3AV2A

The human nucleosome structure containing the histone variant h3.3
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title Structures of human nucleosomes containing major histone H3 variants
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3av2A00
4AWLC 4ZBJB 5AV9B 4J8WA 3KUYA 1P3ID 5B2IA 5B1MD 5AV8D 1KX4A 3AV1C 1BH8A 3KWQA 3LJAC 2LY8A 4LD9C 3REKC 4YS3B 5GSUB 5FUGA 3WTPE 5CP6B 4X23D 5AY8B 3MNNB 3UT9D 3AV2B 4H9OB 4WU9A 4ZUXA 1P3GA 5AVCA 3AFAA 1B67A 3AZMD 1S32B 4Z2MH 3KXBC 3C1BC 5B0YB 2YFVB 1F66A 3W99C 1P3PA 3X1UC 2IO5C 3C1CA 1EQZD 1KX3B 5KDMB 5B32C 4UUZB 5JRGD 4G91C 3AZGB 3O62D 3W98D 3UTBC 3WAAA 5B40B 3AZIC 3MGPB 3AYWB 5GXQB 5GT0D 4QLCA 3B0DC 5B24B 4WU8C 3UTAB 1P3BB 4J8XB 3B6FB 1P3KB 1P3IC 5B1MC 4YM6A 5AV8C 3REIB 5B2JD 3REHD 4WNNA 5AV9D 1U35A 3WA9A 4X23C 3UT9C 1M19A 3AZEA 4H9NA 3WKJC 4KGCB 3LZ0B 4YS3D 3LELB 5GSUD 3VH5W 5CP6D 5B1LB 5AY8D 3MNND 3RELA 3AV2D 1EQZC 5B0ZB 1S32D 1P3MA 5DNNB 3AZKA 5JRGC 5B0YD 4LD9B 3AN2A 2F8NA 3W98C 5CPIC 1N1JA 5GT0C 4JJNB 3AZGD 5B40D 3MGPD 5B24D 5B2JC 3REHC 5E5AA 3UTAD 4H9SC 3X1VA 1P3BD 5AV9C 5B32B 4J8XD 3W96A 4Z66D 3B6FD 3AZMA 3UTBB 3B0BA 3MGRB 3REID 1KU5A 3MVDB 3W97D 4YS3C 3AZHA 3VH6A 5GSUC 3X1TA 1Q9CA 4CSRB 5CP6C 1P3AB 3AZFB 3MNNC 3AV2C 1KX5D 1M18B 5JA4A 1S32C 3AZJA 3LZ0D 5G49B 3LELD 2BYKA 5B0YC 5CPKA 5B1LD 5CPJC 1JFIA 2NZDA 1ID3A 3REJA 2FJ7A 5B0ZD 1BFMA 5AVBA 5DNND 4H9QA 5GT3A 5AV5A 3LZ1B 3B6GB 2NQBD 3WKJB 4LD9D 3NQJA 1M1AA 1ZLAC 3B0CW 4J8VA 5B40C 3MGPC 4XUJB 5B24C 4JJND 3UTAC 4KUDA 1P3BC 4R8PA 3B6FC 4Z66C 5CPIB 3REIC 5BS7A 4J8UA 3W97C 3AZNB 3A6NA 5BNVB 4Z5TA 5DNMA 5C3IC 3MGRD 1KX5C 3MVDD 3LZ0C 2YFWA 1P3LB 3LELC 5B33D 5F99B 3MGQB 3MGSB 1P3AD 1KX3A 5B1LC 3AZFD 1M18D 5B0ZC 4H9PA 1AOID 5DNNC 2NQBC 2CV5B 3X1SD 3AYWA 5GXQA 2AROB 3LZ1D 4JJNC 1P3KA 3B6GD 3WKJD 5AV6A 2PYOA 1TZYA 5B31A 1HQ3C 5CPJB 4XUJD 5BNXB 4KGCA 1A7WA 2RVQC 5BO0A 1BH9B 3V9RB 1TAFA 5CPID 3AZLB 1P3OD 3MGRC 1ZLAB 4KHAB 3MVDC 4YM6C 3AZND 1P34B 5B33C 1P3AC 3AZFC 4Z66B 3AV1A 1M18C 3LJAA 1AOIC 1P3LD 3REKA 4XZQB 5F99D 1H3OB 4Z2MG 2BYMB 3R45B 3MGQD 3MGSD 3X1SC 3W97B 3TU4B 5C3IB 3KXBA 4EO5B 3C1BA 4J8WB 3LZ1C 3B6GC 1KX5B 1P3FD 3NQUA 2CV5D 3W99A 5B2IB 3X1UA 1KX4B 1BH8B 3KWQB 4XUJC 5B32A 5FUGB 4DRBA 2AROD 3VH6T 3UTBA 2F8NK 4WU9B 4ZUXB 1P3GB 5AVCB 3AFAB 2NQBB 3AZIA 5CPJD 1P3OC 4WU8A 1P3PB 3AZNC 2HIOD 1ULYA 5E5AC 4H9RA 1P3IA 5B1MA 5AV8A 3AZLD 1ZLAD 1P3LC 3WAAB 1HQ3B 2F8NG 1P34D 5F99C 3MGQC 3MGSC 4X23A 3UT9A 4QLCB 3KSYA 4NE3A 4XZQD 1P3FC 2CV5C 4YM6B 3TU4D 5B33B 1EQZA 1HTAA 4WNNB 1U35B 4J8WD 2AROC 4CAYA 5JRGA 3KUYD 3WA9B 3O62A 5B2ID 1AOIB 5GT3C 1M19B 3W98A 4H9NB 1KX4D 3KWQD 3X1SB 5GT0A 2HIOC 4WU9D 4ZUXD 1P3GD 5AVCD 3AFAD 1P3MB 3WTPC 3AZKB 3AZLC 1F66D 4DRAA 5B2JA 3REHA 3AN2B 2F8NB 1P3PD 5AV9A 1N1JB 1P34C 3C1CD 3VH5A 4YS3A 3WAAD 1HQ3D 4XZQC 5GSUA 1P3OB 5CP6A 5AY8A 3MNNA 3TU4C 3AV2A 4QLCD 4H9OA 5E5AB 2RVQD 1S32A 4J8WC 4EO5C 3W96B 5B0YA 2YFVA 3KUYC 5B2IC 5CPJA 4YM6D 5BNXA 1KX4C 3KWQC 3AZHB 5KDMA 1U35D 4UUZA 3X1TB 3AZGA 3WA9D 1M19D 1ZLAA 3AZED 4WU9C 4ZUXC 1P3GC 5JA4B 5AVCC 3AFAC 1P3FB 3AZJB 5B40A 3MGPA 1F66C 5B24A 3UTAA 1P3PC 1P3BA 3RELD 4J8XA 3C1CC 4Z66A 3B6FA 1ID3B 3REJB 2FJ7B 2NZDB 5AVBB 1P3MD 5GT3B 5AV5B 3AZKD 3REIA 3AN2D 3NQJB 2F8ND 3W97A 2HUEC 3WAAC 4J8VB 4QLCC 1KX5A 2HIOB 4KUDB 3LZ0A 4R8PB 3LELA 3WTPB 5B1LA 5CHLB 5B31G 4NE5A 5B0ZA 5E5AD 4J8UB 3X1VD 5DNNA 1U35C 3A6NB 3W96D 2NQBA 4Z5TB 5DNMB 4LD9A 3WA9C 1M19C 3AZEC 4E44A 2YFWB 3AZHD 4JJNA 3X1TD 3RELC 3KUYB 4H9PB 3AZJD 1P3MC 1HQ3A 3VH6W 3AZKC 3AN2C 5CPKD 2NZDD 1ID3D 3REJD 2FJ7D 5AVBD 5GT3D 5AV5D 3MGRA 1R4VA 5AV6B 3MVDA 1M1AD 5B33A 1F66B 2PYOB 1TZYB 4CSRA 5B31B 4J8VD 1P3AA 3AZFA 3C1CB 5B32G 1M18A 3X1VC 4NE6A 1AOIA 4KUDD 1B6WA 4R8PD 1F1EA 5G49A 3W96C 3WTPD 2F8NH 5BO0B 3AZMC 3X1SA 4G92B 1TAFB 2HUEB 4HGAB 4AWLB 4J8UD 3AZHC 3LZ1A 3A6ND 3B6GA 3X1TC 4Z5TD 5DNMD 3WKJA 3VH5T 5BT1D 3AV1B 3LJAB 3O62C 3AZJC 3REKB 4XUJA 5CPKC 1KX3D 2NZDC 1ID3C 3REJC 2FJ7C 5AVBC 4M6BA 3KXBB 3C1BB 5CPIA 5AV5C 3AZEB 1P3OA 3W99B 3NQUB 2CWEA 3AYWD 5GXQD 3X1UB 2IO5B 3AZNA 1M1AC 5BNVA 4J8VC 4ZBJC 3RELB 1P3KD 4G91B 5AV6D 2JSSA 4KUDC 1P3LA 4R8PC 5F99A 2PYOD 1TZYD 4NFTA 3MGQA 5B31D 3MGSA 3AZIB 4H9SA 1WWIA 3B0DB 4WV4B 5BS7C 4WU8B 4J8UC 5AY8C 3A6NC 4KGCD 4Z5TC 5DNMC 1P3FA 4H9RB 2CV5A 1P3IB 5B1MB 5AV8B 5BT1C 2AROA 3X1VB 1KX3C 4X23B 3UT9B 3AZGC 3AV1D 3LJAD 3AZMB 3REKD 1WWSA 3AYWC 5GXQC 2HIOA 1EQZB 1BH9A 3V9RA 3B0CT 4J8XC 3KXBD 3WTPA 3C1BD 4CAYB 5JRGB 3AZLA 1P3KC 3W99D 4KHAA 5AV6C 3O62B 3W98B 4WZSB 3X1UD 2BYKB 1P34A 2PYOC 1TZYC 5CPKB 5B31C 2L5AA 5GT0B 5B32D 1JFIB 3UTBD 4H9QB 4XZQA 4KGCC 1H3OA 2BYMA 3R45A 4G92C 3AZID 3TU4A 4HGAC 1M1AB 5B2JB 3REHB 4WU8D 4E45A
chains in the Genus database with same CATH superfamily
4AWLC 4ZBJB 5AV9B 4J8WA 3KUYA 1P3ID 5B2IA 5B1MD 5AV8D 1KX4A 3AV1C 1BH8A 3KWQA 3LJAC 2LY8A 4LD9C 4WJ3C 3H0MC 3REKC 4YS3B 5GSUB 5FUGA 3WTPE 5CP6B 4X23D 5AY8B 3MNNB 3UT9D 3AV2B 4H9OB 4WU9A 4ZUXA 1P3GA 5AVCA 3AFAA 1B67A 3AZMD 1S32B 4Z2MH 3KXBC 3C1BC 2ZY2A 2YFVB 5B0YB 1F66A 3W99C 1P3PA 3X1UC 2IO5C 3C1CA 2G5IC 1EQZD 1KX3B 5KDMB 2Y2QA 5B32C 4UUZB 5JRGD 4G91C 3AZGB 3O62D 3W98D 3UTBC 3WAAA 5B40B 3AZIC 3MGPB 3AYWB 5GXQB 5GT0D 4QLCA 3B0DC 5B24B 4WU8C 3UTAB 1P3BB 4J8XB 3B6FB 2Y2IA 1P3KB 1P3IC 5B1MC 4YM6A 2J8PA 5AV8C 3REIB 5B2JD 3REHD 4WNNA 5AV9D 1U35A 3WA9A 4X23C 3UT9C 1M19A 3AZEA 4H9NA 3WKJC 4KGCB 2Y2GA 1T3UA 3LZ0B 3EPHA 4YS3D 3LELB 5GSUD 3VH5W 5CP6D 5B1LB 5AY8D 3MNND 3RELA 3AV2D 1EQZC 5B0ZB 1S32D 1P3MA 5DNNB 1W2EA 3AZKA 5JRGC 5B0YD 4LD9B 3AN2A 2F8NA 3W98C 5CPIC 2JE5A 1N1JA 3AL0C 5GT0C 4JJNB 3AZGD 2DF4C 5B40D 3MGPD 5B24D 5B2JC 3REHC 5E5AA 3UTAD 4H9SC 3X1VA 1P3BD 3A1IA 5AV9C 5B32B 4J8XD 3W96A 4Z66D 3B6FD 3AZMA 3UTBB 3B0BA 3MGRB 3REID 2Y2JA 1KU5A 3MVDB 3W97D 4YS3C 3AZHA 3VH6A 5GSUC 3X1TA 1Q9CA 4CSRB 5CP6C 1P3AB 3AZFB 2Y2PA 3MNNC 3AV2C 1KX5D 1M18B 5JA4A 1S32C 3AZJA 3LZ0D 5G49B 3LELD 2BYKA 5B0YC 5CPKA 2XD1A 5B1LD 5CPJC 1JFIA 2NZDA 1ID3A 3REJA 2FJ7A 5B0ZD 1BFMA 5AVBA 5DNND 4H9QA 5GT3A 5AV5A 3LZ1B 3B6GB 2NQBD 3WKJB 4LD9D 2ZY5A 3NQJA 2G5HC 2VQRA 1M1AA 1ZLAC 3B0CW 4J8VA 2DQNC 5B40C 1Z2CB 3MGPC 4XUJB 5B24C 4JJND 3UTAC 4KUDA 1P3BC 4R8PA 3B6FC 4Z66C 5CPIB 3REIC 3F6TA 5BS7A 4J8UA 3W97C 3AZNB 3A6NA 5BNVB 4Z5TA 5DNMA 5C3IC 3MGRD 1KX5C 3MVDD 3LZ0C 2YFWA 1P3LB 3LELC 5B33D 5F99B 3MGQB 3MGSB 1P3AD 1KX3A 2BG1A 2Y2KA 5B1LC 3AZFD 3P5JB 1M18D 5B0ZC 4H9PA 1AOID 5DNNC 2NQBC 2CV5B 3X1SD 3AYWA 5GXQA 2UWXA 2AROB 3LZ1D 4JJNC 1P3KA 3B6GD 3WKJD 5AV6A 2PYOA 1TZYA 5B31A 1HQ3C 5CPJB 4XUJD 5BNXB 4KGCA 1A7WA 2RVQC 5BO0A 1BH9B 3V9RB 1TAFA 5CPID 3AZLB 1P3OD 3MGRC 1ZLAB 4KHAB 3MVDC 4YM6C 3AZND 1P34B 5B33C 2RIQA 1P3AC 3AZFC 4Z66B 3AV1A 1M18C 3LJAA 1AOIC 1P3LD 3REKA 4XZQB 5F99D 1H3OB 4Z2MG 2BYMB 3R45B 3MGQD 3MGSD 3X1SC 3W97B 3TU4B 5C3IB 3KXBA 4EO5B 3C1BA 4J8WB 3LZ1C 3B6GC 1KX5B 1P3FD 3NQUA 2CV5D 3W99A 5B2IB 3X1UA 1KX4B 1BH8B 3KWQB 4XUJC 5B32A 5FUGB 4DRBA 2AROD 3VH6T 3UTBA 2F8NK 4WU9B 4ZUXB 1P3GB 5AVCB 3AFAB 2NQBB 3AZIA 3H0RC 5CPJD 1P3OC 3EPJA 4WU8A 1P3PB 3AZNC 2HIOD 1ULYA 5E5AC 4H9RA 1P3IA 5B1MA 5AV8A 3A1KA 3AZLD 1ZLAD 1P3LC 1PZRA 3WAAB 1HQ3B 2F8NG 1P34D 5F99C 3MGQC 3MGSC 4X23A 3UT9A 4QLCB 3KFUG 3KSYA 4NE3A 4XZQD 1P3FC 2CV5C 4YM6B 3TU4D 5B33B 1EQZA 1HTAA 4WNNB 1U35B 2Y2OA 4J8WD 2AROC 4CAYA 5JRGA 3KUYD 3WA9B 3O62A 5B2ID 1AOIB 5GT3C 1M19B 3W98A 2ZM5A 4H9NB 1KX4D 3KWQD 2Y2HA 3X1SB 2FFFB 5GT0A 2HIOC 4WU9D 4ZUXD 1P3GD 5AVCD 2JCHA 3AFAD 1P3MB 2ZY4A 3WTPC 3AZKB 3AZLC 1F66D 4DRAA 5B2JA 3REHA 3AN2B 2F8NB 2Y2NA 1P3PD 5AV9A 1N1JB 1P34C 3C1CD 3VH5A 4YS3A 3WAAD 1HQ3D 4XZQC 5GSUA 1P3OB 5CP6A 5AY8A 3MNNA 3TU4C 3AV2A 4QLCD 4H9OA 5E5AB 2RVQD 1S32A 4J8WC 4EO5C 3W96B 5B0YA 2YFVA 3KUYC 5B2IC 5CPJA 4YM6D 5BNXA 1KX4C 3KWQC 3AZHB 5KDMA 1U35D 4UUZA 3X1TB 3AZGA 3WA9D 1M19D 1ZLAA 3AZED 4WU9C 4ZUXC 1P3GC 5JA4B 5AVCC 3AFAC 1P3FB 3AZJB 5B40A 3MGPA 1F66C 5B24A 3UTAA 1P3PC 1P3BA 3RELD 4J8XA 3C1CC 4Z66A 3B6FA 1ID3B 3REJB 2FJ7B 2NZDB 5AVBB 1P3MD 5GT3B 5AV5B 3EPKA 3AZKD 3REIA 3AN2D 3NQJB 2F8ND 3W97A 2HUEC 3WAAC 4J8VB 4QLCC 1KX5A 2HIOB 4KUDB 3LZ0A 4R8PB 3LELA 3WTPB 5B1LA 5CHLB 5B31G 4DQYB 4NE5A 5B0ZA 5E5AD 4J8UB 3X1VD 5DNNA 1U35C 3A6NB 3W96D 2NQBA 4Z5TB 5DNMB 3H0LC 4LD9A 3WA9C 1M19C 3AZEC 4E44A 2YFWB 3EPLA 3AZHD 4JJNA 3X1TD 3RELC 3KUYB 4H9PB 3AZJD 1P3MC 1HQ3A 3VH6W 3AZKC 3AN2C 5CPKD 2NZDD 1ID3D 3REJD 2FJ7D 5AVBD 5GT3D 5AV5D 3MGRA 1R4VA 5AV6B 3MVDA 3FDDA 1M1AD 5B33A 1F66B 2PYOB 1TZYB 4CSRA 5B31B 4J8VD 1P3AA 3AZFA 3C1CB 5B32G 1M18A 3X1VC 4NE6A 1AOIA 4KUDD 1B6WA 4R8PD 1F1EA 5G49A 3W96C 3WTPD 2F8NH 5BO0B 3AZMC 3X1SA 4G92B 1TAFB 2HUEB 4HGAB 4AWLB 4J8UD 3AZHC 3LZ1A 3A6ND 2Y2LA 3B6GA 3X1TC 4UPKA 4Z5TD 5DNMD 3WKJA 3VH5T 5BT1D 3AV1B 3LJAB 3EG5B 3O62C 3AZJC 3REKB 4XUJA 5CPKC 1KX3D 2NZDC 1ID3C 3REJC 2FJ7C 5AVBC 4M6BA 3KXBB 3C1BB 5CPIA 5AV5C 3AZEB 1P3OA 3W99B 3NQUB 2CWEA 3AYWD 5GXQD 3X1UB 2IO5B 3AZNA 1M1AC 5BNVA 4J8VC 4ZBJC 2ZY3A 3RELB 1P3KD 4G91B 5AV6D 2JSSA 4KUDC 1P3LA 4R8PC 5F99A 2PYOD 1TZYD 4NFTA 3MGQA 5B31D 3MGSA 3AZIB 4H9SA 1WWIA 3B0DB 4WV4B 5BS7C 4WU8B 4J8UC 5AY8C 3A6NC 4KGCD 4Z5TC 5DNMC 1P3FA 4H9RB 2CV5A 1P3IB 5B1MB 5AV8B 5BT1C 2AROA 3X1VB 1KX3C 4X23B 3UT9B 3AZGC 3AV1D 3LJAD 3AZMB 2F2AC 3REKD 1WWSA 3AYWC 5GXQC 2W8SA 2HIOA 1EQZB 1BH9A 3V9RA 3B0CT 4J8XC 3KXBD 3WTPA 3C1BD 4CAYB 2XD5A 5JRGB 3AZLA 1P3KC 3W99D 4KHAA 5AV6C 3O62B 3W98B 4WZSB 3X1UD 2BYKB 1P34A 2Y2MA 2PYOC 1TZYC 3IP4C 5CPKB 5B31C 2L5AA 5GT0B 5B32D 1JFIB 3UTBD 4H9QB 4XZQA 4KGCC 1H3OA 2BYMA 3R45A 4G92C 3AZID 3TU4A 4HGAC 1M1AB 5B2JB 3REHB 4WU8D 4E45A
chains in the Genus database with same CATH topology
4AWLC 4ZBJB 5AV9B 4J8WA 3KUYA 1P3ID 5B2IA 5B1MD 5AV8D 1KX4A 3AV1C 1BH8A 3KWQA 3LJAC 2LY8A 4LD9C 4WJ3C 3H0MC 3REKC 4YS3B 5GSUB 5FUGA 3WTPE 5CP6B 4X23D 5AY8B 3MNNB 3UT9D 3AV2B 4H9OB 4WU9A 4ZUXA 1P3GA 5AVCA 3AFAA 1B67A 3AZMD 1S32B 4Z2MH 3KXBC 3C1BC 2ZY2A 2YFVB 5B0YB 1F66A 3W99C 1P3PA 3X1UC 2IO5C 3C1CA 2G5IC 1EQZD 1KX3B 5KDMB 2Y2QA 5B32C 4UUZB 5JRGD 4G91C 3AZGB 3O62D 3W98D 3UTBC 3WAAA 5B40B 3AZIC 3MGPB 3AYWB 5GXQB 5GT0D 4QLCA 3B0DC 5B24B 4WU8C 3UTAB 1P3BB 4J8XB 3B6FB 2Y2IA 1P3KB 1P3IC 5B1MC 4YM6A 2J8PA 5AV8C 3REIB 5B2JD 3REHD 4WNNA 5AV9D 1U35A 3WA9A 4X23C 3UT9C 1M19A 3AZEA 4H9NA 3WKJC 4KGCB 2Y2GA 1T3UA 3LZ0B 3EPHA 4YS3D 3LELB 5GSUD 3VH5W 5CP6D 5B1LB 5AY8D 3MNND 3RELA 3AV2D 1EQZC 5B0ZB 1S32D 1P3MA 5DNNB 1W2EA 3AZKA 5JRGC 5B0YD 4LD9B 3AN2A 2F8NA 3W98C 5CPIC 2JE5A 1N1JA 3AL0C 5GT0C 4JJNB 3AZGD 2DF4C 5B40D 3MGPD 5B24D 5B2JC 3REHC 5E5AA 3UTAD 4H9SC 3X1VA 1P3BD 3A1IA 5AV9C 5B32B 4J8XD 3W96A 4Z66D 3B6FD 3AZMA 3UTBB 3B0BA 3MGRB 3REID 2Y2JA 1KU5A 3MVDB 3W97D 4YS3C 3AZHA 3VH6A 5GSUC 3X1TA 1Q9CA 4CSRB 5CP6C 1P3AB 3AZFB 2Y2PA 3MNNC 3AV2C 1KX5D 1M18B 5JA4A 1S32C 3AZJA 3LZ0D 5G49B 3LELD 2BYKA 5B0YC 5CPKA 2XD1A 5B1LD 5CPJC 1JFIA 2NZDA 1ID3A 3REJA 2FJ7A 5B0ZD 1BFMA 5AVBA 5DNND 4H9QA 5GT3A 5AV5A 3LZ1B 3B6GB 2NQBD 3WKJB 4LD9D 2ZY5A 3NQJA 2G5HC 2VQRA 1M1AA 1ZLAC 3B0CW 4J8VA 2DQNC 5B40C 1Z2CB 3MGPC 4XUJB 5B24C 4JJND 3UTAC 4KUDA 1P3BC 4R8PA 3B6FC 4Z66C 5CPIB 3REIC 3F6TA 5BS7A 4J8UA 3W97C 3AZNB 3A6NA 5BNVB 4Z5TA 5DNMA 5C3IC 3MGRD 1KX5C 3MVDD 3LZ0C 2YFWA 1P3LB 3LELC 5B33D 5F99B 3MGQB 3MGSB 1P3AD 1KX3A 2BG1A 2Y2KA 5B1LC 3AZFD 3P5JB 1M18D 5B0ZC 4H9PA 1AOID 5DNNC 2NQBC 2CV5B 3X1SD 3AYWA 5GXQA 2UWXA 2AROB 3LZ1D 4JJNC 1P3KA 3B6GD 3WKJD 5AV6A 2PYOA 1TZYA 5B31A 1HQ3C 5CPJB 4XUJD 5BNXB 4KGCA 1A7WA 2RVQC 5BO0A 1BH9B 3V9RB 1TAFA 5CPID 3AZLB 1P3OD 3MGRC 1ZLAB 4KHAB 3MVDC 4YM6C 3AZND 1P34B 5B33C 2RIQA 1P3AC 3AZFC 4Z66B 3AV1A 1M18C 3LJAA 1AOIC 1P3LD 3REKA 4XZQB 5F99D 1H3OB 4Z2MG 2BYMB 3R45B 3MGQD 3MGSD 3X1SC 3W97B 3TU4B 5C3IB 3KXBA 4EO5B 3C1BA 4J8WB 3LZ1C 3B6GC 1KX5B 1P3FD 3NQUA 2CV5D 3W99A 5B2IB 3X1UA 1KX4B 1BH8B 3KWQB 4XUJC 5B32A 5FUGB 4DRBA 2AROD 3VH6T 3UTBA 2F8NK 4WU9B 4ZUXB 1P3GB 5AVCB 3AFAB 2NQBB 3AZIA 3H0RC 5CPJD 1P3OC 3EPJA 4WU8A 1P3PB 3AZNC 2HIOD 1ULYA 5E5AC 4H9RA 1P3IA 5B1MA 5AV8A 3A1KA 3AZLD 1ZLAD 1P3LC 1PZRA 3WAAB 1HQ3B 2F8NG 1P34D 5F99C 3MGQC 3MGSC 4X23A 3UT9A 4QLCB 3KFUG 3KSYA 4NE3A 4XZQD 1P3FC 2CV5C 4YM6B 3TU4D 5B33B 1EQZA 1HTAA 4WNNB 1U35B 2Y2OA 4J8WD 2AROC 4CAYA 5JRGA 3KUYD 3WA9B 3O62A 5B2ID 1AOIB 5GT3C 1M19B 3W98A 2ZM5A 4H9NB 1KX4D 3KWQD 2Y2HA 3X1SB 2FFFB 5GT0A 2HIOC 4WU9D 4ZUXD 1P3GD 5AVCD 2JCHA 3AFAD 1P3MB 2ZY4A 3WTPC 3AZKB 3AZLC 1F66D 4DRAA 5B2JA 3REHA 3AN2B 2F8NB 2Y2NA 1P3PD 5AV9A 1N1JB 1P34C 3C1CD 3VH5A 4YS3A 3WAAD 1HQ3D 4XZQC 5GSUA 1P3OB 5CP6A 5AY8A 3MNNA 3TU4C 3AV2A 4QLCD 4H9OA 5E5AB 2RVQD 1S32A 4J8WC 4EO5C 3W96B 5B0YA 2YFVA 3KUYC 5B2IC 5CPJA 4YM6D 5BNXA 1KX4C 3KWQC 3AZHB 5KDMA 1U35D 4UUZA 3X1TB 3AZGA 3WA9D 1M19D 1ZLAA 3AZED 4WU9C 4ZUXC 1P3GC 5JA4B 5AVCC 3AFAC 1P3FB 3AZJB 5B40A 3MGPA 1F66C 5B24A 3UTAA 1P3PC 1P3BA 3RELD 4J8XA 3C1CC 4Z66A 3B6FA 1ID3B 3REJB 2FJ7B 2NZDB 5AVBB 1P3MD 5GT3B 5AV5B 3EPKA 3AZKD 3REIA 3AN2D 3NQJB 2F8ND 3W97A 2HUEC 3WAAC 4J8VB 4QLCC 1KX5A 2HIOB 4KUDB 3LZ0A 4R8PB 3LELA 3WTPB 5B1LA 5CHLB 5B31G 4DQYB 4NE5A 5B0ZA 5E5AD 4J8UB 3X1VD 5DNNA 1U35C 3A6NB 3W96D 2NQBA 4Z5TB 5DNMB 3H0LC 4LD9A 3WA9C 1M19C 3AZEC 4E44A 2YFWB 3EPLA 3AZHD 4JJNA 3X1TD 3RELC 3KUYB 4H9PB 3AZJD 1P3MC 1HQ3A 3VH6W 3AZKC 3AN2C 5CPKD 2NZDD 1ID3D 3REJD 2FJ7D 5AVBD 5GT3D 5AV5D 3MGRA 1R4VA 5AV6B 3MVDA 3FDDA 1M1AD 5B33A 1F66B 2PYOB 1TZYB 4CSRA 5B31B 4J8VD 1P3AA 3AZFA 3C1CB 5B32G 1M18A 3X1VC 4NE6A 1AOIA 4KUDD 1B6WA 4R8PD 1F1EA 5G49A 3W96C 3WTPD 2F8NH 5BO0B 3AZMC 3X1SA 4G92B 1TAFB 2HUEB 4HGAB 4AWLB 4J8UD 3AZHC 3LZ1A 3A6ND 2Y2LA 3B6GA 3X1TC 4UPKA 4Z5TD 5DNMD 3WKJA 3VH5T 5BT1D 3AV1B 3LJAB 3EG5B 3O62C 3AZJC 3REKB 4XUJA 5CPKC 1KX3D 2NZDC 1ID3C 3REJC 2FJ7C 5AVBC 4M6BA 3KXBB 3C1BB 5CPIA 5AV5C 3AZEB 1P3OA 3W99B 3NQUB 2CWEA 3AYWD 5GXQD 3X1UB 2IO5B 3AZNA 1M1AC 5BNVA 4J8VC 4ZBJC 2ZY3A 3RELB 1P3KD 4G91B 5AV6D 2JSSA 4KUDC 1P3LA 4R8PC 5F99A 2PYOD 1TZYD 4NFTA 3MGQA 5B31D 3MGSA 3AZIB 4H9SA 1WWIA 3B0DB 4WV4B 5BS7C 4WU8B 4J8UC 5AY8C 3A6NC 4KGCD 4Z5TC 5DNMC 1P3FA 4H9RB 2CV5A 1P3IB 5B1MB 5AV8B 5BT1C 2AROA 3X1VB 1KX3C 4X23B 3UT9B 3AZGC 3AV1D 3LJAD 3AZMB 2F2AC 3REKD 1WWSA 3AYWC 5GXQC 2W8SA 2HIOA 1EQZB 1BH9A 3V9RA 3B0CT 4J8XC 3KXBD 3WTPA 3C1BD 4CAYB 2XD5A 5JRGB 3AZLA 1P3KC 3W99D 4KHAA 5AV6C 3O62B 3W98B 4WZSB 3X1UD 2BYKB 1P34A 2Y2MA 2PYOC 1TZYC 3IP4C 5CPKB 5B31C 2L5AA 5GT0B 5B32D 1JFIB 3UTBD 4H9QB 4XZQA 4KGCC 1H3OA 2BYMA 3R45A 4G92C 3AZID 3TU4A 4HGAC 1M1AB 5B2JB 3REHB 4WU8D 4E45A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AWL C;  4ZBJ B;  5AV9 B;  4J8W A;  3KUY A;  1P3I D;  5B2I A;  5B1M D;  5AV8 D;  1KX4 A;  3AV1 C;  1BH8 A;  3KWQ A;  3LJA C;  2LY8 A;  4LD9 C;  3REK C;  4YS3 B;  5GSU B;  5FUG A;  3WTP E;  5CP6 B;  4X23 D;  5AY8 B;  3MNN B;  3UT9 D;  3AV2 B;  4H9O B;  4WU9 A;  4ZUX A;  1P3G A;  5AVC A;  3AFA A;  1B67 A;  3AZM D;  1S32 B;  4Z2M H;  3KXB C;  3C1B C;  5B0Y B;  2YFV B;  1F66 A;  3W99 C;  1P3P A;  3X1U C;  2IO5 C;  3C1C A;  1EQZ D;  1KX3 B;  5KDM B;  5B32 C;  4UUZ B;  5JRG D;  4G91 C;  3AZG B;  3O62 D;  3W98 D;  3UTB C;  3WAA A;  5B40 B;  3AZI C;  3MGP B;  3AYW B;  5GXQ B;  5GT0 D;  4QLC A;  3B0D C;  5B24 B;  4WU8 C;  3UTA B;  1P3B B;  4J8X B;  3B6F B;  1P3K B;  1P3I C;  5B1M C;  4YM6 A;  5AV8 C;  3REI B;  5B2J D;  3REH D;  4WNN A;  5AV9 D;  1U35 A;  3WA9 A;  4X23 C;  3UT9 C;  1M19 A;  3AZE A;  4H9N A;  3WKJ C;  4KGC B;  3LZ0 B;  4YS3 D;  3LEL B;  5GSU D;  3VH5 W;  5CP6 D;  5B1L B;  5AY8 D;  3MNN D;  3REL A;  3AV2 D;  1EQZ C;  5B0Z B;  1S32 D;  1P3M A;  5DNN B;  3AZK A;  5JRG C;  5B0Y D;  4LD9 B;  3AN2 A;  2F8N A;  3W98 C;  5CPI C;  1N1J A;  5GT0 C;  4JJN B;  3AZG D;  5B40 D;  3MGP D;  5B24 D;  5B2J C;  3REH C;  5E5A A;  3UTA D;  4H9S C;  3X1V A;  1P3B D;  5AV9 C;  5B32 B;  4J8X D;  3W96 A;  4Z66 D;  3B6F D;  3AZM A;  3UTB B;  3B0B A;  3MGR B;  3REI D;  1KU5 A;  3MVD B;  3W97 D;  4YS3 C;  3AZH A;  3VH6 A;  5GSU C;  3X1T A;  1Q9C A;  4CSR B;  5CP6 C;  1P3A B;  3AZF B;  3MNN C;  3AV2 C;  1KX5 D;  1M18 B;  5JA4 A;  1S32 C;  3AZJ A;  3LZ0 D;  5G49 B;  3LEL D;  2BYK A;  5B0Y C;  5CPK A;  5B1L D;  5CPJ C;  1JFI A;  2NZD A;  1ID3 A;  3REJ A;  2FJ7 A;  5B0Z D;  1BFM A;  5AVB A;  5DNN D;  4H9Q A;  5GT3 A;  5AV5 A;  3LZ1 B;  3B6G B;  2NQB D;  3WKJ B;  4LD9 D;  3NQJ A;  1M1A A;  1ZLA C;  3B0C W;  4J8V A;  5B40 C;  3MGP C;  4XUJ B;  5B24 C;  4JJN D;  3UTA C;  4KUD A;  1P3B C;  4R8P A;  3B6F C;  4Z66 C;  5CPI B;  3REI C;  5BS7 A;  4J8U A;  3W97 C;  3AZN B;  3A6N A;  5BNV B;  4Z5T A;  5DNM A;  5C3I C;  3MGR D;  1KX5 C;  3MVD D;  3LZ0 C;  2YFW A;  1P3L B;  3LEL C;  5B33 D;  5F99 B;  3MGQ B;  3MGS B;  1P3A D;  1KX3 A;  5B1L C;  3AZF D;  1M18 D;  5B0Z C;  4H9P A;  1AOI D;  5DNN C;  2NQB C;  2CV5 B;  3X1S D;  3AYW A;  5GXQ A;  2ARO B;  3LZ1 D;  4JJN C;  1P3K A;  3B6G D;  3WKJ D;  5AV6 A;  2PYO A;  1TZY A;  5B31 A;  1HQ3 C;  5CPJ B;  4XUJ D;  5BNX B;  4KGC A;  1A7W A;  2RVQ C;  5BO0 A;  1BH9 B;  3V9R B;  1TAF A;  5CPI D;  3AZL B;  1P3O D;  3MGR C;  1ZLA B;  4KHA B;  3MVD C;  4YM6 C;  3AZN D;  1P34 B;  5B33 C;  1P3A C;  3AZF C;  4Z66 B;  3AV1 A;  1M18 C;  3LJA A;  1AOI C;  1P3L D;  3REK A;  4XZQ B;  5F99 D;  1H3O B;  4Z2M G;  2BYM B;  3R45 B;  3MGQ D;  3MGS D;  3X1S C;  3W97 B;  3TU4 B;  5C3I B;  3KXB A;  4EO5 B;  3C1B A;  4J8W B;  3LZ1 C;  3B6G C;  1KX5 B;  1P3F D;  3NQU A;  2CV5 D;  3W99 A;  5B2I B;  3X1U A;  1KX4 B;  1BH8 B;  3KWQ B;  4XUJ C;  5B32 A;  5FUG B;  4DRB A;  2ARO D;  3VH6 T;  3UTB A;  2F8N K;  4WU9 B;  4ZUX B;  1P3G B;  5AVC B;  3AFA B;  2NQB B;  3AZI A;  5CPJ D;  1P3O C;  4WU8 A;  1P3P B;  3AZN C;  2HIO D;  1ULY A;  5E5A C;  4H9R A;  1P3I A;  5B1M A;  5AV8 A;  3AZL D;  1ZLA D;  1P3L C;  3WAA B;  1HQ3 B;  2F8N G;  1P34 D;  5F99 C;  3MGQ C;  3MGS C;  4X23 A;  3UT9 A;  4QLC B;  3KSY A;  4NE3 A;  4XZQ D;  1P3F C;  2CV5 C;  4YM6 B;  3TU4 D;  5B33 B;  1EQZ A;  1HTA A;  4WNN B;  1U35 B;  4J8W D;  2ARO C;  4CAY A;  5JRG A;  3KUY D;  3WA9 B;  3O62 A;  5B2I D;  1AOI B;  5GT3 C;  1M19 B;  3W98 A;  4H9N B;  1KX4 D;  3KWQ D;  3X1S B;  5GT0 A;  2HIO C;  4WU9 D;  4ZUX D;  1P3G D;  5AVC D;  3AFA D;  1P3M B;  3WTP C;  3AZK B;  3AZL C;  1F66 D;  4DRA A;  5B2J A;  3REH A;  3AN2 B;  2F8N B;  1P3P D;  5AV9 A;  1N1J B;  1P34 C;  3C1C D;  3VH5 A;  4YS3 A;  3WAA D;  1HQ3 D;  4XZQ C;  5GSU A;  1P3O B;  5CP6 A;  5AY8 A;  3MNN A;  3TU4 C;  3AV2 A;  4QLC D;  4H9O A;  5E5A B;  2RVQ D;  1S32 A;  4J8W C;  4EO5 C;  3W96 B;  5B0Y A;  2YFV A;  3KUY C;  5B2I C;  5CPJ A;  4YM6 D;  5BNX A;  1KX4 C;  3KWQ C;  3AZH B;  5KDM A;  1U35 D;  4UUZ A;  3X1T B;  3AZG A;  3WA9 D;  1M19 D;  1ZLA A;  3AZE D;  4WU9 C;  4ZUX C;  1P3G C;  5JA4 B;  5AVC C;  3AFA C;  1P3F B;  3AZJ B;  5B40 A;  3MGP A;  1F66 C;  5B24 A;  3UTA A;  1P3P C;  1P3B A;  3REL D;  4J8X A;  3C1C C;  4Z66 A;  3B6F A;  1ID3 B;  3REJ B;  2FJ7 B;  2NZD B;  5AVB B;  1P3M D;  5GT3 B;  5AV5 B;  3AZK D;  3REI A;  3AN2 D;  3NQJ B;  2F8N D;  3W97 A;  2HUE C;  3WAA C;  4J8V B;  4QLC C;  1KX5 A;  2HIO B;  4KUD B;  3LZ0 A;  4R8P B;  3LEL A;  3WTP B;  5B1L A;  5CHL B;  5B31 G;  4NE5 A;  5B0Z A;  5E5A D;  4J8U B;  3X1V D;  5DNN A;  1U35 C;  3A6N B;  3W96 D;  2NQB A;  4Z5T B;  5DNM B;  4LD9 A;  3WA9 C;  1M19 C;  3AZE C;  4E44 A;  2YFW B;  3AZH D;  4JJN A;  3X1T D;  3REL C;  3KUY B;  4H9P B;  3AZJ D;  1P3M C;  1HQ3 A;  3VH6 W;  3AZK C;  3AN2 C;  5CPK D;  2NZD D;  1ID3 D;  3REJ D;  2FJ7 D;  5AVB D;  5GT3 D;  5AV5 D;  3MGR A;  1R4V A;  5AV6 B;  3MVD A;  1M1A D;  5B33 A;  1F66 B;  2PYO B;  1TZY B;  4CSR A;  5B31 B;  4J8V D;  1P3A A;  3AZF A;  3C1C B;  5B32 G;  1M18 A;  3X1V C;  4NE6 A;  1AOI A;  4KUD D;  1B6W A;  4R8P D;  1F1E A;  5G49 A;  3W96 C;  3WTP D;  2F8N H;  5BO0 B;  3AZM C;  3X1S A;  4G92 B;  1TAF B;  2HUE B;  4HGA B;  4AWL B;  4J8U D;  3AZH C;  3LZ1 A;  3A6N D;  3B6G A;  3X1T C;  4Z5T D;  5DNM D;  3WKJ A;  3VH5 T;  5BT1 D;  3AV1 B;  3LJA B;  3O62 C;  3AZJ C;  3REK B;  4XUJ A;  5CPK C;  1KX3 D;  2NZD C;  1ID3 C;  3REJ C;  2FJ7 C;  5AVB C;  4M6B A;  3KXB B;  3C1B B;  5CPI A;  5AV5 C;  3AZE B;  1P3O A;  3W99 B;  3NQU B;  2CWE A;  3AYW D;  5GXQ D;  3X1U B;  2IO5 B;  3AZN A;  1M1A C;  5BNV A;  4J8V C;  4ZBJ C;  3REL B;  1P3K D;  4G91 B;  5AV6 D;  2JSS A;  4KUD C;  1P3L A;  4R8P C;  5F99 A;  2PYO D;  1TZY D;  4NFT A;  3MGQ A;  5B31 D;  3MGS A;  3AZI B;  4H9S A;  1WWI A;  3B0D B;  4WV4 B;  5BS7 C;  4WU8 B;  4J8U C;  5AY8 C;  3A6N C;  4KGC D;  4Z5T C;  5DNM C;  1P3F A;  4H9R B;  2CV5 A;  1P3I B;  5B1M B;  5AV8 B;  5BT1 C;  2ARO A;  3X1V B;  1KX3 C;  4X23 B;  3UT9 B;  3AZG C;  3AV1 D;  3LJA D;  3AZM B;  3REK D;  1WWS A;  3AYW C;  5GXQ C;  2HIO A;  1EQZ B;  1BH9 A;  3V9R A;  3B0C T;  4J8X C;  3KXB D;  3WTP A;  3C1B D;  4CAY B;  5JRG B;  3AZL A;  1P3K C;  3W99 D;  4KHA A;  5AV6 C;  3O62 B;  3W98 B;  4WZS B;  3X1U D;  2BYK B;  1P34 A;  2PYO C;  1TZY C;  5CPK B;  5B31 C;  2L5A A;  5GT0 B;  5B32 D;  1JFI B;  3UTB D;  4H9Q B;  4XZQ A;  4KGC C;  1H3O A;  2BYM A;  3R45 A;  4G92 C;  3AZI D;  3TU4 A;  4HGA C;  1M1A B;  5B2J B;  3REH B;  4WU8 D;  4E45 A; 
#chains in the Genus database with same CATH topology
 4AWL C;  4ZBJ B;  5AV9 B;  4J8W A;  3KUY A;  1P3I D;  5B2I A;  5B1M D;  5AV8 D;  1KX4 A;  3AV1 C;  1BH8 A;  3KWQ A;  3LJA C;  2LY8 A;  4LD9 C;  4WJ3 C;  3H0M C;  3REK C;  4YS3 B;  5GSU B;  5FUG A;  3WTP E;  5CP6 B;  4X23 D;  5AY8 B;  3MNN B;  3UT9 D;  3AV2 B;  4H9O B;  4WU9 A;  4ZUX A;  1P3G A;  5AVC A;  3AFA A;  1B67 A;  3AZM D;  1S32 B;  4Z2M H;  3KXB C;  3C1B C;  2ZY2 A;  2YFV B;  5B0Y B;  1F66 A;  3W99 C;  1P3P A;  3X1U C;  2IO5 C;  3C1C A;  2G5I C;  1EQZ D;  1KX3 B;  5KDM B;  2Y2Q A;  5B32 C;  4UUZ B;  5JRG D;  4G91 C;  3AZG B;  3O62 D;  3W98 D;  3UTB C;  3WAA A;  5B40 B;  3AZI C;  3MGP B;  3AYW B;  5GXQ B;  5GT0 D;  4QLC A;  3B0D C;  5B24 B;  4WU8 C;  3UTA B;  1P3B B;  4J8X B;  3B6F B;  2Y2I A;  1P3K B;  1P3I C;  5B1M C;  4YM6 A;  2J8P A;  5AV8 C;  3REI B;  5B2J D;  3REH D;  4WNN A;  5AV9 D;  1U35 A;  3WA9 A;  4X23 C;  3UT9 C;  1M19 A;  3AZE A;  4H9N A;  3WKJ C;  4KGC B;  2Y2G A;  1T3U A;  3LZ0 B;  3EPH A;  4YS3 D;  3LEL B;  5GSU D;  3VH5 W;  5CP6 D;  5B1L B;  5AY8 D;  3MNN D;  3REL A;  3AV2 D;  1EQZ C;  5B0Z B;  1S32 D;  1P3M A;  5DNN B;  1W2E A;  3AZK A;  5JRG C;  5B0Y D;  4LD9 B;  3AN2 A;  2F8N A;  3W98 C;  5CPI C;  2JE5 A;  1N1J A;  3AL0 C;  5GT0 C;  4JJN B;  3AZG D;  2DF4 C;  5B40 D;  3MGP D;  5B24 D;  5B2J C;  3REH C;  5E5A A;  3UTA D;  4H9S C;  3X1V A;  1P3B D;  3A1I A;  5AV9 C;  5B32 B;  4J8X D;  3W96 A;  4Z66 D;  3B6F D;  3AZM A;  3UTB B;  3B0B A;  3MGR B;  3REI D;  2Y2J A;  1KU5 A;  3MVD B;  3W97 D;  4YS3 C;  3AZH A;  3VH6 A;  5GSU C;  3X1T A;  1Q9C A;  4CSR B;  5CP6 C;  1P3A B;  3AZF B;  2Y2P A;  3MNN C;  3AV2 C;  1KX5 D;  1M18 B;  5JA4 A;  1S32 C;  3AZJ A;  3LZ0 D;  5G49 B;  3LEL D;  2BYK A;  5B0Y C;  5CPK A;  2XD1 A;  5B1L D;  5CPJ C;  1JFI A;  2NZD A;  1ID3 A;  3REJ A;  2FJ7 A;  5B0Z D;  1BFM A;  5AVB A;  5DNN D;  4H9Q A;  5GT3 A;  5AV5 A;  3LZ1 B;  3B6G B;  2NQB D;  3WKJ B;  4LD9 D;  2ZY5 A;  3NQJ A;  2G5H C;  2VQR A;  1M1A A;  1ZLA C;  3B0C W;  4J8V A;  2DQN C;  5B40 C;  1Z2C B;  3MGP C;  4XUJ B;  5B24 C;  4JJN D;  3UTA C;  4KUD A;  1P3B C;  4R8P A;  3B6F C;  4Z66 C;  5CPI B;  3REI C;  3F6T A;  5BS7 A;  4J8U A;  3W97 C;  3AZN B;  3A6N A;  5BNV B;  4Z5T A;  5DNM A;  5C3I C;  3MGR D;  1KX5 C;  3MVD D;  3LZ0 C;  2YFW A;  1P3L B;  3LEL C;  5B33 D;  5F99 B;  3MGQ B;  3MGS B;  1P3A D;  1KX3 A;  2BG1 A;  2Y2K A;  5B1L C;  3AZF D;  3P5J B;  1M18 D;  5B0Z C;  4H9P A;  1AOI D;  5DNN C;  2NQB C;  2CV5 B;  3X1S D;  3AYW A;  5GXQ A;  2UWX A;  2ARO B;  3LZ1 D;  4JJN C;  1P3K A;  3B6G D;  3WKJ D;  5AV6 A;  2PYO A;  1TZY A;  5B31 A;  1HQ3 C;  5CPJ B;  4XUJ D;  5BNX B;  4KGC A;  1A7W A;  2RVQ C;  5BO0 A;  1BH9 B;  3V9R B;  1TAF A;  5CPI D;  3AZL B;  1P3O D;  3MGR C;  1ZLA B;  4KHA B;  3MVD C;  4YM6 C;  3AZN D;  1P34 B;  5B33 C;  2RIQ A;  1P3A C;  3AZF C;  4Z66 B;  3AV1 A;  1M18 C;  3LJA A;  1AOI C;  1P3L D;  3REK A;  4XZQ B;  5F99 D;  1H3O B;  4Z2M G;  2BYM B;  3R45 B;  3MGQ D;  3MGS D;  3X1S C;  3W97 B;  3TU4 B;  5C3I B;  3KXB A;  4EO5 B;  3C1B A;  4J8W B;  3LZ1 C;  3B6G C;  1KX5 B;  1P3F D;  3NQU A;  2CV5 D;  3W99 A;  5B2I B;  3X1U A;  1KX4 B;  1BH8 B;  3KWQ B;  4XUJ C;  5B32 A;  5FUG B;  4DRB A;  2ARO D;  3VH6 T;  3UTB A;  2F8N K;  4WU9 B;  4ZUX B;  1P3G B;  5AVC B;  3AFA B;  2NQB B;  3AZI A;  3H0R C;  5CPJ D;  1P3O C;  3EPJ A;  4WU8 A;  1P3P B;  3AZN C;  2HIO D;  1ULY A;  5E5A C;  4H9R A;  1P3I A;  5B1M A;  5AV8 A;  3A1K A;  3AZL D;  1ZLA D;  1P3L C;  1PZR A;  3WAA B;  1HQ3 B;  2F8N G;  1P34 D;  5F99 C;  3MGQ C;  3MGS C;  4X23 A;  3UT9 A;  4QLC B;  3KFU G;  3KSY A;  4NE3 A;  4XZQ D;  1P3F C;  2CV5 C;  4YM6 B;  3TU4 D;  5B33 B;  1EQZ A;  1HTA A;  4WNN B;  1U35 B;  2Y2O A;  4J8W D;  2ARO C;  4CAY A;  5JRG A;  3KUY D;  3WA9 B;  3O62 A;  5B2I D;  1AOI B;  5GT3 C;  1M19 B;  3W98 A;  2ZM5 A;  4H9N B;  1KX4 D;  3KWQ D;  2Y2H A;  3X1S B;  2FFF B;  5GT0 A;  2HIO C;  4WU9 D;  4ZUX D;  1P3G D;  5AVC D;  2JCH A;  3AFA D;  1P3M B;  2ZY4 A;  3WTP C;  3AZK B;  3AZL C;  1F66 D;  4DRA A;  5B2J A;  3REH A;  3AN2 B;  2F8N B;  2Y2N A;  1P3P D;  5AV9 A;  1N1J B;  1P34 C;  3C1C D;  3VH5 A;  4YS3 A;  3WAA D;  1HQ3 D;  4XZQ C;  5GSU A;  1P3O B;  5CP6 A;  5AY8 A;  3MNN A;  3TU4 C;  3AV2 A;  4QLC D;  4H9O A;  5E5A B;  2RVQ D;  1S32 A;  4J8W C;  4EO5 C;  3W96 B;  5B0Y A;  2YFV A;  3KUY C;  5B2I C;  5CPJ A;  4YM6 D;  5BNX A;  1KX4 C;  3KWQ C;  3AZH B;  5KDM A;  1U35 D;  4UUZ A;  3X1T B;  3AZG A;  3WA9 D;  1M19 D;  1ZLA A;  3AZE D;  4WU9 C;  4ZUX C;  1P3G C;  5JA4 B;  5AVC C;  3AFA C;  1P3F B;  3AZJ B;  5B40 A;  3MGP A;  1F66 C;  5B24 A;  3UTA A;  1P3P C;  1P3B A;  3REL D;  4J8X A;  3C1C C;  4Z66 A;  3B6F A;  1ID3 B;  3REJ B;  2FJ7 B;  2NZD B;  5AVB B;  1P3M D;  5GT3 B;  5AV5 B;  3EPK A;  3AZK D;  3REI A;  3AN2 D;  3NQJ B;  2F8N D;  3W97 A;  2HUE C;  3WAA C;  4J8V B;  4QLC C;  1KX5 A;  2HIO B;  4KUD B;  3LZ0 A;  4R8P B;  3LEL A;  3WTP B;  5B1L A;  5CHL B;  5B31 G;  4DQY B;  4NE5 A;  5B0Z A;  5E5A D;  4J8U B;  3X1V D;  5DNN A;  1U35 C;  3A6N B;  3W96 D;  2NQB A;  4Z5T B;  5DNM B;  3H0L C;  4LD9 A;  3WA9 C;  1M19 C;  3AZE C;  4E44 A;  2YFW B;  3EPL A;  3AZH D;  4JJN A;  3X1T D;  3REL C;  3KUY B;  4H9P B;  3AZJ D;  1P3M C;  1HQ3 A;  3VH6 W;  3AZK C;  3AN2 C;  5CPK D;  2NZD D;  1ID3 D;  3REJ D;  2FJ7 D;  5AVB D;  5GT3 D;  5AV5 D;  3MGR A;  1R4V A;  5AV6 B;  3MVD A;  3FDD A;  1M1A D;  5B33 A;  1F66 B;  2PYO B;  1TZY B;  4CSR A;  5B31 B;  4J8V D;  1P3A A;  3AZF A;  3C1C B;  5B32 G;  1M18 A;  3X1V C;  4NE6 A;  1AOI A;  4KUD D;  1B6W A;  4R8P D;  1F1E A;  5G49 A;  3W96 C;  3WTP D;  2F8N H;  5BO0 B;  3AZM C;  3X1S A;  4G92 B;  1TAF B;  2HUE B;  4HGA B;  4AWL B;  4J8U D;  3AZH C;  3LZ1 A;  3A6N D;  2Y2L A;  3B6G A;  3X1T C;  4UPK A;  4Z5T D;  5DNM D;  3WKJ A;  3VH5 T;  5BT1 D;  3AV1 B;  3LJA B;  3EG5 B;  3O62 C;  3AZJ C;  3REK B;  4XUJ A;  5CPK C;  1KX3 D;  2NZD C;  1ID3 C;  3REJ C;  2FJ7 C;  5AVB C;  4M6B A;  3KXB B;  3C1B B;  5CPI A;  5AV5 C;  3AZE B;  1P3O A;  3W99 B;  3NQU B;  2CWE A;  3AYW D;  5GXQ D;  3X1U B;  2IO5 B;  3AZN A;  1M1A C;  5BNV A;  4J8V C;  4ZBJ C;  2ZY3 A;  3REL B;  1P3K D;  4G91 B;  5AV6 D;  2JSS A;  4KUD C;  1P3L A;  4R8P C;  5F99 A;  2PYO D;  1TZY D;  4NFT A;  3MGQ A;  5B31 D;  3MGS A;  3AZI B;  4H9S A;  1WWI A;  3B0D B;  4WV4 B;  5BS7 C;  4WU8 B;  4J8U C;  5AY8 C;  3A6N C;  4KGC D;  4Z5T C;  5DNM C;  1P3F A;  4H9R B;  2CV5 A;  1P3I B;  5B1M B;  5AV8 B;  5BT1 C;  2ARO A;  3X1V B;  1KX3 C;  4X23 B;  3UT9 B;  3AZG C;  3AV1 D;  3LJA D;  3AZM B;  2F2A C;  3REK D;  1WWS A;  3AYW C;  5GXQ C;  2W8S A;  2HIO A;  1EQZ B;  1BH9 A;  3V9R A;  3B0C T;  4J8X C;  3KXB D;  3WTP A;  3C1B D;  4CAY B;  2XD5 A;  5JRG B;  3AZL A;  1P3K C;  3W99 D;  4KHA A;  5AV6 C;  3O62 B;  3W98 B;  4WZS B;  3X1U D;  2BYK B;  1P34 A;  2Y2M A;  2PYO C;  1TZY C;  3IP4 C;  5CPK B;  5B31 C;  2L5A A;  5GT0 B;  5B32 D;  1JFI B;  3UTB D;  4H9Q B;  4XZQ A;  4KGC C;  1H3O A;  2BYM A;  3R45 A;  4G92 C;  3AZI D;  3TU4 A;  4HGA C;  1M1A B;  5B2J B;  3REH B;  4WU8 D;  4E45 A; 
#chains in the Genus database with same CATH homology
 4AWL C;  4ZBJ B;  5AV9 B;  4J8W A;  3KUY A;  1P3I D;  5B2I A;  5B1M D;  5AV8 D;  1KX4 A;  3AV1 C;  1BH8 A;  3KWQ A;  3LJA C;  2LY8 A;  4LD9 C;  4WJ3 C;  3H0M C;  3REK C;  4YS3 B;  5GSU B;  5FUG A;  3WTP E;  5CP6 B;  4X23 D;  5AY8 B;  3MNN B;  3UT9 D;  3AV2 B;  4H9O B;  4WU9 A;  4ZUX A;  1P3G A;  5AVC A;  3AFA A;  1B67 A;  3AZM D;  1S32 B;  4Z2M H;  3KXB C;  3C1B C;  2ZY2 A;  2YFV B;  5B0Y B;  1F66 A;  3W99 C;  1P3P A;  3X1U C;  2IO5 C;  3C1C A;  2G5I C;  1EQZ D;  1KX3 B;  5KDM B;  2Y2Q A;  5B32 C;  4UUZ B;  5JRG D;  4G91 C;  3AZG B;  3O62 D;  3W98 D;  3UTB C;  3WAA A;  5B40 B;  3AZI C;  3MGP B;  3AYW B;  5GXQ B;  5GT0 D;  4QLC A;  3B0D C;  5B24 B;  4WU8 C;  3UTA B;  1P3B B;  4J8X B;  3B6F B;  2Y2I A;  1P3K B;  1P3I C;  5B1M C;  4YM6 A;  2J8P A;  5AV8 C;  3REI B;  5B2J D;  3REH D;  4WNN A;  5AV9 D;  1U35 A;  3WA9 A;  4X23 C;  3UT9 C;  1M19 A;  3AZE A;  4H9N A;  3WKJ C;  4KGC B;  2Y2G A;  1T3U A;  3LZ0 B;  3EPH A;  4YS3 D;  3LEL B;  5GSU D;  3VH5 W;  5CP6 D;  5B1L B;  5AY8 D;  3MNN D;  3REL A;  3AV2 D;  1EQZ C;  5B0Z B;  1S32 D;  1P3M A;  5DNN B;  1W2E A;  3AZK A;  5JRG C;  5B0Y D;  4LD9 B;  3AN2 A;  2F8N A;  3W98 C;  5CPI C;  2JE5 A;  1N1J A;  3AL0 C;  5GT0 C;  4JJN B;  3AZG D;  2DF4 C;  5B40 D;  3MGP D;  5B24 D;  5B2J C;  3REH C;  5E5A A;  3UTA D;  4H9S C;  3X1V A;  1P3B D;  3A1I A;  5AV9 C;  5B32 B;  4J8X D;  3W96 A;  4Z66 D;  3B6F D;  3AZM A;  3UTB B;  3B0B A;  3MGR B;  3REI D;  2Y2J A;  1KU5 A;  3MVD B;  3W97 D;  4YS3 C;  3AZH A;  3VH6 A;  5GSU C;  3X1T A;  1Q9C A;  4CSR B;  5CP6 C;  1P3A B;  3AZF B;  2Y2P A;  3MNN C;  3AV2 C;  1KX5 D;  1M18 B;  5JA4 A;  1S32 C;  3AZJ A;  3LZ0 D;  5G49 B;  3LEL D;  2BYK A;  5B0Y C;  5CPK A;  2XD1 A;  5B1L D;  5CPJ C;  1JFI A;  2NZD A;  1ID3 A;  3REJ A;  2FJ7 A;  5B0Z D;  1BFM A;  5AVB A;  5DNN D;  4H9Q A;  5GT3 A;  5AV5 A;  3LZ1 B;  3B6G B;  2NQB D;  3WKJ B;  4LD9 D;  2ZY5 A;  3NQJ A;  2G5H C;  2VQR A;  1M1A A;  1ZLA C;  3B0C W;  4J8V A;  2DQN C;  5B40 C;  1Z2C B;  3MGP C;  4XUJ B;  5B24 C;  4JJN D;  3UTA C;  4KUD A;  1P3B C;  4R8P A;  3B6F C;  4Z66 C;  5CPI B;  3REI C;  3F6T A;  5BS7 A;  4J8U A;  3W97 C;  3AZN B;  3A6N A;  5BNV B;  4Z5T A;  5DNM A;  5C3I C;  3MGR D;  1KX5 C;  3MVD D;  3LZ0 C;  2YFW A;  1P3L B;  3LEL C;  5B33 D;  5F99 B;  3MGQ B;  3MGS B;  1P3A D;  1KX3 A;  2BG1 A;  2Y2K A;  5B1L C;  3AZF D;  3P5J B;  1M18 D;  5B0Z C;  4H9P A;  1AOI D;  5DNN C;  2NQB C;  2CV5 B;  3X1S D;  3AYW A;  5GXQ A;  2UWX A;  2ARO B;  3LZ1 D;  4JJN C;  1P3K A;  3B6G D;  3WKJ D;  5AV6 A;  2PYO A;  1TZY A;  5B31 A;  1HQ3 C;  5CPJ B;  4XUJ D;  5BNX B;  4KGC A;  1A7W A;  2RVQ C;  5BO0 A;  1BH9 B;  3V9R B;  1TAF A;  5CPI D;  3AZL B;  1P3O D;  3MGR C;  1ZLA B;  4KHA B;  3MVD C;  4YM6 C;  3AZN D;  1P34 B;  5B33 C;  2RIQ A;  1P3A C;  3AZF C;  4Z66 B;  3AV1 A;  1M18 C;  3LJA A;  1AOI C;  1P3L D;  3REK A;  4XZQ B;  5F99 D;  1H3O B;  4Z2M G;  2BYM B;  3R45 B;  3MGQ D;  3MGS D;  3X1S C;  3W97 B;  3TU4 B;  5C3I B;  3KXB A;  4EO5 B;  3C1B A;  4J8W B;  3LZ1 C;  3B6G C;  1KX5 B;  1P3F D;  3NQU A;  2CV5 D;  3W99 A;  5B2I B;  3X1U A;  1KX4 B;  1BH8 B;  3KWQ B;  4XUJ C;  5B32 A;  5FUG B;  4DRB A;  2ARO D;  3VH6 T;  3UTB A;  2F8N K;  4WU9 B;  4ZUX B;  1P3G B;  5AVC B;  3AFA B;  2NQB B;  3AZI A;  3H0R C;  5CPJ D;  1P3O C;  3EPJ A;  4WU8 A;  1P3P B;  3AZN C;  2HIO D;  1ULY A;  5E5A C;  4H9R A;  1P3I A;  5B1M A;  5AV8 A;  3A1K A;  3AZL D;  1ZLA D;  1P3L C;  1PZR A;  3WAA B;  1HQ3 B;  2F8N G;  1P34 D;  5F99 C;  3MGQ C;  3MGS C;  4X23 A;  3UT9 A;  4QLC B;  3KFU G;  3KSY A;  4NE3 A;  4XZQ D;  1P3F C;  2CV5 C;  4YM6 B;  3TU4 D;  5B33 B;  1EQZ A;  1HTA A;  4WNN B;  1U35 B;  2Y2O A;  4J8W D;  2ARO C;  4CAY A;  5JRG A;  3KUY D;  3WA9 B;  3O62 A;  5B2I D;  1AOI B;  5GT3 C;  1M19 B;  3W98 A;  2ZM5 A;  4H9N B;  1KX4 D;  3KWQ D;  2Y2H A;  3X1S B;  2FFF B;  5GT0 A;  2HIO C;  4WU9 D;  4ZUX D;  1P3G D;  5AVC D;  2JCH A;  3AFA D;  1P3M B;  2ZY4 A;  3WTP C;  3AZK B;  3AZL C;  1F66 D;  4DRA A;  5B2J A;  3REH A;  3AN2 B;  2F8N B;  2Y2N A;  1P3P D;  5AV9 A;  1N1J B;  1P34 C;  3C1C D;  3VH5 A;  4YS3 A;  3WAA D;  1HQ3 D;  4XZQ C;  5GSU A;  1P3O B;  5CP6 A;  5AY8 A;  3MNN A;  3TU4 C;  3AV2 A;  4QLC D;  4H9O A;  5E5A B;  2RVQ D;  1S32 A;  4J8W C;  4EO5 C;  3W96 B;  5B0Y A;  2YFV A;  3KUY C;  5B2I C;  5CPJ A;  4YM6 D;  5BNX A;  1KX4 C;  3KWQ C;  3AZH B;  5KDM A;  1U35 D;  4UUZ A;  3X1T B;  3AZG A;  3WA9 D;  1M19 D;  1ZLA A;  3AZE D;  4WU9 C;  4ZUX C;  1P3G C;  5JA4 B;  5AVC C;  3AFA C;  1P3F B;  3AZJ B;  5B40 A;  3MGP A;  1F66 C;  5B24 A;  3UTA A;  1P3P C;  1P3B A;  3REL D;  4J8X A;  3C1C C;  4Z66 A;  3B6F A;  1ID3 B;  3REJ B;  2FJ7 B;  2NZD B;  5AVB B;  1P3M D;  5GT3 B;  5AV5 B;  3EPK A;  3AZK D;  3REI A;  3AN2 D;  3NQJ B;  2F8N D;  3W97 A;  2HUE C;  3WAA C;  4J8V B;  4QLC C;  1KX5 A;  2HIO B;  4KUD B;  3LZ0 A;  4R8P B;  3LEL A;  3WTP B;  5B1L A;  5CHL B;  5B31 G;  4DQY B;  4NE5 A;  5B0Z A;  5E5A D;  4J8U B;  3X1V D;  5DNN A;  1U35 C;  3A6N B;  3W96 D;  2NQB A;  4Z5T B;  5DNM B;  3H0L C;  4LD9 A;  3WA9 C;  1M19 C;  3AZE C;  4E44 A;  2YFW B;  3EPL A;  3AZH D;  4JJN A;  3X1T D;  3REL C;  3KUY B;  4H9P B;  3AZJ D;  1P3M C;  1HQ3 A;  3VH6 W;  3AZK C;  3AN2 C;  5CPK D;  2NZD D;  1ID3 D;  3REJ D;  2FJ7 D;  5AVB D;  5GT3 D;  5AV5 D;  3MGR A;  1R4V A;  5AV6 B;  3MVD A;  3FDD A;  1M1A D;  5B33 A;  1F66 B;  2PYO B;  1TZY B;  4CSR A;  5B31 B;  4J8V D;  1P3A A;  3AZF A;  3C1C B;  5B32 G;  1M18 A;  3X1V C;  4NE6 A;  1AOI A;  4KUD D;  1B6W A;  4R8P D;  1F1E A;  5G49 A;  3W96 C;  3WTP D;  2F8N H;  5BO0 B;  3AZM C;  3X1S A;  4G92 B;  1TAF B;  2HUE B;  4HGA B;  4AWL B;  4J8U D;  3AZH C;  3LZ1 A;  3A6N D;  2Y2L A;  3B6G A;  3X1T C;  4UPK A;  4Z5T D;  5DNM D;  3WKJ A;  3VH5 T;  5BT1 D;  3AV1 B;  3LJA B;  3EG5 B;  3O62 C;  3AZJ C;  3REK B;  4XUJ A;  5CPK C;  1KX3 D;  2NZD C;  1ID3 C;  3REJ C;  2FJ7 C;  5AVB C;  4M6B A;  3KXB B;  3C1B B;  5CPI A;  5AV5 C;  3AZE B;  1P3O A;  3W99 B;  3NQU B;  2CWE A;  3AYW D;  5GXQ D;  3X1U B;  2IO5 B;  3AZN A;  1M1A C;  5BNV A;  4J8V C;  4ZBJ C;  2ZY3 A;  3REL B;  1P3K D;  4G91 B;  5AV6 D;  2JSS A;  4KUD C;  1P3L A;  4R8P C;  5F99 A;  2PYO D;  1TZY D;  4NFT A;  3MGQ A;  5B31 D;  3MGS A;  3AZI B;  4H9S A;  1WWI A;  3B0D B;  4WV4 B;  5BS7 C;  4WU8 B;  4J8U C;  5AY8 C;  3A6N C;  4KGC D;  4Z5T C;  5DNM C;  1P3F A;  4H9R B;  2CV5 A;  1P3I B;  5B1M B;  5AV8 B;  5BT1 C;  2ARO A;  3X1V B;  1KX3 C;  4X23 B;  3UT9 B;  3AZG C;  3AV1 D;  3LJA D;  3AZM B;  2F2A C;  3REK D;  1WWS A;  3AYW C;  5GXQ C;  2W8S A;  2HIO A;  1EQZ B;  1BH9 A;  3V9R A;  3B0C T;  4J8X C;  3KXB D;  3WTP A;  3C1B D;  4CAY B;  2XD5 A;  5JRG B;  3AZL A;  1P3K C;  3W99 D;  4KHA A;  5AV6 C;  3O62 B;  3W98 B;  4WZS B;  3X1U D;  2BYK B;  1P34 A;  2Y2M A;  2PYO C;  1TZY C;  3IP4 C;  5CPK B;  5B31 C;  2L5A A;  5GT0 B;  5B32 D;  1JFI B;  3UTB D;  4H9Q B;  4XZQ A;  4KGC C;  1H3O A;  2BYM A;  3R45 A;  4G92 C;  3AZI D;  3TU4 A;  4HGA C;  1M1A B;  5B2J B;  3REH B;  4WU8 D;  4E45 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...