3AV2A

The human nucleosome structure containing the histone variant h3.3
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title Structures of human nucleosomes containing major histone H3 variants
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3av2A00
4WZSB 4JJNA 3REHD 4E45A 1P34D 4KUDC 5B1MD 5B0YB 3LJAD 4NE6A 4KGCD 5GT3D 3AZJA 3AZNC 3WAAD 3MNNC 1M19A 4Z2MG 2HIOA 1U35C 3B6GC 3O62D 3MVDB 5BNVA 1BH9A 3AZJB 5E5AA 5B32A 3AFAA 5FUGB 1M19B 3KSYA 3MGQC 5AY8D 4KUDA 5BNVB 1BH9B 5E5AB 5B32B 3AFAB 1KX5C 2IO5C 4J8UD 1EQZD 2NQBC 3X1SC 4QLCC 2LY8A 3AZNA 5B24B 4KUDB 3REJD 5B0ZD 3VH5A 5CPID 3AZLB 1P3MC 3B6GA 5BT1D 3LELC 4Z5TD 4EO5C 4J8VB 1KX5A 3REHC 1P34C 1HQ3C 2NQBA 1ID3D 4QLCA 4J8WD 2JSSA 5CPJD 2BYMB 4KGCC 5GT3C 3KWQC 1KX5B 3X1VD 1P3MA 3V9RB 3UT9B 2NQBB 3WAAC 4QLCB 4LD9D 5B33D 3X1UD 3B0DC 4H9PA 4XZQD 3O62C 3LELA 1M18D 3UTAD 2F8NH 3W98D 1P3MB 5CPKC 3AZKD 4AWLC 3REHA 1P34A 4YS3D 5AY8C 5B1MA 1S32D 3LJAA 5AVCB 1WWSA 5B0YD 4KGCA 5GT3A 4J8UC 1EQZC 3WTPB 2PYOB 3B0CW 5B1MB 3REJC 5B0ZC 3WAAA 5AV5B 3LJAB 3NQJB 3KXBC 4KGCB 3O62A 5GT3B 3WA9C 3MVDD 4H9RB 3WAAB 5BT1C 4Z5TC 5AY8A 3O62B 4J8UA 1TZYD 3AZHB 1EQZA 1ID3C 4J8WC 2RVQD 5AY8B 3REJA 5B0ZA 5CPJC 5B24D 4XUJA 4YM6D 5CPIA 3X1VC 1P3GB 4J8UB 3AZLD 4LD9C 3REKC 3X1UC 5B33C 4CAYA 3REJB 5B0ZB 3NQUA 1P3AD 2NZDD 1Q9CA 4XZQC 4Z2MH 1M18C 4XUJB 3UTAC 3X1TB 5CPIB 3W98C 4Z5TA 3AV2B 3AZKC 2F8NG 5AV6D 3NQUB 4YS3C 4J8VD 3AZGD 2CWEA 1ID3A 4J8WA 4DRBA 5CPJA 5B0YC 1P3FB 3X1VA 4WNNB 3B0CT 4LD9A 3MGPB 5B33A 1N1JA 5B31G 3X1UA 3UT9D 5DNND 5CPJB 4XZQA 1M18A 3UTAA 3W98A 3X1VB 3MVDC 5B2ID 1P3KB 3AZKA 4LD9B 3X1UB 1N1JB 2YFVB 4YS3A 1S32A 4Z66D 3UTAB 4H9NB 5B0YA 5AVCD 1TZYC 5E5AC 4YS3B 2RVQC 2AROD 3AZEB 5JA4A 1S32B 3WTPD 2PYOD 5B24C 4YM6C 3RELD 2F8ND 3TU4D 5AV5D 3AZLC 4WV4B 3MVDA 5JA4B 1P3AC 2NZDC 5FUGA 4NFTA 3UTBB 5B31D 4G91C 4J8VC 1TZYA 2CV5B 3AZHD 3R45B 3AZID 5B24A 4YM6A 1TZYB 3AZLA 3AYWD 1P3GD 3UT9C 1P3AA 4H9SA 4H9QB 2NZDA 4YM6B 5B2IC 1AOID 4XUJD 3X1TD 3LZ1D 3AV2D 5AV6A 1P3AB 4J8VA 2NZDB 4G92B 3AZGA 5AVCC 1ULYA 5AV6B 1B6WA 2BYMA 4G91B 1P3FD 2AROC 4NE5A 3AZGB 1ZLAD 3WTPC 2PYOC 3V9RA 5B1MC 5DNNA 3UT9A 3TU4C 5AV5C 3LJAC 5B1LD 3MGPD 5B2IA 5DNNB 1P3KD 5GT0D 4Z66A 5BNXA 5B31C 5B2IB 5AVCA 3AZFB 3AN2D 5B40D 5AV9D 2AROA 4Z66B 3AZHC 5BNXB 3WTPA 2PYOA 3AZIC 3RELA 3AZED 2F8NA 3TU4A 5AV5A 3KUYD 3NQJA 3W99D 3LZ0D 1P3GC 2AROB 3RELB 2F8NB 4H9RA 3TU4B 1AOIC 4XUJC 5CPIC 3X1TC 3AV2C 5G49A 5B31A 4J8XD 3UTBD 3REID 3B0BA 1BH8A 1M1AB 3AZHA 4UUZA 3AZIA 2CV5D 5G49B 5GXQB 5B31B 1P3FC 1ZLAC 3AYWA 1P3GA 3AV1D 1BH8B 1P3ID 4UUZB 3MGPC 3AZIB 3VH5W 3MGRD 1AOIA 3X1TA 3LZ1A 3AYWB 3AV2A 1P3KC 1AOIB 1H3OB 3LZ1B 3AN2C 2YFWB 1P3FA 5B40C 1ZLAA 1P3OB 4WNNA 1S32C 3AZEC 5B1LA 1F1EA 3MGPA 3B6FB 3W99C 3LZ0C 1ZLAB 4R8PD 1P3KA 5GT0A 5B1LB 5CHLB 5GSUB 2YFVA 4J8XC 5F99B 3UTBC 5AV8B 1KX3D 3AN2A 4H9NA 4X23D 3REIC 1P3LB 5B40A 5AV9A 5GT0B 3AZFD 5B2JB 2CV5C 3AZEA 1U35D 1WWIA 3MGSD 3KUYA 1TAFA 3W99A 3LZ0A 3AN2B 4H9OA 3AV1C 5B40B 5AV9B 3MGQD 3C1CB 3VH5T 5DNMB 3KUYB 4KHAA 1TAFB 5C3IB 4DRAA 3LZ0B 1P3BB 4H9OB 3W99B 3WKJB 3A6ND 4J8XA 3X1SD 3UTBA 3AFAC 3REIA 5BS7C 4H9SC 2L5AA 4G92C 4KHAB 5KDMB 2CV5A 1M1AD 3R45A 3AZMB 3VH6A 4J8XB 5AV6C 5GXQD 3REIB 3AV1A 3W96B 3AZGC 1P3IA 3C1BD 1KU5A 5BO0A 5CP6B 4H9QA 3MGRA 1F66D 3W97D 3AV1B 4ZBJC 1HQ3D 1P3IB 4R8PC 5BO0B 5DNNC 5BS7A 3MGRB 3KWQD 2F8NK 4JJNB 1KX3C 4WU8D 4X23C 3AZFC 4Z66C 3MGSC 1P3OD 5CPKD 3B6FD 2HIOB 1R4VA 4R8PA 1P3PD 3RELC 3A6NC 5GSUD 1KX3A 4ZBJB 4X23A 4R8PB 5F99D 3AZFA 3MNNA 5AV8D 1P3LD 1M1AC 1U35A 3KXBD 4WU9D 3MGSA 1KX4D 5B2JD 1KX3B 3WA9D 5GXQC 4X23B 3AZNB 2FJ7D 3MNNB 3C1BC 3MGQA 4M6BA 1U35B 3MGSB 3B6GB 3C1CD 1B67A 1F66C 5DNMD 3W97C 3A6NA 1P3BD 5JRGD 3AYWC 3MGQB 3X1SA 3WKJD 3WTPE 3VH6W 4ZUXD 1M1AA 4WU8C 2IO5B 3A6NB 3LZ1C 5AVBD 3X1SB 3REKD 5GXQA 3AZMD 3C1BA 5B32G 1P3OC 3W96D 3B6FC 5CP6D 1F66A 3W97A 1HQ3A 3C1BB 4H9PB 3LELB 1P3PC 4NE3A 5B1LC 4EO5B 5GSUC 3KWQA 1F66B 3W97B 3REHB 4WU8A 1HQ3B 1P34B 5F99C 1H3OA 4JJND 5AV8C 2YFWA 1P3LC 1JFIA 5GT0C 4WU9C 1KX4C 3KWQB 5B2JC 1P3OA 4WU8B 4HGAC 5CPKA 2FJ7C 3B6FA 3AZJD 1JFIB 4CSRA 5AV9C 3B0DB 1M19D 2HIOD 1P3PA 3C1CC 5DNMC 3KUYC 5CPKB 5C3IC 1P3BC 5GSUA 5JRGC 5E5AD 5B32D 3AFAD 4AWLB 4CSRB 3WKJC 5F99A 4E44A 1BFMA 1P3PB 5AV8A 1P3LA 4ZUXC 4KUDD 3VH6T 3KXBA 4WU9A 1KX4A 2HUEC 5B2JA 1EQZB 5AVBC 3WA9A 3AZMC 2FJ7A 3AZND 3W96C 3MNND 3KXBB 4WU9B 1KX4B 3C1CA 5CP6C 3WA9B 5DNMA 3B6GD 4CAYB 4HGAB 2FJ7B 1P3BA 5JRGA 3WKJA 1P3IC 1HTAA 4Z5TB 2BYKA 4ZUXA 3MGRC 5KDMA 5JRGB 4JJNC 5AVBA 1KX5D 1ID3B 4J8WB 3REKA 3AZMA 2NQBD 4QLCD 2BYKB 4ZUXB 3W96A 2HUEB 5AVBB 5CP6A 3REKB 5B33B 3AZJC 1P3MD 1M19C 4XZQB 2HIOC 1M18B 3W98B 3LELD 3AZKB 1A7WA 5B32C
chains in the Genus database with same CATH superfamily
4WZSB 4JJNA 3REHD 4E45A 1P34D 4KUDC 5B1MD 5B0YB 3LJAD 4NE6A 4KGCD 5GT3D 3AZJA 3AZNC 3WAAD 3MNNC 1M19A 4Z2MG 2HIOA 1U35C 3B6GC 3O62D 3MVDB 5BNVA 1BH9A 3AZJB 5E5AA 5B32A 3AFAA 5FUGB 1M19B 3KSYA 3MGQC 5AY8D 4KUDA 2ZY4A 5BNVB 1BH9B 5E5AB 5B32B 3AFAB 1KX5C 2IO5C 4J8UD 1EQZD 2NQBC 3X1SC 4QLCC 2LY8A 3H0MC 2Y2JA 3AZNA 5B24B 4KUDB 3REJD 5B0ZD 2W8SA 3VH5A 5CPID 3AZLB 1P3MC 3B6GA 2XD5A 5BT1D 3LELC 4Z5TD 4EO5C 4J8VB 2VQRA 1KX5A 3REHC 1P34C 1HQ3C 2NQBA 1ID3D 4QLCA 4J8WD 2JSSA 3A1IA 5CPJD 2BYMB 2Y2GA 4KGCC 5GT3C 3KWQC 1KX5B 3X1VD 1P3MA 3V9RB 3UT9B 2NQBB 3WAAC 4QLCB 1W2EA 4LD9D 5B33D 3X1UD 3B0DC 4H9PA 4XZQD 3O62C 3LELA 1M18D 3UTAD 2F8NH 3W98D 1P3MB 5CPKC 3H0RC 3AZKD 2Y2HA 4AWLC 3REHA 1P34A 4YS3D 5AY8C 5B1MA 1S32D 3LJAA 5AVCB 1WWSA 2FFFB 5B0YD 4KGCA 5GT3A 4J8UC 1EQZC 3WTPB 2PYOB 3B0CW 5B1MB 3REJC 5B0ZC 3WAAA 5AV5B 3LJAB 3NQJB 3KXBC 4KGCB 3O62A 5GT3B 2Y2KA 3WA9C 3MVDD 4H9RB 3WAAB 5BT1C 4Z5TC 5AY8A 3O62B 4J8UA 1TZYD 3AZHB 1EQZA 1ID3C 4J8WC 2RVQD 5AY8B 3REJA 5B0ZA 2JE5A 5CPJC 1T3UA 5B24D 4XUJA 4YM6D 5CPIA 3X1VC 1P3GB 2J8PA 4J8UB 3AZLD 4LD9C 3REKC 3X1UC 5B33C 4CAYA 3REJB 5B0ZB 3NQUA 1P3AD 2NZDD 1Q9CA 4XZQC 4Z2MH 1M18C 4XUJB 3UTAC 3X1TB 5CPIB 3W98C 4Z5TA 3AV2B 3AZKC 2F8NG 3H0LC 5AV6D 3NQUB 4YS3C 4J8VD 2JCHA 3AZGD 2CWEA 1ID3A 4J8WA 4DRBA 5CPJA 5B0YC 1P3FB 3X1VA 4WNNB 3B0CT 4LD9A 3MGPB 5B33A 1N1JA 5B31G 3X1UA 3EPHA 3UT9D 5DNND 5CPJB 4XZQA 1M18A 2DF4C 3UTAA 3W98A 3X1VB 3MVDC 5B2ID 1P3KB 3AZKA 4LD9B 3X1UB 1N1JB 2YFVB 4YS3A 1S32A 4Z66D 3UTAB 2Y2LA 4H9NB 5B0YA 5AVCD 1TZYC 5E5AC 4YS3B 2RVQC 2AROD 3AZEB 5JA4A 1S32B 3WTPD 2PYOD 5B24C 4YM6C 3RELD 2F8ND 3TU4D 5AV5D 3AZLC 3EPKA 4WV4B 2UWXA 5JA4B 3MVDA 1P3AC 2NZDC 5FUGA 2Y2NA 4NFTA 3UTBB 5B31D 4G91C 4J8VC 1TZYA 2CV5B 3AZHD 3R45B 3AZID 5B24A 4YM6A 1TZYB 3AZLA 3AYWD 1P3GD 3UT9C 1P3AA 4H9SA 4H9QB 2NZDA 4YM6B 5B2IC 1AOID 4XUJD 3X1TD 3LZ1D 3AV2D 5AV6A 1P3AB 4J8VA 2NZDB 4G92B 3AZGA 2Y2PA 5AVCC 1ULYA 5AV6B 1B6WA 2BYMA 4G91B 3F6TA 1P3FD 2AROC 4NE5A 3AZGB 1ZLAD 3WTPC 2PYOC 3V9RA 5B1MC 5DNNA 3UT9A 3TU4C 2Y2IA 5AV5C 5B1LD 3LJAC 3MGPD 5B2IA 5DNNB 1P3KD 5GT0D 4Z66A 5BNXA 1PZRA 5B31C 5B2IB 5AVCA 3AZFB 3AN2D 5B40D 5AV9D 2AROA 4Z66B 3AZHC 5BNXB 3WTPA 2PYOA 3AZIC 3RELA 3AZED 2F8NA 3TU4A 5AV5A 3KUYD 3NQJA 3W99D 3LZ0D 1P3GC 2BG1A 2AROB 2Y2MA 3RELB 2F8NB 4H9RA 3TU4B 1AOIC 4XUJC 5CPIC 3X1TC 3AV2C 5G49A 5B31A 4J8XD 3UTBD 3REID 3B0BA 1BH8A 1M1AB 3AZHA 4UUZA 3AZIA 2CV5D 5G49B 5GXQB 5B31B 1P3FC 1ZLAC 3AYWA 1P3GA 3AV1D 1BH8B 1P3ID 1Z2CB 4UUZB 3MGPC 3VH5W 3AZIB 3MGRD 1AOIA 3X1TA 3LZ1A 3AYWB 3AV2A 1P3KC 2ZM5A 1AOIB 1H3OB 3LZ1B 3AN2C 2YFWB 1P3FA 5B40C 1ZLAA 1P3OB 4WNNA 1S32C 3AZEC 3EPJA 5B1LA 1F1EA 3MGPA 3B6FB 3W99C 3LZ0C 2ZY2A 1ZLAB 4R8PD 1P3KA 5GT0A 5B1LB 5CHLB 5GSUB 2YFVA 2G5IC 4J8XC 5F99B 3UTBC 5AV8B 1KX3D 3AN2A 4H9NA 4X23D 3REIC 1P3LB 5B40A 5AV9A 5GT0B 3AZFD 5B2JB 2CV5C 3AZEA 1U35D 1WWIA 3MGSD 3KUYA 1TAFA 3W99A 3LZ0A 3AN2B 4H9OA 3AV1C 5B40B 5AV9B 3MGQD 3C1CB 3VH5T 5DNMB 3KUYB 4KHAA 1TAFB 5C3IB 4DRAA 3LZ0B 1P3BB 4H9OB 3W99B 3WKJB 3A6ND 4J8XA 4UPKA 3X1SD 3UTBA 3AFAC 3REIA 5BS7C 4H9SC 2L5AA 4G92C 4KHAB 5KDMB 4WJ3C 2DQNC 2CV5A 1M1AD 3R45A 3AZMB 3VH6A 4J8XB 5AV6C 5GXQD 3REIB 3AV1A 3W96B 3AZGC 1P3IA 2ZY3A 1KU5A 3C1BD 5BO0A 2Y2QA 3EG5B 5CP6B 4H9QA 3MGRA 1F66D 3W97D 3AV1B 4ZBJC 1HQ3D 1P3IB 4R8PC 5BO0B 3IP4C 5DNNC 5BS7A 3MGRB 3A1KA 3KWQD 2F8NK 4JJNB 1KX3C 4WU8D 4X23C 3AZFC 4Z66C 3MGSC 1P3OD 3FDDA 5CPKD 3B6FD 2HIOB 1R4VA 2XD1A 4R8PA 3KFUG 1P3PD 3RELC 3A6NC 5GSUD 2RIQA 1KX3A 4ZBJB 4X23A 4R8PB 5F99D 3AZFA 2G5HC 3MNNA 5AV8D 1P3LD 1M1AC 1U35A 3KXBD 4WU9D 3MGSA 3EPLA 1KX4D 5B2JD 1KX3B 3WA9D 5GXQC 4X23B 3AZNB 2FJ7D 3MNNB 3C1BC 3MGQA 4M6BA 1U35B 3MGSB 3B6GB 3C1CD 1B67A 1F66C 5DNMD 3W97C 3A6NA 1P3BD 5JRGD 3AYWC 3MGQB 3X1SA 3WKJD 3WTPE 2Y2OA 3VH6W 4ZUXD 2ZY5A 1M1AA 4WU8C 2IO5B 3A6NB 3LZ1C 5AVBD 3X1SB 3REKD 5GXQA 3AZMD 3C1BA 5B32G 1P3OC 3W96D 3P5JB 3B6FC 4DQYB 5CP6D 1F66A 3W97A 1HQ3A 3C1BB 4H9PB 3LELB 1P3PC 4NE3A 5B1LC 4EO5B 5GSUC 3KWQA 1F66B 3W97B 3REHB 4WU8A 1HQ3B 1P34B 5F99C 1H3OA 4JJND 5AV8C 2YFWA 1P3LC 1JFIA 5GT0C 4WU9C 1KX4C 3KWQB 5B2JC 1P3OA 4WU8B 4HGAC 5CPKA 2FJ7C 3B6FA 3AZJD 1JFIB 4CSRA 5AV9C 3B0DB 1M19D 2HIOD 1P3PA 3C1CC 5DNMC 3KUYC 5CPKB 5C3IC 1P3BC 5GSUA 5JRGC 5E5AD 5B32D 3AFAD 4AWLB 4CSRB 3WKJC 5F99A 4E44A 1BFMA 1P3PB 5AV8A 1P3LA 4ZUXC 4KUDD 3VH6T 3KXBA 4WU9A 1KX4A 2HUEC 5B2JA 1EQZB 5AVBC 3AL0C 3WA9A 3AZMC 2FJ7A 3AZND 3W96C 3MNND 3KXBB 4WU9B 1KX4B 3C1CA 5CP6C 3WA9B 5DNMA 3B6GD 4CAYB 4HGAB 2FJ7B 1P3BA 5JRGA 3WKJA 1P3IC 1HTAA 4Z5TB 2BYKA 4ZUXA 3MGRC 5KDMA 5JRGB 4JJNC 5AVBA 1KX5D 1ID3B 4J8WB 3REKA 3AZMA 2NQBD 4QLCD 2BYKB 4ZUXB 3W96A 2F2AC 2HUEB 5AVBB 5CP6A 3REKB 5B33B 3AZJC 1P3MD 1M19C 4XZQB 2HIOC 1M18B 3W98B 3LELD 3AZKB 1A7WA 5B32C
chains in the Genus database with same CATH topology
4WZSB 4JJNA 3REHD 4E45A 1P34D 4KUDC 5B1MD 5B0YB 3LJAD 4NE6A 4KGCD 5GT3D 3AZJA 3AZNC 3WAAD 3MNNC 1M19A 4Z2MG 2HIOA 1U35C 3B6GC 3O62D 3MVDB 5BNVA 1BH9A 3AZJB 5E5AA 5B32A 3AFAA 5FUGB 1M19B 3KSYA 3MGQC 5AY8D 4KUDA 2ZY4A 5BNVB 1BH9B 5E5AB 5B32B 3AFAB 1KX5C 2IO5C 4J8UD 1EQZD 2NQBC 3X1SC 4QLCC 2LY8A 3H0MC 2Y2JA 3AZNA 5B24B 4KUDB 3REJD 5B0ZD 2W8SA 3VH5A 5CPID 3AZLB 1P3MC 3B6GA 2XD5A 5BT1D 3LELC 4Z5TD 4EO5C 4J8VB 2VQRA 1KX5A 3REHC 1P34C 1HQ3C 2NQBA 1ID3D 4QLCA 4J8WD 2JSSA 3A1IA 5CPJD 2BYMB 2Y2GA 4KGCC 5GT3C 3KWQC 1KX5B 3X1VD 1P3MA 3V9RB 3UT9B 2NQBB 3WAAC 4QLCB 1W2EA 4LD9D 5B33D 3X1UD 3B0DC 4H9PA 4XZQD 3O62C 3LELA 1M18D 3UTAD 2F8NH 3W98D 1P3MB 5CPKC 3H0RC 3AZKD 2Y2HA 4AWLC 3REHA 1P34A 4YS3D 5AY8C 5B1MA 1S32D 3LJAA 5AVCB 1WWSA 2FFFB 5B0YD 4KGCA 5GT3A 4J8UC 1EQZC 3WTPB 2PYOB 3B0CW 5B1MB 3REJC 5B0ZC 3WAAA 5AV5B 3LJAB 3NQJB 3KXBC 4KGCB 3O62A 5GT3B 2Y2KA 3WA9C 3MVDD 4H9RB 3WAAB 5BT1C 4Z5TC 5AY8A 3O62B 4J8UA 1TZYD 3AZHB 1EQZA 1ID3C 4J8WC 2RVQD 5AY8B 3REJA 5B0ZA 2JE5A 5CPJC 1T3UA 5B24D 4XUJA 4YM6D 5CPIA 3X1VC 1P3GB 2J8PA 4J8UB 3AZLD 4LD9C 3REKC 3X1UC 5B33C 4CAYA 3REJB 5B0ZB 3NQUA 1P3AD 2NZDD 1Q9CA 4XZQC 4Z2MH 1M18C 4XUJB 3UTAC 3X1TB 5CPIB 3W98C 4Z5TA 3AV2B 3AZKC 2F8NG 3H0LC 5AV6D 3NQUB 4YS3C 4J8VD 2JCHA 3AZGD 2CWEA 1ID3A 4J8WA 4DRBA 5CPJA 5B0YC 1P3FB 3X1VA 4WNNB 3B0CT 4LD9A 3MGPB 5B33A 1N1JA 5B31G 3X1UA 3EPHA 3UT9D 5DNND 5CPJB 4XZQA 1M18A 2DF4C 3UTAA 3W98A 3X1VB 3MVDC 5B2ID 1P3KB 3AZKA 4LD9B 3X1UB 1N1JB 2YFVB 4YS3A 1S32A 4Z66D 3UTAB 2Y2LA 4H9NB 5B0YA 5AVCD 1TZYC 5E5AC 4YS3B 2RVQC 2AROD 3AZEB 5JA4A 1S32B 3WTPD 2PYOD 5B24C 4YM6C 3RELD 2F8ND 3TU4D 5AV5D 3AZLC 3EPKA 4WV4B 2UWXA 5JA4B 3MVDA 1P3AC 2NZDC 5FUGA 2Y2NA 4NFTA 3UTBB 5B31D 4G91C 4J8VC 1TZYA 2CV5B 3AZHD 3R45B 3AZID 5B24A 4YM6A 1TZYB 3AZLA 3AYWD 1P3GD 3UT9C 1P3AA 4H9SA 4H9QB 2NZDA 4YM6B 5B2IC 1AOID 4XUJD 3X1TD 3LZ1D 3AV2D 5AV6A 1P3AB 4J8VA 2NZDB 4G92B 3AZGA 2Y2PA 5AVCC 1ULYA 5AV6B 1B6WA 2BYMA 4G91B 3F6TA 1P3FD 2AROC 4NE5A 3AZGB 1ZLAD 3WTPC 2PYOC 3V9RA 5B1MC 5DNNA 3UT9A 3TU4C 2Y2IA 5AV5C 5B1LD 3LJAC 3MGPD 5B2IA 5DNNB 1P3KD 5GT0D 4Z66A 5BNXA 1PZRA 5B31C 5B2IB 5AVCA 3AZFB 3AN2D 5B40D 5AV9D 2AROA 4Z66B 3AZHC 5BNXB 3WTPA 2PYOA 3AZIC 3RELA 3AZED 2F8NA 3TU4A 5AV5A 3KUYD 3NQJA 3W99D 3LZ0D 1P3GC 2BG1A 2AROB 2Y2MA 3RELB 2F8NB 4H9RA 3TU4B 1AOIC 4XUJC 5CPIC 3X1TC 3AV2C 5G49A 5B31A 4J8XD 3UTBD 3REID 3B0BA 1BH8A 1M1AB 3AZHA 4UUZA 3AZIA 2CV5D 5G49B 5GXQB 5B31B 1P3FC 1ZLAC 3AYWA 1P3GA 3AV1D 1BH8B 1P3ID 1Z2CB 4UUZB 3MGPC 3VH5W 3AZIB 3MGRD 1AOIA 3X1TA 3LZ1A 3AYWB 3AV2A 1P3KC 2ZM5A 1AOIB 1H3OB 3LZ1B 3AN2C 2YFWB 1P3FA 5B40C 1ZLAA 1P3OB 4WNNA 1S32C 3AZEC 3EPJA 5B1LA 1F1EA 3MGPA 3B6FB 3W99C 3LZ0C 2ZY2A 1ZLAB 4R8PD 1P3KA 5GT0A 5B1LB 5CHLB 5GSUB 2YFVA 2G5IC 4J8XC 5F99B 3UTBC 5AV8B 1KX3D 3AN2A 4H9NA 4X23D 3REIC 1P3LB 5B40A 5AV9A 5GT0B 3AZFD 5B2JB 2CV5C 3AZEA 1U35D 1WWIA 3MGSD 3KUYA 1TAFA 3W99A 3LZ0A 3AN2B 4H9OA 3AV1C 5B40B 5AV9B 3MGQD 3C1CB 3VH5T 5DNMB 3KUYB 4KHAA 1TAFB 5C3IB 4DRAA 3LZ0B 1P3BB 4H9OB 3W99B 3WKJB 3A6ND 4J8XA 4UPKA 3X1SD 3UTBA 3AFAC 3REIA 5BS7C 4H9SC 2L5AA 4G92C 4KHAB 5KDMB 4WJ3C 2DQNC 2CV5A 1M1AD 3R45A 3AZMB 3VH6A 4J8XB 5AV6C 5GXQD 3REIB 3AV1A 3W96B 3AZGC 1P3IA 2ZY3A 1KU5A 3C1BD 5BO0A 2Y2QA 3EG5B 5CP6B 4H9QA 3MGRA 1F66D 3W97D 3AV1B 4ZBJC 1HQ3D 1P3IB 4R8PC 5BO0B 3IP4C 5DNNC 5BS7A 3MGRB 3A1KA 3KWQD 2F8NK 4JJNB 1KX3C 4WU8D 4X23C 3AZFC 4Z66C 3MGSC 1P3OD 3FDDA 5CPKD 3B6FD 2HIOB 1R4VA 2XD1A 4R8PA 3KFUG 1P3PD 3RELC 3A6NC 5GSUD 2RIQA 1KX3A 4ZBJB 4X23A 4R8PB 5F99D 3AZFA 2G5HC 3MNNA 5AV8D 1P3LD 1M1AC 1U35A 3KXBD 4WU9D 3MGSA 3EPLA 1KX4D 5B2JD 1KX3B 3WA9D 5GXQC 4X23B 3AZNB 2FJ7D 3MNNB 3C1BC 3MGQA 4M6BA 1U35B 3MGSB 3B6GB 3C1CD 1B67A 1F66C 5DNMD 3W97C 3A6NA 1P3BD 5JRGD 3AYWC 3MGQB 3X1SA 3WKJD 3WTPE 2Y2OA 3VH6W 4ZUXD 2ZY5A 1M1AA 4WU8C 2IO5B 3A6NB 3LZ1C 5AVBD 3X1SB 3REKD 5GXQA 3AZMD 3C1BA 5B32G 1P3OC 3W96D 3P5JB 3B6FC 4DQYB 5CP6D 1F66A 3W97A 1HQ3A 3C1BB 4H9PB 3LELB 1P3PC 4NE3A 5B1LC 4EO5B 5GSUC 3KWQA 1F66B 3W97B 3REHB 4WU8A 1HQ3B 1P34B 5F99C 1H3OA 4JJND 5AV8C 2YFWA 1P3LC 1JFIA 5GT0C 4WU9C 1KX4C 3KWQB 5B2JC 1P3OA 4WU8B 4HGAC 5CPKA 2FJ7C 3B6FA 3AZJD 1JFIB 4CSRA 5AV9C 3B0DB 1M19D 2HIOD 1P3PA 3C1CC 5DNMC 3KUYC 5CPKB 5C3IC 1P3BC 5GSUA 5JRGC 5E5AD 5B32D 3AFAD 4AWLB 4CSRB 3WKJC 5F99A 4E44A 1BFMA 1P3PB 5AV8A 1P3LA 4ZUXC 4KUDD 3VH6T 3KXBA 4WU9A 1KX4A 2HUEC 5B2JA 1EQZB 5AVBC 3AL0C 3WA9A 3AZMC 2FJ7A 3AZND 3W96C 3MNND 3KXBB 4WU9B 1KX4B 3C1CA 5CP6C 3WA9B 5DNMA 3B6GD 4CAYB 4HGAB 2FJ7B 1P3BA 5JRGA 3WKJA 1P3IC 1HTAA 4Z5TB 2BYKA 4ZUXA 3MGRC 5KDMA 5JRGB 4JJNC 5AVBA 1KX5D 1ID3B 4J8WB 3REKA 3AZMA 2NQBD 4QLCD 2BYKB 4ZUXB 3W96A 2F2AC 2HUEB 5AVBB 5CP6A 3REKB 5B33B 3AZJC 1P3MD 1M19C 4XZQB 2HIOC 1M18B 3W98B 3LELD 3AZKB 1A7WA 5B32C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WZS B;  4JJN A;  3REH D;  4E45 A;  1P34 D;  4KUD C;  5B1M D;  5B0Y B;  3LJA D;  4NE6 A;  4KGC D;  5GT3 D;  3AZJ A;  3AZN C;  3WAA D;  3MNN C;  1M19 A;  4Z2M G;  2HIO A;  1U35 C;  3B6G C;  3O62 D;  3MVD B;  5BNV A;  1BH9 A;  3AZJ B;  5E5A A;  5B32 A;  3AFA A;  5FUG B;  1M19 B;  3KSY A;  3MGQ C;  5AY8 D;  4KUD A;  5BNV B;  1BH9 B;  5E5A B;  5B32 B;  3AFA B;  1KX5 C;  2IO5 C;  4J8U D;  1EQZ D;  2NQB C;  3X1S C;  4QLC C;  2LY8 A;  3AZN A;  5B24 B;  4KUD B;  3REJ D;  5B0Z D;  3VH5 A;  5CPI D;  3AZL B;  1P3M C;  3B6G A;  5BT1 D;  3LEL C;  4Z5T D;  4EO5 C;  4J8V B;  1KX5 A;  3REH C;  1P34 C;  1HQ3 C;  2NQB A;  1ID3 D;  4QLC A;  4J8W D;  2JSS A;  5CPJ D;  2BYM B;  4KGC C;  5GT3 C;  3KWQ C;  1KX5 B;  3X1V D;  1P3M A;  3V9R B;  3UT9 B;  2NQB B;  3WAA C;  4QLC B;  4LD9 D;  5B33 D;  3X1U D;  3B0D C;  4H9P A;  4XZQ D;  3O62 C;  3LEL A;  1M18 D;  3UTA D;  2F8N H;  3W98 D;  1P3M B;  5CPK C;  3AZK D;  4AWL C;  3REH A;  1P34 A;  4YS3 D;  5AY8 C;  5B1M A;  1S32 D;  3LJA A;  5AVC B;  1WWS A;  5B0Y D;  4KGC A;  5GT3 A;  4J8U C;  1EQZ C;  3WTP B;  2PYO B;  3B0C W;  5B1M B;  3REJ C;  5B0Z C;  3WAA A;  5AV5 B;  3LJA B;  3NQJ B;  3KXB C;  4KGC B;  3O62 A;  5GT3 B;  3WA9 C;  3MVD D;  4H9R B;  3WAA B;  5BT1 C;  4Z5T C;  5AY8 A;  3O62 B;  4J8U A;  1TZY D;  3AZH B;  1EQZ A;  1ID3 C;  4J8W C;  2RVQ D;  5AY8 B;  3REJ A;  5B0Z A;  5CPJ C;  5B24 D;  4XUJ A;  4YM6 D;  5CPI A;  3X1V C;  1P3G B;  4J8U B;  3AZL D;  4LD9 C;  3REK C;  3X1U C;  5B33 C;  4CAY A;  3REJ B;  5B0Z B;  3NQU A;  1P3A D;  2NZD D;  1Q9C A;  4XZQ C;  4Z2M H;  1M18 C;  4XUJ B;  3UTA C;  3X1T B;  5CPI B;  3W98 C;  4Z5T A;  3AV2 B;  3AZK C;  2F8N G;  5AV6 D;  3NQU B;  4YS3 C;  4J8V D;  3AZG D;  2CWE A;  1ID3 A;  4J8W A;  4DRB A;  5CPJ A;  5B0Y C;  1P3F B;  3X1V A;  4WNN B;  3B0C T;  4LD9 A;  3MGP B;  5B33 A;  1N1J A;  5B31 G;  3X1U A;  3UT9 D;  5DNN D;  5CPJ B;  4XZQ A;  1M18 A;  3UTA A;  3W98 A;  3X1V B;  3MVD C;  5B2I D;  1P3K B;  3AZK A;  4LD9 B;  3X1U B;  1N1J B;  2YFV B;  4YS3 A;  1S32 A;  4Z66 D;  3UTA B;  4H9N B;  5B0Y A;  5AVC D;  1TZY C;  5E5A C;  4YS3 B;  2RVQ C;  2ARO D;  3AZE B;  5JA4 A;  1S32 B;  3WTP D;  2PYO D;  5B24 C;  4YM6 C;  3REL D;  2F8N D;  3TU4 D;  5AV5 D;  3AZL C;  4WV4 B;  3MVD A;  5JA4 B;  1P3A C;  2NZD C;  5FUG A;  4NFT A;  3UTB B;  5B31 D;  4G91 C;  4J8V C;  1TZY A;  2CV5 B;  3AZH D;  3R45 B;  3AZI D;  5B24 A;  4YM6 A;  1TZY B;  3AZL A;  3AYW D;  1P3G D;  3UT9 C;  1P3A A;  4H9S A;  4H9Q B;  2NZD A;  4YM6 B;  5B2I C;  1AOI D;  4XUJ D;  3X1T D;  3LZ1 D;  3AV2 D;  5AV6 A;  1P3A B;  4J8V A;  2NZD B;  4G92 B;  3AZG A;  5AVC C;  1ULY A;  5AV6 B;  1B6W A;  2BYM A;  4G91 B;  1P3F D;  2ARO C;  4NE5 A;  3AZG B;  1ZLA D;  3WTP C;  2PYO C;  3V9R A;  5B1M C;  5DNN A;  3UT9 A;  3TU4 C;  5AV5 C;  3LJA C;  5B1L D;  3MGP D;  5B2I A;  5DNN B;  1P3K D;  5GT0 D;  4Z66 A;  5BNX A;  5B31 C;  5B2I B;  5AVC A;  3AZF B;  3AN2 D;  5B40 D;  5AV9 D;  2ARO A;  4Z66 B;  3AZH C;  5BNX B;  3WTP A;  2PYO A;  3AZI C;  3REL A;  3AZE D;  2F8N A;  3TU4 A;  5AV5 A;  3KUY D;  3NQJ A;  3W99 D;  3LZ0 D;  1P3G C;  2ARO B;  3REL B;  2F8N B;  4H9R A;  3TU4 B;  1AOI C;  4XUJ C;  5CPI C;  3X1T C;  3AV2 C;  5G49 A;  5B31 A;  4J8X D;  3UTB D;  3REI D;  3B0B A;  1BH8 A;  1M1A B;  3AZH A;  4UUZ A;  3AZI A;  2CV5 D;  5G49 B;  5GXQ B;  5B31 B;  1P3F C;  1ZLA C;  3AYW A;  1P3G A;  3AV1 D;  1BH8 B;  1P3I D;  4UUZ B;  3MGP C;  3AZI B;  3VH5 W;  3MGR D;  1AOI A;  3X1T A;  3LZ1 A;  3AYW B;  3AV2 A;  1P3K C;  1AOI B;  1H3O B;  3LZ1 B;  3AN2 C;  2YFW B;  1P3F A;  5B40 C;  1ZLA A;  1P3O B;  4WNN A;  1S32 C;  3AZE C;  5B1L A;  1F1E A;  3MGP A;  3B6F B;  3W99 C;  3LZ0 C;  1ZLA B;  4R8P D;  1P3K A;  5GT0 A;  5B1L B;  5CHL B;  5GSU B;  2YFV A;  4J8X C;  5F99 B;  3UTB C;  5AV8 B;  1KX3 D;  3AN2 A;  4H9N A;  4X23 D;  3REI C;  1P3L B;  5B40 A;  5AV9 A;  5GT0 B;  3AZF D;  5B2J B;  2CV5 C;  3AZE A;  1U35 D;  1WWI A;  3MGS D;  3KUY A;  1TAF A;  3W99 A;  3LZ0 A;  3AN2 B;  4H9O A;  3AV1 C;  5B40 B;  5AV9 B;  3MGQ D;  3C1C B;  3VH5 T;  5DNM B;  3KUY B;  4KHA A;  1TAF B;  5C3I B;  4DRA A;  3LZ0 B;  1P3B B;  4H9O B;  3W99 B;  3WKJ B;  3A6N D;  4J8X A;  3X1S D;  3UTB A;  3AFA C;  3REI A;  5BS7 C;  4H9S C;  2L5A A;  4G92 C;  4KHA B;  5KDM B;  2CV5 A;  1M1A D;  3R45 A;  3AZM B;  3VH6 A;  4J8X B;  5AV6 C;  5GXQ D;  3REI B;  3AV1 A;  3W96 B;  3AZG C;  1P3I A;  3C1B D;  1KU5 A;  5BO0 A;  5CP6 B;  4H9Q A;  3MGR A;  1F66 D;  3W97 D;  3AV1 B;  4ZBJ C;  1HQ3 D;  1P3I B;  4R8P C;  5BO0 B;  5DNN C;  5BS7 A;  3MGR B;  3KWQ D;  2F8N K;  4JJN B;  1KX3 C;  4WU8 D;  4X23 C;  3AZF C;  4Z66 C;  3MGS C;  1P3O D;  5CPK D;  3B6F D;  2HIO B;  1R4V A;  4R8P A;  1P3P D;  3REL C;  3A6N C;  5GSU D;  1KX3 A;  4ZBJ B;  4X23 A;  4R8P B;  5F99 D;  3AZF A;  3MNN A;  5AV8 D;  1P3L D;  1M1A C;  1U35 A;  3KXB D;  4WU9 D;  3MGS A;  1KX4 D;  5B2J D;  1KX3 B;  3WA9 D;  5GXQ C;  4X23 B;  3AZN B;  2FJ7 D;  3MNN B;  3C1B C;  3MGQ A;  4M6B A;  1U35 B;  3MGS B;  3B6G B;  3C1C D;  1B67 A;  1F66 C;  5DNM D;  3W97 C;  3A6N A;  1P3B D;  5JRG D;  3AYW C;  3MGQ B;  3X1S A;  3WKJ D;  3WTP E;  3VH6 W;  4ZUX D;  1M1A A;  4WU8 C;  2IO5 B;  3A6N B;  3LZ1 C;  5AVB D;  3X1S B;  3REK D;  5GXQ A;  3AZM D;  3C1B A;  5B32 G;  1P3O C;  3W96 D;  3B6F C;  5CP6 D;  1F66 A;  3W97 A;  1HQ3 A;  3C1B B;  4H9P B;  3LEL B;  1P3P C;  4NE3 A;  5B1L C;  4EO5 B;  5GSU C;  3KWQ A;  1F66 B;  3W97 B;  3REH B;  4WU8 A;  1HQ3 B;  1P34 B;  5F99 C;  1H3O A;  4JJN D;  5AV8 C;  2YFW A;  1P3L C;  1JFI A;  5GT0 C;  4WU9 C;  1KX4 C;  3KWQ B;  5B2J C;  1P3O A;  4WU8 B;  4HGA C;  5CPK A;  2FJ7 C;  3B6F A;  3AZJ D;  1JFI B;  4CSR A;  5AV9 C;  3B0D B;  1M19 D;  2HIO D;  1P3P A;  3C1C C;  5DNM C;  3KUY C;  5CPK B;  5C3I C;  1P3B C;  5GSU A;  5JRG C;  5E5A D;  5B32 D;  3AFA D;  4AWL B;  4CSR B;  3WKJ C;  5F99 A;  4E44 A;  1BFM A;  1P3P B;  5AV8 A;  1P3L A;  4ZUX C;  4KUD D;  3VH6 T;  3KXB A;  4WU9 A;  1KX4 A;  2HUE C;  5B2J A;  1EQZ B;  5AVB C;  3WA9 A;  3AZM C;  2FJ7 A;  3AZN D;  3W96 C;  3MNN D;  3KXB B;  4WU9 B;  1KX4 B;  3C1C A;  5CP6 C;  3WA9 B;  5DNM A;  3B6G D;  4CAY B;  4HGA B;  2FJ7 B;  1P3B A;  5JRG A;  3WKJ A;  1P3I C;  1HTA A;  4Z5T B;  2BYK A;  4ZUX A;  3MGR C;  5KDM A;  5JRG B;  4JJN C;  5AVB A;  1KX5 D;  1ID3 B;  4J8W B;  3REK A;  3AZM A;  2NQB D;  4QLC D;  2BYK B;  4ZUX B;  3W96 A;  2HUE B;  5AVB B;  5CP6 A;  3REK B;  5B33 B;  3AZJ C;  1P3M D;  1M19 C;  4XZQ B;  2HIO C;  1M18 B;  3W98 B;  3LEL D;  3AZK B;  1A7W A;  5B32 C; 
#chains in the Genus database with same CATH topology
 4WZS B;  4JJN A;  3REH D;  4E45 A;  1P34 D;  4KUD C;  5B1M D;  5B0Y B;  3LJA D;  4NE6 A;  4KGC D;  5GT3 D;  3AZJ A;  3AZN C;  3WAA D;  3MNN C;  1M19 A;  4Z2M G;  2HIO A;  1U35 C;  3B6G C;  3O62 D;  3MVD B;  5BNV A;  1BH9 A;  3AZJ B;  5E5A A;  5B32 A;  3AFA A;  5FUG B;  1M19 B;  3KSY A;  3MGQ C;  5AY8 D;  4KUD A;  2ZY4 A;  5BNV B;  1BH9 B;  5E5A B;  5B32 B;  3AFA B;  1KX5 C;  2IO5 C;  4J8U D;  1EQZ D;  2NQB C;  3X1S C;  4QLC C;  2LY8 A;  3H0M C;  2Y2J A;  3AZN A;  5B24 B;  4KUD B;  3REJ D;  5B0Z D;  2W8S A;  3VH5 A;  5CPI D;  3AZL B;  1P3M C;  3B6G A;  2XD5 A;  5BT1 D;  3LEL C;  4Z5T D;  4EO5 C;  4J8V B;  2VQR A;  1KX5 A;  3REH C;  1P34 C;  1HQ3 C;  2NQB A;  1ID3 D;  4QLC A;  4J8W D;  2JSS A;  3A1I A;  5CPJ D;  2BYM B;  2Y2G A;  4KGC C;  5GT3 C;  3KWQ C;  1KX5 B;  3X1V D;  1P3M A;  3V9R B;  3UT9 B;  2NQB B;  3WAA C;  4QLC B;  1W2E A;  4LD9 D;  5B33 D;  3X1U D;  3B0D C;  4H9P A;  4XZQ D;  3O62 C;  3LEL A;  1M18 D;  3UTA D;  2F8N H;  3W98 D;  1P3M B;  5CPK C;  3H0R C;  3AZK D;  2Y2H A;  4AWL C;  3REH A;  1P34 A;  4YS3 D;  5AY8 C;  5B1M A;  1S32 D;  3LJA A;  5AVC B;  1WWS A;  2FFF B;  5B0Y D;  4KGC A;  5GT3 A;  4J8U C;  1EQZ C;  3WTP B;  2PYO B;  3B0C W;  5B1M B;  3REJ C;  5B0Z C;  3WAA A;  5AV5 B;  3LJA B;  3NQJ B;  3KXB C;  4KGC B;  3O62 A;  5GT3 B;  2Y2K A;  3WA9 C;  3MVD D;  4H9R B;  3WAA B;  5BT1 C;  4Z5T C;  5AY8 A;  3O62 B;  4J8U A;  1TZY D;  3AZH B;  1EQZ A;  1ID3 C;  4J8W C;  2RVQ D;  5AY8 B;  3REJ A;  5B0Z A;  2JE5 A;  5CPJ C;  1T3U A;  5B24 D;  4XUJ A;  4YM6 D;  5CPI A;  3X1V C;  1P3G B;  2J8P A;  4J8U B;  3AZL D;  4LD9 C;  3REK C;  3X1U C;  5B33 C;  4CAY A;  3REJ B;  5B0Z B;  3NQU A;  1P3A D;  2NZD D;  1Q9C A;  4XZQ C;  4Z2M H;  1M18 C;  4XUJ B;  3UTA C;  3X1T B;  5CPI B;  3W98 C;  4Z5T A;  3AV2 B;  3AZK C;  2F8N G;  3H0L C;  5AV6 D;  3NQU B;  4YS3 C;  4J8V D;  2JCH A;  3AZG D;  2CWE A;  1ID3 A;  4J8W A;  4DRB A;  5CPJ A;  5B0Y C;  1P3F B;  3X1V A;  4WNN B;  3B0C T;  4LD9 A;  3MGP B;  5B33 A;  1N1J A;  5B31 G;  3X1U A;  3EPH A;  3UT9 D;  5DNN D;  5CPJ B;  4XZQ A;  1M18 A;  2DF4 C;  3UTA A;  3W98 A;  3X1V B;  3MVD C;  5B2I D;  1P3K B;  3AZK A;  4LD9 B;  3X1U B;  1N1J B;  2YFV B;  4YS3 A;  1S32 A;  4Z66 D;  3UTA B;  2Y2L A;  4H9N B;  5B0Y A;  5AVC D;  1TZY C;  5E5A C;  4YS3 B;  2RVQ C;  2ARO D;  3AZE B;  5JA4 A;  1S32 B;  3WTP D;  2PYO D;  5B24 C;  4YM6 C;  3REL D;  2F8N D;  3TU4 D;  5AV5 D;  3AZL C;  3EPK A;  4WV4 B;  2UWX A;  5JA4 B;  3MVD A;  1P3A C;  2NZD C;  5FUG A;  2Y2N A;  4NFT A;  3UTB B;  5B31 D;  4G91 C;  4J8V C;  1TZY A;  2CV5 B;  3AZH D;  3R45 B;  3AZI D;  5B24 A;  4YM6 A;  1TZY B;  3AZL A;  3AYW D;  1P3G D;  3UT9 C;  1P3A A;  4H9S A;  4H9Q B;  2NZD A;  4YM6 B;  5B2I C;  1AOI D;  4XUJ D;  3X1T D;  3LZ1 D;  3AV2 D;  5AV6 A;  1P3A B;  4J8V A;  2NZD B;  4G92 B;  3AZG A;  2Y2P A;  5AVC C;  1ULY A;  5AV6 B;  1B6W A;  2BYM A;  4G91 B;  3F6T A;  1P3F D;  2ARO C;  4NE5 A;  3AZG B;  1ZLA D;  3WTP C;  2PYO C;  3V9R A;  5B1M C;  5DNN A;  3UT9 A;  3TU4 C;  2Y2I A;  5AV5 C;  5B1L D;  3LJA C;  3MGP D;  5B2I A;  5DNN B;  1P3K D;  5GT0 D;  4Z66 A;  5BNX A;  1PZR A;  5B31 C;  5B2I B;  5AVC A;  3AZF B;  3AN2 D;  5B40 D;  5AV9 D;  2ARO A;  4Z66 B;  3AZH C;  5BNX B;  3WTP A;  2PYO A;  3AZI C;  3REL A;  3AZE D;  2F8N A;  3TU4 A;  5AV5 A;  3KUY D;  3NQJ A;  3W99 D;  3LZ0 D;  1P3G C;  2BG1 A;  2ARO B;  2Y2M A;  3REL B;  2F8N B;  4H9R A;  3TU4 B;  1AOI C;  4XUJ C;  5CPI C;  3X1T C;  3AV2 C;  5G49 A;  5B31 A;  4J8X D;  3UTB D;  3REI D;  3B0B A;  1BH8 A;  1M1A B;  3AZH A;  4UUZ A;  3AZI A;  2CV5 D;  5G49 B;  5GXQ B;  5B31 B;  1P3F C;  1ZLA C;  3AYW A;  1P3G A;  3AV1 D;  1BH8 B;  1P3I D;  1Z2C B;  4UUZ B;  3MGP C;  3VH5 W;  3AZI B;  3MGR D;  1AOI A;  3X1T A;  3LZ1 A;  3AYW B;  3AV2 A;  1P3K C;  2ZM5 A;  1AOI B;  1H3O B;  3LZ1 B;  3AN2 C;  2YFW B;  1P3F A;  5B40 C;  1ZLA A;  1P3O B;  4WNN A;  1S32 C;  3AZE C;  3EPJ A;  5B1L A;  1F1E A;  3MGP A;  3B6F B;  3W99 C;  3LZ0 C;  2ZY2 A;  1ZLA B;  4R8P D;  1P3K A;  5GT0 A;  5B1L B;  5CHL B;  5GSU B;  2YFV A;  2G5I C;  4J8X C;  5F99 B;  3UTB C;  5AV8 B;  1KX3 D;  3AN2 A;  4H9N A;  4X23 D;  3REI C;  1P3L B;  5B40 A;  5AV9 A;  5GT0 B;  3AZF D;  5B2J B;  2CV5 C;  3AZE A;  1U35 D;  1WWI A;  3MGS D;  3KUY A;  1TAF A;  3W99 A;  3LZ0 A;  3AN2 B;  4H9O A;  3AV1 C;  5B40 B;  5AV9 B;  3MGQ D;  3C1C B;  3VH5 T;  5DNM B;  3KUY B;  4KHA A;  1TAF B;  5C3I B;  4DRA A;  3LZ0 B;  1P3B B;  4H9O B;  3W99 B;  3WKJ B;  3A6N D;  4J8X A;  4UPK A;  3X1S D;  3UTB A;  3AFA C;  3REI A;  5BS7 C;  4H9S C;  2L5A A;  4G92 C;  4KHA B;  5KDM B;  4WJ3 C;  2DQN C;  2CV5 A;  1M1A D;  3R45 A;  3AZM B;  3VH6 A;  4J8X B;  5AV6 C;  5GXQ D;  3REI B;  3AV1 A;  3W96 B;  3AZG C;  1P3I A;  2ZY3 A;  1KU5 A;  3C1B D;  5BO0 A;  2Y2Q A;  3EG5 B;  5CP6 B;  4H9Q A;  3MGR A;  1F66 D;  3W97 D;  3AV1 B;  4ZBJ C;  1HQ3 D;  1P3I B;  4R8P C;  5BO0 B;  3IP4 C;  5DNN C;  5BS7 A;  3MGR B;  3A1K A;  3KWQ D;  2F8N K;  4JJN B;  1KX3 C;  4WU8 D;  4X23 C;  3AZF C;  4Z66 C;  3MGS C;  1P3O D;  3FDD A;  5CPK D;  3B6F D;  2HIO B;  1R4V A;  2XD1 A;  4R8P A;  3KFU G;  1P3P D;  3REL C;  3A6N C;  5GSU D;  2RIQ A;  1KX3 A;  4ZBJ B;  4X23 A;  4R8P B;  5F99 D;  3AZF A;  2G5H C;  3MNN A;  5AV8 D;  1P3L D;  1M1A C;  1U35 A;  3KXB D;  4WU9 D;  3MGS A;  3EPL A;  1KX4 D;  5B2J D;  1KX3 B;  3WA9 D;  5GXQ C;  4X23 B;  3AZN B;  2FJ7 D;  3MNN B;  3C1B C;  3MGQ A;  4M6B A;  1U35 B;  3MGS B;  3B6G B;  3C1C D;  1B67 A;  1F66 C;  5DNM D;  3W97 C;  3A6N A;  1P3B D;  5JRG D;  3AYW C;  3MGQ B;  3X1S A;  3WKJ D;  3WTP E;  2Y2O A;  3VH6 W;  4ZUX D;  2ZY5 A;  1M1A A;  4WU8 C;  2IO5 B;  3A6N B;  3LZ1 C;  5AVB D;  3X1S B;  3REK D;  5GXQ A;  3AZM D;  3C1B A;  5B32 G;  1P3O C;  3W96 D;  3P5J B;  3B6F C;  4DQY B;  5CP6 D;  1F66 A;  3W97 A;  1HQ3 A;  3C1B B;  4H9P B;  3LEL B;  1P3P C;  4NE3 A;  5B1L C;  4EO5 B;  5GSU C;  3KWQ A;  1F66 B;  3W97 B;  3REH B;  4WU8 A;  1HQ3 B;  1P34 B;  5F99 C;  1H3O A;  4JJN D;  5AV8 C;  2YFW A;  1P3L C;  1JFI A;  5GT0 C;  4WU9 C;  1KX4 C;  3KWQ B;  5B2J C;  1P3O A;  4WU8 B;  4HGA C;  5CPK A;  2FJ7 C;  3B6F A;  3AZJ D;  1JFI B;  4CSR A;  5AV9 C;  3B0D B;  1M19 D;  2HIO D;  1P3P A;  3C1C C;  5DNM C;  3KUY C;  5CPK B;  5C3I C;  1P3B C;  5GSU A;  5JRG C;  5E5A D;  5B32 D;  3AFA D;  4AWL B;  4CSR B;  3WKJ C;  5F99 A;  4E44 A;  1BFM A;  1P3P B;  5AV8 A;  1P3L A;  4ZUX C;  4KUD D;  3VH6 T;  3KXB A;  4WU9 A;  1KX4 A;  2HUE C;  5B2J A;  1EQZ B;  5AVB C;  3AL0 C;  3WA9 A;  3AZM C;  2FJ7 A;  3AZN D;  3W96 C;  3MNN D;  3KXB B;  4WU9 B;  1KX4 B;  3C1C A;  5CP6 C;  3WA9 B;  5DNM A;  3B6G D;  4CAY B;  4HGA B;  2FJ7 B;  1P3B A;  5JRG A;  3WKJ A;  1P3I C;  1HTA A;  4Z5T B;  2BYK A;  4ZUX A;  3MGR C;  5KDM A;  5JRG B;  4JJN C;  5AVB A;  1KX5 D;  1ID3 B;  4J8W B;  3REK A;  3AZM A;  2NQB D;  4QLC D;  2BYK B;  4ZUX B;  3W96 A;  2F2A C;  2HUE B;  5AVB B;  5CP6 A;  3REK B;  5B33 B;  3AZJ C;  1P3M D;  1M19 C;  4XZQ B;  2HIO C;  1M18 B;  3W98 B;  3LEL D;  3AZK B;  1A7W A;  5B32 C; 
#chains in the Genus database with same CATH homology
 4WZS B;  4JJN A;  3REH D;  4E45 A;  1P34 D;  4KUD C;  5B1M D;  5B0Y B;  3LJA D;  4NE6 A;  4KGC D;  5GT3 D;  3AZJ A;  3AZN C;  3WAA D;  3MNN C;  1M19 A;  4Z2M G;  2HIO A;  1U35 C;  3B6G C;  3O62 D;  3MVD B;  5BNV A;  1BH9 A;  3AZJ B;  5E5A A;  5B32 A;  3AFA A;  5FUG B;  1M19 B;  3KSY A;  3MGQ C;  5AY8 D;  4KUD A;  2ZY4 A;  5BNV B;  1BH9 B;  5E5A B;  5B32 B;  3AFA B;  1KX5 C;  2IO5 C;  4J8U D;  1EQZ D;  2NQB C;  3X1S C;  4QLC C;  2LY8 A;  3H0M C;  2Y2J A;  3AZN A;  5B24 B;  4KUD B;  3REJ D;  5B0Z D;  2W8S A;  3VH5 A;  5CPI D;  3AZL B;  1P3M C;  3B6G A;  2XD5 A;  5BT1 D;  3LEL C;  4Z5T D;  4EO5 C;  4J8V B;  2VQR A;  1KX5 A;  3REH C;  1P34 C;  1HQ3 C;  2NQB A;  1ID3 D;  4QLC A;  4J8W D;  2JSS A;  3A1I A;  5CPJ D;  2BYM B;  2Y2G A;  4KGC C;  5GT3 C;  3KWQ C;  1KX5 B;  3X1V D;  1P3M A;  3V9R B;  3UT9 B;  2NQB B;  3WAA C;  4QLC B;  1W2E A;  4LD9 D;  5B33 D;  3X1U D;  3B0D C;  4H9P A;  4XZQ D;  3O62 C;  3LEL A;  1M18 D;  3UTA D;  2F8N H;  3W98 D;  1P3M B;  5CPK C;  3H0R C;  3AZK D;  2Y2H A;  4AWL C;  3REH A;  1P34 A;  4YS3 D;  5AY8 C;  5B1M A;  1S32 D;  3LJA A;  5AVC B;  1WWS A;  2FFF B;  5B0Y D;  4KGC A;  5GT3 A;  4J8U C;  1EQZ C;  3WTP B;  2PYO B;  3B0C W;  5B1M B;  3REJ C;  5B0Z C;  3WAA A;  5AV5 B;  3LJA B;  3NQJ B;  3KXB C;  4KGC B;  3O62 A;  5GT3 B;  2Y2K A;  3WA9 C;  3MVD D;  4H9R B;  3WAA B;  5BT1 C;  4Z5T C;  5AY8 A;  3O62 B;  4J8U A;  1TZY D;  3AZH B;  1EQZ A;  1ID3 C;  4J8W C;  2RVQ D;  5AY8 B;  3REJ A;  5B0Z A;  2JE5 A;  5CPJ C;  1T3U A;  5B24 D;  4XUJ A;  4YM6 D;  5CPI A;  3X1V C;  1P3G B;  2J8P A;  4J8U B;  3AZL D;  4LD9 C;  3REK C;  3X1U C;  5B33 C;  4CAY A;  3REJ B;  5B0Z B;  3NQU A;  1P3A D;  2NZD D;  1Q9C A;  4XZQ C;  4Z2M H;  1M18 C;  4XUJ B;  3UTA C;  3X1T B;  5CPI B;  3W98 C;  4Z5T A;  3AV2 B;  3AZK C;  2F8N G;  3H0L C;  5AV6 D;  3NQU B;  4YS3 C;  4J8V D;  2JCH A;  3AZG D;  2CWE A;  1ID3 A;  4J8W A;  4DRB A;  5CPJ A;  5B0Y C;  1P3F B;  3X1V A;  4WNN B;  3B0C T;  4LD9 A;  3MGP B;  5B33 A;  1N1J A;  5B31 G;  3X1U A;  3EPH A;  3UT9 D;  5DNN D;  5CPJ B;  4XZQ A;  1M18 A;  2DF4 C;  3UTA A;  3W98 A;  3X1V B;  3MVD C;  5B2I D;  1P3K B;  3AZK A;  4LD9 B;  3X1U B;  1N1J B;  2YFV B;  4YS3 A;  1S32 A;  4Z66 D;  3UTA B;  2Y2L A;  4H9N B;  5B0Y A;  5AVC D;  1TZY C;  5E5A C;  4YS3 B;  2RVQ C;  2ARO D;  3AZE B;  5JA4 A;  1S32 B;  3WTP D;  2PYO D;  5B24 C;  4YM6 C;  3REL D;  2F8N D;  3TU4 D;  5AV5 D;  3AZL C;  3EPK A;  4WV4 B;  2UWX A;  5JA4 B;  3MVD A;  1P3A C;  2NZD C;  5FUG A;  2Y2N A;  4NFT A;  3UTB B;  5B31 D;  4G91 C;  4J8V C;  1TZY A;  2CV5 B;  3AZH D;  3R45 B;  3AZI D;  5B24 A;  4YM6 A;  1TZY B;  3AZL A;  3AYW D;  1P3G D;  3UT9 C;  1P3A A;  4H9S A;  4H9Q B;  2NZD A;  4YM6 B;  5B2I C;  1AOI D;  4XUJ D;  3X1T D;  3LZ1 D;  3AV2 D;  5AV6 A;  1P3A B;  4J8V A;  2NZD B;  4G92 B;  3AZG A;  2Y2P A;  5AVC C;  1ULY A;  5AV6 B;  1B6W A;  2BYM A;  4G91 B;  3F6T A;  1P3F D;  2ARO C;  4NE5 A;  3AZG B;  1ZLA D;  3WTP C;  2PYO C;  3V9R A;  5B1M C;  5DNN A;  3UT9 A;  3TU4 C;  2Y2I A;  5AV5 C;  5B1L D;  3LJA C;  3MGP D;  5B2I A;  5DNN B;  1P3K D;  5GT0 D;  4Z66 A;  5BNX A;  1PZR A;  5B31 C;  5B2I B;  5AVC A;  3AZF B;  3AN2 D;  5B40 D;  5AV9 D;  2ARO A;  4Z66 B;  3AZH C;  5BNX B;  3WTP A;  2PYO A;  3AZI C;  3REL A;  3AZE D;  2F8N A;  3TU4 A;  5AV5 A;  3KUY D;  3NQJ A;  3W99 D;  3LZ0 D;  1P3G C;  2BG1 A;  2ARO B;  2Y2M A;  3REL B;  2F8N B;  4H9R A;  3TU4 B;  1AOI C;  4XUJ C;  5CPI C;  3X1T C;  3AV2 C;  5G49 A;  5B31 A;  4J8X D;  3UTB D;  3REI D;  3B0B A;  1BH8 A;  1M1A B;  3AZH A;  4UUZ A;  3AZI A;  2CV5 D;  5G49 B;  5GXQ B;  5B31 B;  1P3F C;  1ZLA C;  3AYW A;  1P3G A;  3AV1 D;  1BH8 B;  1P3I D;  1Z2C B;  4UUZ B;  3MGP C;  3VH5 W;  3AZI B;  3MGR D;  1AOI A;  3X1T A;  3LZ1 A;  3AYW B;  3AV2 A;  1P3K C;  2ZM5 A;  1AOI B;  1H3O B;  3LZ1 B;  3AN2 C;  2YFW B;  1P3F A;  5B40 C;  1ZLA A;  1P3O B;  4WNN A;  1S32 C;  3AZE C;  3EPJ A;  5B1L A;  1F1E A;  3MGP A;  3B6F B;  3W99 C;  3LZ0 C;  2ZY2 A;  1ZLA B;  4R8P D;  1P3K A;  5GT0 A;  5B1L B;  5CHL B;  5GSU B;  2YFV A;  2G5I C;  4J8X C;  5F99 B;  3UTB C;  5AV8 B;  1KX3 D;  3AN2 A;  4H9N A;  4X23 D;  3REI C;  1P3L B;  5B40 A;  5AV9 A;  5GT0 B;  3AZF D;  5B2J B;  2CV5 C;  3AZE A;  1U35 D;  1WWI A;  3MGS D;  3KUY A;  1TAF A;  3W99 A;  3LZ0 A;  3AN2 B;  4H9O A;  3AV1 C;  5B40 B;  5AV9 B;  3MGQ D;  3C1C B;  3VH5 T;  5DNM B;  3KUY B;  4KHA A;  1TAF B;  5C3I B;  4DRA A;  3LZ0 B;  1P3B B;  4H9O B;  3W99 B;  3WKJ B;  3A6N D;  4J8X A;  4UPK A;  3X1S D;  3UTB A;  3AFA C;  3REI A;  5BS7 C;  4H9S C;  2L5A A;  4G92 C;  4KHA B;  5KDM B;  4WJ3 C;  2DQN C;  2CV5 A;  1M1A D;  3R45 A;  3AZM B;  3VH6 A;  4J8X B;  5AV6 C;  5GXQ D;  3REI B;  3AV1 A;  3W96 B;  3AZG C;  1P3I A;  2ZY3 A;  1KU5 A;  3C1B D;  5BO0 A;  2Y2Q A;  3EG5 B;  5CP6 B;  4H9Q A;  3MGR A;  1F66 D;  3W97 D;  3AV1 B;  4ZBJ C;  1HQ3 D;  1P3I B;  4R8P C;  5BO0 B;  3IP4 C;  5DNN C;  5BS7 A;  3MGR B;  3A1K A;  3KWQ D;  2F8N K;  4JJN B;  1KX3 C;  4WU8 D;  4X23 C;  3AZF C;  4Z66 C;  3MGS C;  1P3O D;  3FDD A;  5CPK D;  3B6F D;  2HIO B;  1R4V A;  2XD1 A;  4R8P A;  3KFU G;  1P3P D;  3REL C;  3A6N C;  5GSU D;  2RIQ A;  1KX3 A;  4ZBJ B;  4X23 A;  4R8P B;  5F99 D;  3AZF A;  2G5H C;  3MNN A;  5AV8 D;  1P3L D;  1M1A C;  1U35 A;  3KXB D;  4WU9 D;  3MGS A;  3EPL A;  1KX4 D;  5B2J D;  1KX3 B;  3WA9 D;  5GXQ C;  4X23 B;  3AZN B;  2FJ7 D;  3MNN B;  3C1B C;  3MGQ A;  4M6B A;  1U35 B;  3MGS B;  3B6G B;  3C1C D;  1B67 A;  1F66 C;  5DNM D;  3W97 C;  3A6N A;  1P3B D;  5JRG D;  3AYW C;  3MGQ B;  3X1S A;  3WKJ D;  3WTP E;  2Y2O A;  3VH6 W;  4ZUX D;  2ZY5 A;  1M1A A;  4WU8 C;  2IO5 B;  3A6N B;  3LZ1 C;  5AVB D;  3X1S B;  3REK D;  5GXQ A;  3AZM D;  3C1B A;  5B32 G;  1P3O C;  3W96 D;  3P5J B;  3B6F C;  4DQY B;  5CP6 D;  1F66 A;  3W97 A;  1HQ3 A;  3C1B B;  4H9P B;  3LEL B;  1P3P C;  4NE3 A;  5B1L C;  4EO5 B;  5GSU C;  3KWQ A;  1F66 B;  3W97 B;  3REH B;  4WU8 A;  1HQ3 B;  1P34 B;  5F99 C;  1H3O A;  4JJN D;  5AV8 C;  2YFW A;  1P3L C;  1JFI A;  5GT0 C;  4WU9 C;  1KX4 C;  3KWQ B;  5B2J C;  1P3O A;  4WU8 B;  4HGA C;  5CPK A;  2FJ7 C;  3B6F A;  3AZJ D;  1JFI B;  4CSR A;  5AV9 C;  3B0D B;  1M19 D;  2HIO D;  1P3P A;  3C1C C;  5DNM C;  3KUY C;  5CPK B;  5C3I C;  1P3B C;  5GSU A;  5JRG C;  5E5A D;  5B32 D;  3AFA D;  4AWL B;  4CSR B;  3WKJ C;  5F99 A;  4E44 A;  1BFM A;  1P3P B;  5AV8 A;  1P3L A;  4ZUX C;  4KUD D;  3VH6 T;  3KXB A;  4WU9 A;  1KX4 A;  2HUE C;  5B2J A;  1EQZ B;  5AVB C;  3AL0 C;  3WA9 A;  3AZM C;  2FJ7 A;  3AZN D;  3W96 C;  3MNN D;  3KXB B;  4WU9 B;  1KX4 B;  3C1C A;  5CP6 C;  3WA9 B;  5DNM A;  3B6G D;  4CAY B;  4HGA B;  2FJ7 B;  1P3B A;  5JRG A;  3WKJ A;  1P3I C;  1HTA A;  4Z5T B;  2BYK A;  4ZUX A;  3MGR C;  5KDM A;  5JRG B;  4JJN C;  5AVB A;  1KX5 D;  1ID3 B;  4J8W B;  3REK A;  3AZM A;  2NQB D;  4QLC D;  2BYK B;  4ZUX B;  3W96 A;  2F2A C;  2HUE B;  5AVB B;  5CP6 A;  3REK B;  5B33 B;  3AZJ C;  1P3M D;  1M19 C;  4XZQ B;  2HIO C;  1M18 B;  3W98 B;  3LEL D;  3AZK B;  1A7W A;  5B32 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...