3AV2B

The human nucleosome structure containing the histone variant h3.3
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
78
structure length
78
Chain Sequence
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title Structures of human nucleosomes containing major histone H3 variants
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 27
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3av2B00
1KX4A 2PYOC 3X1VB 3MGSC 1P3FD 4ZBJC 5BNXA 1TZYC 5AV5A 3AV2D 5B40B 3MVDC 1M1AA 4WV4B 5B33D 1JFIA 3WA9B 1P3LC 5F99B 2HUEB 4Z2MG 5BT1C 3REHC 3AZKB 5B24A 3KXBD 3VH6W 4J8VB 3X1UC 5CPIC 5BNVA 5CP6B 3X1SD 1P3PA 3AZHA 1ID3B 5B2JC 1F66B 5DNMA 1P3OC 4E45A 5AVCA 3AYWC 1P3GA 3AZGC 4H9NA 5B31A 4H9RA 4KHAA 3LJAC 1P3KD 2LY8A 4ZUXB 5GT0C 5AY8B 3LZ0D 1P3AD 3TU4D 1EQZC 5AV9B 3AZID 1AOID 1P3FC 5B32D 5GXQD 3W99D 3AV2C 5B33C 5G49B 5CPJB 5AV6D 1M19A 5C3IB 3KXBC 4EO5C 4AWLB 3LELA 4H9PA 1P3MA 4DRAA 3X1SC 3LZ1B 3RELD 4WU9D 3AV1A 4H9SC 4J8WD 3AZED 4ZBJB 3RELA 3AZFB 4WU9A 1TZYB 1KX3D 3MVDB 3UTAD 1P3KC 2AROD 2NQBA 5B1MD 3AN2A 2IO5B 5B1LD 3W96A 3LZ0C 1P3AC 5AV8D 3X1UB 5CPIB 5CP6A 3REJB 3TU4C 5B0YD 3B0BA 3WKJB 3AZIC 5B2JB 1AOIC 3MGQB 3AFAA 3B6GA 3AZJA 5B32C 4KUDD 3W99C 5GXQC 3C1CD 4J8XB 4NE5A 2HIOD 3WTPB 5AV6C 3MGRD 4Z5TB 4JJND 4WU8B 3LJAB 4CAYA 3C1CA 4E44A 5E5AB 4R8PA 3AZMD 4KGCD 3O62B 4YM6D 5CPKC 3RELC 4WU9C 2F8ND 3W98B 4UUZA 4J8WC 4YS3D 3AZEC 2CV5D 1P3FB 2BYKB 1P34B 3X1TB 3AV2B 1KX3C 3WAAD 1TAFB 3UTAC 3UTBD 5CPJA 5JRGD 4LD9A 1P3BD 4NFTA 2AROC 5B1MC 5BS7C 1S32B 5B1LC 5B0ZA 4G92C 5AV8C 4X23A 1Q9CA 3MGPD 3B6FB 1P3BA 3LZ1A 4WNNB 1M18D 1B67A 5B0YC 2RVQD 1KX4D 4KUDC 3C1CC 3MNNA 3AZFA 2HIOC 3MGRC 5AV5D 5B2IB 1M1AD 4JJNC 3REKD 4DRBA 3AZMC 1N1JA 5AVBB 1P3IB 4KGCC 3AZLB 3LZ0B 3REJA 5B24D 4YM6C 3TU4B 1U35A 3REKA 3WKJA 3UT9D 4G91C 4YS3C 1P3PD 3AZHD 1A7WA 3A6NA 2CV5C 2YFWB 4NE3A 5B32B 3KWQA 5DNMD 5GXQB 3WAAC 5AVCD 1P3GD 3WTPA 3UT9A 3UTBC 5JRGC 5GSUD 1P3BC 4NE6A 4Z5TA 5AV6B 1KX5B 4CSRA 1BFMA 2NZDA 5B31D 3AZNB 1ZLAA 2BYMB 4XUJB 2FJ7B 3MGPC 4H9QA 5GSUA 3O62A 5CPKB 1M18C 3WTPE 3REIB 1B6WA 4QLCD 4J8WB 1KX4C 3R45B 2BYKA 4J8UD 3X1TA 3C1BD 1TAFA 4XZQB 4QLCA 3W97B 5AV5C 1M1AC 3REKC 5B1MB 4J8UA 4Z66D 5B1LB 3C1BA 1M19D 1HQ3D 5AV8B 3V9RA 5B24C 3B6FA 1H3OA 3LELD 1P3MD 4WNNA 3KUYA 5B0YB 4Z66A 5GT3A 3UT9C 5DNNB 1P3PC 3AZHC 1HQ3A 3AV1D 5DNMC 5AVCC 3X1VD 1P3GC 5GSUC 5B2IA 3MGRB 4JJNB 5B31C 2PYOB 3X1VA 5AVBA 2NQBD 3AZLA 3MGSB 3AZMB 3AN2D 5B40A 4YM6B 3W96D 2F8NB 5CP6D 4QLCC 3WA9A 1ULYA 5BO0B 4G91B 5F99A 1P3LB 3AZKA 1ID3D 3REHB 2CV5B 4J8UC 4J8VA 3C1BC 3WAAB 3AFAD 3B6GD 3AZJD 5B32G 5JRGB 3B0DC 1ID3A 1F66A 4Z66C 5JA4B 1M19C 1P3OB 3AYWB 3NQUB 2BYMA 1HQ3C 4XUJA 4ZUXD 3AZGB 5AY8D 3LELC 3MGPB 1P3MC 4R8PD 3REIA 1M18B 5KDMB 4ZUXA 3AV1C 5AV9D 1BH8B 3R45A 5AY8A 5GT0B 3X1VC 4XZQA 5BNXB 5AV5B 1M1AB 5AV9A 1EQZB 5CPJD 4LD9D 1JFIB 2NQBC 3AN2C 2HUEC 5B0ZD 5B24B 3W96C 4X23D 5G49A 5B33B 5CP6C 5BNVB 3LZ1D 1R4VA 1P3PB 1ID3C 3AZHB 3KXBB 4EO5B 5DNMB 3AFAC 5AVCB 3AZJC 3B6GC 3X1SB 3MNND 3AZFD 4H9NB 2PYOA 5B31B 4KHAB 4ZUXC 3MGSA 5AY8C 1TZYA 4H9OB 4R8PC 3MVDA 3REJD 1P3KB 1U35D 5AV9C 1P3LA 3WKJD 2F8NG 3REHA 3MGQD 3X1UA 5CPIA 3A6ND 1P3AB 4J8XD 3KWQD 3WTPD 5B2JA 5CPJC 3AZIB 3MGQA 4LD9C 1P3OA 4Z5TD 1AOIB 1M19B 2JSSA 4WU8D 4Z2MH 4J8XA 3AZGA 2NZDD 4AWLC 5B0ZC 3W99B 2YFVB 3LELB 5E5AD 1ZLAD 4X23C 1BH9B 3O62D 3LZ1C 4WU8A 3LJAA 2CWEA 3W98D 3AV1B 5GT0A 5E5AA 1P34D 3MNNC 3AZFC 3X1TD 1EQZA 3RELB 3W98A 4WU9B 2RVQC 2F8NK 2NQBB 2IO5C 1P3FA 3AZEB 3AN2B 1S32D 1P34A 3AV2A 1WWIA 1KX3B 3W96B 5B33A 3REJC 3B6FD 3UTAB 1U35C 2AROB 1S32A 3KUYD 3WKJC 1HTAA 3VH5T 5GT3D 3KXBA 3MGQC 4G92B 3A6NC 3AFAB 3AZJB 3B6GB 4J8XC 3KWQC 3X1SA 3WTPC 4H9SA 4Z5TC 5B2ID 4WU8C 2NZDC 4KUDB 4CAYB 3C1CB 5B31G 4H9OA 5E5AC 5AVBD 1ZLAC 3NQJB 2HIOB 4R8PB 3AZLD 1P3ID 3O62C 5B40D 1P3KA 3W98C 3WA9D 4UUZB 1P3IA 5F99D 3LZ0A 1P3AA 4KGCB 3AZKD 1P34C 3VH5A 3X1TC 3TU4A 4J8VD 3AZIA 1KX5D 1AOIA 4LD9B 4YS3B 2YFWA 1S32C 5B32A 1F66D 5GXQA 3W99A 3AZND 5B0ZB 2YFVA 4HGAC 5FUGB 4XUJD 2FJ7D 4X23B 4WZSB 3B6FC 1BH9A 3UTBB 1KX5A 5AV6A 1P3BB 5CPKD 3KUYC 3REID 1F1EA 5GT3C 3AZNA 2FJ7A 5CPKA 3MNNB 2L5AA 4XZQD 5CHLB 3W97D 5B2IC 3B0CT 4M6BA 4J8WA 1KX4B 3AZEA 5AVBC 1KX3A 1P3IC 3AZLC 1N1JB 3W97A 3UTAA 5B40C 3VH5W 2AROA 5B1MA 5BS7A 1U35B 3REKB 5B1LA 3WA9C 5DNND 5F99C 3AZKC 5AV8A 3A6NB 4J8VC 3KWQB 5B0YA 3UT9B 3VH6T 1KX5C 5DNNA 4CSRB 1F66C 4KUDA 2PYOD 2NZDB 3AZNC 1WWSA 3NQJA 2HIOA 4XUJC 3MGSD 1P3GB 1ZLAB 2FJ7C 4H9QB 5GSUB 3MGRA 1TZYD 4JJNA 3MVDD 3REIC 4H9RB 3AZMA 4KGCA 1P3LD 3REHD 5BT1D 4YM6A 4XZQC 2F8NA 3X1UD 5CPID 3W97C 1KU5A 4QLCB 5BO0A 4YS3A 2CV5A 2F8NH 5B2JD 4J8UB 3VH6A 1P3OD 3WAAA 3C1BB 3AYWD 4HGAB 5FUGA 3AZGD 3UTBA 3V9RB 5JRGA 1H3OB 3B0DB 3KUYB 5JA4A 4Z66B 5GT3B 5DNNC 3NQUA 3AYWA 5C3IC 3LJAD 1HQ3B 5GT0D 3MGPA 3KSYA 4H9PB 1P3MB 1M18A 3B0CW 5KDMA 1EQZD 1BH8A
chains in the Genus database with same CATH superfamily
1KX4A 2PYOC 1PZRA 3X1VB 3MGSC 1P3FD 4ZBJC 5BNXA 1TZYC 5AV5A 3AV2D 5B40B 3MVDC 1M1AA 4WV4B 5B33D 1JFIA 2BG1A 3WA9B 1P3LC 5F99B 2HUEB 4Z2MG 5BT1C 3REHC 3AZKB 5B24A 3KXBD 2Y2OA 3VH6W 4J8VB 3X1UC 5CPIC 5BNVA 2Y2MA 5CP6B 3X1SD 1P3PA 3AZHA 1ID3B 5B2JC 1F66B 5DNMA 1P3OC 4E45A 5AVCA 3AYWC 1P3GA 3AZGC 4H9NA 5B31A 4H9RA 4KHAA 3LJAC 1P3KD 2LY8A 4ZUXB 5GT0C 5AY8B 3LZ0D 1P3AD 3TU4D 1EQZC 5AV9B 3AZID 1AOID 1P3FC 5B32D 5GXQD 3W99D 3AV2C 5B33C 3H0LC 5G49B 5CPJB 5AV6D 1M19A 5C3IB 3KXBC 4EO5C 4AWLB 3LELA 4H9PA 1P3MA 1T3UA 4DRAA 3X1SC 3LZ1B 3RELD 4WU9D 3AV1A 3EPJA 4H9SC 4J8WD 3AZED 4ZBJB 3RELA 2XD5A 3AZFB 4WU9A 1TZYB 2Y2IA 1KX3D 3MVDB 3UTAD 1P3KC 2AROD 2NQBA 5B1MD 3AN2A 2IO5B 5B1LD 3W96A 3LZ0C 1P3AC 5AV8D 3X1UB 5CPIB 5CP6A 3REJB 3TU4C 5B0YD 3B0BA 3WKJB 3AZIC 5B2JB 1AOIC 3MGQB 3AFAA 3B6GA 3AZJA 5B32C 4KUDD 2ZY2A 3W99C 5GXQC 3C1CD 4J8XB 4NE5A 2HIOD 3EPKA 3WTPB 5AV6C 2Y2GA 3MGRD 4Z5TB 4JJND 4WU8B 3LJAB 4CAYA 3C1CA 4E44A 5E5AB 4R8PA 3AZMD 4KGCD 3O62B 4YM6D 5CPKC 3RELC 4WU9C 2F8ND 3W98B 4WJ3C 4UUZA 4J8WC 4YS3D 3AZEC 2CV5D 1P3FB 2BYKB 1P34B 3X1TB 3AV2B 1KX3C 3WAAD 1TAFB 3UTAC 3UTBD 5CPJA 5JRGD 4LD9A 1P3BD 4NFTA 2AROC 5B1MC 5BS7C 1S32B 5B1LC 5B0ZA 4G92C 3A1IA 5AV8C 4X23A 1Q9CA 3MGPD 3B6FB 1P3BA 3LZ1A 4WNNB 1M18D 1B67A 5B0YC 2RVQD 1KX4D 4KUDC 3C1CC 3MNNA 3AZFA 2HIOC 3F6TA 3MGRC 5AV5D 5B2IB 1M1AD 4JJNC 3REKD 4DRBA 2Y2QA 1N1JA 5AVBB 3AZMC 1P3IB 3AZLB 4KGCC 3LZ0B 3REJA 5B24D 4YM6C 3TU4B 4DQYB 1U35A 3REKA 3WKJA 3UT9D 4G91C 4YS3C 2ZM5A 1P3PD 3AZHD 1A7WA 3A6NA 2CV5C 2YFWB 4NE3A 5B32B 3KWQA 5DNMD 5GXQB 3WAAC 5AVCD 1P3GD 3WTPA 3UT9A 3UTBC 5JRGC 3KFUG 5GSUD 1P3BC 4NE6A 4Z5TA 5AV6B 2Y2LA 1KX5B 4CSRA 1BFMA 2NZDA 5B31D 3AZNB 2Y2JA 1ZLAA 2BYMB 4XUJB 2FJ7B 3MGPC 4H9QA 5GSUA 3O62A 5CPKB 1M18C 3WTPE 3REIB 1B6WA 4QLCD 2FFFB 1W2EA 4J8WB 3R45B 1KX4C 2BYKA 4J8UD 3X1TA 4UPKA 3C1BD 1TAFA 4XZQB 4QLCA 3W97B 5AV5C 1M1AC 2ZY4A 3REKC 5B1MB 4J8UA 3IP4C 5B1LB 4Z66D 3C1BA 1M19D 1HQ3D 5AV8B 3V9RA 5B24C 3B6FA 1H3OA 3LELD 1P3MD 4WNNA 3KUYA 5B0YB 4Z66A 5GT3A 3UT9C 5DNNB 1P3PC 3AZHC 1HQ3A 3AV1D 3H0RC 5DNMC 5AVCC 3X1VD 1P3GC 5GSUC 5B2IA 3MGRB 4JJNB 5B31C 2PYOB 3X1VA 5AVBA 2NQBD 3AZLA 3MGSB 3AZMB 2JCHA 3AN2D 5B40A 4YM6B 3W96D 2F8NB 5CP6D 4QLCC 3WA9A 1ULYA 5BO0B 4G91B 5F99A 1P3LB 3AZKA 1ID3D 3REHB 2CV5B 4J8UC 4J8VA 3C1BC 3WAAB 3AFAD 3B6GD 3AZJD 5B32G 5JRGB 3B0DC 1ID3A 1F66A 4Z66C 5JA4B 1M19C 1P3OB 3AYWB 3NQUB 2BYMA 1HQ3C 4XUJA 4ZUXD 3AZGB 5AY8D 3LELC 3MGPB 1P3MC 4R8PD 3REIA 1M18B 5KDMB 4ZUXA 3AV1C 5AV9D 1BH8B 3R45A 5AY8A 5GT0B 3X1VC 4XZQA 2XD1A 5BNXB 5AV5B 1M1AB 5AV9A 1EQZB 5CPJD 4LD9D 1JFIB 2NQBC 3AN2C 2HUEC 3EPLA 5B0ZD 5B24B 3W96C 4X23D 2Y2KA 5G49A 5B33B 5CP6C 5BNVB 3LZ1D 1R4VA 1P3PB 1ID3C 3AZHB 3AL0C 3KXBB 4EO5B 5DNMB 3AFAC 5AVCB 3AZJC 3B6GC 3X1SB 3MNND 3AZFD 4H9NB 2PYOA 5B31B 2VQRA 4KHAB 4ZUXC 3MGSA 5AY8C 1TZYA 4H9OB 4R8PC 3MVDA 3REJD 1P3KB 1U35D 5AV9C 1P3LA 3WKJD 2F8NG 3REHA 3MGQD 3X1UA 5CPIA 3A6ND 1P3AB 2JE5A 4J8XD 3KWQD 2F2AC 3WTPD 5B2JA 5CPJC 3AZIB 3MGQA 4LD9C 1P3OA 4Z5TD 1AOIB 1M19B 2JSSA 4WU8D 4Z2MH 4J8XA 3AZGA 2NZDD 4AWLC 5B0ZC 3W99B 2YFVB 3LELB 5E5AD 1ZLAD 4X23C 1BH9B 3O62D 3LZ1C 4WU8A 3LJAA 2CWEA 3W98D 3AV1B 5GT0A 5E5AA 1P34D 3MNNC 3AZFC 3X1TD 1EQZA 3RELB 3W98A 4WU9B 2RVQC 2F8NK 2NQBB 2IO5C 1P3FA 2ZY3A 3AZEB 3AN2B 1S32D 1P34A 3AV2A 1WWIA 1KX3B 3W96B 5B33A 3REJC 3B6FD 3UTAB 1U35C 2AROB 1S32A 3KUYD 3WKJC 1HTAA 2G5HC 3VH5T 5GT3D 3KXBA 3MGQC 4G92B 3A6NC 3AFAB 3AZJB 3B6GB 4J8XC 3FDDA 3X1SA 3KWQC 2W8SA 3WTPC 4H9SA 4Z5TC 5B2ID 4WU8C 2NZDC 4KUDB 4CAYB 3C1CB 5B31G 4H9OA 5E5AC 5AVBD 1ZLAC 3NQJB 2HIOB 4R8PB 3AZLD 1P3ID 3O62C 5B40D 1P3KA 3W98C 3WA9D 4UUZB 1P3IA 5F99D 3LZ0A 1P3AA 4KGCB 3AZKD 1P34C 3VH5A 2J8PA 2Y2HA 4J8VD 3TU4A 3X1TC 3AZIA 1KX5D 1AOIA 4LD9B 4YS3B 2YFWA 1S32C 5B32A 1F66D 5GXQA 3W99A 3AZND 5B0ZB 2YFVA 4HGAC 5FUGB 4XUJD 2FJ7D 4X23B 4WZSB 3B6FC 1BH9A 3UTBB 1KX5A 5AV6A 1P3BB 5CPKD 3KUYC 3REID 1F1EA 2DF4C 3P5JB 5GT3C 3AZNA 2FJ7A 3EG5B 3A1KA 5CPKA 3MNNB 2L5AA 4XZQD 5CHLB 3W97D 5B2IC 3B0CT 4M6BA 4J8WA 1KX4B 2ZY5A 3AZEA 5AVBC 1KX3A 1P3IC 3AZLC 1N1JB 3W97A 2DQNC 3UTAA 5B40C 3VH5W 2AROA 5B1MA 5BS7A 1U35B 3REKB 5B1LA 3WA9C 5DNND 5F99C 3AZKC 5AV8A 3A6NB 4J8VC 3KWQB 2Y2NA 2Y2PA 5B0YA 3UT9B 3VH6T 1KX5C 5DNNA 4CSRB 1F66C 4KUDA 2PYOD 2NZDB 3AZNC 1WWSA 3NQJA 2HIOA 4XUJC 3MGSD 1P3GB 1ZLAB 2FJ7C 2UWXA 4H9QB 5GSUB 3MGRA 1TZYD 4JJNA 3MVDD 3REIC 4H9RB 1Z2CB 3AZMA 4KGCA 1P3LD 3REHD 5BT1D 4YM6A 4XZQC 2F8NA 3X1UD 5CPID 3W97C 1KU5A 4QLCB 5BO0A 3H0MC 4YS3A 2CV5A 2F8NH 5B2JD 2RIQA 4J8UB 3VH6A 1P3OD 3WAAA 3C1BB 3AYWD 4HGAB 5FUGA 3AZGD 3UTBA 3V9RB 5JRGA 1H3OB 3B0DB 3KUYB 5JA4A 4Z66B 5GT3B 5DNNC 3NQUA 3AYWA 5C3IC 3LJAD 1HQ3B 5GT0D 3MGPA 3KSYA 4H9PB 1P3MB 3EPHA 1M18A 3B0CW 5KDMA 2G5IC 1EQZD 1BH8A
chains in the Genus database with same CATH topology
1KX4A 2PYOC 1PZRA 3X1VB 3MGSC 1P3FD 4ZBJC 5BNXA 1TZYC 5AV5A 3AV2D 5B40B 3MVDC 1M1AA 4WV4B 5B33D 1JFIA 2BG1A 3WA9B 1P3LC 5F99B 2HUEB 4Z2MG 5BT1C 3REHC 3AZKB 5B24A 3KXBD 2Y2OA 3VH6W 4J8VB 3X1UC 5CPIC 5BNVA 2Y2MA 5CP6B 3X1SD 1P3PA 3AZHA 1ID3B 5B2JC 1F66B 5DNMA 1P3OC 4E45A 5AVCA 3AYWC 1P3GA 3AZGC 4H9NA 5B31A 4H9RA 4KHAA 3LJAC 1P3KD 2LY8A 4ZUXB 5GT0C 5AY8B 3LZ0D 1P3AD 3TU4D 1EQZC 5AV9B 3AZID 1AOID 1P3FC 5B32D 5GXQD 3W99D 3AV2C 5B33C 3H0LC 5G49B 5CPJB 5AV6D 1M19A 5C3IB 3KXBC 4EO5C 4AWLB 3LELA 4H9PA 1P3MA 1T3UA 4DRAA 3X1SC 3LZ1B 3RELD 4WU9D 3AV1A 3EPJA 4H9SC 4J8WD 3AZED 4ZBJB 3RELA 2XD5A 3AZFB 4WU9A 1TZYB 2Y2IA 1KX3D 3MVDB 3UTAD 1P3KC 2AROD 2NQBA 5B1MD 3AN2A 2IO5B 5B1LD 3W96A 3LZ0C 1P3AC 5AV8D 3X1UB 5CPIB 5CP6A 3REJB 3TU4C 5B0YD 3B0BA 3WKJB 3AZIC 5B2JB 1AOIC 3MGQB 3AFAA 3B6GA 3AZJA 5B32C 4KUDD 2ZY2A 3W99C 5GXQC 3C1CD 4J8XB 4NE5A 2HIOD 3EPKA 3WTPB 5AV6C 2Y2GA 3MGRD 4Z5TB 4JJND 4WU8B 3LJAB 4CAYA 3C1CA 4E44A 5E5AB 4R8PA 3AZMD 4KGCD 3O62B 4YM6D 5CPKC 3RELC 4WU9C 2F8ND 3W98B 4WJ3C 4UUZA 4J8WC 4YS3D 3AZEC 2CV5D 1P3FB 2BYKB 1P34B 3X1TB 3AV2B 1KX3C 3WAAD 1TAFB 3UTAC 3UTBD 5CPJA 5JRGD 4LD9A 1P3BD 4NFTA 2AROC 5B1MC 5BS7C 1S32B 5B1LC 5B0ZA 4G92C 3A1IA 5AV8C 4X23A 1Q9CA 3MGPD 3B6FB 1P3BA 3LZ1A 4WNNB 1M18D 1B67A 5B0YC 2RVQD 1KX4D 4KUDC 3C1CC 3MNNA 3AZFA 2HIOC 3F6TA 3MGRC 5AV5D 5B2IB 1M1AD 4JJNC 3REKD 4DRBA 2Y2QA 1N1JA 5AVBB 3AZMC 1P3IB 3AZLB 4KGCC 3LZ0B 3REJA 5B24D 4YM6C 3TU4B 4DQYB 1U35A 3REKA 3WKJA 3UT9D 4G91C 4YS3C 2ZM5A 1P3PD 3AZHD 1A7WA 3A6NA 2CV5C 2YFWB 4NE3A 5B32B 3KWQA 5DNMD 5GXQB 3WAAC 5AVCD 1P3GD 3WTPA 3UT9A 3UTBC 5JRGC 3KFUG 5GSUD 1P3BC 4NE6A 4Z5TA 5AV6B 2Y2LA 1KX5B 4CSRA 1BFMA 2NZDA 5B31D 3AZNB 2Y2JA 1ZLAA 2BYMB 4XUJB 2FJ7B 3MGPC 4H9QA 5GSUA 3O62A 5CPKB 1M18C 3WTPE 3REIB 1B6WA 4QLCD 2FFFB 1W2EA 4J8WB 3R45B 1KX4C 2BYKA 4J8UD 3X1TA 4UPKA 3C1BD 1TAFA 4XZQB 4QLCA 3W97B 5AV5C 1M1AC 2ZY4A 3REKC 5B1MB 4J8UA 3IP4C 5B1LB 4Z66D 3C1BA 1M19D 1HQ3D 5AV8B 3V9RA 5B24C 3B6FA 1H3OA 3LELD 1P3MD 4WNNA 3KUYA 5B0YB 4Z66A 5GT3A 3UT9C 5DNNB 1P3PC 3AZHC 1HQ3A 3AV1D 3H0RC 5DNMC 5AVCC 3X1VD 1P3GC 5GSUC 5B2IA 3MGRB 4JJNB 5B31C 2PYOB 3X1VA 5AVBA 2NQBD 3AZLA 3MGSB 3AZMB 2JCHA 3AN2D 5B40A 4YM6B 3W96D 2F8NB 5CP6D 4QLCC 3WA9A 1ULYA 5BO0B 4G91B 5F99A 1P3LB 3AZKA 1ID3D 3REHB 2CV5B 4J8UC 4J8VA 3C1BC 3WAAB 3AFAD 3B6GD 3AZJD 5B32G 5JRGB 3B0DC 1ID3A 1F66A 4Z66C 5JA4B 1M19C 1P3OB 3AYWB 3NQUB 2BYMA 1HQ3C 4XUJA 4ZUXD 3AZGB 5AY8D 3LELC 3MGPB 1P3MC 4R8PD 3REIA 1M18B 5KDMB 4ZUXA 3AV1C 5AV9D 1BH8B 3R45A 5AY8A 5GT0B 3X1VC 4XZQA 2XD1A 5BNXB 5AV5B 1M1AB 5AV9A 1EQZB 5CPJD 4LD9D 1JFIB 2NQBC 3AN2C 2HUEC 3EPLA 5B0ZD 5B24B 3W96C 4X23D 2Y2KA 5G49A 5B33B 5CP6C 5BNVB 3LZ1D 1R4VA 1P3PB 1ID3C 3AZHB 3AL0C 3KXBB 4EO5B 5DNMB 3AFAC 5AVCB 3AZJC 3B6GC 3X1SB 3MNND 3AZFD 4H9NB 2PYOA 5B31B 2VQRA 4KHAB 4ZUXC 3MGSA 5AY8C 1TZYA 4H9OB 4R8PC 3MVDA 3REJD 1P3KB 1U35D 5AV9C 1P3LA 3WKJD 2F8NG 3REHA 3MGQD 3X1UA 5CPIA 3A6ND 1P3AB 2JE5A 4J8XD 3KWQD 2F2AC 3WTPD 5B2JA 5CPJC 3AZIB 3MGQA 4LD9C 1P3OA 4Z5TD 1AOIB 1M19B 2JSSA 4WU8D 4Z2MH 4J8XA 3AZGA 2NZDD 4AWLC 5B0ZC 3W99B 2YFVB 3LELB 5E5AD 1ZLAD 4X23C 1BH9B 3O62D 3LZ1C 4WU8A 3LJAA 2CWEA 3W98D 3AV1B 5GT0A 5E5AA 1P34D 3MNNC 3AZFC 3X1TD 1EQZA 3RELB 3W98A 4WU9B 2RVQC 2F8NK 2NQBB 2IO5C 1P3FA 2ZY3A 3AZEB 3AN2B 1S32D 1P34A 3AV2A 1WWIA 1KX3B 3W96B 5B33A 3REJC 3B6FD 3UTAB 1U35C 2AROB 1S32A 3KUYD 3WKJC 1HTAA 2G5HC 3VH5T 5GT3D 3KXBA 3MGQC 4G92B 3A6NC 3AFAB 3AZJB 3B6GB 4J8XC 3FDDA 3X1SA 3KWQC 2W8SA 3WTPC 4H9SA 4Z5TC 5B2ID 4WU8C 2NZDC 4KUDB 4CAYB 3C1CB 5B31G 4H9OA 5E5AC 5AVBD 1ZLAC 3NQJB 2HIOB 4R8PB 3AZLD 1P3ID 3O62C 5B40D 1P3KA 3W98C 3WA9D 4UUZB 1P3IA 5F99D 3LZ0A 1P3AA 4KGCB 3AZKD 1P34C 3VH5A 2J8PA 2Y2HA 4J8VD 3TU4A 3X1TC 3AZIA 1KX5D 1AOIA 4LD9B 4YS3B 2YFWA 1S32C 5B32A 1F66D 5GXQA 3W99A 3AZND 5B0ZB 2YFVA 4HGAC 5FUGB 4XUJD 2FJ7D 4X23B 4WZSB 3B6FC 1BH9A 3UTBB 1KX5A 5AV6A 1P3BB 5CPKD 3KUYC 3REID 1F1EA 2DF4C 3P5JB 5GT3C 3AZNA 2FJ7A 3EG5B 3A1KA 5CPKA 3MNNB 2L5AA 4XZQD 5CHLB 3W97D 5B2IC 3B0CT 4M6BA 4J8WA 1KX4B 2ZY5A 3AZEA 5AVBC 1KX3A 1P3IC 3AZLC 1N1JB 3W97A 2DQNC 3UTAA 5B40C 3VH5W 2AROA 5B1MA 5BS7A 1U35B 3REKB 5B1LA 3WA9C 5DNND 5F99C 3AZKC 5AV8A 3A6NB 4J8VC 3KWQB 2Y2NA 2Y2PA 5B0YA 3UT9B 3VH6T 1KX5C 5DNNA 4CSRB 1F66C 4KUDA 2PYOD 2NZDB 3AZNC 1WWSA 3NQJA 2HIOA 4XUJC 3MGSD 1P3GB 1ZLAB 2FJ7C 2UWXA 4H9QB 5GSUB 3MGRA 1TZYD 4JJNA 3MVDD 3REIC 4H9RB 1Z2CB 3AZMA 4KGCA 1P3LD 3REHD 5BT1D 4YM6A 4XZQC 2F8NA 3X1UD 5CPID 3W97C 1KU5A 4QLCB 5BO0A 3H0MC 4YS3A 2CV5A 2F8NH 5B2JD 2RIQA 4J8UB 3VH6A 1P3OD 3WAAA 3C1BB 3AYWD 4HGAB 5FUGA 3AZGD 3UTBA 3V9RB 5JRGA 1H3OB 3B0DB 3KUYB 5JA4A 4Z66B 5GT3B 5DNNC 3NQUA 3AYWA 5C3IC 3LJAD 1HQ3B 5GT0D 3MGPA 3KSYA 4H9PB 1P3MB 3EPHA 1M18A 3B0CW 5KDMA 2G5IC 1EQZD 1BH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KX4 A;  2PYO C;  3X1V B;  3MGS C;  1P3F D;  4ZBJ C;  5BNX A;  1TZY C;  5AV5 A;  3AV2 D;  5B40 B;  3MVD C;  1M1A A;  4WV4 B;  5B33 D;  1JFI A;  3WA9 B;  1P3L C;  5F99 B;  2HUE B;  4Z2M G;  5BT1 C;  3REH C;  3AZK B;  5B24 A;  3KXB D;  3VH6 W;  4J8V B;  3X1U C;  5CPI C;  5BNV A;  5CP6 B;  3X1S D;  1P3P A;  3AZH A;  1ID3 B;  5B2J C;  1F66 B;  5DNM A;  1P3O C;  4E45 A;  5AVC A;  3AYW C;  1P3G A;  3AZG C;  4H9N A;  5B31 A;  4H9R A;  4KHA A;  3LJA C;  1P3K D;  2LY8 A;  4ZUX B;  5GT0 C;  5AY8 B;  3LZ0 D;  1P3A D;  3TU4 D;  1EQZ C;  5AV9 B;  3AZI D;  1AOI D;  1P3F C;  5B32 D;  5GXQ D;  3W99 D;  3AV2 C;  5B33 C;  5G49 B;  5CPJ B;  5AV6 D;  1M19 A;  5C3I B;  3KXB C;  4EO5 C;  4AWL B;  3LEL A;  4H9P A;  1P3M A;  4DRA A;  3X1S C;  3LZ1 B;  3REL D;  4WU9 D;  3AV1 A;  4H9S C;  4J8W D;  3AZE D;  4ZBJ B;  3REL A;  3AZF B;  4WU9 A;  1TZY B;  1KX3 D;  3MVD B;  3UTA D;  1P3K C;  2ARO D;  2NQB A;  5B1M D;  3AN2 A;  2IO5 B;  5B1L D;  3W96 A;  3LZ0 C;  1P3A C;  5AV8 D;  3X1U B;  5CPI B;  5CP6 A;  3REJ B;  3TU4 C;  5B0Y D;  3B0B A;  3WKJ B;  3AZI C;  5B2J B;  1AOI C;  3MGQ B;  3AFA A;  3B6G A;  3AZJ A;  5B32 C;  4KUD D;  3W99 C;  5GXQ C;  3C1C D;  4J8X B;  4NE5 A;  2HIO D;  3WTP B;  5AV6 C;  3MGR D;  4Z5T B;  4JJN D;  4WU8 B;  3LJA B;  4CAY A;  3C1C A;  4E44 A;  5E5A B;  4R8P A;  3AZM D;  4KGC D;  3O62 B;  4YM6 D;  5CPK C;  3REL C;  4WU9 C;  2F8N D;  3W98 B;  4UUZ A;  4J8W C;  4YS3 D;  3AZE C;  2CV5 D;  1P3F B;  2BYK B;  1P34 B;  3X1T B;  3AV2 B;  1KX3 C;  3WAA D;  1TAF B;  3UTA C;  3UTB D;  5CPJ A;  5JRG D;  4LD9 A;  1P3B D;  4NFT A;  2ARO C;  5B1M C;  5BS7 C;  1S32 B;  5B1L C;  5B0Z A;  4G92 C;  5AV8 C;  4X23 A;  1Q9C A;  3MGP D;  3B6F B;  1P3B A;  3LZ1 A;  4WNN B;  1M18 D;  1B67 A;  5B0Y C;  2RVQ D;  1KX4 D;  4KUD C;  3C1C C;  3MNN A;  3AZF A;  2HIO C;  3MGR C;  5AV5 D;  5B2I B;  1M1A D;  4JJN C;  3REK D;  4DRB A;  3AZM C;  1N1J A;  5AVB B;  1P3I B;  4KGC C;  3AZL B;  3LZ0 B;  3REJ A;  5B24 D;  4YM6 C;  3TU4 B;  1U35 A;  3REK A;  3WKJ A;  3UT9 D;  4G91 C;  4YS3 C;  1P3P D;  3AZH D;  1A7W A;  3A6N A;  2CV5 C;  2YFW B;  4NE3 A;  5B32 B;  3KWQ A;  5DNM D;  5GXQ B;  3WAA C;  5AVC D;  1P3G D;  3WTP A;  3UT9 A;  3UTB C;  5JRG C;  5GSU D;  1P3B C;  4NE6 A;  4Z5T A;  5AV6 B;  1KX5 B;  4CSR A;  1BFM A;  2NZD A;  5B31 D;  3AZN B;  1ZLA A;  2BYM B;  4XUJ B;  2FJ7 B;  3MGP C;  4H9Q A;  5GSU A;  3O62 A;  5CPK B;  1M18 C;  3WTP E;  3REI B;  1B6W A;  4QLC D;  4J8W B;  1KX4 C;  3R45 B;  2BYK A;  4J8U D;  3X1T A;  3C1B D;  1TAF A;  4XZQ B;  4QLC A;  3W97 B;  5AV5 C;  1M1A C;  3REK C;  5B1M B;  4J8U A;  4Z66 D;  5B1L B;  3C1B A;  1M19 D;  1HQ3 D;  5AV8 B;  3V9R A;  5B24 C;  3B6F A;  1H3O A;  3LEL D;  1P3M D;  4WNN A;  3KUY A;  5B0Y B;  4Z66 A;  5GT3 A;  3UT9 C;  5DNN B;  1P3P C;  3AZH C;  1HQ3 A;  3AV1 D;  5DNM C;  5AVC C;  3X1V D;  1P3G C;  5GSU C;  5B2I A;  3MGR B;  4JJN B;  5B31 C;  2PYO B;  3X1V A;  5AVB A;  2NQB D;  3AZL A;  3MGS B;  3AZM B;  3AN2 D;  5B40 A;  4YM6 B;  3W96 D;  2F8N B;  5CP6 D;  4QLC C;  3WA9 A;  1ULY A;  5BO0 B;  4G91 B;  5F99 A;  1P3L B;  3AZK A;  1ID3 D;  3REH B;  2CV5 B;  4J8U C;  4J8V A;  3C1B C;  3WAA B;  3AFA D;  3B6G D;  3AZJ D;  5B32 G;  5JRG B;  3B0D C;  1ID3 A;  1F66 A;  4Z66 C;  5JA4 B;  1M19 C;  1P3O B;  3AYW B;  3NQU B;  2BYM A;  1HQ3 C;  4XUJ A;  4ZUX D;  3AZG B;  5AY8 D;  3LEL C;  3MGP B;  1P3M C;  4R8P D;  3REI A;  1M18 B;  5KDM B;  4ZUX A;  3AV1 C;  5AV9 D;  1BH8 B;  3R45 A;  5AY8 A;  5GT0 B;  3X1V C;  4XZQ A;  5BNX B;  5AV5 B;  1M1A B;  5AV9 A;  1EQZ B;  5CPJ D;  4LD9 D;  1JFI B;  2NQB C;  3AN2 C;  2HUE C;  5B0Z D;  5B24 B;  3W96 C;  4X23 D;  5G49 A;  5B33 B;  5CP6 C;  5BNV B;  3LZ1 D;  1R4V A;  1P3P B;  1ID3 C;  3AZH B;  3KXB B;  4EO5 B;  5DNM B;  3AFA C;  5AVC B;  3AZJ C;  3B6G C;  3X1S B;  3MNN D;  3AZF D;  4H9N B;  2PYO A;  5B31 B;  4KHA B;  4ZUX C;  3MGS A;  5AY8 C;  1TZY A;  4H9O B;  4R8P C;  3MVD A;  3REJ D;  1P3K B;  1U35 D;  5AV9 C;  1P3L A;  3WKJ D;  2F8N G;  3REH A;  3MGQ D;  3X1U A;  5CPI A;  3A6N D;  1P3A B;  4J8X D;  3KWQ D;  3WTP D;  5B2J A;  5CPJ C;  3AZI B;  3MGQ A;  4LD9 C;  1P3O A;  4Z5T D;  1AOI B;  1M19 B;  2JSS A;  4WU8 D;  4Z2M H;  4J8X A;  3AZG A;  2NZD D;  4AWL C;  5B0Z C;  3W99 B;  2YFV B;  3LEL B;  5E5A D;  1ZLA D;  4X23 C;  1BH9 B;  3O62 D;  3LZ1 C;  4WU8 A;  3LJA A;  2CWE A;  3W98 D;  3AV1 B;  5GT0 A;  5E5A A;  1P34 D;  3MNN C;  3AZF C;  3X1T D;  1EQZ A;  3REL B;  3W98 A;  4WU9 B;  2RVQ C;  2F8N K;  2NQB B;  2IO5 C;  1P3F A;  3AZE B;  3AN2 B;  1S32 D;  1P34 A;  3AV2 A;  1WWI A;  1KX3 B;  3W96 B;  5B33 A;  3REJ C;  3B6F D;  3UTA B;  1U35 C;  2ARO B;  1S32 A;  3KUY D;  3WKJ C;  1HTA A;  3VH5 T;  5GT3 D;  3KXB A;  3MGQ C;  4G92 B;  3A6N C;  3AFA B;  3AZJ B;  3B6G B;  4J8X C;  3KWQ C;  3X1S A;  3WTP C;  4H9S A;  4Z5T C;  5B2I D;  4WU8 C;  2NZD C;  4KUD B;  4CAY B;  3C1C B;  5B31 G;  4H9O A;  5E5A C;  5AVB D;  1ZLA C;  3NQJ B;  2HIO B;  4R8P B;  3AZL D;  1P3I D;  3O62 C;  5B40 D;  1P3K A;  3W98 C;  3WA9 D;  4UUZ B;  1P3I A;  5F99 D;  3LZ0 A;  1P3A A;  4KGC B;  3AZK D;  1P34 C;  3VH5 A;  3X1T C;  3TU4 A;  4J8V D;  3AZI A;  1KX5 D;  1AOI A;  4LD9 B;  4YS3 B;  2YFW A;  1S32 C;  5B32 A;  1F66 D;  5GXQ A;  3W99 A;  3AZN D;  5B0Z B;  2YFV A;  4HGA C;  5FUG B;  4XUJ D;  2FJ7 D;  4X23 B;  4WZS B;  3B6F C;  1BH9 A;  3UTB B;  1KX5 A;  5AV6 A;  1P3B B;  5CPK D;  3KUY C;  3REI D;  1F1E A;  5GT3 C;  3AZN A;  2FJ7 A;  5CPK A;  3MNN B;  2L5A A;  4XZQ D;  5CHL B;  3W97 D;  5B2I C;  3B0C T;  4M6B A;  4J8W A;  1KX4 B;  3AZE A;  5AVB C;  1KX3 A;  1P3I C;  3AZL C;  1N1J B;  3W97 A;  3UTA A;  5B40 C;  3VH5 W;  2ARO A;  5B1M A;  5BS7 A;  1U35 B;  3REK B;  5B1L A;  3WA9 C;  5DNN D;  5F99 C;  3AZK C;  5AV8 A;  3A6N B;  4J8V C;  3KWQ B;  5B0Y A;  3UT9 B;  3VH6 T;  1KX5 C;  5DNN A;  4CSR B;  1F66 C;  4KUD A;  2PYO D;  2NZD B;  3AZN C;  1WWS A;  3NQJ A;  2HIO A;  4XUJ C;  3MGS D;  1P3G B;  1ZLA B;  2FJ7 C;  4H9Q B;  5GSU B;  3MGR A;  1TZY D;  4JJN A;  3MVD D;  3REI C;  4H9R B;  3AZM A;  4KGC A;  1P3L D;  3REH D;  5BT1 D;  4YM6 A;  4XZQ C;  2F8N A;  3X1U D;  5CPI D;  3W97 C;  1KU5 A;  4QLC B;  5BO0 A;  4YS3 A;  2CV5 A;  2F8N H;  5B2J D;  4J8U B;  3VH6 A;  1P3O D;  3WAA A;  3C1B B;  3AYW D;  4HGA B;  5FUG A;  3AZG D;  3UTB A;  3V9R B;  5JRG A;  1H3O B;  3B0D B;  3KUY B;  5JA4 A;  4Z66 B;  5GT3 B;  5DNN C;  3NQU A;  3AYW A;  5C3I C;  3LJA D;  1HQ3 B;  5GT0 D;  3MGP A;  3KSY A;  4H9P B;  1P3M B;  1M18 A;  3B0C W;  5KDM A;  1EQZ D;  1BH8 A; 
#chains in the Genus database with same CATH topology
 1KX4 A;  2PYO C;  1PZR A;  3X1V B;  3MGS C;  1P3F D;  4ZBJ C;  5BNX A;  1TZY C;  5AV5 A;  3AV2 D;  5B40 B;  3MVD C;  1M1A A;  4WV4 B;  5B33 D;  1JFI A;  2BG1 A;  3WA9 B;  1P3L C;  5F99 B;  2HUE B;  4Z2M G;  5BT1 C;  3REH C;  3AZK B;  5B24 A;  3KXB D;  2Y2O A;  3VH6 W;  4J8V B;  3X1U C;  5CPI C;  5BNV A;  2Y2M A;  5CP6 B;  3X1S D;  1P3P A;  3AZH A;  1ID3 B;  5B2J C;  1F66 B;  5DNM A;  1P3O C;  4E45 A;  5AVC A;  3AYW C;  1P3G A;  3AZG C;  4H9N A;  5B31 A;  4H9R A;  4KHA A;  3LJA C;  1P3K D;  2LY8 A;  4ZUX B;  5GT0 C;  5AY8 B;  3LZ0 D;  1P3A D;  3TU4 D;  1EQZ C;  5AV9 B;  3AZI D;  1AOI D;  1P3F C;  5B32 D;  5GXQ D;  3W99 D;  3AV2 C;  5B33 C;  3H0L C;  5G49 B;  5CPJ B;  5AV6 D;  1M19 A;  5C3I B;  3KXB C;  4EO5 C;  4AWL B;  3LEL A;  4H9P A;  1P3M A;  1T3U A;  4DRA A;  3X1S C;  3LZ1 B;  3REL D;  4WU9 D;  3AV1 A;  3EPJ A;  4H9S C;  4J8W D;  3AZE D;  4ZBJ B;  3REL A;  2XD5 A;  3AZF B;  4WU9 A;  1TZY B;  2Y2I A;  1KX3 D;  3MVD B;  3UTA D;  1P3K C;  2ARO D;  2NQB A;  5B1M D;  3AN2 A;  2IO5 B;  5B1L D;  3W96 A;  3LZ0 C;  1P3A C;  5AV8 D;  3X1U B;  5CPI B;  5CP6 A;  3REJ B;  3TU4 C;  5B0Y D;  3B0B A;  3WKJ B;  3AZI C;  5B2J B;  1AOI C;  3MGQ B;  3AFA A;  3B6G A;  3AZJ A;  5B32 C;  4KUD D;  2ZY2 A;  3W99 C;  5GXQ C;  3C1C D;  4J8X B;  4NE5 A;  2HIO D;  3EPK A;  3WTP B;  5AV6 C;  2Y2G A;  3MGR D;  4Z5T B;  4JJN D;  4WU8 B;  3LJA B;  4CAY A;  3C1C A;  4E44 A;  5E5A B;  4R8P A;  3AZM D;  4KGC D;  3O62 B;  4YM6 D;  5CPK C;  3REL C;  4WU9 C;  2F8N D;  3W98 B;  4WJ3 C;  4UUZ A;  4J8W C;  4YS3 D;  3AZE C;  2CV5 D;  1P3F B;  2BYK B;  1P34 B;  3X1T B;  3AV2 B;  1KX3 C;  3WAA D;  1TAF B;  3UTA C;  3UTB D;  5CPJ A;  5JRG D;  4LD9 A;  1P3B D;  4NFT A;  2ARO C;  5B1M C;  5BS7 C;  1S32 B;  5B1L C;  5B0Z A;  4G92 C;  3A1I A;  5AV8 C;  4X23 A;  1Q9C A;  3MGP D;  3B6F B;  1P3B A;  3LZ1 A;  4WNN B;  1M18 D;  1B67 A;  5B0Y C;  2RVQ D;  1KX4 D;  4KUD C;  3C1C C;  3MNN A;  3AZF A;  2HIO C;  3F6T A;  3MGR C;  5AV5 D;  5B2I B;  1M1A D;  4JJN C;  3REK D;  4DRB A;  2Y2Q A;  1N1J A;  5AVB B;  3AZM C;  1P3I B;  3AZL B;  4KGC C;  3LZ0 B;  3REJ A;  5B24 D;  4YM6 C;  3TU4 B;  4DQY B;  1U35 A;  3REK A;  3WKJ A;  3UT9 D;  4G91 C;  4YS3 C;  2ZM5 A;  1P3P D;  3AZH D;  1A7W A;  3A6N A;  2CV5 C;  2YFW B;  4NE3 A;  5B32 B;  3KWQ A;  5DNM D;  5GXQ B;  3WAA C;  5AVC D;  1P3G D;  3WTP A;  3UT9 A;  3UTB C;  5JRG C;  3KFU G;  5GSU D;  1P3B C;  4NE6 A;  4Z5T A;  5AV6 B;  2Y2L A;  1KX5 B;  4CSR A;  1BFM A;  2NZD A;  5B31 D;  3AZN B;  2Y2J A;  1ZLA A;  2BYM B;  4XUJ B;  2FJ7 B;  3MGP C;  4H9Q A;  5GSU A;  3O62 A;  5CPK B;  1M18 C;  3WTP E;  3REI B;  1B6W A;  4QLC D;  2FFF B;  1W2E A;  4J8W B;  3R45 B;  1KX4 C;  2BYK A;  4J8U D;  3X1T A;  4UPK A;  3C1B D;  1TAF A;  4XZQ B;  4QLC A;  3W97 B;  5AV5 C;  1M1A C;  2ZY4 A;  3REK C;  5B1M B;  4J8U A;  3IP4 C;  5B1L B;  4Z66 D;  3C1B A;  1M19 D;  1HQ3 D;  5AV8 B;  3V9R A;  5B24 C;  3B6F A;  1H3O A;  3LEL D;  1P3M D;  4WNN A;  3KUY A;  5B0Y B;  4Z66 A;  5GT3 A;  3UT9 C;  5DNN B;  1P3P C;  3AZH C;  1HQ3 A;  3AV1 D;  3H0R C;  5DNM C;  5AVC C;  3X1V D;  1P3G C;  5GSU C;  5B2I A;  3MGR B;  4JJN B;  5B31 C;  2PYO B;  3X1V A;  5AVB A;  2NQB D;  3AZL A;  3MGS B;  3AZM B;  2JCH A;  3AN2 D;  5B40 A;  4YM6 B;  3W96 D;  2F8N B;  5CP6 D;  4QLC C;  3WA9 A;  1ULY A;  5BO0 B;  4G91 B;  5F99 A;  1P3L B;  3AZK A;  1ID3 D;  3REH B;  2CV5 B;  4J8U C;  4J8V A;  3C1B C;  3WAA B;  3AFA D;  3B6G D;  3AZJ D;  5B32 G;  5JRG B;  3B0D C;  1ID3 A;  1F66 A;  4Z66 C;  5JA4 B;  1M19 C;  1P3O B;  3AYW B;  3NQU B;  2BYM A;  1HQ3 C;  4XUJ A;  4ZUX D;  3AZG B;  5AY8 D;  3LEL C;  3MGP B;  1P3M C;  4R8P D;  3REI A;  1M18 B;  5KDM B;  4ZUX A;  3AV1 C;  5AV9 D;  1BH8 B;  3R45 A;  5AY8 A;  5GT0 B;  3X1V C;  4XZQ A;  2XD1 A;  5BNX B;  5AV5 B;  1M1A B;  5AV9 A;  1EQZ B;  5CPJ D;  4LD9 D;  1JFI B;  2NQB C;  3AN2 C;  2HUE C;  3EPL A;  5B0Z D;  5B24 B;  3W96 C;  4X23 D;  2Y2K A;  5G49 A;  5B33 B;  5CP6 C;  5BNV B;  3LZ1 D;  1R4V A;  1P3P B;  1ID3 C;  3AZH B;  3AL0 C;  3KXB B;  4EO5 B;  5DNM B;  3AFA C;  5AVC B;  3AZJ C;  3B6G C;  3X1S B;  3MNN D;  3AZF D;  4H9N B;  2PYO A;  5B31 B;  2VQR A;  4KHA B;  4ZUX C;  3MGS A;  5AY8 C;  1TZY A;  4H9O B;  4R8P C;  3MVD A;  3REJ D;  1P3K B;  1U35 D;  5AV9 C;  1P3L A;  3WKJ D;  2F8N G;  3REH A;  3MGQ D;  3X1U A;  5CPI A;  3A6N D;  1P3A B;  2JE5 A;  4J8X D;  3KWQ D;  2F2A C;  3WTP D;  5B2J A;  5CPJ C;  3AZI B;  3MGQ A;  4LD9 C;  1P3O A;  4Z5T D;  1AOI B;  1M19 B;  2JSS A;  4WU8 D;  4Z2M H;  4J8X A;  3AZG A;  2NZD D;  4AWL C;  5B0Z C;  3W99 B;  2YFV B;  3LEL B;  5E5A D;  1ZLA D;  4X23 C;  1BH9 B;  3O62 D;  3LZ1 C;  4WU8 A;  3LJA A;  2CWE A;  3W98 D;  3AV1 B;  5GT0 A;  5E5A A;  1P34 D;  3MNN C;  3AZF C;  3X1T D;  1EQZ A;  3REL B;  3W98 A;  4WU9 B;  2RVQ C;  2F8N K;  2NQB B;  2IO5 C;  1P3F A;  2ZY3 A;  3AZE B;  3AN2 B;  1S32 D;  1P34 A;  3AV2 A;  1WWI A;  1KX3 B;  3W96 B;  5B33 A;  3REJ C;  3B6F D;  3UTA B;  1U35 C;  2ARO B;  1S32 A;  3KUY D;  3WKJ C;  1HTA A;  2G5H C;  3VH5 T;  5GT3 D;  3KXB A;  3MGQ C;  4G92 B;  3A6N C;  3AFA B;  3AZJ B;  3B6G B;  4J8X C;  3FDD A;  3X1S A;  3KWQ C;  2W8S A;  3WTP C;  4H9S A;  4Z5T C;  5B2I D;  4WU8 C;  2NZD C;  4KUD B;  4CAY B;  3C1C B;  5B31 G;  4H9O A;  5E5A C;  5AVB D;  1ZLA C;  3NQJ B;  2HIO B;  4R8P B;  3AZL D;  1P3I D;  3O62 C;  5B40 D;  1P3K A;  3W98 C;  3WA9 D;  4UUZ B;  1P3I A;  5F99 D;  3LZ0 A;  1P3A A;  4KGC B;  3AZK D;  1P34 C;  3VH5 A;  2J8P A;  2Y2H A;  4J8V D;  3TU4 A;  3X1T C;  3AZI A;  1KX5 D;  1AOI A;  4LD9 B;  4YS3 B;  2YFW A;  1S32 C;  5B32 A;  1F66 D;  5GXQ A;  3W99 A;  3AZN D;  5B0Z B;  2YFV A;  4HGA C;  5FUG B;  4XUJ D;  2FJ7 D;  4X23 B;  4WZS B;  3B6F C;  1BH9 A;  3UTB B;  1KX5 A;  5AV6 A;  1P3B B;  5CPK D;  3KUY C;  3REI D;  1F1E A;  2DF4 C;  3P5J B;  5GT3 C;  3AZN A;  2FJ7 A;  3EG5 B;  3A1K A;  5CPK A;  3MNN B;  2L5A A;  4XZQ D;  5CHL B;  3W97 D;  5B2I C;  3B0C T;  4M6B A;  4J8W A;  1KX4 B;  2ZY5 A;  3AZE A;  5AVB C;  1KX3 A;  1P3I C;  3AZL C;  1N1J B;  3W97 A;  2DQN C;  3UTA A;  5B40 C;  3VH5 W;  2ARO A;  5B1M A;  5BS7 A;  1U35 B;  3REK B;  5B1L A;  3WA9 C;  5DNN D;  5F99 C;  3AZK C;  5AV8 A;  3A6N B;  4J8V C;  3KWQ B;  2Y2N A;  2Y2P A;  5B0Y A;  3UT9 B;  3VH6 T;  1KX5 C;  5DNN A;  4CSR B;  1F66 C;  4KUD A;  2PYO D;  2NZD B;  3AZN C;  1WWS A;  3NQJ A;  2HIO A;  4XUJ C;  3MGS D;  1P3G B;  1ZLA B;  2FJ7 C;  2UWX A;  4H9Q B;  5GSU B;  3MGR A;  1TZY D;  4JJN A;  3MVD D;  3REI C;  4H9R B;  1Z2C B;  3AZM A;  4KGC A;  1P3L D;  3REH D;  5BT1 D;  4YM6 A;  4XZQ C;  2F8N A;  3X1U D;  5CPI D;  3W97 C;  1KU5 A;  4QLC B;  5BO0 A;  3H0M C;  4YS3 A;  2CV5 A;  2F8N H;  5B2J D;  2RIQ A;  4J8U B;  3VH6 A;  1P3O D;  3WAA A;  3C1B B;  3AYW D;  4HGA B;  5FUG A;  3AZG D;  3UTB A;  3V9R B;  5JRG A;  1H3O B;  3B0D B;  3KUY B;  5JA4 A;  4Z66 B;  5GT3 B;  5DNN C;  3NQU A;  3AYW A;  5C3I C;  3LJA D;  1HQ3 B;  5GT0 D;  3MGP A;  3KSY A;  4H9P B;  1P3M B;  3EPH A;  1M18 A;  3B0C W;  5KDM A;  2G5I C;  1EQZ D;  1BH8 A; 
#chains in the Genus database with same CATH homology
 1KX4 A;  2PYO C;  1PZR A;  3X1V B;  3MGS C;  1P3F D;  4ZBJ C;  5BNX A;  1TZY C;  5AV5 A;  3AV2 D;  5B40 B;  3MVD C;  1M1A A;  4WV4 B;  5B33 D;  1JFI A;  2BG1 A;  3WA9 B;  1P3L C;  5F99 B;  2HUE B;  4Z2M G;  5BT1 C;  3REH C;  3AZK B;  5B24 A;  3KXB D;  2Y2O A;  3VH6 W;  4J8V B;  3X1U C;  5CPI C;  5BNV A;  2Y2M A;  5CP6 B;  3X1S D;  1P3P A;  3AZH A;  1ID3 B;  5B2J C;  1F66 B;  5DNM A;  1P3O C;  4E45 A;  5AVC A;  3AYW C;  1P3G A;  3AZG C;  4H9N A;  5B31 A;  4H9R A;  4KHA A;  3LJA C;  1P3K D;  2LY8 A;  4ZUX B;  5GT0 C;  5AY8 B;  3LZ0 D;  1P3A D;  3TU4 D;  1EQZ C;  5AV9 B;  3AZI D;  1AOI D;  1P3F C;  5B32 D;  5GXQ D;  3W99 D;  3AV2 C;  5B33 C;  3H0L C;  5G49 B;  5CPJ B;  5AV6 D;  1M19 A;  5C3I B;  3KXB C;  4EO5 C;  4AWL B;  3LEL A;  4H9P A;  1P3M A;  1T3U A;  4DRA A;  3X1S C;  3LZ1 B;  3REL D;  4WU9 D;  3AV1 A;  3EPJ A;  4H9S C;  4J8W D;  3AZE D;  4ZBJ B;  3REL A;  2XD5 A;  3AZF B;  4WU9 A;  1TZY B;  2Y2I A;  1KX3 D;  3MVD B;  3UTA D;  1P3K C;  2ARO D;  2NQB A;  5B1M D;  3AN2 A;  2IO5 B;  5B1L D;  3W96 A;  3LZ0 C;  1P3A C;  5AV8 D;  3X1U B;  5CPI B;  5CP6 A;  3REJ B;  3TU4 C;  5B0Y D;  3B0B A;  3WKJ B;  3AZI C;  5B2J B;  1AOI C;  3MGQ B;  3AFA A;  3B6G A;  3AZJ A;  5B32 C;  4KUD D;  2ZY2 A;  3W99 C;  5GXQ C;  3C1C D;  4J8X B;  4NE5 A;  2HIO D;  3EPK A;  3WTP B;  5AV6 C;  2Y2G A;  3MGR D;  4Z5T B;  4JJN D;  4WU8 B;  3LJA B;  4CAY A;  3C1C A;  4E44 A;  5E5A B;  4R8P A;  3AZM D;  4KGC D;  3O62 B;  4YM6 D;  5CPK C;  3REL C;  4WU9 C;  2F8N D;  3W98 B;  4WJ3 C;  4UUZ A;  4J8W C;  4YS3 D;  3AZE C;  2CV5 D;  1P3F B;  2BYK B;  1P34 B;  3X1T B;  3AV2 B;  1KX3 C;  3WAA D;  1TAF B;  3UTA C;  3UTB D;  5CPJ A;  5JRG D;  4LD9 A;  1P3B D;  4NFT A;  2ARO C;  5B1M C;  5BS7 C;  1S32 B;  5B1L C;  5B0Z A;  4G92 C;  3A1I A;  5AV8 C;  4X23 A;  1Q9C A;  3MGP D;  3B6F B;  1P3B A;  3LZ1 A;  4WNN B;  1M18 D;  1B67 A;  5B0Y C;  2RVQ D;  1KX4 D;  4KUD C;  3C1C C;  3MNN A;  3AZF A;  2HIO C;  3F6T A;  3MGR C;  5AV5 D;  5B2I B;  1M1A D;  4JJN C;  3REK D;  4DRB A;  2Y2Q A;  1N1J A;  5AVB B;  3AZM C;  1P3I B;  3AZL B;  4KGC C;  3LZ0 B;  3REJ A;  5B24 D;  4YM6 C;  3TU4 B;  4DQY B;  1U35 A;  3REK A;  3WKJ A;  3UT9 D;  4G91 C;  4YS3 C;  2ZM5 A;  1P3P D;  3AZH D;  1A7W A;  3A6N A;  2CV5 C;  2YFW B;  4NE3 A;  5B32 B;  3KWQ A;  5DNM D;  5GXQ B;  3WAA C;  5AVC D;  1P3G D;  3WTP A;  3UT9 A;  3UTB C;  5JRG C;  3KFU G;  5GSU D;  1P3B C;  4NE6 A;  4Z5T A;  5AV6 B;  2Y2L A;  1KX5 B;  4CSR A;  1BFM A;  2NZD A;  5B31 D;  3AZN B;  2Y2J A;  1ZLA A;  2BYM B;  4XUJ B;  2FJ7 B;  3MGP C;  4H9Q A;  5GSU A;  3O62 A;  5CPK B;  1M18 C;  3WTP E;  3REI B;  1B6W A;  4QLC D;  2FFF B;  1W2E A;  4J8W B;  3R45 B;  1KX4 C;  2BYK A;  4J8U D;  3X1T A;  4UPK A;  3C1B D;  1TAF A;  4XZQ B;  4QLC A;  3W97 B;  5AV5 C;  1M1A C;  2ZY4 A;  3REK C;  5B1M B;  4J8U A;  3IP4 C;  5B1L B;  4Z66 D;  3C1B A;  1M19 D;  1HQ3 D;  5AV8 B;  3V9R A;  5B24 C;  3B6F A;  1H3O A;  3LEL D;  1P3M D;  4WNN A;  3KUY A;  5B0Y B;  4Z66 A;  5GT3 A;  3UT9 C;  5DNN B;  1P3P C;  3AZH C;  1HQ3 A;  3AV1 D;  3H0R C;  5DNM C;  5AVC C;  3X1V D;  1P3G C;  5GSU C;  5B2I A;  3MGR B;  4JJN B;  5B31 C;  2PYO B;  3X1V A;  5AVB A;  2NQB D;  3AZL A;  3MGS B;  3AZM B;  2JCH A;  3AN2 D;  5B40 A;  4YM6 B;  3W96 D;  2F8N B;  5CP6 D;  4QLC C;  3WA9 A;  1ULY A;  5BO0 B;  4G91 B;  5F99 A;  1P3L B;  3AZK A;  1ID3 D;  3REH B;  2CV5 B;  4J8U C;  4J8V A;  3C1B C;  3WAA B;  3AFA D;  3B6G D;  3AZJ D;  5B32 G;  5JRG B;  3B0D C;  1ID3 A;  1F66 A;  4Z66 C;  5JA4 B;  1M19 C;  1P3O B;  3AYW B;  3NQU B;  2BYM A;  1HQ3 C;  4XUJ A;  4ZUX D;  3AZG B;  5AY8 D;  3LEL C;  3MGP B;  1P3M C;  4R8P D;  3REI A;  1M18 B;  5KDM B;  4ZUX A;  3AV1 C;  5AV9 D;  1BH8 B;  3R45 A;  5AY8 A;  5GT0 B;  3X1V C;  4XZQ A;  2XD1 A;  5BNX B;  5AV5 B;  1M1A B;  5AV9 A;  1EQZ B;  5CPJ D;  4LD9 D;  1JFI B;  2NQB C;  3AN2 C;  2HUE C;  3EPL A;  5B0Z D;  5B24 B;  3W96 C;  4X23 D;  2Y2K A;  5G49 A;  5B33 B;  5CP6 C;  5BNV B;  3LZ1 D;  1R4V A;  1P3P B;  1ID3 C;  3AZH B;  3AL0 C;  3KXB B;  4EO5 B;  5DNM B;  3AFA C;  5AVC B;  3AZJ C;  3B6G C;  3X1S B;  3MNN D;  3AZF D;  4H9N B;  2PYO A;  5B31 B;  2VQR A;  4KHA B;  4ZUX C;  3MGS A;  5AY8 C;  1TZY A;  4H9O B;  4R8P C;  3MVD A;  3REJ D;  1P3K B;  1U35 D;  5AV9 C;  1P3L A;  3WKJ D;  2F8N G;  3REH A;  3MGQ D;  3X1U A;  5CPI A;  3A6N D;  1P3A B;  2JE5 A;  4J8X D;  3KWQ D;  2F2A C;  3WTP D;  5B2J A;  5CPJ C;  3AZI B;  3MGQ A;  4LD9 C;  1P3O A;  4Z5T D;  1AOI B;  1M19 B;  2JSS A;  4WU8 D;  4Z2M H;  4J8X A;  3AZG A;  2NZD D;  4AWL C;  5B0Z C;  3W99 B;  2YFV B;  3LEL B;  5E5A D;  1ZLA D;  4X23 C;  1BH9 B;  3O62 D;  3LZ1 C;  4WU8 A;  3LJA A;  2CWE A;  3W98 D;  3AV1 B;  5GT0 A;  5E5A A;  1P34 D;  3MNN C;  3AZF C;  3X1T D;  1EQZ A;  3REL B;  3W98 A;  4WU9 B;  2RVQ C;  2F8N K;  2NQB B;  2IO5 C;  1P3F A;  2ZY3 A;  3AZE B;  3AN2 B;  1S32 D;  1P34 A;  3AV2 A;  1WWI A;  1KX3 B;  3W96 B;  5B33 A;  3REJ C;  3B6F D;  3UTA B;  1U35 C;  2ARO B;  1S32 A;  3KUY D;  3WKJ C;  1HTA A;  2G5H C;  3VH5 T;  5GT3 D;  3KXB A;  3MGQ C;  4G92 B;  3A6N C;  3AFA B;  3AZJ B;  3B6G B;  4J8X C;  3FDD A;  3X1S A;  3KWQ C;  2W8S A;  3WTP C;  4H9S A;  4Z5T C;  5B2I D;  4WU8 C;  2NZD C;  4KUD B;  4CAY B;  3C1C B;  5B31 G;  4H9O A;  5E5A C;  5AVB D;  1ZLA C;  3NQJ B;  2HIO B;  4R8P B;  3AZL D;  1P3I D;  3O62 C;  5B40 D;  1P3K A;  3W98 C;  3WA9 D;  4UUZ B;  1P3I A;  5F99 D;  3LZ0 A;  1P3A A;  4KGC B;  3AZK D;  1P34 C;  3VH5 A;  2J8P A;  2Y2H A;  4J8V D;  3TU4 A;  3X1T C;  3AZI A;  1KX5 D;  1AOI A;  4LD9 B;  4YS3 B;  2YFW A;  1S32 C;  5B32 A;  1F66 D;  5GXQ A;  3W99 A;  3AZN D;  5B0Z B;  2YFV A;  4HGA C;  5FUG B;  4XUJ D;  2FJ7 D;  4X23 B;  4WZS B;  3B6F C;  1BH9 A;  3UTB B;  1KX5 A;  5AV6 A;  1P3B B;  5CPK D;  3KUY C;  3REI D;  1F1E A;  2DF4 C;  3P5J B;  5GT3 C;  3AZN A;  2FJ7 A;  3EG5 B;  3A1K A;  5CPK A;  3MNN B;  2L5A A;  4XZQ D;  5CHL B;  3W97 D;  5B2I C;  3B0C T;  4M6B A;  4J8W A;  1KX4 B;  2ZY5 A;  3AZE A;  5AVB C;  1KX3 A;  1P3I C;  3AZL C;  1N1J B;  3W97 A;  2DQN C;  3UTA A;  5B40 C;  3VH5 W;  2ARO A;  5B1M A;  5BS7 A;  1U35 B;  3REK B;  5B1L A;  3WA9 C;  5DNN D;  5F99 C;  3AZK C;  5AV8 A;  3A6N B;  4J8V C;  3KWQ B;  2Y2N A;  2Y2P A;  5B0Y A;  3UT9 B;  3VH6 T;  1KX5 C;  5DNN A;  4CSR B;  1F66 C;  4KUD A;  2PYO D;  2NZD B;  3AZN C;  1WWS A;  3NQJ A;  2HIO A;  4XUJ C;  3MGS D;  1P3G B;  1ZLA B;  2FJ7 C;  2UWX A;  4H9Q B;  5GSU B;  3MGR A;  1TZY D;  4JJN A;  3MVD D;  3REI C;  4H9R B;  1Z2C B;  3AZM A;  4KGC A;  1P3L D;  3REH D;  5BT1 D;  4YM6 A;  4XZQ C;  2F8N A;  3X1U D;  5CPI D;  3W97 C;  1KU5 A;  4QLC B;  5BO0 A;  3H0M C;  4YS3 A;  2CV5 A;  2F8N H;  5B2J D;  2RIQ A;  4J8U B;  3VH6 A;  1P3O D;  3WAA A;  3C1B B;  3AYW D;  4HGA B;  5FUG A;  3AZG D;  3UTB A;  3V9R B;  5JRG A;  1H3O B;  3B0D B;  3KUY B;  5JA4 A;  4Z66 B;  5GT3 B;  5DNN C;  3NQU A;  3AYW A;  5C3I C;  3LJA D;  1HQ3 B;  5GT0 D;  3MGP A;  3KSY A;  4H9P B;  1P3M B;  3EPH A;  1M18 A;  3B0C W;  5KDM A;  2G5I C;  1EQZ D;  1BH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...