D93B 3C09B 5IB4A 1XF1A 2NY0C 1BREA 2BSCA 3VQ2C 2DWDA 3ZQXA 4PS4L 4RESB 1Q94A 2C3XA 3B9EA 3T5WA 5IKCA 3MFGB 1ACYL 2X7LA 2AV7B 3MUZ1 2X09A 2R1XB 5D6DA 5BVPL 4M6NL 5BRZB 4LARL 1NC2D 1TQUA 3BPCA 4W4OC 3VG9C 4AJ0A 3DJZA 4UQ2A 3OQRA 2NY6D 4QDGA 1YAIA 4M02A 4WSJA 3F7QA 3ARGC 4TPRL 1UQSB 1J11A 3PWLA 1A6TA 2ZWLT 5DK2A 5E51A 4YHZL 1R5WB 1A66A 4LK4A 1H0DA 4Y4HD 2B0SH 2HFGH 4JQIL 5K9QI 3QUXC 3MNZA 1MJUL 4AMWA 4Z7VA 5T5NG 1UD6A 4PJIE 3NP3A 1VFOA 2IMMA 4Z3GA 1WEJL 3L4YA 3LZPA 3ZX1A 4NZTH 3I84A 3AUVA 3WGUB 1RMFL 3VXMD 5H4YA 1CBVL 2XQ0A 4RA3A 1M3IA 2I85A 2M2DA 2ZX6A 2KT6A 4UDUA 2EKSA 4XMWA 2MJWA 3FRPB 2X1QA 4OFYD 1MJJA 5E6ZA 1SBBA 1A8ZA 4DN4L 5M94B 3WN5B 2L0DA 3HZMA 3I2CL 1CC3A 5ERWB 2DQCL 1C5BL 3V6OA 1BVLB 5AW3B 3QIBB 2A4CA 2E27H 3RKPA 2IDSA 2X1WL 3ZU8A 1W72L 3QXTA 1FL3A 2W81C 3N0PB 1T0NA 4IMLA 5IJVA 5KJ7E 1QFUL 1HOCB 1O9ZA 1MLBB 2CPUA 3FQXA 5LKNA 4UQAA 1HDMA 2DI9A 2G4GA 2WGXA 3BWZA 2EUZA 2XFXA 4POZC 3FUFA 1KB3A 1HHGB 3IDMA 3KXFD 6FABH 1J9QA 4J3XA 2O5NA 4K23L 1A6ZA 1TJGH 3WIFA 5CJXC 3T0WA 3WKMH 4QXTB 2FX9H 2CKNA 1BIIB 1QO3B 4CKVX 1N64H 4QTHA 1FN4A 3ZDZE 2XN9D 5KUKA 1CGUA 4AEHH 3G6JE 2KH2B 4QI3A 4TUOA 4AYDC 4I89A 3U0PA 3DXAD 1K5WA 4JFED 2IWKA 4NKOB 1EV2E 3H9SB 1IGJA 3GHEL 4RX4A 4H40A 1E28B 3GJFB 4EQ2A 3C5SA 1IJ9A 1IC0A 1IAIH 2ZAIA 3M17B 3VGEA 1QBML 4WK2B 3NBNA 2HFGL 2HPTA 4LLUB 3FQWB 1J0IA 3P30L 3U1QA 3LEXA 4OUOA 2W92A 2BY3A 1RJZB 2Z31C 5GSVA 3SCMA 4PJHA 2OQJB 3ECBA 3HAEB 5KVGL 2BSED 2EE3A 4YQXL 3F7KA 5EFIB 3EJZC 4A66A 3DROA 5MEND 4ICWA 2WP3T 2W94A 3PNWB 1FV1B 3EFOB 5D1XD 3CK0L 5IBLC 4URKA 2Z1PA 4ZPVB 1PLGH 1G6RL 2I07B 2ARJQ 3MTXA 4MZ2A 3HKFA 2HYMA 3ILDA 1ZWIA 2FJSA 1IILE 4LSPL 5FUCE 1JPFA 1ML0A 1KT2B 4TULL 3PU7A 2YN5A 4G80A 1L9NA 4IHOA 4KK6C 1FYTA 3TV8A 1TYEB 4LSRL 2GAZB 4NCC2 4OI8A 2WBJB 4CMHC 2VDPH 4NERA 1YNTB 2DQJL 4JPKL 1RZ7H 2NW2A 3TCTA 1MFEL 4QOKB 3E3QE 1J8SA 3DYMA 4ALAC 1VADA 3CHXA 1CGSH 1JHTA 2ZCKH 1C8QA 4KI5E 4PGDB 4XXWC 5E5MA 2WP3O 5LAXA 1DE4A 2LTQC 2R2HB 5CSGA 1CDCA 1NTDA 3OKNA 4NZJA 1VESA 3S3PA 2ZKMX 5J1TC 5A40E 2Y5TB 3VI4F 2YIHA 1PG7X 1JV5A 3DURB 2DBJA 1UXMA 2VUOA 1Z0MA 3Q1SH 4IU3A 5BW7A 3U6RB 2EAEA 4FXGB 4K3DH 5E2UL 4XPAH 5SX5K 1UXWB 3RNQA 4GRLC 3A6CL 3CVBA 4DGYH 2EDOA 5FA3B 3WFDL 4BRJA 1BYNA 2AS5M 1QMUA 2XV3A 4HFWA 1MCRA 5EULV 4E42A 1WBZA 3AU1A 4Y19A 4UNVA 3JVFC 4QNPF 5IB4B 1DCEA 4ANXA 4EDXB 4HJEA 2VZ3A 4G6FB 3OZKA 2EINB 4MA3B 4JO3H 3Q2WA 2YRPA 2OULB 3UTZB 2AEQL 2JJTA 5F0LB 2ITFA 2GJ6A 5CFAA