3AV2A

The human nucleosome structure containing the histone variant h3.3
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
b'PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
molecule tags Structural protein/dna
source organism Homo sapiens
publication title Structures of human nucleosomes containing major histone H3 variants
pubmed doi rcsb
total genus 32
structure length 97
sequence length 97
chains with identical sequence E
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00125 Histone Core histone H2A/H2B/H3/H4
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3av2A00
1BH8B 3AV2A 3REHB 2L5AA 5CPKA 2NQBB 5B40C 5GT3B 1P3LA 5F99C 4XZQB 3LZ0C 1F66A 3AN2A 4WZSB 5F99B 5BNVB 5B2ID 3AZJA 1P3BC 1P3OA 3UT9D 3AZMD 4LD9C 1KX5B 5B1LB 3X1VC 1P3AD 5B31D 3V9RA 3UTAD 5DNNC 4E45A 1P34B 3AZHD 3REIB 5B40A 3AZND 5B32B 5B33A 3X1UC 1TZYC 4XUJC 1P34C 1ZLAA 5B0YB 4Z66D 1M18A 2AROC 1KX3D 4WU8D 4LD9A 3AZFC 3AZJC 3W99C 5GSUA 1KU5A 1F1EA 4XZQC 3KXBD 1M19C 1KX4B 4H9QB 5BT1D 4YM6B 3MNND 4H9OA 2NZDD 3C1BC 1P3FB 1P3OD 2YFVB 3AFAA 3W98C 4KUDB 5B31B 3UTAB 4X23B 2PYOA 5DNMD 4NE5A 3MGSC 3AZHB 5CPKB 3MGRC 3RELB 1ID3B 4ZUXC 1EQZC 5GT3A 5B33D 2HUEB 5CPJD 2BYMB 2FJ7C 4WNNB 3MGPB 3VH5A 3MGSA 3WTPA 2AROA 3KWQC 1P3MD 3WA9B 5CPIA 5BO0A 4QLCD 4WU9D 1N1JA 3AZMC 3TU4D 4YM6A 4Z5TB 5B2JC 3REJC 1P3FA 3KXBA 5CPJB 3W97C 1P3FD 4R8PB 4DRBA 5BS7A 3AYWA 4X23C 3B6GD 5AV8B 3X1SC 5G49A 5FUGA 1ULYA 3MNNA 1P3OC 2NZDA 3A6ND 3VH6W 5GT0D 3W98D 1Q9CA 5GXQA 3UTBD 1ZLAB 5BS7C 4KHAA 3AN2C 3LJAC 4J8VC 3AZGD 4M6BA 1P3GA 3KXBC 4JJNA 4YM6C 1P3PB 4Z2MH 1N1JB 4J8VB 4Z5TA 4Z66C 4JJNC 5GT3C 1KX5D 1BH9A 5KDMB 3WAAB 2NQBC 3AZJB 3B0DB 1P34D 4Z5TD 4NFTA 4QLCC 5GXQC 3WA9D 4H9PB 5G49B 5AV9D 3LZ1A 1P3BA 1HQ3A 3B0DC 4J8XC 3REIC 4X23A 5GXQB 5B1LC 5AV6B 3W96C 3W98A 1HTAA 5AY8C 3LZ0A 1F66C 2LY8A 2YFWB 1U35C 4KGCD 2RVQC 3AZMA 4LD9B 5AY8A 3KUYA 1P3KB 3UTBA 4H9NA 5AV6D 3AZEA 1HQ3C 2IO5C 5DNMC 3AZFA 1KX5A 4XZQD 4WU9A 5B40B 2RVQD 5CPJC 1ZLAC 4KUDA 5B24A 5AV8A 3MVDB 3LJAD 3C1CB 5CP6B 4WU8A 3RELD 1P3LD 5AVCC 3MGPD 2HIOA 4G91C 5C3IB 3REID 4CAYB 5AV5C 3AZNB 3X1TC 3RELA 2F8ND 5B1MB 3KUYB 5B32G 3O62D 4X23D 1P3GB 5GSUB 3NQUB 3A6NC 3WTPB 1U35A 5AVCA 5AVBD 3WA9C 4ZUXB 3MGRB 3RELC 1B67A 3MVDC 3REKD 4YS3A 1EQZB 1P3AA 5AVCD 3MGPC 2F8NK 2FJ7B 3WKJC 3B6GB 3AZKA 3X1TB 2CWEA 4H9SC 1P3FC 5CP6C 1KX4D 3AZKC 3LELC 1P3BD 3KWQA 4H9RB 4UUZA 5B31C 5AV9A 3UTAC 3MGQC 2NQBA 3UTBC 3UT9C 4LD9D 5AV8D 4AWLB 1P3ID 3B0CW 5DNND 2IO5B 5JRGD 1F66B 3AFAD 5B0YD 2CV5C 1KX4C 4J8WC 1M1AB 5AV5A 1WWIA 4J8VA 1H3OB 4HGAC 5B1LD 1P3AB 5AVBA 5B2IA 5B32C 1B6WA 5B1LA 2YFVA 3W99D 4QLCB 3C1BA 3W96B 5GXQD 5B0YC 2CV5D 1AOIB 3AYWC 3AZJD 3MGSD 3W97A 5CP6A 5B0ZD 3VH6A 1M19D 3AV2D 1WWSA 5B0ZA 2CV5B 3AV1D 3MGPA 5GT0B 1P3KA 3WKJD 1TAFA 3REHC 3TU4A 3X1VD 3UTBB 1ZLAD 5CPID 1P3OB 4H9OB 3LZ1D 3B6FD 3X1TD 2PYOC 3MNNC 2NZDC 2HIOD 3REIA 3X1TA 3WKJB 4KGCA 4J8UD 1AOIA 3C1CD 3AZID 5AV6A 5AV8C 3REHA 3TU4C 3W97D 3KUYD 3AZHA 5B0ZB 4Z66A 1M18D 2CV5A 3AZGA 4J8WB 1M1AC 5CPKC 1ID3D 5B2JB 1TAFB 3REJB 3TU4B 3MGRD 5CP6D 4Z2MG 4ZUXD 5B24D 4AWLC 1EQZD 3MGQA 4WV4B 5C3IC 2FJ7D 5AVCB 1H3OA 1BH9B 5KDMA 4WU9B 3KUYC 3LELA 3AV1B 5B1MD 5JA4A 1TZYA 4XUJA 3WTPD 3LZ0D 5B24B 3B0BA 3W96A 3AFAC 1P3IC 4YM6D 5AY8D 3MNNB 2NZDB 2F8NH 5BT1C 2F8NA 5GT0C 4CAYA 3W98B 3AZLD 3REHD 4J8UB 4J8WA 4XZQA 3AZIA 1S32B 5AY8B 3WAAD 5F99A 3MGRA 1EQZA 3AZEB 4G92B 3VH6T 3AV1A 5JA4B 3AV2C 1S32D 3NQJB 3B0CT 1P3MB 1BFMA 4H9PA 5AV6C 4HGAB 1P3AC 3AN2D 1BH8A 3AV2B 4E44A 1HQ3D 4H9RA 5B0YA 1P3PC 4R8PD 3AZEC 3W96D 5CHLB 3AZLA 3LJAB 1P3PA 5B2IC 2HIOC 5BO0B 3UT9B 4J8UC 5B31G 3REKA 1KX4A 5B2IB 5F99D 3AZED 3KXBB 1P3GD 5B40D 4J8XD 1P34A 5JRGB 5BNXA 1P3IB 1M1AD 5FUGB 3LELD 2AROD 3W97B 4ZBJB 3MVDD 3X1SB 4WU8B 3AZIC 4Z5TC 2YFWA 3VH5T 3REKC 3O62B 4EO5B 3WAAC 4Z66B 2BYMA 4G91B 3AZNC 1TZYD 4XUJD 3MGSB 3AZHC 5AV5D 3O62C 3B6FA 3C1BD 3REKB 5B32D 5E5AB 3AZLC 4YS3D 5B31A 5B2JD 3REJD 3UTAA 3AZKB 5DNMB 1HQ3B 5JRGC 2PYOB 4R8PC 1R4VA 4NE3A 5B33C 3W99B 1P3KC 1ID3A 5AV9B 3AZKD 3KWQD 5B1MA 3AZMB 2AROB 4WU9C 3AYWD 3LJAA 3WA9A 3AZIB 1P3GC 4H9QA 4EO5C 3A6NA 5AV5B 4J8XB 3AZFB 3B6GA 3X1UB 3AYWB 3C1CC 5BNXB 1P3IA 1P3MC 1A7WA 2BYKA 2PYOD 5CPIC 2HIOB 3AZNA 3LZ1C 3LZ0B 1M19B 5GT3D 1KX5C 2NQBD 3AZGB 3AN2B 5CPIB 5BNVA 4KUDD 5E5AD 4ZUXA 3MGQB 4J8VD 3AZGC 5E5AA 4H9SA 3X1UA 3LELB 5GSUD 1P3MA 5JRGA 3VH5W 4CSRB 3AFAB 3LZ1B 5B32A 5CPKD 3X1UD 1JFIB 3WKJA 3B6GC 3X1SD 5DNNB 1F66D 1AOIC 3C1CA 1U35D 4KGCC 1KX3C 4KHAB 3KWQB 3X1SA 3W99A 4G92C 1M19A 3KSYA 4JJNB 5AV9C 1S32A 3WTPE 3NQUA 1M18C 1ID3C 1M1AA 3B6FB 1P3KD 1S32C 4YS3B 3MGQD 4JJND 5AVBB 5B24C 3V9RB 5CPJA 3R45A 4KUDC 4R8PA 3AV1C 5B33B 3X1VA 4YS3C 3MVDA 3C1BB 1KX3A 5DNNA 1P3PD 1M18B 2F8NG 2F8NB 2BYKB 4UUZB 3O62A 3B6FC 1P3LB 4WNNA 4J8UA 1AOID 5AVBC 2JSSA 5GT0A 5B2JA 5E5AC 3REJA 3AZLB 4WU8C 1U35B 4H9NB 5B1MC 2HUEC 3UT9A 1P3LC 3AZFD 3WAAA 3WTPC 5B0ZC 5GSUC 3A6NB 2FJ7A 4J8XA 3R45B 4J8WD 1TZYB 4XUJB 3NQJA 3X1VB 4CSRA 1JFIA 4QLCA 1KX3B 5DNMA 4KGCB 4NE6A 4ZBJC 4DRAA 1P3BB
chains in the Genus database with same CATH superfamily
1BH8B 3AV2A 3REHB 2L5AA 5CPKA 2NQBB 5B40C 5GT3B 1P3LA 5F99C 4XZQB 3LZ0C 1F66A 3AN2A 4WZSB 5F99B 5BNVB 5B2ID 3AZJA 2BG1A 1P3BC 1P3OA 3UT9D 3AZMD 4LD9C 1KX5B 5B1LB 3X1VC 1P3AD 5B31D 3V9RA 3UTAD 5DNNC 4E45A 1P34B 3AZHD 3REIB 5B40A 3A1KA 3AZND 5B32B 5B33A 3X1UC 1TZYC 4XUJC 1P34C 1ZLAA 5B0YB 4Z66D 1M18A 2AROC 1KX3D 4WU8D 4LD9A 3AZFC 3A1IA 3AZJC 3W99C 5GSUA 1KU5A 1F1EA 4XZQC 3KXBD 1M19C 1KX4B 4H9QB 5BT1D 4YM6B 3MNND 4H9OA 2NZDD 3C1BC 1P3FB 1P3OD 2YFVB 3AFAA 3W98C 4KUDB 5B31B 3UTAB 4X23B 2PYOA 5DNMD 4NE5A 3MGSC 3AZHB 5CPKB 3MGRC 3RELB 1ID3B 4ZUXC 1EQZC 5GT3A 2Y2HA 2HUEB 5CPJD 5B33D 2BYMB 2FJ7C 4WNNB 3MGPB 3VH5A 3MGSA 3WTPA 2AROA 3KWQC 1P3MD 3WA9B 5CPIA 5BO0A 4QLCD 4WU9D 1N1JA 3AZMC 3TU4D 4YM6A 4Z5TB 5B2JC 3REJC 1P3FA 2Y2LA 3KXBA 5CPJB 3W97C 1P3FD 4R8PB 4DRBA 5BS7A 3AYWA 4UPKA 4X23C 3B6GD 5AV8B 3X1SC 5G49A 5FUGA 1ULYA 3MNNA 1P3OC 2NZDA 3A6ND 3VH6W 5GT0D 3W98D 1Q9CA 5GXQA 3UTBD 1ZLAB 1W2EA 5BS7C 4KHAA 3AN2C 3LJAC 4J8VC 3AZGD 4M6BA 2F2AC 3KXBC 1P3GA 4JJNA 4YM6C 1P3PB 4Z2MH 1N1JB 2VQRA 4J8VB 4Z5TA 4Z66C 4JJNC 5GT3C 1KX5D 1BH9A 5KDMB 3WAAB 2NQBC 2ZY4A 3AZJB 3B0DB 1P34D 4Z5TD 4NFTA 4QLCC 5GXQC 3WA9D 4H9PB 5G49B 5AV9D 3LZ1A 1P3BA 1HQ3A 3B0DC 4J8XC 3REIC 4X23A 5GXQB 2Y2QA 5B1LC 5AV6B 1PZRA 3W96C 3W98A 1HTAA 5AY8C 3LZ0A 1F66C 2LY8A 2YFWB 1U35C 4KGCD 2RVQC 3AZMA 4LD9B 5AY8A 3KUYA 1P3KB 3UTBA 4H9NA 5AV6D 3AZEA 1HQ3C 2IO5C 5DNMC 3AZFA 1KX5A 4XZQD 4WU9A 5B40B 3IP4C 2RVQD 5CPJC 1ZLAC 4KUDA 5B24A 5AV8A 3MVDB 3LJAD 3C1CB 2JCHA 5CP6B 4WU8A 3RELD 1P3LD 5AVCC 3MGPD 2HIOA 4G91C 5C3IB 3REID 4CAYB 5AV5C 3AZNB 3X1TC 3RELA 2F8ND 2FFFB 5B1MB 3KUYB 2W8SA 5B32G 3O62D 4X23D 1P3GB 5GSUB 3NQUB 3A6NC 3WTPB 1U35A 5AVCA 4WJ3C 5AVBD 3WA9C 4ZUXB 3MGRB 3RELC 1B67A 3MVDC 3REKD 4YS3A 1EQZB 1P3AA 5AVCD 3MGPC 2F8NK 2FJ7B 3WKJC 3B6GB 2JE5A 3AZKA 3X1TB 2CWEA 4H9SC 1P3FC 2XD1A 5CP6C 2Y2NA 1KX4D 3AZKC 3LELC 1P3BD 3KWQA 4H9RB 4UUZA 5B31C 5AV9A 3UTAC 3MGQC 2NQBA 3UTBC 3UT9C 4LD9D 5AV8D 4AWLB 1P3ID 3B0CW 5DNND 2IO5B 5JRGD 1F66B 3AFAD 2DF4C 5B0YD 2CV5C 1KX4C 3KFUG 4J8WC 1M1AB 5AV5A 1WWIA 4J8VA 1H3OB 4DQYB 4HGAC 5B1LD 1P3AB 5AVBA 5B2IA 5B32C 1B6WA 5B1LA 2YFVA 3P5JB 3W99D 4QLCB 3EPKA 3C1BA 3W96B 5GXQD 5B0YC 2CV5D 1AOIB 3AYWC 3AZJD 3MGSD 3W97A 5CP6A 5B0ZD 3VH6A 1M19D 3AV2D 1WWSA 5B0ZA 2CV5B 3AV1D 3MGPA 5GT0B 2Y2GA 1P3KA 3WKJD 1TAFA 3REHC 3TU4A 3X1VD 3UTBB 1ZLAD 2G5HC 5CPID 1P3OB 2DQNC 4H9OB 3LZ1D 3B6FD 3X1TD 2PYOC 3MNNC 2Y2KA 2NZDC 2HIOD 3REIA 3X1TA 3WKJB 4KGCA 4J8UD 1AOIA 3C1CD 3EPHA 3AZID 5AV6A 5AV8C 3REHA 3TU4C 3W97D 3KUYD 3AZHA 5B0ZB 4Z66A 1M18D 2CV5A 3AZGA 4J8WB 3EPLA 1M1AC 5CPKC 1ID3D 5B2JB 1TAFB 3REJB 3TU4B 3MGRD 5CP6D 4Z2MG 4ZUXD 5B24D 4AWLC 1EQZD 3MGQA 4WV4B 5C3IC 2FJ7D 5AVCB 1H3OA 1BH9B 5KDMA 4WU9B 3KUYC 3LELA 3AV1B 5B1MD 5JA4A 1TZYA 4XUJA 3WTPD 3LZ0D 5B24B 3B0BA 3W96A 3AFAC 1P3IC 4YM6D 5AY8D 3MNNB 2NZDB 2F8NH 5BT1C 2F8NA 3F6TA 5GT0C 4CAYA 3W98B 1T3UA 3AZLD 3REHD 4J8UB 4J8WA 4XZQA 3H0MC 3AZIA 1S32B 5AY8B 3WAAD 5F99A 3MGRA 1EQZA 3AZEB 4G92B 3VH6T 3AV1A 5JA4B 2ZM5A 3AV2C 1S32D 3NQJB 3B0CT 1P3MB 1BFMA 4H9PA 5AV6C 4HGAB 1P3AC 3AN2D 1BH8A 3AV2B 4E44A 3H0RC 1HQ3D 4H9RA 5B0YA 1P3PC 4R8PD 3AZEC 3W96D 5CHLB 3AZLA 3LJAB 1P3PA 5B2IC 2HIOC 5BO0B 3UT9B 4J8UC 3FDDA 5B31G 3REKA 1KX4A 5B2IB 5F99D 2UWXA 3AZED 3KXBB 1P3GD 5B40D 4J8XD 2Y2PA 1P34A 5JRGB 5BNXA 1P3IB 1M1AD 5FUGB 3LELD 2AROD 3W97B 4ZBJB 3MVDD 3X1SB 4WU8B 3AZIC 4Z5TC 2YFWA 3VH5T 3REKC 3O62B 2J8PA 4EO5B 3WAAC 4Z66B 2BYMA 4G91B 3AZNC 1TZYD 4XUJD 3MGSB 3AZHC 5AV5D 3O62C 3B6FA 3C1BD 3REKB 5B32D 5E5AB 3AZLC 2XD5A 4YS3D 5B31A 5B2JD 3REJD 3UTAA 3AZKB 5DNMB 1HQ3B 5JRGC 2PYOB 4R8PC 1R4VA 4NE3A 5B33C 3W99B 1P3KC 1ID3A 5AV9B 3AZKD 2ZY2A 3KWQD 5B1MA 3AZMB 2AROB 4WU9C 3AYWD 3LJAA 3WA9A 3AZIB 1P3GC 4H9QA 4EO5C 3A6NA 5AV5B 4J8XB 3AZFB 3B6GA 3X1UB 3AYWB 3C1CC 5BNXB 1P3IA 1P3MC 2Y2IA 1A7WA 2BYKA 2PYOD 5CPIC 2HIOB 3AZNA 3LZ1C 3LZ0B 1M19B 5GT3D 1KX5C 2Y2OA 2NQBD 3AZGB 3AN2B 5CPIB 5BNVA 4KUDD 5E5AD 4ZUXA 3MGQB 4J8VD 3AZGC 5E5AA 4H9SA 3X1UA 3LELB 5GSUD 3EG5B 1P3MA 5JRGA 3VH5W 4CSRB 3AFAB 3LZ1B 1Z2CB 5B32A 3X1UD 5CPKD 1JFIB 3WKJA 2G5IC 3B6GC 2ZY5A 3X1SD 5DNNB 1F66D 1AOIC 3C1CA 1U35D 4KGCC 1KX3C 4KHAB 3H0LC 3X1SA 3KWQB 3W99A 4G92C 1M19A 3KSYA 4JJNB 5AV9C 1S32A 3EPJA 3WTPE 3NQUA 1M18C 1ID3C 1M1AA 3B6FB 1P3KD 2Y2MA 1S32C 4YS3B 3MGQD 4JJND 5AVBB 5B24C 3V9RB 5CPJA 3R45A 4KUDC 4R8PA 3AV1C 5B33B 3X1VA 4YS3C 3MVDA 3C1BB 1KX3A 5DNNA 1P3PD 1M18B 2F8NG 2F8NB 2BYKB 4UUZB 3O62A 3B6FC 1P3LB 4WNNA 4J8UA 1AOID 5AVBC 2JSSA 5GT0A 2RIQA 5B2JA 5E5AC 3REJA 3AZLB 4WU8C 1U35B 4H9NB 2ZY3A 5B1MC 2HUEC 3UT9A 1P3LC 3AZFD 2Y2JA 3WTPC 3WAAA 5B0ZC 5GSUC 3A6NB 2FJ7A 4J8XA 3R45B 4J8WD 3AL0C 1TZYB 4XUJB 3NQJA 3X1VB 4CSRA 1JFIA 4QLCA 1KX3B 5DNMA 4KGCB 4NE6A 4ZBJC 4DRAA 1P3BB
chains in the Genus database with same CATH topology
1BH8B 3AV2A 3REHB 2L5AA 5CPKA 2NQBB 5B40C 5GT3B 1P3LA 5F99C 4XZQB 3LZ0C 1F66A 3AN2A 4WZSB 5F99B 5BNVB 5B2ID 3AZJA 2BG1A 1P3BC 1P3OA 3UT9D 3AZMD 4LD9C 1KX5B 5B1LB 3X1VC 1P3AD 5B31D 3V9RA 3UTAD 5DNNC 4E45A 1P34B 3AZHD 3REIB 5B40A 3A1KA 3AZND 5B32B 5B33A 3X1UC 1TZYC 4XUJC 1P34C 1ZLAA 5B0YB 4Z66D 1M18A 2AROC 1KX3D 4WU8D 4LD9A 3AZFC 3A1IA 3AZJC 3W99C 5GSUA 1KU5A 1F1EA 4XZQC 3KXBD 1M19C 1KX4B 4H9QB 5BT1D 4YM6B 3MNND 4H9OA 2NZDD 3C1BC 1P3FB 1P3OD 2YFVB 3AFAA 3W98C 4KUDB 5B31B 3UTAB 4X23B 2PYOA 5DNMD 4NE5A 3MGSC 3AZHB 5CPKB 3MGRC 3RELB 1ID3B 4ZUXC 1EQZC 5GT3A 2Y2HA 2HUEB 5CPJD 5B33D 2BYMB 2FJ7C 4WNNB 3MGPB 3VH5A 3MGSA 3WTPA 2AROA 3KWQC 1P3MD 3WA9B 5CPIA 5BO0A 4QLCD 4WU9D 1N1JA 3AZMC 3TU4D 4YM6A 4Z5TB 5B2JC 3REJC 1P3FA 2Y2LA 3KXBA 5CPJB 3W97C 1P3FD 4R8PB 4DRBA 5BS7A 3AYWA 4UPKA 4X23C 3B6GD 5AV8B 3X1SC 5G49A 5FUGA 1ULYA 3MNNA 1P3OC 2NZDA 3A6ND 3VH6W 5GT0D 3W98D 1Q9CA 5GXQA 3UTBD 1ZLAB 1W2EA 5BS7C 4KHAA 3AN2C 3LJAC 4J8VC 3AZGD 4M6BA 2F2AC 3KXBC 1P3GA 4JJNA 4YM6C 1P3PB 4Z2MH 1N1JB 2VQRA 4J8VB 4Z5TA 4Z66C 4JJNC 5GT3C 1KX5D 1BH9A 5KDMB 3WAAB 2NQBC 2ZY4A 3AZJB 3B0DB 1P34D 4Z5TD 4NFTA 4QLCC 5GXQC 3WA9D 4H9PB 5G49B 5AV9D 3LZ1A 1P3BA 1HQ3A 3B0DC 4J8XC 3REIC 4X23A 5GXQB 2Y2QA 5B1LC 5AV6B 1PZRA 3W96C 3W98A 1HTAA 5AY8C 3LZ0A 1F66C 2LY8A 2YFWB 1U35C 4KGCD 2RVQC 3AZMA 4LD9B 5AY8A 3KUYA 1P3KB 3UTBA 4H9NA 5AV6D 3AZEA 1HQ3C 2IO5C 5DNMC 3AZFA 1KX5A 4XZQD 4WU9A 5B40B 3IP4C 2RVQD 5CPJC 1ZLAC 4KUDA 5B24A 5AV8A 3MVDB 3LJAD 3C1CB 2JCHA 5CP6B 4WU8A 3RELD 1P3LD 5AVCC 3MGPD 2HIOA 4G91C 5C3IB 3REID 4CAYB 5AV5C 3AZNB 3X1TC 3RELA 2F8ND 2FFFB 5B1MB 3KUYB 2W8SA 5B32G 3O62D 4X23D 1P3GB 5GSUB 3NQUB 3A6NC 3WTPB 1U35A 5AVCA 4WJ3C 5AVBD 3WA9C 4ZUXB 3MGRB 3RELC 1B67A 3MVDC 3REKD 4YS3A 1EQZB 1P3AA 5AVCD 3MGPC 2F8NK 2FJ7B 3WKJC 3B6GB 2JE5A 3AZKA 3X1TB 2CWEA 4H9SC 1P3FC 2XD1A 5CP6C 2Y2NA 1KX4D 3AZKC 3LELC 1P3BD 3KWQA 4H9RB 4UUZA 5B31C 5AV9A 3UTAC 3MGQC 2NQBA 3UTBC 3UT9C 4LD9D 5AV8D 4AWLB 1P3ID 3B0CW 5DNND 2IO5B 5JRGD 1F66B 3AFAD 2DF4C 5B0YD 2CV5C 1KX4C 3KFUG 4J8WC 1M1AB 5AV5A 1WWIA 4J8VA 1H3OB 4DQYB 4HGAC 5B1LD 1P3AB 5AVBA 5B2IA 5B32C 1B6WA 5B1LA 2YFVA 3P5JB 3W99D 4QLCB 3EPKA 3C1BA 3W96B 5GXQD 5B0YC 2CV5D 1AOIB 3AYWC 3AZJD 3MGSD 3W97A 5CP6A 5B0ZD 3VH6A 1M19D 3AV2D 1WWSA 5B0ZA 2CV5B 3AV1D 3MGPA 5GT0B 2Y2GA 1P3KA 3WKJD 1TAFA 3REHC 3TU4A 3X1VD 3UTBB 1ZLAD 2G5HC 5CPID 1P3OB 2DQNC 4H9OB 3LZ1D 3B6FD 3X1TD 2PYOC 3MNNC 2Y2KA 2NZDC 2HIOD 3REIA 3X1TA 3WKJB 4KGCA 4J8UD 1AOIA 3C1CD 3EPHA 3AZID 5AV6A 5AV8C 3REHA 3TU4C 3W97D 3KUYD 3AZHA 5B0ZB 4Z66A 1M18D 2CV5A 3AZGA 4J8WB 3EPLA 1M1AC 5CPKC 1ID3D 5B2JB 1TAFB 3REJB 3TU4B 3MGRD 5CP6D 4Z2MG 4ZUXD 5B24D 4AWLC 1EQZD 3MGQA 4WV4B 5C3IC 2FJ7D 5AVCB 1H3OA 1BH9B 5KDMA 4WU9B 3KUYC 3LELA 3AV1B 5B1MD 5JA4A 1TZYA 4XUJA 3WTPD 3LZ0D 5B24B 3B0BA 3W96A 3AFAC 1P3IC 4YM6D 5AY8D 3MNNB 2NZDB 2F8NH 5BT1C 2F8NA 3F6TA 5GT0C 4CAYA 3W98B 1T3UA 3AZLD 3REHD 4J8UB 4J8WA 4XZQA 3H0MC 3AZIA 1S32B 5AY8B 3WAAD 5F99A 3MGRA 1EQZA 3AZEB 4G92B 3VH6T 3AV1A 5JA4B 2ZM5A 3AV2C 1S32D 3NQJB 3B0CT 1P3MB 1BFMA 4H9PA 5AV6C 4HGAB 1P3AC 3AN2D 1BH8A 3AV2B 4E44A 3H0RC 1HQ3D 4H9RA 5B0YA 1P3PC 4R8PD 3AZEC 3W96D 5CHLB 3AZLA 3LJAB 1P3PA 5B2IC 2HIOC 5BO0B 3UT9B 4J8UC 3FDDA 5B31G 3REKA 1KX4A 5B2IB 5F99D 2UWXA 3AZED 3KXBB 1P3GD 5B40D 4J8XD 2Y2PA 1P34A 5JRGB 5BNXA 1P3IB 1M1AD 5FUGB 3LELD 2AROD 3W97B 4ZBJB 3MVDD 3X1SB 4WU8B 3AZIC 4Z5TC 2YFWA 3VH5T 3REKC 3O62B 2J8PA 4EO5B 3WAAC 4Z66B 2BYMA 4G91B 3AZNC 1TZYD 4XUJD 3MGSB 3AZHC 5AV5D 3O62C 3B6FA 3C1BD 3REKB 5B32D 5E5AB 3AZLC 2XD5A 4YS3D 5B31A 5B2JD 3REJD 3UTAA 3AZKB 5DNMB 1HQ3B 5JRGC 2PYOB 4R8PC 1R4VA 4NE3A 5B33C 3W99B 1P3KC 1ID3A 5AV9B 3AZKD 2ZY2A 3KWQD 5B1MA 3AZMB 2AROB 4WU9C 3AYWD 3LJAA 3WA9A 3AZIB 1P3GC 4H9QA 4EO5C 3A6NA 5AV5B 4J8XB 3AZFB 3B6GA 3X1UB 3AYWB 3C1CC 5BNXB 1P3IA 1P3MC 2Y2IA 1A7WA 2BYKA 2PYOD 5CPIC 2HIOB 3AZNA 3LZ1C 3LZ0B 1M19B 5GT3D 1KX5C 2Y2OA 2NQBD 3AZGB 3AN2B 5CPIB 5BNVA 4KUDD 5E5AD 4ZUXA 3MGQB 4J8VD 3AZGC 5E5AA 4H9SA 3X1UA 3LELB 5GSUD 3EG5B 1P3MA 5JRGA 3VH5W 4CSRB 3AFAB 3LZ1B 1Z2CB 5B32A 3X1UD 5CPKD 1JFIB 3WKJA 2G5IC 3B6GC 2ZY5A 3X1SD 5DNNB 1F66D 1AOIC 3C1CA 1U35D 4KGCC 1KX3C 4KHAB 3H0LC 3X1SA 3KWQB 3W99A 4G92C 1M19A 3KSYA 4JJNB 5AV9C 1S32A 3EPJA 3WTPE 3NQUA 1M18C 1ID3C 1M1AA 3B6FB 1P3KD 2Y2MA 1S32C 4YS3B 3MGQD 4JJND 5AVBB 5B24C 3V9RB 5CPJA 3R45A 4KUDC 4R8PA 3AV1C 5B33B 3X1VA 4YS3C 3MVDA 3C1BB 1KX3A 5DNNA 1P3PD 1M18B 2F8NG 2F8NB 2BYKB 4UUZB 3O62A 3B6FC 1P3LB 4WNNA 4J8UA 1AOID 5AVBC 2JSSA 5GT0A 2RIQA 5B2JA 5E5AC 3REJA 3AZLB 4WU8C 1U35B 4H9NB 2ZY3A 5B1MC 2HUEC 3UT9A 1P3LC 3AZFD 2Y2JA 3WTPC 3WAAA 5B0ZC 5GSUC 3A6NB 2FJ7A 4J8XA 3R45B 4J8WD 3AL0C 1TZYB 4XUJB 3NQJA 3X1VB 4CSRA 1JFIA 4QLCA 1KX3B 5DNMA 4KGCB 4NE6A 4ZBJC 4DRAA 1P3BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BH8 B;  3AV2 A;  3REH B;  2L5A A;  5CPK A;  2NQB B;  5B40 C;  5GT3 B;  1P3L A;  5F99 C;  4XZQ B;  3LZ0 C;  1F66 A;  3AN2 A;  4WZS B;  5F99 B;  5BNV B;  5B2I D;  3AZJ A;  1P3B C;  1P3O A;  3UT9 D;  3AZM D;  4LD9 C;  1KX5 B;  5B1L B;  3X1V C;  1P3A D;  5B31 D;  3V9R A;  3UTA D;  5DNN C;  4E45 A;  1P34 B;  3AZH D;  3REI B;  5B40 A;  3AZN D;  5B32 B;  5B33 A;  3X1U C;  1TZY C;  4XUJ C;  1P34 C;  1ZLA A;  5B0Y B;  4Z66 D;  1M18 A;  2ARO C;  1KX3 D;  4WU8 D;  4LD9 A;  3AZF C;  3AZJ C;  3W99 C;  5GSU A;  1KU5 A;  1F1E A;  4XZQ C;  3KXB D;  1M19 C;  1KX4 B;  4H9Q B;  5BT1 D;  4YM6 B;  3MNN D;  4H9O A;  2NZD D;  3C1B C;  1P3F B;  1P3O D;  2YFV B;  3AFA A;  3W98 C;  4KUD B;  5B31 B;  3UTA B;  4X23 B;  2PYO A;  5DNM D;  4NE5 A;  3MGS C;  3AZH B;  5CPK B;  3MGR C;  3REL B;  1ID3 B;  4ZUX C;  1EQZ C;  5GT3 A;  5B33 D;  2HUE B;  5CPJ D;  2BYM B;  2FJ7 C;  4WNN B;  3MGP B;  3VH5 A;  3MGS A;  3WTP A;  2ARO A;  3KWQ C;  1P3M D;  3WA9 B;  5CPI A;  5BO0 A;  4QLC D;  4WU9 D;  1N1J A;  3AZM C;  3TU4 D;  4YM6 A;  4Z5T B;  5B2J C;  3REJ C;  1P3F A;  3KXB A;  5CPJ B;  3W97 C;  1P3F D;  4R8P B;  4DRB A;  5BS7 A;  3AYW A;  4X23 C;  3B6G D;  5AV8 B;  3X1S C;  5G49 A;  5FUG A;  1ULY A;  3MNN A;  1P3O C;  2NZD A;  3A6N D;  3VH6 W;  5GT0 D;  3W98 D;  1Q9C A;  5GXQ A;  3UTB D;  1ZLA B;  5BS7 C;  4KHA A;  3AN2 C;  3LJA C;  4J8V C;  3AZG D;  4M6B A;  1P3G A;  3KXB C;  4JJN A;  4YM6 C;  1P3P B;  4Z2M H;  1N1J B;  4J8V B;  4Z5T A;  4Z66 C;  4JJN C;  5GT3 C;  1KX5 D;  1BH9 A;  5KDM B;  3WAA B;  2NQB C;  3AZJ B;  3B0D B;  1P34 D;  4Z5T D;  4NFT A;  4QLC C;  5GXQ C;  3WA9 D;  4H9P B;  5G49 B;  5AV9 D;  3LZ1 A;  1P3B A;  1HQ3 A;  3B0D C;  4J8X C;  3REI C;  4X23 A;  5GXQ B;  5B1L C;  5AV6 B;  3W96 C;  3W98 A;  1HTA A;  5AY8 C;  3LZ0 A;  1F66 C;  2LY8 A;  2YFW B;  1U35 C;  4KGC D;  2RVQ C;  3AZM A;  4LD9 B;  5AY8 A;  3KUY A;  1P3K B;  3UTB A;  4H9N A;  5AV6 D;  3AZE A;  1HQ3 C;  2IO5 C;  5DNM C;  3AZF A;  1KX5 A;  4XZQ D;  4WU9 A;  5B40 B;  2RVQ D;  5CPJ C;  1ZLA C;  4KUD A;  5B24 A;  5AV8 A;  3MVD B;  3LJA D;  3C1C B;  5CP6 B;  4WU8 A;  3REL D;  1P3L D;  5AVC C;  3MGP D;  2HIO A;  4G91 C;  5C3I B;  3REI D;  4CAY B;  5AV5 C;  3AZN B;  3X1T C;  3REL A;  2F8N D;  5B1M B;  3KUY B;  5B32 G;  3O62 D;  4X23 D;  1P3G B;  5GSU B;  3NQU B;  3A6N C;  3WTP B;  1U35 A;  5AVC A;  5AVB D;  3WA9 C;  4ZUX B;  3MGR B;  3REL C;  1B67 A;  3MVD C;  3REK D;  4YS3 A;  1EQZ B;  1P3A A;  5AVC D;  3MGP C;  2F8N K;  2FJ7 B;  3WKJ C;  3B6G B;  3AZK A;  3X1T B;  2CWE A;  4H9S C;  1P3F C;  5CP6 C;  1KX4 D;  3AZK C;  3LEL C;  1P3B D;  3KWQ A;  4H9R B;  4UUZ A;  5B31 C;  5AV9 A;  3UTA C;  3MGQ C;  2NQB A;  3UTB C;  3UT9 C;  4LD9 D;  5AV8 D;  4AWL B;  1P3I D;  3B0C W;  5DNN D;  2IO5 B;  5JRG D;  1F66 B;  3AFA D;  5B0Y D;  2CV5 C;  1KX4 C;  4J8W C;  1M1A B;  5AV5 A;  1WWI A;  4J8V A;  1H3O B;  4HGA C;  5B1L D;  1P3A B;  5AVB A;  5B2I A;  5B32 C;  1B6W A;  5B1L A;  2YFV A;  3W99 D;  4QLC B;  3C1B A;  3W96 B;  5GXQ D;  5B0Y C;  2CV5 D;  1AOI B;  3AYW C;  3AZJ D;  3MGS D;  3W97 A;  5CP6 A;  5B0Z D;  3VH6 A;  1M19 D;  3AV2 D;  1WWS A;  5B0Z A;  2CV5 B;  3AV1 D;  3MGP A;  5GT0 B;  1P3K A;  3WKJ D;  1TAF A;  3REH C;  3TU4 A;  3X1V D;  3UTB B;  1ZLA D;  5CPI D;  1P3O B;  4H9O B;  3LZ1 D;  3B6F D;  3X1T D;  2PYO C;  3MNN C;  2NZD C;  2HIO D;  3REI A;  3X1T A;  3WKJ B;  4KGC A;  4J8U D;  1AOI A;  3C1C D;  3AZI D;  5AV6 A;  5AV8 C;  3REH A;  3TU4 C;  3W97 D;  3KUY D;  3AZH A;  5B0Z B;  4Z66 A;  1M18 D;  2CV5 A;  3AZG A;  4J8W B;  1M1A C;  5CPK C;  1ID3 D;  5B2J B;  1TAF B;  3REJ B;  3TU4 B;  3MGR D;  5CP6 D;  4Z2M G;  4ZUX D;  5B24 D;  4AWL C;  1EQZ D;  3MGQ A;  4WV4 B;  5C3I C;  2FJ7 D;  5AVC B;  1H3O A;  1BH9 B;  5KDM A;  4WU9 B;  3KUY C;  3LEL A;  3AV1 B;  5B1M D;  5JA4 A;  1TZY A;  4XUJ A;  3WTP D;  3LZ0 D;  5B24 B;  3B0B A;  3W96 A;  3AFA C;  1P3I C;  4YM6 D;  5AY8 D;  3MNN B;  2NZD B;  2F8N H;  5BT1 C;  2F8N A;  5GT0 C;  4CAY A;  3W98 B;  3AZL D;  3REH D;  4J8U B;  4J8W A;  4XZQ A;  3AZI A;  1S32 B;  5AY8 B;  3WAA D;  5F99 A;  3MGR A;  1EQZ A;  3AZE B;  4G92 B;  3VH6 T;  3AV1 A;  5JA4 B;  3AV2 C;  1S32 D;  3NQJ B;  3B0C T;  1P3M B;  1BFM A;  4H9P A;  5AV6 C;  4HGA B;  1P3A C;  3AN2 D;  1BH8 A;  3AV2 B;  4E44 A;  1HQ3 D;  4H9R A;  5B0Y A;  1P3P C;  4R8P D;  3AZE C;  3W96 D;  5CHL B;  3AZL A;  3LJA B;  1P3P A;  5B2I C;  2HIO C;  5BO0 B;  3UT9 B;  4J8U C;  5B31 G;  3REK A;  1KX4 A;  5B2I B;  5F99 D;  3AZE D;  3KXB B;  1P3G D;  5B40 D;  4J8X D;  1P34 A;  5JRG B;  5BNX A;  1P3I B;  1M1A D;  5FUG B;  3LEL D;  2ARO D;  3W97 B;  4ZBJ B;  3MVD D;  3X1S B;  4WU8 B;  3AZI C;  4Z5T C;  2YFW A;  3VH5 T;  3REK C;  3O62 B;  4EO5 B;  3WAA C;  4Z66 B;  2BYM A;  4G91 B;  3AZN C;  1TZY D;  4XUJ D;  3MGS B;  3AZH C;  5AV5 D;  3O62 C;  3B6F A;  3C1B D;  3REK B;  5B32 D;  5E5A B;  3AZL C;  4YS3 D;  5B31 A;  5B2J D;  3REJ D;  3UTA A;  3AZK B;  5DNM B;  1HQ3 B;  5JRG C;  2PYO B;  4R8P C;  1R4V A;  4NE3 A;  5B33 C;  3W99 B;  1P3K C;  1ID3 A;  5AV9 B;  3AZK D;  3KWQ D;  5B1M A;  3AZM B;  2ARO B;  4WU9 C;  3AYW D;  3LJA A;  3WA9 A;  3AZI B;  1P3G C;  4H9Q A;  4EO5 C;  3A6N A;  5AV5 B;  4J8X B;  3AZF B;  3B6G A;  3X1U B;  3AYW B;  3C1C C;  5BNX B;  1P3I A;  1P3M C;  1A7W A;  2BYK A;  2PYO D;  5CPI C;  2HIO B;  3AZN A;  3LZ1 C;  3LZ0 B;  1M19 B;  5GT3 D;  1KX5 C;  2NQB D;  3AZG B;  3AN2 B;  5CPI B;  5BNV A;  4KUD D;  5E5A D;  4ZUX A;  3MGQ B;  4J8V D;  3AZG C;  5E5A A;  4H9S A;  3X1U A;  3LEL B;  5GSU D;  1P3M A;  5JRG A;  3VH5 W;  4CSR B;  3AFA B;  3LZ1 B;  5B32 A;  5CPK D;  3X1U D;  1JFI B;  3WKJ A;  3B6G C;  3X1S D;  5DNN B;  1F66 D;  1AOI C;  3C1C A;  1U35 D;  4KGC C;  1KX3 C;  4KHA B;  3KWQ B;  3X1S A;  3W99 A;  4G92 C;  1M19 A;  3KSY A;  4JJN B;  5AV9 C;  1S32 A;  3WTP E;  3NQU A;  1M18 C;  1ID3 C;  1M1A A;  3B6F B;  1P3K D;  1S32 C;  4YS3 B;  3MGQ D;  4JJN D;  5AVB B;  5B24 C;  3V9R B;  5CPJ A;  3R45 A;  4KUD C;  4R8P A;  3AV1 C;  5B33 B;  3X1V A;  4YS3 C;  3MVD A;  3C1B B;  1KX3 A;  5DNN A;  1P3P D;  1M18 B;  2F8N G;  2F8N B;  2BYK B;  4UUZ B;  3O62 A;  3B6F C;  1P3L B;  4WNN A;  4J8U A;  1AOI D;  5AVB C;  2JSS A;  5GT0 A;  5B2J A;  5E5A C;  3REJ A;  3AZL B;  4WU8 C;  1U35 B;  4H9N B;  5B1M C;  2HUE C;  3UT9 A;  1P3L C;  3AZF D;  3WAA A;  3WTP C;  5B0Z C;  5GSU C;  3A6N B;  2FJ7 A;  4J8X A;  3R45 B;  4J8W D;  1TZY B;  4XUJ B;  3NQJ A;  3X1V B;  4CSR A;  1JFI A;  4QLC A;  1KX3 B;  5DNM A;  4KGC B;  4NE6 A;  4ZBJ C;  4DRA A;  1P3B B; 
#chains in the Genus database with same CATH topology
 1BH8 B;  3AV2 A;  3REH B;  2L5A A;  5CPK A;  2NQB B;  5B40 C;  5GT3 B;  1P3L A;  5F99 C;  4XZQ B;  3LZ0 C;  1F66 A;  3AN2 A;  4WZS B;  5F99 B;  5BNV B;  5B2I D;  3AZJ A;  2BG1 A;  1P3B C;  1P3O A;  3UT9 D;  3AZM D;  4LD9 C;  1KX5 B;  5B1L B;  3X1V C;  1P3A D;  5B31 D;  3V9R A;  3UTA D;  5DNN C;  4E45 A;  1P34 B;  3AZH D;  3REI B;  5B40 A;  3A1K A;  3AZN D;  5B32 B;  5B33 A;  3X1U C;  1TZY C;  4XUJ C;  1P34 C;  1ZLA A;  5B0Y B;  4Z66 D;  1M18 A;  2ARO C;  1KX3 D;  4WU8 D;  4LD9 A;  3AZF C;  3A1I A;  3AZJ C;  3W99 C;  5GSU A;  1KU5 A;  1F1E A;  4XZQ C;  3KXB D;  1M19 C;  1KX4 B;  4H9Q B;  5BT1 D;  4YM6 B;  3MNN D;  4H9O A;  2NZD D;  3C1B C;  1P3F B;  1P3O D;  2YFV B;  3AFA A;  3W98 C;  4KUD B;  5B31 B;  3UTA B;  4X23 B;  2PYO A;  5DNM D;  4NE5 A;  3MGS C;  3AZH B;  5CPK B;  3MGR C;  3REL B;  1ID3 B;  4ZUX C;  1EQZ C;  5GT3 A;  2Y2H A;  2HUE B;  5CPJ D;  5B33 D;  2BYM B;  2FJ7 C;  4WNN B;  3MGP B;  3VH5 A;  3MGS A;  3WTP A;  2ARO A;  3KWQ C;  1P3M D;  3WA9 B;  5CPI A;  5BO0 A;  4QLC D;  4WU9 D;  1N1J A;  3AZM C;  3TU4 D;  4YM6 A;  4Z5T B;  5B2J C;  3REJ C;  1P3F A;  2Y2L A;  3KXB A;  5CPJ B;  3W97 C;  1P3F D;  4R8P B;  4DRB A;  5BS7 A;  3AYW A;  4UPK A;  4X23 C;  3B6G D;  5AV8 B;  3X1S C;  5G49 A;  5FUG A;  1ULY A;  3MNN A;  1P3O C;  2NZD A;  3A6N D;  3VH6 W;  5GT0 D;  3W98 D;  1Q9C A;  5GXQ A;  3UTB D;  1ZLA B;  1W2E A;  5BS7 C;  4KHA A;  3AN2 C;  3LJA C;  4J8V C;  3AZG D;  4M6B A;  2F2A C;  3KXB C;  1P3G A;  4JJN A;  4YM6 C;  1P3P B;  4Z2M H;  1N1J B;  2VQR A;  4J8V B;  4Z5T A;  4Z66 C;  4JJN C;  5GT3 C;  1KX5 D;  1BH9 A;  5KDM B;  3WAA B;  2NQB C;  2ZY4 A;  3AZJ B;  3B0D B;  1P34 D;  4Z5T D;  4NFT A;  4QLC C;  5GXQ C;  3WA9 D;  4H9P B;  5G49 B;  5AV9 D;  3LZ1 A;  1P3B A;  1HQ3 A;  3B0D C;  4J8X C;  3REI C;  4X23 A;  5GXQ B;  2Y2Q A;  5B1L C;  5AV6 B;  1PZR A;  3W96 C;  3W98 A;  1HTA A;  5AY8 C;  3LZ0 A;  1F66 C;  2LY8 A;  2YFW B;  1U35 C;  4KGC D;  2RVQ C;  3AZM A;  4LD9 B;  5AY8 A;  3KUY A;  1P3K B;  3UTB A;  4H9N A;  5AV6 D;  3AZE A;  1HQ3 C;  2IO5 C;  5DNM C;  3AZF A;  1KX5 A;  4XZQ D;  4WU9 A;  5B40 B;  3IP4 C;  2RVQ D;  5CPJ C;  1ZLA C;  4KUD A;  5B24 A;  5AV8 A;  3MVD B;  3LJA D;  3C1C B;  2JCH A;  5CP6 B;  4WU8 A;  3REL D;  1P3L D;  5AVC C;  3MGP D;  2HIO A;  4G91 C;  5C3I B;  3REI D;  4CAY B;  5AV5 C;  3AZN B;  3X1T C;  3REL A;  2F8N D;  2FFF B;  5B1M B;  3KUY B;  2W8S A;  5B32 G;  3O62 D;  4X23 D;  1P3G B;  5GSU B;  3NQU B;  3A6N C;  3WTP B;  1U35 A;  5AVC A;  4WJ3 C;  5AVB D;  3WA9 C;  4ZUX B;  3MGR B;  3REL C;  1B67 A;  3MVD C;  3REK D;  4YS3 A;  1EQZ B;  1P3A A;  5AVC D;  3MGP C;  2F8N K;  2FJ7 B;  3WKJ C;  3B6G B;  2JE5 A;  3AZK A;  3X1T B;  2CWE A;  4H9S C;  1P3F C;  2XD1 A;  5CP6 C;  2Y2N A;  1KX4 D;  3AZK C;  3LEL C;  1P3B D;  3KWQ A;  4H9R B;  4UUZ A;  5B31 C;  5AV9 A;  3UTA C;  3MGQ C;  2NQB A;  3UTB C;  3UT9 C;  4LD9 D;  5AV8 D;  4AWL B;  1P3I D;  3B0C W;  5DNN D;  2IO5 B;  5JRG D;  1F66 B;  3AFA D;  2DF4 C;  5B0Y D;  2CV5 C;  1KX4 C;  3KFU G;  4J8W C;  1M1A B;  5AV5 A;  1WWI A;  4J8V A;  1H3O B;  4DQY B;  4HGA C;  5B1L D;  1P3A B;  5AVB A;  5B2I A;  5B32 C;  1B6W A;  5B1L A;  2YFV A;  3P5J B;  3W99 D;  4QLC B;  3EPK A;  3C1B A;  3W96 B;  5GXQ D;  5B0Y C;  2CV5 D;  1AOI B;  3AYW C;  3AZJ D;  3MGS D;  3W97 A;  5CP6 A;  5B0Z D;  3VH6 A;  1M19 D;  3AV2 D;  1WWS A;  5B0Z A;  2CV5 B;  3AV1 D;  3MGP A;  5GT0 B;  2Y2G A;  1P3K A;  3WKJ D;  1TAF A;  3REH C;  3TU4 A;  3X1V D;  3UTB B;  1ZLA D;  2G5H C;  5CPI D;  1P3O B;  2DQN C;  4H9O B;  3LZ1 D;  3B6F D;  3X1T D;  2PYO C;  3MNN C;  2Y2K A;  2NZD C;  2HIO D;  3REI A;  3X1T A;  3WKJ B;  4KGC A;  4J8U D;  1AOI A;  3C1C D;  3EPH A;  3AZI D;  5AV6 A;  5AV8 C;  3REH A;  3TU4 C;  3W97 D;  3KUY D;  3AZH A;  5B0Z B;  4Z66 A;  1M18 D;  2CV5 A;  3AZG A;  4J8W B;  3EPL A;  1M1A C;  5CPK C;  1ID3 D;  5B2J B;  1TAF B;  3REJ B;  3TU4 B;  3MGR D;  5CP6 D;  4Z2M G;  4ZUX D;  5B24 D;  4AWL C;  1EQZ D;  3MGQ A;  4WV4 B;  5C3I C;  2FJ7 D;  5AVC B;  1H3O A;  1BH9 B;  5KDM A;  4WU9 B;  3KUY C;  3LEL A;  3AV1 B;  5B1M D;  5JA4 A;  1TZY A;  4XUJ A;  3WTP D;  3LZ0 D;  5B24 B;  3B0B A;  3W96 A;  3AFA C;  1P3I C;  4YM6 D;  5AY8 D;  3MNN B;  2NZD B;  2F8N H;  5BT1 C;  2F8N A;  3F6T A;  5GT0 C;  4CAY A;  3W98 B;  1T3U A;  3AZL D;  3REH D;  4J8U B;  4J8W A;  4XZQ A;  3H0M C;  3AZI A;  1S32 B;  5AY8 B;  3WAA D;  5F99 A;  3MGR A;  1EQZ A;  3AZE B;  4G92 B;  3VH6 T;  3AV1 A;  5JA4 B;  2ZM5 A;  3AV2 C;  1S32 D;  3NQJ B;  3B0C T;  1P3M B;  1BFM A;  4H9P A;  5AV6 C;  4HGA B;  1P3A C;  3AN2 D;  1BH8 A;  3AV2 B;  4E44 A;  3H0R C;  1HQ3 D;  4H9R A;  5B0Y A;  1P3P C;  4R8P D;  3AZE C;  3W96 D;  5CHL B;  3AZL A;  3LJA B;  1P3P A;  5B2I C;  2HIO C;  5BO0 B;  3UT9 B;  4J8U C;  3FDD A;  5B31 G;  3REK A;  1KX4 A;  5B2I B;  5F99 D;  2UWX A;  3AZE D;  3KXB B;  1P3G D;  5B40 D;  4J8X D;  2Y2P A;  1P34 A;  5JRG B;  5BNX A;  1P3I B;  1M1A D;  5FUG B;  3LEL D;  2ARO D;  3W97 B;  4ZBJ B;  3MVD D;  3X1S B;  4WU8 B;  3AZI C;  4Z5T C;  2YFW A;  3VH5 T;  3REK C;  3O62 B;  2J8P A;  4EO5 B;  3WAA C;  4Z66 B;  2BYM A;  4G91 B;  3AZN C;  1TZY D;  4XUJ D;  3MGS B;  3AZH C;  5AV5 D;  3O62 C;  3B6F A;  3C1B D;  3REK B;  5B32 D;  5E5A B;  3AZL C;  2XD5 A;  4YS3 D;  5B31 A;  5B2J D;  3REJ D;  3UTA A;  3AZK B;  5DNM B;  1HQ3 B;  5JRG C;  2PYO B;  4R8P C;  1R4V A;  4NE3 A;  5B33 C;  3W99 B;  1P3K C;  1ID3 A;  5AV9 B;  3AZK D;  2ZY2 A;  3KWQ D;  5B1M A;  3AZM B;  2ARO B;  4WU9 C;  3AYW D;  3LJA A;  3WA9 A;  3AZI B;  1P3G C;  4H9Q A;  4EO5 C;  3A6N A;  5AV5 B;  4J8X B;  3AZF B;  3B6G A;  3X1U B;  3AYW B;  3C1C C;  5BNX B;  1P3I A;  1P3M C;  2Y2I A;  1A7W A;  2BYK A;  2PYO D;  5CPI C;  2HIO B;  3AZN A;  3LZ1 C;  3LZ0 B;  1M19 B;  5GT3 D;  1KX5 C;  2Y2O A;  2NQB D;  3AZG B;  3AN2 B;  5CPI B;  5BNV A;  4KUD D;  5E5A D;  4ZUX A;  3MGQ B;  4J8V D;  3AZG C;  5E5A A;  4H9S A;  3X1U A;  3LEL B;  5GSU D;  3EG5 B;  1P3M A;  5JRG A;  3VH5 W;  4CSR B;  3AFA B;  3LZ1 B;  1Z2C B;  5B32 A;  3X1U D;  5CPK D;  1JFI B;  3WKJ A;  2G5I C;  3B6G C;  2ZY5 A;  3X1S D;  5DNN B;  1F66 D;  1AOI C;  3C1C A;  1U35 D;  4KGC C;  1KX3 C;  4KHA B;  3H0L C;  3X1S A;  3KWQ B;  3W99 A;  4G92 C;  1M19 A;  3KSY A;  4JJN B;  5AV9 C;  1S32 A;  3EPJ A;  3WTP E;  3NQU A;  1M18 C;  1ID3 C;  1M1A A;  3B6F B;  1P3K D;  2Y2M A;  1S32 C;  4YS3 B;  3MGQ D;  4JJN D;  5AVB B;  5B24 C;  3V9R B;  5CPJ A;  3R45 A;  4KUD C;  4R8P A;  3AV1 C;  5B33 B;  3X1V A;  4YS3 C;  3MVD A;  3C1B B;  1KX3 A;  5DNN A;  1P3P D;  1M18 B;  2F8N G;  2F8N B;  2BYK B;  4UUZ B;  3O62 A;  3B6F C;  1P3L B;  4WNN A;  4J8U A;  1AOI D;  5AVB C;  2JSS A;  5GT0 A;  2RIQ A;  5B2J A;  5E5A C;  3REJ A;  3AZL B;  4WU8 C;  1U35 B;  4H9N B;  2ZY3 A;  5B1M C;  2HUE C;  3UT9 A;  1P3L C;  3AZF D;  2Y2J A;  3WTP C;  3WAA A;  5B0Z C;  5GSU C;  3A6N B;  2FJ7 A;  4J8X A;  3R45 B;  4J8W D;  3AL0 C;  1TZY B;  4XUJ B;  3NQJ A;  3X1V B;  4CSR A;  1JFI A;  4QLC A;  1KX3 B;  5DNM A;  4KGC B;  4NE6 A;  4ZBJ C;  4DRA A;  1P3B B; 
#chains in the Genus database with same CATH homology
 1BH8 B;  3AV2 A;  3REH B;  2L5A A;  5CPK A;  2NQB B;  5B40 C;  5GT3 B;  1P3L A;  5F99 C;  4XZQ B;  3LZ0 C;  1F66 A;  3AN2 A;  4WZS B;  5F99 B;  5BNV B;  5B2I D;  3AZJ A;  2BG1 A;  1P3B C;  1P3O A;  3UT9 D;  3AZM D;  4LD9 C;  1KX5 B;  5B1L B;  3X1V C;  1P3A D;  5B31 D;  3V9R A;  3UTA D;  5DNN C;  4E45 A;  1P34 B;  3AZH D;  3REI B;  5B40 A;  3A1K A;  3AZN D;  5B32 B;  5B33 A;  3X1U C;  1TZY C;  4XUJ C;  1P34 C;  1ZLA A;  5B0Y B;  4Z66 D;  1M18 A;  2ARO C;  1KX3 D;  4WU8 D;  4LD9 A;  3AZF C;  3A1I A;  3AZJ C;  3W99 C;  5GSU A;  1KU5 A;  1F1E A;  4XZQ C;  3KXB D;  1M19 C;  1KX4 B;  4H9Q B;  5BT1 D;  4YM6 B;  3MNN D;  4H9O A;  2NZD D;  3C1B C;  1P3F B;  1P3O D;  2YFV B;  3AFA A;  3W98 C;  4KUD B;  5B31 B;  3UTA B;  4X23 B;  2PYO A;  5DNM D;  4NE5 A;  3MGS C;  3AZH B;  5CPK B;  3MGR C;  3REL B;  1ID3 B;  4ZUX C;  1EQZ C;  5GT3 A;  2Y2H A;  2HUE B;  5CPJ D;  5B33 D;  2BYM B;  2FJ7 C;  4WNN B;  3MGP B;  3VH5 A;  3MGS A;  3WTP A;  2ARO A;  3KWQ C;  1P3M D;  3WA9 B;  5CPI A;  5BO0 A;  4QLC D;  4WU9 D;  1N1J A;  3AZM C;  3TU4 D;  4YM6 A;  4Z5T B;  5B2J C;  3REJ C;  1P3F A;  2Y2L A;  3KXB A;  5CPJ B;  3W97 C;  1P3F D;  4R8P B;  4DRB A;  5BS7 A;  3AYW A;  4UPK A;  4X23 C;  3B6G D;  5AV8 B;  3X1S C;  5G49 A;  5FUG A;  1ULY A;  3MNN A;  1P3O C;  2NZD A;  3A6N D;  3VH6 W;  5GT0 D;  3W98 D;  1Q9C A;  5GXQ A;  3UTB D;  1ZLA B;  1W2E A;  5BS7 C;  4KHA A;  3AN2 C;  3LJA C;  4J8V C;  3AZG D;  4M6B A;  2F2A C;  3KXB C;  1P3G A;  4JJN A;  4YM6 C;  1P3P B;  4Z2M H;  1N1J B;  2VQR A;  4J8V B;  4Z5T A;  4Z66 C;  4JJN C;  5GT3 C;  1KX5 D;  1BH9 A;  5KDM B;  3WAA B;  2NQB C;  2ZY4 A;  3AZJ B;  3B0D B;  1P34 D;  4Z5T D;  4NFT A;  4QLC C;  5GXQ C;  3WA9 D;  4H9P B;  5G49 B;  5AV9 D;  3LZ1 A;  1P3B A;  1HQ3 A;  3B0D C;  4J8X C;  3REI C;  4X23 A;  5GXQ B;  2Y2Q A;  5B1L C;  5AV6 B;  1PZR A;  3W96 C;  3W98 A;  1HTA A;  5AY8 C;  3LZ0 A;  1F66 C;  2LY8 A;  2YFW B;  1U35 C;  4KGC D;  2RVQ C;  3AZM A;  4LD9 B;  5AY8 A;  3KUY A;  1P3K B;  3UTB A;  4H9N A;  5AV6 D;  3AZE A;  1HQ3 C;  2IO5 C;  5DNM C;  3AZF A;  1KX5 A;  4XZQ D;  4WU9 A;  5B40 B;  3IP4 C;  2RVQ D;  5CPJ C;  1ZLA C;  4KUD A;  5B24 A;  5AV8 A;  3MVD B;  3LJA D;  3C1C B;  2JCH A;  5CP6 B;  4WU8 A;  3REL D;  1P3L D;  5AVC C;  3MGP D;  2HIO A;  4G91 C;  5C3I B;  3REI D;  4CAY B;  5AV5 C;  3AZN B;  3X1T C;  3REL A;  2F8N D;  2FFF B;  5B1M B;  3KUY B;  2W8S A;  5B32 G;  3O62 D;  4X23 D;  1P3G B;  5GSU B;  3NQU B;  3A6N C;  3WTP B;  1U35 A;  5AVC A;  4WJ3 C;  5AVB D;  3WA9 C;  4ZUX B;  3MGR B;  3REL C;  1B67 A;  3MVD C;  3REK D;  4YS3 A;  1EQZ B;  1P3A A;  5AVC D;  3MGP C;  2F8N K;  2FJ7 B;  3WKJ C;  3B6G B;  2JE5 A;  3AZK A;  3X1T B;  2CWE A;  4H9S C;  1P3F C;  2XD1 A;  5CP6 C;  2Y2N A;  1KX4 D;  3AZK C;  3LEL C;  1P3B D;  3KWQ A;  4H9R B;  4UUZ A;  5B31 C;  5AV9 A;  3UTA C;  3MGQ C;  2NQB A;  3UTB C;  3UT9 C;  4LD9 D;  5AV8 D;  4AWL B;  1P3I D;  3B0C W;  5DNN D;  2IO5 B;  5JRG D;  1F66 B;  3AFA D;  2DF4 C;  5B0Y D;  2CV5 C;  1KX4 C;  3KFU G;  4J8W C;  1M1A B;  5AV5 A;  1WWI A;  4J8V A;  1H3O B;  4DQY B;  4HGA C;  5B1L D;  1P3A B;  5AVB A;  5B2I A;  5B32 C;  1B6W A;  5B1L A;  2YFV A;  3P5J B;  3W99 D;  4QLC B;  3EPK A;  3C1B A;  3W96 B;  5GXQ D;  5B0Y C;  2CV5 D;  1AOI B;  3AYW C;  3AZJ D;  3MGS D;  3W97 A;  5CP6 A;  5B0Z D;  3VH6 A;  1M19 D;  3AV2 D;  1WWS A;  5B0Z A;  2CV5 B;  3AV1 D;  3MGP A;  5GT0 B;  2Y2G A;  1P3K A;  3WKJ D;  1TAF A;  3REH C;  3TU4 A;  3X1V D;  3UTB B;  1ZLA D;  2G5H C;  5CPI D;  1P3O B;  2DQN C;  4H9O B;  3LZ1 D;  3B6F D;  3X1T D;  2PYO C;  3MNN C;  2Y2K A;  2NZD C;  2HIO D;  3REI A;  3X1T A;  3WKJ B;  4KGC A;  4J8U D;  1AOI A;  3C1C D;  3EPH A;  3AZI D;  5AV6 A;  5AV8 C;  3REH A;  3TU4 C;  3W97 D;  3KUY D;  3AZH A;  5B0Z B;  4Z66 A;  1M18 D;  2CV5 A;  3AZG A;  4J8W B;  3EPL A;  1M1A C;  5CPK C;  1ID3 D;  5B2J B;  1TAF B;  3REJ B;  3TU4 B;  3MGR D;  5CP6 D;  4Z2M G;  4ZUX D;  5B24 D;  4AWL C;  1EQZ D;  3MGQ A;  4WV4 B;  5C3I C;  2FJ7 D;  5AVC B;  1H3O A;  1BH9 B;  5KDM A;  4WU9 B;  3KUY C;  3LEL A;  3AV1 B;  5B1M D;  5JA4 A;  1TZY A;  4XUJ A;  3WTP D;  3LZ0 D;  5B24 B;  3B0B A;  3W96 A;  3AFA C;  1P3I C;  4YM6 D;  5AY8 D;  3MNN B;  2NZD B;  2F8N H;  5BT1 C;  2F8N A;  3F6T A;  5GT0 C;  4CAY A;  3W98 B;  1T3U A;  3AZL D;  3REH D;  4J8U B;  4J8W A;  4XZQ A;  3H0M C;  3AZI A;  1S32 B;  5AY8 B;  3WAA D;  5F99 A;  3MGR A;  1EQZ A;  3AZE B;  4G92 B;  3VH6 T;  3AV1 A;  5JA4 B;  2ZM5 A;  3AV2 C;  1S32 D;  3NQJ B;  3B0C T;  1P3M B;  1BFM A;  4H9P A;  5AV6 C;  4HGA B;  1P3A C;  3AN2 D;  1BH8 A;  3AV2 B;  4E44 A;  3H0R C;  1HQ3 D;  4H9R A;  5B0Y A;  1P3P C;  4R8P D;  3AZE C;  3W96 D;  5CHL B;  3AZL A;  3LJA B;  1P3P A;  5B2I C;  2HIO C;  5BO0 B;  3UT9 B;  4J8U C;  3FDD A;  5B31 G;  3REK A;  1KX4 A;  5B2I B;  5F99 D;  2UWX A;  3AZE D;  3KXB B;  1P3G D;  5B40 D;  4J8X D;  2Y2P A;  1P34 A;  5JRG B;  5BNX A;  1P3I B;  1M1A D;  5FUG B;  3LEL D;  2ARO D;  3W97 B;  4ZBJ B;  3MVD D;  3X1S B;  4WU8 B;  3AZI C;  4Z5T C;  2YFW A;  3VH5 T;  3REK C;  3O62 B;  2J8P A;  4EO5 B;  3WAA C;  4Z66 B;  2BYM A;  4G91 B;  3AZN C;  1TZY D;  4XUJ D;  3MGS B;  3AZH C;  5AV5 D;  3O62 C;  3B6F A;  3C1B D;  3REK B;  5B32 D;  5E5A B;  3AZL C;  2XD5 A;  4YS3 D;  5B31 A;  5B2J D;  3REJ D;  3UTA A;  3AZK B;  5DNM B;  1HQ3 B;  5JRG C;  2PYO B;  4R8P C;  1R4V A;  4NE3 A;  5B33 C;  3W99 B;  1P3K C;  1ID3 A;  5AV9 B;  3AZK D;  2ZY2 A;  3KWQ D;  5B1M A;  3AZM B;  2ARO B;  4WU9 C;  3AYW D;  3LJA A;  3WA9 A;  3AZI B;  1P3G C;  4H9Q A;  4EO5 C;  3A6N A;  5AV5 B;  4J8X B;  3AZF B;  3B6G A;  3X1U B;  3AYW B;  3C1C C;  5BNX B;  1P3I A;  1P3M C;  2Y2I A;  1A7W A;  2BYK A;  2PYO D;  5CPI C;  2HIO B;  3AZN A;  3LZ1 C;  3LZ0 B;  1M19 B;  5GT3 D;  1KX5 C;  2Y2O A;  2NQB D;  3AZG B;  3AN2 B;  5CPI B;  5BNV A;  4KUD D;  5E5A D;  4ZUX A;  3MGQ B;  4J8V D;  3AZG C;  5E5A A;  4H9S A;  3X1U A;  3LEL B;  5GSU D;  3EG5 B;  1P3M A;  5JRG A;  3VH5 W;  4CSR B;  3AFA B;  3LZ1 B;  1Z2C B;  5B32 A;  3X1U D;  5CPK D;  1JFI B;  3WKJ A;  2G5I C;  3B6G C;  2ZY5 A;  3X1S D;  5DNN B;  1F66 D;  1AOI C;  3C1C A;  1U35 D;  4KGC C;  1KX3 C;  4KHA B;  3H0L C;  3X1S A;  3KWQ B;  3W99 A;  4G92 C;  1M19 A;  3KSY A;  4JJN B;  5AV9 C;  1S32 A;  3EPJ A;  3WTP E;  3NQU A;  1M18 C;  1ID3 C;  1M1A A;  3B6F B;  1P3K D;  2Y2M A;  1S32 C;  4YS3 B;  3MGQ D;  4JJN D;  5AVB B;  5B24 C;  3V9R B;  5CPJ A;  3R45 A;  4KUD C;  4R8P A;  3AV1 C;  5B33 B;  3X1V A;  4YS3 C;  3MVD A;  3C1B B;  1KX3 A;  5DNN A;  1P3P D;  1M18 B;  2F8N G;  2F8N B;  2BYK B;  4UUZ B;  3O62 A;  3B6F C;  1P3L B;  4WNN A;  4J8U A;  1AOI D;  5AVB C;  2JSS A;  5GT0 A;  2RIQ A;  5B2J A;  5E5A C;  3REJ A;  3AZL B;  4WU8 C;  1U35 B;  4H9N B;  2ZY3 A;  5B1M C;  2HUE C;  3UT9 A;  1P3L C;  3AZF D;  2Y2J A;  3WTP C;  3WAA A;  5B0Z C;  5GSU C;  3A6N B;  2FJ7 A;  4J8X A;  3R45 B;  4J8W D;  3AL0 C;  1TZY B;  4XUJ B;  3NQJ A;  3X1V B;  4CSR A;  1JFI A;  4QLC A;  1KX3 B;  5DNM A;  4KGC B;  4NE6 A;  4ZBJ C;  4DRA A;  1P3B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...