3AV7A

Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
404
structure length
404
Chain Sequence
SMLGDVERFFSKKALEMRASEVRELLKLVETSDIISLAGGLPNPKTFPKEIIRDILVEIMEKYADKALQYGTTKGFTPLRETLMKWLGKRYGISQDNDIMITSGSQQALDLIGRVFLNPGDIVVVEAPTYLAALQAFNFYEPQYIQIPLDDEGMKVEILEEKLKELKSQGKKVKVVYTVPTFQNPAGVTMNEDRRKYLLELASEYDFIVVEDDPYGELRYSGNPEKKIKALDNEGRVIYLGTFSKILAPGFRIGWMVGDPGIIRKMEIAKQSTDLCTNVFGQVVAWRYVDGGYLEKHIPEIRKFYKPRRDAMLEALEEFMPEGVKWTKPEGGMFIWVTLPDGIDSKKMLERAIKKGVAYVPGEAFYAHRDVKNTMRLNFTYVDEDKIMEGIKRLAETIKEELKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein PH0207
publication title Structural insight into kynurenic acid excretion mechanisms of kynurenine aminotransferase in the hyperthermophilic archaeon Pyrococcus horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Transferase
total genus 153
structure length 404
sequence length 404
chains with identical sequence C
ec nomenclature ec 2.6.1.7: Kynurenine--oxoglutarate transaminase.
pdb deposition date 2011-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3av7A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3av7A01
3BCBA 1MDZA 4MQRA 5TF5A 4WLHA 1V2FA 4A0GA 2C7TA 4RIZA 4ADBA 3FZ6A 1MGVA 2E54A 3UE8A 1DJ9A 3AOVA 2R5CA 4ZM4A 2X5FA 2AY3A 4RITA 2VMPA 1C7GA 1SFFA 2HUIA 2HP1A 5IWQA 3DYDA 2HUFA 2XBNA 4N0BA 4ATPA 4W5KA 3HL2A 4OYTA 1IX6A 4LW2A 1CZEA 2AY9A 3N75A 4R5FA 4BA5A 1H1CA 1CJ0A 3N0LA 3I5TA 4GDYA 2GQNA 1YIYA 3FDBA 3PDBA 4RKDA 3UAKA 1AKBA 1ECXA 3MC6C 3VOMA 1BJ4A 4AZJA 3PD6A 3WKRA 1EG5A 2BI1A 1ARTA 4IXOA 3B46A 3NTJA 4WB0A 1E5EA 1QGNA 1KL2A 3PA9A 3AEMA 1QISA 2QLRA 2PB0A 2BI5A 4K2MA 3TFTA 3P6KA 2ZJGA 4KXKA 1SZUA 1ARIA 3PIUA 1YOOA 4DQ6A 5M49A 2Z61A 3AOWA 1WKHA 4IYOA 1N8PA 4DGTA 1ZODA 3BCXA 1B9IA 3W1JA 1TOGA 3DR7A 4E3QA 3DODA 3FDDA 1FC4A 1D7VA 1ZC9A 2Z20A 1WSTA 3HLMA 1ASFA 3RCHA 1CQ8A 1LC7A 4ZWMA 3A8UX 1LW5A 3T32A 3E77A 1BQDA 4JF1A 1ASEA 2C81A 1WYTA 4PIWA 2OATA 1S06A 3LVMA 2ZY4A 4GEBA 2CANA 5DB5A 2AY5A 3GZCA 2BWNA 3EUCA 4U1TA 4XEWA 3ELEA 2VMVA 2QB3A 3A2BA 3ASAA 1AMSA 5DJ9A 2PB2A 3AEJA 1AJRA 1M32A 3HBXA 3WZFA 1MLYA 1WYUA 1QJ3A 2BI3A 2BIAA 2EGYA 3IF2A 3AEMC 3FCRA 3JTXA 1ELUA 1MDOA 1WYVB 2AEUA 1AIAA 1ORDA 2VIBA 4XK1A 2WK9A 3DZZA 3LG0A 4O6ZA 3FD0A 2NMPA 1DGEA 2YCPA 4BQ0A 1AKCA 1AAMA 3E2FA 3EI5A 2AEVA 3R9AA 1DJEA 2JGTA 2EPJA 3FZ7A 1GCKA 4Y0DA 4A6TA 4BA4A 5JAYA 1QITA 1UU2A 5F9SA 4RM1A 2PO3A 2VLHA 5G2QA 2FNUA 3VAXA 2JG2A 1YJZA 1BJWA 5HHYA 1OHVA 5HXXA 5AX8A 1ARSA 3A9YA 2HZPA 4XJOA 2BI9A 3OKSA 3LVKA 2VGSA 1GC4A 3TCMA 2CJDA 3KKIA 1GC2A 1BKGA 2OQXA 2W7FA 4ADDA 1AMQA 1TARA 4EB7A 2R0TA 3AEJC 1VP4A 1M0NA 1OATA 2QBTA 4JEYA 4W8IA 1BJOB 1B8GA 2ZY5A 3GJUA 2Z9XA 3BWNC 3BWOA 4AO4A 2X3LA 2CTZA 1W7MA 4XJLA 1J32A 3L8AA 4Y0IA 4CBRA 4F5MA 4DBCA 4OCAA 4AH3A 1AJSB 1B5OA 1EQBA 2XH1A 3QI6A 1C4KA 4WBTA 3K7YA 2E7UA 5G4JA 3TATA 3VK2A 2W7HA 1M0QA 1I48A 1PMMA 1ASLA 2W7DA 4RKCA 5HDMA 4B9BA 2VGUA 1SZKA 1KL1A 1SVVA 3PJ0A 4I8AA 3WLXA 3PD6B 1GC0A 2VMQA 5M4BA 4Q76A 1AHYA 2OKJA 3PPLA 1AHXA 1GEYA 3E2ZA 2YKYA 2VGZA 1B9HA 5F8VA 4BMKA 1DFOA 2CFBA 1Y4IA 2GB3A 3M5UA 4ZDLA 2DGKA 1PMOA 5BJ3A 1B4XA 1M4NA 2EZ1A 4GRXA 4IYOB 2D61A 3BS8A 3E2YA 1OXOA 3GETA 1C7NA 3F0HA 1O62A 1BJOA 2VMTA 1O69A 3HQTA 2D65A 1O4SA 1D7RA 1CL2A 4ZM3A 4XQ2A 4ZDPA 3NU7A 1IUGA 4H51A 3RCHB 2C0RA 2FN6A 1WYTB 1JG8A 4PFNA 1AJSA 1AHEA 2D63A 1X29A 4W1VA 5G2PA 4F5HA 3IHJA 4F5FA 3AEPA 5EAVA 2W7JA 1I43A 1O61A 5EIGB 3EZSA 2D66A 4JEXA 4JEVA 1WYUB 4UHNA 2VMZA 9AATA 2CH2A 2ZYJA 4ADCA 3FRKA 1Z7DA 2VMRA 2VLFA 1QIRA 2Z9VA 3COGA 3BB8A 1MAQA 3NX3A 1DJUA 2VMOA 1ASDA 4WYGA 3W1IA 1XEYA 4B98A 2YCTA 1CQ6A 3BCAA 3CQ4A 4IW7A 3DXVA 2QB2A 3RBFA 1GDEA 2CB1A 3MADA 3RI6A 2YCNA 4ZSWA 2VMSA 3CQ6A 4P3MA 3NU8A 1YIZA 2W7GA 2WK8A 4WYFA 2Q7WA 4IXSA 1C9CA 1ASBA 3CQ5A 4F4EA 5LHAA 4JEZA 4F5LA 1MDXA 4LNMA 2CINA 1GEWA 2GMSA 3LVJA 1SPAA 2CJGA 2JJHA 1AMAA 2BYJA 4M2JA 2ZUKA 1TOEA 5EFSA 2WKAA 4WXFA 3HMUA 2D5YA 3P1TA 2JJGA 3ZRRA 2Z1YA 5FT5A 4F5IA 2VMWA 3FTBA 2VMYA 2VI9A 4WXGA 4F5JA 3MKJA 2AY4A 5EIGA 1S08A 2BHXA 1S07A 2V1PA 3ASBA 2W7EA 3NYUA 4GE9A 4UHMA 4XAUA 2BKWA 2YKUA 5EQCA 2O1BA 1RV4A 1PFFA 2YKVA 3EI7A 1EJIA 1QZ9A 3QGUA 4MY5A 5E5IA 1D7UA 3JWAA 2HOXA 3DU4A 2VMUA 3RBLA 4MQQA 3AENA 3GR9A 5BJ4A 4LNLA 4TV7A 2W7LA 3QM2A 1W7LA 4EMYA 1V72A 5E4ZA 4ZASA 1OXPA 1BS0A 1TATA 2C44A 5DJ1A 2X5DA 3E2ZB 1AICA 3EIAA 2VIAA 1YNUA 4A00A 5G4IA 1YAAA 3LY1A 1V2DA 4L0OA 1C7OA 3FVUA 3EZ1A 2GSAA 2VGTA 2EZ2A 1AMRA 3II0A 4OC9A 4ZWVA 4UOYA 4F5GA 5M46A 1LC8A 2FNIA 4WLJA 1TASA 2QMAA 2Z67A 3MEBA 3DR4A 1ARGA 3N5MA 4PVFA 3ECDA 3MAFA 1SF2A 3DRDA 4FFCA 1ASMA 3GBXA 4MQPA 5J8QA 4WP0A 4WYAA 3MBBA 4Y0HA 4A0RA 4WXBA 4BHDA 3HT4A 1X28A 4K2IA 1QJ5A 1ZOBA 2AATA 5K8BA 3AEOA 4F5KA 3FVXA 1AHGA 3W1HA 4MGRA 1G7XA 1AIBA 1AY5A 2RFVA 1BJNA 3JWBA 1I41A 4JE5A 2HP2A 4GSAA 2W8JA 5M4DA 2G6WA 3A9XA 2JJFA 2QA3A 5D95A 3E6GA 3VK3A 3GZDA 3UWCA 4J8LA 3I16A 3NYTA 1AKAA 2X8UA 2DGMA 3ZRQA 4WYDA 1IAXA 1OHYA 1IVRA 2HOYA 3QPGA 4AZKA 1JS3A 1VJOA 3FZ8A 1XI9A 4UHOA 3BC8A 1BQAA 1YJSA 4GE7A 3EI6A 4WYCA 1AAWA 1TPLA 2VMXA 2W8WA 4EU1A 1W7NA 2BWPA 3TFUA 1M0OA 5G0AA 4TN4A 1D7SA 3WCNA 3EIBA 2ZSLA 1KMKA 4MKKA 1KKPA 5EUEA 4W91A 3WY7A 5EUDA 2D64A 4E3RA 2W8TA 1GC3A 5FT4A 4Q6RA 4LW4A 3ACZA 4KAMA 1M6SA 3PGYA 4HF8A 2AY6A 3I4JA 3LWSA 3D6KA 3G0TA 1X2AA 5E3KA 1JS6A 5D5SA 2W7IA 2OGEA 3JU7A 2AY8A 3B8XA 1MLZA 2CH1A 2V0YA 3RUYA 4LNJA 3MAUA 3F9TA 2HOZA 3HDOA 2VI8A 3K40A 3F6TA 3LVLB 3GZDC 4ATQA 2HORA 1TOIA 4ADEA 2E7JA 2YOBA 2AY7A 5LH9A 1CL1A 1JF9A 2JISA 3CAIA 2CY8A 2VMNA 3KGWA 2TPLA 1BT4A 3NUIA 1S09A 2BYLA 4JEWA 2AY1A 3ZZJA 3GSBA 1LK9A 3AENB 3BV0A 1YJYA 4RAEA 1RVYA 2WK7A 3ATHA 5FT8A 1LW4A 3WGCA 1UU0A 2FYFA 2OGAA 4WD2A 1OHWA 1B5PA 8AATA 4AO9A 4TMRA 3WKSA 3FQ7A 2YKXA 3H7FA 4AOAA 4E1OA 1D2FA 4IY7A 2AY2A 3FFRA 4GE4A 1ASAA 4IX8A 1G7WA 3BN1A 4E77A 1H0CA 3CBFA 3G8MA 2Z1ZA 1DGDA 4IXZA 1IBJA 5G09A 2BIGA 4NOGA 4OBVA 4A0FA 1IAYA 3K28A 2W8UA 1S0AA 1TOJA 3JW9A 2D7ZA 3ELPA 3FVSA 2D7YA 3MAFB 1VEFA 1CQ7A 2ORDA 2YHKA 4Q31A 1ASNA 1FG7A 1N31A 3DXWA 2ZY2A 3G7QA 1UKJA 3B1EA 2YRIA 4K2BA 1DTYA 1TOKA 5C6UA 3FSLA 3VP6A 4R8DA 4A0HA 4P7YA 3WGBA 4ZLVA 4CXRA 2VGWA 1U08A 3L44A 4W1WA 1E5FA 1M0PA 2Z9UA 5I92A 4OTLA 1N2TA 3R4TA 2BIEA 3DC1A 4RJYA 3ZRPA 4EB5A 2ZY3A 4PFFA 4Q75A 1GD9A 3AELA 3FKDA 4ITGA 3NRAA 4M2MA 3KE3A 1AY4A 3AATA 4OT8A 1LKCA 2W8VA 3KGXA 3LV2A 4HVKA 3BWNA 1CS1A 1KKJA 3NDNA 4W1XA 4MKJA 4ZSYA 1W3UA 3TQXA 1PG8A 4A6UA 1AHFA 1KMJA 1AX4A 2DGLA 1LC5A 3OP7A 2EH6A 2F8JA 2FQ6A 2W7MA 3WCOA 4CVQA 1DKAA 1I29A 3H14A 3FFHA 2CJHA 3E9KA 2W7KA 5DX5A 3PAAA 4JF0A 3AV7A 1AY8A 3FQ8A 4ISYA 4EFFA 2O7CA 1V2EA 3A9ZA 3EI8A 1T3IA 2DKJA 3B1DA 2HUUA 1BW0A 1ARHA 3GWPA 3PDXA 3QBOA 1J04A 4UQVA 2O0RA 3FQAA 1W23A 2CSTA 5EAAA 1ASCA 2BI2A 4CXQA 4KYOA 4R2NA 1M7YA 2R2NA 4OMAA 2VYCA 1IX8A 4R5ZA 2JJEA 1MAPA 4M2KA 4ZAHA 4FL0A 1UU1A 1G4XA 4RJ0A 1RV3A 1IJIA 2R5CB 1SZSA 1C0NA 3QN6A 3NUBA 1ELQA 2BWOA 4XJMA 3NYSA 1P3WA 1WYVA 4XJPA 3EI9A 3ISLA 3JZLA 2R5EA 3Q8NA 2YRRA 3ZZKA 3B1CA 4A72A 4ZDOA 2E7IA 2Z9WA 1WKGA 3NNKA 4LC3A 1RVUA 1GEXA 5EUNA 7AATA 2FM1A 4CBSA 2OKKA 1ASGA 3VK4A 1Z3ZA 3PDBB 4A6RA 1IX7A 4OBUA 4ITXA 1CZCA 2ZSMA 4MSOA 2DR1A 4J5UA 1FG3A 2DOUA 2ZP7A 4JE5D 1LS3A 3WX9A 4WB0B 3MC6A 4N0WA 2DKBA 4WYEA 2GMUA 2ZC0A 3HVYA 4RLGA 3RQ1A 2VGVA 3USFA 3QHXA 2EO5A 5FT6A 1GBNA 1X0MA 4QGRA 1G4VA 4U2HA
chains in the Genus database with same CATH superfamily
3BCBA 1MDZA 4MQRA 5TF5A 4WLHA 1V2FA 4A0GA 2C7TA 4RIZA 4ADBA 3FZ6A 1MGVA 2E54A 3UE8A 1DJ9A 3AOVA 2R5CA 4ZM4A 2X5FA 2AY3A 4RITA 2VMPA 1C7GA 1SFFA 2HUIA 2KFPA 2HP1A 5IWQA 3DYDA 2HUFA 2XBNA 4N0BA 4ATPA 4W5KA 3HL2A 4OYTA 2EYQA 1IX6A 4LW2A 1CZEA 2AY9A 3N75A 4R5FA 4BA5A 1H1CA 1CJ0A 3N0LA 3I5TA 4GDYA 2GQNA 1YIYA 3FDBA 3PDBA 4RKDA 3UAKA 1AKBA 1ECXA 3MC6C 3VOMA 1BJ4A 4AZJA 3PD6A 3WKRA 1EG5A 2BI1A 1ARTA 4IXOA 3B46A 3NTJA 4WB0A 1E5EA 1QGNA 1KL2A 3PA9A 3AEMA 1QISA 2QLRA 2PB0A 2BI5A 4K2MA 3TFTA 3P6KA 2ZJGA 4KXKA 1SZUA 1ARIA 3PIUA 1YOOA 4DQ6A 5M49A 2Z61A 3AOWA 1WKHA 4IYOA 1N8PA 4DGTA 3N7NA 1ZODA 3BCXA 1B9IA 5KTBA 3W1JA 1TOGA 3DR7A 4E3QA 3DODA 3FDDA 1FC4A 1D7VA 1ZC9A 2Z20A 1WSTA 3HLMA 1ASFA 3RCHA 1CQ8A 1LC7A 4H63Q 4ZWMA 3A8UX 1LW5A 3T32A 3E77A 1BQDA 4JF1A 1ASEA 2C81A 1WYTA 4PIWA 2OATA 1S06A 3LVMA 2ZY4A 4GEBA 2CANA 5DB5A 2AY5A 3GZCA 2BWNA 3EUCA 4U1TA 4XEWA 3ELEA 2VMVA 2QB3A 3A2BA 3ASAA 1AMSA 5DJ9A 2PB2A 3AEJA 1AJRA 1M32A 3HBXA 3WZFA 1MLYA 1WYUA 1QJ3A 2BI3A 2BIAA 2EGYA 3IF2A 3AEMC 3FCRA 3JTXA 1ELUA 1MDOA 1WYVB 2AEUA 1AIAA 1ORDA 2VIBA 4XK1A 2WK9A 3DZZA 3LG0A 4O6ZA 3FD0A 2NMPA 1DGEA 2YCPA 4BQ0A 1AKCA 1AAMA 3E2FA 3EI5A 2AEVA 3R9AA 1DJEA 2JGTA 2EPJA 3FZ7A 1GCKA 4Y0DA 4A6TA 4BA4A 5JAYA 1QITA 1UU2A 5F9SA 4RM1A 2PO3A 2VLHA 5G2QA 2FNUA 3VAXA 2JG2A 1YJZA 1BJWA 5HHYA 1OHVA 5HXXA 5AX8A 1ARSA 3A9YA 2HZPA 4XJOA 2BI9A 2FKIA 3OKSA 3LVKA 2VGSA 1GC4A 3TCMA 2CJDA 3KKIA 1GC2A 1BKGA 2OQXA 2W7FA 4ADDA 1AMQA 1TARA 4EB7A 2R0TA 3AEJC 1VP4A 1M0NA 1OATA 2QBTA 4JEYA 4W8IA 1BJOB 1B8GA 2ZY5A 3GJUA 2Z9XA 3BWNC 3BWOA 4AO4A 2X3LA 2CTZA 1W7MA 4XJLA 1J32A 3L8AA 4Y0IA 2A1VA 4CBRA 4F5MA 4DBCA 4OCAA 4AH3A 1AJSB 1B5OA 1EQBA 2XH1A 3QI6A 1C4KA 4WBTA 3K7YA 2E7UA 5G4JA 3TATA 3VK2A 2W7HA 1M0QA 1I48A 1PMMA 1ASLA 2W7DA 4RKCA 5HDMA 4B9BA 1KAFA 2VGUA 1SZKA 1KL1A 1SVVA 3PJ0A 4I8AA 3WLXA 3PD6B 1GC0A 2VMQA 5M4BA 4Q76A 1AHYA 2OKJA 3PPLA 1AHXA 1GEYA 3E2ZA 2YKYA 2VGZA 1B9HA 5F8VA 4BMKA 1DFOA 3N4XA 2CFBA 1Y4IA 2GB3A 3M5UA 4ZDLA 2DGKA 1PMOA 5BJ3A 1B4XA 1M4NA 2EZ1A 4GRXA 4IYOB 2D61A 3BS8A 3E2YA 1OXOA 3GETA 1C7NA 3F0HA 1O62A 1BJOA 2VMTA 1O69A 3HQTA 2D65A 1O4SA 1D7RA 1CL2A 4ZM3A 4XQ2A 4ZDPA 3NU7A 1IUGA 4H51A 3RCHB 2C0RA 2FN6A 1WYTB 1JG8A 4PFNA 1AJSA 1AHEA 2D63A 1X29A 4W1VA 5G2PA 4F5HA 3IHJA 4F5FA 3AEPA 5EAVA 2W7JA 1I43A 1O61A 5EIGB 3EZSA 2D66A 2G7JA 4JEXA 4JEVA 3N4SA 1WYUB 4UHNA 2VMZA 9AATA 2CH2A 2ZYJA 4ADCA 3FRKA 1Z7DA 2VMRA 2VLFA 1QIRA 2Z9VA 3COGA 3BB8A 1MAQA 3NX3A 1DJUA 2VMOA 1ASDA 4WYGA 3W1IA 1XEYA 4B98A 2YCTA 1CQ6A 2WB6A 3BCAA 3CQ4A 4IW7A 3DXVA 2QB2A 3RBFA 1GDEA 2CB1A 3MADA 3RI6A 2YCNA 4ZSWA 2VMSA 3CQ6A 4P3MA 3NU8A 1YIZA 2W7GA 2WK8A 4WYFA 2Q7WA 4IXSA 1C9CA 1ASBA 3CQ5A 4F4EA 5LHAA 4JEZA 4F5LA 1MDXA 4LNMA 2CINA 2QSRA 1GEWA 2GMSA 3LVJA 1SPAA 2CJGA 2JJHA 1AMAA 2BYJA 4M2JA 2ZUKA 1TOEA 5EFSA 2WKAA 4WXFA 3HMUA 2D5YA 3P1TA 2JJGA 3ZRRA 2Z1YA 5FT5A 4F5IA 2VMWA 3FTBA 2VMYA 2VI9A 4WXGA 4F5JA 3MKJA 2AY4A 5EIGA 1S08A 2BHXA 1S07A 2V1PA 3ASBA 2W7EA 3NYUA 4GE9A 4UHMA 4XAUA 2BKWA 2YKUA 5EQCA 2O1BA 1RV4A 1PFFA 2YKVA 3EI7A 1EJIA 1QZ9A 3QGUA 4MY5A 5E5IA 1D7UA 3JWAA 2HOXA 3DU4A 2VMUA 3RBLA 4MQQA 3AENA 3GR9A 5BJ4A 4LNLA 4TV7A 3N4RA 2W7LA 3QM2A 1W7LA 4EMYA 1V72A 5E4ZA 4ZASA 1OXPA 1BS0A 1TATA 2C44A 5DJ1A 2X5DA 3E2ZB 1AICA 3EIAA 2VIAA 1YNUA 4A00A 5G4IA 1YAAA 3LY1A 1V2DA 4L0OA 1C7OA 3FVUA 3EZ1A 2GSAA 2VGTA 2EZ2A 1AMRA 3II0A 4OC9A 4ZWVA 4UOYA 4F5GA 5M46A 1LC8A 2FNIA 4WLJA 1TASA 2QMAA 2Z67A 3MEBA 3DR4A 1ARGA 3N5MA 4PVFA 3ECDA 3MAFA 1SF2A 3DRDA 4FFCA 1ASMA 3GBXA 4MQPA 5J8QA 4WP0A 4WYAA 3MBBA 4Y0HA 4A0RA 4WXBA 4BHDA 3HT4A 1X28A 4K2IA 1QJ5A 1ZOBA 2AATA 5K8BA 3AEOA 4F5KA 3FVXA 1AHGA 3W1HA 4MGRA 1G7XA 1AIBA 1AY5A 2RFVA 1BJNA 3JWBA 3H9XA 1I41A 4JE5A 2HP2A 4GSAA 2W8JA 5M4DA 2G6WA 3A9XA 2JJFA 2QA3A 5D95A 3E6GA 3VK3A 3GZDA 3UWCA 4J8LA 3I16A 3NYTA 1AKAA 2X8UA 2DGMA 3ZRQA 4WYDA 1IAXA 1OHYA 1IVRA 2HOYA 3QPGA 4AZKA 1JS3A 1VJOA 3FZ8A 1XI9A 4UHOA 3BC8A 1BQAA 1YJSA 4GE7A 3EI6A 4WYCA 1AAWA 1TPLA 2VMXA 2W8WA 4EU1A 1W7NA 2BWPA 3TFUA 1M0OA 5G0AA 4TN4A 1D7SA 3WCNA 3EIBA 2ZSLA 1KMKA 4MKKA 1KKPA 5EUEA 4W91A 3WY7A 5EUDA 2D64A 4E3RA 2W8TA 1GC3A 5FT4A 4Q6RA 4LW4A 3ACZA 4KAMA 1M6SA 3PGYA 4HF8A 2AY6A 3I4JA 3LWSA 3D6KA 3G0TA 1X2AA 5E3KA 1JS6A 5D5SA 2W7IA 2OGEA 3JU7A 2AY8A 3B8XA 1MLZA 2CH1A 2V0YA 3RUYA 4LNJA 3MAUA 3F9TA 2HOZA 3HDOA 2VI8A 3K40A 3F6TA 3LVLB 3GZDC 4ATQA 2HORA 1TOIA 4ADEA 2E7JA 2YOBA 2AY7A 5LH9A 1CL1A 1JF9A 2JISA 3CAIA 2CY8A 2VMNA 3KGWA 2TPLA 1BT4A 3NUIA 1S09A 2BYLA 4JEWA 2AY1A 3ZZJA 3GSBA 1LK9A 3AENB 3BV0A 1YJYA 4RAEA 1RVYA 2WK7A 3ATHA 5FT8A 1LW4A 3WGCA 1UU0A 2FYFA 2OGAA 4WD2A 1OHWA 1B5PA 8AATA 4AO9A 4TMRA 3WKSA 3FQ7A 2YKXA 3H7FA 4AOAA 4E1OA 1D2FA 4IY7A 2AY2A 3FFRA 4GE4A 1ASAA 4IX8A 1G7WA 3BN1A 4E77A 1H0CA 3CBFA 3G8MA 2Z1ZA 1DGDA 4IXZA 1IBJA 5G09A 2BIGA 4NOGA 4OBVA 4A0FA 1IAYA 3K28A 2W8UA 1S0AA 1TOJA 3JW9A 2D7ZA 3ELPA 3FVSA 2D7YA 3MAFB 1VEFA 1CQ7A 2ORDA 2YHKA 4Q31A 1ASNA 1FG7A 1N31A 3DXWA 2ZY2A 3G7QA 1UKJA 3B1EA 2YRIA 4K2BA 1DTYA 1TOKA 5C6UA 3FSLA 3VP6A 4R8DA 4A0HA 4P7YA 3WGBA 4ZLVA 4CXRA 2VGWA 1U08A 3L44A 4W1WA 1E5FA 1M0PA 2Z9UA 5I92A 4OTLA 1N2TA 3R4TA 2BIEA 3DC1A 4RJYA 3ZRPA 4EB5A 2ZY3A 4PFFA 4Q75A 1GD9A 3AELA 3FKDA 4ITGA 3NRAA 4M2MA 3KE3A 1AY4A 3AATA 4OT8A 1LKCA 2W8VA 3KGXA 3LV2A 4HVKA 3BWNA 1CS1A 1KKJA 3NDNA 4W1XA 4MKJA 4ZSYA 1W3UA 3TQXA 1PG8A 4A6UA 1AHFA 1KMJA 1AX4A 2DGLA 1LC5A 3OP7A 2EH6A 2F8JA 2FQ6A 2W7MA 3WCOA 4CVQA 4K05A 1DKAA 1I29A 3H14A 3FFHA 2CJHA 3E9KA 2W7KA 5DX5A 3PAAA 4JF0A 3AV7A 1AY8A 3FQ8A 4ISYA 4EFFA 2O7CA 1V2EA 3A9ZA 3EI8A 1T3IA 2DKJA 3B1DA 2HUUA 1BW0A 1ARHA 3GWPA 3PDXA 3QBOA 1J04A 4UQVA 2O0RA 3FQAA 1W23A 2CSTA 5EAAA 1ASCA 2BI2A 4CXQA 4KYOA 4R2NA 1M7YA 2R2NA 4OMAA 2VYCA 1IX8A 4R5ZA 2JJEA 1MAPA 4M2KA 4ZAHA 4FL0A 1UU1A 1G4XA 4RJ0A 1RV3A 1IJIA 2R5CB 1SZSA 1C0NA 3QN6A 3NUBA 1ELQA 2BWOA 4XJMA 3NYSA 1P3WA 1WYVA 4XJPA 3EI9A 3ISLA 3JZLA 2R5EA 3Q8NA 2YRRA 3ZZKA 3B1CA 4A72A 4ZDOA 2E7IA 2Z9WA 1WKGA 3NNKA 4LC3A 1RVUA 1GEXA 5EUNA 7AATA 2FM1A 4CBSA 2OKKA 1ASGA 3VK4A 1Z3ZA 3PDBB 4A6RA 1IX7A 4OBUA 4ITXA 1CZCA 2ZSMA 4MSOA 2DR1A 4J5UA 1FG3A 2DOUA 2ZP7A 4JE5D 1LS3A 3WX9A 4WB0B 3MC6A 4N0WA 2DKBA 4WYEA 2GMUA 2ZC0A 3HVYA 4RLGA 3RQ1A 2VGVA 3USFA 3QHXA 2EO5A 5FT6A 1GBNA 1X0MA 4QGRA 1G4VA 4U2HA
chains in the Genus database with same CATH topology
3BCBA 1MDZA 4MQRA 5TF5A 4WLHA 1V2FA 4A0GA 2C7TA 4RIZA 4ADBA 3FZ6A 1MGVA 2E54A 3UE8A 1DJ9A 3AOVA 2R5CA 4ZM4A 2X5FA 2AY3A 4RITA 2VMPA 1C7GA 1SFFA 2HUIA 2KFPA 2HP1A 5IWQA 3DYDA 2HUFA 2XBNA 4N0BA 4ATPA 4W5KA 3HL2A 4OYTA 2EYQA 1IX6A 4LW2A 1CZEA 2AY9A 3N75A 4R5FA 4BA5A 1H1CA 1CJ0A 3N0LA 3I5TA 4GDYA 2GQNA 1YIYA 3FDBA 3PDBA 4RKDA 3UAKA 1AKBA 1ECXA 3MC6C 3VOMA 1BJ4A 4AZJA 3PD6A 3WKRA 1EG5A 2BI1A 1ARTA 4IXOA 3B46A 3NTJA 4WB0A 1E5EA 1QGNA 1KL2A 3PA9A 3AEMA 1QISA 2QLRA 2PB0A 2BI5A 4K2MA 3TFTA 3P6KA 2ZJGA 4KXKA 1SZUA 1ARIA 3PIUA 1YOOA 4DQ6A 5M49A 2Z61A 3AOWA 1WKHA 4IYOA 1N8PA 4DGTA 3N7NA 1ZODA 3BCXA 1B9IA 5KTBA 3W1JA 1TOGA 3DR7A 4E3QA 3DODA 3FDDA 1FC4A 1D7VA 1ZC9A 2Z20A 1WSTA 3HLMA 1ASFA 3RCHA 1CQ8A 1LC7A 4H63Q 4ZWMA 3A8UX 1LW5A 3T32A 3E77A 1BQDA 4JF1A 1ASEA 2C81A 1WYTA 4PIWA 2OATA 1S06A 3LVMA 2ZY4A 4GEBA 2CANA 5DB5A 2AY5A 3GZCA 2BWNA 3EUCA 4U1TA 4XEWA 3ELEA 2VMVA 2QB3A 3A2BA 3ASAA 1AMSA 5DJ9A 2PB2A 3AEJA 1AJRA 1M32A 3HBXA 3WZFA 1MLYA 1WYUA 1QJ3A 2BI3A 2BIAA 2EGYA 3IF2A 3AEMC 3FCRA 3JTXA 1ELUA 1MDOA 1WYVB 2AEUA 1AIAA 1ORDA 2VIBA 4XK1A 2WK9A 3DZZA 3LG0A 4O6ZA 3FD0A 2NMPA 1DGEA 2YCPA 4BQ0A 1AKCA 1AAMA 3E2FA 3EI5A 2AEVA 3R9AA 1DJEA 2JGTA 2EPJA 3FZ7A 1GCKA 4Y0DA 4A6TA 4BA4A 5JAYA 1QITA 1UU2A 5F9SA 4RM1A 2PO3A 2VLHA 5G2QA 2FNUA 3VAXA 2JG2A 1YJZA 1BJWA 5HHYA 1OHVA 5HXXA 5AX8A 1ARSA 3A9YA 2HZPA 4XJOA 2BI9A 2FKIA 3OKSA 3LVKA 2VGSA 1GC4A 3TCMA 2CJDA 3KKIA 1GC2A 1BKGA 2OQXA 2W7FA 4ADDA 1AMQA 1TARA 4EB7A 2R0TA 3AEJC 1VP4A 1M0NA 1OATA 2QBTA 4JEYA 4W8IA 1BJOB 1B8GA 2ZY5A 3GJUA 2Z9XA 3BWNC 3BWOA 4AO4A 2X3LA 2CTZA 1W7MA 4XJLA 1J32A 3L8AA 4Y0IA 2A1VA 4CBRA 4F5MA 4DBCA 4OCAA 4AH3A 1AJSB 1B5OA 1EQBA 2XH1A 3QI6A 1C4KA 4WBTA 3K7YA 2E7UA 5G4JA 3TATA 3VK2A 2W7HA 1M0QA 1I48A 1PMMA 1ASLA 2W7DA 4RKCA 5HDMA 4B9BA 2VGUA 1SZKA 1KL1A 1SVVA 3PJ0A 4I8AA 3WLXA 3PD6B 1GC0A 2VMQA 5M4BA 4Q76A 1AHYA 2OKJA 3PPLA 1AHXA 1GEYA 3E2ZA 2YKYA 2VGZA 1B9HA 5F8VA 4BMKA 1DFOA 3N4XA 2CFBA 1Y4IA 2GB3A 3M5UA 4ZDLA 2DGKA 1PMOA 5BJ3A 1B4XA 1M4NA 2EZ1A 4GRXA 4IYOB 2D61A 3BS8A 3E2YA 1OXOA 3GETA 1C7NA 3F0HA 1O62A 1BJOA 2VMTA 1O69A 3HQTA 2D65A 1O4SA 1D7RA 1CL2A 4ZM3A 4XQ2A 4ZDPA 3NU7A 1IUGA 4H51A 3RCHB 2C0RA 2FN6A 1WYTB 1JG8A 4PFNA 1AJSA 1AHEA 2D63A 1X29A 4W1VA 5G2PA 4F5HA 3IHJA 4F5FA 3AEPA 5EAVA 2W7JA 1I43A 1O61A 5EIGB 3EZSA 2D66A 2G7JA 4JEXA 4JEVA 3N4SA 1WYUB 4UHNA 2VMZA 9AATA 2CH2A 2ZYJA 4ADCA 3FRKA 1Z7DA 2VMRA 2VLFA 1QIRA 2Z9VA 3COGA 3BB8A 1MAQA 3NX3A 1DJUA 2VMOA 1ASDA 4WYGA 3W1IA 1XEYA 4B98A 2YCTA 1CQ6A 2WB6A 3BCAA 3CQ4A 4IW7A 3DXVA 2QB2A 3RBFA 1GDEA 2CB1A 3MADA 3RI6A 2YCNA 4ZSWA 2VMSA 3CQ6A 4P3MA 3NU8A 1YIZA 2W7GA 2WK8A 4WYFA 2Q7WA 4IXSA 1C9CA 1ASBA 3CQ5A 4F4EA 5LHAA 4JEZA 4F5LA 1MDXA 4LNMA 2CINA 2QSRA 1GEWA 2GMSA 3LVJA 1SPAA 2CJGA 2JJHA 1AMAA 2BYJA 4M2JA 2ZUKA 1TOEA 5EFSA 2WKAA 4WXFA 3HMUA 2D5YA 3P1TA 2JJGA 3ZRRA 2Z1YA 5FT5A 4F5IA 2VMWA 3FTBA 2VMYA 2VI9A 4WXGA 4F5JA 3MKJA 2AY4A 5EIGA 1S08A 2BHXA 1S07A 2V1PA 3ASBA 2W7EA 3NYUA 4GE9A 4UHMA 4XAUA 2BKWA 2YKUA 5EQCA 2O1BA 1RV4A 1PFFA 2YKVA 3EI7A 1EJIA 1QZ9A 3QGUA 4MY5A 5E5IA 1D7UA 3JWAA 2HOXA 3DU4A 2VMUA 3RBLA 4MQQA 3AENA 3GR9A 5BJ4A 4LNLA 4TV7A 3N4RA 2W7LA 3QM2A 1W7LA 4EMYA 1V72A 5E4ZA 4ZASA 1OXPA 1BS0A 1TATA 2C44A 5DJ1A 2X5DA 3E2ZB 1AICA 3EIAA 2VIAA 1YNUA 4A00A 5G4IA 1YAAA 3LY1A 1V2DA 4L0OA 1C7OA 3FVUA 3EZ1A 2GSAA 2VGTA 2EZ2A 1AMRA 3II0A 4OC9A 4ZWVA 4UOYA 4F5GA 5M46A 1LC8A 2FNIA 4WLJA 1TASA 2QMAA 2Z67A 3MEBA 3DR4A 1ARGA 3N5MA 4PVFA 3ECDA 3MAFA 1SF2A 3DRDA 4FFCA 1ASMA 3GBXA 4MQPA 5J8QA 4WP0A 4WYAA 3MBBA 4Y0HA 4A0RA 4WXBA 4BHDA 3HT4A 1X28A 4K2IA 1QJ5A 1ZOBA 2AATA 5K8BA 3AEOA 4F5KA 3FVXA 1AHGA 3W1HA 4MGRA 1G7XA 1AIBA 1AY5A 2RFVA 1BJNA 3JWBA 3H9XA 1I41A 4JE5A 2HP2A 4GSAA 2W8JA 5M4DA 2G6WA 3A9XA 2JJFA 2QA3A 5D95A 3E6GA 3VK3A 3GZDA 3UWCA 4J8LA 3I16A 3NYTA 1AKAA 2X8UA 2DGMA 3ZRQA 4WYDA 1IAXA 1OHYA 1IVRA 2HOYA 3QPGA 4AZKA 1JS3A 1VJOA 3FZ8A 1XI9A 4UHOA 3BC8A 1BQAA 1YJSA 4GE7A 3EI6A 4WYCA 1AAWA 1TPLA 2VMXA 2W8WA 4EU1A 1W7NA 2BWPA 3TFUA 1M0OA 5G0AA 4TN4A 1D7SA 3WCNA 3EIBA 2ZSLA 1KMKA 4MKKA 1KKPA 5EUEA 4W91A 3WY7A 5EUDA 2D64A 4E3RA 2W8TA 1GC3A 5FT4A 4Q6RA 4LW4A 3ACZA 4KAMA 1M6SA 3PGYA 4HF8A 2AY6A 3I4JA 3LWSA 3D6KA 3G0TA 1X2AA 5E3KA 1JS6A 5D5SA 2W7IA 2OGEA 3JU7A 2AY8A 3B8XA 1MLZA 2CH1A 2V0YA 3RUYA 4LNJA 3MAUA 3F9TA 2HOZA 3HDOA 2VI8A 3K40A 3F6TA 3LVLB 3GZDC 4ATQA 2HORA 1TOIA 4ADEA 2E7JA 2YOBA 2AY7A 5LH9A 1CL1A 1JF9A 2JISA 3CAIA 2CY8A 2VMNA 3KGWA 2TPLA 1BT4A 3NUIA 1S09A 2BYLA 4JEWA 2AY1A 3ZZJA 3GSBA 1LK9A 3AENB 3BV0A 1YJYA 4RAEA 1RVYA 2WK7A 3ATHA 5FT8A 1LW4A 3WGCA 1UU0A 2FYFA 2OGAA 4WD2A 1OHWA 1B5PA 8AATA 4AO9A 4TMRA 3WKSA 3FQ7A 2YKXA 3H7FA 4AOAA 4E1OA 1D2FA 4IY7A 2AY2A 3FFRA 4GE4A 1ASAA 4IX8A 1G7WA 3BN1A 4E77A 1H0CA 3CBFA 3G8MA 2Z1ZA 1DGDA 4IXZA 1IBJA 5G09A 2BIGA 4NOGA 4OBVA 4A0FA 1IAYA 3K28A 2W8UA 1S0AA 1TOJA 3JW9A 2D7ZA 3ELPA 3FVSA 2D7YA 3MAFB 1VEFA 1CQ7A 2ORDA 2YHKA 4Q31A 1ASNA 1FG7A 1N31A 3DXWA 2ZY2A 3G7QA 1UKJA 3B1EA 2YRIA 4K2BA 1DTYA 1TOKA 5C6UA 3FSLA 3VP6A 4R8DA 4A0HA 4P7YA 3WGBA 4ZLVA 4CXRA 2VGWA 1U08A 3L44A 4W1WA 1E5FA 1M0PA 2Z9UA 5I92A 4OTLA 1N2TA 3R4TA 2BIEA 3DC1A 4RJYA 3ZRPA 4EB5A 2ZY3A 4PFFA 4Q75A 1GD9A 3AELA 3FKDA 4ITGA 3NRAA 4M2MA 3KE3A 1AY4A 3AATA 4OT8A 1LKCA 2W8VA 3KGXA 3LV2A 4HVKA 3BWNA 1CS1A 1KKJA 3NDNA 4W1XA 4MKJA 4ZSYA 1W3UA 3TQXA 1PG8A 4A6UA 1AHFA 1KMJA 1AX4A 2DGLA 1LC5A 3OP7A 2EH6A 2F8JA 2FQ6A 2W7MA 3WCOA 4CVQA 4K05A 1DKAA 1I29A 3H14A 3FFHA 2CJHA 3E9KA 2W7KA 5DX5A 3PAAA 4JF0A 3AV7A 1AY8A 3FQ8A 4ISYA 4EFFA 2O7CA 1V2EA 3A9ZA 3EI8A 1T3IA 2DKJA 3B1DA 2HUUA 1BW0A 1ARHA 3GWPA 3PDXA 3QBOA 1J04A 4UQVA 2O0RA 3FQAA 1W23A 2CSTA 5EAAA 1ASCA 2BI2A 4CXQA 4KYOA 4R2NA 1M7YA 2R2NA 4OMAA 2VYCA 1IX8A 4R5ZA 2JJEA 1MAPA 4M2KA 4ZAHA 4FL0A 1UU1A 1G4XA 4RJ0A 1RV3A 1IJIA 2R5CB 1SZSA 1C0NA 3QN6A 3NUBA 1ELQA 2BWOA 4XJMA 3NYSA 1P3WA 1WYVA 4XJPA 3EI9A 3ISLA 3JZLA 2R5EA 3Q8NA 2YRRA 3ZZKA 3B1CA 4A72A 4ZDOA 2E7IA 2Z9WA 1WKGA 3NNKA 4LC3A 1RVUA 1GEXA 5EUNA 7AATA 2FM1A 4CBSA 2OKKA 1ASGA 3VK4A 1Z3ZA 3PDBB 4A6RA 1IX7A 4OBUA 4ITXA 1CZCA 2ZSMA 4MSOA 2DR1A 4J5UA 1FG3A 2DOUA 2ZP7A 4JE5D 1LS3A 3WX9A 4WB0B 3MC6A 4N0WA 2DKBA 4WYEA 2GMUA 2ZC0A 3HVYA 4RLGA 3RQ1A 2VGVA 3USFA 3QHXA 2EO5A 5FT6A 1GBNA 1X0MA 4QGRA 1G4VA 4U2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BCB A;  1MDZ A;  4MQR A;  5TF5 A;  4WLH A;  1V2F A;  4A0G A;  2C7T A;  4RIZ A;  4ADB A;  3FZ6 A;  1MGV A;  2E54 A;  3UE8 A;  1DJ9 A;  3AOV A;  2R5C A;  4ZM4 A;  2X5F A;  2AY3 A;  4RIT A;  2VMP A;  1C7G A;  1SFF A;  2HUI A;  2HP1 A;  5IWQ A;  3DYD A;  2HUF A;  2XBN A;  4N0B A;  4ATP A;  4W5K A;  3HL2 A;  4OYT A;  1IX6 A;  4LW2 A;  1CZE A;  2AY9 A;  3N75 A;  4R5F A;  4BA5 A;  1H1C A;  1CJ0 A;  3N0L A;  3I5T A;  4GDY A;  2GQN A;  1YIY A;  3FDB A;  3PDB A;  4RKD A;  3UAK A;  1AKB A;  1ECX A;  3MC6 C;  3VOM A;  1BJ4 A;  4AZJ A;  3PD6 A;  3WKR A;  1EG5 A;  2BI1 A;  1ART A;  4IXO A;  3B46 A;  3NTJ A;  4WB0 A;  1E5E A;  1QGN A;  1KL2 A;  3PA9 A;  3AEM A;  1QIS A;  2QLR A;  2PB0 A;  2BI5 A;  4K2M A;  3TFT A;  3P6K A;  2ZJG A;  4KXK A;  1SZU A;  1ARI A;  3PIU A;  1YOO A;  4DQ6 A;  5M49 A;  2Z61 A;  3AOW A;  1WKH A;  4IYO A;  1N8P A;  4DGT A;  1ZOD A;  3BCX A;  1B9I A;  3W1J A;  1TOG A;  3DR7 A;  4E3Q A;  3DOD A;  3FDD A;  1FC4 A;  1D7V A;  1ZC9 A;  2Z20 A;  1WST A;  3HLM A;  1ASF A;  3RCH A;  1CQ8 A;  1LC7 A;  4ZWM A;  3A8U X;  1LW5 A;  3T32 A;  3E77 A;  1BQD A;  4JF1 A;  1ASE A;  2C81 A;  1WYT A;  4PIW A;  2OAT A;  1S06 A;  3LVM A;  2ZY4 A;  4GEB A;  2CAN A;  5DB5 A;  2AY5 A;  3GZC A;  2BWN A;  3EUC A;  4U1T A;  4XEW A;  3ELE A;  2VMV A;  2QB3 A;  3A2B A;  3ASA A;  1AMS A;  5DJ9 A;  2PB2 A;  3AEJ A;  1AJR A;  1M32 A;  3HBX A;  3WZF A;  1MLY A;  1WYU A;  1QJ3 A;  2BI3 A;  2BIA A;  2EGY A;  3IF2 A;  3AEM C;  3FCR A;  3JTX A;  1ELU A;  1MDO A;  1WYV B;  2AEU A;  1AIA A;  1ORD A;  2VIB A;  4XK1 A;  2WK9 A;  3DZZ A;  3LG0 A;  4O6Z A;  3FD0 A;  2NMP A;  1DGE A;  2YCP A;  4BQ0 A;  1AKC A;  1AAM A;  3E2F A;  3EI5 A;  2AEV A;  3R9A A;  1DJE A;  2JGT A;  2EPJ A;  3FZ7 A;  1GCK A;  4Y0D A;  4A6T A;  4BA4 A;  5JAY A;  1QIT A;  1UU2 A;  5F9S A;  4RM1 A;  2PO3 A;  2VLH A;  5G2Q A;  2FNU A;  3VAX A;  2JG2 A;  1YJZ A;  1BJW A;  5HHY A;  1OHV A;  5HXX A;  5AX8 A;  1ARS A;  3A9Y A;  2HZP A;  4XJO A;  2BI9 A;  3OKS A;  3LVK A;  2VGS A;  1GC4 A;  3TCM A;  2CJD A;  3KKI A;  1GC2 A;  1BKG A;  2OQX A;  2W7F A;  4ADD A;  1AMQ A;  1TAR A;  4EB7 A;  2R0T A;  3AEJ C;  1VP4 A;  1M0N A;  1OAT A;  2QBT A;  4JEY A;  4W8I A;  1BJO B;  1B8G A;  2ZY5 A;  3GJU A;  2Z9X A;  3BWN C;  3BWO A;  4AO4 A;  2X3L A;  2CTZ A;  1W7M A;  4XJL A;  1J32 A;  3L8A A;  4Y0I A;  4CBR A;  4F5M A;  4DBC A;  4OCA A;  4AH3 A;  1AJS B;  1B5O A;  1EQB A;  2XH1 A;  3QI6 A;  1C4K A;  4WBT A;  3K7Y A;  2E7U A;  5G4J A;  3TAT A;  3VK2 A;  2W7H A;  1M0Q A;  1I48 A;  1PMM A;  1ASL A;  2W7D A;  4RKC A;  5HDM A;  4B9B A;  2VGU A;  1SZK A;  1KL1 A;  1SVV A;  3PJ0 A;  4I8A A;  3WLX A;  3PD6 B;  1GC0 A;  2VMQ A;  5M4B A;  4Q76 A;  1AHY A;  2OKJ A;  3PPL A;  1AHX A;  1GEY A;  3E2Z A;  2YKY A;  2VGZ A;  1B9H A;  5F8V A;  4BMK A;  1DFO A;  2CFB A;  1Y4I A;  2GB3 A;  3M5U A;  4ZDL A;  2DGK A;  1PMO A;  5BJ3 A;  1B4X A;  1M4N A;  2EZ1 A;  4GRX A;  4IYO B;  2D61 A;  3BS8 A;  3E2Y A;  1OXO A;  3GET A;  1C7N A;  3F0H A;  1O62 A;  1BJO A;  2VMT A;  1O69 A;  3HQT A;  2D65 A;  1O4S A;  1D7R A;  1CL2 A;  4ZM3 A;  4XQ2 A;  4ZDP A;  3NU7 A;  1IUG A;  4H51 A;  3RCH B;  2C0R A;  2FN6 A;  1WYT B;  1JG8 A;  4PFN A;  1AJS A;  1AHE A;  2D63 A;  1X29 A;  4W1V A;  5G2P A;  4F5H A;  3IHJ A;  4F5F A;  3AEP A;  5EAV A;  2W7J A;  1I43 A;  1O61 A;  5EIG B;  3EZS A;  2D66 A;  4JEX A;  4JEV A;  1WYU B;  4UHN A;  2VMZ A;  9AAT A;  2CH2 A;  2ZYJ A;  4ADC A;  3FRK A;  1Z7D A;  2VMR A;  2VLF A;  1QIR A;  2Z9V A;  3COG A;  3BB8 A;  1MAQ A;  3NX3 A;  1DJU A;  2VMO A;  1ASD A;  4WYG A;  3W1I A;  1XEY A;  4B98 A;  2YCT A;  1CQ6 A;  3BCA A;  3CQ4 A;  4IW7 A;  3DXV A;  2QB2 A;  3RBF A;  1GDE A;  2CB1 A;  3MAD A;  3RI6 A;  2YCN A;  4ZSW A;  2VMS A;  3CQ6 A;  4P3M A;  3NU8 A;  1YIZ A;  2W7G A;  2WK8 A;  4WYF A;  2Q7W A;  4IXS A;  1C9C A;  1ASB A;  3CQ5 A;  4F4E A;  5LHA A;  4JEZ A;  4F5L A;  1MDX A;  4LNM A;  2CIN A;  1GEW A;  2GMS A;  3LVJ A;  1SPA A;  2CJG A;  2JJH A;  1AMA A;  2BYJ A;  4M2J A;  2ZUK A;  1TOE A;  5EFS A;  2WKA A;  4WXF A;  3HMU A;  2D5Y A;  3P1T A;  2JJG A;  3ZRR A;  2Z1Y A;  5FT5 A;  4F5I A;  2VMW A;  3FTB A;  2VMY A;  2VI9 A;  4WXG A;  4F5J A;  3MKJ A;  2AY4 A;  5EIG A;  1S08 A;  2BHX A;  1S07 A;  2V1P A;  3ASB A;  2W7E A;  3NYU A;  4GE9 A;  4UHM A;  4XAU A;  2BKW A;  2YKU A;  5EQC A;  2O1B A;  1RV4 A;  1PFF A;  2YKV A;  3EI7 A;  1EJI A;  1QZ9 A;  3QGU A;  4MY5 A;  5E5I A;  1D7U A;  3JWA A;  2HOX A;  3DU4 A;  2VMU A;  3RBL A;  4MQQ A;  3AEN A;  3GR9 A;  5BJ4 A;  4LNL A;  4TV7 A;  2W7L A;  3QM2 A;  1W7L A;  4EMY A;  1V72 A;  5E4Z A;  4ZAS A;  1OXP A;  1BS0 A;  1TAT A;  2C44 A;  5DJ1 A;  2X5D A;  3E2Z B;  1AIC A;  3EIA A;  2VIA A;  1YNU A;  4A00 A;  5G4I A;  1YAA A;  3LY1 A;  1V2D A;  4L0O A;  1C7O A;  3FVU A;  3EZ1 A;  2GSA A;  2VGT A;  2EZ2 A;  1AMR A;  3II0 A;  4OC9 A;  4ZWV A;  4UOY A;  4F5G A;  5M46 A;  1LC8 A;  2FNI A;  4WLJ A;  1TAS A;  2QMA A;  2Z67 A;  3MEB A;  3DR4 A;  1ARG A;  3N5M A;  4PVF A;  3ECD A;  3MAF A;  1SF2 A;  3DRD A;  4FFC A;  1ASM A;  3GBX A;  4MQP A;  5J8Q A;  4WP0 A;  4WYA A;  3MBB A;  4Y0H A;  4A0R A;  4WXB A;  4BHD A;  3HT4 A;  1X28 A;  4K2I A;  1QJ5 A;  1ZOB A;  2AAT A;  5K8B A;  3AEO A;  4F5K A;  3FVX A;  1AHG A;  3W1H A;  4MGR A;  1G7X A;  1AIB A;  1AY5 A;  2RFV A;  1BJN A;  3JWB A;  1I41 A;  4JE5 A;  2HP2 A;  4GSA A;  2W8J A;  5M4D A;  2G6W A;  3A9X A;  2JJF A;  2QA3 A;  5D95 A;  3E6G A;  3VK3 A;  3GZD A;  3UWC A;  4J8L A;  3I16 A;  3NYT A;  1AKA A;  2X8U A;  2DGM A;  3ZRQ A;  4WYD A;  1IAX A;  1OHY A;  1IVR A;  2HOY A;  3QPG A;  4AZK A;  1JS3 A;  1VJO A;  3FZ8 A;  1XI9 A;  4UHO A;  3BC8 A;  1BQA A;  1YJS A;  4GE7 A;  3EI6 A;  4WYC A;  1AAW A;  1TPL A;  2VMX A;  2W8W A;  4EU1 A;  1W7N A;  2BWP A;  3TFU A;  1M0O A;  5G0A A;  4TN4 A;  1D7S A;  3WCN A;  3EIB A;  2ZSL A;  1KMK A;  4MKK A;  1KKP A;  5EUE A;  4W91 A;  3WY7 A;  5EUD A;  2D64 A;  4E3R A;  2W8T A;  1GC3 A;  5FT4 A;  4Q6R A;  4LW4 A;  3ACZ A;  4KAM A;  1M6S A;  3PGY A;  4HF8 A;  2AY6 A;  3I4J A;  3LWS A;  3D6K A;  3G0T A;  1X2A A;  5E3K A;  1JS6 A;  5D5S A;  2W7I A;  2OGE A;  3JU7 A;  2AY8 A;  3B8X A;  1MLZ A;  2CH1 A;  2V0Y A;  3RUY A;  4LNJ A;  3MAU A;  3F9T A;  2HOZ A;  3HDO A;  2VI8 A;  3K40 A;  3F6T A;  3LVL B;  3GZD C;  4ATQ A;  2HOR A;  1TOI A;  4ADE A;  2E7J A;  2YOB A;  2AY7 A;  5LH9 A;  1CL1 A;  1JF9 A;  2JIS A;  3CAI A;  2CY8 A;  2VMN A;  3KGW A;  2TPL A;  1BT4 A;  3NUI A;  1S09 A;  2BYL A;  4JEW A;  2AY1 A;  3ZZJ A;  3GSB A;  1LK9 A;  3AEN B;  3BV0 A;  1YJY A;  4RAE A;  1RVY A;  2WK7 A;  3ATH A;  5FT8 A;  1LW4 A;  3WGC A;  1UU0 A;  2FYF A;  2OGA A;  4WD2 A;  1OHW A;  1B5P A;  8AAT A;  4AO9 A;  4TMR A;  3WKS A;  3FQ7 A;  2YKX A;  3H7F A;  4AOA A;  4E1O A;  1D2F A;  4IY7 A;  2AY2 A;  3FFR A;  4GE4 A;  1ASA A;  4IX8 A;  1G7W A;  3BN1 A;  4E77 A;  1H0C A;  3CBF A;  3G8M A;  2Z1Z A;  1DGD A;  4IXZ A;  1IBJ A;  5G09 A;  2BIG A;  4NOG A;  4OBV A;  4A0F A;  1IAY A;  3K28 A;  2W8U A;  1S0A A;  1TOJ A;  3JW9 A;  2D7Z A;  3ELP A;  3FVS A;  2D7Y A;  3MAF B;  1VEF A;  1CQ7 A;  2ORD A;  2YHK A;  4Q31 A;  1ASN A;  1FG7 A;  1N31 A;  3DXW A;  2ZY2 A;  3G7Q A;  1UKJ A;  3B1E A;  2YRI A;  4K2B A;  1DTY A;  1TOK A;  5C6U A;  3FSL A;  3VP6 A;  4R8D A;  4A0H A;  4P7Y A;  3WGB A;  4ZLV A;  4CXR A;  2VGW A;  1U08 A;  3L44 A;  4W1W A;  1E5F A;  1M0P A;  2Z9U A;  5I92 A;  4OTL A;  1N2T A;  3R4T A;  2BIE A;  3DC1 A;  4RJY A;  3ZRP A;  4EB5 A;  2ZY3 A;  4PFF A;  4Q75 A;  1GD9 A;  3AEL A;  3FKD A;  4ITG A;  3NRA A;  4M2M A;  3KE3 A;  1AY4 A;  3AAT A;  4OT8 A;  1LKC A;  2W8V A;  3KGX A;  3LV2 A;  4HVK A;  3BWN A;  1CS1 A;  1KKJ A;  3NDN A;  4W1X A;  4MKJ A;  4ZSY A;  1W3U A;  3TQX A;  1PG8 A;  4A6U A;  1AHF A;  1KMJ A;  1AX4 A;  2DGL A;  1LC5 A;  3OP7 A;  2EH6 A;  2F8J A;  2FQ6 A;  2W7M A;  3WCO A;  4CVQ A;  1DKA A;  1I29 A;  3H14 A;  3FFH A;  2CJH A;  3E9K A;  2W7K A;  5DX5 A;  3PAA A;  4JF0 A;  3AV7 A;  1AY8 A;  3FQ8 A;  4ISY A;  4EFF A;  2O7C A;  1V2E A;  3A9Z A;  3EI8 A;  1T3I A;  2DKJ A;  3B1D A;  2HUU A;  1BW0 A;  1ARH A;  3GWP A;  3PDX A;  3QBO A;  1J04 A;  4UQV A;  2O0R A;  3FQA A;  1W23 A;  2CST A;  5EAA A;  1ASC A;  2BI2 A;  4CXQ A;  4KYO A;  4R2N A;  1M7Y A;  2R2N A;  4OMA A;  2VYC A;  1IX8 A;  4R5Z A;  2JJE A;  1MAP A;  4M2K A;  4ZAH A;  4FL0 A;  1UU1 A;  1G4X A;  4RJ0 A;  1RV3 A;  1IJI A;  2R5C B;  1SZS A;  1C0N A;  3QN6 A;  3NUB A;  1ELQ A;  2BWO A;  4XJM A;  3NYS A;  1P3W A;  1WYV A;  4XJP A;  3EI9 A;  3ISL A;  3JZL A;  2R5E A;  3Q8N A;  2YRR A;  3ZZK A;  3B1C A;  4A72 A;  4ZDO A;  2E7I A;  2Z9W A;  1WKG A;  3NNK A;  4LC3 A;  1RVU A;  1GEX A;  5EUN A;  7AAT A;  2FM1 A;  4CBS A;  2OKK A;  1ASG A;  3VK4 A;  1Z3Z A;  3PDB B;  4A6R A;  1IX7 A;  4OBU A;  4ITX A;  1CZC A;  2ZSM A;  4MSO A;  2DR1 A;  4J5U A;  1FG3 A;  2DOU A;  2ZP7 A;  4JE5 D;  1LS3 A;  3WX9 A;  4WB0 B;  3MC6 A;  4N0W A;  2DKB A;  4WYE A;  2GMU A;  2ZC0 A;  3HVY A;  4RLG A;  3RQ1 A;  2VGV A;  3USF A;  3QHX A;  2EO5 A;  5FT6 A;  1GBN A;  1X0M A;  4QGR A;  1G4V A;  4U2H A; 
#chains in the Genus database with same CATH topology
 3BCB A;  1MDZ A;  4MQR A;  5TF5 A;  4WLH A;  1V2F A;  4A0G A;  2C7T A;  4RIZ A;  4ADB A;  3FZ6 A;  1MGV A;  2E54 A;  3UE8 A;  1DJ9 A;  3AOV A;  2R5C A;  4ZM4 A;  2X5F A;  2AY3 A;  4RIT A;  2VMP A;  1C7G A;  1SFF A;  2HUI A;  2KFP A;  2HP1 A;  5IWQ A;  3DYD A;  2HUF A;  2XBN A;  4N0B A;  4ATP A;  4W5K A;  3HL2 A;  4OYT A;  2EYQ A;  1IX6 A;  4LW2 A;  1CZE A;  2AY9 A;  3N75 A;  4R5F A;  4BA5 A;  1H1C A;  1CJ0 A;  3N0L A;  3I5T A;  4GDY A;  2GQN A;  1YIY A;  3FDB A;  3PDB A;  4RKD A;  3UAK A;  1AKB A;  1ECX A;  3MC6 C;  3VOM A;  1BJ4 A;  4AZJ A;  3PD6 A;  3WKR A;  1EG5 A;  2BI1 A;  1ART A;  4IXO A;  3B46 A;  3NTJ A;  4WB0 A;  1E5E A;  1QGN A;  1KL2 A;  3PA9 A;  3AEM A;  1QIS A;  2QLR A;  2PB0 A;  2BI5 A;  4K2M A;  3TFT A;  3P6K A;  2ZJG A;  4KXK A;  1SZU A;  1ARI A;  3PIU A;  1YOO A;  4DQ6 A;  5M49 A;  2Z61 A;  3AOW A;  1WKH A;  4IYO A;  1N8P A;  4DGT A;  3N7N A;  1ZOD A;  3BCX A;  1B9I A;  5KTB A;  3W1J A;  1TOG A;  3DR7 A;  4E3Q A;  3DOD A;  3FDD A;  1FC4 A;  1D7V A;  1ZC9 A;  2Z20 A;  1WST A;  3HLM A;  1ASF A;  3RCH A;  1CQ8 A;  1LC7 A;  4H63 Q;  4ZWM A;  3A8U X;  1LW5 A;  3T32 A;  3E77 A;  1BQD A;  4JF1 A;  1ASE A;  2C81 A;  1WYT A;  4PIW A;  2OAT A;  1S06 A;  3LVM A;  2ZY4 A;  4GEB A;  2CAN A;  5DB5 A;  2AY5 A;  3GZC A;  2BWN A;  3EUC A;  4U1T A;  4XEW A;  3ELE A;  2VMV A;  2QB3 A;  3A2B A;  3ASA A;  1AMS A;  5DJ9 A;  2PB2 A;  3AEJ A;  1AJR A;  1M32 A;  3HBX A;  3WZF A;  1MLY A;  1WYU A;  1QJ3 A;  2BI3 A;  2BIA A;  2EGY A;  3IF2 A;  3AEM C;  3FCR A;  3JTX A;  1ELU A;  1MDO A;  1WYV B;  2AEU A;  1AIA A;  1ORD A;  2VIB A;  4XK1 A;  2WK9 A;  3DZZ A;  3LG0 A;  4O6Z A;  3FD0 A;  2NMP A;  1DGE A;  2YCP A;  4BQ0 A;  1AKC A;  1AAM A;  3E2F A;  3EI5 A;  2AEV A;  3R9A A;  1DJE A;  2JGT A;  2EPJ A;  3FZ7 A;  1GCK A;  4Y0D A;  4A6T A;  4BA4 A;  5JAY A;  1QIT A;  1UU2 A;  5F9S A;  4RM1 A;  2PO3 A;  2VLH A;  5G2Q A;  2FNU A;  3VAX A;  2JG2 A;  1YJZ A;  1BJW A;  5HHY A;  1OHV A;  5HXX A;  5AX8 A;  1ARS A;  3A9Y A;  2HZP A;  4XJO A;  2BI9 A;  2FKI A;  3OKS A;  3LVK A;  2VGS A;  1GC4 A;  3TCM A;  2CJD A;  3KKI A;  1GC2 A;  1BKG A;  2OQX A;  2W7F A;  4ADD A;  1AMQ A;  1TAR A;  4EB7 A;  2R0T A;  3AEJ C;  1VP4 A;  1M0N A;  1OAT A;  2QBT A;  4JEY A;  4W8I A;  1BJO B;  1B8G A;  2ZY5 A;  3GJU A;  2Z9X A;  3BWN C;  3BWO A;  4AO4 A;  2X3L A;  2CTZ A;  1W7M A;  4XJL A;  1J32 A;  3L8A A;  4Y0I A;  2A1V A;  4CBR A;  4F5M A;  4DBC A;  4OCA A;  4AH3 A;  1AJS B;  1B5O A;  1EQB A;  2XH1 A;  3QI6 A;  1C4K A;  4WBT A;  3K7Y A;  2E7U A;  5G4J A;  3TAT A;  3VK2 A;  2W7H A;  1M0Q A;  1I48 A;  1PMM A;  1ASL A;  2W7D A;  4RKC A;  5HDM A;  4B9B A;  1KAF A;  2VGU A;  1SZK A;  1KL1 A;  1SVV A;  3PJ0 A;  4I8A A;  3WLX A;  3PD6 B;  1GC0 A;  2VMQ A;  5M4B A;  4Q76 A;  1AHY A;  2OKJ A;  3PPL A;  1AHX A;  1GEY A;  3E2Z A;  2YKY A;  2VGZ A;  1B9H A;  5F8V A;  4BMK A;  1DFO A;  3N4X A;  2CFB A;  1Y4I A;  2GB3 A;  3M5U A;  4ZDL A;  2DGK A;  1PMO A;  5BJ3 A;  1B4X A;  1M4N A;  2EZ1 A;  4GRX A;  4IYO B;  2D61 A;  3BS8 A;  3E2Y A;  1OXO A;  3GET A;  1C7N A;  3F0H A;  1O62 A;  1BJO A;  2VMT A;  1O69 A;  3HQT A;  2D65 A;  1O4S A;  1D7R A;  1CL2 A;  4ZM3 A;  4XQ2 A;  4ZDP A;  3NU7 A;  1IUG A;  4H51 A;  3RCH B;  2C0R A;  2FN6 A;  1WYT B;  1JG8 A;  4PFN A;  1AJS A;  1AHE A;  2D63 A;  1X29 A;  4W1V A;  5G2P A;  4F5H A;  3IHJ A;  4F5F A;  3AEP A;  5EAV A;  2W7J A;  1I43 A;  1O61 A;  5EIG B;  3EZS A;  2D66 A;  2G7J A;  4JEX A;  4JEV A;  3N4S A;  1WYU B;  4UHN A;  2VMZ A;  9AAT A;  2CH2 A;  2ZYJ A;  4ADC A;  3FRK A;  1Z7D A;  2VMR A;  2VLF A;  1QIR A;  2Z9V A;  3COG A;  3BB8 A;  1MAQ A;  3NX3 A;  1DJU A;  2VMO A;  1ASD A;  4WYG A;  3W1I A;  1XEY A;  4B98 A;  2YCT A;  1CQ6 A;  2WB6 A;  3BCA A;  3CQ4 A;  4IW7 A;  3DXV A;  2QB2 A;  3RBF A;  1GDE A;  2CB1 A;  3MAD A;  3RI6 A;  2YCN A;  4ZSW A;  2VMS A;  3CQ6 A;  4P3M A;  3NU8 A;  1YIZ A;  2W7G A;  2WK8 A;  4WYF A;  2Q7W A;  4IXS A;  1C9C A;  1ASB A;  3CQ5 A;  4F4E A;  5LHA A;  4JEZ A;  4F5L A;  1MDX A;  4LNM A;  2CIN A;  2QSR A;  1GEW A;  2GMS A;  3LVJ A;  1SPA A;  2CJG A;  2JJH A;  1AMA A;  2BYJ A;  4M2J A;  2ZUK A;  1TOE A;  5EFS A;  2WKA A;  4WXF A;  3HMU A;  2D5Y A;  3P1T A;  2JJG A;  3ZRR A;  2Z1Y A;  5FT5 A;  4F5I A;  2VMW A;  3FTB A;  2VMY A;  2VI9 A;  4WXG A;  4F5J A;  3MKJ A;  2AY4 A;  5EIG A;  1S08 A;  2BHX A;  1S07 A;  2V1P A;  3ASB A;  2W7E A;  3NYU A;  4GE9 A;  4UHM A;  4XAU A;  2BKW A;  2YKU A;  5EQC A;  2O1B A;  1RV4 A;  1PFF A;  2YKV A;  3EI7 A;  1EJI A;  1QZ9 A;  3QGU A;  4MY5 A;  5E5I A;  1D7U A;  3JWA A;  2HOX A;  3DU4 A;  2VMU A;  3RBL A;  4MQQ A;  3AEN A;  3GR9 A;  5BJ4 A;  4LNL A;  4TV7 A;  3N4R A;  2W7L A;  3QM2 A;  1W7L A;  4EMY A;  1V72 A;  5E4Z A;  4ZAS A;  1OXP A;  1BS0 A;  1TAT A;  2C44 A;  5DJ1 A;  2X5D A;  3E2Z B;  1AIC A;  3EIA A;  2VIA A;  1YNU A;  4A00 A;  5G4I A;  1YAA A;  3LY1 A;  1V2D A;  4L0O A;  1C7O A;  3FVU A;  3EZ1 A;  2GSA A;  2VGT A;  2EZ2 A;  1AMR A;  3II0 A;  4OC9 A;  4ZWV A;  4UOY A;  4F5G A;  5M46 A;  1LC8 A;  2FNI A;  4WLJ A;  1TAS A;  2QMA A;  2Z67 A;  3MEB A;  3DR4 A;  1ARG A;  3N5M A;  4PVF A;  3ECD A;  3MAF A;  1SF2 A;  3DRD A;  4FFC A;  1ASM A;  3GBX A;  4MQP A;  5J8Q A;  4WP0 A;  4WYA A;  3MBB A;  4Y0H A;  4A0R A;  4WXB A;  4BHD A;  3HT4 A;  1X28 A;  4K2I A;  1QJ5 A;  1ZOB A;  2AAT A;  5K8B A;  3AEO A;  4F5K A;  3FVX A;  1AHG A;  3W1H A;  4MGR A;  1G7X A;  1AIB A;  1AY5 A;  2RFV A;  1BJN A;  3JWB A;  3H9X A;  1I41 A;  4JE5 A;  2HP2 A;  4GSA A;  2W8J A;  5M4D A;  2G6W A;  3A9X A;  2JJF A;  2QA3 A;  5D95 A;  3E6G A;  3VK3 A;  3GZD A;  3UWC A;  4J8L A;  3I16 A;  3NYT A;  1AKA A;  2X8U A;  2DGM A;  3ZRQ A;  4WYD A;  1IAX A;  1OHY A;  1IVR A;  2HOY A;  3QPG A;  4AZK A;  1JS3 A;  1VJO A;  3FZ8 A;  1XI9 A;  4UHO A;  3BC8 A;  1BQA A;  1YJS A;  4GE7 A;  3EI6 A;  4WYC A;  1AAW A;  1TPL A;  2VMX A;  2W8W A;  4EU1 A;  1W7N A;  2BWP A;  3TFU A;  1M0O A;  5G0A A;  4TN4 A;  1D7S A;  3WCN A;  3EIB A;  2ZSL A;  1KMK A;  4MKK A;  1KKP A;  5EUE A;  4W91 A;  3WY7 A;  5EUD A;  2D64 A;  4E3R A;  2W8T A;  1GC3 A;  5FT4 A;  4Q6R A;  4LW4 A;  3ACZ A;  4KAM A;  1M6S A;  3PGY A;  4HF8 A;  2AY6 A;  3I4J A;  3LWS A;  3D6K A;  3G0T A;  1X2A A;  5E3K A;  1JS6 A;  5D5S A;  2W7I A;  2OGE A;  3JU7 A;  2AY8 A;  3B8X A;  1MLZ A;  2CH1 A;  2V0Y A;  3RUY A;  4LNJ A;  3MAU A;  3F9T A;  2HOZ A;  3HDO A;  2VI8 A;  3K40 A;  3F6T A;  3LVL B;  3GZD C;  4ATQ A;  2HOR A;  1TOI A;  4ADE A;  2E7J A;  2YOB A;  2AY7 A;  5LH9 A;  1CL1 A;  1JF9 A;  2JIS A;  3CAI A;  2CY8 A;  2VMN A;  3KGW A;  2TPL A;  1BT4 A;  3NUI A;  1S09 A;  2BYL A;  4JEW A;  2AY1 A;  3ZZJ A;  3GSB A;  1LK9 A;  3AEN B;  3BV0 A;  1YJY A;  4RAE A;  1RVY A;  2WK7 A;  3ATH A;  5FT8 A;  1LW4 A;  3WGC A;  1UU0 A;  2FYF A;  2OGA A;  4WD2 A;  1OHW A;  1B5P A;  8AAT A;  4AO9 A;  4TMR A;  3WKS A;  3FQ7 A;  2YKX A;  3H7F A;  4AOA A;  4E1O A;  1D2F A;  4IY7 A;  2AY2 A;  3FFR A;  4GE4 A;  1ASA A;  4IX8 A;  1G7W A;  3BN1 A;  4E77 A;  1H0C A;  3CBF A;  3G8M A;  2Z1Z A;  1DGD A;  4IXZ A;  1IBJ A;  5G09 A;  2BIG A;  4NOG A;  4OBV A;  4A0F A;  1IAY A;  3K28 A;  2W8U A;  1S0A A;  1TOJ A;  3JW9 A;  2D7Z A;  3ELP A;  3FVS A;  2D7Y A;  3MAF B;  1VEF A;  1CQ7 A;  2ORD A;  2YHK A;  4Q31 A;  1ASN A;  1FG7 A;  1N31 A;  3DXW A;  2ZY2 A;  3G7Q A;  1UKJ A;  3B1E A;  2YRI A;  4K2B A;  1DTY A;  1TOK A;  5C6U A;  3FSL A;  3VP6 A;  4R8D A;  4A0H A;  4P7Y A;  3WGB A;  4ZLV A;  4CXR A;  2VGW A;  1U08 A;  3L44 A;  4W1W A;  1E5F A;  1M0P A;  2Z9U A;  5I92 A;  4OTL A;  1N2T A;  3R4T A;  2BIE A;  3DC1 A;  4RJY A;  3ZRP A;  4EB5 A;  2ZY3 A;  4PFF A;  4Q75 A;  1GD9 A;  3AEL A;  3FKD A;  4ITG A;  3NRA A;  4M2M A;  3KE3 A;  1AY4 A;  3AAT A;  4OT8 A;  1LKC A;  2W8V A;  3KGX A;  3LV2 A;  4HVK A;  3BWN A;  1CS1 A;  1KKJ A;  3NDN A;  4W1X A;  4MKJ A;  4ZSY A;  1W3U A;  3TQX A;  1PG8 A;  4A6U A;  1AHF A;  1KMJ A;  1AX4 A;  2DGL A;  1LC5 A;  3OP7 A;  2EH6 A;  2F8J A;  2FQ6 A;  2W7M A;  3WCO A;  4CVQ A;  4K05 A;  1DKA A;  1I29 A;  3H14 A;  3FFH A;  2CJH A;  3E9K A;  2W7K A;  5DX5 A;  3PAA A;  4JF0 A;  3AV7 A;  1AY8 A;  3FQ8 A;  4ISY A;  4EFF A;  2O7C A;  1V2E A;  3A9Z A;  3EI8 A;  1T3I A;  2DKJ A;  3B1D A;  2HUU A;  1BW0 A;  1ARH A;  3GWP A;  3PDX A;  3QBO A;  1J04 A;  4UQV A;  2O0R A;  3FQA A;  1W23 A;  2CST A;  5EAA A;  1ASC A;  2BI2 A;  4CXQ A;  4KYO A;  4R2N A;  1M7Y A;  2R2N A;  4OMA A;  2VYC A;  1IX8 A;  4R5Z A;  2JJE A;  1MAP A;  4M2K A;  4ZAH A;  4FL0 A;  1UU1 A;  1G4X A;  4RJ0 A;  1RV3 A;  1IJI A;  2R5C B;  1SZS A;  1C0N A;  3QN6 A;  3NUB A;  1ELQ A;  2BWO A;  4XJM A;  3NYS A;  1P3W A;  1WYV A;  4XJP A;  3EI9 A;  3ISL A;  3JZL A;  2R5E A;  3Q8N A;  2YRR A;  3ZZK A;  3B1C A;  4A72 A;  4ZDO A;  2E7I A;  2Z9W A;  1WKG A;  3NNK A;  4LC3 A;  1RVU A;  1GEX A;  5EUN A;  7AAT A;  2FM1 A;  4CBS A;  2OKK A;  1ASG A;  3VK4 A;  1Z3Z A;  3PDB B;  4A6R A;  1IX7 A;  4OBU A;  4ITX A;  1CZC A;  2ZSM A;  4MSO A;  2DR1 A;  4J5U A;  1FG3 A;  2DOU A;  2ZP7 A;  4JE5 D;  1LS3 A;  3WX9 A;  4WB0 B;  3MC6 A;  4N0W A;  2DKB A;  4WYE A;  2GMU A;  2ZC0 A;  3HVY A;  4RLG A;  3RQ1 A;  2VGV A;  3USF A;  3QHX A;  2EO5 A;  5FT6 A;  1GBN A;  1X0M A;  4QGR A;  1G4V A;  4U2H A; 
#chains in the Genus database with same CATH homology
 3BCB A;  1MDZ A;  4MQR A;  5TF5 A;  4WLH A;  1V2F A;  4A0G A;  2C7T A;  4RIZ A;  4ADB A;  3FZ6 A;  1MGV A;  2E54 A;  3UE8 A;  1DJ9 A;  3AOV A;  2R5C A;  4ZM4 A;  2X5F A;  2AY3 A;  4RIT A;  2VMP A;  1C7G A;  1SFF A;  2HUI A;  2KFP A;  2HP1 A;  5IWQ A;  3DYD A;  2HUF A;  2XBN A;  4N0B A;  4ATP A;  4W5K A;  3HL2 A;  4OYT A;  2EYQ A;  1IX6 A;  4LW2 A;  1CZE A;  2AY9 A;  3N75 A;  4R5F A;  4BA5 A;  1H1C A;  1CJ0 A;  3N0L A;  3I5T A;  4GDY A;  2GQN A;  1YIY A;  3FDB A;  3PDB A;  4RKD A;  3UAK A;  1AKB A;  1ECX A;  3MC6 C;  3VOM A;  1BJ4 A;  4AZJ A;  3PD6 A;  3WKR A;  1EG5 A;  2BI1 A;  1ART A;  4IXO A;  3B46 A;  3NTJ A;  4WB0 A;  1E5E A;  1QGN A;  1KL2 A;  3PA9 A;  3AEM A;  1QIS A;  2QLR A;  2PB0 A;  2BI5 A;  4K2M A;  3TFT A;  3P6K A;  2ZJG A;  4KXK A;  1SZU A;  1ARI A;  3PIU A;  1YOO A;  4DQ6 A;  5M49 A;  2Z61 A;  3AOW A;  1WKH A;  4IYO A;  1N8P A;  4DGT A;  3N7N A;  1ZOD A;  3BCX A;  1B9I A;  5KTB A;  3W1J A;  1TOG A;  3DR7 A;  4E3Q A;  3DOD A;  3FDD A;  1FC4 A;  1D7V A;  1ZC9 A;  2Z20 A;  1WST A;  3HLM A;  1ASF A;  3RCH A;  1CQ8 A;  1LC7 A;  4H63 Q;  4ZWM A;  3A8U X;  1LW5 A;  3T32 A;  3E77 A;  1BQD A;  4JF1 A;  1ASE A;  2C81 A;  1WYT A;  4PIW A;  2OAT A;  1S06 A;  3LVM A;  2ZY4 A;  4GEB A;  2CAN A;  5DB5 A;  2AY5 A;  3GZC A;  2BWN A;  3EUC A;  4U1T A;  4XEW A;  3ELE A;  2VMV A;  2QB3 A;  3A2B A;  3ASA A;  1AMS A;  5DJ9 A;  2PB2 A;  3AEJ A;  1AJR A;  1M32 A;  3HBX A;  3WZF A;  1MLY A;  1WYU A;  1QJ3 A;  2BI3 A;  2BIA A;  2EGY A;  3IF2 A;  3AEM C;  3FCR A;  3JTX A;  1ELU A;  1MDO A;  1WYV B;  2AEU A;  1AIA A;  1ORD A;  2VIB A;  4XK1 A;  2WK9 A;  3DZZ A;  3LG0 A;  4O6Z A;  3FD0 A;  2NMP A;  1DGE A;  2YCP A;  4BQ0 A;  1AKC A;  1AAM A;  3E2F A;  3EI5 A;  2AEV A;  3R9A A;  1DJE A;  2JGT A;  2EPJ A;  3FZ7 A;  1GCK A;  4Y0D A;  4A6T A;  4BA4 A;  5JAY A;  1QIT A;  1UU2 A;  5F9S A;  4RM1 A;  2PO3 A;  2VLH A;  5G2Q A;  2FNU A;  3VAX A;  2JG2 A;  1YJZ A;  1BJW A;  5HHY A;  1OHV A;  5HXX A;  5AX8 A;  1ARS A;  3A9Y A;  2HZP A;  4XJO A;  2BI9 A;  2FKI A;  3OKS A;  3LVK A;  2VGS A;  1GC4 A;  3TCM A;  2CJD A;  3KKI A;  1GC2 A;  1BKG A;  2OQX A;  2W7F A;  4ADD A;  1AMQ A;  1TAR A;  4EB7 A;  2R0T A;  3AEJ C;  1VP4 A;  1M0N A;  1OAT A;  2QBT A;  4JEY A;  4W8I A;  1BJO B;  1B8G A;  2ZY5 A;  3GJU A;  2Z9X A;  3BWN C;  3BWO A;  4AO4 A;  2X3L A;  2CTZ A;  1W7M A;  4XJL A;  1J32 A;  3L8A A;  4Y0I A;  2A1V A;  4CBR A;  4F5M A;  4DBC A;  4OCA A;  4AH3 A;  1AJS B;  1B5O A;  1EQB A;  2XH1 A;  3QI6 A;  1C4K A;  4WBT A;  3K7Y A;  2E7U A;  5G4J A;  3TAT A;  3VK2 A;  2W7H A;  1M0Q A;  1I48 A;  1PMM A;  1ASL A;  2W7D A;  4RKC A;  5HDM A;  4B9B A;  2VGU A;  1SZK A;  1KL1 A;  1SVV A;  3PJ0 A;  4I8A A;  3WLX A;  3PD6 B;  1GC0 A;  2VMQ A;  5M4B A;  4Q76 A;  1AHY A;  2OKJ A;  3PPL A;  1AHX A;  1GEY A;  3E2Z A;  2YKY A;  2VGZ A;  1B9H A;  5F8V A;  4BMK A;  1DFO A;  3N4X A;  2CFB A;  1Y4I A;  2GB3 A;  3M5U A;  4ZDL A;  2DGK A;  1PMO A;  5BJ3 A;  1B4X A;  1M4N A;  2EZ1 A;  4GRX A;  4IYO B;  2D61 A;  3BS8 A;  3E2Y A;  1OXO A;  3GET A;  1C7N A;  3F0H A;  1O62 A;  1BJO A;  2VMT A;  1O69 A;  3HQT A;  2D65 A;  1O4S A;  1D7R A;  1CL2 A;  4ZM3 A;  4XQ2 A;  4ZDP A;  3NU7 A;  1IUG A;  4H51 A;  3RCH B;  2C0R A;  2FN6 A;  1WYT B;  1JG8 A;  4PFN A;  1AJS A;  1AHE A;  2D63 A;  1X29 A;  4W1V A;  5G2P A;  4F5H A;  3IHJ A;  4F5F A;  3AEP A;  5EAV A;  2W7J A;  1I43 A;  1O61 A;  5EIG B;  3EZS A;  2D66 A;  2G7J A;  4JEX A;  4JEV A;  3N4S A;  1WYU B;  4UHN A;  2VMZ A;  9AAT A;  2CH2 A;  2ZYJ A;  4ADC A;  3FRK A;  1Z7D A;  2VMR A;  2VLF A;  1QIR A;  2Z9V A;  3COG A;  3BB8 A;  1MAQ A;  3NX3 A;  1DJU A;  2VMO A;  1ASD A;  4WYG A;  3W1I A;  1XEY A;  4B98 A;  2YCT A;  1CQ6 A;  2WB6 A;  3BCA A;  3CQ4 A;  4IW7 A;  3DXV A;  2QB2 A;  3RBF A;  1GDE A;  2CB1 A;  3MAD A;  3RI6 A;  2YCN A;  4ZSW A;  2VMS A;  3CQ6 A;  4P3M A;  3NU8 A;  1YIZ A;  2W7G A;  2WK8 A;  4WYF A;  2Q7W A;  4IXS A;  1C9C A;  1ASB A;  3CQ5 A;  4F4E A;  5LHA A;  4JEZ A;  4F5L A;  1MDX A;  4LNM A;  2CIN A;  2QSR A;  1GEW A;  2GMS A;  3LVJ A;  1SPA A;  2CJG A;  2JJH A;  1AMA A;  2BYJ A;  4M2J A;  2ZUK A;  1TOE A;  5EFS A;  2WKA A;  4WXF A;  3HMU A;  2D5Y A;  3P1T A;  2JJG A;  3ZRR A;  2Z1Y A;  5FT5 A;  4F5I A;  2VMW A;  3FTB A;  2VMY A;  2VI9 A;  4WXG A;  4F5J A;  3MKJ A;  2AY4 A;  5EIG A;  1S08 A;  2BHX A;  1S07 A;  2V1P A;  3ASB A;  2W7E A;  3NYU A;  4GE9 A;  4UHM A;  4XAU A;  2BKW A;  2YKU A;  5EQC A;  2O1B A;  1RV4 A;  1PFF A;  2YKV A;  3EI7 A;  1EJI A;  1QZ9 A;  3QGU A;  4MY5 A;  5E5I A;  1D7U A;  3JWA A;  2HOX A;  3DU4 A;  2VMU A;  3RBL A;  4MQQ A;  3AEN A;  3GR9 A;  5BJ4 A;  4LNL A;  4TV7 A;  3N4R A;  2W7L A;  3QM2 A;  1W7L A;  4EMY A;  1V72 A;  5E4Z A;  4ZAS A;  1OXP A;  1BS0 A;  1TAT A;  2C44 A;  5DJ1 A;  2X5D A;  3E2Z B;  1AIC A;  3EIA A;  2VIA A;  1YNU A;  4A00 A;  5G4I A;  1YAA A;  3LY1 A;  1V2D A;  4L0O A;  1C7O A;  3FVU A;  3EZ1 A;  2GSA A;  2VGT A;  2EZ2 A;  1AMR A;  3II0 A;  4OC9 A;  4ZWV A;  4UOY A;  4F5G A;  5M46 A;  1LC8 A;  2FNI A;  4WLJ A;  1TAS A;  2QMA A;  2Z67 A;  3MEB A;  3DR4 A;  1ARG A;  3N5M A;  4PVF A;  3ECD A;  3MAF A;  1SF2 A;  3DRD A;  4FFC A;  1ASM A;  3GBX A;  4MQP A;  5J8Q A;  4WP0 A;  4WYA A;  3MBB A;  4Y0H A;  4A0R A;  4WXB A;  4BHD A;  3HT4 A;  1X28 A;  4K2I A;  1QJ5 A;  1ZOB A;  2AAT A;  5K8B A;  3AEO A;  4F5K A;  3FVX A;  1AHG A;  3W1H A;  4MGR A;  1G7X A;  1AIB A;  1AY5 A;  2RFV A;  1BJN A;  3JWB A;  3H9X A;  1I41 A;  4JE5 A;  2HP2 A;  4GSA A;  2W8J A;  5M4D A;  2G6W A;  3A9X A;  2JJF A;  2QA3 A;  5D95 A;  3E6G A;  3VK3 A;  3GZD A;  3UWC A;  4J8L A;  3I16 A;  3NYT A;  1AKA A;  2X8U A;  2DGM A;  3ZRQ A;  4WYD A;  1IAX A;  1OHY A;  1IVR A;  2HOY A;  3QPG A;  4AZK A;  1JS3 A;  1VJO A;  3FZ8 A;  1XI9 A;  4UHO A;  3BC8 A;  1BQA A;  1YJS A;  4GE7 A;  3EI6 A;  4WYC A;  1AAW A;  1TPL A;  2VMX A;  2W8W A;  4EU1 A;  1W7N A;  2BWP A;  3TFU A;  1M0O A;  5G0A A;  4TN4 A;  1D7S A;  3WCN A;  3EIB A;  2ZSL A;  1KMK A;  4MKK A;  1KKP A;  5EUE A;  4W91 A;  3WY7 A;  5EUD A;  2D64 A;  4E3R A;  2W8T A;  1GC3 A;  5FT4 A;  4Q6R A;  4LW4 A;  3ACZ A;  4KAM A;  1M6S A;  3PGY A;  4HF8 A;  2AY6 A;  3I4J A;  3LWS A;  3D6K A;  3G0T A;  1X2A A;  5E3K A;  1JS6 A;  5D5S A;  2W7I A;  2OGE A;  3JU7 A;  2AY8 A;  3B8X A;  1MLZ A;  2CH1 A;  2V0Y A;  3RUY A;  4LNJ A;  3MAU A;  3F9T A;  2HOZ A;  3HDO A;  2VI8 A;  3K40 A;  3F6T A;  3LVL B;  3GZD C;  4ATQ A;  2HOR A;  1TOI A;  4ADE A;  2E7J A;  2YOB A;  2AY7 A;  5LH9 A;  1CL1 A;  1JF9 A;  2JIS A;  3CAI A;  2CY8 A;  2VMN A;  3KGW A;  2TPL A;  1BT4 A;  3NUI A;  1S09 A;  2BYL A;  4JEW A;  2AY1 A;  3ZZJ A;  3GSB A;  1LK9 A;  3AEN B;  3BV0 A;  1YJY A;  4RAE A;  1RVY A;  2WK7 A;  3ATH A;  5FT8 A;  1LW4 A;  3WGC A;  1UU0 A;  2FYF A;  2OGA A;  4WD2 A;  1OHW A;  1B5P A;  8AAT A;  4AO9 A;  4TMR A;  3WKS A;  3FQ7 A;  2YKX A;  3H7F A;  4AOA A;  4E1O A;  1D2F A;  4IY7 A;  2AY2 A;  3FFR A;  4GE4 A;  1ASA A;  4IX8 A;  1G7W A;  3BN1 A;  4E77 A;  1H0C A;  3CBF A;  3G8M A;  2Z1Z A;  1DGD A;  4IXZ A;  1IBJ A;  5G09 A;  2BIG A;  4NOG A;  4OBV A;  4A0F A;  1IAY A;  3K28 A;  2W8U A;  1S0A A;  1TOJ A;  3JW9 A;  2D7Z A;  3ELP A;  3FVS A;  2D7Y A;  3MAF B;  1VEF A;  1CQ7 A;  2ORD A;  2YHK A;  4Q31 A;  1ASN A;  1FG7 A;  1N31 A;  3DXW A;  2ZY2 A;  3G7Q A;  1UKJ A;  3B1E A;  2YRI A;  4K2B A;  1DTY A;  1TOK A;  5C6U A;  3FSL A;  3VP6 A;  4R8D A;  4A0H A;  4P7Y A;  3WGB A;  4ZLV A;  4CXR A;  2VGW A;  1U08 A;  3L44 A;  4W1W A;  1E5F A;  1M0P A;  2Z9U A;  5I92 A;  4OTL A;  1N2T A;  3R4T A;  2BIE A;  3DC1 A;  4RJY A;  3ZRP A;  4EB5 A;  2ZY3 A;  4PFF A;  4Q75 A;  1GD9 A;  3AEL A;  3FKD A;  4ITG A;  3NRA A;  4M2M A;  3KE3 A;  1AY4 A;  3AAT A;  4OT8 A;  1LKC A;  2W8V A;  3KGX A;  3LV2 A;  4HVK A;  3BWN A;  1CS1 A;  1KKJ A;  3NDN A;  4W1X A;  4MKJ A;  4ZSY A;  1W3U A;  3TQX A;  1PG8 A;  4A6U A;  1AHF A;  1KMJ A;  1AX4 A;  2DGL A;  1LC5 A;  3OP7 A;  2EH6 A;  2F8J A;  2FQ6 A;  2W7M A;  3WCO A;  4CVQ A;  4K05 A;  1DKA A;  1I29 A;  3H14 A;  3FFH A;  2CJH A;  3E9K A;  2W7K A;  5DX5 A;  3PAA A;  4JF0 A;  3AV7 A;  1AY8 A;  3FQ8 A;  4ISY A;  4EFF A;  2O7C A;  1V2E A;  3A9Z A;  3EI8 A;  1T3I A;  2DKJ A;  3B1D A;  2HUU A;  1BW0 A;  1ARH A;  3GWP A;  3PDX A;  3QBO A;  1J04 A;  4UQV A;  2O0R A;  3FQA A;  1W23 A;  2CST A;  5EAA A;  1ASC A;  2BI2 A;  4CXQ A;  4KYO A;  4R2N A;  1M7Y A;  2R2N A;  4OMA A;  2VYC A;  1IX8 A;  4R5Z A;  2JJE A;  1MAP A;  4M2K A;  4ZAH A;  4FL0 A;  1UU1 A;  1G4X A;  4RJ0 A;  1RV3 A;  1IJI A;  2R5C B;  1SZS A;  1C0N A;  3QN6 A;  3NUB A;  1ELQ A;  2BWO A;  4XJM A;  3NYS A;  1P3W A;  1WYV A;  4XJP A;  3EI9 A;  3ISL A;  3JZL A;  2R5E A;  3Q8N A;  2YRR A;  3ZZK A;  3B1C A;  4A72 A;  4ZDO A;  2E7I A;  2Z9W A;  1WKG A;  3NNK A;  4LC3 A;  1RVU A;  1GEX A;  5EUN A;  7AAT A;  2FM1 A;  4CBS A;  2OKK A;  1ASG A;  3VK4 A;  1Z3Z A;  3PDB B;  4A6R A;  1IX7 A;  4OBU A;  4ITX A;  1CZC A;  2ZSM A;  4MSO A;  2DR1 A;  4J5U A;  1FG3 A;  2DOU A;  2ZP7 A;  4JE5 D;  1LS3 A;  3WX9 A;  4WB0 B;  3MC6 A;  4N0W A;  2DKB A;  4WYE A;  2GMU A;  2ZC0 A;  3HVY A;  4RLG A;  3RQ1 A;  2VGV A;  3USF A;  3QHX A;  2EO5 A;  5FT6 A;  1GBN A;  1X0M A;  4QGR A;  1G4V A;  4U2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...