3AV2B

The human nucleosome structure containing the histone variant h3.3
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
78
structure length
78
Chain Sequence
b'NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.3
molecule tags Structural protein/dna
source organism Homo sapiens
publication title Structures of human nucleosomes containing major histone H3 variants
pubmed doi rcsb
total genus 27
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2011-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3av2B00
3MGRD 5B2JB 4J8WC 3W97B 5AV6D 4YM6D 3B6FB 2BYKB 1B6WA 1P3PA 1BH9A 4EO5C 3MGQB 4ZBJB 3AZHA 4WNNB 5B1MA 4KUDC 5C3IB 1HQ3A 1M19C 1AOIC 3KUYD 4H9QB 1P3FD 3B6GD 5B32B 3MGPD 1P3ID 1F66D 3WAAC 4KHAB 3LELA 5BO0A 3WTPB 4J8UC 3MGSA 3REKB 1P3PB 1M1AD 1M1AC 2F8NK 3UTBD 1P3AC 3AZNB 1BH8A 3AZKA 3AZGB 5B31B 4QLCA 3WTPE 3TU4C 4H9SA 5GSUB 5DNNB 5CP6A 3UT9B 1R4VA 4HGAB 3MGRB 1JFIB 3X1TA 3REKA 3B6FA 5G49A 1KX3C 1P3BD 2BYMB 4X23C 3C1BC 4KGCA 4QLCB 2YFVA 3W98C 2AROD 5AV9C 2CV5C 3A6ND 1P34C 3WAAA 5B24C 3WAAD 5AVBA 3MNNC 1P3KD 5BO0B 2IO5C 5AVCD 3REJA 1EQZD 5AVCA 5B1LD 3C1CB 3REJD 3RELD 1KX4D 1KX4A 5CPIA 3LELB 1BFMA 4G91B 1P3GC 1ZLAB 1HQ3D 3AZED 3AZEC 5JRGD 3REHC 5B31A 3AZMD 3AZHC 4CSRA 5GT3A 5B2IC 5GXQA 3AYWD 3LELD 3AV1C 3X1SB 3AV2A 3LZ1D 5B40B 5B0ZD 3AZLD 1TZYD 1KX5D 4YM6B 4J8XA 4H9QA 5KDMA 1P3MC 1P3MD 4ZUXA 2CV5A 5B31G 5CPKC 4G92C 4J8VD 4YM6A 5GT0A 3REKD 2JSSA 5AVBB 5B1MC 3TU4A 5B0YC 1S32D 1S32C 5AVCC 3AZFC 1KU5A 4Z66B 3LZ0B 1HQ3C 5BT1C 4XUJC 1P3FC 5AV8D 3B6GC 2NZDA 3O62C 3AZKB 4J8UA 3W97D 2HUEB 4E44A 3UTAB 4UUZA 3AZID 1P3OC 1P3OD 3AV2C 3VH5W 1JFIA 4AWLC 3LZ1C 1M18B 3KWQB 1P3AA 4LD9B 2RVQD 4YS3C 5B0ZC 5AV9A 3AZLC 3W96A 3KXBC 5GXQB 3W96D 5CP6B 3X1UB 3AFAB 1F66B 4J8WD 2CWEA 5CPIC 5GT3D 5CPKA 4KGCB 5GXQD 3X1TC 3W96B 1N1JB 5E5AB 5AY8C 3X1UA 3AN2C 3WKJA 3VH5T 3MGSB 3WKJD 1M18A 5AV5B 1M18D 4LD9A 2AROB 1H3OA 3VH5A 5B31D 3NQJA 3UTBB 3KUYC 4WU9C 3MVDC 5DNNA 1ULYA 5F99B 2PYOB 5AV8A 3B6FD 3A6NC 1ZLAA 2NQBD 3REIC 3NQUA 4Z66A 3LZ0A 4ZUXC 3LJAB 5B32D 2FJ7A 3B0DB 4J8XC 3AZMB 4R8PB 3REJC 5B1LC 3RELC 5BS7A 5CPJC 5AV6A 1U35C 5B0YA 4DRBA 2NZDD 3WA9B 3W99C 3AZND 1P3KB 3AZNA 5B2ID 5GT3C 5B2IA 4NE6A 2NQBB 1P3BC 3X1UD 3VH6A 3O62A 2HIOC 3C1BD 1ID3B 4J8WB 2F8NH 1P3FA 3B6GA 4WU8D 4WU8C 1TZYC 2FJ7B 5JRGB 1M19A 3W97A 4J8UD 1N1JA 3B0CW 4J8VB 3MGQC 5GSUD 5B33B 1P3LC 3MGPC 1P3IC 5BNVA 5AV5D 2NZDB 5B24D 1HTAA 3AZLA 2CV5D 3UTAD 3AZIB 1M19B 4Z66D 3LZ0D 3AZJD 1KX5B 4J8VA 5GT0C 1Q9CA 5GT0D 5DNMB 5B32C 5G49B 4H9RB 1P3GD 3WAAB 4XZQD 1EQZC 5BNXB 3WTPC 5B32G 4J8UB 1KX3D 4H9PB 5JA4A 3R45B 2YFVB 4Z5TC 1P3PC 1P3PD 3KWQD 1M1AB 3AYWC 4WZSB 1ZLAD 3W99D 3AZNC 3AFAA 3AZHD 3AFAD 4JJNB 3AZJB 1P3OA 3C1CD 3TU4B 1KX4B 5DNND 5DNNC 3WA9D 1H3OB 3C1BA 2RVQC 4YS3D 2F8NG 3A6NA 3MGRA 4HGAC 4JJND 3W98D 4JJNA 5F99A 5AV6C 4X23B 5AV8B 3AN2A 1ID3D 5FUGB 5B1LA 3RELA 3MNNA 3MNND 5CPKD 3NQJB 4QLCC 3WKJC 2F8NB 5AV9B 4R8PA 2PYOD 3X1VC 4KUDD 4LD9D 1P34B 4KUDA 4H9SC 4XZQC 5CP6D 3MNNB 4NFTA 5GSUA 4H9OA 5B2JC 2IO5B 1F1EA 3W97C 3B6FC 1A7WA 3AV1A 3LELC 3AV1D 4G91C 4EO5B 1ZLAC 4ZBJC 2BYMA 4J8XD 3AZHB 5CHLB 5AV5A 1P34A 4KUDB 5C3IC 2AROA 4UUZB 3X1SD 1AOIB 3X1SC 5F99D 5B32A 2FJ7D 1P3BA 4YM6C 3W99A 4NE5A 4XUJD 3REKC 5B1MD 3C1CA 1P3MB 3KWQA 3AZEA 4R8PD 1P3AB 3AZFD 4G92B 3AZGC 3AZGD 5B31C 2F8ND 1M19D 3MGPA 3AZIA 1P3IA 1AOID 5BT1D 5GSUC 5AVBC 3UT9C 5B2JD 1P3KA 1S32B 3O62D 2YFWB 3B0CT 5B24A 1TAFA 3MGRC 3R45A 1HQ3B 5CPID 1KX3B 5BNXA 1P3FB 3B6GB 5JRGA 3C1BB 3O62B 3WTPA 3AN2D 1ID3A 1P3GA 1P3OB 4Z5TA 3W98B 4H9NA 3X1SA 3UTAA 3AV2B 3AYWA 4AWLB 4DRAA 2CV5B 1KX3A 3AZJA 4YS3B 5B0ZB 3AZLB 3KXBB 4CAYB 2PYOA 5B24B 5GXQC 3X1TD 5AY8A 3X1UC 5BNVB 1S32A 3V9RB 4XZQA 3AFAC 1F66C 2LY8A 4H9NB 5CPIB 3C1CC 3REID 4X23D 1P34D 1P3GB 1P3MA 3X1TB 3VH6T 4WU9D 2BYKA 1WWSA 5E5AC 3AZEB 1B67A 1P3LD 3VH6W 3MVDD 3REHB 5AV5C 4WV4B 2AROC 3UT9A 5B2IB 3UT9D 4Z2MG 3KXBD 4CSRB 2L5AA 3AV1B 3WA9A 3UTBC 1P3AD 3KUYB 3TU4D 4YS3A 5B40C 5B40D 3MVDB 3REHD 3REHA 5B0YD 3A6NB 4J8WA 3AZFA 3REIB 3LJAD 3AZMA 3LJAC 3B0DC 4NE3A 5B2JA 5CPKB 5FUGA 5B1LB 3LZ1A 3RELB 3KUYA 5CPJB 1BH8B 3AZGA 1U35B 5B0ZA 2HIOA 1F66A 2HIOD 4WNNA 5B1MB 1AOIA 5B0YB 5AVCB 3AZFB 1P3KC 4H9RA 4Z66C 3LZ0C 3MGQA 4E45A 3MGQD 5E5AA 5E5AD 4XUJB 1P3LA 2NQBA 2HIOB 4KHAA 1ID3C 3AZKC 4WU8B 3NQUB 1TZYB 5CPJA 5JRGC 2HUEC 3UTAC 5CPJD 4QLCD 2FJ7C 3WTPD 1U35A 5KDMB 4J8VC 5BS7C 3LZ1B 1M18C 5B33D 3KWQC 5B33C 3X1VD 4XUJA 1P3LB 3MGPB 1P3IB 4LD9C 2NZDC 5CP6C 3AZIC 4WU9A 1KX5C 3LJAA 3MVDA 5GT0B 5DNMD 5DNMC 2F8NA 4KGCD 4KGCC 3W96C 4CAYA 4X23A 3KXBA 1EQZB 5AY8B 3AN2B 5JA4B 3MGSC 3MGSD 4WU8A 1WWIA 4H9OB 5AV9D 1M1AA 4Z5TB 3W98A 3UTBA 3AYWB 3KSYA 4WU9B 4JJNC 3AZJC 5B40A 5F99C 1KX4C 2PYOC 3AZKD 1TAFB 3B0BA 4ZUXB 4Z2MH 2YFWA 5AY8D 1TZYA 4J8XB 3AZMC 4R8PC 5B33A 4Z5TD 3X1VA 3REJB 5AV6B 5AV8C 3AV2D 3REIA 1BH9B 4ZUXD 4M6BA 1KX5A 3WKJB 5DNMA 3WA9C 3W99B 3X1VB 5AVBD 5GT3B 2NQBC 3V9RA 4XZQB 1U35D 1P3BB 1EQZA 4H9PA
chains in the Genus database with same CATH superfamily
3MGRD 5B2JB 4J8WC 3W97B 5AV6D 4YM6D 3B6FB 2BYKB 1B6WA 1P3PA 2Y2KA 1BH9A 4EO5C 3MGQB 4ZBJB 3AZHA 4WNNB 5B1MA 4KUDC 5C3IB 1HQ3A 1M19C 1AOIC 3KUYD 4H9QB 2XD1A 1P3FD 3B6GD 5B32B 3EG5B 3MGPD 1Z2CB 1P3ID 1F66D 2Y2IA 3WAAC 4KHAB 3LELA 5BO0A 3WTPB 4J8UC 3MGSA 3REKB 1P3PB 1M1AD 1M1AC 2F8NK 2ZM5A 3UTBD 1P3AC 3AZNB 1BH8A 3AZKA 3AZGB 5B31B 4QLCA 3WTPE 3TU4C 4H9SA 5GSUB 5DNNB 5CP6A 3UT9B 1R4VA 2JE5A 4HGAB 3MGRB 1JFIB 3X1TA 3REKA 3B6FA 5G49A 1KX3C 1P3BD 2BYMB 4X23C 3C1BC 4KGCA 4QLCB 2YFVA 3W98C 2AROD 5AV9C 2CV5C 3A6ND 1P34C 3WAAA 3A1IA 5B24C 3WAAD 5AVBA 3MNNC 1P3KD 5BO0B 3P5JB 2IO5C 5AVCD 3REJA 1EQZD 5AVCA 5B1LD 3C1CB 3REJD 3RELD 1KX4D 1KX4A 5CPIA 3LELB 1BFMA 4G91B 1P3GC 1ZLAB 1HQ3D 3AZED 3AZEC 5JRGD 2W8SA 3REHC 5B31A 3AZMD 3AZHC 4CSRA 5GT3A 5B2IC 5GXQA 3AYWD 3LELD 3AV1C 3X1SB 3AV2A 3LZ1D 5B40B 5B0ZD 3AZLD 1TZYD 1W2EA 1KX5D 4YM6B 2Y2QA 4J8XA 4H9QA 5KDMA 1P3MC 1P3MD 4ZUXA 2CV5A 2Y2OA 2ZY5A 5B31G 4G92C 5CPKC 4J8VD 4YM6A 5GT0A 3EPLA 3REKD 2JSSA 5AVBB 5B1MC 3TU4A 5B0YC 1S32D 1S32C 5AVCC 3AZFC 1KU5A 4Z66B 3LZ0B 1HQ3C 5BT1C 4XUJC 1P3FC 5AV8D 3B6GC 2NZDA 3O62C 3AZKB 4J8UA 3W97D 3EPJA 2HUEB 4E44A 3UTAB 4UUZA 3AZID 1P3OC 1P3OD 3AV2C 3VH5W 1JFIA 4AWLC 3LZ1C 1M18B 3KWQB 1P3AA 3FDDA 2RVQD 4YS3C 5B0ZC 4LD9B 5AV9A 3AZLC 3W96A 3KXBC 5GXQB 3W96D 5CP6B 3X1UB 3AFAB 3EPHA 1F66B 3H0MC 4J8WD 2CWEA 5CPIC 5GT3D 5CPKA 4KGCB 2Y2PA 5GXQD 3X1TC 3W96B 1N1JB 5E5AB 5AY8C 3X1UA 3AN2C 3WKJA 3VH5T 3MGSB 3WKJD 1M18A 5AV5B 1M18D 4LD9A 2AROB 1H3OA 3VH5A 5B31D 3NQJA 3UTBB 3KUYC 4WU9C 3MVDC 5DNNA 1ULYA 2ZY4A 5F99B 2PYOB 5AV8A 3B6FD 3A6NC 1ZLAA 2NQBD 3REIC 3NQUA 4Z66A 3LZ0A 4ZUXC 3LJAB 5B32D 2FJ7A 3B0DB 4J8XC 3AZMB 4R8PB 3REJC 5B1LC 3RELC 5BS7A 5CPJC 5AV6A 3IP4C 1U35C 5B0YA 4DRBA 2NZDD 3WA9B 3W99C 3AZND 1P3KB 3AZNA 5B2ID 5GT3C 5B2IA 4DQYB 4NE6A 2NQBB 1P3BC 3X1UD 3VH6A 3O62A 2HIOC 3C1BD 1ID3B 4J8WB 2F8NH 1P3FA 3B6GA 4WU8D 4WU8C 1TZYC 2FJ7B 5JRGB 1M19A 3W97A 4J8UD 1N1JA 3B0CW 4J8VB 3MGQC 2BG1A 5GSUD 5B33B 1P3LC 3MGPC 1P3IC 5BNVA 5AV5D 2NZDB 5B24D 1HTAA 3AZLA 2CV5D 3UTAD 3AZIB 1M19B 4Z66D 3LZ0D 3AZJD 1KX5B 4J8VA 5GT0C 1Q9CA 5GT0D 5DNMB 5B32C 5G49B 1T3UA 4H9RB 1P3GD 3WAAB 4XZQD 1EQZC 5BNXB 3WTPC 5B32G 4J8UB 1KX3D 4H9PB 5JA4A 3R45B 2YFVB 4Z5TC 1P3PC 1P3PD 3KWQD 1M1AB 3AYWC 4WZSB 1ZLAD 3W99D 3AZNC 3AFAA 3AZHD 3AFAD 4JJNB 3AZJB 1P3OA 3C1CD 3TU4B 1KX4B 2Y2GA 5DNND 5DNNC 3WA9D 1H3OB 3C1BA 2RVQC 4YS3D 2F8NG 3A6NA 3MGRA 4HGAC 4JJND 3W98D 4JJNA 5F99A 5AV6C 4X23B 5AV8B 3AN2A 1ID3D 5FUGB 5B1LA 2ZY3A 3RELA 3MNNA 3MNND 5CPKD 3NQJB 4QLCC 3WKJC 2F8NB 5AV9B 4R8PA 2PYOD 3X1VC 4KUDD 4LD9D 1P34B 4KUDA 4H9SC 4XZQC 5CP6D 3MNNB 3AL0C 4NFTA 5GSUA 4H9OA 5B2JC 2IO5B 1F1EA 3W97C 3B6FC 1A7WA 3AV1A 3LELC 3AV1D 4G91C 4EO5B 1ZLAC 4ZBJC 2BYMA 4J8XD 3AZHB 3H0LC 5CHLB 5AV5A 1P34A 4KUDB 5C3IC 2AROA 4UUZB 3X1SD 1AOIB 3X1SC 5F99D 5B32A 2FJ7D 2F2AC 1P3BA 4YM6C 3W99A 4NE5A 4XUJD 3REKC 5B1MD 3C1CA 1P3MB 2J8PA 3KWQA 3AZEA 4R8PD 1P3AB 3AZFD 4G92B 3AZGC 3AZGD 5B31C 2F8ND 1M19D 3MGPA 3AZIA 1P3IA 1AOID 5BT1D 5GSUC 5AVBC 3UT9C 5B2JD 1P3KA 1S32B 3O62D 2YFWB 3B0CT 5B24A 1TAFA 3MGRC 3R45A 1HQ3B 5CPID 2ZY2A 1KX3B 2JCHA 2FFFB 5BNXA 1P3FB 3B6GB 5JRGA 3C1BB 3O62B 3WTPA 3AN2D 1ID3A 1P3GA 1P3OB 4Z5TA 3W98B 4H9NA 3X1SA 3UTAA 3AV2B 3AYWA 4AWLB 3H0RC 4DRAA 2CV5B 1KX3A 3AZJA 4YS3B 5B0ZB 2G5HC 3AZLB 4CAYB 3KXBB 2PYOA 5B24B 5GXQC 3X1TD 5AY8A 3X1UC 5BNVB 2Y2JA 1S32A 3V9RB 4XZQA 3AFAC 1F66C 2LY8A 4H9NB 5CPIB 3C1CC 3REID 4X23D 1P34D 1P3GB 1P3MA 3X1TB 3VH6T 4WU9D 2BYKA 1WWSA 5E5AC 3AZEB 1B67A 1P3LD 3VH6W 3MVDD 3REHB 5AV5C 4WV4B 2AROC 3UT9A 5B2IB 3UT9D 4Z2MG 3KXBD 4CSRB 2L5AA 2Y2HA 3AV1B 3WA9A 3UTBC 1P3AD 3KUYB 3TU4D 4YS3A 5B40C 5B40D 2Y2NA 3EPKA 3MVDB 2Y2LA 3REHD 3REHA 5B0YD 3A6NB 4J8WA 3AZFA 3REIB 2UWXA 3LJAD 2G5IC 3LJAC 3AZMA 3B0DC 4NE3A 3F6TA 5B2JA 5CPKB 5FUGA 5B1LB 2VQRA 3LZ1A 3RELB 3KUYA 5CPJB 1BH8B 3AZGA 1U35B 5B0ZA 2HIOA 1F66A 2HIOD 4WNNA 5B1MB 1AOIA 5B0YB 5AVCB 3AZFB 1P3KC 4H9RA 4Z66C 3LZ0C 3MGQA 4E45A 3MGQD 5E5AA 5E5AD 4XUJB 1P3LA 2NQBA 2HIOB 4KHAA 1PZRA 1ID3C 3AZKC 4WU8B 3NQUB 1TZYB 5CPJA 5JRGC 2HUEC 3UTAC 5CPJD 4QLCD 2FJ7C 3WTPD 1U35A 5KDMB 4J8VC 5BS7C 3LZ1B 1M18C 5B33D 3KWQC 5B33C 3X1VD 4XUJA 1P3LB 3MGPB 1P3IB 4LD9C 2NZDC 5CP6C 2RIQA 3AZIC 4WU9A 1KX5C 3LJAA 3MVDA 4UPKA 5GT0B 5DNMC 5DNMD 2F8NA 4KGCD 4KGCC 3W96C 4CAYA 4X23A 3KXBA 1EQZB 5AY8B 3AN2B 5JA4B 3MGSC 3MGSD 4WU8A 1WWIA 4H9OB 5AV9D 1M1AA 4Z5TB 3W98A 3UTBA 3AYWB 3KSYA 4WU9B 4JJNC 4WJ3C 3AZJC 5B40A 5F99C 1KX4C 2PYOC 3AZKD 1TAFB 3B0BA 4ZUXB 4Z2MH 2YFWA 3A1KA 5AY8D 2XD5A 1TZYA 4J8XB 3AZMC 4R8PC 5B33A 4Z5TD 3X1VA 3REJB 5AV6B 5AV8C 3AV2D 3KFUG 3REIA 1BH9B 4ZUXD 4M6BA 1KX5A 3WKJB 5DNMA 3WA9C 3W99B 3X1VB 5AVBD 5GT3B 2NQBC 3V9RA 4XZQB 2DQNC 1U35D 2Y2MA 1P3BB 2DF4C 1EQZA 4H9PA
chains in the Genus database with same CATH topology
3MGRD 5B2JB 4J8WC 3W97B 5AV6D 4YM6D 3B6FB 2BYKB 1B6WA 1P3PA 2Y2KA 1BH9A 4EO5C 3MGQB 4ZBJB 3AZHA 4WNNB 5B1MA 4KUDC 5C3IB 1HQ3A 1M19C 1AOIC 3KUYD 4H9QB 2XD1A 1P3FD 3B6GD 5B32B 3EG5B 3MGPD 1Z2CB 1P3ID 1F66D 2Y2IA 3WAAC 4KHAB 3LELA 5BO0A 3WTPB 4J8UC 3MGSA 3REKB 1P3PB 1M1AD 1M1AC 2F8NK 2ZM5A 3UTBD 1P3AC 3AZNB 1BH8A 3AZKA 3AZGB 5B31B 4QLCA 3WTPE 3TU4C 4H9SA 5GSUB 5DNNB 5CP6A 3UT9B 1R4VA 2JE5A 4HGAB 3MGRB 1JFIB 3X1TA 3REKA 3B6FA 5G49A 1KX3C 1P3BD 2BYMB 4X23C 3C1BC 4KGCA 4QLCB 2YFVA 3W98C 2AROD 5AV9C 2CV5C 3A6ND 1P34C 3WAAA 3A1IA 5B24C 3WAAD 5AVBA 3MNNC 1P3KD 5BO0B 3P5JB 2IO5C 5AVCD 3REJA 1EQZD 5AVCA 5B1LD 3C1CB 3REJD 3RELD 1KX4D 1KX4A 5CPIA 3LELB 1BFMA 4G91B 1P3GC 1ZLAB 1HQ3D 3AZED 3AZEC 5JRGD 2W8SA 3REHC 5B31A 3AZMD 3AZHC 4CSRA 5GT3A 5B2IC 5GXQA 3AYWD 3LELD 3AV1C 3X1SB 3AV2A 3LZ1D 5B40B 5B0ZD 3AZLD 1TZYD 1W2EA 1KX5D 4YM6B 2Y2QA 4J8XA 4H9QA 5KDMA 1P3MC 1P3MD 4ZUXA 2CV5A 2Y2OA 2ZY5A 5B31G 4G92C 5CPKC 4J8VD 4YM6A 5GT0A 3EPLA 3REKD 2JSSA 5AVBB 5B1MC 3TU4A 5B0YC 1S32D 1S32C 5AVCC 3AZFC 1KU5A 4Z66B 3LZ0B 1HQ3C 5BT1C 4XUJC 1P3FC 5AV8D 3B6GC 2NZDA 3O62C 3AZKB 4J8UA 3W97D 3EPJA 2HUEB 4E44A 3UTAB 4UUZA 3AZID 1P3OC 1P3OD 3AV2C 3VH5W 1JFIA 4AWLC 3LZ1C 1M18B 3KWQB 1P3AA 3FDDA 2RVQD 4YS3C 5B0ZC 4LD9B 5AV9A 3AZLC 3W96A 3KXBC 5GXQB 3W96D 5CP6B 3X1UB 3AFAB 3EPHA 1F66B 3H0MC 4J8WD 2CWEA 5CPIC 5GT3D 5CPKA 4KGCB 2Y2PA 5GXQD 3X1TC 3W96B 1N1JB 5E5AB 5AY8C 3X1UA 3AN2C 3WKJA 3VH5T 3MGSB 3WKJD 1M18A 5AV5B 1M18D 4LD9A 2AROB 1H3OA 3VH5A 5B31D 3NQJA 3UTBB 3KUYC 4WU9C 3MVDC 5DNNA 1ULYA 2ZY4A 5F99B 2PYOB 5AV8A 3B6FD 3A6NC 1ZLAA 2NQBD 3REIC 3NQUA 4Z66A 3LZ0A 4ZUXC 3LJAB 5B32D 2FJ7A 3B0DB 4J8XC 3AZMB 4R8PB 3REJC 5B1LC 3RELC 5BS7A 5CPJC 5AV6A 3IP4C 1U35C 5B0YA 4DRBA 2NZDD 3WA9B 3W99C 3AZND 1P3KB 3AZNA 5B2ID 5GT3C 5B2IA 4DQYB 4NE6A 2NQBB 1P3BC 3X1UD 3VH6A 3O62A 2HIOC 3C1BD 1ID3B 4J8WB 2F8NH 1P3FA 3B6GA 4WU8D 4WU8C 1TZYC 2FJ7B 5JRGB 1M19A 3W97A 4J8UD 1N1JA 3B0CW 4J8VB 3MGQC 2BG1A 5GSUD 5B33B 1P3LC 3MGPC 1P3IC 5BNVA 5AV5D 2NZDB 5B24D 1HTAA 3AZLA 2CV5D 3UTAD 3AZIB 1M19B 4Z66D 3LZ0D 3AZJD 1KX5B 4J8VA 5GT0C 1Q9CA 5GT0D 5DNMB 5B32C 5G49B 1T3UA 4H9RB 1P3GD 3WAAB 4XZQD 1EQZC 5BNXB 3WTPC 5B32G 4J8UB 1KX3D 4H9PB 5JA4A 3R45B 2YFVB 4Z5TC 1P3PC 1P3PD 3KWQD 1M1AB 3AYWC 4WZSB 1ZLAD 3W99D 3AZNC 3AFAA 3AZHD 3AFAD 4JJNB 3AZJB 1P3OA 3C1CD 3TU4B 1KX4B 2Y2GA 5DNND 5DNNC 3WA9D 1H3OB 3C1BA 2RVQC 4YS3D 2F8NG 3A6NA 3MGRA 4HGAC 4JJND 3W98D 4JJNA 5F99A 5AV6C 4X23B 5AV8B 3AN2A 1ID3D 5FUGB 5B1LA 2ZY3A 3RELA 3MNNA 3MNND 5CPKD 3NQJB 4QLCC 3WKJC 2F8NB 5AV9B 4R8PA 2PYOD 3X1VC 4KUDD 4LD9D 1P34B 4KUDA 4H9SC 4XZQC 5CP6D 3MNNB 3AL0C 4NFTA 5GSUA 4H9OA 5B2JC 2IO5B 1F1EA 3W97C 3B6FC 1A7WA 3AV1A 3LELC 3AV1D 4G91C 4EO5B 1ZLAC 4ZBJC 2BYMA 4J8XD 3AZHB 3H0LC 5CHLB 5AV5A 1P34A 4KUDB 5C3IC 2AROA 4UUZB 3X1SD 1AOIB 3X1SC 5F99D 5B32A 2FJ7D 2F2AC 1P3BA 4YM6C 3W99A 4NE5A 4XUJD 3REKC 5B1MD 3C1CA 1P3MB 2J8PA 3KWQA 3AZEA 4R8PD 1P3AB 3AZFD 4G92B 3AZGC 3AZGD 5B31C 2F8ND 1M19D 3MGPA 3AZIA 1P3IA 1AOID 5BT1D 5GSUC 5AVBC 3UT9C 5B2JD 1P3KA 1S32B 3O62D 2YFWB 3B0CT 5B24A 1TAFA 3MGRC 3R45A 1HQ3B 5CPID 2ZY2A 1KX3B 2JCHA 2FFFB 5BNXA 1P3FB 3B6GB 5JRGA 3C1BB 3O62B 3WTPA 3AN2D 1ID3A 1P3GA 1P3OB 4Z5TA 3W98B 4H9NA 3X1SA 3UTAA 3AV2B 3AYWA 4AWLB 3H0RC 4DRAA 2CV5B 1KX3A 3AZJA 4YS3B 5B0ZB 2G5HC 3AZLB 4CAYB 3KXBB 2PYOA 5B24B 5GXQC 3X1TD 5AY8A 3X1UC 5BNVB 2Y2JA 1S32A 3V9RB 4XZQA 3AFAC 1F66C 2LY8A 4H9NB 5CPIB 3C1CC 3REID 4X23D 1P34D 1P3GB 1P3MA 3X1TB 3VH6T 4WU9D 2BYKA 1WWSA 5E5AC 3AZEB 1B67A 1P3LD 3VH6W 3MVDD 3REHB 5AV5C 4WV4B 2AROC 3UT9A 5B2IB 3UT9D 4Z2MG 3KXBD 4CSRB 2L5AA 2Y2HA 3AV1B 3WA9A 3UTBC 1P3AD 3KUYB 3TU4D 4YS3A 5B40C 5B40D 2Y2NA 3EPKA 3MVDB 2Y2LA 3REHD 3REHA 5B0YD 3A6NB 4J8WA 3AZFA 3REIB 2UWXA 3LJAD 2G5IC 3LJAC 3AZMA 3B0DC 4NE3A 3F6TA 5B2JA 5CPKB 5FUGA 5B1LB 2VQRA 3LZ1A 3RELB 3KUYA 5CPJB 1BH8B 3AZGA 1U35B 5B0ZA 2HIOA 1F66A 2HIOD 4WNNA 5B1MB 1AOIA 5B0YB 5AVCB 3AZFB 1P3KC 4H9RA 4Z66C 3LZ0C 3MGQA 4E45A 3MGQD 5E5AA 5E5AD 4XUJB 1P3LA 2NQBA 2HIOB 4KHAA 1PZRA 1ID3C 3AZKC 4WU8B 3NQUB 1TZYB 5CPJA 5JRGC 2HUEC 3UTAC 5CPJD 4QLCD 2FJ7C 3WTPD 1U35A 5KDMB 4J8VC 5BS7C 3LZ1B 1M18C 5B33D 3KWQC 5B33C 3X1VD 4XUJA 1P3LB 3MGPB 1P3IB 4LD9C 2NZDC 5CP6C 2RIQA 3AZIC 4WU9A 1KX5C 3LJAA 3MVDA 4UPKA 5GT0B 5DNMC 5DNMD 2F8NA 4KGCD 4KGCC 3W96C 4CAYA 4X23A 3KXBA 1EQZB 5AY8B 3AN2B 5JA4B 3MGSC 3MGSD 4WU8A 1WWIA 4H9OB 5AV9D 1M1AA 4Z5TB 3W98A 3UTBA 3AYWB 3KSYA 4WU9B 4JJNC 4WJ3C 3AZJC 5B40A 5F99C 1KX4C 2PYOC 3AZKD 1TAFB 3B0BA 4ZUXB 4Z2MH 2YFWA 3A1KA 5AY8D 2XD5A 1TZYA 4J8XB 3AZMC 4R8PC 5B33A 4Z5TD 3X1VA 3REJB 5AV6B 5AV8C 3AV2D 3KFUG 3REIA 1BH9B 4ZUXD 4M6BA 1KX5A 3WKJB 5DNMA 3WA9C 3W99B 3X1VB 5AVBD 5GT3B 2NQBC 3V9RA 4XZQB 2DQNC 1U35D 2Y2MA 1P3BB 2DF4C 1EQZA 4H9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGR D;  5B2J B;  4J8W C;  3W97 B;  5AV6 D;  4YM6 D;  3B6F B;  2BYK B;  1B6W A;  1P3P A;  1BH9 A;  4EO5 C;  3MGQ B;  4ZBJ B;  3AZH A;  4WNN B;  5B1M A;  4KUD C;  5C3I B;  1HQ3 A;  1M19 C;  1AOI C;  3KUY D;  4H9Q B;  1P3F D;  3B6G D;  5B32 B;  3MGP D;  1P3I D;  1F66 D;  3WAA C;  4KHA B;  3LEL A;  5BO0 A;  3WTP B;  4J8U C;  3MGS A;  3REK B;  1P3P B;  1M1A D;  1M1A C;  2F8N K;  3UTB D;  1P3A C;  3AZN B;  1BH8 A;  3AZK A;  3AZG B;  5B31 B;  4QLC A;  3WTP E;  3TU4 C;  4H9S A;  5GSU B;  5DNN B;  5CP6 A;  3UT9 B;  1R4V A;  4HGA B;  3MGR B;  1JFI B;  3X1T A;  3REK A;  3B6F A;  5G49 A;  1KX3 C;  1P3B D;  2BYM B;  4X23 C;  3C1B C;  4KGC A;  4QLC B;  2YFV A;  3W98 C;  2ARO D;  5AV9 C;  2CV5 C;  3A6N D;  1P34 C;  3WAA A;  5B24 C;  3WAA D;  5AVB A;  3MNN C;  1P3K D;  5BO0 B;  2IO5 C;  5AVC D;  3REJ A;  1EQZ D;  5AVC A;  5B1L D;  3C1C B;  3REJ D;  3REL D;  1KX4 D;  1KX4 A;  5CPI A;  3LEL B;  1BFM A;  4G91 B;  1P3G C;  1ZLA B;  1HQ3 D;  3AZE D;  3AZE C;  5JRG D;  3REH C;  5B31 A;  3AZM D;  3AZH C;  4CSR A;  5GT3 A;  5B2I C;  5GXQ A;  3AYW D;  3LEL D;  3AV1 C;  3X1S B;  3AV2 A;  3LZ1 D;  5B40 B;  5B0Z D;  3AZL D;  1TZY D;  1KX5 D;  4YM6 B;  4J8X A;  4H9Q A;  5KDM A;  1P3M C;  1P3M D;  4ZUX A;  2CV5 A;  5B31 G;  5CPK C;  4G92 C;  4J8V D;  4YM6 A;  5GT0 A;  3REK D;  2JSS A;  5AVB B;  5B1M C;  3TU4 A;  5B0Y C;  1S32 D;  1S32 C;  5AVC C;  3AZF C;  1KU5 A;  4Z66 B;  3LZ0 B;  1HQ3 C;  5BT1 C;  4XUJ C;  1P3F C;  5AV8 D;  3B6G C;  2NZD A;  3O62 C;  3AZK B;  4J8U A;  3W97 D;  2HUE B;  4E44 A;  3UTA B;  4UUZ A;  3AZI D;  1P3O C;  1P3O D;  3AV2 C;  3VH5 W;  1JFI A;  4AWL C;  3LZ1 C;  1M18 B;  3KWQ B;  1P3A A;  4LD9 B;  2RVQ D;  4YS3 C;  5B0Z C;  5AV9 A;  3AZL C;  3W96 A;  3KXB C;  5GXQ B;  3W96 D;  5CP6 B;  3X1U B;  3AFA B;  1F66 B;  4J8W D;  2CWE A;  5CPI C;  5GT3 D;  5CPK A;  4KGC B;  5GXQ D;  3X1T C;  3W96 B;  1N1J B;  5E5A B;  5AY8 C;  3X1U A;  3AN2 C;  3WKJ A;  3VH5 T;  3MGS B;  3WKJ D;  1M18 A;  5AV5 B;  1M18 D;  4LD9 A;  2ARO B;  1H3O A;  3VH5 A;  5B31 D;  3NQJ A;  3UTB B;  3KUY C;  4WU9 C;  3MVD C;  5DNN A;  1ULY A;  5F99 B;  2PYO B;  5AV8 A;  3B6F D;  3A6N C;  1ZLA A;  2NQB D;  3REI C;  3NQU A;  4Z66 A;  3LZ0 A;  4ZUX C;  3LJA B;  5B32 D;  2FJ7 A;  3B0D B;  4J8X C;  3AZM B;  4R8P B;  3REJ C;  5B1L C;  3REL C;  5BS7 A;  5CPJ C;  5AV6 A;  1U35 C;  5B0Y A;  4DRB A;  2NZD D;  3WA9 B;  3W99 C;  3AZN D;  1P3K B;  3AZN A;  5B2I D;  5GT3 C;  5B2I A;  4NE6 A;  2NQB B;  1P3B C;  3X1U D;  3VH6 A;  3O62 A;  2HIO C;  3C1B D;  1ID3 B;  4J8W B;  2F8N H;  1P3F A;  3B6G A;  4WU8 D;  4WU8 C;  1TZY C;  2FJ7 B;  5JRG B;  1M19 A;  3W97 A;  4J8U D;  1N1J A;  3B0C W;  4J8V B;  3MGQ C;  5GSU D;  5B33 B;  1P3L C;  3MGP C;  1P3I C;  5BNV A;  5AV5 D;  2NZD B;  5B24 D;  1HTA A;  3AZL A;  2CV5 D;  3UTA D;  3AZI B;  1M19 B;  4Z66 D;  3LZ0 D;  3AZJ D;  1KX5 B;  4J8V A;  5GT0 C;  1Q9C A;  5GT0 D;  5DNM B;  5B32 C;  5G49 B;  4H9R B;  1P3G D;  3WAA B;  4XZQ D;  1EQZ C;  5BNX B;  3WTP C;  5B32 G;  4J8U B;  1KX3 D;  4H9P B;  5JA4 A;  3R45 B;  2YFV B;  4Z5T C;  1P3P C;  1P3P D;  3KWQ D;  1M1A B;  3AYW C;  4WZS B;  1ZLA D;  3W99 D;  3AZN C;  3AFA A;  3AZH D;  3AFA D;  4JJN B;  3AZJ B;  1P3O A;  3C1C D;  3TU4 B;  1KX4 B;  5DNN D;  5DNN C;  3WA9 D;  1H3O B;  3C1B A;  2RVQ C;  4YS3 D;  2F8N G;  3A6N A;  3MGR A;  4HGA C;  4JJN D;  3W98 D;  4JJN A;  5F99 A;  5AV6 C;  4X23 B;  5AV8 B;  3AN2 A;  1ID3 D;  5FUG B;  5B1L A;  3REL A;  3MNN A;  3MNN D;  5CPK D;  3NQJ B;  4QLC C;  3WKJ C;  2F8N B;  5AV9 B;  4R8P A;  2PYO D;  3X1V C;  4KUD D;  4LD9 D;  1P34 B;  4KUD A;  4H9S C;  4XZQ C;  5CP6 D;  3MNN B;  4NFT A;  5GSU A;  4H9O A;  5B2J C;  2IO5 B;  1F1E A;  3W97 C;  3B6F C;  1A7W A;  3AV1 A;  3LEL C;  3AV1 D;  4G91 C;  4EO5 B;  1ZLA C;  4ZBJ C;  2BYM A;  4J8X D;  3AZH B;  5CHL B;  5AV5 A;  1P34 A;  4KUD B;  5C3I C;  2ARO A;  4UUZ B;  3X1S D;  1AOI B;  3X1S C;  5F99 D;  5B32 A;  2FJ7 D;  1P3B A;  4YM6 C;  3W99 A;  4NE5 A;  4XUJ D;  3REK C;  5B1M D;  3C1C A;  1P3M B;  3KWQ A;  3AZE A;  4R8P D;  1P3A B;  3AZF D;  4G92 B;  3AZG C;  3AZG D;  5B31 C;  2F8N D;  1M19 D;  3MGP A;  3AZI A;  1P3I A;  1AOI D;  5BT1 D;  5GSU C;  5AVB C;  3UT9 C;  5B2J D;  1P3K A;  1S32 B;  3O62 D;  2YFW B;  3B0C T;  5B24 A;  1TAF A;  3MGR C;  3R45 A;  1HQ3 B;  5CPI D;  1KX3 B;  5BNX A;  1P3F B;  3B6G B;  5JRG A;  3C1B B;  3O62 B;  3WTP A;  3AN2 D;  1ID3 A;  1P3G A;  1P3O B;  4Z5T A;  3W98 B;  4H9N A;  3X1S A;  3UTA A;  3AV2 B;  3AYW A;  4AWL B;  4DRA A;  2CV5 B;  1KX3 A;  3AZJ A;  4YS3 B;  5B0Z B;  3AZL B;  3KXB B;  4CAY B;  2PYO A;  5B24 B;  5GXQ C;  3X1T D;  5AY8 A;  3X1U C;  5BNV B;  1S32 A;  3V9R B;  4XZQ A;  3AFA C;  1F66 C;  2LY8 A;  4H9N B;  5CPI B;  3C1C C;  3REI D;  4X23 D;  1P34 D;  1P3G B;  1P3M A;  3X1T B;  3VH6 T;  4WU9 D;  2BYK A;  1WWS A;  5E5A C;  3AZE B;  1B67 A;  1P3L D;  3VH6 W;  3MVD D;  3REH B;  5AV5 C;  4WV4 B;  2ARO C;  3UT9 A;  5B2I B;  3UT9 D;  4Z2M G;  3KXB D;  4CSR B;  2L5A A;  3AV1 B;  3WA9 A;  3UTB C;  1P3A D;  3KUY B;  3TU4 D;  4YS3 A;  5B40 C;  5B40 D;  3MVD B;  3REH D;  3REH A;  5B0Y D;  3A6N B;  4J8W A;  3AZF A;  3REI B;  3LJA D;  3AZM A;  3LJA C;  3B0D C;  4NE3 A;  5B2J A;  5CPK B;  5FUG A;  5B1L B;  3LZ1 A;  3REL B;  3KUY A;  5CPJ B;  1BH8 B;  3AZG A;  1U35 B;  5B0Z A;  2HIO A;  1F66 A;  2HIO D;  4WNN A;  5B1M B;  1AOI A;  5B0Y B;  5AVC B;  3AZF B;  1P3K C;  4H9R A;  4Z66 C;  3LZ0 C;  3MGQ A;  4E45 A;  3MGQ D;  5E5A A;  5E5A D;  4XUJ B;  1P3L A;  2NQB A;  2HIO B;  4KHA A;  1ID3 C;  3AZK C;  4WU8 B;  3NQU B;  1TZY B;  5CPJ A;  5JRG C;  2HUE C;  3UTA C;  5CPJ D;  4QLC D;  2FJ7 C;  3WTP D;  1U35 A;  5KDM B;  4J8V C;  5BS7 C;  3LZ1 B;  1M18 C;  5B33 D;  3KWQ C;  5B33 C;  3X1V D;  4XUJ A;  1P3L B;  3MGP B;  1P3I B;  4LD9 C;  2NZD C;  5CP6 C;  3AZI C;  4WU9 A;  1KX5 C;  3LJA A;  3MVD A;  5GT0 B;  5DNM D;  5DNM C;  2F8N A;  4KGC D;  4KGC C;  3W96 C;  4CAY A;  4X23 A;  3KXB A;  1EQZ B;  5AY8 B;  3AN2 B;  5JA4 B;  3MGS C;  3MGS D;  4WU8 A;  1WWI A;  4H9O B;  5AV9 D;  1M1A A;  4Z5T B;  3W98 A;  3UTB A;  3AYW B;  3KSY A;  4WU9 B;  4JJN C;  3AZJ C;  5B40 A;  5F99 C;  1KX4 C;  2PYO C;  3AZK D;  1TAF B;  3B0B A;  4ZUX B;  4Z2M H;  2YFW A;  5AY8 D;  1TZY A;  4J8X B;  3AZM C;  4R8P C;  5B33 A;  4Z5T D;  3X1V A;  3REJ B;  5AV6 B;  5AV8 C;  3AV2 D;  3REI A;  1BH9 B;  4ZUX D;  4M6B A;  1KX5 A;  3WKJ B;  5DNM A;  3WA9 C;  3W99 B;  3X1V B;  5AVB D;  5GT3 B;  2NQB C;  3V9R A;  4XZQ B;  1U35 D;  1P3B B;  1EQZ A;  4H9P A; 
#chains in the Genus database with same CATH topology
 3MGR D;  5B2J B;  4J8W C;  3W97 B;  5AV6 D;  4YM6 D;  3B6F B;  2BYK B;  1B6W A;  1P3P A;  2Y2K A;  1BH9 A;  4EO5 C;  3MGQ B;  4ZBJ B;  3AZH A;  4WNN B;  5B1M A;  4KUD C;  5C3I B;  1HQ3 A;  1M19 C;  1AOI C;  3KUY D;  4H9Q B;  2XD1 A;  1P3F D;  3B6G D;  5B32 B;  3EG5 B;  3MGP D;  1Z2C B;  1P3I D;  1F66 D;  2Y2I A;  3WAA C;  4KHA B;  3LEL A;  5BO0 A;  3WTP B;  4J8U C;  3MGS A;  3REK B;  1P3P B;  1M1A D;  1M1A C;  2F8N K;  2ZM5 A;  3UTB D;  1P3A C;  3AZN B;  1BH8 A;  3AZK A;  3AZG B;  5B31 B;  4QLC A;  3WTP E;  3TU4 C;  4H9S A;  5GSU B;  5DNN B;  5CP6 A;  3UT9 B;  1R4V A;  2JE5 A;  4HGA B;  3MGR B;  1JFI B;  3X1T A;  3REK A;  3B6F A;  5G49 A;  1KX3 C;  1P3B D;  2BYM B;  4X23 C;  3C1B C;  4KGC A;  4QLC B;  2YFV A;  3W98 C;  2ARO D;  5AV9 C;  2CV5 C;  3A6N D;  1P34 C;  3WAA A;  3A1I A;  5B24 C;  3WAA D;  5AVB A;  3MNN C;  1P3K D;  5BO0 B;  3P5J B;  2IO5 C;  5AVC D;  3REJ A;  1EQZ D;  5AVC A;  5B1L D;  3C1C B;  3REJ D;  3REL D;  1KX4 D;  1KX4 A;  5CPI A;  3LEL B;  1BFM A;  4G91 B;  1P3G C;  1ZLA B;  1HQ3 D;  3AZE D;  3AZE C;  5JRG D;  2W8S A;  3REH C;  5B31 A;  3AZM D;  3AZH C;  4CSR A;  5GT3 A;  5B2I C;  5GXQ A;  3AYW D;  3LEL D;  3AV1 C;  3X1S B;  3AV2 A;  3LZ1 D;  5B40 B;  5B0Z D;  3AZL D;  1TZY D;  1W2E A;  1KX5 D;  4YM6 B;  2Y2Q A;  4J8X A;  4H9Q A;  5KDM A;  1P3M C;  1P3M D;  4ZUX A;  2CV5 A;  2Y2O A;  2ZY5 A;  5B31 G;  4G92 C;  5CPK C;  4J8V D;  4YM6 A;  5GT0 A;  3EPL A;  3REK D;  2JSS A;  5AVB B;  5B1M C;  3TU4 A;  5B0Y C;  1S32 D;  1S32 C;  5AVC C;  3AZF C;  1KU5 A;  4Z66 B;  3LZ0 B;  1HQ3 C;  5BT1 C;  4XUJ C;  1P3F C;  5AV8 D;  3B6G C;  2NZD A;  3O62 C;  3AZK B;  4J8U A;  3W97 D;  3EPJ A;  2HUE B;  4E44 A;  3UTA B;  4UUZ A;  3AZI D;  1P3O C;  1P3O D;  3AV2 C;  3VH5 W;  1JFI A;  4AWL C;  3LZ1 C;  1M18 B;  3KWQ B;  1P3A A;  3FDD A;  2RVQ D;  4YS3 C;  5B0Z C;  4LD9 B;  5AV9 A;  3AZL C;  3W96 A;  3KXB C;  5GXQ B;  3W96 D;  5CP6 B;  3X1U B;  3AFA B;  3EPH A;  1F66 B;  3H0M C;  4J8W D;  2CWE A;  5CPI C;  5GT3 D;  5CPK A;  4KGC B;  2Y2P A;  5GXQ D;  3X1T C;  3W96 B;  1N1J B;  5E5A B;  5AY8 C;  3X1U A;  3AN2 C;  3WKJ A;  3VH5 T;  3MGS B;  3WKJ D;  1M18 A;  5AV5 B;  1M18 D;  4LD9 A;  2ARO B;  1H3O A;  3VH5 A;  5B31 D;  3NQJ A;  3UTB B;  3KUY C;  4WU9 C;  3MVD C;  5DNN A;  1ULY A;  2ZY4 A;  5F99 B;  2PYO B;  5AV8 A;  3B6F D;  3A6N C;  1ZLA A;  2NQB D;  3REI C;  3NQU A;  4Z66 A;  3LZ0 A;  4ZUX C;  3LJA B;  5B32 D;  2FJ7 A;  3B0D B;  4J8X C;  3AZM B;  4R8P B;  3REJ C;  5B1L C;  3REL C;  5BS7 A;  5CPJ C;  5AV6 A;  3IP4 C;  1U35 C;  5B0Y A;  4DRB A;  2NZD D;  3WA9 B;  3W99 C;  3AZN D;  1P3K B;  3AZN A;  5B2I D;  5GT3 C;  5B2I A;  4DQY B;  4NE6 A;  2NQB B;  1P3B C;  3X1U D;  3VH6 A;  3O62 A;  2HIO C;  3C1B D;  1ID3 B;  4J8W B;  2F8N H;  1P3F A;  3B6G A;  4WU8 D;  4WU8 C;  1TZY C;  2FJ7 B;  5JRG B;  1M19 A;  3W97 A;  4J8U D;  1N1J A;  3B0C W;  4J8V B;  3MGQ C;  2BG1 A;  5GSU D;  5B33 B;  1P3L C;  3MGP C;  1P3I C;  5BNV A;  5AV5 D;  2NZD B;  5B24 D;  1HTA A;  3AZL A;  2CV5 D;  3UTA D;  3AZI B;  1M19 B;  4Z66 D;  3LZ0 D;  3AZJ D;  1KX5 B;  4J8V A;  5GT0 C;  1Q9C A;  5GT0 D;  5DNM B;  5B32 C;  5G49 B;  1T3U A;  4H9R B;  1P3G D;  3WAA B;  4XZQ D;  1EQZ C;  5BNX B;  3WTP C;  5B32 G;  4J8U B;  1KX3 D;  4H9P B;  5JA4 A;  3R45 B;  2YFV B;  4Z5T C;  1P3P C;  1P3P D;  3KWQ D;  1M1A B;  3AYW C;  4WZS B;  1ZLA D;  3W99 D;  3AZN C;  3AFA A;  3AZH D;  3AFA D;  4JJN B;  3AZJ B;  1P3O A;  3C1C D;  3TU4 B;  1KX4 B;  2Y2G A;  5DNN D;  5DNN C;  3WA9 D;  1H3O B;  3C1B A;  2RVQ C;  4YS3 D;  2F8N G;  3A6N A;  3MGR A;  4HGA C;  4JJN D;  3W98 D;  4JJN A;  5F99 A;  5AV6 C;  4X23 B;  5AV8 B;  3AN2 A;  1ID3 D;  5FUG B;  5B1L A;  2ZY3 A;  3REL A;  3MNN A;  3MNN D;  5CPK D;  3NQJ B;  4QLC C;  3WKJ C;  2F8N B;  5AV9 B;  4R8P A;  2PYO D;  3X1V C;  4KUD D;  4LD9 D;  1P34 B;  4KUD A;  4H9S C;  4XZQ C;  5CP6 D;  3MNN B;  3AL0 C;  4NFT A;  5GSU A;  4H9O A;  5B2J C;  2IO5 B;  1F1E A;  3W97 C;  3B6F C;  1A7W A;  3AV1 A;  3LEL C;  3AV1 D;  4G91 C;  4EO5 B;  1ZLA C;  4ZBJ C;  2BYM A;  4J8X D;  3AZH B;  3H0L C;  5CHL B;  5AV5 A;  1P34 A;  4KUD B;  5C3I C;  2ARO A;  4UUZ B;  3X1S D;  1AOI B;  3X1S C;  5F99 D;  5B32 A;  2FJ7 D;  2F2A C;  1P3B A;  4YM6 C;  3W99 A;  4NE5 A;  4XUJ D;  3REK C;  5B1M D;  3C1C A;  1P3M B;  2J8P A;  3KWQ A;  3AZE A;  4R8P D;  1P3A B;  3AZF D;  4G92 B;  3AZG C;  3AZG D;  5B31 C;  2F8N D;  1M19 D;  3MGP A;  3AZI A;  1P3I A;  1AOI D;  5BT1 D;  5GSU C;  5AVB C;  3UT9 C;  5B2J D;  1P3K A;  1S32 B;  3O62 D;  2YFW B;  3B0C T;  5B24 A;  1TAF A;  3MGR C;  3R45 A;  1HQ3 B;  5CPI D;  2ZY2 A;  1KX3 B;  2JCH A;  2FFF B;  5BNX A;  1P3F B;  3B6G B;  5JRG A;  3C1B B;  3O62 B;  3WTP A;  3AN2 D;  1ID3 A;  1P3G A;  1P3O B;  4Z5T A;  3W98 B;  4H9N A;  3X1S A;  3UTA A;  3AV2 B;  3AYW A;  4AWL B;  3H0R C;  4DRA A;  2CV5 B;  1KX3 A;  3AZJ A;  4YS3 B;  5B0Z B;  2G5H C;  3AZL B;  4CAY B;  3KXB B;  2PYO A;  5B24 B;  5GXQ C;  3X1T D;  5AY8 A;  3X1U C;  5BNV B;  2Y2J A;  1S32 A;  3V9R B;  4XZQ A;  3AFA C;  1F66 C;  2LY8 A;  4H9N B;  5CPI B;  3C1C C;  3REI D;  4X23 D;  1P34 D;  1P3G B;  1P3M A;  3X1T B;  3VH6 T;  4WU9 D;  2BYK A;  1WWS A;  5E5A C;  3AZE B;  1B67 A;  1P3L D;  3VH6 W;  3MVD D;  3REH B;  5AV5 C;  4WV4 B;  2ARO C;  3UT9 A;  5B2I B;  3UT9 D;  4Z2M G;  3KXB D;  4CSR B;  2L5A A;  2Y2H A;  3AV1 B;  3WA9 A;  3UTB C;  1P3A D;  3KUY B;  3TU4 D;  4YS3 A;  5B40 C;  5B40 D;  2Y2N A;  3EPK A;  3MVD B;  2Y2L A;  3REH D;  3REH A;  5B0Y D;  3A6N B;  4J8W A;  3AZF A;  3REI B;  2UWX A;  3LJA D;  2G5I C;  3LJA C;  3AZM A;  3B0D C;  4NE3 A;  3F6T A;  5B2J A;  5CPK B;  5FUG A;  5B1L B;  2VQR A;  3LZ1 A;  3REL B;  3KUY A;  5CPJ B;  1BH8 B;  3AZG A;  1U35 B;  5B0Z A;  2HIO A;  1F66 A;  2HIO D;  4WNN A;  5B1M B;  1AOI A;  5B0Y B;  5AVC B;  3AZF B;  1P3K C;  4H9R A;  4Z66 C;  3LZ0 C;  3MGQ A;  4E45 A;  3MGQ D;  5E5A A;  5E5A D;  4XUJ B;  1P3L A;  2NQB A;  2HIO B;  4KHA A;  1PZR A;  1ID3 C;  3AZK C;  4WU8 B;  3NQU B;  1TZY B;  5CPJ A;  5JRG C;  2HUE C;  3UTA C;  5CPJ D;  4QLC D;  2FJ7 C;  3WTP D;  1U35 A;  5KDM B;  4J8V C;  5BS7 C;  3LZ1 B;  1M18 C;  5B33 D;  3KWQ C;  5B33 C;  3X1V D;  4XUJ A;  1P3L B;  3MGP B;  1P3I B;  4LD9 C;  2NZD C;  5CP6 C;  2RIQ A;  3AZI C;  4WU9 A;  1KX5 C;  3LJA A;  3MVD A;  4UPK A;  5GT0 B;  5DNM C;  5DNM D;  2F8N A;  4KGC D;  4KGC C;  3W96 C;  4CAY A;  4X23 A;  3KXB A;  1EQZ B;  5AY8 B;  3AN2 B;  5JA4 B;  3MGS C;  3MGS D;  4WU8 A;  1WWI A;  4H9O B;  5AV9 D;  1M1A A;  4Z5T B;  3W98 A;  3UTB A;  3AYW B;  3KSY A;  4WU9 B;  4JJN C;  4WJ3 C;  3AZJ C;  5B40 A;  5F99 C;  1KX4 C;  2PYO C;  3AZK D;  1TAF B;  3B0B A;  4ZUX B;  4Z2M H;  2YFW A;  3A1K A;  5AY8 D;  2XD5 A;  1TZY A;  4J8X B;  3AZM C;  4R8P C;  5B33 A;  4Z5T D;  3X1V A;  3REJ B;  5AV6 B;  5AV8 C;  3AV2 D;  3KFU G;  3REI A;  1BH9 B;  4ZUX D;  4M6B A;  1KX5 A;  3WKJ B;  5DNM A;  3WA9 C;  3W99 B;  3X1V B;  5AVB D;  5GT3 B;  2NQB C;  3V9R A;  4XZQ B;  2DQN C;  1U35 D;  2Y2M A;  1P3B B;  2DF4 C;  1EQZ A;  4H9P A; 
#chains in the Genus database with same CATH homology
 3MGR D;  5B2J B;  4J8W C;  3W97 B;  5AV6 D;  4YM6 D;  3B6F B;  2BYK B;  1B6W A;  1P3P A;  2Y2K A;  1BH9 A;  4EO5 C;  3MGQ B;  4ZBJ B;  3AZH A;  4WNN B;  5B1M A;  4KUD C;  5C3I B;  1HQ3 A;  1M19 C;  1AOI C;  3KUY D;  4H9Q B;  2XD1 A;  1P3F D;  3B6G D;  5B32 B;  3EG5 B;  3MGP D;  1Z2C B;  1P3I D;  1F66 D;  2Y2I A;  3WAA C;  4KHA B;  3LEL A;  5BO0 A;  3WTP B;  4J8U C;  3MGS A;  3REK B;  1P3P B;  1M1A D;  1M1A C;  2F8N K;  2ZM5 A;  3UTB D;  1P3A C;  3AZN B;  1BH8 A;  3AZK A;  3AZG B;  5B31 B;  4QLC A;  3WTP E;  3TU4 C;  4H9S A;  5GSU B;  5DNN B;  5CP6 A;  3UT9 B;  1R4V A;  2JE5 A;  4HGA B;  3MGR B;  1JFI B;  3X1T A;  3REK A;  3B6F A;  5G49 A;  1KX3 C;  1P3B D;  2BYM B;  4X23 C;  3C1B C;  4KGC A;  4QLC B;  2YFV A;  3W98 C;  2ARO D;  5AV9 C;  2CV5 C;  3A6N D;  1P34 C;  3WAA A;  3A1I A;  5B24 C;  3WAA D;  5AVB A;  3MNN C;  1P3K D;  5BO0 B;  3P5J B;  2IO5 C;  5AVC D;  3REJ A;  1EQZ D;  5AVC A;  5B1L D;  3C1C B;  3REJ D;  3REL D;  1KX4 D;  1KX4 A;  5CPI A;  3LEL B;  1BFM A;  4G91 B;  1P3G C;  1ZLA B;  1HQ3 D;  3AZE D;  3AZE C;  5JRG D;  2W8S A;  3REH C;  5B31 A;  3AZM D;  3AZH C;  4CSR A;  5GT3 A;  5B2I C;  5GXQ A;  3AYW D;  3LEL D;  3AV1 C;  3X1S B;  3AV2 A;  3LZ1 D;  5B40 B;  5B0Z D;  3AZL D;  1TZY D;  1W2E A;  1KX5 D;  4YM6 B;  2Y2Q A;  4J8X A;  4H9Q A;  5KDM A;  1P3M C;  1P3M D;  4ZUX A;  2CV5 A;  2Y2O A;  2ZY5 A;  5B31 G;  4G92 C;  5CPK C;  4J8V D;  4YM6 A;  5GT0 A;  3EPL A;  3REK D;  2JSS A;  5AVB B;  5B1M C;  3TU4 A;  5B0Y C;  1S32 D;  1S32 C;  5AVC C;  3AZF C;  1KU5 A;  4Z66 B;  3LZ0 B;  1HQ3 C;  5BT1 C;  4XUJ C;  1P3F C;  5AV8 D;  3B6G C;  2NZD A;  3O62 C;  3AZK B;  4J8U A;  3W97 D;  3EPJ A;  2HUE B;  4E44 A;  3UTA B;  4UUZ A;  3AZI D;  1P3O C;  1P3O D;  3AV2 C;  3VH5 W;  1JFI A;  4AWL C;  3LZ1 C;  1M18 B;  3KWQ B;  1P3A A;  3FDD A;  2RVQ D;  4YS3 C;  5B0Z C;  4LD9 B;  5AV9 A;  3AZL C;  3W96 A;  3KXB C;  5GXQ B;  3W96 D;  5CP6 B;  3X1U B;  3AFA B;  3EPH A;  1F66 B;  3H0M C;  4J8W D;  2CWE A;  5CPI C;  5GT3 D;  5CPK A;  4KGC B;  2Y2P A;  5GXQ D;  3X1T C;  3W96 B;  1N1J B;  5E5A B;  5AY8 C;  3X1U A;  3AN2 C;  3WKJ A;  3VH5 T;  3MGS B;  3WKJ D;  1M18 A;  5AV5 B;  1M18 D;  4LD9 A;  2ARO B;  1H3O A;  3VH5 A;  5B31 D;  3NQJ A;  3UTB B;  3KUY C;  4WU9 C;  3MVD C;  5DNN A;  1ULY A;  2ZY4 A;  5F99 B;  2PYO B;  5AV8 A;  3B6F D;  3A6N C;  1ZLA A;  2NQB D;  3REI C;  3NQU A;  4Z66 A;  3LZ0 A;  4ZUX C;  3LJA B;  5B32 D;  2FJ7 A;  3B0D B;  4J8X C;  3AZM B;  4R8P B;  3REJ C;  5B1L C;  3REL C;  5BS7 A;  5CPJ C;  5AV6 A;  3IP4 C;  1U35 C;  5B0Y A;  4DRB A;  2NZD D;  3WA9 B;  3W99 C;  3AZN D;  1P3K B;  3AZN A;  5B2I D;  5GT3 C;  5B2I A;  4DQY B;  4NE6 A;  2NQB B;  1P3B C;  3X1U D;  3VH6 A;  3O62 A;  2HIO C;  3C1B D;  1ID3 B;  4J8W B;  2F8N H;  1P3F A;  3B6G A;  4WU8 D;  4WU8 C;  1TZY C;  2FJ7 B;  5JRG B;  1M19 A;  3W97 A;  4J8U D;  1N1J A;  3B0C W;  4J8V B;  3MGQ C;  2BG1 A;  5GSU D;  5B33 B;  1P3L C;  3MGP C;  1P3I C;  5BNV A;  5AV5 D;  2NZD B;  5B24 D;  1HTA A;  3AZL A;  2CV5 D;  3UTA D;  3AZI B;  1M19 B;  4Z66 D;  3LZ0 D;  3AZJ D;  1KX5 B;  4J8V A;  5GT0 C;  1Q9C A;  5GT0 D;  5DNM B;  5B32 C;  5G49 B;  1T3U A;  4H9R B;  1P3G D;  3WAA B;  4XZQ D;  1EQZ C;  5BNX B;  3WTP C;  5B32 G;  4J8U B;  1KX3 D;  4H9P B;  5JA4 A;  3R45 B;  2YFV B;  4Z5T C;  1P3P C;  1P3P D;  3KWQ D;  1M1A B;  3AYW C;  4WZS B;  1ZLA D;  3W99 D;  3AZN C;  3AFA A;  3AZH D;  3AFA D;  4JJN B;  3AZJ B;  1P3O A;  3C1C D;  3TU4 B;  1KX4 B;  2Y2G A;  5DNN D;  5DNN C;  3WA9 D;  1H3O B;  3C1B A;  2RVQ C;  4YS3 D;  2F8N G;  3A6N A;  3MGR A;  4HGA C;  4JJN D;  3W98 D;  4JJN A;  5F99 A;  5AV6 C;  4X23 B;  5AV8 B;  3AN2 A;  1ID3 D;  5FUG B;  5B1L A;  2ZY3 A;  3REL A;  3MNN A;  3MNN D;  5CPK D;  3NQJ B;  4QLC C;  3WKJ C;  2F8N B;  5AV9 B;  4R8P A;  2PYO D;  3X1V C;  4KUD D;  4LD9 D;  1P34 B;  4KUD A;  4H9S C;  4XZQ C;  5CP6 D;  3MNN B;  3AL0 C;  4NFT A;  5GSU A;  4H9O A;  5B2J C;  2IO5 B;  1F1E A;  3W97 C;  3B6F C;  1A7W A;  3AV1 A;  3LEL C;  3AV1 D;  4G91 C;  4EO5 B;  1ZLA C;  4ZBJ C;  2BYM A;  4J8X D;  3AZH B;  3H0L C;  5CHL B;  5AV5 A;  1P34 A;  4KUD B;  5C3I C;  2ARO A;  4UUZ B;  3X1S D;  1AOI B;  3X1S C;  5F99 D;  5B32 A;  2FJ7 D;  2F2A C;  1P3B A;  4YM6 C;  3W99 A;  4NE5 A;  4XUJ D;  3REK C;  5B1M D;  3C1C A;  1P3M B;  2J8P A;  3KWQ A;  3AZE A;  4R8P D;  1P3A B;  3AZF D;  4G92 B;  3AZG C;  3AZG D;  5B31 C;  2F8N D;  1M19 D;  3MGP A;  3AZI A;  1P3I A;  1AOI D;  5BT1 D;  5GSU C;  5AVB C;  3UT9 C;  5B2J D;  1P3K A;  1S32 B;  3O62 D;  2YFW B;  3B0C T;  5B24 A;  1TAF A;  3MGR C;  3R45 A;  1HQ3 B;  5CPI D;  2ZY2 A;  1KX3 B;  2JCH A;  2FFF B;  5BNX A;  1P3F B;  3B6G B;  5JRG A;  3C1B B;  3O62 B;  3WTP A;  3AN2 D;  1ID3 A;  1P3G A;  1P3O B;  4Z5T A;  3W98 B;  4H9N A;  3X1S A;  3UTA A;  3AV2 B;  3AYW A;  4AWL B;  3H0R C;  4DRA A;  2CV5 B;  1KX3 A;  3AZJ A;  4YS3 B;  5B0Z B;  2G5H C;  3AZL B;  4CAY B;  3KXB B;  2PYO A;  5B24 B;  5GXQ C;  3X1T D;  5AY8 A;  3X1U C;  5BNV B;  2Y2J A;  1S32 A;  3V9R B;  4XZQ A;  3AFA C;  1F66 C;  2LY8 A;  4H9N B;  5CPI B;  3C1C C;  3REI D;  4X23 D;  1P34 D;  1P3G B;  1P3M A;  3X1T B;  3VH6 T;  4WU9 D;  2BYK A;  1WWS A;  5E5A C;  3AZE B;  1B67 A;  1P3L D;  3VH6 W;  3MVD D;  3REH B;  5AV5 C;  4WV4 B;  2ARO C;  3UT9 A;  5B2I B;  3UT9 D;  4Z2M G;  3KXB D;  4CSR B;  2L5A A;  2Y2H A;  3AV1 B;  3WA9 A;  3UTB C;  1P3A D;  3KUY B;  3TU4 D;  4YS3 A;  5B40 C;  5B40 D;  2Y2N A;  3EPK A;  3MVD B;  2Y2L A;  3REH D;  3REH A;  5B0Y D;  3A6N B;  4J8W A;  3AZF A;  3REI B;  2UWX A;  3LJA D;  2G5I C;  3LJA C;  3AZM A;  3B0D C;  4NE3 A;  3F6T A;  5B2J A;  5CPK B;  5FUG A;  5B1L B;  2VQR A;  3LZ1 A;  3REL B;  3KUY A;  5CPJ B;  1BH8 B;  3AZG A;  1U35 B;  5B0Z A;  2HIO A;  1F66 A;  2HIO D;  4WNN A;  5B1M B;  1AOI A;  5B0Y B;  5AVC B;  3AZF B;  1P3K C;  4H9R A;  4Z66 C;  3LZ0 C;  3MGQ A;  4E45 A;  3MGQ D;  5E5A A;  5E5A D;  4XUJ B;  1P3L A;  2NQB A;  2HIO B;  4KHA A;  1PZR A;  1ID3 C;  3AZK C;  4WU8 B;  3NQU B;  1TZY B;  5CPJ A;  5JRG C;  2HUE C;  3UTA C;  5CPJ D;  4QLC D;  2FJ7 C;  3WTP D;  1U35 A;  5KDM B;  4J8V C;  5BS7 C;  3LZ1 B;  1M18 C;  5B33 D;  3KWQ C;  5B33 C;  3X1V D;  4XUJ A;  1P3L B;  3MGP B;  1P3I B;  4LD9 C;  2NZD C;  5CP6 C;  2RIQ A;  3AZI C;  4WU9 A;  1KX5 C;  3LJA A;  3MVD A;  4UPK A;  5GT0 B;  5DNM C;  5DNM D;  2F8N A;  4KGC D;  4KGC C;  3W96 C;  4CAY A;  4X23 A;  3KXB A;  1EQZ B;  5AY8 B;  3AN2 B;  5JA4 B;  3MGS C;  3MGS D;  4WU8 A;  1WWI A;  4H9O B;  5AV9 D;  1M1A A;  4Z5T B;  3W98 A;  3UTB A;  3AYW B;  3KSY A;  4WU9 B;  4JJN C;  4WJ3 C;  3AZJ C;  5B40 A;  5F99 C;  1KX4 C;  2PYO C;  3AZK D;  1TAF B;  3B0B A;  4ZUX B;  4Z2M H;  2YFW A;  3A1K A;  5AY8 D;  2XD5 A;  1TZY A;  4J8X B;  3AZM C;  4R8P C;  5B33 A;  4Z5T D;  3X1V A;  3REJ B;  5AV6 B;  5AV8 C;  3AV2 D;  3KFU G;  3REI A;  1BH9 B;  4ZUX D;  4M6B A;  1KX5 A;  3WKJ B;  5DNM A;  3WA9 C;  3W99 B;  3X1V B;  5AVB D;  5GT3 B;  2NQB C;  3V9R A;  4XZQ B;  2DQN C;  1U35 D;  2Y2M A;  1P3B B;  2DF4 C;  1EQZ A;  4H9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...