3AV8A

Refined structure of plant-type [2fe-2s] ferredoxin i from aphanothece sacrum at 1.46 a resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
97
structure length
97
Chain Sequence
ASYKVTLKTPDGDNVITVPDDEYILDVAEEQGLDLPYSCRAGACSTCAGKLVSGPAPDQSDQSFLDDDQIQAGYILTCVAYPTGDCVIETHKEEALY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-1
publication title Mapping of protein-protein interaction sites in the plant-type [2Fe-2S] ferredoxin.
pubmed doi rcsb
source organism Aphanothece sacrum
molecule tags Electron transport
total genus 25
structure length 97
sequence length 97
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3av8A00
1JWAD 1YJJA 2DWQA 1FMAD 3W5UB 1FFVA 3P4PB 1VDVA 1ZP0B 1WRIA 1FFUA 2WQYB 3B2GA 4LTUA 3HVZA 1J7AA 3VRAB 3NVZA 2WDQB 5C2TB 1FO4A 1JW9D 2E3TA 1E9MA 3AEAB 1YQ4B 1XLNA 1F0ZA 1SIJA 3NS1A 1UWMA 5EE1A 1E10A 5G5HA 1QF6A 1N60A 1J7CA 1B9RA 1WGKA 1SB3C 1RYJA 1ZOYB 3AEDB 4YTNB 2H88B 3W9CB 2KMMA 2AX5A 2W54A 3AE1B 3VR8B 1I7HA 1NENB 1ZUD2 3HRDD 1NEKB 2LEKA 3AEGB 3P4RB 2W3SA 1GAQB 1KRHA 1RWSA 1E7PB 1NI3A 1YJIA 1OQQA 1VJKA 1E6EB 5AUKA 3SFEB 1A70A 1DOIA 1XO3A 2OHFA 2PKOA 4JWUC 2JQRB 2WDRB 2WLBA 1TYGB 3DWGC 1ZXIA 3AE4B 2BT6A 3AE8B 1DOYA 3AV8A 1FRRA 1N61A 3AMZA 1NVID 5AUIA 2MJ3A 1N5XA 2BS2B 2M56B 1NYRA 3P4SB 3FC4A 1JROA 3BIID 2JX5A 1WXQA 1KFYB 1YQ3B 3RPFC 1TJEA 1ROEA 1E0ZA 2L52A 2FBWB 2MJDA 1IUEA 3FAHA 2WDVB 1XLQA 4ZHPA 3AECB 3AE6B 4YSXB 2B76B 1V8CA 1L6VA 2Y5CA 5H92C 2HTME 1RM6C 2PVOD 3AE3B 3PO0A 5EE9A 1FXIA 1QOAA 1DGJA 1L6UA 1JRPA 1L0VB 3AN1A 1OQRA 4YTPB 1QOBA 4WQMA 1WYGA 1JWBD 3P4QB 4C7ZA 1V97A 4ZOHC 1GPXA 1PDXA 2CJOA 3AEBB 4HRSA 3HUIA 2ACZB 4YSYB 3WCQA 3AEFB 1OFFA 4IDIA 3AE9B 2G1EA 4N58A 3AEEB 2PVGC 3LXFA 1R7SA 4USAA 4YXDB 3B9JA 4WWMA 2H89B 2M19A 1CJEA 3NVVA 5H8YE 1RFKA 2DBYA 4N6EB 4C80A 3NVYA 2PIAA 1TKGA 1CZPA 1L5PA 2W55A 3B2FA 1AWDA 1NYQA 3CWIA 3KWLA 1QT9A 1FXAA 3AE7B 1N62A 3LB8C 4FXCA 3SFDB 1JALA 3NRZA 4P6VF 1N63A 2CU3A 3P63A 3NVWA 5EE0A 3AE5B 2WS3B 1J7BA 1EWYC 1N5WA 3L4PA 1QOFA 1KF6B 2MJEA 5GXGB 5MPOA 4YT0B 5EE3A 4N59A 1PFDA 2L83A 2WU2B 4ITKA 1XLPA 1FRDA 3P1MA 3VRBB 2BS3B 2W3RA 4C7YA 2BS4B 5C3JB 1QLBB 1SF0A 1TKEA 2WP9B 3ZYYX 1DOXA 3DWMA 1JQ4A 3AE2B 1VLBA 2QJLA 1QOGA 1XLOA 2Q5WD 2CJNA 1WWTA 3CIRB 3ETRA 3EUB2 4HROA 1TKYA 2QIEB 3AB5A 2K22A 4KX6B 1FIQA 2K5PA 4YTMB 1T3QA 3AH7A 5G5GA 3W5VB 2WU5B 2EKIA 1FM0D 3VR9B 2KAJA 2MH7A 3SR6A 2K9XA 4JWSC 4JX1C 4ZHOA 3ABVB 3AM9A 4US9A 1PUTA 1AYFA 4YSZB 4US8A 4A9AA 2N0SB
chains in the Genus database with same CATH superfamily
3MFGA 3K9PB 3A4SC 1FFUA 3B2GA 4B6WA 2PLPA 4ANUA 1F2RC 1R4NB 1YQ4B 1WGYA 4HCNB 1F77A 1Y56A 2V1YA 4PT5A 2W54A 4G3XB 4I6PA 2WXQA 2J0MA 1RWSA 2QILA 4IWQA 3UINB 3RCZA 2DYOA 3CSTA 3X0WA 1WX8A 2JX5A 3BVMA 2BKFA 3QQ8B 2WWZA 4XX5A 2NPTA 1C78A 4WAFA 1TS3A 3V6CB 3TEYA 1JWBD 4HLEA 4W9JA 1KJTA 3TL5A 1OFFA 3RNCC 1E8YA 3R3MA 1HXYD 4W9LA 3OJ4B 3DBLB 3C8YA 4BZAA 4PYZA 5I4DA 1RFKA 1TKGA 3CWIA 3Q8AA 4WWOA 2D07B 4KKJA 4DXFA 4P6VF 3N9YC 1XCTL 4MGZE 3NVWA 3QARA 1T0YA 1CMXB 4ITKA 2KLCA 3P1MA 2BS3B 3VFKA 4CQNA 3UGBB 1XLOA 2RGFA 1J0GA 1FEHA 1IBXA 1GOZA 1VZ7A 1VRAB 1D6EC 2DAJA 4GMVA 1RRBA 2JRHA 4A9AA 2JU6X 4DHJB 1YJJA 2XBBC 1V1PB 4KIKA 4MEMA 1V86A 4LNKA 1FCLA 2KWCA 3KWVA 3DPDA 3DBRB 3AEDB 3HK0A 1SXTA 2CHWA 1VD2A 4KKIA 4AJWA 1EM7A 3U4EG 1NVID 1NBFC 1NYRA 3CSFA 1KOTA 2LVOA 4NAMA 2OJWA 5GMVA 4BBNF 1XLQA 2K3UA 4LDTD 3M95A 3QK0A 4CHKA 2VH2A 3EFUA 2ZVNA 4K1RB 1E5WA 2BYVE 4RGNA 1JRPA 1JRUA 2INPE 3QWZB 4K7SA 2LI5A 1TZOA 1NI2A 3AEBB 4WH4A 3WCQA 2G1EA 2D5GA 2XK5A 1WIAA 2CHZA 2Z8LA 2AQ1B 1P7EA 3APDA 3T9LA 2V0GA 3KYDD 4OW0A 4GDKA 1SSNA 3N1XC 1J7BA 4GSWA 2XEWA 3R66C 2JRIB 4LJOB 3L54A 4HKQA 3BY4B 1ZPSA 4PS8A 2ASQA 3Q3JA 1K8RB 2G4DB 4JPSA 4XDDA 3HM3A 2N1WA 1LGRA 1P3QU 3PPAA 4BBNC 3EUB2 2LXCA 4BOZB 3GZNB 1VZ8A 3ZIMA 4M0WA 1SE2A 1V1PA 1GB4A 1MFWA 3IG3A 3JYUA 5TR5A 1AYFA 4L2YA 2BW2A 3MC0B 2NBWB 4A3OA 2DWQA 1L4DB 1VDVA 1E8WA 3KUCB 3ZXRA 2DZMA 2N4FA 3V05A 4RF0A 2PTLA 4FADA 4URKA 2MP2B 3I57A 2V3SA 3VTUA 4DDID 1WGKA 4XWWA 2KQ4X 3QCAA 2LMCA 5BYQA 4D2KA 1I4GA 1OQQA 3U7DA 2ZW0A 4W9GA 1Q5WB 2GBMA 2KD0A 1D4BA 1JROA 1HE8A 2A4ZA 4AQ7A 4HK2A 3T3NA 3N30A 4DDGD 4MM3B 1L6VA 1R4NI 1E8XA 4S17A 1PYWD 4K3BA 3Q8BA 1OQRA 3A9KB 3P4QB 3SDLC 3V61A 3ZNZB 2E6XA 1H4RA 3WA0A 3NZUA 2FE8A 2V4LA 4RNAA 4KGSA 2CU1A 3N20C 4JIOU 2X8XX 2J52A 1YNTE 4W9CA 3RMKC 1TBEA 3TUOA 1UD7A 3MTNB 2ZCBA 2AQ2B 2GRIA 2D3CA 2PEAA 5D94A 1WE7A 3Q14C 2JF5A 1XLPA 5CHWA 1SE3A 4A55A 4W9EA 2WP9B 4O1NA 1UZXB 2RDBC 1K50A 4MJSA 1VLBA 3X23A 2LUMA 3IAM1 4KX6B 2HE7A 5IO9A 3DBLI 4W9KA 1VCBA 2QDFA 5G55A 1M94A 3BINA 1ZDVA 3H7PA 4P1CC 2MP2A 3GE8C 2AL6A 2Y3AA 3O65B 3U8ZA 1WRIA 3HVZA 4RH6A 1HA5A 1GC6A 1JW9D 1WGDA 3GS2A 1OEYA 4GDLB 3U7ZA 3BK2A 2BF8B 1ZOYB 1TS4A 2L8JA 2KANA 1SE4A 3HRDD 2IGDA 1WR1A 3W1SC 1QZEA 5AUKA 1ZGUB 3SFEB 2FUG1 2RPVA 2MEKA 4FULA 2BQQA 2WLBA 3RN9C 3B1LX 5C23A 3RYTA 4ZHPA 2NTTA 3AECB 5BYSA 3NS8A 5DPWA 2WXNA 5HI1A 3VAWA 2D3BA 1F9JA 3FILB 2ZPYA 3DBRI 1TY2A 1AARA 1GJZA 1XD3B 4A3PA 2PE9A 4HRSA 5BYRA 3ZQ4A 5AZHA 5D3DA 2IGHA 2QEJC 1L0XB 2J42A 4JQWC 4N6EB 3KWLA 4DHZE 4AP4C 1QILA 3AE7B 3ZNHB 4RM8A 4C4VB 1YMHE 3PZDA 2WGSA 1T0RC 2GBJA 3IBEA 4MT5A 2V4IB 2WXMA 4DK5A 3UQBA 5LXHA 4G11A 1QOGA 5LLIA 2IZVB 1FIQA 3AULA 4LNIA 1FM0D 2INCC 2KNBA 4ANXA 3RT3B 2OOBB 2AQ3B 3ZJVA 1T6BX 2KO3A 3WALA 1I4PA 1D5XC 3ZTDA 2DX5B 4LLGM 1XT9B 2KTRA 1MG8A 3T3OA 2C7NB 2OJRA 4GIVA 3CF6E 1LXDA 2V3NA 1UF0A 4IOIE 4A20A 1QF6A 1BT0A 2FIDA 4YTNB 1B1ZA 4HJKA 3GZNI 3C19A 2LGSA 5CX3A 1HEZE 1WI0A 2OHFA 2A5UA 2M56B 4KDLB 1WX7A 3RPFC 2KWUB 3FILA 3ZTCA 2BB5A 2KDIA 3KUZA 1I4QA 5J17A 2KLGA 1WXSA 3NG0A 1YIWA 1YX6B 3AN1A 1UWXA 2O2VB 3Q3OC 3E9SA 2L0FA 4M8NA 3ML9A 2DZKA 1R7SA 5KHOA 3PRPB 1ZDXA 1CJEA 4C4VA 2J0JA 3KUDB 2ONQA 4C80A 3Q3FA 2JSVX 2MLBA 1IYFA 4BOSC 1JALA 4WIPA 1Z2MA 2PMVA 2XN9C 3ZO5B 2JXTA 1SF0A 2NBUA 2QC8A 3EECA 1C79A 2DHZA 3EC8A 4II3B 2WXGA 2KQ7A 5J18A 2EMTA 4OVVA 2KVRA 4HPPA 5FR3A 2L1AA 4ZDVA 2IYDB 3MJWA 2KVZA 2K8BA 5D2MB 3QHTA 2K0PA 3DVGX 3IHPC 1C3TA 1ZP0B 3B08A 3WAPA 2HDEA 2E3TA 2G4SA 1XLNA 4M8MA 1SIFA 3EGRA 4E3CA 2O6VB 5AEKB 3W9CB 2AX5A 2FCQA 3H9DA 2IO2B 2LUEA 2JWZA 4KDIC 1ENFA 3VHTC 1WM2A 4HCPB 2KN5A 1DOIA 4FJYA 2DYBA 3AE4B 2BKRB 3EFCA 1WMHB 3AV8A 1EF5A 1TT5B 3PV1A 4FN2A 3N1YC 3HM6X 4ACFA 1TJEA 1ET6A 1ROEA 4G50A 4YSXB 1T0QC 2D3GA 2LWPA 2WXJA 4PYUA 3H6NA 2MX2A 4C7ZA 3ZUNA 1GB1A 3DHGC 3DHIC 3Q6BA 3PT2B 1UH6A 1DYQA 2IO3B 3BYTB 2UU7A 3BWUD 3HIZA 1WRDB 4FA6A 1JQ4A 1BXTA 2BB6A 3PLVA 1STEA 4FXCA 4HWIB 1GG3A 4ANVA 2N9PC 2VZKB 2L0TA 1UUPA 3AI5A 1WFYA 2ZPNA 4XYCA 2L05A 2HTHA 4MGKE 4NAWA 2QSDA 4YTMB 4S0RA 2ON8A 5G5GA 2EKIA 2GMIC 5E6PA 2L7RA 4HKZE 1FFVA 2CHXA 3I9V1 4HJGE 3AEAB 1F0ZA 2JZPA 2BBCA 3ZXVA 1E10A 2RDGA 1EF1A 5AZGA 1J7CA 1Q1OA 3ZDMC 1RYJA 1WMHA 2KJRA 5FKAC 4KSLC 4BKGA 4MDKE 1FXTB 3AEGB 1E6EB 3SD5A 4JWUC 2JQRB 2M8SA 3AE8B 4XDCA 4F7ZA 1I4RA 3FC4A 2R61A 2LGDA 1HTOA 2N9LA 2I2YA 4OHJA 1OGWA 2RDHA 2FCSA 3VUXA 1IP9A 4I6LB 3VVWB 2LRUA 1L0VB 2WXFA 4KZCA 4YTPB 4XGAB 1MI0A 4ICUA 3VUWA 2L3ZA 1FD6A 2H89B 1EU4A 1T5XD 4F1SA 2NTSA 2W55A 2FUHB 1FXAA 1WXAA 3LB8C 3RD2A 3QC8B 4LK0M 1S3SG 2LVQA 2SAKA 3OJ3A 4EKUA 3APCA 3QIJA 1WJ6A 4NZLB 5DCNA 2VZKD 3IAS1 1PFDA 4N59A 1IGDA 4LNNA 1QLBB 1TKEA 4ICVA 2N7DA 1I35A 4J6IA 3QAQA 2QJLA 4Q2JA 2Q5WD 2IJ0A 1F2RI 2BVCA 2EKEC 2K22A 3ZNGC 4AJYB 4OZCA 5LNK1 4ANWA 3PTFC 4KGTA 2I1JA 3AM9A 3PREA 2JUOA 4YSZB 2HJ1A 3P4PB 3TCAA 1GNUA 2LZ6A 2KFKB 4W9HA 1FO4A 2DYMA 4MGYE 2NR2A 2DAFA 4HDOA 1ZUD2 2C5LC 4DHZB 1NI3A 2DLBA 3TMPB 3ZDTA 1TYGB 2WXIA 2BT6A 2PPHA 3BIID 5E6OA 2M1MA 4DHJD 2RMMA 3B0AA 2MWSB 1P1AA 2DZJA 4XC2A 4WWPA 2PVOD 3AE3B 1DGJA 4CO7A 1MG4A 1YN3A 2BYEA 3HUIA 4YWGG 4WJPA 1PQSA 2K8HA 2M17A 3PZ7A 4N58A 1WJ4A 4PS3A 4B95A 5H8YE 2GBRA 3R8BA 3KW5B 1A5RA 2RD0A 3HHMA 4C00A 2G3QB 1EUVB 4WURA 3KH0A 3BZDB 1V80A 3JSVB 3A9JB 1N6ZA 4DBGA 2MJEA 5MPOA 3RNAC 1KM7A 2KHWB 2BS4B 3BVGA 3I3TB 1VZ6A 4FJZA 5BMIA 1TGZB 4PK1A 5BMGA 2I1KA 2K6DB 2WXHA 2IDYA 1AW7A 3KYCD 3K9OB 1WGGA 2D2QA 5E6NA 3SR6A 4UDUC 3SEBA 3RNBC 4HXDA 1M4VA 4JL9A 4E74A 1WXVA 4X57B 3NVZA 1WZ0A 5C2TB 3PLUA 4K81A 3NS1A 3PZ8A 4IWOA 1LQBA 3WAMA 2BYTA 1ACCA 3P4RB 2IPKD 4HPLB 1XO3A 3MHZA 1ZXIA 2FNJB 1I4XA 4ASWC 1JCKB 4KGRA 5LXIB 1YQ3B 3P42A 2FBWB 3FAHA 5IP4D 1RFAA 1V81A 2KWVB 3MHSD 4NQLB 4MGIE 4QAYA 3PO0A 3APFA 2NCNA 2HD5B 3U30A 3RI7C 2LRWA 5DPTA 1J19A 5JXVA 2MHJA 3VH3B 1K52A 4MM3A 2PVGC 1WF9A 3W1SA 3LXFA 3A9JA 4KSKC 4E71A 2M4NA 2JT4B 3A9KA 1UBIA 4RGOS 1QT9A 3M63B 2KN4A 1N63A 4A8XC 1Z5SB 1V5OA 1FPYA 3L4PA 2LJIA 4FHJA 3LYYA 1MVKA 3DCGA 4L1BA 1FRDA 3VRBB 4N9F4 3ZYYX 1YD8U 3A33B 2VH1A 3OAWA 1P98A 3BK1A 1QKZA 1TIFA 1WWTA 4HROA 2EELA 4F8CB 2MBHA 2FIFA 2MQJA 1FNUA 5IAAC 1WE6A 3DQVA 2J4XA 3ZVVA 3DBSA 1C77A 1BUIC 2IY1B 3A1QB 3L10B 3IT6B 1E9MA 1SIJA 1YN4A 5FR6A 1WXMA 3N32A 5T8IA 3RNGC 3MC9A 2INDC 4P1BC 3Q3MC 1TTNA 2H88B 2KMMA 3R2IA 2JWUA 2KXJA 3VUYA 2UYZB 5HG2A 1V6EA 1Y8RC 2PKOA 5JHBA 2ZW1A 4GDLA 2N9XA 3WAOA 3VTWA 1J8CA 1V9JA 3V6EB 1E8ZA 1FNWA 2BPSA 2UWQA 1LO5D 5CTRC 4G0NB 4NJ7A 3VQIA 2V3PA 4ZOHC 1T0SC 2C7HA 4K7WA 3AE9B 3U2SC 2W9NA 4FLHA 3AEEB 4USAA 1F1HA 4WWMA 5L83A 2M19A 5D6JB 2DBYA 3NVYA 3B2FA 1AWDA 5CHFA 1Q10A 3PHWB 3NRZA 1PGAA 1UGMA 4HDQA 1OTRB 5GXGB 2I38A 4EEWA 2KX0A 2KDBA 2YVCA 2WHIA 3GOEA 3C0RB 3V3XA 1SJED 3M3JA 3ETRA 3GP7A 4RF1A 1WZ3A 4ZRIA 1PGBA 2B3AA 1T3QA 4FBJB 3W5VB 2JPHA 4W9IA 2K9XA 2OEDA 2KTFA 3NOBA 1D3ZA 1E7UA 1GUAB 2V9HA 1V1OA 3W5UB 1ISNA 2WQYB 2WXPA 1J7AA 3VRAB 1WM3A 3PSEB 3Q8EA 1TS5A 3GB1A 1NDDA 3ONSA 4WJNA 4FJVB 2DENB 2JZZA 4OZAA 1WYWB 1UNSA 2WXOA 4B0EA 1C1YB 4REZA 4ZYNA 3ECIA 2NPTB 2KMAA 4EZKA 1N61A 3I5JC 3P4SB 4RFBA 2YEPF 3OLMD 4JE3B 1WXQA 4XE0A 2IO1B 1E0ZA 5D3IB 1IUEA 4M00A 4MSMB 2HTME 2C60A 5IA7A 1RM6C 1BMLC 2BTEA 5C1ZA 1FXIA 1AN8A 3VTVA 1QOBA 4GB9A 2FCNA 1JMLA 1KH0A 1V97A 2MSED 1PDXA 5CHVC 2L32A 2IY0B 4IDIA 3ZNID 2JYTA 3B9JA 2WXLA 4JLCA 3V60A 1C4PA 3R2TA 4LNFA 1HQRD 2J53A 2O2VA 3HVDA 2ZZPB 3RNEC 3R7RA 3QJZA 2L00B 3EHVA 2K1FA 3P63A 1C4CA 1WR6E 2PJHA 2Z0DB 2TSSA 2WX0A 1IBXB 1KF6B 1WY8A 3S2AA 1XQQA 1LM8B 3SHQA 2W82A 4EUTA 1WX9A 2GI9A 4KIKB 2N7EA 4TMAB 4LJPB 3TEXA 3DDCB 4LCDE 5J2RA 2ZNVC 3AH7A 5G2NA 2QCZA 1V49A 2MH7A 5BMHA 1SE9A 1KLVA 3L16A 4US8A 5EDSA 4WQOB 1TY0A 2DNFA 5DPRA 2KWDA 4BKSA 4LDTB 1FCCC 3QX1A 3UIPB 1ZE3D 5EE1A 2D11A 5G5HA 3PHXB 2JVCA 4ZYSA 1ZXHA 3ZRCA 1P7FA 1NEKB 2WXRA 4BKSD 2K8CA 1YJIA 5BO4B 1VJKA 1UELA 3UF8A 2XNAC 3DWGC 3AMZA 4RMAA 2MJ3A 2O6VA 2AL3A 1V2YA 3DHHC 1KFYB 3RFZB 2WYQA 2PW9A 2L52A 3H7SA 4GN1A 2WDVB 2XK5B 2B76B 1V8CA 2QMTA 2O6VD 3ZGZA 2DZIA 5HHDG 1WYGA 2N9KA 1YOVB 4GDKB 4GU2A 4H2AA 2CJOA 2KJHB 2ACZB 1H8CA 2Z0EB 2GBKA 4HVBA 4MELA 4BAXA 1OQYA 2YLMA 2WX1A 1C4AA 3N3KB 1D5MC 5JZEB 2MBOA 5L95C 3DVNU 1F52A 2LHDA 2C7MB 2N9EB 3LJ3A 4YL8A 1EWYC 2MBEA 2L76A 1QOFA 5KHQA 2R2OA 4YT0B 4M0WB 5DPSA 1WGRA 2L83A 1MJDA 3IXSA 4MACA 2K6QA 3L08A 1S1QB 2KACA 3MJ5A 3TSSA 3ZJTA 4AUQC 4MH8A 3VR9B 4JX1C 4JWSC 3VH4B 3ABVB 4AS1A 4US9A 4OVUA 2CKHB 1K53A 1ZW7A 3ML8A 1X1MA 1FMAD 2JY6A 4W9FA 1WGHA 4R3DA 2GLSA 2LVPA 1YN5A 4EE2A 3R7QA 1UWMA 2LXAA 2BWFA 3PRZA 3TIXA 1L4ZB 1I7HA 2IO0B 1E7PB 2KX3A 1KLUD 4LTUA 3UQAA 4NJCA 2KYWA 3TEWA 2ICIA 3H8HA 1LFDA 4IM3A 4W9DA 3CMMB 1G6JA 3DBHB 1CK1A 3NZSA 5IOIA 2D3AA 3ZLZA 1WSPA 1IGCA 3DOWA 1QQRA 2SEBD 4WQMA 2KC2A 4EFOA 2G45B 1OEYJ 1RLFA 2X38A 2PE6B 4IKGA 2AEHA 1RAXA 2C9WB 3ZRFA 1CZPA 3BVZA 2INNE 1NYQA 4YSYB 2BGFA 2KJ6A 2KFJA 4MJSB 2WS3B 2Y5BB 4XZ4A 1EU3A 4IM0A 5EE3A 4C7YA 2Z59B 1MHHE 1SJHD 4RCOA 3FKYA 3AE2B 3H7PB 1WJUA 3AU5A 4KVGB 3JW0X 1TKYA 3AB5A 2M0AA 3PVLA 2Y5PA 1XXGA 3WANA 4NPNA 5E6JA 1ET9A 2VRRB 4AWJA 3PGEA 1JWAD 2LASA 2K25A 4TV3A 1UGJA 5IKCM 4IC7B 2NMQA 2REXA 4RGMA 3NUHB 1JWSD 2RR9A 3T8MA 3E56A 4TQ1A 3BYYB 4J3OD 4IW0A 2KZRA 4BKTA 1E90A 2WXKA 1HTQA 2W3SA 1KRHA 5D7GA 2KFKA 1A70A 4NY0A 4MSQB 1U4AA 4KV2A 1XCQL 4BVUC 3GE3C 1JWMD 2R2QA 5HKHA 5FK9C 4TKNA 4IM2A 1WJNA 4TSSA 1I4HA 2MJDA 5H92C 3U52E 3IVFA 5EE9A 1PGXA 2FAZA 1L6UA 2LHEA 4KZ0A 2EMSA 4EZLA 2KQSA 1ZKHA 3DVNV 3M62B 2KK8A 3I63C 4P7IA 3UI3A 3ZKJC 2MW5A 2RSUA 4XWTA 1EWCA 1EO6A 1C76A 4AOFA 3NVVA 2IBIB 1L2NA 2GB1A 5TSSA 2J0KA 4IWPA 3ZJUA 5IN7A 4NQKE 3AXCA 3RUIB 4P16A 2CU3A 1R4MB 3AE5B 1N5WA 4IUMB 4ZRQA 3RULA 2MCNB 4K3CA 2WU2B 2JXXA 5C3JB 4NNJB 1JWUD 1SEBD 4PS7A 4EZJA 3JSVA 3QA8A 1YJ1A 4JGHB 2QIEB 3TEZA 2D10A 2KMCA 2KTRB 1MHXA 4B0MA 2MA9B 3NHEB 4GOCA 4ZHOA 3RNFC 1E7VA 1L7YA 3RZFA 3VXWA 4M01A 4L23A 4GLSC 4ARCA 1V5TA 3UIOB 4K7UA 3OG5A 1N60A 3SU8X 2MBQA 4ARIA 1SB3C 2KKCA 2AWTA 3Q8CA 3L0WB 3AE1B 2J7QB 3VR8B 2LEKA 3P2BA 1SBBB 4DXAB 1GAQB 3IT4B 2NBVB 2LJ5A 3V62A 3VDZA 1FRRA 2RPQA 1K51A 2BS2B 4WWNA 3ZW3A 2MBBB 3DVGY 2JZ3B 2ZCCA 2Y5CA 1D5ZC 2LD9A 1QOAA 5HFYA 1YQBA 1ESFA 3IFWB 1GPXA 1WH3A 5AZFA 3W2DA 3Q3NC 3NY5A 4ZRPA 3Q2AC 4DXGA 4YXDB 2LGIA 3WIMA 3URYA 1N62A 4WJQA 3SFDB 3DBHI 3KLSX 1FNVA 4C56C 1IPGA 2BWES 3PRMB 4B9KA 2W3RA 2FCMA 2BYFA 4IG7B 1P0RA 2CJNA 3CIRB 1XEEA 2LFIA 2KDEB 4DWFA 3H1UA 2ZJDA 2LGXA 4A6QA 1TZ1A 5JHAA 4LNOA 2JYEA 2KC1A 2HJ8A 1PUTA 1TS2A 1YX5B 2M0XA 2N1VA 4GGQA 2N0SB 1UBQA 2QHOA 1Q0WB 1HZ5A 3L13A 2WDQB 3A4RA 1HZ6A 3MP9A 3TJPA 4HPMB 1B9RA 1NENB 2ZEQA 4ZRJA 2KOXA 1GC7A 2YEPB 2KDFB 3A1QA 2WDRB 4MH0E 1DOYA 3L17A 4DQOC 3KQ4A 1MPEA 5AUIA 1N5XA 2G9HD 3MC8A 4HEA1 4FHKA 3RZWC 4RM9A 2KDMA 3Q69A 3OWEB 2ZNVB 3AE6B 4TUUA 2CR5A 4EOYA 1P9DU 2NVUI 3PS6A 4OVZA 3W1YA 4TQ0A 1CQVA 1KLGD 2IGGA 3ENEA 3TBLD 3O13A 3EA6A 4II2B 4WJOA 4ZRKA 1XF5L 4WAAA 1KTKA 2LGYA 3ALBA 3AU4A 2ZVOA 3AEFB 2GOWA 2K39A 3NZ3A 3Q8FA 4I6NB 4BFRA 2PIAA 1L5PA 3J9CA 4CYEA 5JH5C 5EE0A 3KVFB 4OZBA 4GXBA 4M02A 4NAWB 1VR9A 1L0YB 2MRPA 4NJ6A 2NS5A 1DOXA 3DWMA 2KT7A 2CS4A 1C9FA 4RGTA 1I42A 3JVZX 2K5PA 2N7JA 3D32A 3N1ZC 2WNMA 2GBNA 1SGHA 2WU5B 3LDZE 2WDTB 2KAJA 2AYOB 4A90A 3NJTA 1R4MI
chains in the Genus database with same CATH topology
1M4VA 1FMAD 3MFGA 4LLGM 4R3DA 1FFUA 3B2GA 3NVZA 5C2TB 2PLPA 3T3OA 1F2RC 1YN5A 4EE2A 1YQ4B 3NS1A 1UWMA 2V3NA 4IOIE 1QF6A 3PZ8A 1F77A 4YTNB 1Y56A 1B1ZA 1L4ZB 4PT5A 2W54A 1I7HA 2WXQA 2BYTA 1ACCA 3P4RB 2IPKD 1RWSA 2QILA 1E7PB 1KLUD 1HEZE 1XO3A 2OHFA 4LTUA 4NJCA 2DYOA 1ZXIA 3MHZA 1I4XA 3TEWA 2ICIA 2M56B 1JCKB 3H8HA 4KGRA 2JX5A 1YQ3B 3RPFC 3BVMA 2FBWB 3FILA 3FAHA 3P42A 2BB5A 1CK1A 1I4QA 1C78A 3PO0A 1WSPA 1IGCA 4WAFA 3AN1A 1QQRA 1TS3A 1UWXA 2SEBD 4WQMA 3TEYA 1JWBD 3E9SA 5JXVA 1OFFA 2X38A 1HXYD 4IKGA 1K52A 2PVGC 3W1SA 3LXFA 1R7SA 3C8YA 1ZDXA 1CJEA 5I4DA 1RFKA 2ONQA 4C80A 1TKGA 1CZPA 2JSVX 3BVZA 2INNE 1NYQA 3CWIA 3Q8AA 4RGOS 1QT9A 4YSYB 4KKJA 4DXFA 2KN4A 1JALA 4P6VF 3N9YC 1XCTL 1N63A 3NVWA 4A8XC 2WS3B 1EU3A 2PMVA 4WIPA 3L4PA 2XN9C 2LJIA 3LYYA 1MVKA 5EE3A 4ITKA 4L1BA 3P1MA 1FRDA 3VRBB 4C7YA 2BS3B 2JXTA 1MHHE 1SJHD 4RCOA 1SF0A 4CQNA 3ZYYX 3AE2B 3BK1A 1C79A 1QKZA 1XLOA 1WWTA 4HROA 2EELA 1TKYA 1FEHA 3AB5A 2M0AA 1IBXA 2Y5PA 1XXGA 2WXGA 1GOZA 1VZ7A 5FR3A 2L1AA 1VRAB 1D6EC 5E6JA 1FNUA 1ET9A 2K0PA 4A9AA 2JU6X 1JWAD 1YJJA 1V1PB 1UGJA 1ZP0B 2J4XA 2NMQA 1C77A 1BUIC 3NUHB 2HDEA 4RGMA 3IT6B 2E3TA 1E9MA 1JWSD 1XLNA 1SIJA 1YN4A 1FCLA 3EGRA 3E56A 5T8IA 3KWVA 3BYYB 4TQ1A 4J3OD 3AEDB 3W9CB 2H88B 2KMMA 3R2IA 2AX5A 2JWUA 2WXKA 5HG2A 1SXTA 2W3SA 1KRHA 1ENFA 5D7GA 4KKIA 1A70A 1DOIA 2PKOA 1XCQL 3AE4B 1EM7A 2ZW1A 3AV8A 3U4EG 1NVID 1NYRA 1JWMD 5FK9C 4NAMA 1TJEA 1ET6A 1I4HA 1ROEA 4TSSA 2MJDA 1XLQA 2K3UA 1FNWA 4YSXB 5H92C 3U52E 5EE9A 1PGXA 2WXJA 1L6UA 1LO5D 4RGNA 1JRPA 2LHEA 2INPE 1TZOA 3VQIA 2V3PA 4C7ZA 4ZOHC 3AEBB 4WH4A 1GB1A 3WCQA 3AE9B 2G1EA 2D5GA 3U2SC 3UI3A 3AEEB 4XWTA 1EWCA 4USAA 1DYQA 1C76A 2Z8LA 3BYTB 4WWMA 2AQ1B 2M19A 1P7EA 3NVVA 2DBYA 3BWUD 2GB1A 5TSSA 3NVYA 3ZJUA 3B2FA 1JQ4A 1BXTA 1AWDA 2V0GA 2BB6A 4OW0A 1Q10A 1STEA 1SSNA 4FXCA 3NRZA 4P16A 2CU3A 3AE5B 1J7BA 2VZKB 1N5WA 1PGAA 1UUPA 4ZRQA 4HKQA 5GXGB 2I38A 1ZPSA 2WU2B 5C3JB 4JPSA 4XDDA 1JWUD 1SEBD 3V3XA 1SJED 3EUB2 3ETRA 3TEZA 2QIEB 3GP7A 1VZ8A 4RF1A 1PGBA 2QSDA 4YTMB 1T3QA 4M0WA 1MHXA 4B0MA 1SE2A 2ON8A 1V1PA 5G5GA 3W5VB 1GB4A 2EKIA 2K9XA 4ZHOA 2OEDA 1AYFA 4L2YA 2BW2A 3MC0B 2DWQA 4L23A 1V1OA 4HKZE 3W5UB 4GLSC 1FFVA 1L4DB 1VDVA 4ARCA 2WQYB 2WXPA 1J7AA 3VRAB 3V05A 3Q8EA 3I9V1 4HJGE 1TS5A 3AEAB 4RF0A 2JZPA 1F0ZA 2PTLA 2BBCA 1E10A 2RDGA 3GB1A 3I57A 1N60A 1J7CA 4ARIA 1WGKA 1SB3C 1RYJA 2KQ4X 4XWWA 2LMCA 4OZAA 3Q8CA 5BYQA 5FKAC 3AE1B 3VR8B 4D2KA 2LEKA 3AEGB 1SBBB 1I4GA 1UNSA 1GAQB 2WXOA 4B0EA 3IT4B 1OQQA 1E6EB 2ZW0A 4REZA 4JWUC 2JQRB 3AE8B 1FRRA 1N61A 4XDCA 1K51A 2BS2B 3P4SB 4RFBA 2YEPF 1I4RA 3FC4A 1D4BA 1JROA 4JE3B 1WXQA 4XE0A 2R61A 4AQ7A 2N9LA 3T3NA 2I2YA 1E0ZA 4OHJA 5D3IB 1IUEA 2RDHA 4MM3B 1L6VA 2Y5CA 2HTME 1D5ZC 1RM6C 1BMLC 2BTEA 1FXIA 1AN8A 1QOAA 5HFYA 1PYWD 1L0VB 2WXFA 1ESFA 3Q8BA 1OQRA 4YTPB 1QOBA 3P4QB 1JMLA 1KH0A 1V97A 1GPXA 1PDXA 3W2DA 2E6XA 2L32A 1MI0A 4IDIA 2FE8A 4RNAA 4ZRPA 4KGSA 4DXGA 2JYTA 4YXDB 3B9JA 1FD6A 2WXLA 2LGIA 2H89B 1EU4A 2J52A 1T5XD 1YNTE 1C4PA 3R2TA 1HQRD 2J53A 2NTSA 2W55A 3HVDA 3URYA 1FXAA 3LB8C 1N62A 3SFDB 3TUOA 3P63A 4LK0M 2SAKA 1C4CA 2AQ2B 3KLSX 2GRIA 1FNVA 2TSSA 4C56C 1IBXB 1KF6B 4NZLB 2VZKD 3IAS1 1PFDA 4N59A 1XLPA 1IGDA 1SE3A 2W3RA 4A55A 1QLBB 1TKEA 2WP9B 4O1NA 1K50A 1VLBA 2W82A 2QJLA 4Q2JA 2LUMA 2CJNA 1XEEA 2IJ0A 2LFIA 2Q5WD 3CIRB 1F2RI 3IAM1 2GI9A 2K22A 4KX6B 4TMAB 4A6QA 3TEXA 3AH7A 4OZCA 5LNK1 2JYEA 2MH7A 5BMHA 4KGTA 3AM9A 1ZDVA 1PUTA 1TS2A 4YSZB 4US8A 2N0SB 1TY0A 2Y3AA 3P4PB 2KWDA 1WRIA 3HVZA 4RH6A 1HZ5A 1HA5A 2WDQB 1FO4A 1JW9D 2DYMA 1FCCC 3GS2A 1HZ6A 3MP9A 1ZE3D 5EE1A 5G5HA 4GDLB 3U7ZA 3BK2A 1B9RA 1ZOYB 1TS4A 4ZYSA 1ZXHA 1NENB 1ZUD2 1P7FA 1SE4A 3HRDD 1NEKB 2IGDA 2WXRA 1NI3A 1YJIA 5AUKA 1VJKA 2FUG1 2YEPB 2RPVA 3SFEB 2DLBA 2MEKA 2XNAC 2WLBA 2WDRB 3DWGC 1TYGB 2WXIA 2BT6A 1DOYA 3AMZA 4DQOC 3KQ4A 1MPEA 5AUIA 2MJ3A 1N5XA 2G9HD 4HEA1 3BIID 2RMMA 1KFYB 3RFZB 2PW9A 2L52A 2KDMA 2WDVB 4ZHPA 2NTTA 3Q69A 3AECB 3AE6B 3OWEB 5BYSA 2B76B 1V8CA 4OVZA 4TQ0A 1CQVA 1KLGD 2PVOD 2WXNA 3AE3B 5HI1A 2IGGA 2QMTA 1DGJA 3ZGZA 3O13A 3EA6A 3FILB 1TY2A 5HHDG 1YN3A 1WYGA 2N9KA 1XF5L 4GDKB 1KTKA 4H2AA 2CJOA 4HRSA 3HUIA 2ACZB 4YWGG 3AEFB 5BYRA 3ZQ4A 3PZ7A 1C4AA 4N58A 5D3DA 2IGHA 1I4PA 3NZ3A 3Q8FA 2QEJC 1L0XB 2J42A 5H8YE 3R8BA 1D5MC 4N6EB 2PIAA 3KWLA 1L5PA 3J9CA 4WURA 1QILA 2LHDA 3AE7B 3BZDB 5EE0A 4OZBA 1EWYC 1YMHE 4NAWB 1QOFA 1VR9A 2MJEA 1L0YB 4YT0B 5MPOA 2L83A 3IXSA 4MACA 2BS4B 3BVGA 1DOXA 3DWMA 4MT5A 2V4IB 2WXMA 1VZ6A 2KACA 1C9FA 1QOGA 4RGTA 3MJ5A 5BMIA 1FIQA 5BMGA 2K5PA 2N7JA 3TSSA 2WNMA 3ZJTA 2WU5B 2WXHA 4MH8A 2IDYA 1FM0D 3VR9B 1AW7A 2KAJA 3SR6A 4JX1C 4JWSC 3ABVB 4AS1A 4A90A 2AQ3B 4UDUC 1T6BX 4US9A 3ZJVA 3SEBA 1K53A 1D5XC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JWA D;  1YJJ A;  2DWQ A;  1FMA D;  3W5U B;  1FFV A;  3P4P B;  1VDV A;  1ZP0 B;  1WRI A;  1FFU A;  2WQY B;  3B2G A;  4LTU A;  3HVZ A;  1J7A A;  3VRA B;  3NVZ A;  2WDQ B;  5C2T B;  1FO4 A;  1JW9 D;  2E3T A;  1E9M A;  3AEA B;  1YQ4 B;  1XLN A;  1F0Z A;  1SIJ A;  3NS1 A;  1UWM A;  5EE1 A;  1E10 A;  5G5H A;  1QF6 A;  1N60 A;  1J7C A;  1B9R A;  1WGK A;  1SB3 C;  1RYJ A;  1ZOY B;  3AED B;  4YTN B;  2H88 B;  3W9C B;  2KMM A;  2AX5 A;  2W54 A;  3AE1 B;  3VR8 B;  1I7H A;  1NEN B;  1ZUD 2;  3HRD D;  1NEK B;  2LEK A;  3AEG B;  3P4R B;  2W3S A;  1GAQ B;  1KRH A;  1RWS A;  1E7P B;  1NI3 A;  1YJI A;  1OQQ A;  1VJK A;  1E6E B;  5AUK A;  3SFE B;  1A70 A;  1DOI A;  1XO3 A;  2OHF A;  2PKO A;  4JWU C;  2JQR B;  2WDR B;  2WLB A;  1TYG B;  3DWG C;  1ZXI A;  3AE4 B;  2BT6 A;  3AE8 B;  1DOY A;  3AV8 A;  1FRR A;  1N61 A;  3AMZ A;  1NVI D;  5AUI A;  2MJ3 A;  1N5X A;  2BS2 B;  2M56 B;  1NYR A;  3P4S B;  3FC4 A;  1JRO A;  3BII D;  2JX5 A;  1WXQ A;  1KFY B;  1YQ3 B;  3RPF C;  1TJE A;  1ROE A;  1E0Z A;  2L52 A;  2FBW B;  2MJD A;  1IUE A;  3FAH A;  2WDV B;  1XLQ A;  4ZHP A;  3AEC B;  3AE6 B;  4YSX B;  2B76 B;  1V8C A;  1L6V A;  2Y5C A;  5H92 C;  2HTM E;  1RM6 C;  2PVO D;  3AE3 B;  3PO0 A;  5EE9 A;  1FXI A;  1QOA A;  1DGJ A;  1L6U A;  1JRP A;  1L0V B;  3AN1 A;  1OQR A;  4YTP B;  1QOB A;  4WQM A;  1WYG A;  1JWB D;  3P4Q B;  4C7Z A;  1V97 A;  4ZOH C;  1GPX A;  1PDX A;  2CJO A;  3AEB B;  4HRS A;  3HUI A;  2ACZ B;  4YSY B;  3WCQ A;  3AEF B;  1OFF A;  4IDI A;  3AE9 B;  2G1E A;  4N58 A;  3AEE B;  2PVG C;  3LXF A;  1R7S A;  4USA A;  4YXD B;  3B9J A;  4WWM A;  2H89 B;  2M19 A;  1CJE A;  3NVV A;  5H8Y E;  1RFK A;  2DBY A;  4N6E B;  4C80 A;  3NVY A;  2PIA A;  1TKG A;  1CZP A;  1L5P A;  2W55 A;  3B2F A;  1AWD A;  1NYQ A;  3CWI A;  3KWL A;  1QT9 A;  1FXA A;  3AE7 B;  1N62 A;  3LB8 C;  4FXC A;  3SFD B;  1JAL A;  3NRZ A;  4P6V F;  1N63 A;  2CU3 A;  3P63 A;  3NVW A;  5EE0 A;  3AE5 B;  2WS3 B;  1J7B A;  1EWY C;  1N5W A;  3L4P A;  1QOF A;  1KF6 B;  2MJE A;  5GXG B;  5MPO A;  4YT0 B;  5EE3 A;  4N59 A;  1PFD A;  2L83 A;  2WU2 B;  4ITK A;  1XLP A;  1FRD A;  3P1M A;  3VRB B;  2BS3 B;  2W3R A;  4C7Y A;  2BS4 B;  5C3J B;  1QLB B;  1SF0 A;  1TKE A;  2WP9 B;  3ZYY X;  1DOX A;  3DWM A;  1JQ4 A;  3AE2 B;  1VLB A;  2QJL A;  1QOG A;  1XLO A;  2Q5W D;  2CJN A;  1WWT A;  3CIR B;  3ETR A;  3EUB 2;  4HRO A;  1TKY A;  2QIE B;  3AB5 A;  2K22 A;  4KX6 B;  1FIQ A;  2K5P A;  4YTM B;  1T3Q A;  3AH7 A;  5G5G A;  3W5V B;  2WU5 B;  2EKI A;  1FM0 D;  3VR9 B;  2KAJ A;  2MH7 A;  3SR6 A;  2K9X A;  4JWS C;  4JX1 C;  4ZHO A;  3ABV B;  3AM9 A;  4US9 A;  1PUT A;  1AYF A;  4YSZ B;  4US8 A;  4A9A A;  2N0S B; 
#chains in the Genus database with same CATH topology
 3MFG A;  3K9P B;  3A4S C;  1FFU A;  3B2G A;  4B6W A;  2PLP A;  4ANU A;  1F2R C;  1R4N B;  1YQ4 B;  1WGY A;  4HCN B;  1F77 A;  1Y56 A;  2V1Y A;  4PT5 A;  2W54 A;  4G3X B;  4I6P A;  2WXQ A;  2J0M A;  1RWS A;  2QIL A;  4IWQ A;  3UIN B;  3RCZ A;  2DYO A;  3CST A;  3X0W A;  1WX8 A;  2JX5 A;  3BVM A;  2BKF A;  3QQ8 B;  2WWZ A;  4XX5 A;  2NPT A;  1C78 A;  4WAF A;  1TS3 A;  3V6C B;  3TEY A;  1JWB D;  4HLE A;  4W9J A;  1KJT A;  3TL5 A;  1OFF A;  3RNC C;  1E8Y A;  3R3M A;  1HXY D;  4W9L A;  3OJ4 B;  3DBL B;  3C8Y A;  4BZA A;  4PYZ A;  5I4D A;  1RFK A;  1TKG A;  3CWI A;  3Q8A A;  4WWO A;  2D07 B;  4KKJ A;  4DXF A;  4P6V F;  3N9Y C;  1XCT L;  4MGZ E;  3NVW A;  3QAR A;  1T0Y A;  1CMX B;  4ITK A;  2KLC A;  3P1M A;  2BS3 B;  3VFK A;  4CQN A;  3UGB B;  1XLO A;  2RGF A;  1J0G A;  1FEH A;  1IBX A;  1GOZ A;  1VZ7 A;  1VRA B;  1D6E C;  2DAJ A;  4GMV A;  1RRB A;  2JRH A;  4A9A A;  2JU6 X;  4DHJ B;  1YJJ A;  2XBB C;  1V1P B;  4KIK A;  4MEM A;  1V86 A;  4LNK A;  1FCL A;  2KWC A;  3KWV A;  3DPD A;  3DBR B;  3AED B;  3HK0 A;  1SXT A;  2CHW A;  1VD2 A;  4KKI A;  4AJW A;  1EM7 A;  3U4E G;  1NVI D;  1NBF C;  1NYR A;  3CSF A;  1KOT A;  2LVO A;  4NAM A;  2OJW A;  5GMV A;  4BBN F;  1XLQ A;  2K3U A;  4LDT D;  3M95 A;  3QK0 A;  4CHK A;  2VH2 A;  3EFU A;  2ZVN A;  4K1R B;  1E5W A;  2BYV E;  4RGN A;  1JRP A;  1JRU A;  2INP E;  3QWZ B;  4K7S A;  2LI5 A;  1TZO A;  1NI2 A;  3AEB B;  4WH4 A;  3WCQ A;  2G1E A;  2D5G A;  2XK5 A;  1WIA A;  2CHZ A;  2Z8L A;  2AQ1 B;  1P7E A;  3APD A;  3T9L A;  2V0G A;  3KYD D;  4OW0 A;  4GDK A;  1SSN A;  3N1X C;  1J7B A;  4GSW A;  2XEW A;  3R66 C;  2JRI B;  4LJO B;  3L54 A;  4HKQ A;  3BY4 B;  1ZPS A;  4PS8 A;  2ASQ A;  3Q3J A;  1K8R B;  2G4D B;  4JPS A;  4XDD A;  3HM3 A;  2N1W A;  1LGR A;  1P3Q U;  3PPA A;  4BBN C;  3EUB 2;  2LXC A;  4BOZ B;  3GZN B;  1VZ8 A;  3ZIM A;  4M0W A;  1SE2 A;  1V1P A;  1GB4 A;  1MFW A;  3IG3 A;  3JYU A;  5TR5 A;  1AYF A;  4L2Y A;  2BW2 A;  3MC0 B;  2NBW B;  4A3O A;  2DWQ A;  1L4D B;  1VDV A;  1E8W A;  3KUC B;  3ZXR A;  2DZM A;  2N4F A;  3V05 A;  4RF0 A;  2PTL A;  4FAD A;  4URK A;  2MP2 B;  3I57 A;  2V3S A;  3VTU A;  4DDI D;  1WGK A;  4XWW A;  2KQ4 X;  3QCA A;  2LMC A;  5BYQ A;  4D2K A;  1I4G A;  1OQQ A;  3U7D A;  2ZW0 A;  4W9G A;  1Q5W B;  2GBM A;  2KD0 A;  1D4B A;  1JRO A;  1HE8 A;  2A4Z A;  4AQ7 A;  4HK2 A;  3T3N A;  3N30 A;  4DDG D;  4MM3 B;  1L6V A;  1R4N I;  1E8X A;  4S17 A;  1PYW D;  4K3B A;  3Q8B A;  1OQR A;  3A9K B;  3P4Q B;  3SDL C;  3V61 A;  3ZNZ B;  2E6X A;  1H4R A;  3WA0 A;  3NZU A;  2FE8 A;  2V4L A;  4RNA A;  4KGS A;  2CU1 A;  3N20 C;  4JIO U;  2X8X X;  2J52 A;  1YNT E;  4W9C A;  3RMK C;  1TBE A;  3TUO A;  1UD7 A;  3MTN B;  2ZCB A;  2AQ2 B;  2GRI A;  2D3C A;  2PEA A;  5D94 A;  1WE7 A;  3Q14 C;  2JF5 A;  1XLP A;  5CHW A;  1SE3 A;  4A55 A;  4W9E A;  2WP9 B;  4O1N A;  1UZX B;  2RDB C;  1K50 A;  4MJS A;  1VLB A;  3X23 A;  2LUM A;  3IAM 1;  4KX6 B;  2HE7 A;  5IO9 A;  3DBL I;  4W9K A;  1VCB A;  2QDF A;  5G55 A;  1M94 A;  3BIN A;  1ZDV A;  3H7P A;  4P1C C;  2MP2 A;  3GE8 C;  2AL6 A;  2Y3A A;  3O65 B;  3U8Z A;  1WRI A;  3HVZ A;  4RH6 A;  1HA5 A;  1GC6 A;  1JW9 D;  1WGD A;  3GS2 A;  1OEY A;  4GDL B;  3U7Z A;  3BK2 A;  2BF8 B;  1ZOY B;  1TS4 A;  2L8J A;  2KAN A;  1SE4 A;  3HRD D;  2IGD A;  1WR1 A;  3W1S C;  1QZE A;  5AUK A;  1ZGU B;  3SFE B;  2FUG 1;  2RPV A;  2MEK A;  4FUL A;  2BQQ A;  2WLB A;  3RN9 C;  3B1L X;  5C23 A;  3RYT A;  4ZHP A;  2NTT A;  3AEC B;  5BYS A;  3NS8 A;  5DPW A;  2WXN A;  5HI1 A;  3VAW A;  2D3B A;  1F9J A;  3FIL B;  2ZPY A;  3DBR I;  1TY2 A;  1AAR A;  1GJZ A;  1XD3 B;  4A3P A;  2PE9 A;  4HRS A;  5BYR A;  3ZQ4 A;  5AZH A;  5D3D A;  2IGH A;  2QEJ C;  1L0X B;  2J42 A;  4JQW C;  4N6E B;  3KWL A;  4DHZ E;  4AP4 C;  1QIL A;  3AE7 B;  3ZNH B;  4RM8 A;  4C4V B;  1YMH E;  3PZD A;  2WGS A;  1T0R C;  2GBJ A;  3IBE A;  4MT5 A;  2V4I B;  2WXM A;  4DK5 A;  3UQB A;  5LXH A;  4G11 A;  1QOG A;  5LLI A;  2IZV B;  1FIQ A;  3AUL A;  4LNI A;  1FM0 D;  2INC C;  2KNB A;  4ANX A;  3RT3 B;  2OOB B;  2AQ3 B;  3ZJV A;  1T6B X;  2KO3 A;  3WAL A;  1I4P A;  1D5X C;  3ZTD A;  2DX5 B;  4LLG M;  1XT9 B;  2KTR A;  1MG8 A;  3T3O A;  2C7N B;  2OJR A;  4GIV A;  3CF6 E;  1LXD A;  2V3N A;  1UF0 A;  4IOI E;  4A20 A;  1QF6 A;  1BT0 A;  2FID A;  4YTN B;  1B1Z A;  4HJK A;  3GZN I;  3C19 A;  2LGS A;  5CX3 A;  1HEZ E;  1WI0 A;  2OHF A;  2A5U A;  2M56 B;  4KDL B;  1WX7 A;  3RPF C;  2KWU B;  3FIL A;  3ZTC A;  2BB5 A;  2KDI A;  3KUZ A;  1I4Q A;  5J17 A;  2KLG A;  1WXS A;  3NG0 A;  1YIW A;  1YX6 B;  3AN1 A;  1UWX A;  2O2V B;  3Q3O C;  3E9S A;  2L0F A;  4M8N A;  3ML9 A;  2DZK A;  1R7S A;  5KHO A;  3PRP B;  1ZDX A;  1CJE A;  4C4V A;  2J0J A;  3KUD B;  2ONQ A;  4C80 A;  3Q3F A;  2JSV X;  2MLB A;  1IYF A;  4BOS C;  1JAL A;  4WIP A;  1Z2M A;  2PMV A;  2XN9 C;  3ZO5 B;  2JXT A;  1SF0 A;  2NBU A;  2QC8 A;  3EEC A;  1C79 A;  2DHZ A;  3EC8 A;  4II3 B;  2WXG A;  2KQ7 A;  5J18 A;  2EMT A;  4OVV A;  2KVR A;  4HPP A;  5FR3 A;  2L1A A;  4ZDV A;  2IYD B;  3MJW A;  2KVZ A;  2K8B A;  5D2M B;  3QHT A;  2K0P A;  3DVG X;  3IHP C;  1C3T A;  1ZP0 B;  3B08 A;  3WAP A;  2HDE A;  2E3T A;  2G4S A;  1XLN A;  4M8M A;  1SIF A;  3EGR A;  4E3C A;  2O6V B;  5AEK B;  3W9C B;  2AX5 A;  2FCQ A;  3H9D A;  2IO2 B;  2LUE A;  2JWZ A;  4KDI C;  1ENF A;  3VHT C;  1WM2 A;  4HCP B;  2KN5 A;  1DOI A;  4FJY A;  2DYB A;  3AE4 B;  2BKR B;  3EFC A;  1WMH B;  3AV8 A;  1EF5 A;  1TT5 B;  3PV1 A;  4FN2 A;  3N1Y C;  3HM6 X;  4ACF A;  1TJE A;  1ET6 A;  1ROE A;  4G50 A;  4YSX B;  1T0Q C;  2D3G A;  2LWP A;  2WXJ A;  4PYU A;  3H6N A;  2MX2 A;  4C7Z A;  3ZUN A;  1GB1 A;  3DHG C;  3DHI C;  3Q6B A;  3PT2 B;  1UH6 A;  1DYQ A;  2IO3 B;  3BYT B;  2UU7 A;  3BWU D;  3HIZ A;  1WRD B;  4FA6 A;  1JQ4 A;  1BXT A;  2BB6 A;  3PLV A;  1STE A;  4FXC A;  4HWI B;  1GG3 A;  4ANV A;  2N9P C;  2VZK B;  2L0T A;  1UUP A;  3AI5 A;  1WFY A;  2ZPN A;  4XYC A;  2L05 A;  2HTH A;  4MGK E;  4NAW A;  2QSD A;  4YTM B;  4S0R A;  2ON8 A;  5G5G A;  2EKI A;  2GMI C;  5E6P A;  2L7R A;  4HKZ E;  1FFV A;  2CHX A;  3I9V 1;  4HJG E;  3AEA B;  1F0Z A;  2JZP A;  2BBC A;  3ZXV A;  1E10 A;  2RDG A;  1EF1 A;  5AZG A;  1J7C A;  1Q1O A;  3ZDM C;  1RYJ A;  1WMH A;  2KJR A;  5FKA C;  4KSL C;  4BKG A;  4MDK E;  1FXT B;  3AEG B;  1E6E B;  3SD5 A;  4JWU C;  2JQR B;  2M8S A;  3AE8 B;  4XDC A;  4F7Z A;  1I4R A;  3FC4 A;  2R61 A;  2LGD A;  1HTO A;  2N9L A;  2I2Y A;  4OHJ A;  1OGW A;  2RDH A;  2FCS A;  3VUX A;  1IP9 A;  4I6L B;  3VVW B;  2LRU A;  1L0V B;  2WXF A;  4KZC A;  4YTP B;  4XGA B;  1MI0 A;  4ICU A;  3VUW A;  2L3Z A;  1FD6 A;  2H89 B;  1EU4 A;  1T5X D;  4F1S A;  2NTS A;  2W55 A;  2FUH B;  1FXA A;  1WXA A;  3LB8 C;  3RD2 A;  3QC8 B;  4LK0 M;  1S3S G;  2LVQ A;  2SAK A;  3OJ3 A;  4EKU A;  3APC A;  3QIJ A;  1WJ6 A;  4NZL B;  5DCN A;  2VZK D;  3IAS 1;  1PFD A;  4N59 A;  1IGD A;  4LNN A;  1QLB B;  1TKE A;  4ICV A;  2N7D A;  1I35 A;  4J6I A;  3QAQ A;  2QJL A;  4Q2J A;  2Q5W D;  2IJ0 A;  1F2R I;  2BVC A;  2EKE C;  2K22 A;  3ZNG C;  4AJY B;  4OZC A;  5LNK 1;  4ANW A;  3PTF C;  4KGT A;  2I1J A;  3AM9 A;  3PRE A;  2JUO A;  4YSZ B;  2HJ1 A;  3P4P B;  3TCA A;  1GNU A;  2LZ6 A;  2KFK B;  4W9H A;  1FO4 A;  2DYM A;  4MGY E;  2NR2 A;  2DAF A;  4HDO A;  1ZUD 2;  2C5L C;  4DHZ B;  1NI3 A;  2DLB A;  3TMP B;  3ZDT A;  1TYG B;  2WXI A;  2BT6 A;  2PPH A;  3BII D;  5E6O A;  2M1M A;  4DHJ D;  2RMM A;  3B0A A;  2MWS B;  1P1A A;  2DZJ A;  4XC2 A;  4WWP A;  2PVO D;  3AE3 B;  1DGJ A;  4CO7 A;  1MG4 A;  1YN3 A;  2BYE A;  3HUI A;  4YWG G;  4WJP A;  1PQS A;  2K8H A;  2M17 A;  3PZ7 A;  4N58 A;  1WJ4 A;  4PS3 A;  4B95 A;  5H8Y E;  2GBR A;  3R8B A;  3KW5 B;  1A5R A;  2RD0 A;  3HHM A;  4C00 A;  2G3Q B;  1EUV B;  4WUR A;  3KH0 A;  3BZD B;  1V80 A;  3JSV B;  3A9J B;  1N6Z A;  4DBG A;  2MJE A;  5MPO A;  3RNA C;  1KM7 A;  2KHW B;  2BS4 B;  3BVG A;  3I3T B;  1VZ6 A;  4FJZ A;  5BMI A;  1TGZ B;  4PK1 A;  5BMG A;  2I1K A;  2K6D B;  2WXH A;  2IDY A;  1AW7 A;  3KYC D;  3K9O B;  1WGG A;  2D2Q A;  5E6N A;  3SR6 A;  4UDU C;  3SEB A;  3RNB C;  4HXD A;  1M4V A;  4JL9 A;  4E74 A;  1WXV A;  4X57 B;  3NVZ A;  1WZ0 A;  5C2T B;  3PLU A;  4K81 A;  3NS1 A;  3PZ8 A;  4IWO A;  1LQB A;  3WAM A;  2BYT A;  1ACC A;  3P4R B;  2IPK D;  4HPL B;  1XO3 A;  3MHZ A;  1ZXI A;  2FNJ B;  1I4X A;  4ASW C;  1JCK B;  4KGR A;  5LXI B;  1YQ3 B;  3P42 A;  2FBW B;  3FAH A;  5IP4 D;  1RFA A;  1V81 A;  2KWV B;  3MHS D;  4NQL B;  4MGI E;  4QAY A;  3PO0 A;  3APF A;  2NCN A;  2HD5 B;  3U30 A;  3RI7 C;  2LRW A;  5DPT A;  1J19 A;  5JXV A;  2MHJ A;  3VH3 B;  1K52 A;  4MM3 A;  2PVG C;  1WF9 A;  3W1S A;  3LXF A;  3A9J A;  4KSK C;  4E71 A;  2M4N A;  2JT4 B;  3A9K A;  1UBI A;  4RGO S;  1QT9 A;  3M63 B;  2KN4 A;  1N63 A;  4A8X C;  1Z5S B;  1V5O A;  1FPY A;  3L4P A;  2LJI A;  4FHJ A;  3LYY A;  1MVK A;  3DCG A;  4L1B A;  1FRD A;  3VRB B;  4N9F 4;  3ZYY X;  1YD8 U;  3A33 B;  2VH1 A;  3OAW A;  1P98 A;  3BK1 A;  1QKZ A;  1TIF A;  1WWT A;  4HRO A;  2EEL A;  4F8C B;  2MBH A;  2FIF A;  2MQJ A;  1FNU A;  5IAA C;  1WE6 A;  3DQV A;  2J4X A;  3ZVV A;  3DBS A;  1C77 A;  1BUI C;  2IY1 B;  3A1Q B;  3L10 B;  3IT6 B;  1E9M A;  1SIJ A;  1YN4 A;  5FR6 A;  1WXM A;  3N32 A;  5T8I A;  3RNG C;  3MC9 A;  2IND C;  4P1B C;  3Q3M C;  1TTN A;  2H88 B;  2KMM A;  3R2I A;  2JWU A;  2KXJ A;  3VUY A;  2UYZ B;  5HG2 A;  1V6E A;  1Y8R C;  2PKO A;  5JHB A;  2ZW1 A;  4GDL A;  2N9X A;  3WAO A;  3VTW A;  1J8C A;  1V9J A;  3V6E B;  1E8Z A;  1FNW A;  2BPS A;  2UWQ A;  1LO5 D;  5CTR C;  4G0N B;  4NJ7 A;  3VQI A;  2V3P A;  4ZOH C;  1T0S C;  2C7H A;  4K7W A;  3AE9 B;  3U2S C;  2W9N A;  4FLH A;  3AEE B;  4USA A;  1F1H A;  4WWM A;  5L83 A;  2M19 A;  5D6J B;  2DBY A;  3NVY A;  3B2F A;  1AWD A;  5CHF A;  1Q10 A;  3PHW B;  3NRZ A;  1PGA A;  1UGM A;  4HDQ A;  1OTR B;  5GXG B;  2I38 A;  4EEW A;  2KX0 A;  2KDB A;  2YVC A;  2WHI A;  3GOE A;  3C0R B;  3V3X A;  1SJE D;  3M3J A;  3ETR A;  3GP7 A;  4RF1 A;  1WZ3 A;  4ZRI A;  1PGB A;  2B3A A;  1T3Q A;  4FBJ B;  3W5V B;  2JPH A;  4W9I A;  2K9X A;  2OED A;  2KTF A;  3NOB A;  1D3Z A;  1E7U A;  1GUA B;  2V9H A;  1V1O A;  3W5U B;  1ISN A;  2WQY B;  2WXP A;  1J7A A;  3VRA B;  1WM3 A;  3PSE B;  3Q8E A;  1TS5 A;  3GB1 A;  1NDD A;  3ONS A;  4WJN A;  4FJV B;  2DEN B;  2JZZ A;  4OZA A;  1WYW B;  1UNS A;  2WXO A;  4B0E A;  1C1Y B;  4REZ A;  4ZYN A;  3ECI A;  2NPT B;  2KMA A;  4EZK A;  1N61 A;  3I5J C;  3P4S B;  4RFB A;  2YEP F;  3OLM D;  4JE3 B;  1WXQ A;  4XE0 A;  2IO1 B;  1E0Z A;  5D3I B;  1IUE A;  4M00 A;  4MSM B;  2HTM E;  2C60 A;  5IA7 A;  1RM6 C;  1BML C;  2BTE A;  5C1Z A;  1FXI A;  1AN8 A;  3VTV A;  1QOB A;  4GB9 A;  2FCN A;  1JML A;  1KH0 A;  1V97 A;  2MSE D;  1PDX A;  5CHV C;  2L32 A;  2IY0 B;  4IDI A;  3ZNI D;  2JYT A;  3B9J A;  2WXL A;  4JLC A;  3V60 A;  1C4P A;  3R2T A;  4LNF A;  1HQR D;  2J53 A;  2O2V A;  3HVD A;  2ZZP B;  3RNE C;  3R7R A;  3QJZ A;  2L00 B;  3EHV A;  2K1F A;  3P63 A;  1C4C A;  1WR6 E;  2PJH A;  2Z0D B;  2TSS A;  2WX0 A;  1IBX B;  1KF6 B;  1WY8 A;  3S2A A;  1XQQ A;  1LM8 B;  3SHQ A;  2W82 A;  4EUT A;  1WX9 A;  2GI9 A;  4KIK B;  2N7E A;  4TMA B;  4LJP B;  3TEX A;  3DDC B;  4LCD E;  5J2R A;  2ZNV C;  3AH7 A;  5G2N A;  2QCZ A;  1V49 A;  2MH7 A;  5BMH A;  1SE9 A;  1KLV A;  3L16 A;  4US8 A;  5EDS A;  4WQO B;  1TY0 A;  2DNF A;  5DPR A;  2KWD A;  4BKS A;  4LDT B;  1FCC C;  3QX1 A;  3UIP B;  1ZE3 D;  5EE1 A;  2D11 A;  5G5H A;  3PHX B;  2JVC A;  4ZYS A;  1ZXH A;  3ZRC A;  1P7F A;  1NEK B;  2WXR A;  4BKS D;  2K8C A;  1YJI A;  5BO4 B;  1VJK A;  1UEL A;  3UF8 A;  2XNA C;  3DWG C;  3AMZ A;  4RMA A;  2MJ3 A;  2O6V A;  2AL3 A;  1V2Y A;  3DHH C;  1KFY B;  3RFZ B;  2WYQ A;  2PW9 A;  2L52 A;  3H7S A;  4GN1 A;  2WDV B;  2XK5 B;  2B76 B;  1V8C A;  2QMT A;  2O6V D;  3ZGZ A;  2DZI A;  5HHD G;  1WYG A;  2N9K A;  1YOV B;  4GDK B;  4GU2 A;  4H2A A;  2CJO A;  2KJH B;  2ACZ B;  1H8C A;  2Z0E B;  2GBK A;  4HVB A;  4MEL A;  4BAX A;  1OQY A;  2YLM A;  2WX1 A;  1C4A A;  3N3K B;  1D5M C;  5JZE B;  2MBO A;  5L95 C;  3DVN U;  1F52 A;  2LHD A;  2C7M B;  2N9E B;  3LJ3 A;  4YL8 A;  1EWY C;  2MBE A;  2L76 A;  1QOF A;  5KHQ A;  2R2O A;  4YT0 B;  4M0W B;  5DPS A;  1WGR A;  2L83 A;  1MJD A;  3IXS A;  4MAC A;  2K6Q A;  3L08 A;  1S1Q B;  2KAC A;  3MJ5 A;  3TSS A;  3ZJT A;  4AUQ C;  4MH8 A;  3VR9 B;  4JX1 C;  4JWS C;  3VH4 B;  3ABV B;  4AS1 A;  4US9 A;  4OVU A;  2CKH B;  1K53 A;  1ZW7 A;  3ML8 A;  1X1M A;  1FMA D;  2JY6 A;  4W9F A;  1WGH A;  4R3D A;  2GLS A;  2LVP A;  1YN5 A;  4EE2 A;  3R7Q A;  1UWM A;  2LXA A;  2BWF A;  3PRZ A;  3TIX A;  1L4Z B;  1I7H A;  2IO0 B;  1E7P B;  2KX3 A;  1KLU D;  4LTU A;  3UQA A;  4NJC A;  2KYW A;  3TEW A;  2ICI A;  3H8H A;  1LFD A;  4IM3 A;  4W9D A;  3CMM B;  1G6J A;  3DBH B;  1CK1 A;  3NZS A;  5IOI A;  2D3A A;  3ZLZ A;  1WSP A;  1IGC A;  3DOW A;  1QQR A;  2SEB D;  4WQM A;  2KC2 A;  4EFO A;  2G45 B;  1OEY J;  1RLF A;  2X38 A;  2PE6 B;  4IKG A;  2AEH A;  1RAX A;  2C9W B;  3ZRF A;  1CZP A;  3BVZ A;  2INN E;  1NYQ A;  4YSY B;  2BGF A;  2KJ6 A;  2KFJ A;  4MJS B;  2WS3 B;  2Y5B B;  4XZ4 A;  1EU3 A;  4IM0 A;  5EE3 A;  4C7Y A;  2Z59 B;  1MHH E;  1SJH D;  4RCO A;  3FKY A;  3AE2 B;  3H7P B;  1WJU A;  3AU5 A;  4KVG B;  3JW0 X;  1TKY A;  3AB5 A;  2M0A A;  3PVL A;  2Y5P A;  1XXG A;  3WAN A;  4NPN A;  5E6J A;  1ET9 A;  2VRR B;  4AWJ A;  3PGE A;  1JWA D;  2LAS A;  2K25 A;  4TV3 A;  1UGJ A;  5IKC M;  4IC7 B;  2NMQ A;  2REX A;  4RGM A;  3NUH B;  1JWS D;  2RR9 A;  3T8M A;  3E56 A;  4TQ1 A;  3BYY B;  4J3O D;  4IW0 A;  2KZR A;  4BKT A;  1E90 A;  2WXK A;  1HTQ A;  2W3S A;  1KRH A;  5D7G A;  2KFK A;  1A70 A;  4NY0 A;  4MSQ B;  1U4A A;  4KV2 A;  1XCQ L;  4BVU C;  3GE3 C;  1JWM D;  2R2Q A;  5HKH A;  5FK9 C;  4TKN A;  4IM2 A;  1WJN A;  4TSS A;  1I4H A;  2MJD A;  5H92 C;  3U52 E;  3IVF A;  5EE9 A;  1PGX A;  2FAZ A;  1L6U A;  2LHE A;  4KZ0 A;  2EMS A;  4EZL A;  2KQS A;  1ZKH A;  3DVN V;  3M62 B;  2KK8 A;  3I63 C;  4P7I A;  3UI3 A;  3ZKJ C;  2MW5 A;  2RSU A;  4XWT A;  1EWC A;  1EO6 A;  1C76 A;  4AOF A;  3NVV A;  2IBI B;  1L2N A;  2GB1 A;  5TSS A;  2J0K A;  4IWP A;  3ZJU A;  5IN7 A;  4NQK E;  3AXC A;  3RUI B;  4P16 A;  2CU3 A;  1R4M B;  3AE5 B;  1N5W A;  4IUM B;  4ZRQ A;  3RUL A;  2MCN B;  4K3C A;  2WU2 B;  2JXX A;  5C3J B;  4NNJ B;  1JWU D;  1SEB D;  4PS7 A;  4EZJ A;  3JSV A;  3QA8 A;  1YJ1 A;  4JGH B;  2QIE B;  3TEZ A;  2D10 A;  2KMC A;  2KTR B;  1MHX A;  4B0M A;  2MA9 B;  3NHE B;  4GOC A;  4ZHO A;  3RNF C;  1E7V A;  1L7Y A;  3RZF A;  3VXW A;  4M01 A;  4L23 A;  4GLS C;  4ARC A;  1V5T A;  3UIO B;  4K7U A;  3OG5 A;  1N60 A;  3SU8 X;  2MBQ A;  4ARI A;  1SB3 C;  2KKC A;  2AWT A;  3Q8C A;  3L0W B;  3AE1 B;  2J7Q B;  3VR8 B;  2LEK A;  3P2B A;  1SBB B;  4DXA B;  1GAQ B;  3IT4 B;  2NBV B;  2LJ5 A;  3V62 A;  3VDZ A;  1FRR A;  2RPQ A;  1K51 A;  2BS2 B;  4WWN A;  3ZW3 A;  2MBB B;  3DVG Y;  2JZ3 B;  2ZCC A;  2Y5C A;  1D5Z C;  2LD9 A;  1QOA A;  5HFY A;  1YQB A;  1ESF A;  3IFW B;  1GPX A;  1WH3 A;  5AZF A;  3W2D A;  3Q3N C;  3NY5 A;  4ZRP A;  3Q2A C;  4DXG A;  4YXD B;  2LGI A;  3WIM A;  3URY A;  1N62 A;  4WJQ A;  3SFD B;  3DBH I;  3KLS X;  1FNV A;  4C56 C;  1IPG A;  2BWE S;  3PRM B;  4B9K A;  2W3R A;  2FCM A;  2BYF A;  4IG7 B;  1P0R A;  2CJN A;  3CIR B;  1XEE A;  2LFI A;  2KDE B;  4DWF A;  3H1U A;  2ZJD A;  2LGX A;  4A6Q A;  1TZ1 A;  5JHA A;  4LNO A;  2JYE A;  2KC1 A;  2HJ8 A;  1PUT A;  1TS2 A;  1YX5 B;  2M0X A;  2N1V A;  4GGQ A;  2N0S B;  1UBQ A;  2QHO A;  1Q0W B;  1HZ5 A;  3L13 A;  2WDQ B;  3A4R A;  1HZ6 A;  3MP9 A;  3TJP A;  4HPM B;  1B9R A;  1NEN B;  2ZEQ A;  4ZRJ A;  2KOX A;  1GC7 A;  2YEP B;  2KDF B;  3A1Q A;  2WDR B;  4MH0 E;  1DOY A;  3L17 A;  4DQO C;  3KQ4 A;  1MPE A;  5AUI A;  1N5X A;  2G9H D;  3MC8 A;  4HEA 1;  4FHK A;  3RZW C;  4RM9 A;  2KDM A;  3Q69 A;  3OWE B;  2ZNV B;  3AE6 B;  4TUU A;  2CR5 A;  4EOY A;  1P9D U;  2NVU I;  3PS6 A;  4OVZ A;  3W1Y A;  4TQ0 A;  1CQV A;  1KLG D;  2IGG A;  3ENE A;  3TBL D;  3O13 A;  3EA6 A;  4II2 B;  4WJO A;  4ZRK A;  1XF5 L;  4WAA A;  1KTK A;  2LGY A;  3ALB A;  3AU4 A;  2ZVO A;  3AEF B;  2GOW A;  2K39 A;  3NZ3 A;  3Q8F A;  4I6N B;  4BFR A;  2PIA A;  1L5P A;  3J9C A;  4CYE A;  5JH5 C;  5EE0 A;  3KVF B;  4OZB A;  4GXB A;  4M02 A;  4NAW B;  1VR9 A;  1L0Y B;  2MRP A;  4NJ6 A;  2NS5 A;  1DOX A;  3DWM A;  2KT7 A;  2CS4 A;  1C9F A;  4RGT A;  1I42 A;  3JVZ X;  2K5P A;  2N7J A;  3D32 A;  3N1Z C;  2WNM A;  2GBN A;  1SGH A;  2WU5 B;  3LDZ E;  2WDT B;  2KAJ A;  2AYO B;  4A90 A;  3NJT A;  1R4M I; 
#chains in the Genus database with same CATH homology
 1M4V A;  1FMA D;  3MFG A;  4LLG M;  4R3D A;  1FFU A;  3B2G A;  3NVZ A;  5C2T B;  2PLP A;  3T3O A;  1F2R C;  1YN5 A;  4EE2 A;  1YQ4 B;  3NS1 A;  1UWM A;  2V3N A;  4IOI E;  1QF6 A;  3PZ8 A;  1F77 A;  4YTN B;  1Y56 A;  1B1Z A;  1L4Z B;  4PT5 A;  2W54 A;  1I7H A;  2WXQ A;  2BYT A;  1ACC A;  3P4R B;  2IPK D;  1RWS A;  2QIL A;  1E7P B;  1KLU D;  1HEZ E;  1XO3 A;  2OHF A;  4LTU A;  4NJC A;  2DYO A;  1ZXI A;  3MHZ A;  1I4X A;  3TEW A;  2ICI A;  2M56 B;  1JCK B;  3H8H A;  4KGR A;  2JX5 A;  1YQ3 B;  3RPF C;  3BVM A;  2FBW B;  3FIL A;  3FAH A;  3P42 A;  2BB5 A;  1CK1 A;  1I4Q A;  1C78 A;  3PO0 A;  1WSP A;  1IGC A;  4WAF A;  3AN1 A;  1QQR A;  1TS3 A;  1UWX A;  2SEB D;  4WQM A;  3TEY A;  1JWB D;  3E9S A;  5JXV A;  1OFF A;  2X38 A;  1HXY D;  4IKG A;  1K52 A;  2PVG C;  3W1S A;  3LXF A;  1R7S A;  3C8Y A;  1ZDX A;  1CJE A;  5I4D A;  1RFK A;  2ONQ A;  4C80 A;  1TKG A;  1CZP A;  2JSV X;  3BVZ A;  2INN E;  1NYQ A;  3CWI A;  3Q8A A;  4RGO S;  1QT9 A;  4YSY B;  4KKJ A;  4DXF A;  2KN4 A;  1JAL A;  4P6V F;  3N9Y C;  1XCT L;  1N63 A;  3NVW A;  4A8X C;  2WS3 B;  1EU3 A;  2PMV A;  4WIP A;  3L4P A;  2XN9 C;  2LJI A;  3LYY A;  1MVK A;  5EE3 A;  4ITK A;  4L1B A;  3P1M A;  1FRD A;  3VRB B;  4C7Y A;  2BS3 B;  2JXT A;  1MHH E;  1SJH D;  4RCO A;  1SF0 A;  4CQN A;  3ZYY X;  3AE2 B;  3BK1 A;  1C79 A;  1QKZ A;  1XLO A;  1WWT A;  4HRO A;  2EEL A;  1TKY A;  1FEH A;  3AB5 A;  2M0A A;  1IBX A;  2Y5P A;  1XXG A;  2WXG A;  1GOZ A;  1VZ7 A;  5FR3 A;  2L1A A;  1VRA B;  1D6E C;  5E6J A;  1FNU A;  1ET9 A;  2K0P A;  4A9A A;  2JU6 X;  1JWA D;  1YJJ A;  1V1P B;  1UGJ A;  1ZP0 B;  2J4X A;  2NMQ A;  1C77 A;  1BUI C;  3NUH B;  2HDE A;  4RGM A;  3IT6 B;  2E3T A;  1E9M A;  1JWS D;  1XLN A;  1SIJ A;  1YN4 A;  1FCL A;  3EGR A;  3E56 A;  5T8I A;  3KWV A;  3BYY B;  4TQ1 A;  4J3O D;  3AED B;  3W9C B;  2H88 B;  2KMM A;  3R2I A;  2AX5 A;  2JWU A;  2WXK A;  5HG2 A;  1SXT A;  2W3S A;  1KRH A;  1ENF A;  5D7G A;  4KKI A;  1A70 A;  1DOI A;  2PKO A;  1XCQ L;  3AE4 B;  1EM7 A;  2ZW1 A;  3AV8 A;  3U4E G;  1NVI D;  1NYR A;  1JWM D;  5FK9 C;  4NAM A;  1TJE A;  1ET6 A;  1I4H A;  1ROE A;  4TSS A;  2MJD A;  1XLQ A;  2K3U A;  1FNW A;  4YSX B;  5H92 C;  3U52 E;  5EE9 A;  1PGX A;  2WXJ A;  1L6U A;  1LO5 D;  4RGN A;  1JRP A;  2LHE A;  2INP E;  1TZO A;  3VQI A;  2V3P A;  4C7Z A;  4ZOH C;  3AEB B;  4WH4 A;  1GB1 A;  3WCQ A;  3AE9 B;  2G1E A;  2D5G A;  3U2S C;  3UI3 A;  3AEE B;  4XWT A;  1EWC A;  4USA A;  1DYQ A;  1C76 A;  2Z8L A;  3BYT B;  4WWM A;  2AQ1 B;  2M19 A;  1P7E A;  3NVV A;  2DBY A;  3BWU D;  2GB1 A;  5TSS A;  3NVY A;  3ZJU A;  3B2F A;  1JQ4 A;  1BXT A;  1AWD A;  2V0G A;  2BB6 A;  4OW0 A;  1Q10 A;  1STE A;  1SSN A;  4FXC A;  3NRZ A;  4P16 A;  2CU3 A;  3AE5 B;  1J7B A;  2VZK B;  1N5W A;  1PGA A;  1UUP A;  4ZRQ A;  4HKQ A;  5GXG B;  2I38 A;  1ZPS A;  2WU2 B;  5C3J B;  4JPS A;  4XDD A;  1JWU D;  1SEB D;  3V3X A;  1SJE D;  3EUB 2;  3ETR A;  3TEZ A;  2QIE B;  3GP7 A;  1VZ8 A;  4RF1 A;  1PGB A;  2QSD A;  4YTM B;  1T3Q A;  4M0W A;  1MHX A;  4B0M A;  1SE2 A;  2ON8 A;  1V1P A;  5G5G A;  3W5V B;  1GB4 A;  2EKI A;  2K9X A;  4ZHO A;  2OED A;  1AYF A;  4L2Y A;  2BW2 A;  3MC0 B;  2DWQ A;  4L23 A;  1V1O A;  4HKZ E;  3W5U B;  4GLS C;  1FFV A;  1L4D B;  1VDV A;  4ARC A;  2WQY B;  2WXP A;  1J7A A;  3VRA B;  3V05 A;  3Q8E A;  3I9V 1;  4HJG E;  1TS5 A;  3AEA B;  4RF0 A;  2JZP A;  1F0Z A;  2PTL A;  2BBC A;  1E10 A;  2RDG A;  3GB1 A;  3I57 A;  1N60 A;  1J7C A;  4ARI A;  1WGK A;  1SB3 C;  1RYJ A;  2KQ4 X;  4XWW A;  2LMC A;  4OZA A;  3Q8C A;  5BYQ A;  5FKA C;  3AE1 B;  3VR8 B;  4D2K A;  2LEK A;  3AEG B;  1SBB B;  1I4G A;  1UNS A;  1GAQ B;  2WXO A;  4B0E A;  3IT4 B;  1OQQ A;  1E6E B;  2ZW0 A;  4REZ A;  4JWU C;  2JQR B;  3AE8 B;  1FRR A;  1N61 A;  4XDC A;  1K51 A;  2BS2 B;  3P4S B;  4RFB A;  2YEP F;  1I4R A;  3FC4 A;  1D4B A;  1JRO A;  4JE3 B;  1WXQ A;  4XE0 A;  2R61 A;  4AQ7 A;  2N9L A;  3T3N A;  2I2Y A;  1E0Z A;  4OHJ A;  5D3I B;  1IUE A;  2RDH A;  4MM3 B;  1L6V A;  2Y5C A;  2HTM E;  1D5Z C;  1RM6 C;  1BML C;  2BTE A;  1FXI A;  1AN8 A;  1QOA A;  5HFY A;  1PYW D;  1L0V B;  2WXF A;  1ESF A;  3Q8B A;  1OQR A;  4YTP B;  1QOB A;  3P4Q B;  1JML A;  1KH0 A;  1V97 A;  1GPX A;  1PDX A;  3W2D A;  2E6X A;  2L32 A;  1MI0 A;  4IDI A;  2FE8 A;  4RNA A;  4ZRP A;  4KGS A;  4DXG A;  2JYT A;  4YXD B;  3B9J A;  1FD6 A;  2WXL A;  2LGI A;  2H89 B;  1EU4 A;  2J52 A;  1T5X D;  1YNT E;  1C4P A;  3R2T A;  1HQR D;  2J53 A;  2NTS A;  2W55 A;  3HVD A;  3URY A;  1FXA A;  3LB8 C;  1N62 A;  3SFD B;  3TUO A;  3P63 A;  4LK0 M;  2SAK A;  1C4C A;  2AQ2 B;  3KLS X;  2GRI A;  1FNV A;  2TSS A;  4C56 C;  1IBX B;  1KF6 B;  4NZL B;  2VZK D;  3IAS 1;  1PFD A;  4N59 A;  1XLP A;  1IGD A;  1SE3 A;  2W3R A;  4A55 A;  1QLB B;  1TKE A;  2WP9 B;  4O1N A;  1K50 A;  1VLB A;  2W82 A;  2QJL A;  4Q2J A;  2LUM A;  2CJN A;  1XEE A;  2IJ0 A;  2LFI A;  2Q5W D;  3CIR B;  1F2R I;  3IAM 1;  2GI9 A;  2K22 A;  4KX6 B;  4TMA B;  4A6Q A;  3TEX A;  3AH7 A;  4OZC A;  5LNK 1;  2JYE A;  2MH7 A;  5BMH A;  4KGT A;  3AM9 A;  1ZDV A;  1PUT A;  1TS2 A;  4YSZ B;  4US8 A;  2N0S B;  1TY0 A;  2Y3A A;  3P4P B;  2KWD A;  1WRI A;  3HVZ A;  4RH6 A;  1HZ5 A;  1HA5 A;  2WDQ B;  1FO4 A;  1JW9 D;  2DYM A;  1FCC C;  3GS2 A;  1HZ6 A;  3MP9 A;  1ZE3 D;  5EE1 A;  5G5H A;  4GDL B;  3U7Z A;  3BK2 A;  1B9R A;  1ZOY B;  1TS4 A;  4ZYS A;  1ZXH A;  1NEN B;  1ZUD 2;  1P7F A;  1SE4 A;  3HRD D;  1NEK B;  2IGD A;  2WXR A;  1NI3 A;  1YJI A;  5AUK A;  1VJK A;  2FUG 1;  2YEP B;  2RPV A;  3SFE B;  2DLB A;  2MEK A;  2XNA C;  2WLB A;  2WDR B;  3DWG C;  1TYG B;  2WXI A;  2BT6 A;  1DOY A;  3AMZ A;  4DQO C;  3KQ4 A;  1MPE A;  5AUI A;  2MJ3 A;  1N5X A;  2G9H D;  4HEA 1;  3BII D;  2RMM A;  1KFY B;  3RFZ B;  2PW9 A;  2L52 A;  2KDM A;  2WDV B;  4ZHP A;  2NTT A;  3Q69 A;  3AEC B;  3AE6 B;  3OWE B;  5BYS A;  2B76 B;  1V8C A;  4OVZ A;  4TQ0 A;  1CQV A;  1KLG D;  2PVO D;  2WXN A;  3AE3 B;  5HI1 A;  2IGG A;  2QMT A;  1DGJ A;  3ZGZ A;  3O13 A;  3EA6 A;  3FIL B;  1TY2 A;  5HHD G;  1YN3 A;  1WYG A;  2N9K A;  1XF5 L;  4GDK B;  1KTK A;  4H2A A;  2CJO A;  4HRS A;  3HUI A;  2ACZ B;  4YWG G;  3AEF B;  5BYR A;  3ZQ4 A;  3PZ7 A;  1C4A A;  4N58 A;  5D3D A;  2IGH A;  1I4P A;  3NZ3 A;  3Q8F A;  2QEJ C;  1L0X B;  2J42 A;  5H8Y E;  3R8B A;  1D5M C;  4N6E B;  2PIA A;  3KWL A;  1L5P A;  3J9C A;  4WUR A;  1QIL A;  2LHD A;  3AE7 B;  3BZD B;  5EE0 A;  4OZB A;  1EWY C;  1YMH E;  4NAW B;  1QOF A;  1VR9 A;  2MJE A;  1L0Y B;  4YT0 B;  5MPO A;  2L83 A;  3IXS A;  4MAC A;  2BS4 B;  3BVG A;  1DOX A;  3DWM A;  4MT5 A;  2V4I B;  2WXM A;  1VZ6 A;  2KAC A;  1C9F A;  1QOG A;  4RGT A;  3MJ5 A;  5BMI A;  1FIQ A;  5BMG A;  2K5P A;  2N7J A;  3TSS A;  2WNM A;  3ZJT A;  2WU5 B;  2WXH A;  4MH8 A;  2IDY A;  1FM0 D;  3VR9 B;  1AW7 A;  2KAJ A;  3SR6 A;  4JX1 C;  4JWS C;  3ABV B;  4AS1 A;  4A90 A;  2AQ3 B;  4UDU C;  1T6B X;  4US9 A;  3ZJV A;  3SEB A;  1K53 A;  1D5X C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...