3AV2B

The human nucleosome structure containing the histone variant h3.3
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
78
structure length
78
Chain Sequence
b'NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
publication title Structures of human nucleosomes containing major histone H3 variants
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein/dna
total genus 27
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3av2B00
3W97A 4XUJD 3KUYC 5F99A 1P3IC 2AROD 5AVCB 4JJNB 3AV2A 4AWLB 1TZYB 3AZJC 5GT0C 2F8ND 3O62C 4DRBA 2AROB 1P34D 4YM6B 2HUEC 4XZQA 3MGSD 3MGQD 5DNMC 2F8NB 4DRAA 3MGRD 1P3LA 2NQBC 3W96C 4YS3B 5CPJA 3B6GD 3KXBA 3MVDD 5B2JA 3MNNC 1S32B 4Z5TA 1ID3C 4H9PA 3MGQB 3X1VD 4R8PC 3C1CC 4H9NA 3WAAA 5CP6C 3MGRB 3REJB 3MVDB 3WTPD 3X1VB 1KX4B 1KX5D 4ZUXD 1P3FB 3LELA 3A6NC 3VH6T 3AV1C 5BS7A 3X1UC 5AV8D 3LJAA 3UTAC 4J8XB 3B0CT 1ZLAD 5CPIC 4Z66B 3AZNC 4G91B 4H9RA 3C1BA 5B2ID 5CPKC 5GSUA 5B24C 2NZDB 3X1SC 3W99C 1P3AD 3AZEC 4NE5A 5B2IB 5B0YD 3WA9D 4KUDA 5B32B 4WU8B 5AVBC 4J8VC 5B40C 1Q9CA 1AOIB 5KDMB 1BH9B 5AVCC 5GXQB 3KUYA 4JJNC 1P3ID 4AWLC 1TZYC 2JSSA 2BYKA 3AZJA 5GT0A 2CV5B 5GT0D 2BYMA 3O62D 2AROC 4YM6C 1M19B 4HGAB 4CAYA 5DNMA 5B1MD 3AZGA 3AZLB 1ULYA 1P3BB 4YS3C 5E5AA 2NQBA 4QLCD 1S32C 3W96A 3R45A 4J8WD 2FJ7D 4KHAA 3MGSC 3W96D 1KX3A 3MGQC 3MNND 5JA4A 1ID3D 3MGRC 5B1MB 4R8PA 4UUZA 3C1CD 5CP6A 3REJC 3MVDC 4QLCB 2FJ7B 4J8WB 4EO5B 5AY8A 3X1VC 1KX4C 1P3FC 5B1LA 1H3OB 1TAFB 3AZMD 3LZ0B 3A6NA 3RELB 3AV1A 3AV1D 4ZUXC 3X1UA 1R4VA 4J8XC 3REKB 3UTAA 4CSRB 3AZMB 4Z66C 1P3PA 4G91C 5CPID 3AZNA 3NQJB 4H9QA 3REIB 2NZDC 5CPKD 5B24D 3X1SD 5JRGD 1P3KA 3NQUB 3KWQB 1EQZD 3W99D 5B2IC 5AV9B 3UT9B 3AZEA 3AZKA 5B32C 4WU8C 1AOIC 5DNND 3AZID 1P3MA 5B40A 5B40D 5AVBD 4J8VA 5JRGB 3LZ1D 1M18A 1EQZB 1JFIB 5GXQC 3REHA 3AYWD 5AVCA 5DNNB 3AZIB 3WKJD 4JJNA 5BT1C 3LZ1B 1TZYA 2LY8A 2CV5C 4XUJA 3AYWB 1M19C 2AROA 4HGAC 3WKJB 4YM6A 4YM6D 2F8NA 3AZLC 1P3BC 4X23D 3VH5A 5BNVA 4YS3D 3TU4B 4ZBJB 1P34A 1S32D 3MGSA 5AV5B 3MGQA 4G92B 1P3OB 3B0DB 5B1MC 4X23B 3MGPB 3MGRA 4QLCC 3VH6A 2FJ7C 4J8WC 3B6GA 2YFWB 5G49B 4EO5C 4WNNB 5FUGB 3MVDA 3REJD 4Z2MG 3X1VA 1KX4D 1P3FD 3AN2B 4LD9D 3X1TD 5B33D 3RELC 3VH5T 3WTPA 3REKC 1KX5A 4ZUXA 1WWIA 3AZMC 3W97B 4J8XD 1P3GB 2F8NG 4LD9B 3X1TB 5B33B 3AV2B 4Z2MH 5AV8A 3AZHD 4Z66D 3REIC 3W98D 2NZDD 4XZQB 3KWQC 1ZLAA 3AZHB 3UT9C 2IO5B 5CPJB 5B2IA 2F8NH 5B32D 4WU8D 4Z5TB 3W98B 5JRGC 1AOID 4H9PB 1EQZC 1P3AA 5KDMA 1A7WA 5B0YA 5DNNC 5GXQA 5GXQD 1F1EA 3AZIC 3WA9A 3LZ1C 2PYOB 5BT1D 2CV5D 2CWEA 3AYWC 4J8UD 3WKJC 1P3IA 1M19D 3LJAB 3B0BA 3AZLD 1P3BD 3TU4C 3O62A 1U35D 4J8UB 4ZBJC 3UTBB 5AV5C 4G92C 1P3OC 3B0DC 2RVQD 4X23C 3MGPC 5B1MA 4H9SC 1U35B 4QLCA 2FJ7A 4J8WA 3MNNA 1ID3A 1H3OA 1TAFA 3AN2C 3C1CA 4KUDB 3LZ0D 3RELA 3RELD 5CHLB 5GT3B 3W97C 5BO0B 3REKA 3REKD 1P3GC 3AZMA 3X1TC 4LD9C 5B33C 3AV2C 4M6BA 2BYKB 5B31D 2F8NK 2BYMB 3VH5W 3NQJA 3REID 1F66D 3AZHC 3NQUA 4NE6A 3KWQD 3AZGB 2IO5C 5CPIA 5B31B 5CPJC 3VH6W 5E5AB 5AV9D 3UT9D 3R45B 4NE3A 4Z5TC 3W98C 5CPKA 1KX3B 5B24A 1F66B 3X1SA 5JRGA 3V9RB 1EQZA 3W99A 4WU9D 1N1JA 2YFVB 1JFIA 4H9OB 5B0ZB 3WTPE 3B0CW 3B6FD 5DNNA 3AZIA 5AY8B 5AVBA 2PYOC 3LZ1A 5B1LB 4WU9B 2HIOD 3B6FB 4NFTA 3AYWA 1M1AB 3WKJA 5C3IB 4J8UC 3UTBC 2HIOB 1HQ3D 3TU4D 4KGCD 1P3PB 3AZFD 1WWSA 5AV5D 4WZSB 1P3OD 1P3OA 4X23A 1U35C 4H9QB 3MGPD 5BNXB 4YS3A 1HQ3B 4KGCB 2YFWA 5G49A 4WNNA 5FUGA 1S32A 1P3KB 2RVQC 3AZFB 3AFAD 3AZKB 4KUDC 3AN2D 1P3MB 3REJA 1M18B 5AV6B 5GT3C 3AFAB 1KX4A 1BH8B 1P3FA 3REHB 3W97D 3LZ0C 5F99D 1P3GA 1P3GD 4LD9A 1HTAA 3X1TA 5B33A 3AV2D 4XUJB 4J8XA 5F99B 4XZQD 3AZGC 5B31C 3AZHA 4Z66A 5E5AC 1P3LD 4WV4B 5BNVB 5CPJD 1KX3C 3KXBD 1P34B 5B2JD 3W98A 1F66C 4Z5TD 3MGSB 2NZDA 4E44A 3WAAD 5AV9C 5B0ZC 1P3LB 3B6GB 5AY8C 3KXBB 4WU8A 5B2JB 5B32A 1AOIA 5B1LC 2PYOA 4WU9C 2PYOD 4H9NB 3WAAB 1BH9A 3LELD 3B6FC 1M1AC 3WTPB 1KX5B 5C3IC 4ZUXB 3LJAD 2HIOC 2CV5A 3LELB 4J8UA 3UTBA 3UTBD 1P3PC 1M19A 5AV8B 3AZLA 1P3BA 3C1BD 1U35A 1B67A 1HQ3C 4KGCC 5GSUD 1P3KC 3AZFC 1ZLAB 5B32G 3AZKC 4H9RB 3C1BB 1P3MC 5GSUB 4KUDD 1M18C 5AV6C 1P3AB 3AFAC 5GT3A 3REHC 5BO0A 5GT3D 5B0YB 3WA9B 3LZ0A 3KUYD 3AZJD 4XUJC 5F99C 4CSRA 3KUYB 1P3IB 1BFMA 3AZJB 5DNMD 3AZGD 5GT0B 5B31A 3O62B 5E5AD 2NQBD 3REIA 1P34C 4XZQC 1KX3D 1F66A 2HUEB 4CAYB 3V9RA 3KWQA 5DNMB 1P3LC 2YFVA 4R8PD 3B6GC 4H9OA 5AV9A 5CP6D 5B0ZA 3KXBC 5B0ZD 3UT9A 5B2JC 2NQBB 3W96B 4KHAB 5AY8D 3MNNB 1ID3B 5JA4B 3WAAC 5B1LD 4WU9A 4R8PB 3C1CB 4UUZB 5CP6B 3B6FA 3WTPC 1M1AA 1M1AD 3A6ND 1KX5C 3X1UD 3KSYA 3LELC 2HIOA 3UTAD 2L5AA 4E45A 5BS7C 5B31G 3A6NB 5AV8C 3AV1B 1P3PD 3LJAC 3X1UB 3AZND 1B6WA 5BNXA 3UTAB 1HQ3A 3TU4A 4KGCA 1ZLAC 3AZFA 1P3KD 5AV5A 5CPIB 3C1BC 3MGPA 3AZNB 3AZED 3AZKD 5GSUC 4H9SA 5CPKB 1P3MD 5B24B 4J8VD 3X1SB 1P3AC 5AV6A 1M18D 5AV6D 3W99B 3AFAA 1N1JB 5B0YC 1BH8A 3AZEB 1KU5A 3WA9C 3REHD 3AN2A 5AVCD 5B40B 5AVBB 4J8VB 4JJND 1TZYD
chains in the Genus database with same CATH superfamily
3W97A 4XUJD 3KUYC 5F99A 1P3IC 2AROD 5AVCB 4JJNB 3AV2A 4AWLB 1TZYB 2Y2IA 3AZJC 5GT0C 2F8ND 3O62C 4DRBA 2AROB 1P34D 4YM6B 2HUEC 4XZQA 3MGSD 3MGQD 5DNMC 2F8NB 4DRAA 3MGRD 1P3LA 2NQBC 3W96C 4YS3B 5CPJA 3B6GD 3KXBA 3MVDD 5B2JA 3MNNC 1S32B 4Z5TA 1ID3C 4H9PA 3MGQB 3X1VD 4R8PC 3C1CC 4H9NA 3WAAA 5CP6C 3MGRB 3REJB 3MVDB 3WTPD 3X1VB 2FFFB 1KX4B 4ZUXD 1KX5D 1P3FB 3LELA 2Y2JA 1Z2CB 3A6NC 3VH6T 3AV1C 5BS7A 3X1UC 5AV8D 3LJAA 2ZY3A 3UTAC 4J8XB 3B0CT 1ZLAD 5CPIC 3P5JB 4Z66B 3AZNC 4G91B 4H9RA 3C1BA 5B2ID 5CPKC 5GSUA 5B24C 2NZDB 3X1SC 3W99C 1P3AD 3AZEC 1PZRA 4NE5A 5B2IB 5B0YD 3WA9D 4KUDA 5B32B 4WU8B 5AVBC 4J8VC 5B40C 1Q9CA 1AOIB 5KDMB 1BH9B 5AVCC 5GXQB 3KUYA 4JJNC 1P3ID 4AWLC 1TZYC 2W8SA 2JSSA 2BYKA 3AZJA 2BG1A 5GT0A 2CV5B 5GT0D 2BYMA 3O62D 2AROC 4YM6C 1M19B 4HGAB 4CAYA 5DNMA 5B1MD 3AZGA 3AZLB 1ULYA 1P3BB 4YS3C 5E5AA 2NQBA 4QLCD 1S32C 3W96A 3R45A 4J8WD 2FJ7D 4KHAA 3MGSC 3W96D 1KX3A 3MGQC 3MNND 5JA4A 1ID3D 3MGRC 5B1MB 4R8PA 4UUZA 3C1CD 5CP6A 3REJC 3MVDC 4QLCB 2FJ7B 4J8WB 4EO5B 5AY8A 3X1VC 1KX4C 1P3FC 5B1LA 1H3OB 1TAFB 3AZMD 3LZ0B 3EPLA 3A6NA 3RELB 3AV1A 3AV1D 4ZUXC 3X1UA 1R4VA 4J8XC 3REKB 3UTAA 4CSRB 3AZMB 4Z66C 1P3PA 4G91C 5CPID 3AZNA 3NQJB 4H9QA 3REIB 3H0LC 2NZDC 5CPKD 5B24D 3X1SD 5JRGD 1P3KA 3NQUB 3KWQB 1EQZD 3W99D 5B2IC 5AV9B 3UT9B 3AZEA 3AZKA 5B32C 4WU8C 3H0RC 1AOIC 5DNND 3AZID 1P3MA 5B40A 5B40D 5AVBD 4J8VA 5JRGB 3LZ1D 1M18A 1EQZB 1JFIB 5GXQC 3REHA 3AYWD 5AVCA 5DNNB 3AZIB 3WKJD 4JJNA 5BT1C 3LZ1B 1TZYA 2LY8A 2CV5C 2Y2NA 4XUJA 3AYWB 1M19C 2AROA 1T3UA 2Y2MA 4HGAC 3WKJB 4YM6A 4YM6D 2F8NA 3AZLC 1P3BC 3H0MC 4X23D 3VH5A 5BNVA 4YS3D 3TU4B 4ZBJB 1P34A 1S32D 3MGSA 5AV5B 3MGQA 4G92B 1P3OB 3B0DB 5B1MC 4X23B 3MGPB 3MGRA 4QLCC 3VH6A 2FJ7C 4J8WC 3B6GA 2YFWB 5G49B 4EO5C 4WNNB 5FUGB 3MVDA 3REJD 4Z2MG 3X1VA 1KX4D 1P3FD 3AN2B 4LD9D 3X1TD 5B33D 3RELC 3VH5T 3WTPA 3REKC 1KX5A 4ZUXA 1WWIA 3AZMC 3W97B 3EPKA 4J8XD 1P3GB 3KFUG 2F8NG 4LD9B 3X1TB 5B33B 3AV2B 4Z2MH 5AV8A 3AZHD 4Z66D 3REIC 3W98D 2NZDD 4XZQB 3KWQC 1ZLAA 3AZHB 3UT9C 2IO5B 3A1IA 5CPJB 5B2IA 2F8NH 5B32D 4WU8D 4Z5TB 3W98B 5JRGC 1AOID 4H9PB 1EQZC 1P3AA 5KDMA 1A7WA 2XD1A 2VQRA 5B0YA 5DNNC 5GXQA 5GXQD 1F1EA 3AZIC 3WA9A 3LZ1C 2PYOB 5BT1D 2J8PA 2CV5D 2CWEA 3AYWC 4J8UD 3WKJC 1P3IA 1M19D 3LJAB 3B0BA 3AZLD 1P3BD 3TU4C 3O62A 1U35D 4J8UB 4ZBJC 3UTBB 2G5IC 5AV5C 4G92C 1P3OC 3B0DC 2RVQD 4X23C 3MGPC 3FDDA 5B1MA 4H9SC 1U35B 4QLCA 2FJ7A 4J8WA 4UPKA 3MNNA 1ID3A 1H3OA 1TAFA 3AN2C 3C1CA 4DQYB 4KUDB 3LZ0D 2F2AC 3RELA 3RELD 5CHLB 5GT3B 3W97C 5BO0B 3REKA 3REKD 1P3GC 3AZMA 3X1TC 4LD9C 5B33C 3AV2C 4M6BA 2BYKB 5B31D 2F8NK 2BYMB 3VH5W 3NQJA 3REID 2ZY5A 1F66D 3AZHC 3NQUA 4NE6A 4WJ3C 3KWQD 3AZGB 2IO5C 5CPIA 5B31B 5CPJC 3VH6W 5E5AB 5AV9D 3UT9D 3R45B 4NE3A 4Z5TC 3W98C 5CPKA 1KX3B 5B24A 1F66B 3X1SA 5JRGA 3V9RB 1EQZA 3W99A 4WU9D 1N1JA 2YFVB 1JFIA 4H9OB 5B0ZB 3WTPE 3B0CW 3B6FD 5DNNA 3AZIA 5AY8B 5AVBA 2PYOC 3LZ1A 5B1LB 3EPHA 4WU9B 2HIOD 3B6FB 4NFTA 3AYWA 1M1AB 3WKJA 5C3IB 4J8UC 3UTBC 2HIOB 2XD5A 1HQ3D 3TU4D 4KGCD 1P3PB 3AZFD 1WWSA 5AV5D 4WZSB 2Y2GA 1P3OD 1P3OA 4X23A 1U35C 4H9QB 3MGPD 5BNXB 4YS3A 1HQ3B 4KGCB 2YFWA 5G49A 4WNNA 5FUGA 1S32A 1P3KB 2RVQC 3AZFB 3AFAD 3AZKB 4KUDC 3AN2D 1P3MB 3REJA 1M18B 5AV6B 5GT3C 3AFAB 1KX4A 1BH8B 1P3FA 3REHB 3AL0C 3W97D 3LZ0C 5F99D 1P3GA 1P3GD 4LD9A 1HTAA 3X1TA 5B33A 2JCHA 3AV2D 4XUJB 4J8XA 5F99B 4XZQD 3AZGC 5B31C 3AZHA 4Z66A 5E5AC 1P3LD 4WV4B 5BNVB 5CPJD 1KX3C 3KXBD 1P34B 5B2JD 3W98A 1F66C 4Z5TD 3MGSB 2NZDA 4E44A 3WAAD 5AV9C 5B0ZC 1P3LB 3B6GB 5AY8C 3KXBB 5B32A 5B2JB 4WU8A 1AOIA 5B1LC 2PYOA 4WU9C 2PYOD 4H9NB 3WAAB 2JE5A 1BH9A 3LELD 3A1KA 3B6FC 1M1AC 3WTPB 2DQNC 5C3IC 4ZUXB 3LJAD 2HIOC 1KX5B 2CV5A 3LELB 4J8UA 3UTBA 3UTBD 1P3PC 1M19A 5AV8B 3AZLA 1P3BA 3C1BD 1U35A 1B67A 1HQ3C 4KGCC 5GSUD 1P3KC 3AZFC 1ZLAB 2Y2OA 2RIQA 5B32G 3AZKC 2Y2QA 4H9RB 3C1BB 1P3MC 5GSUB 4KUDD 2ZM5A 1M18C 5AV6C 1P3AB 3AFAC 2Y2LA 5GT3A 3REHC 5BO0A 5GT3D 5B0YB 3WA9B 3LZ0A 3KUYD 3EG5B 2Y2PA 3AZJD 4XUJC 5F99C 4CSRA 3KUYB 1P3IB 1BFMA 3IP4C 3AZJB 5DNMD 3AZGD 5GT0B 5B31A 3O62B 5E5AD 2NQBD 3REIA 1P34C 2Y2HA 4XZQC 1KX3D 1F66A 2HUEB 4CAYB 3V9RA 3KWQA 5DNMB 1P3LC 2YFVA 4R8PD 3B6GC 2ZY2A 4H9OA 5AV9A 5CP6D 5B0ZA 3KXBC 5B0ZD 3UT9A 2G5HC 5B2JC 3W96B 2NQBB 4KHAB 2ZY4A 2Y2KA 5AY8D 3MNNB 1ID3B 5JA4B 3WAAC 5B1LD 4WU9A 4R8PB 3C1CB 4UUZB 5CP6B 3B6FA 3WTPC 1M1AA 1W2EA 1M1AD 3A6ND 1KX5C 3X1UD 3KSYA 3LELC 2UWXA 2HIOA 3UTAD 2L5AA 4E45A 5BS7C 5B31G 3A6NB 5AV8C 3AV1B 2DF4C 1P3PD 3LJAC 3X1UB 3AZND 1B6WA 5BNXA 3UTAB 1HQ3A 3TU4A 4KGCA 1ZLAC 3AZFA 1P3KD 5AV5A 5CPIB 3C1BC 3MGPA 3AZNB 3AZED 3AZKD 5GSUC 4H9SA 3EPJA 5CPKB 1P3MD 5B24B 4J8VD 3X1SB 1P3AC 5AV6A 1M18D 5AV6D 3W99B 3AFAA 1N1JB 5B0YC 1BH8A 3AZEB 1KU5A 3WA9C 3F6TA 3REHD 3AN2A 5AVCD 5B40B 5AVBB 4J8VB 4JJND 1TZYD
chains in the Genus database with same CATH topology
3W97A 4XUJD 3KUYC 5F99A 1P3IC 2AROD 5AVCB 4JJNB 3AV2A 4AWLB 1TZYB 2Y2IA 3AZJC 5GT0C 2F8ND 3O62C 4DRBA 2AROB 1P34D 4YM6B 2HUEC 4XZQA 3MGSD 3MGQD 5DNMC 2F8NB 4DRAA 3MGRD 1P3LA 2NQBC 3W96C 4YS3B 5CPJA 3B6GD 3KXBA 3MVDD 5B2JA 3MNNC 1S32B 4Z5TA 1ID3C 4H9PA 3MGQB 3X1VD 4R8PC 3C1CC 4H9NA 3WAAA 5CP6C 3MGRB 3REJB 3MVDB 3WTPD 3X1VB 2FFFB 1KX4B 4ZUXD 1KX5D 1P3FB 3LELA 2Y2JA 1Z2CB 3A6NC 3VH6T 3AV1C 5BS7A 3X1UC 5AV8D 3LJAA 2ZY3A 3UTAC 4J8XB 3B0CT 1ZLAD 5CPIC 3P5JB 4Z66B 3AZNC 4G91B 4H9RA 3C1BA 5B2ID 5CPKC 5GSUA 5B24C 2NZDB 3X1SC 3W99C 1P3AD 3AZEC 1PZRA 4NE5A 5B2IB 5B0YD 3WA9D 4KUDA 5B32B 4WU8B 5AVBC 4J8VC 5B40C 1Q9CA 1AOIB 5KDMB 1BH9B 5AVCC 5GXQB 3KUYA 4JJNC 1P3ID 4AWLC 1TZYC 2W8SA 2JSSA 2BYKA 3AZJA 2BG1A 5GT0A 2CV5B 5GT0D 2BYMA 3O62D 2AROC 4YM6C 1M19B 4HGAB 4CAYA 5DNMA 5B1MD 3AZGA 3AZLB 1ULYA 1P3BB 4YS3C 5E5AA 2NQBA 4QLCD 1S32C 3W96A 3R45A 4J8WD 2FJ7D 4KHAA 3MGSC 3W96D 1KX3A 3MGQC 3MNND 5JA4A 1ID3D 3MGRC 5B1MB 4R8PA 4UUZA 3C1CD 5CP6A 3REJC 3MVDC 4QLCB 2FJ7B 4J8WB 4EO5B 5AY8A 3X1VC 1KX4C 1P3FC 5B1LA 1H3OB 1TAFB 3AZMD 3LZ0B 3EPLA 3A6NA 3RELB 3AV1A 3AV1D 4ZUXC 3X1UA 1R4VA 4J8XC 3REKB 3UTAA 4CSRB 3AZMB 4Z66C 1P3PA 4G91C 5CPID 3AZNA 3NQJB 4H9QA 3REIB 3H0LC 2NZDC 5CPKD 5B24D 3X1SD 5JRGD 1P3KA 3NQUB 3KWQB 1EQZD 3W99D 5B2IC 5AV9B 3UT9B 3AZEA 3AZKA 5B32C 4WU8C 3H0RC 1AOIC 5DNND 3AZID 1P3MA 5B40A 5B40D 5AVBD 4J8VA 5JRGB 3LZ1D 1M18A 1EQZB 1JFIB 5GXQC 3REHA 3AYWD 5AVCA 5DNNB 3AZIB 3WKJD 4JJNA 5BT1C 3LZ1B 1TZYA 2LY8A 2CV5C 2Y2NA 4XUJA 3AYWB 1M19C 2AROA 1T3UA 2Y2MA 4HGAC 3WKJB 4YM6A 4YM6D 2F8NA 3AZLC 1P3BC 3H0MC 4X23D 3VH5A 5BNVA 4YS3D 3TU4B 4ZBJB 1P34A 1S32D 3MGSA 5AV5B 3MGQA 4G92B 1P3OB 3B0DB 5B1MC 4X23B 3MGPB 3MGRA 4QLCC 3VH6A 2FJ7C 4J8WC 3B6GA 2YFWB 5G49B 4EO5C 4WNNB 5FUGB 3MVDA 3REJD 4Z2MG 3X1VA 1KX4D 1P3FD 3AN2B 4LD9D 3X1TD 5B33D 3RELC 3VH5T 3WTPA 3REKC 1KX5A 4ZUXA 1WWIA 3AZMC 3W97B 3EPKA 4J8XD 1P3GB 3KFUG 2F8NG 4LD9B 3X1TB 5B33B 3AV2B 4Z2MH 5AV8A 3AZHD 4Z66D 3REIC 3W98D 2NZDD 4XZQB 3KWQC 1ZLAA 3AZHB 3UT9C 2IO5B 3A1IA 5CPJB 5B2IA 2F8NH 5B32D 4WU8D 4Z5TB 3W98B 5JRGC 1AOID 4H9PB 1EQZC 1P3AA 5KDMA 1A7WA 2XD1A 2VQRA 5B0YA 5DNNC 5GXQA 5GXQD 1F1EA 3AZIC 3WA9A 3LZ1C 2PYOB 5BT1D 2J8PA 2CV5D 2CWEA 3AYWC 4J8UD 3WKJC 1P3IA 1M19D 3LJAB 3B0BA 3AZLD 1P3BD 3TU4C 3O62A 1U35D 4J8UB 4ZBJC 3UTBB 2G5IC 5AV5C 4G92C 1P3OC 3B0DC 2RVQD 4X23C 3MGPC 3FDDA 5B1MA 4H9SC 1U35B 4QLCA 2FJ7A 4J8WA 4UPKA 3MNNA 1ID3A 1H3OA 1TAFA 3AN2C 3C1CA 4DQYB 4KUDB 3LZ0D 2F2AC 3RELA 3RELD 5CHLB 5GT3B 3W97C 5BO0B 3REKA 3REKD 1P3GC 3AZMA 3X1TC 4LD9C 5B33C 3AV2C 4M6BA 2BYKB 5B31D 2F8NK 2BYMB 3VH5W 3NQJA 3REID 2ZY5A 1F66D 3AZHC 3NQUA 4NE6A 4WJ3C 3KWQD 3AZGB 2IO5C 5CPIA 5B31B 5CPJC 3VH6W 5E5AB 5AV9D 3UT9D 3R45B 4NE3A 4Z5TC 3W98C 5CPKA 1KX3B 5B24A 1F66B 3X1SA 5JRGA 3V9RB 1EQZA 3W99A 4WU9D 1N1JA 2YFVB 1JFIA 4H9OB 5B0ZB 3WTPE 3B0CW 3B6FD 5DNNA 3AZIA 5AY8B 5AVBA 2PYOC 3LZ1A 5B1LB 3EPHA 4WU9B 2HIOD 3B6FB 4NFTA 3AYWA 1M1AB 3WKJA 5C3IB 4J8UC 3UTBC 2HIOB 2XD5A 1HQ3D 3TU4D 4KGCD 1P3PB 3AZFD 1WWSA 5AV5D 4WZSB 2Y2GA 1P3OD 1P3OA 4X23A 1U35C 4H9QB 3MGPD 5BNXB 4YS3A 1HQ3B 4KGCB 2YFWA 5G49A 4WNNA 5FUGA 1S32A 1P3KB 2RVQC 3AZFB 3AFAD 3AZKB 4KUDC 3AN2D 1P3MB 3REJA 1M18B 5AV6B 5GT3C 3AFAB 1KX4A 1BH8B 1P3FA 3REHB 3AL0C 3W97D 3LZ0C 5F99D 1P3GA 1P3GD 4LD9A 1HTAA 3X1TA 5B33A 2JCHA 3AV2D 4XUJB 4J8XA 5F99B 4XZQD 3AZGC 5B31C 3AZHA 4Z66A 5E5AC 1P3LD 4WV4B 5BNVB 5CPJD 1KX3C 3KXBD 1P34B 5B2JD 3W98A 1F66C 4Z5TD 3MGSB 2NZDA 4E44A 3WAAD 5AV9C 5B0ZC 1P3LB 3B6GB 5AY8C 3KXBB 5B32A 5B2JB 4WU8A 1AOIA 5B1LC 2PYOA 4WU9C 2PYOD 4H9NB 3WAAB 2JE5A 1BH9A 3LELD 3A1KA 3B6FC 1M1AC 3WTPB 2DQNC 5C3IC 4ZUXB 3LJAD 2HIOC 1KX5B 2CV5A 3LELB 4J8UA 3UTBA 3UTBD 1P3PC 1M19A 5AV8B 3AZLA 1P3BA 3C1BD 1U35A 1B67A 1HQ3C 4KGCC 5GSUD 1P3KC 3AZFC 1ZLAB 2Y2OA 2RIQA 5B32G 3AZKC 2Y2QA 4H9RB 3C1BB 1P3MC 5GSUB 4KUDD 2ZM5A 1M18C 5AV6C 1P3AB 3AFAC 2Y2LA 5GT3A 3REHC 5BO0A 5GT3D 5B0YB 3WA9B 3LZ0A 3KUYD 3EG5B 2Y2PA 3AZJD 4XUJC 5F99C 4CSRA 3KUYB 1P3IB 1BFMA 3IP4C 3AZJB 5DNMD 3AZGD 5GT0B 5B31A 3O62B 5E5AD 2NQBD 3REIA 1P34C 2Y2HA 4XZQC 1KX3D 1F66A 2HUEB 4CAYB 3V9RA 3KWQA 5DNMB 1P3LC 2YFVA 4R8PD 3B6GC 2ZY2A 4H9OA 5AV9A 5CP6D 5B0ZA 3KXBC 5B0ZD 3UT9A 2G5HC 5B2JC 3W96B 2NQBB 4KHAB 2ZY4A 2Y2KA 5AY8D 3MNNB 1ID3B 5JA4B 3WAAC 5B1LD 4WU9A 4R8PB 3C1CB 4UUZB 5CP6B 3B6FA 3WTPC 1M1AA 1W2EA 1M1AD 3A6ND 1KX5C 3X1UD 3KSYA 3LELC 2UWXA 2HIOA 3UTAD 2L5AA 4E45A 5BS7C 5B31G 3A6NB 5AV8C 3AV1B 2DF4C 1P3PD 3LJAC 3X1UB 3AZND 1B6WA 5BNXA 3UTAB 1HQ3A 3TU4A 4KGCA 1ZLAC 3AZFA 1P3KD 5AV5A 5CPIB 3C1BC 3MGPA 3AZNB 3AZED 3AZKD 5GSUC 4H9SA 3EPJA 5CPKB 1P3MD 5B24B 4J8VD 3X1SB 1P3AC 5AV6A 1M18D 5AV6D 3W99B 3AFAA 1N1JB 5B0YC 1BH8A 3AZEB 1KU5A 3WA9C 3F6TA 3REHD 3AN2A 5AVCD 5B40B 5AVBB 4J8VB 4JJND 1TZYD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W97 A;  4XUJ D;  3KUY C;  5F99 A;  1P3I C;  2ARO D;  5AVC B;  4JJN B;  3AV2 A;  4AWL B;  1TZY B;  3AZJ C;  5GT0 C;  2F8N D;  3O62 C;  4DRB A;  2ARO B;  1P34 D;  4YM6 B;  2HUE C;  4XZQ A;  3MGS D;  3MGQ D;  5DNM C;  2F8N B;  4DRA A;  3MGR D;  1P3L A;  2NQB C;  3W96 C;  4YS3 B;  5CPJ A;  3B6G D;  3KXB A;  3MVD D;  5B2J A;  3MNN C;  1S32 B;  4Z5T A;  1ID3 C;  4H9P A;  3MGQ B;  3X1V D;  4R8P C;  3C1C C;  4H9N A;  3WAA A;  5CP6 C;  3MGR B;  3REJ B;  3MVD B;  3WTP D;  3X1V B;  1KX4 B;  1KX5 D;  4ZUX D;  1P3F B;  3LEL A;  3A6N C;  3VH6 T;  3AV1 C;  5BS7 A;  3X1U C;  5AV8 D;  3LJA A;  3UTA C;  4J8X B;  3B0C T;  1ZLA D;  5CPI C;  4Z66 B;  3AZN C;  4G91 B;  4H9R A;  3C1B A;  5B2I D;  5CPK C;  5GSU A;  5B24 C;  2NZD B;  3X1S C;  3W99 C;  1P3A D;  3AZE C;  4NE5 A;  5B2I B;  5B0Y D;  3WA9 D;  4KUD A;  5B32 B;  4WU8 B;  5AVB C;  4J8V C;  5B40 C;  1Q9C A;  1AOI B;  5KDM B;  1BH9 B;  5AVC C;  5GXQ B;  3KUY A;  4JJN C;  1P3I D;  4AWL C;  1TZY C;  2JSS A;  2BYK A;  3AZJ A;  5GT0 A;  2CV5 B;  5GT0 D;  2BYM A;  3O62 D;  2ARO C;  4YM6 C;  1M19 B;  4HGA B;  4CAY A;  5DNM A;  5B1M D;  3AZG A;  3AZL B;  1ULY A;  1P3B B;  4YS3 C;  5E5A A;  2NQB A;  4QLC D;  1S32 C;  3W96 A;  3R45 A;  4J8W D;  2FJ7 D;  4KHA A;  3MGS C;  3W96 D;  1KX3 A;  3MGQ C;  3MNN D;  5JA4 A;  1ID3 D;  3MGR C;  5B1M B;  4R8P A;  4UUZ A;  3C1C D;  5CP6 A;  3REJ C;  3MVD C;  4QLC B;  2FJ7 B;  4J8W B;  4EO5 B;  5AY8 A;  3X1V C;  1KX4 C;  1P3F C;  5B1L A;  1H3O B;  1TAF B;  3AZM D;  3LZ0 B;  3A6N A;  3REL B;  3AV1 A;  3AV1 D;  4ZUX C;  3X1U A;  1R4V A;  4J8X C;  3REK B;  3UTA A;  4CSR B;  3AZM B;  4Z66 C;  1P3P A;  4G91 C;  5CPI D;  3AZN A;  3NQJ B;  4H9Q A;  3REI B;  2NZD C;  5CPK D;  5B24 D;  3X1S D;  5JRG D;  1P3K A;  3NQU B;  3KWQ B;  1EQZ D;  3W99 D;  5B2I C;  5AV9 B;  3UT9 B;  3AZE A;  3AZK A;  5B32 C;  4WU8 C;  1AOI C;  5DNN D;  3AZI D;  1P3M A;  5B40 A;  5B40 D;  5AVB D;  4J8V A;  5JRG B;  3LZ1 D;  1M18 A;  1EQZ B;  1JFI B;  5GXQ C;  3REH A;  3AYW D;  5AVC A;  5DNN B;  3AZI B;  3WKJ D;  4JJN A;  5BT1 C;  3LZ1 B;  1TZY A;  2LY8 A;  2CV5 C;  4XUJ A;  3AYW B;  1M19 C;  2ARO A;  4HGA C;  3WKJ B;  4YM6 A;  4YM6 D;  2F8N A;  3AZL C;  1P3B C;  4X23 D;  3VH5 A;  5BNV A;  4YS3 D;  3TU4 B;  4ZBJ B;  1P34 A;  1S32 D;  3MGS A;  5AV5 B;  3MGQ A;  4G92 B;  1P3O B;  3B0D B;  5B1M C;  4X23 B;  3MGP B;  3MGR A;  4QLC C;  3VH6 A;  2FJ7 C;  4J8W C;  3B6G A;  2YFW B;  5G49 B;  4EO5 C;  4WNN B;  5FUG B;  3MVD A;  3REJ D;  4Z2M G;  3X1V A;  1KX4 D;  1P3F D;  3AN2 B;  4LD9 D;  3X1T D;  5B33 D;  3REL C;  3VH5 T;  3WTP A;  3REK C;  1KX5 A;  4ZUX A;  1WWI A;  3AZM C;  3W97 B;  4J8X D;  1P3G B;  2F8N G;  4LD9 B;  3X1T B;  5B33 B;  3AV2 B;  4Z2M H;  5AV8 A;  3AZH D;  4Z66 D;  3REI C;  3W98 D;  2NZD D;  4XZQ B;  3KWQ C;  1ZLA A;  3AZH B;  3UT9 C;  2IO5 B;  5CPJ B;  5B2I A;  2F8N H;  5B32 D;  4WU8 D;  4Z5T B;  3W98 B;  5JRG C;  1AOI D;  4H9P B;  1EQZ C;  1P3A A;  5KDM A;  1A7W A;  5B0Y A;  5DNN C;  5GXQ A;  5GXQ D;  1F1E A;  3AZI C;  3WA9 A;  3LZ1 C;  2PYO B;  5BT1 D;  2CV5 D;  2CWE A;  3AYW C;  4J8U D;  3WKJ C;  1P3I A;  1M19 D;  3LJA B;  3B0B A;  3AZL D;  1P3B D;  3TU4 C;  3O62 A;  1U35 D;  4J8U B;  4ZBJ C;  3UTB B;  5AV5 C;  4G92 C;  1P3O C;  3B0D C;  2RVQ D;  4X23 C;  3MGP C;  5B1M A;  4H9S C;  1U35 B;  4QLC A;  2FJ7 A;  4J8W A;  3MNN A;  1ID3 A;  1H3O A;  1TAF A;  3AN2 C;  3C1C A;  4KUD B;  3LZ0 D;  3REL A;  3REL D;  5CHL B;  5GT3 B;  3W97 C;  5BO0 B;  3REK A;  3REK D;  1P3G C;  3AZM A;  3X1T C;  4LD9 C;  5B33 C;  3AV2 C;  4M6B A;  2BYK B;  5B31 D;  2F8N K;  2BYM B;  3VH5 W;  3NQJ A;  3REI D;  1F66 D;  3AZH C;  3NQU A;  4NE6 A;  3KWQ D;  3AZG B;  2IO5 C;  5CPI A;  5B31 B;  5CPJ C;  3VH6 W;  5E5A B;  5AV9 D;  3UT9 D;  3R45 B;  4NE3 A;  4Z5T C;  3W98 C;  5CPK A;  1KX3 B;  5B24 A;  1F66 B;  3X1S A;  5JRG A;  3V9R B;  1EQZ A;  3W99 A;  4WU9 D;  1N1J A;  2YFV B;  1JFI A;  4H9O B;  5B0Z B;  3WTP E;  3B0C W;  3B6F D;  5DNN A;  3AZI A;  5AY8 B;  5AVB A;  2PYO C;  3LZ1 A;  5B1L B;  4WU9 B;  2HIO D;  3B6F B;  4NFT A;  3AYW A;  1M1A B;  3WKJ A;  5C3I B;  4J8U C;  3UTB C;  2HIO B;  1HQ3 D;  3TU4 D;  4KGC D;  1P3P B;  3AZF D;  1WWS A;  5AV5 D;  4WZS B;  1P3O D;  1P3O A;  4X23 A;  1U35 C;  4H9Q B;  3MGP D;  5BNX B;  4YS3 A;  1HQ3 B;  4KGC B;  2YFW A;  5G49 A;  4WNN A;  5FUG A;  1S32 A;  1P3K B;  2RVQ C;  3AZF B;  3AFA D;  3AZK B;  4KUD C;  3AN2 D;  1P3M B;  3REJ A;  1M18 B;  5AV6 B;  5GT3 C;  3AFA B;  1KX4 A;  1BH8 B;  1P3F A;  3REH B;  3W97 D;  3LZ0 C;  5F99 D;  1P3G A;  1P3G D;  4LD9 A;  1HTA A;  3X1T A;  5B33 A;  3AV2 D;  4XUJ B;  4J8X A;  5F99 B;  4XZQ D;  3AZG C;  5B31 C;  3AZH A;  4Z66 A;  5E5A C;  1P3L D;  4WV4 B;  5BNV B;  5CPJ D;  1KX3 C;  3KXB D;  1P34 B;  5B2J D;  3W98 A;  1F66 C;  4Z5T D;  3MGS B;  2NZD A;  4E44 A;  3WAA D;  5AV9 C;  5B0Z C;  1P3L B;  3B6G B;  5AY8 C;  3KXB B;  4WU8 A;  5B2J B;  5B32 A;  1AOI A;  5B1L C;  2PYO A;  4WU9 C;  2PYO D;  4H9N B;  3WAA B;  1BH9 A;  3LEL D;  3B6F C;  1M1A C;  3WTP B;  1KX5 B;  5C3I C;  4ZUX B;  3LJA D;  2HIO C;  2CV5 A;  3LEL B;  4J8U A;  3UTB A;  3UTB D;  1P3P C;  1M19 A;  5AV8 B;  3AZL A;  1P3B A;  3C1B D;  1U35 A;  1B67 A;  1HQ3 C;  4KGC C;  5GSU D;  1P3K C;  3AZF C;  1ZLA B;  5B32 G;  3AZK C;  4H9R B;  3C1B B;  1P3M C;  5GSU B;  4KUD D;  1M18 C;  5AV6 C;  1P3A B;  3AFA C;  5GT3 A;  3REH C;  5BO0 A;  5GT3 D;  5B0Y B;  3WA9 B;  3LZ0 A;  3KUY D;  3AZJ D;  4XUJ C;  5F99 C;  4CSR A;  3KUY B;  1P3I B;  1BFM A;  3AZJ B;  5DNM D;  3AZG D;  5GT0 B;  5B31 A;  3O62 B;  5E5A D;  2NQB D;  3REI A;  1P34 C;  4XZQ C;  1KX3 D;  1F66 A;  2HUE B;  4CAY B;  3V9R A;  3KWQ A;  5DNM B;  1P3L C;  2YFV A;  4R8P D;  3B6G C;  4H9O A;  5AV9 A;  5CP6 D;  5B0Z A;  3KXB C;  5B0Z D;  3UT9 A;  5B2J C;  2NQB B;  3W96 B;  4KHA B;  5AY8 D;  3MNN B;  1ID3 B;  5JA4 B;  3WAA C;  5B1L D;  4WU9 A;  4R8P B;  3C1C B;  4UUZ B;  5CP6 B;  3B6F A;  3WTP C;  1M1A A;  1M1A D;  3A6N D;  1KX5 C;  3X1U D;  3KSY A;  3LEL C;  2HIO A;  3UTA D;  2L5A A;  4E45 A;  5BS7 C;  5B31 G;  3A6N B;  5AV8 C;  3AV1 B;  1P3P D;  3LJA C;  3X1U B;  3AZN D;  1B6W A;  5BNX A;  3UTA B;  1HQ3 A;  3TU4 A;  4KGC A;  1ZLA C;  3AZF A;  1P3K D;  5AV5 A;  5CPI B;  3C1B C;  3MGP A;  3AZN B;  3AZE D;  3AZK D;  5GSU C;  4H9S A;  5CPK B;  1P3M D;  5B24 B;  4J8V D;  3X1S B;  1P3A C;  5AV6 A;  1M18 D;  5AV6 D;  3W99 B;  3AFA A;  1N1J B;  5B0Y C;  1BH8 A;  3AZE B;  1KU5 A;  3WA9 C;  3REH D;  3AN2 A;  5AVC D;  5B40 B;  5AVB B;  4J8V B;  4JJN D;  1TZY D; 
#chains in the Genus database with same CATH topology
 3W97 A;  4XUJ D;  3KUY C;  5F99 A;  1P3I C;  2ARO D;  5AVC B;  4JJN B;  3AV2 A;  4AWL B;  1TZY B;  2Y2I A;  3AZJ C;  5GT0 C;  2F8N D;  3O62 C;  4DRB A;  2ARO B;  1P34 D;  4YM6 B;  2HUE C;  4XZQ A;  3MGS D;  3MGQ D;  5DNM C;  2F8N B;  4DRA A;  3MGR D;  1P3L A;  2NQB C;  3W96 C;  4YS3 B;  5CPJ A;  3B6G D;  3KXB A;  3MVD D;  5B2J A;  3MNN C;  1S32 B;  4Z5T A;  1ID3 C;  4H9P A;  3MGQ B;  3X1V D;  4R8P C;  3C1C C;  4H9N A;  3WAA A;  5CP6 C;  3MGR B;  3REJ B;  3MVD B;  3WTP D;  3X1V B;  2FFF B;  1KX4 B;  4ZUX D;  1KX5 D;  1P3F B;  3LEL A;  2Y2J A;  1Z2C B;  3A6N C;  3VH6 T;  3AV1 C;  5BS7 A;  3X1U C;  5AV8 D;  3LJA A;  2ZY3 A;  3UTA C;  4J8X B;  3B0C T;  1ZLA D;  5CPI C;  3P5J B;  4Z66 B;  3AZN C;  4G91 B;  4H9R A;  3C1B A;  5B2I D;  5CPK C;  5GSU A;  5B24 C;  2NZD B;  3X1S C;  3W99 C;  1P3A D;  3AZE C;  1PZR A;  4NE5 A;  5B2I B;  5B0Y D;  3WA9 D;  4KUD A;  5B32 B;  4WU8 B;  5AVB C;  4J8V C;  5B40 C;  1Q9C A;  1AOI B;  5KDM B;  1BH9 B;  5AVC C;  5GXQ B;  3KUY A;  4JJN C;  1P3I D;  4AWL C;  1TZY C;  2W8S A;  2JSS A;  2BYK A;  3AZJ A;  2BG1 A;  5GT0 A;  2CV5 B;  5GT0 D;  2BYM A;  3O62 D;  2ARO C;  4YM6 C;  1M19 B;  4HGA B;  4CAY A;  5DNM A;  5B1M D;  3AZG A;  3AZL B;  1ULY A;  1P3B B;  4YS3 C;  5E5A A;  2NQB A;  4QLC D;  1S32 C;  3W96 A;  3R45 A;  4J8W D;  2FJ7 D;  4KHA A;  3MGS C;  3W96 D;  1KX3 A;  3MGQ C;  3MNN D;  5JA4 A;  1ID3 D;  3MGR C;  5B1M B;  4R8P A;  4UUZ A;  3C1C D;  5CP6 A;  3REJ C;  3MVD C;  4QLC B;  2FJ7 B;  4J8W B;  4EO5 B;  5AY8 A;  3X1V C;  1KX4 C;  1P3F C;  5B1L A;  1H3O B;  1TAF B;  3AZM D;  3LZ0 B;  3EPL A;  3A6N A;  3REL B;  3AV1 A;  3AV1 D;  4ZUX C;  3X1U A;  1R4V A;  4J8X C;  3REK B;  3UTA A;  4CSR B;  3AZM B;  4Z66 C;  1P3P A;  4G91 C;  5CPI D;  3AZN A;  3NQJ B;  4H9Q A;  3REI B;  3H0L C;  2NZD C;  5CPK D;  5B24 D;  3X1S D;  5JRG D;  1P3K A;  3NQU B;  3KWQ B;  1EQZ D;  3W99 D;  5B2I C;  5AV9 B;  3UT9 B;  3AZE A;  3AZK A;  5B32 C;  4WU8 C;  3H0R C;  1AOI C;  5DNN D;  3AZI D;  1P3M A;  5B40 A;  5B40 D;  5AVB D;  4J8V A;  5JRG B;  3LZ1 D;  1M18 A;  1EQZ B;  1JFI B;  5GXQ C;  3REH A;  3AYW D;  5AVC A;  5DNN B;  3AZI B;  3WKJ D;  4JJN A;  5BT1 C;  3LZ1 B;  1TZY A;  2LY8 A;  2CV5 C;  2Y2N A;  4XUJ A;  3AYW B;  1M19 C;  2ARO A;  1T3U A;  2Y2M A;  4HGA C;  3WKJ B;  4YM6 A;  4YM6 D;  2F8N A;  3AZL C;  1P3B C;  3H0M C;  4X23 D;  3VH5 A;  5BNV A;  4YS3 D;  3TU4 B;  4ZBJ B;  1P34 A;  1S32 D;  3MGS A;  5AV5 B;  3MGQ A;  4G92 B;  1P3O B;  3B0D B;  5B1M C;  4X23 B;  3MGP B;  3MGR A;  4QLC C;  3VH6 A;  2FJ7 C;  4J8W C;  3B6G A;  2YFW B;  5G49 B;  4EO5 C;  4WNN B;  5FUG B;  3MVD A;  3REJ D;  4Z2M G;  3X1V A;  1KX4 D;  1P3F D;  3AN2 B;  4LD9 D;  3X1T D;  5B33 D;  3REL C;  3VH5 T;  3WTP A;  3REK C;  1KX5 A;  4ZUX A;  1WWI A;  3AZM C;  3W97 B;  3EPK A;  4J8X D;  1P3G B;  3KFU G;  2F8N G;  4LD9 B;  3X1T B;  5B33 B;  3AV2 B;  4Z2M H;  5AV8 A;  3AZH D;  4Z66 D;  3REI C;  3W98 D;  2NZD D;  4XZQ B;  3KWQ C;  1ZLA A;  3AZH B;  3UT9 C;  2IO5 B;  3A1I A;  5CPJ B;  5B2I A;  2F8N H;  5B32 D;  4WU8 D;  4Z5T B;  3W98 B;  5JRG C;  1AOI D;  4H9P B;  1EQZ C;  1P3A A;  5KDM A;  1A7W A;  2XD1 A;  2VQR A;  5B0Y A;  5DNN C;  5GXQ A;  5GXQ D;  1F1E A;  3AZI C;  3WA9 A;  3LZ1 C;  2PYO B;  5BT1 D;  2J8P A;  2CV5 D;  2CWE A;  3AYW C;  4J8U D;  3WKJ C;  1P3I A;  1M19 D;  3LJA B;  3B0B A;  3AZL D;  1P3B D;  3TU4 C;  3O62 A;  1U35 D;  4J8U B;  4ZBJ C;  3UTB B;  2G5I C;  5AV5 C;  4G92 C;  1P3O C;  3B0D C;  2RVQ D;  4X23 C;  3MGP C;  3FDD A;  5B1M A;  4H9S C;  1U35 B;  4QLC A;  2FJ7 A;  4J8W A;  4UPK A;  3MNN A;  1ID3 A;  1H3O A;  1TAF A;  3AN2 C;  3C1C A;  4DQY B;  4KUD B;  3LZ0 D;  2F2A C;  3REL A;  3REL D;  5CHL B;  5GT3 B;  3W97 C;  5BO0 B;  3REK A;  3REK D;  1P3G C;  3AZM A;  3X1T C;  4LD9 C;  5B33 C;  3AV2 C;  4M6B A;  2BYK B;  5B31 D;  2F8N K;  2BYM B;  3VH5 W;  3NQJ A;  3REI D;  2ZY5 A;  1F66 D;  3AZH C;  3NQU A;  4NE6 A;  4WJ3 C;  3KWQ D;  3AZG B;  2IO5 C;  5CPI A;  5B31 B;  5CPJ C;  3VH6 W;  5E5A B;  5AV9 D;  3UT9 D;  3R45 B;  4NE3 A;  4Z5T C;  3W98 C;  5CPK A;  1KX3 B;  5B24 A;  1F66 B;  3X1S A;  5JRG A;  3V9R B;  1EQZ A;  3W99 A;  4WU9 D;  1N1J A;  2YFV B;  1JFI A;  4H9O B;  5B0Z B;  3WTP E;  3B0C W;  3B6F D;  5DNN A;  3AZI A;  5AY8 B;  5AVB A;  2PYO C;  3LZ1 A;  5B1L B;  3EPH A;  4WU9 B;  2HIO D;  3B6F B;  4NFT A;  3AYW A;  1M1A B;  3WKJ A;  5C3I B;  4J8U C;  3UTB C;  2HIO B;  2XD5 A;  1HQ3 D;  3TU4 D;  4KGC D;  1P3P B;  3AZF D;  1WWS A;  5AV5 D;  4WZS B;  2Y2G A;  1P3O D;  1P3O A;  4X23 A;  1U35 C;  4H9Q B;  3MGP D;  5BNX B;  4YS3 A;  1HQ3 B;  4KGC B;  2YFW A;  5G49 A;  4WNN A;  5FUG A;  1S32 A;  1P3K B;  2RVQ C;  3AZF B;  3AFA D;  3AZK B;  4KUD C;  3AN2 D;  1P3M B;  3REJ A;  1M18 B;  5AV6 B;  5GT3 C;  3AFA B;  1KX4 A;  1BH8 B;  1P3F A;  3REH B;  3AL0 C;  3W97 D;  3LZ0 C;  5F99 D;  1P3G A;  1P3G D;  4LD9 A;  1HTA A;  3X1T A;  5B33 A;  2JCH A;  3AV2 D;  4XUJ B;  4J8X A;  5F99 B;  4XZQ D;  3AZG C;  5B31 C;  3AZH A;  4Z66 A;  5E5A C;  1P3L D;  4WV4 B;  5BNV B;  5CPJ D;  1KX3 C;  3KXB D;  1P34 B;  5B2J D;  3W98 A;  1F66 C;  4Z5T D;  3MGS B;  2NZD A;  4E44 A;  3WAA D;  5AV9 C;  5B0Z C;  1P3L B;  3B6G B;  5AY8 C;  3KXB B;  5B32 A;  5B2J B;  4WU8 A;  1AOI A;  5B1L C;  2PYO A;  4WU9 C;  2PYO D;  4H9N B;  3WAA B;  2JE5 A;  1BH9 A;  3LEL D;  3A1K A;  3B6F C;  1M1A C;  3WTP B;  2DQN C;  5C3I C;  4ZUX B;  3LJA D;  2HIO C;  1KX5 B;  2CV5 A;  3LEL B;  4J8U A;  3UTB A;  3UTB D;  1P3P C;  1M19 A;  5AV8 B;  3AZL A;  1P3B A;  3C1B D;  1U35 A;  1B67 A;  1HQ3 C;  4KGC C;  5GSU D;  1P3K C;  3AZF C;  1ZLA B;  2Y2O A;  2RIQ A;  5B32 G;  3AZK C;  2Y2Q A;  4H9R B;  3C1B B;  1P3M C;  5GSU B;  4KUD D;  2ZM5 A;  1M18 C;  5AV6 C;  1P3A B;  3AFA C;  2Y2L A;  5GT3 A;  3REH C;  5BO0 A;  5GT3 D;  5B0Y B;  3WA9 B;  3LZ0 A;  3KUY D;  3EG5 B;  2Y2P A;  3AZJ D;  4XUJ C;  5F99 C;  4CSR A;  3KUY B;  1P3I B;  1BFM A;  3IP4 C;  3AZJ B;  5DNM D;  3AZG D;  5GT0 B;  5B31 A;  3O62 B;  5E5A D;  2NQB D;  3REI A;  1P34 C;  2Y2H A;  4XZQ C;  1KX3 D;  1F66 A;  2HUE B;  4CAY B;  3V9R A;  3KWQ A;  5DNM B;  1P3L C;  2YFV A;  4R8P D;  3B6G C;  2ZY2 A;  4H9O A;  5AV9 A;  5CP6 D;  5B0Z A;  3KXB C;  5B0Z D;  3UT9 A;  2G5H C;  5B2J C;  3W96 B;  2NQB B;  4KHA B;  2ZY4 A;  2Y2K A;  5AY8 D;  3MNN B;  1ID3 B;  5JA4 B;  3WAA C;  5B1L D;  4WU9 A;  4R8P B;  3C1C B;  4UUZ B;  5CP6 B;  3B6F A;  3WTP C;  1M1A A;  1W2E A;  1M1A D;  3A6N D;  1KX5 C;  3X1U D;  3KSY A;  3LEL C;  2UWX A;  2HIO A;  3UTA D;  2L5A A;  4E45 A;  5BS7 C;  5B31 G;  3A6N B;  5AV8 C;  3AV1 B;  2DF4 C;  1P3P D;  3LJA C;  3X1U B;  3AZN D;  1B6W A;  5BNX A;  3UTA B;  1HQ3 A;  3TU4 A;  4KGC A;  1ZLA C;  3AZF A;  1P3K D;  5AV5 A;  5CPI B;  3C1B C;  3MGP A;  3AZN B;  3AZE D;  3AZK D;  5GSU C;  4H9S A;  3EPJ A;  5CPK B;  1P3M D;  5B24 B;  4J8V D;  3X1S B;  1P3A C;  5AV6 A;  1M18 D;  5AV6 D;  3W99 B;  3AFA A;  1N1J B;  5B0Y C;  1BH8 A;  3AZE B;  1KU5 A;  3WA9 C;  3F6T A;  3REH D;  3AN2 A;  5AVC D;  5B40 B;  5AVB B;  4J8V B;  4JJN D;  1TZY D; 
#chains in the Genus database with same CATH homology
 3W97 A;  4XUJ D;  3KUY C;  5F99 A;  1P3I C;  2ARO D;  5AVC B;  4JJN B;  3AV2 A;  4AWL B;  1TZY B;  2Y2I A;  3AZJ C;  5GT0 C;  2F8N D;  3O62 C;  4DRB A;  2ARO B;  1P34 D;  4YM6 B;  2HUE C;  4XZQ A;  3MGS D;  3MGQ D;  5DNM C;  2F8N B;  4DRA A;  3MGR D;  1P3L A;  2NQB C;  3W96 C;  4YS3 B;  5CPJ A;  3B6G D;  3KXB A;  3MVD D;  5B2J A;  3MNN C;  1S32 B;  4Z5T A;  1ID3 C;  4H9P A;  3MGQ B;  3X1V D;  4R8P C;  3C1C C;  4H9N A;  3WAA A;  5CP6 C;  3MGR B;  3REJ B;  3MVD B;  3WTP D;  3X1V B;  2FFF B;  1KX4 B;  4ZUX D;  1KX5 D;  1P3F B;  3LEL A;  2Y2J A;  1Z2C B;  3A6N C;  3VH6 T;  3AV1 C;  5BS7 A;  3X1U C;  5AV8 D;  3LJA A;  2ZY3 A;  3UTA C;  4J8X B;  3B0C T;  1ZLA D;  5CPI C;  3P5J B;  4Z66 B;  3AZN C;  4G91 B;  4H9R A;  3C1B A;  5B2I D;  5CPK C;  5GSU A;  5B24 C;  2NZD B;  3X1S C;  3W99 C;  1P3A D;  3AZE C;  1PZR A;  4NE5 A;  5B2I B;  5B0Y D;  3WA9 D;  4KUD A;  5B32 B;  4WU8 B;  5AVB C;  4J8V C;  5B40 C;  1Q9C A;  1AOI B;  5KDM B;  1BH9 B;  5AVC C;  5GXQ B;  3KUY A;  4JJN C;  1P3I D;  4AWL C;  1TZY C;  2W8S A;  2JSS A;  2BYK A;  3AZJ A;  2BG1 A;  5GT0 A;  2CV5 B;  5GT0 D;  2BYM A;  3O62 D;  2ARO C;  4YM6 C;  1M19 B;  4HGA B;  4CAY A;  5DNM A;  5B1M D;  3AZG A;  3AZL B;  1ULY A;  1P3B B;  4YS3 C;  5E5A A;  2NQB A;  4QLC D;  1S32 C;  3W96 A;  3R45 A;  4J8W D;  2FJ7 D;  4KHA A;  3MGS C;  3W96 D;  1KX3 A;  3MGQ C;  3MNN D;  5JA4 A;  1ID3 D;  3MGR C;  5B1M B;  4R8P A;  4UUZ A;  3C1C D;  5CP6 A;  3REJ C;  3MVD C;  4QLC B;  2FJ7 B;  4J8W B;  4EO5 B;  5AY8 A;  3X1V C;  1KX4 C;  1P3F C;  5B1L A;  1H3O B;  1TAF B;  3AZM D;  3LZ0 B;  3EPL A;  3A6N A;  3REL B;  3AV1 A;  3AV1 D;  4ZUX C;  3X1U A;  1R4V A;  4J8X C;  3REK B;  3UTA A;  4CSR B;  3AZM B;  4Z66 C;  1P3P A;  4G91 C;  5CPI D;  3AZN A;  3NQJ B;  4H9Q A;  3REI B;  3H0L C;  2NZD C;  5CPK D;  5B24 D;  3X1S D;  5JRG D;  1P3K A;  3NQU B;  3KWQ B;  1EQZ D;  3W99 D;  5B2I C;  5AV9 B;  3UT9 B;  3AZE A;  3AZK A;  5B32 C;  4WU8 C;  3H0R C;  1AOI C;  5DNN D;  3AZI D;  1P3M A;  5B40 A;  5B40 D;  5AVB D;  4J8V A;  5JRG B;  3LZ1 D;  1M18 A;  1EQZ B;  1JFI B;  5GXQ C;  3REH A;  3AYW D;  5AVC A;  5DNN B;  3AZI B;  3WKJ D;  4JJN A;  5BT1 C;  3LZ1 B;  1TZY A;  2LY8 A;  2CV5 C;  2Y2N A;  4XUJ A;  3AYW B;  1M19 C;  2ARO A;  1T3U A;  2Y2M A;  4HGA C;  3WKJ B;  4YM6 A;  4YM6 D;  2F8N A;  3AZL C;  1P3B C;  3H0M C;  4X23 D;  3VH5 A;  5BNV A;  4YS3 D;  3TU4 B;  4ZBJ B;  1P34 A;  1S32 D;  3MGS A;  5AV5 B;  3MGQ A;  4G92 B;  1P3O B;  3B0D B;  5B1M C;  4X23 B;  3MGP B;  3MGR A;  4QLC C;  3VH6 A;  2FJ7 C;  4J8W C;  3B6G A;  2YFW B;  5G49 B;  4EO5 C;  4WNN B;  5FUG B;  3MVD A;  3REJ D;  4Z2M G;  3X1V A;  1KX4 D;  1P3F D;  3AN2 B;  4LD9 D;  3X1T D;  5B33 D;  3REL C;  3VH5 T;  3WTP A;  3REK C;  1KX5 A;  4ZUX A;  1WWI A;  3AZM C;  3W97 B;  3EPK A;  4J8X D;  1P3G B;  3KFU G;  2F8N G;  4LD9 B;  3X1T B;  5B33 B;  3AV2 B;  4Z2M H;  5AV8 A;  3AZH D;  4Z66 D;  3REI C;  3W98 D;  2NZD D;  4XZQ B;  3KWQ C;  1ZLA A;  3AZH B;  3UT9 C;  2IO5 B;  3A1I A;  5CPJ B;  5B2I A;  2F8N H;  5B32 D;  4WU8 D;  4Z5T B;  3W98 B;  5JRG C;  1AOI D;  4H9P B;  1EQZ C;  1P3A A;  5KDM A;  1A7W A;  2XD1 A;  2VQR A;  5B0Y A;  5DNN C;  5GXQ A;  5GXQ D;  1F1E A;  3AZI C;  3WA9 A;  3LZ1 C;  2PYO B;  5BT1 D;  2J8P A;  2CV5 D;  2CWE A;  3AYW C;  4J8U D;  3WKJ C;  1P3I A;  1M19 D;  3LJA B;  3B0B A;  3AZL D;  1P3B D;  3TU4 C;  3O62 A;  1U35 D;  4J8U B;  4ZBJ C;  3UTB B;  2G5I C;  5AV5 C;  4G92 C;  1P3O C;  3B0D C;  2RVQ D;  4X23 C;  3MGP C;  3FDD A;  5B1M A;  4H9S C;  1U35 B;  4QLC A;  2FJ7 A;  4J8W A;  4UPK A;  3MNN A;  1ID3 A;  1H3O A;  1TAF A;  3AN2 C;  3C1C A;  4DQY B;  4KUD B;  3LZ0 D;  2F2A C;  3REL A;  3REL D;  5CHL B;  5GT3 B;  3W97 C;  5BO0 B;  3REK A;  3REK D;  1P3G C;  3AZM A;  3X1T C;  4LD9 C;  5B33 C;  3AV2 C;  4M6B A;  2BYK B;  5B31 D;  2F8N K;  2BYM B;  3VH5 W;  3NQJ A;  3REI D;  2ZY5 A;  1F66 D;  3AZH C;  3NQU A;  4NE6 A;  4WJ3 C;  3KWQ D;  3AZG B;  2IO5 C;  5CPI A;  5B31 B;  5CPJ C;  3VH6 W;  5E5A B;  5AV9 D;  3UT9 D;  3R45 B;  4NE3 A;  4Z5T C;  3W98 C;  5CPK A;  1KX3 B;  5B24 A;  1F66 B;  3X1S A;  5JRG A;  3V9R B;  1EQZ A;  3W99 A;  4WU9 D;  1N1J A;  2YFV B;  1JFI A;  4H9O B;  5B0Z B;  3WTP E;  3B0C W;  3B6F D;  5DNN A;  3AZI A;  5AY8 B;  5AVB A;  2PYO C;  3LZ1 A;  5B1L B;  3EPH A;  4WU9 B;  2HIO D;  3B6F B;  4NFT A;  3AYW A;  1M1A B;  3WKJ A;  5C3I B;  4J8U C;  3UTB C;  2HIO B;  2XD5 A;  1HQ3 D;  3TU4 D;  4KGC D;  1P3P B;  3AZF D;  1WWS A;  5AV5 D;  4WZS B;  2Y2G A;  1P3O D;  1P3O A;  4X23 A;  1U35 C;  4H9Q B;  3MGP D;  5BNX B;  4YS3 A;  1HQ3 B;  4KGC B;  2YFW A;  5G49 A;  4WNN A;  5FUG A;  1S32 A;  1P3K B;  2RVQ C;  3AZF B;  3AFA D;  3AZK B;  4KUD C;  3AN2 D;  1P3M B;  3REJ A;  1M18 B;  5AV6 B;  5GT3 C;  3AFA B;  1KX4 A;  1BH8 B;  1P3F A;  3REH B;  3AL0 C;  3W97 D;  3LZ0 C;  5F99 D;  1P3G A;  1P3G D;  4LD9 A;  1HTA A;  3X1T A;  5B33 A;  2JCH A;  3AV2 D;  4XUJ B;  4J8X A;  5F99 B;  4XZQ D;  3AZG C;  5B31 C;  3AZH A;  4Z66 A;  5E5A C;  1P3L D;  4WV4 B;  5BNV B;  5CPJ D;  1KX3 C;  3KXB D;  1P34 B;  5B2J D;  3W98 A;  1F66 C;  4Z5T D;  3MGS B;  2NZD A;  4E44 A;  3WAA D;  5AV9 C;  5B0Z C;  1P3L B;  3B6G B;  5AY8 C;  3KXB B;  5B32 A;  5B2J B;  4WU8 A;  1AOI A;  5B1L C;  2PYO A;  4WU9 C;  2PYO D;  4H9N B;  3WAA B;  2JE5 A;  1BH9 A;  3LEL D;  3A1K A;  3B6F C;  1M1A C;  3WTP B;  2DQN C;  5C3I C;  4ZUX B;  3LJA D;  2HIO C;  1KX5 B;  2CV5 A;  3LEL B;  4J8U A;  3UTB A;  3UTB D;  1P3P C;  1M19 A;  5AV8 B;  3AZL A;  1P3B A;  3C1B D;  1U35 A;  1B67 A;  1HQ3 C;  4KGC C;  5GSU D;  1P3K C;  3AZF C;  1ZLA B;  2Y2O A;  2RIQ A;  5B32 G;  3AZK C;  2Y2Q A;  4H9R B;  3C1B B;  1P3M C;  5GSU B;  4KUD D;  2ZM5 A;  1M18 C;  5AV6 C;  1P3A B;  3AFA C;  2Y2L A;  5GT3 A;  3REH C;  5BO0 A;  5GT3 D;  5B0Y B;  3WA9 B;  3LZ0 A;  3KUY D;  3EG5 B;  2Y2P A;  3AZJ D;  4XUJ C;  5F99 C;  4CSR A;  3KUY B;  1P3I B;  1BFM A;  3IP4 C;  3AZJ B;  5DNM D;  3AZG D;  5GT0 B;  5B31 A;  3O62 B;  5E5A D;  2NQB D;  3REI A;  1P34 C;  2Y2H A;  4XZQ C;  1KX3 D;  1F66 A;  2HUE B;  4CAY B;  3V9R A;  3KWQ A;  5DNM B;  1P3L C;  2YFV A;  4R8P D;  3B6G C;  2ZY2 A;  4H9O A;  5AV9 A;  5CP6 D;  5B0Z A;  3KXB C;  5B0Z D;  3UT9 A;  2G5H C;  5B2J C;  3W96 B;  2NQB B;  4KHA B;  2ZY4 A;  2Y2K A;  5AY8 D;  3MNN B;  1ID3 B;  5JA4 B;  3WAA C;  5B1L D;  4WU9 A;  4R8P B;  3C1C B;  4UUZ B;  5CP6 B;  3B6F A;  3WTP C;  1M1A A;  1W2E A;  1M1A D;  3A6N D;  1KX5 C;  3X1U D;  3KSY A;  3LEL C;  2UWX A;  2HIO A;  3UTA D;  2L5A A;  4E45 A;  5BS7 C;  5B31 G;  3A6N B;  5AV8 C;  3AV1 B;  2DF4 C;  1P3P D;  3LJA C;  3X1U B;  3AZN D;  1B6W A;  5BNX A;  3UTA B;  1HQ3 A;  3TU4 A;  4KGC A;  1ZLA C;  3AZF A;  1P3K D;  5AV5 A;  5CPI B;  3C1B C;  3MGP A;  3AZN B;  3AZE D;  3AZK D;  5GSU C;  4H9S A;  3EPJ A;  5CPK B;  1P3M D;  5B24 B;  4J8V D;  3X1S B;  1P3A C;  5AV6 A;  1M18 D;  5AV6 D;  3W99 B;  3AFA A;  1N1J B;  5B0Y C;  1BH8 A;  3AZE B;  1KU5 A;  3WA9 C;  3F6T A;  3REH D;  3AN2 A;  5AVC D;  5B40 B;  5AVB B;  4J8V B;  4JJN D;  1TZY D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...