3AV8A

Refined structure of plant-type [2fe-2s] ferredoxin i from aphanothece sacrum at 1.46 a resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
97
structure length
97
Chain Sequence
b'ASYKVTLKTPDGDNVITVPDDEYILDVAEEQGLDLPYSCRAGACSTCAGKLVSGPAPDQSDQSFLDDDQIQAGYILTCVAYPTGDCVIETHKEEALY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-1
publication title Mapping of protein-protein interaction sites in the plant-type [2Fe-2S] ferredoxin.
pubmed doi rcsb
source organism Aphanothece sacrum
molecule tags Electron transport
total genus 25
structure length 97
sequence length 97
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3av8A00
3AH7A 1QF6A 3W5VB 1FM0D 1GAQB 2FBWB 2MJEA 3ETRA 5EE0A 3AE5B 3ZYYX 3P4QB 4WQMA 1J7AA 3AV8A 3HVZA 1JWBD 1L0VB 1FRRA 2QIEB 2BS2B 4USAA 1N60A 4C7YA 1TKEA 1YJJA 1F0ZA 1JWAD 1QOGA 3HUIA 1VLBA 3EUB2 2ACZB 1TKYA 2MH7A 4ZHOA 2N0SB 4N58A 4YTNB 1ZOYB 1NI3A 3P4SB 4YSZB 1CJEA 1RYJA 3AMZA 1PDXA 4US8A 4IDIA 5C3JB 1EWYC 1DOIA 2DBYA 2PKOA 3AEFB 1XLQA 3AE7B 1JQ4A 1N5WA 1KF6B 1PUTA 3B2GA 2K5PA 1FXAA 1N62A 5EE3A 1NYRA 3FC4A 1FIQA 1JROA 3AE6B 5G5HA 5EE9A 4N6EB 5AUKA 1IUEA 1WXQA 3W9CB 3PO0A 4YTMB 4LTUA 1L6VA 3RPFC 2B76B 1RWSA 2Y5CA 3NS1A 5H92C 1N63A 1PFDA 2E3TA 3AE3B 2W3RA 1VDVA 1N5XA 2M56B 2MJDA 3NVZA 4ITKA 3VRAB 2BT6A 3DWMA 3P4RB 4YSYB 4US9A 1N61A 1XLOA 3VR8B 2JQRB 4YSXB 2HTME 1WWTA 3AN1A 2H88B 2WU2B 3NVYA 4JWSC 1TYGB 1XLPA 3W5UB 1SB3C 2WP9B 3CIRB 3SFEB 1XO3A 4JWUC 1WGKA 2WQYB 1WYGA 4YTPB 1ZP0B 1KRHA 5G5GA 1XLNA 3KWLA 3DWGC 2WDVB 3FAHA 3P4PB 2EKIA 3AE8B 4YXDB 2JX5A 2K22A 3LB8C 2PIAA 2M19A 1ZUD2 3B2FA 2WU5B 2OHFA 3NRZA 1KFYB 4C80A 3AEEB 3L4PA 1V97A 1DOYA 1QOBA 2BS4B 1JALA 3B9JA 1QLBB 1E0ZA 5AUIA 4WWMA 1FFUA 4ZOHC 1WRIA 3BIID 1E6EB 1QOAA 4ZHPA 1SIJA 3VR9B 1T3QA 2G1EA 1L6UA 4YT0B 1J7CA 1RM6C 1TJEA 1DOXA 2AX5A 1AYFA 2W3SA 1FMAD 1FRDA 1YQ3B 2DWQA 4HRSA 1AWDA 4JX1C 2KAJA 1SF0A 2CU3A 4FXCA 1YJIA 2L52A 5H8YE 4A9AA 1R7SA 3AE4B 1FFVA 3P63A 3AECB 1I7HA 1YQ4B 3AB5A 1FXIA 3VRBB 5GXGB 1CZPA 1E7PB 2KMMA 1RFKA 1L5PA 2BS3B 2QJLA 1NVID 1TKGA 3AEBB 3LXFA 3NVVA 3AE9B 2CJNA 3CWIA 1DGJA 5EE1A 1A70A 2WDRB 1V8CA 3AM9A 1FO4A 3AEDB 2WDQB 2W55A 4C7ZA 3AEAB 2WLBA 3SR6A 1QT9A 2PVOD 2PVGC 1B9RA 1NEKB 1JW9D 4KX6B 1GPXA 1NENB 1OQRA 2MJ3A 1QOFA 1VJKA 3NVWA 3P1MA 2H89B 2K9XA 5C2TB 1NYQA 2LEKA 3AE2B 3AEGB 5MPOA 1E10A 1JRPA 1ZXIA 1OQQA 2CJOA 3AE1B 1ROEA 3ABVB 4HROA 2WS3B 1OFFA 1UWMA 2W54A 4P6VF 3HRDD 3WCQA 2L83A 4N59A 3SFDB 1J7BA 1E9MA 2Q5WD
chains in the Genus database with same CATH superfamily
2D10A 4TMAB 2G45B 1JWBD 4P7IA 4ICVA 2BS2B 1YOVB 3DBHB 4OVUA 4J6IA 4YTNB 2KTFA 4NZLB 5D2MB 3S2AA 3M3JA 1F2RI 1Z5SB 1E8ZA 3Q3FA 2N9KA 1V6EA 2IDYA 2DNFA 4WJNA 5C23A 1C77A 2LZ6A 4C56C 2JZPA 3QIJA 5IKCM 2KLCA 4AUQC 3VRAB 1ESFA 1BMLC 1EUVB 1MG4A 4DWFA 4US9A 1N61A 2MLBA 1K8RB 2D3GA 3VAWA 4JWSC 2D3CA 2LUEA 4NJ7A 3BVZA 1EU4A 1KRHA 1KLGD 1JMLA 2EKIA 3WAPA 3UF8A 2NS5A 3ZQ4A 4C80A 2NBVB 1XCQL 2KMCA 3TUOA 2KYWA 3CMMB 5FR3A 3DBRI 4URKA 1ET9A 2I38A 2PLPA 1V86A 1WXMA 2OJRA 4FHJA 3DCGA 2LHEA 4KGRA 2FNJB 2KO3A 4II2B 2INCC 2R2QA 3P63A 1L4ZB 1L5PA 4M0WA 3NVVA 3NZUA 2XEWA 2BYEA 4P16A 3ML8A 2ZVNA 1GJZA 3SR6A 4JL9A 1P9DU 2MJ3A 5C2TB 2KFJA 4Q2JA 5MPOA 2DZKA 4S0RA 1I4RA 2CR5A 5E6OA 3SFDB 3M95A 2I1KA 1ISNA 2Q5WD 1D3ZA 2IJ0A 3KQ4A 2K8HA 1IBXB 1SBBB 3SHQA 2HDEA 2BTEA 1J8CA 4DBGA 4BVUC 1TY0A 5KHOA 2WXMA 1SE9A 4IW0A 3TEWA 2FCQA 4NQLB 1CJEA 1TTNA 1EWYC 1DOIA 2PKOA 4XGAB 4MDKE 2HE7A 4K7UA 3AE6B 1FPYA 2V0GA 2IPKD 3PTFC 1Q1OA 4ZRJA 4LTUA 3V3XA 2B76B 4YWGG 3OLMD 2BYFA 2IO1B 2M56B 2L7RA 2MRPA 1XLOA 3R8BA 4RF1A 2ZZPB 3ZXRA 4K7WA 1CQVA 4JWUC 1WYGA 4HCPB 2L00B 3TJPA 2MCNB 2M19A 4ZYSA 2FUHB 4HLEA 1DOYA 4S17A 5GMVA 3IAM1 1SE2A 4TV3A 5AUIA 4ZOHC 1R4NI 1MI0A 3GS2A 1WM2A 1V5TA 1K51A 3V6CB 1OGWA 1WJUA 4LDTD 2BKRB 1I7HA 3AB5A 5J17A 1ET6A 1FD6A 1TKGA 2XBBC 3B0AA 2GRIA 3QWZB 4KIKA 1UELA 2QMTA 1LM8B 2LGSA 1D5ZC 3B1LX 3O13A 2PVOD 4KX6B 5IOIA 1QOFA 3NVWA 1NDDA 4JGHB 3U7ZA 3DBLI 4FBJB 1M94A 1ENFA 1ROEA 3V61A 3JSVB 1UBQA 1J7BA 4IM2A 1SSNA 2BYTA 5TR5A 2JY6A 3KYDD 1V81A 2MP2A 3RI7C 1LQBA 1RAXA 1WF9A 3EUB2 2ACZB 2L0TA 1WI0A 4DQOC 1J19A 2K0PA 2I1JA 3NJTA 4DXGA 3BK2A 3A9JA 4K3CA 1N5WA 3X0WA 4W9HA 2UWQA 3ZGZA 4WJOA 4X57B 3ZKJC 1YQBA 2KFKB 4AP4C 3MC9A 2N9LA 1EU3A 2K6DB 4NNJB 3L10B 4W9LA 1TZOA 2V4IB 2KJ6A 3Q3JA 3KYCD 1XO3A 1C76A 3R7RA 2M4NA 4KKIA 1HTOA 1D6EC 2IY1B 1HZ5A 2KQ7A 3ZRCA 1I4GA 3LB8C 1STEA 4DHJD 2BS4B 3UIPB 1RFAA 1ZDVA 1FFUA 2JYEA 4BOSC 1SIJA 4WURA 1J7CA 4LJPB 4XWTA 4IG7B 1PQSA 4BOZB 3EFCA 1AWDA 4BFRA 2LHDA 1WFYA 1X1MA 1VR9A 3VRBB 2MWSB 4EZKA 5TSSA 1G6JA 2D07B 1SEBD 3DBRB 3HK0A 4ZRIA 2MQJA 4C7ZA 2DENB 3MHSD 2Y3AA 3PLUA 1OQRA 2HJ8A 1VJKA 3P1MA 2A5UA 3RNAC 1NYQA 3NG0A 2UYZB 3P42A 2M8SA 3PS6A 3K9PB 3DDCB 2WXRA 1LXDA 3ZLZA 1QF6A 4CHKA 3K9OB 2AWTA 5BYSA 4XYCA 3Q3MC 3RZWC 1SXTA 4XX5A 1NI2A 2GMIC 3UQAA 1SE4A 1TKYA 2WDTB 3MJWA 3RMKC 3VH4B 1XLQA 4GB9A 4WJPA 1JWMD 1WX9A 2CKHB 5EE3A 2IGGA 4N6EB 1MFWA 2JZ3B 4BZAA 1IBXA 2ICIA 3PSEB 2BVCA 1C4PA 4YSXB 4FADA 2N9XA 1M4VA 3URYA 1TYGB 4MGKE 2WP9B 3H7PB 4YTPB 3WAMA 4O1NA 3QHTA 3MP9A 4ANVA 2WXQA 3L4PA 2KDEB 4BKSD 5G55A 3PRZA 3BYTB 3C19A 4YT0B 2WX1A 2BGFA 3W1YA 3PPAA 4KZ0A 2KAJA 2GBRA 2OOBB 5IN7A 2WXJA 1R4NB 2W55A 1C4CA 4HJGE 3AEAB 2JYTA 1SIFA 1MHXA 1AW7A 1KLUD 1D4BA 4HDQA 4JIOU 3AE2B 1JRPA 2N9PC 2CJOA 2VH2A 4MGIE 3QQ8B 4OHJA 1VZ8A 2FUG1 4LNOA 2MHJA 3APFA 3HVZA 1MPEA 3SD5A 2D3AA 1YJJA 2IY0B 4MSMB 3DBLB 3DHHC 4TUUA 4GU2A 1PGAA 2ZVOA 2LVPA 4FA6A 3QA8A 1JRUA 2AL3A 1P7FA 3JSVA 1WXAA 1TT5B 4DDGD 3RZFA 1J0GA 4P1CC 3V05A 3U52E 4YTMB 3GB1A 4D2KA 2J42A 3DVNU 2JU6X 3ZRFA 3ZTCA 3VR8B 3VUWA 2JQRB 3T3OA 3RN9C 5DCNA 3W5UB 4XDDA 3SFEB 1EM7A 4W9JA 5G5GA 1UUPA 3RNFC 3ZNZB 1HA5A 1E7UA 1KFYB 2ZEQA 1JALA 2ONQA 2KFKA 2MBQA 2AQ1B 1QOAA 3N1YC 1E5WA 5HHDG 5D6JB 2V3SA 1RM6C 1TJEA 3ZVVA 3BY4B 3NUHB 4NAMA 1WJ4A 2KTRB 2DWQA 2Y5PA 4FXCA 2O6VD 5I4DA 3NOBA 3TBLD 2G9HD 1GNUA 1KJTA 3JYUA 3AM9A 5BMIA 2BQQA 4G0NB 1P7EA 2WGSA 2KX0A 1U4AA 2WLBA 4KGSA 1NENB 4IWOA 2JXTA 1E7VA 4FN2A 4OZCA 2KNBA 3JVZX 3WCQA 4K1RB 4NQKE 1YN5A 3HM6X 4IM0A 4MT5A 4B0MA 4BKTA 5DPTA 4WQMA 2KD0A 2Z0EB 5KHQA 3MC8A 2E6XA 1FRRA 1HE8A 4ZRKA 4IUMB 1ZOYB 5LXHA 1WE6A 5C3JB 2EMSA 1JQ4A 4W9IA 1HTQA 2KN5A 4ZYNA 2K5PA 1WJNA 2WXPA 3EGRA 2KMAA 1FIQA 2AQ2B 2PTLA 5BMHA 3V6EB 1RWSA 2MW5A 2JRIB 1VDVA 2K8CA 3DWMA 2INPE 1WWTA 4GLSC 2WXFA 2ZPNA 3P2BA 2WQYB 3LJ3A 2KANA 5CHVC 3TEYA 2M17A 3IXSA 1WJ6A 3Q8FA 1P98A 3NRZA 2LVQA 2XNAC 4WWMA 2O2VB 3BIID 4OZBA 3ZNHB 1XEEA 3PV1A 2ZCBA 4A8XC 1WGDA 3MJ5A 3H7PA 4RM9A 2GB1A 3U7DA 2KQ4X 1L2NA 4EUTA 1V8CA 3ZW3A 4PK1A 2WXNA 4ARCA 2DZIA 1B9RA 1JW9D 4LLGM 2FCNA 4HKZE 5CHWA 4NY0A 4W9DA 3AI5A 2KDIA 4RF0A 3JW0X 2K39A 2G4SA 1SE3A 4A3OA 3AV8A 3GZNI 2EKEC 5LNK1 1IP9A 1V9JA 3H9DA 2MBOA 3BYYB 1VLBA 3Q69A 4FLHA 2KDMA 4N58A 2IYDB 1TBEA 4IDIA 4RFBA 2LJ5A 1KF6B 2KWVB 2KC2A 1D5MC 3PLVA 3FC4A 2ZNVC 3NHEB 4B9KA 1WXQA 1VZ7A 2SAKA 4M02A 3L16A 1PFDA 5LXIB 1D5XC 4PS7A 1WGHA 2RDGA 4YSYB 2W82A 4G50A 1KH0A 1Q5WB 3PREA 4W9KA 3TL5A 2JZZA 2LGIA 1C1YB 1XLNA 4ANUA 3AE8B 4YXDB 2K22A 3J9CA 1B1ZA 1ZUD2 3HHMA 2JWZA 1VRAB 5DPSA 1E0ZA 1WR6E 4PT5A 3PRMB 4C00A 1L0YB 3R7QA 3N30A 2CU1A 4CO7A 3HIZA 1N6ZA 4KSKC 5HG2A 1HZ6A 2WYQA 2RSUA 3W1SC 2W3SA 2D5GA 2IGHA 4F8CB 1AARA 1FXIA 2BS3B 2L32A 4H2AA 4KZCA 1FO4A 3KUCB 1WY8A 4B6WA 2H89B 2R61A 1CMXB 4AS1A 2MEKA 4HROA 2KTRA 2WS3B 2W54A 4MEMA 2QILA 5HKHA 4IWPA 2FBWB 2MJEA 5T8IA 3ETRA 2G4DB 3TIXA 3EECA 3VTUA 1L0VB 1N60A 4AQ7A 4G11A 3DQVA 4EE2A 3KUZA 3A33B 1GB1A 4REZA 2X38A 3H8HA 2DBYA 5BMGA 4GDKB 3KWVA 2MBHA 4WWPA 1IGDA 2FCMA 1JROA 2N7JA 1IUEA 3PO0A 2BB6A 1IPGA 2N1WA 2Z0DB 3NZ3A 2KACA 1MVKA 4ARIA 2Z59B 5BO4B 4AWJA 1I42A 2INDC 2DLBA 4HKQA 3ZJVA 3DOWA 3DWGC 2RDBC 3FAHA 5AEKB 2BWES 1WYWB 2LASA 2JRHA 2OHFA 4KDIC 1YJ1A 2FCSA 2NBUA 1YMHE 3ZJTA 3PHWB 3R2IA 3VR9B 2G1EA 2WX0A 1OEYA 3H7SA 2EMTA 1YJIA 4UDUC 3PZDA 3AECB 4G3XB 2DX5B 1UGMA 5GXGB 3ML9A 3R2TA 3QX1A 3ZNID 1BT0A 4LNNA 2O2VA 3E9SA 2LMCA 3DVNV 3BVGA 4II3B 4M8MA 3APCA 3Q3OC 1ZXIA 3AE1B 3ABVB 4TSSA 1IGCA 2KDBA 3HRDD 2JSVX 4HEA1 3N1XC 3N9YC 5CX3A 1F9JA 4K3BA 2R2OA 2M0AA 1MHHE 4TQ1A 5J2RA 5JZEB 2YEPF 2KHWB 3DVGX 3A1QB 5HFYA 4HPLB 2MH7A 4KV2A 3VVWB 3W1SA 2MBBB 1T0QC 3AMZA 3IBEA 4RH6A 2GBNA 4XE0A 3VH3B 3B2GA 3N20C 4RNAA 3GZNB 4LCDE 2C7NB 3Q8AA 2RR9A 3RPFC 3RNCC 3NS1A 1WSPA 2KJRA 1WXSA 2IBIB 4ITKA 3RULA 1JWUD 2BT6A 1QILA 1WMHB 1XD3B 2WU2B 3NVYA 1XCTL 4E71A 5D7GA 2KQSA 3D32A 2BBCA 2D3BA 4M01A 4HWIB 1BUIC 2KK8A 2WXIA 2ZJDA 1YD8U 3L13A 4K81A 1WR1A 4P1BC 2FIFA 4BKSA 4N9F4 1VCBA 3B9JA 4KVGB 2PE6B 4LK0M 3RD2A 2J0MA 3TCAA 2PEAA 3W2DA 2B3AA 1UNSA 2VH1A 3I5JC 2L76A 4K7SA 5C1ZA 4HRSA 3TEZA 3QARA 2J4XA 1WX7A 3WIMA 3AEBB 4WAAA 1NVID 4WAFA 1L7YA 3AE9B 1YN4A 3CWIA 3VXWA 1TZ1A 1MG8A 3AEDB 2WDQB 4A20A 4TKNA 1QT9A 2V1YA 5BYQA 3SDLC 3T3NA 4HPPA 1Q0WB 3UQBA 1XT9B 2HJ1A 3X23A 4GXBA 1WGRA 3R66C 1WE7A 4W9CA 1PYWD 1WZ3A 4TQ0A 3W5VB 3RYTA 3VUYA 3AE5B 1J7AA 4WJQA 2K6QA 3RNEC 1V1OA 1I4XA 5IP4D 1GG3A 1R4MB 1BXTA 3Q8EA 3L54A 3ZO5B 4ZHOA 4AJWA 3PHXB 2QSDA 4RM8A 1RYJA 2NVUI 2W9NA 3RUIB 1FNWA 2DYBA 3L08A 1TS2A 1E90A 1L6VA 3WANA 4WWOA 3BZDB 3NVZA 4MGZE 4I6NB 4E74A 4MJSB 2KWCA 2H88B 3PGEA 1YN3A 2V4LA 4HPMB 4GDKA 2JF5A 1T5XD 3N3KB 4KGTA 1C3TA 2WU5B 4FHKA 1E8YA 3IVFA 2DYOA 1TS5A 2JUOA 3Q6BA 2KWDA 2XK5A 3N32A 4LDTB 1FMAD 2O6VA 2HTHA 2D11A 4OW0A 4C4VB 1HQRD 1K50A 3OAWA 3KUDB 5IAAC 3N1ZC 1I4HA 4QAYA 1DGJA 2PE9A 5EE1A 2KZRA 4W9FA 1E8WA 2KC1A 5E6NA 1NEKB 2M0XA 3AEGB 1FXTB 3VUXA 1C79A 3AH7A 2J7QB 3GP7A 5E6JA 2INNE 2IO0B 2QCZA 1TS4A 3ONSA 1QOGA 1FCLA 3I9V1 1KLVA 1I4QA 1I4PA 1TY2A 2NCNA 4YSZB 2LRWA 3RNGC 3AE7B 3C0RB 1KTKA 4EEWA 2GBKA 1WM3A 3FILB 1HEZE 4HK2A 3C8YA 2PPHA 3ENEA 3A1QA 3RFZB 3AN1A 1SGHA 2WXOA 4KKJA 2LGDA 4BKGA 1Z2MA 1WRDB 2LVOA 3CIRB 2KDFB 4RGMA 1GOZA 4LNKA 1ZW7A 1PGBA 2QEJC 4DHJB 2JX5A 3IAS1 1FNVA 2N1VA 3B2FA 2WXKA 2KN4A 3AEEB 2D2QA 1V97A 2OEDA 4MELA 2RD0A 1QLBB 1WRIA 4DDID 2N7DA 1QKZA 4WH4A 1WMHA 4B0EA 3IG3A 3ZDMC 3Q3NC 1V49A 5FR6A 2KVZA 3H1UA 4KSLC 3TEXA 1JCKB 3U2SC 2ZNVB 1FFVA 2GBMA 2IO3B 4JE3B 3UGBB 3LXFA 3HVDA 2WDRB 4RCOA 2DYMA 2C7HA 2LI5A 4MM3B 2DHZA 3OJ3A 1ZXHA 4L2YA 1YX5B 3AU5A 1LO5D 2DZMA 2DZJA 4JQWC 3IT4B 2L05A 5FKAC 4J3OD 1FM0D 1F52A 1GAQB 4L23A 2JT4B 3IFWB 2WWZA 4FJYA 3UI3A 2QIEB 1YX6B 4C7YA 1TKEA 1LFDA 1JWAD 1FNUA 3HUIA 4OVZA 4EFOA 3I63C 2N0SB 3R3MA 4ASWC 3QCAA 3CSTA 4I6PA 3VTWA 3AEFB 3ZXVA 3DHIC 3DBSA 5JH5C 2N7EA 3PZ8A 2VZKD 1T0YA 3NZSA 2WXGA 3RT3B 4HJKA 3DHGC 1V1PA 3AE3B 4ZRPA 3IHPC 2QC8A 3BK1A 1XF5L 3ZIMA 2DAFA 2PMVA 1EO6A 1MJDA 2K8BA 4EKUA 2GBJA 4MACA 4EZJA 1SJHD 1WGKA 2BB5A 4ACFA 2HD5B 2LGYA 2WDVB 1EF5A 4PS3A 2RPQA 2QDFA 3EC8A 4NAWB 1XXGA 5L83A 2IGDA 3ZTDA 4MJSA 1OQYA 4GGQA 5FK9C 1UBIA 1ZDXA 1FRDA 1YQ3B 3WA0A 2FE8A 4MH8A 1R7SA 1TS3A 2IZVB 1EWCA 2L8JA 2X8XX 4IC7B 3BVMA 5BYRA 2J0JA 3OWEB 1A70A 1C9FA 1WH3A 2BKFA 4CYEA 1IYFA 5L95C 1ACCA 2V9HA 3MTNB 5AZHA 2AL6A 3L17A 4AJYB 3M62B 3KH0A 2NMQA 2LEKA 2J0KA 3OG5A 2M1MA 1P1AA 1UWMA 4N59A 4C4VA 2JPHA 4I6LB 3H6NA 3ZYYX 3GE8C 1I35A 2BYVE 4JPSA 1VD2A 1A5RA 1C78A 2LJIA 3O65B 3EFUA 3B08A 1R4MI 2REXA 4CQNA 4LNFA 3A9KB 4RGNA 3AXCA 2K3UA 1FXAA 3T8MA 4WQOB 5G5HA 5EE9A 3W9CB 1K52A 2L0FA 5H92C 3ZDTA 3CSFA 1YNTE 4OZAA 3Q14C 2JXXA 2MJDA 4PYUA 4M00A 3WAOA 4LNIA 3Q2AC 4ZDVA 5JHBA 1SB3C 1V5OA 1XQQA 4YL8A 3FILA 1ZGUB 2ZW1A 4DXFA 3P4PB 4HCNB 2KVRA 2PIAA 3BWUD 2RPVA 4GDLB 3A4SC 3LDZE 5D3IB 1E6EB 3PVLA 1UH6A 2ASQA 3QJZA 5E6PA 1QZEA 2XK5B 2AX5A 1Q10A 1AYFA 2LUMA 1WGYA 2O6VB 4AOFA 4W9GA 2CU3A 3TMPB 1L0XB 2L52A 1WXVA 4IWQA 1L4DB 1E7PB 2KMMA 3RCZA 2V3NA 3MFGA 3V60A 2PW9A 4HVBA 2DAJA 1OEYJ 1OQQA 3ZNGC 2LGXA 2WNMA 5LLIA 4P6VF 4KDLB 5D3DA 1TGZB 1E9MA 2IO2B 2KX3A 3WALA 5DPWA 3ECIA 1F77A 3RNBC 1FCCC 3VHTC 2KT7A 3ALBA 2FAZA 4USAA 1F0ZA 2BPSA 2KKCA 4MSQB 2NPTB 4NJCA 1PDXA 4US8A 4MM3A 4RGTA 1ZKHA 1PUTA 2KOXA 4MH0E 2CS4A 1S3SG 2Y5BB 1TIFA 4ZRQA 4DXAB 3GOEA 1N5XA 1UWXA 1GC6A 2JWUA 2C7MB 2WHIA 2HTME 1HXYD 1Y56A 1DYQA 3AULA 2WXLA 1NBFC 3KVFB 1ZP0B 1P0RA 3U30A 1H4RA 4LJOB 3LYYA 3PZ7A 4PS8A 1WZ0A 3Q8BA 4A6QA 4L1BA 1QOBA 4BBNF 1LGRA 2WXHA 2BWFA 1T0RC 3EHVA 2SEBD 3KLSX 1P3QU 2CHXA 1UGJA 1YQ4B 3DVGY 3MC0B 4MGYE 2K25A 2AQ3B 3PT2B 4NAWA 2FIDA 3VTVA 1SJED 3DBHI 4B95A 1GPXA 4IKGA 2LFIA 3CF6E 2VZKB 1F2RC 2YEPB 1GC7A 2L83A 3I57A 2NBWB 4BAXA 2NTSA 5AZFA 2V3PA 2CHZA 4FULA 3ZUNA 4R3DA 4JLCA 4HDOA 1T6BX 2GLSA 5EE0A 2NR2A 4RGOS 1T0SC 2RMMA 1UF0A 5IO9A 3P4SB 2BW2A 1Y8RC 2OJWA 3UIOB 4OVVA 4EOYA 2Z8LA 4ICUA 5CHFA 3V62A 2AYOB 3NS8A 3NY5A 1N62A 4XWWA 1PGXA 1QQRA 1KOTA 5AUKA 1V1PB 2ON8A 2GOWA 2Y5CA 2G3QB 1N63A 2E3TA 4GIVA 4ANWA 2EELA 3FKYA 3P4RB 1FEHA 1CK1A 3A4RA 2QHOA 3U4EG 1VZ6A 3QK0A 1K53A 1XLPA 3QC8B 1E8XA 5IA7A 2LXCA 3A9KA 4A90A 4GN1A 3KWLA 3MHZA 3OJ4B 4M0WB 3PRPB 1H8CA 2A4ZA 3Q8CA 2CHWA 5D94A 2RDHA 3SU8X 4ZHPA 1T3QA 3I3TB 2KJHB 2GI9A 4FJZA 4JX1C 5H8YE 4A9AA 4PYZA 3AE4B 2C9WB 1CZPA 1WIAA 2PJHA 2VRRB 1RFKA 2I2YA 2QJLA 4RMAA 5HI1A 2CJNA 1UZXB 4IM3A 2ZW0A 4GDLA 3DPDA 4DHZB 4XDCA 3L0WB 2PVGC 2K9XA 1E10A 4NJ6A 3U8ZA 5G2NA 2BF8B 3APDA 4BBNC 1EF1A 3ZJUA 5J18A 4WIPA 3UINB 3GE3C 3P4QB 1V2YA 2NTTA 2C5LC 2J52A 1F1HA 4EZLA 4F7ZA 1NI3A 3VDZA 2AEHA 3M63B 4E3CA 2YVCA 3AU4A 2K1FA 1GB4A 4A55A 2N9EB 1GUAB 1NYRA 1WGGA 2J53A 3KW5B 5AZGA 1JWSD 2MX2A 2JVCA 5JXVA 3QAQA 4HXDA 1KM7A 2KXJA 2L1AA 2W3RA 4XC2A 3SEBA 2LXAA 3E56A 4WWNA 5EDSA 1OTRB 2NPTA 4IOIE 5JHAA 1WX8A 2UU7A 2LD9A 2RGFA 4GMVA 4XZ4A 4F1SA 2L3ZA 3EA6A 2MA9B 4M8NA 3VFKA 2ZPYA 4ANXA 4KIKB 1S1QB 3TSSA 4DHZE 2C60A 3BINA 1RLFA 1V80A 1ZPSA 2YLMA 2ZCCA 2KLGA 4GOCA 1L6UA 1YIWA 1DOXA 2KWUB 1SF0A 2N4FA 1ZE3D 1AN8A 2XN9C 3IT6B 4NPNA 3T9LA 4FJVB 4W9EA 2MP2B 2MBEA 1C4AA 2LRUA 2LWPA 5CTRC 2TSSA 3VQIA 5DPRA 4A3PA 4GSWA 2MSED 3A9JB 1OFFA 1UD7A 3HM3A 4DK5A 1RRBA
chains in the Genus database with same CATH topology
2M0AA 1MHHE 4TQ1A 4TMAB 3ZYYX 2YEPF 3HVZA 4JPSA 1JWBD 1MPEA 2BS2B 1YJJA 5HFYA 1C78A 2LJIA 2MH7A 4YTNB 4NZLB 3W1SA 4CQNA 1PGAA 3AMZA 1F2RI 4RH6A 4RGNA 4XE0A 2K3UA 1P7FA 2N9KA 3B2GA 2IDYA 1FXAA 4RNAA 5G5HA 3Q8AA 1C77A 5EE9A 3V05A 3U52E 3W9CB 4C56C 3GB1A 1K52A 3RPFC 4D2KA 4YTMB 2J42A 2JZPA 3NS1A 5H92C 1YNTE 1WSPA 4OZAA 2JU6X 2MJDA 4ITKA 3VRAB 1ESFA 2BT6A 1BMLC 1JWUD 1QILA 4US9A 1N61A 3VR8B 2JQRB 3T3OA 2WU2B 3NVYA 4JWSC 1XCTL 3W5UB 1SB3C 4XDDA 3BVZA 5D7GA 3SFEB 1EM7A 1EU4A 2BBCA 1KRHA 5G5GA 1UUPA 1KLGD 1JMLA 1BUIC 2WXIA 3FILA 1HA5A 2ZW1A 4DXFA 3P4PB 2EKIA 2PIAA 3ZQ4A 4C80A 1KFYB 3BWUD 1XCQL 1JALA 3TUOA 2RPVA 3B9JA 2ONQA 4GDLB 5FR3A 4LK0M 2AQ1B 5D3IB 1ET9A 1E6EB 1QOAA 2I38A 2PLPA 3W2DA 5HHDG 1UNSA 1RM6C 1TJEA 2AX5A 3NUHB 4NAMA 1Q10A 1AYFA 2LUMA 2DWQA 2Y5PA 4HRSA 3TEZA 2LHEA 4FXCA 2CU3A 4KGRA 1L0XB 2L52A 2J4XA 3P63A 5I4DA 1L4DB 1L4ZB 1E7PB 2G9HD 2KMMA 1L5PA 3AEBB 4M0WA 1NVID 4WAFA 3NVVA 2V3NA 3AE9B 1YN4A 3CWIA 3AM9A 4P16A 3MFGA 2PW9A 3AEDB 2WDQB 1P7EA 5BMIA 3SR6A 2WLBA 1QT9A 4KGSA 5BYQA 3T3NA 1NENB 2MJ3A 5C2TB 4Q2JA 5MPOA 2JXTA 1I4RA 1OQQA 4OZCA 2WNMA 4P6VF 5D3DA 3WCQA 3SFDB 1PYWD 1E9MA 1YN5A 2Q5WD 4TQ0A 3W5VB 1F77A 4MT5A 4B0MA 2IJ0A 3KQ4A 1FCCC 3AE5B 4WQMA 1IBXB 1J7AA 1SBBB 2HDEA 1V1OA 2BTEA 1I4XA 2E6XA 1FRRA 4USAA 1F0ZA 1TY0A 2WXMA 1BXTA 3Q8EA 4ZHOA 3TEWA 1ZOYB 2QSDA 1CJEA 1RYJA 4NJCA 1PDXA 4US8A 5C3JB 4RGTA 1EWYC 1DOIA 2PKOA 1JQ4A 1FNWA 1PUTA 2K5PA 2WXPA 3EGRA 1TS2A 1FIQA 3AE6B 2V0GA 2AQ2B 2IPKD 2PTLA 5BMHA 4LTUA 1L6VA 3V3XA 2B76B 4ZRQA 1RWSA 4YWGG 1VDVA 1N5XA 2M56B 3BZDB 3NVZA 1UWXA 3DWMA 1XLOA 2JWUA 3R8BA 4RF1A 2HTME 2INPE 1HXYD 1WWTA 2H88B 4GLSC 1Y56A 1DYQA 2WXFA 2WXLA 1YN3A 1CQVA 4JWUC 2WQYB 1WYGA 1ZP0B 1T5XD 3LYYA 4KGTA 3TEYA 3PZ7A 3IXSA 2M19A 3Q8FA 4ZYSA 2WU5B 3Q8BA 3NRZA 4A6QA 1DOYA 4L1BA 1QOBA 3IAM1 2XNAC 1SE2A 5AUIA 4WWMA 2WXHA 4ZOHC 3BIID 1MI0A 4OZBA 2DYOA 1TS5A 3GS2A 1XEEA 2KWDA 4A8XC 1K51A 2SEBD 3KLSX 3MJ5A 1FMAD 2GB1A 4OW0A 2KQ4X 1HQRD 1K50A 1UGJA 1I7HA 1YQ4B 3AB5A 3MC0B 1ET6A 1FD6A 1TKGA 2AQ3B 1I4HA 2GRIA 1DGJA 5EE1A 1V8CA 2QMTA 1D5ZC 3O13A 2PVOD 2WXNA 4ARCA 1B9RA 1NEKB 1JW9D 1SJED 4KX6B 1GPXA 1QOFA 3NVWA 4IKGA 4LLGM 2LFIA 3AEGB 4HKZE 3U7ZA 2VZKB 1ENFA 1F2RC 1ROEA 2YEPB 4RF0A 2L83A 3I57A 1J7BA 1SSNA 2NTSA 1C79A 2V3PA 2BYTA 3AH7A 4R3DA 1T6BX 1SE3A 5EE0A 3GP7A 5E6JA 2INNE 3AV8A 4RGOS 1TS4A 2RMMA 5LNK1 3BYYB 1QOGA 1FCLA 1VLBA 3EUB2 3I9V1 2ACZB 3Q69A 2KDMA 4N58A 1I4QA 2BW2A 1I4PA 1TY2A 3P4SB 4DQOC 4YSZB 2K0PA 4IDIA 4RFBA 4DXGA 3AE7B 3BK2A 1N5WA 1KTKA 1KF6B 2Z8LA 3FILB 1D5MC 1HEZE 1N62A 3ZGZA 3C8YA 4XWWA 3FC4A 1PGXA 1QQRA 5AUKA 1V1PB 2ON8A 1WXQA 1VZ7A 2Y5CA 2SAKA 1N63A 1PFDA 2E3TA 2N9LA 1EU3A 2EELA 1D5XC 1TZOA 3P4RB 2RDGA 4YSYB 1FEHA 2V4IB 2W82A 3RFZB 1CK1A 3U4EG 1KH0A 3AN1A 4KKJA 1VZ6A 2WXOA 1K53A 1XLPA 3CIRB 1XO3A 1C76A 2LGIA 4RGMA 1GOZA 4A90A 1XLNA 4KKIA 3KWLA 1D6EC 3MHZA 1PGBA 1HZ5A 2QEJC 3AE8B 4YXDB 1I4GA 2JX5A 1FNVA 2K22A 1B1ZA 3IAS1 1ZUD2 1STEA 3B2FA 3J9CA 3LB8C 2WXKA 2KN4A 3AEEB 1V97A 2OEDA 3Q8CA 2BS4B 1VRAB 1QLBB 1E0ZA 1ZDVA 1FFUA 2RDHA 4PT5A 2JYEA 1L0YB 1WRIA 4ZHPA 1SIJA 1T3QA 4WURA 1QKZA 1J7CA 4WH4A 4B0EA 4XWTA 5HG2A 1HZ6A 2GI9A 2W3SA 1AWDA 4JX1C 2D5GA 2LHDA 5H8YE 3TEXA 1JCKB 3U2SC 4A9AA 3AE4B 1FFVA 2IGHA 3VRBB 1VR9A 1FXIA 1CZPA 4JE3B 5TSSA 1RFKA 2BS3B 2QJLA 2I2YA 3LXFA 2L32A 2CJNA 5HI1A 3HVDA 1SEBD 4H2AA 2ZW0A 2WDRB 1FO4A 4C7ZA 4XDCA 2PVGC 2Y3AA 4RCOA 2DYMA 1OQRA 3P1MA 1VJKA 2H89B 2K9XA 1NYQA 2R61A 1E10A 4MM3B 4AS1A 2MEKA 3P42A 4HROA 2WS3B 2W54A 1ZXHA 4L2YA 1LO5D 2WXRA 2QILA 3IT4B 3ZJUA 1QF6A 5FKAC 4J3OD 1FM0D 1GAQB 2FBWB 2MJEA 4WIPA 3ETRA 4L23A 5T8IA 3P4QB 5BYSA 2NTTA 1SXTA 1L0VB 2J52A 3UI3A 2QIEB 1N60A 4AQ7A 4C7YA 1TKEA 1JWAD 1FNUA 3HUIA 4OVZA 1SE4A 1TKYA 2N0SB 1NI3A 4EE2A 1GB1A 4REZA 2X38A 3H8HA 1GB4A 4A55A 2DBYA 5BMGA 3AEFB 1XLQA 3KWVA 4GDKB 3PZ8A 2VZKD 1IGDA 1JWMD 2WXGA 5EE3A 1NYRA 1JROA 2J53A 2IGGA 2N7JA 4N6EB 1V1PA 1IUEA 1JWSD 3PO0A 2BB6A 5JXVA 1IBXA 2ICIA 3AE3B 4ZRPA 2L1AA 2W3RA 3BK1A 3SEBA 1XF5L 2KACA 3NZ3A 1MVKA 2PMVA 4ARIA 3E56A 1C4PA 4YSXB 1M4VA 3URYA 1TYGB 2WP9B 4MACA 2DLBA 4HKQA 3ZJVA 1SJHD 1WGKA 2BB5A 4YTPB 4IOIE 4O1NA 3DWGC 3MP9A 2WDVB 3FAHA 2WXQA 2OHFA 3EA6A 3L4PA 3TSSA 1YMHE 4NAWB 3ZJTA 1XXGA 1ZPSA 3BYTB 3R2IA 2IGDA 3VR9B 2G1EA 1L6UA 4YT0B 5FK9C 1DOXA 1ZDXA 1FRDA 1YQ3B 2KAJA 1SF0A 1YJIA 2FE8A 4UDUC 4MH8A 1R7SA 1ZE3D 1AN8A 1TS3A 2XN9C 1EWCA 3AECB 3IT6B 5GXGB 3R2TA 2WXJA 3BVMA 5BYRA 3OWEB 1A70A 1C9FA 1C4AA 2W55A 1C4CA 1ACCA 4HJGE 2TSSA 3AEAB 3VQIA 2JYTA 2LMCA 3E9SA 1MHXA 1AW7A 3BVGA 1KLUD 1D4BA 2NMQA 2LEKA 3AE2B 1JRPA 1ZXIA 2CJOA 3AE1B 3ABVB 4TSSA 1OFFA 1UWMA 1IGCA 3HRDD 4N59A 2JSVX 4HEA1 3N9YC 4OHJA 1VZ8A 2FUG1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AH7 A;  1QF6 A;  3W5V B;  1FM0 D;  1GAQ B;  2FBW B;  2MJE A;  3ETR A;  5EE0 A;  3AE5 B;  3ZYY X;  3P4Q B;  4WQM A;  1J7A A;  3AV8 A;  3HVZ A;  1JWB D;  1L0V B;  1FRR A;  2QIE B;  2BS2 B;  4USA A;  1N60 A;  4C7Y A;  1TKE A;  1YJJ A;  1F0Z A;  1JWA D;  1QOG A;  3HUI A;  1VLB A;  3EUB 2;  2ACZ B;  1TKY A;  2MH7 A;  4ZHO A;  2N0S B;  4N58 A;  4YTN B;  1ZOY B;  1NI3 A;  3P4S B;  4YSZ B;  1CJE A;  1RYJ A;  3AMZ A;  1PDX A;  4US8 A;  4IDI A;  5C3J B;  1EWY C;  1DOI A;  2DBY A;  2PKO A;  3AEF B;  1XLQ A;  3AE7 B;  1JQ4 A;  1N5W A;  1KF6 B;  1PUT A;  3B2G A;  2K5P A;  1FXA A;  1N62 A;  5EE3 A;  1NYR A;  3FC4 A;  1FIQ A;  1JRO A;  3AE6 B;  5G5H A;  5EE9 A;  4N6E B;  5AUK A;  1IUE A;  1WXQ A;  3W9C B;  3PO0 A;  4YTM B;  4LTU A;  1L6V A;  3RPF C;  2B76 B;  1RWS A;  2Y5C A;  3NS1 A;  5H92 C;  1N63 A;  1PFD A;  2E3T A;  3AE3 B;  2W3R A;  1VDV A;  1N5X A;  2M56 B;  2MJD A;  3NVZ A;  4ITK A;  3VRA B;  2BT6 A;  3DWM A;  3P4R B;  4YSY B;  4US9 A;  1N61 A;  1XLO A;  3VR8 B;  2JQR B;  4YSX B;  2HTM E;  1WWT A;  3AN1 A;  2H88 B;  2WU2 B;  3NVY A;  4JWS C;  1TYG B;  1XLP A;  3W5U B;  1SB3 C;  2WP9 B;  3CIR B;  3SFE B;  1XO3 A;  4JWU C;  1WGK A;  2WQY B;  1WYG A;  4YTP B;  1ZP0 B;  1KRH A;  5G5G A;  1XLN A;  3KWL A;  3DWG C;  2WDV B;  3FAH A;  3P4P B;  2EKI A;  3AE8 B;  4YXD B;  2JX5 A;  2K22 A;  3LB8 C;  2PIA A;  2M19 A;  1ZUD 2;  3B2F A;  2WU5 B;  2OHF A;  3NRZ A;  1KFY B;  4C80 A;  3AEE B;  3L4P A;  1V97 A;  1DOY A;  1QOB A;  2BS4 B;  1JAL A;  3B9J A;  1QLB B;  1E0Z A;  5AUI A;  4WWM A;  1FFU A;  4ZOH C;  1WRI A;  3BII D;  1E6E B;  1QOA A;  4ZHP A;  1SIJ A;  3VR9 B;  1T3Q A;  2G1E A;  1L6U A;  4YT0 B;  1J7C A;  1RM6 C;  1TJE A;  1DOX A;  2AX5 A;  1AYF A;  2W3S A;  1FMA D;  1FRD A;  1YQ3 B;  2DWQ A;  4HRS A;  1AWD A;  4JX1 C;  2KAJ A;  1SF0 A;  2CU3 A;  4FXC A;  1YJI A;  2L52 A;  5H8Y E;  4A9A A;  1R7S A;  3AE4 B;  1FFV A;  3P63 A;  3AEC B;  1I7H A;  1YQ4 B;  3AB5 A;  1FXI A;  3VRB B;  5GXG B;  1CZP A;  1E7P B;  2KMM A;  1RFK A;  1L5P A;  2BS3 B;  2QJL A;  1NVI D;  1TKG A;  3AEB B;  3LXF A;  3NVV A;  3AE9 B;  2CJN A;  3CWI A;  1DGJ A;  5EE1 A;  1A70 A;  2WDR B;  1V8C A;  3AM9 A;  1FO4 A;  3AED B;  2WDQ B;  2W55 A;  4C7Z A;  3AEA B;  2WLB A;  3SR6 A;  1QT9 A;  2PVO D;  2PVG C;  1B9R A;  1NEK B;  1JW9 D;  4KX6 B;  1GPX A;  1NEN B;  1OQR A;  2MJ3 A;  1QOF A;  1VJK A;  3NVW A;  3P1M A;  2H89 B;  2K9X A;  5C2T B;  1NYQ A;  2LEK A;  3AE2 B;  3AEG B;  5MPO A;  1E10 A;  1JRP A;  1ZXI A;  1OQQ A;  2CJO A;  3AE1 B;  1ROE A;  3ABV B;  4HRO A;  2WS3 B;  1OFF A;  1UWM A;  2W54 A;  4P6V F;  3HRD D;  3WCQ A;  2L83 A;  4N59 A;  3SFD B;  1J7B A;  1E9M A;  2Q5W D; 
#chains in the Genus database with same CATH topology
 2D10 A;  4TMA B;  2G45 B;  1JWB D;  4P7I A;  4ICV A;  2BS2 B;  1YOV B;  3DBH B;  4OVU A;  4J6I A;  4YTN B;  2KTF A;  4NZL B;  5D2M B;  3S2A A;  3M3J A;  1F2R I;  1Z5S B;  1E8Z A;  3Q3F A;  2N9K A;  1V6E A;  2IDY A;  2DNF A;  4WJN A;  5C23 A;  1C77 A;  2LZ6 A;  4C56 C;  2JZP A;  3QIJ A;  5IKC M;  2KLC A;  4AUQ C;  3VRA B;  1ESF A;  1BML C;  1EUV B;  1MG4 A;  4DWF A;  4US9 A;  1N61 A;  2MLB A;  1K8R B;  2D3G A;  3VAW A;  4JWS C;  2D3C A;  2LUE A;  4NJ7 A;  3BVZ A;  1EU4 A;  1KRH A;  1KLG D;  1JML A;  2EKI A;  3WAP A;  3UF8 A;  2NS5 A;  3ZQ4 A;  4C80 A;  2NBV B;  1XCQ L;  2KMC A;  3TUO A;  2KYW A;  3CMM B;  5FR3 A;  3DBR I;  4URK A;  1ET9 A;  2I38 A;  2PLP A;  1V86 A;  1WXM A;  2OJR A;  4FHJ A;  3DCG A;  2LHE A;  4KGR A;  2FNJ B;  2KO3 A;  4II2 B;  2INC C;  2R2Q A;  3P63 A;  1L4Z B;  1L5P A;  4M0W A;  3NVV A;  3NZU A;  2XEW A;  2BYE A;  4P16 A;  3ML8 A;  2ZVN A;  1GJZ A;  3SR6 A;  4JL9 A;  1P9D U;  2MJ3 A;  5C2T B;  2KFJ A;  4Q2J A;  5MPO A;  2DZK A;  4S0R A;  1I4R A;  2CR5 A;  5E6O A;  3SFD B;  3M95 A;  2I1K A;  1ISN A;  2Q5W D;  1D3Z A;  2IJ0 A;  3KQ4 A;  2K8H A;  1IBX B;  1SBB B;  3SHQ A;  2HDE A;  2BTE A;  1J8C A;  4DBG A;  4BVU C;  1TY0 A;  5KHO A;  2WXM A;  1SE9 A;  4IW0 A;  3TEW A;  2FCQ A;  4NQL B;  1CJE A;  1TTN A;  1EWY C;  1DOI A;  2PKO A;  4XGA B;  4MDK E;  2HE7 A;  4K7U A;  3AE6 B;  1FPY A;  2V0G A;  2IPK D;  3PTF C;  1Q1O A;  4ZRJ A;  4LTU A;  3V3X A;  2B76 B;  4YWG G;  3OLM D;  2BYF A;  2IO1 B;  2M56 B;  2L7R A;  2MRP A;  1XLO A;  3R8B A;  4RF1 A;  2ZZP B;  3ZXR A;  4K7W A;  1CQV A;  4JWU C;  1WYG A;  4HCP B;  2L00 B;  3TJP A;  2MCN B;  2M19 A;  4ZYS A;  2FUH B;  4HLE A;  1DOY A;  4S17 A;  5GMV A;  3IAM 1;  1SE2 A;  4TV3 A;  5AUI A;  4ZOH C;  1R4N I;  1MI0 A;  3GS2 A;  1WM2 A;  1V5T A;  1K51 A;  3V6C B;  1OGW A;  1WJU A;  4LDT D;  2BKR B;  1I7H A;  3AB5 A;  5J17 A;  1ET6 A;  1FD6 A;  1TKG A;  2XBB C;  3B0A A;  2GRI A;  3QWZ B;  4KIK A;  1UEL A;  2QMT A;  1LM8 B;  2LGS A;  1D5Z C;  3B1L X;  3O13 A;  2PVO D;  4KX6 B;  5IOI A;  1QOF A;  3NVW A;  1NDD A;  4JGH B;  3U7Z A;  3DBL I;  4FBJ B;  1M94 A;  1ENF A;  1ROE A;  3V61 A;  3JSV B;  1UBQ A;  1J7B A;  4IM2 A;  1SSN A;  2BYT A;  5TR5 A;  2JY6 A;  3KYD D;  1V81 A;  2MP2 A;  3RI7 C;  1LQB A;  1RAX A;  1WF9 A;  3EUB 2;  2ACZ B;  2L0T A;  1WI0 A;  4DQO C;  1J19 A;  2K0P A;  2I1J A;  3NJT A;  4DXG A;  3BK2 A;  3A9J A;  4K3C A;  1N5W A;  3X0W A;  4W9H A;  2UWQ A;  3ZGZ A;  4WJO A;  4X57 B;  3ZKJ C;  1YQB A;  2KFK B;  4AP4 C;  3MC9 A;  2N9L A;  1EU3 A;  2K6D B;  4NNJ B;  3L10 B;  4W9L A;  1TZO A;  2V4I B;  2KJ6 A;  3Q3J A;  3KYC D;  1XO3 A;  1C76 A;  3R7R A;  2M4N A;  4KKI A;  1HTO A;  1D6E C;  2IY1 B;  1HZ5 A;  2KQ7 A;  3ZRC A;  1I4G A;  3LB8 C;  1STE A;  4DHJ D;  2BS4 B;  3UIP B;  1RFA A;  1ZDV A;  1FFU A;  2JYE A;  4BOS C;  1SIJ A;  4WUR A;  1J7C A;  4LJP B;  4XWT A;  4IG7 B;  1PQS A;  4BOZ B;  3EFC A;  1AWD A;  4BFR A;  2LHD A;  1WFY A;  1X1M A;  1VR9 A;  3VRB B;  2MWS B;  4EZK A;  5TSS A;  1G6J A;  2D07 B;  1SEB D;  3DBR B;  3HK0 A;  4ZRI A;  2MQJ A;  4C7Z A;  2DEN B;  3MHS D;  2Y3A A;  3PLU A;  1OQR A;  2HJ8 A;  1VJK A;  3P1M A;  2A5U A;  3RNA C;  1NYQ A;  3NG0 A;  2UYZ B;  3P42 A;  2M8S A;  3PS6 A;  3K9P B;  3DDC B;  2WXR A;  1LXD A;  3ZLZ A;  1QF6 A;  4CHK A;  3K9O B;  2AWT A;  5BYS A;  4XYC A;  3Q3M C;  3RZW C;  1SXT A;  4XX5 A;  1NI2 A;  2GMI C;  3UQA A;  1SE4 A;  1TKY A;  2WDT B;  3MJW A;  3RMK C;  3VH4 B;  1XLQ A;  4GB9 A;  4WJP A;  1JWM D;  1WX9 A;  2CKH B;  5EE3 A;  2IGG A;  4N6E B;  1MFW A;  2JZ3 B;  4BZA A;  1IBX A;  2ICI A;  3PSE B;  2BVC A;  1C4P A;  4YSX B;  4FAD A;  2N9X A;  1M4V A;  3URY A;  1TYG B;  4MGK E;  2WP9 B;  3H7P B;  4YTP B;  3WAM A;  4O1N A;  3QHT A;  3MP9 A;  4ANV A;  2WXQ A;  3L4P A;  2KDE B;  4BKS D;  5G55 A;  3PRZ A;  3BYT B;  3C19 A;  4YT0 B;  2WX1 A;  2BGF A;  3W1Y A;  3PPA A;  4KZ0 A;  2KAJ A;  2GBR A;  2OOB B;  5IN7 A;  2WXJ A;  1R4N B;  2W55 A;  1C4C A;  4HJG E;  3AEA B;  2JYT A;  1SIF A;  1MHX A;  1AW7 A;  1KLU D;  1D4B A;  4HDQ A;  4JIO U;  3AE2 B;  1JRP A;  2N9P C;  2CJO A;  2VH2 A;  4MGI E;  3QQ8 B;  4OHJ A;  1VZ8 A;  2FUG 1;  4LNO A;  2MHJ A;  3APF A;  3HVZ A;  1MPE A;  3SD5 A;  2D3A A;  1YJJ A;  2IY0 B;  4MSM B;  3DBL B;  3DHH C;  4TUU A;  4GU2 A;  1PGA A;  2ZVO A;  2LVP A;  4FA6 A;  3QA8 A;  1JRU A;  2AL3 A;  1P7F A;  3JSV A;  1WXA A;  1TT5 B;  4DDG D;  3RZF A;  1J0G A;  4P1C C;  3V05 A;  3U52 E;  4YTM B;  3GB1 A;  4D2K A;  2J42 A;  3DVN U;  2JU6 X;  3ZRF A;  3ZTC A;  3VR8 B;  3VUW A;  2JQR B;  3T3O A;  3RN9 C;  5DCN A;  3W5U B;  4XDD A;  3SFE B;  1EM7 A;  4W9J A;  5G5G A;  1UUP A;  3RNF C;  3ZNZ B;  1HA5 A;  1E7U A;  1KFY B;  2ZEQ A;  1JAL A;  2ONQ A;  2KFK A;  2MBQ A;  2AQ1 B;  1QOA A;  3N1Y C;  1E5W A;  5HHD G;  5D6J B;  2V3S A;  1RM6 C;  1TJE A;  3ZVV A;  3BY4 B;  3NUH B;  4NAM A;  1WJ4 A;  2KTR B;  2DWQ A;  2Y5P A;  4FXC A;  2O6V D;  5I4D A;  3NOB A;  3TBL D;  2G9H D;  1GNU A;  1KJT A;  3JYU A;  3AM9 A;  5BMI A;  2BQQ A;  4G0N B;  1P7E A;  2WGS A;  2KX0 A;  1U4A A;  2WLB A;  4KGS A;  1NEN B;  4IWO A;  2JXT A;  1E7V A;  4FN2 A;  4OZC A;  2KNB A;  3JVZ X;  3WCQ A;  4K1R B;  4NQK E;  1YN5 A;  3HM6 X;  4IM0 A;  4MT5 A;  4B0M A;  4BKT A;  5DPT A;  4WQM A;  2KD0 A;  2Z0E B;  5KHQ A;  3MC8 A;  2E6X A;  1FRR A;  1HE8 A;  4ZRK A;  4IUM B;  1ZOY B;  5LXH A;  1WE6 A;  5C3J B;  2EMS A;  1JQ4 A;  4W9I A;  1HTQ A;  2KN5 A;  4ZYN A;  2K5P A;  1WJN A;  2WXP A;  3EGR A;  2KMA A;  1FIQ A;  2AQ2 B;  2PTL A;  5BMH A;  3V6E B;  1RWS A;  2MW5 A;  2JRI B;  1VDV A;  2K8C A;  3DWM A;  2INP E;  1WWT A;  4GLS C;  2WXF A;  2ZPN A;  3P2B A;  2WQY B;  3LJ3 A;  2KAN A;  5CHV C;  3TEY A;  2M17 A;  3IXS A;  1WJ6 A;  3Q8F A;  1P98 A;  3NRZ A;  2LVQ A;  2XNA C;  4WWM A;  2O2V B;  3BII D;  4OZB A;  3ZNH B;  1XEE A;  3PV1 A;  2ZCB A;  4A8X C;  1WGD A;  3MJ5 A;  3H7P A;  4RM9 A;  2GB1 A;  3U7D A;  2KQ4 X;  1L2N A;  4EUT A;  1V8C A;  3ZW3 A;  4PK1 A;  2WXN A;  4ARC A;  2DZI A;  1B9R A;  1JW9 D;  4LLG M;  2FCN A;  4HKZ E;  5CHW A;  4NY0 A;  4W9D A;  3AI5 A;  2KDI A;  4RF0 A;  3JW0 X;  2K39 A;  2G4S A;  1SE3 A;  4A3O A;  3AV8 A;  3GZN I;  2EKE C;  5LNK 1;  1IP9 A;  1V9J A;  3H9D A;  2MBO A;  3BYY B;  1VLB A;  3Q69 A;  4FLH A;  2KDM A;  4N58 A;  2IYD B;  1TBE A;  4IDI A;  4RFB A;  2LJ5 A;  1KF6 B;  2KWV B;  2KC2 A;  1D5M C;  3PLV A;  3FC4 A;  2ZNV C;  3NHE B;  4B9K A;  1WXQ A;  1VZ7 A;  2SAK A;  4M02 A;  3L16 A;  1PFD A;  5LXI B;  1D5X C;  4PS7 A;  1WGH A;  2RDG A;  4YSY B;  2W82 A;  4G50 A;  1KH0 A;  1Q5W B;  3PRE A;  4W9K A;  3TL5 A;  2JZZ A;  2LGI A;  1C1Y B;  1XLN A;  4ANU A;  3AE8 B;  4YXD B;  2K22 A;  3J9C A;  1B1Z A;  1ZUD 2;  3HHM A;  2JWZ A;  1VRA B;  5DPS A;  1E0Z A;  1WR6 E;  4PT5 A;  3PRM B;  4C00 A;  1L0Y B;  3R7Q A;  3N30 A;  2CU1 A;  4CO7 A;  3HIZ A;  1N6Z A;  4KSK C;  5HG2 A;  1HZ6 A;  2WYQ A;  2RSU A;  3W1S C;  2W3S A;  2D5G A;  2IGH A;  4F8C B;  1AAR A;  1FXI A;  2BS3 B;  2L32 A;  4H2A A;  4KZC A;  1FO4 A;  3KUC B;  1WY8 A;  4B6W A;  2H89 B;  2R61 A;  1CMX B;  4AS1 A;  2MEK A;  4HRO A;  2KTR A;  2WS3 B;  2W54 A;  4MEM A;  2QIL A;  5HKH A;  4IWP A;  2FBW B;  2MJE A;  5T8I A;  3ETR A;  2G4D B;  3TIX A;  3EEC A;  3VTU A;  1L0V B;  1N60 A;  4AQ7 A;  4G11 A;  3DQV A;  4EE2 A;  3KUZ A;  3A33 B;  1GB1 A;  4REZ A;  2X38 A;  3H8H A;  2DBY A;  5BMG A;  4GDK B;  3KWV A;  2MBH A;  4WWP A;  1IGD A;  2FCM A;  1JRO A;  2N7J A;  1IUE A;  3PO0 A;  2BB6 A;  1IPG A;  2N1W A;  2Z0D B;  3NZ3 A;  2KAC A;  1MVK A;  4ARI A;  2Z59 B;  5BO4 B;  4AWJ A;  1I42 A;  2IND C;  2DLB A;  4HKQ A;  3ZJV A;  3DOW A;  3DWG C;  2RDB C;  3FAH A;  5AEK B;  2BWE S;  1WYW B;  2LAS A;  2JRH A;  2OHF A;  4KDI C;  1YJ1 A;  2FCS A;  2NBU A;  1YMH E;  3ZJT A;  3PHW B;  3R2I A;  3VR9 B;  2G1E A;  2WX0 A;  1OEY A;  3H7S A;  2EMT A;  1YJI A;  4UDU C;  3PZD A;  3AEC B;  4G3X B;  2DX5 B;  1UGM A;  5GXG B;  3ML9 A;  3R2T A;  3QX1 A;  3ZNI D;  1BT0 A;  4LNN A;  2O2V A;  3E9S A;  2LMC A;  3DVN V;  3BVG A;  4II3 B;  4M8M A;  3APC A;  3Q3O C;  1ZXI A;  3AE1 B;  3ABV B;  4TSS A;  1IGC A;  2KDB A;  3HRD D;  2JSV X;  4HEA 1;  3N1X C;  3N9Y C;  5CX3 A;  1F9J A;  4K3B A;  2R2O A;  2M0A A;  1MHH E;  4TQ1 A;  5J2R A;  5JZE B;  2YEP F;  2KHW B;  3DVG X;  3A1Q B;  5HFY A;  4HPL B;  2MH7 A;  4KV2 A;  3VVW B;  3W1S A;  2MBB B;  1T0Q C;  3AMZ A;  3IBE A;  4RH6 A;  2GBN A;  4XE0 A;  3VH3 B;  3B2G A;  3N20 C;  4RNA A;  3GZN B;  4LCD E;  2C7N B;  3Q8A A;  2RR9 A;  3RPF C;  3RNC C;  3NS1 A;  1WSP A;  2KJR A;  1WXS A;  2IBI B;  4ITK A;  3RUL A;  1JWU D;  2BT6 A;  1QIL A;  1WMH B;  1XD3 B;  2WU2 B;  3NVY A;  1XCT L;  4E71 A;  5D7G A;  2KQS A;  3D32 A;  2BBC A;  2D3B A;  4M01 A;  4HWI B;  1BUI C;  2KK8 A;  2WXI A;  2ZJD A;  1YD8 U;  3L13 A;  4K81 A;  1WR1 A;  4P1B C;  2FIF A;  4BKS A;  4N9F 4;  1VCB A;  3B9J A;  4KVG B;  2PE6 B;  4LK0 M;  3RD2 A;  2J0M A;  3TCA A;  2PEA A;  3W2D A;  2B3A A;  1UNS A;  2VH1 A;  3I5J C;  2L76 A;  4K7S A;  5C1Z A;  4HRS A;  3TEZ A;  3QAR A;  2J4X A;  1WX7 A;  3WIM A;  3AEB B;  4WAA A;  1NVI D;  4WAF A;  1L7Y A;  3AE9 B;  1YN4 A;  3CWI A;  3VXW A;  1TZ1 A;  1MG8 A;  3AED B;  2WDQ B;  4A20 A;  4TKN A;  1QT9 A;  2V1Y A;  5BYQ A;  3SDL C;  3T3N A;  4HPP A;  1Q0W B;  3UQB A;  1XT9 B;  2HJ1 A;  3X23 A;  4GXB A;  1WGR A;  3R66 C;  1WE7 A;  4W9C A;  1PYW D;  1WZ3 A;  4TQ0 A;  3W5V B;  3RYT A;  3VUY A;  3AE5 B;  1J7A A;  4WJQ A;  2K6Q A;  3RNE C;  1V1O A;  1I4X A;  5IP4 D;  1GG3 A;  1R4M B;  1BXT A;  3Q8E A;  3L54 A;  3ZO5 B;  4ZHO A;  4AJW A;  3PHX B;  2QSD A;  4RM8 A;  1RYJ A;  2NVU I;  2W9N A;  3RUI B;  1FNW A;  2DYB A;  3L08 A;  1TS2 A;  1E90 A;  1L6V A;  3WAN A;  4WWO A;  3BZD B;  3NVZ A;  4MGZ E;  4I6N B;  4E74 A;  4MJS B;  2KWC A;  2H88 B;  3PGE A;  1YN3 A;  2V4L A;  4HPM B;  4GDK A;  2JF5 A;  1T5X D;  3N3K B;  4KGT A;  1C3T A;  2WU5 B;  4FHK A;  1E8Y A;  3IVF A;  2DYO A;  1TS5 A;  2JUO A;  3Q6B A;  2KWD A;  2XK5 A;  3N32 A;  4LDT B;  1FMA D;  2O6V A;  2HTH A;  2D11 A;  4OW0 A;  4C4V B;  1HQR D;  1K50 A;  3OAW A;  3KUD B;  5IAA C;  3N1Z C;  1I4H A;  4QAY A;  1DGJ A;  2PE9 A;  5EE1 A;  2KZR A;  4W9F A;  1E8W A;  2KC1 A;  5E6N A;  1NEK B;  2M0X A;  3AEG B;  1FXT B;  3VUX A;  1C79 A;  3AH7 A;  2J7Q B;  3GP7 A;  5E6J A;  2INN E;  2IO0 B;  2QCZ A;  1TS4 A;  3ONS A;  1QOG A;  1FCL A;  3I9V 1;  1KLV A;  1I4Q A;  1I4P A;  1TY2 A;  2NCN A;  4YSZ B;  2LRW A;  3RNG C;  3AE7 B;  3C0R B;  1KTK A;  4EEW A;  2GBK A;  1WM3 A;  3FIL B;  1HEZ E;  4HK2 A;  3C8Y A;  2PPH A;  3ENE A;  3A1Q A;  3RFZ B;  3AN1 A;  1SGH A;  2WXO A;  4KKJ A;  2LGD A;  4BKG A;  1Z2M A;  1WRD B;  2LVO A;  3CIR B;  2KDF B;  4RGM A;  1GOZ A;  4LNK A;  1ZW7 A;  1PGB A;  2QEJ C;  4DHJ B;  2JX5 A;  3IAS 1;  1FNV A;  2N1V A;  3B2F A;  2WXK A;  2KN4 A;  3AEE B;  2D2Q A;  1V97 A;  2OED A;  4MEL A;  2RD0 A;  1QLB B;  1WRI A;  4DDI D;  2N7D A;  1QKZ A;  4WH4 A;  1WMH A;  4B0E A;  3IG3 A;  3ZDM C;  3Q3N C;  1V49 A;  5FR6 A;  2KVZ A;  3H1U A;  4KSL C;  3TEX A;  1JCK B;  3U2S C;  2ZNV B;  1FFV A;  2GBM A;  2IO3 B;  4JE3 B;  3UGB B;  3LXF A;  3HVD A;  2WDR B;  4RCO A;  2DYM A;  2C7H A;  2LI5 A;  4MM3 B;  2DHZ A;  3OJ3 A;  1ZXH A;  4L2Y A;  1YX5 B;  3AU5 A;  1LO5 D;  2DZM A;  2DZJ A;  4JQW C;  3IT4 B;  2L05 A;  5FKA C;  4J3O D;  1FM0 D;  1F52 A;  1GAQ B;  4L23 A;  2JT4 B;  3IFW B;  2WWZ A;  4FJY A;  3UI3 A;  2QIE B;  1YX6 B;  4C7Y A;  1TKE A;  1LFD A;  1JWA D;  1FNU A;  3HUI A;  4OVZ A;  4EFO A;  3I63 C;  2N0S B;  3R3M A;  4ASW C;  3QCA A;  3CST A;  4I6P A;  3VTW A;  3AEF B;  3ZXV A;  3DHI C;  3DBS A;  5JH5 C;  2N7E A;  3PZ8 A;  2VZK D;  1T0Y A;  3NZS A;  2WXG A;  3RT3 B;  4HJK A;  3DHG C;  1V1P A;  3AE3 B;  4ZRP A;  3IHP C;  2QC8 A;  3BK1 A;  1XF5 L;  3ZIM A;  2DAF A;  2PMV A;  1EO6 A;  1MJD A;  2K8B A;  4EKU A;  2GBJ A;  4MAC A;  4EZJ A;  1SJH D;  1WGK A;  2BB5 A;  4ACF A;  2HD5 B;  2LGY A;  2WDV B;  1EF5 A;  4PS3 A;  2RPQ A;  2QDF A;  3EC8 A;  4NAW B;  1XXG A;  5L83 A;  2IGD A;  3ZTD A;  4MJS A;  1OQY A;  4GGQ A;  5FK9 C;  1UBI A;  1ZDX A;  1FRD A;  1YQ3 B;  3WA0 A;  2FE8 A;  4MH8 A;  1R7S A;  1TS3 A;  2IZV B;  1EWC A;  2L8J A;  2X8X X;  4IC7 B;  3BVM A;  5BYR A;  2J0J A;  3OWE B;  1A70 A;  1C9F A;  1WH3 A;  2BKF A;  4CYE A;  1IYF A;  5L95 C;  1ACC A;  2V9H A;  3MTN B;  5AZH A;  2AL6 A;  3L17 A;  4AJY B;  3M62 B;  3KH0 A;  2NMQ A;  2LEK A;  2J0K A;  3OG5 A;  2M1M A;  1P1A A;  1UWM A;  4N59 A;  4C4V A;  2JPH A;  4I6L B;  3H6N A;  3ZYY X;  3GE8 C;  1I35 A;  2BYV E;  4JPS A;  1VD2 A;  1A5R A;  1C78 A;  2LJI A;  3O65 B;  3EFU A;  3B08 A;  1R4M I;  2REX A;  4CQN A;  4LNF A;  3A9K B;  4RGN A;  3AXC A;  2K3U A;  1FXA A;  3T8M A;  4WQO B;  5G5H A;  5EE9 A;  3W9C B;  1K52 A;  2L0F A;  5H92 C;  3ZDT A;  3CSF A;  1YNT E;  4OZA A;  3Q14 C;  2JXX A;  2MJD A;  4PYU A;  4M00 A;  3WAO A;  4LNI A;  3Q2A C;  4ZDV A;  5JHB A;  1SB3 C;  1V5O A;  1XQQ A;  4YL8 A;  3FIL A;  1ZGU B;  2ZW1 A;  4DXF A;  3P4P B;  4HCN B;  2KVR A;  2PIA A;  3BWU D;  2RPV A;  4GDL B;  3A4S C;  3LDZ E;  5D3I B;  1E6E B;  3PVL A;  1UH6 A;  2ASQ A;  3QJZ A;  5E6P A;  1QZE A;  2XK5 B;  2AX5 A;  1Q10 A;  1AYF A;  2LUM A;  1WGY A;  2O6V B;  4AOF A;  4W9G A;  2CU3 A;  3TMP B;  1L0X B;  2L52 A;  1WXV A;  4IWQ A;  1L4D B;  1E7P B;  2KMM A;  3RCZ A;  2V3N A;  3MFG A;  3V60 A;  2PW9 A;  4HVB A;  2DAJ A;  1OEY J;  1OQQ A;  3ZNG C;  2LGX A;  2WNM A;  5LLI A;  4P6V F;  4KDL B;  5D3D A;  1TGZ B;  1E9M A;  2IO2 B;  2KX3 A;  3WAL A;  5DPW A;  3ECI A;  1F77 A;  3RNB C;  1FCC C;  3VHT C;  2KT7 A;  3ALB A;  2FAZ A;  4USA A;  1F0Z A;  2BPS A;  2KKC A;  4MSQ B;  2NPT B;  4NJC A;  1PDX A;  4US8 A;  4MM3 A;  4RGT A;  1ZKH A;  1PUT A;  2KOX A;  4MH0 E;  2CS4 A;  1S3S G;  2Y5B B;  1TIF A;  4ZRQ A;  4DXA B;  3GOE A;  1N5X A;  1UWX A;  1GC6 A;  2JWU A;  2C7M B;  2WHI A;  2HTM E;  1HXY D;  1Y56 A;  1DYQ A;  3AUL A;  2WXL A;  1NBF C;  3KVF B;  1ZP0 B;  1P0R A;  3U30 A;  1H4R A;  4LJO B;  3LYY A;  3PZ7 A;  4PS8 A;  1WZ0 A;  3Q8B A;  4A6Q A;  4L1B A;  1QOB A;  4BBN F;  1LGR A;  2WXH A;  2BWF A;  1T0R C;  3EHV A;  2SEB D;  3KLS X;  1P3Q U;  2CHX A;  1UGJ A;  1YQ4 B;  3DVG Y;  3MC0 B;  4MGY E;  2K25 A;  2AQ3 B;  3PT2 B;  4NAW A;  2FID A;  3VTV A;  1SJE D;  3DBH I;  4B95 A;  1GPX A;  4IKG A;  2LFI A;  3CF6 E;  2VZK B;  1F2R C;  2YEP B;  1GC7 A;  2L83 A;  3I57 A;  2NBW B;  4BAX A;  2NTS A;  5AZF A;  2V3P A;  2CHZ A;  4FUL A;  3ZUN A;  4R3D A;  4JLC A;  4HDO A;  1T6B X;  2GLS A;  5EE0 A;  2NR2 A;  4RGO S;  1T0S C;  2RMM A;  1UF0 A;  5IO9 A;  3P4S B;  2BW2 A;  1Y8R C;  2OJW A;  3UIO B;  4OVV A;  4EOY A;  2Z8L A;  4ICU A;  5CHF A;  3V62 A;  2AYO B;  3NS8 A;  3NY5 A;  1N62 A;  4XWW A;  1PGX A;  1QQR A;  1KOT A;  5AUK A;  1V1P B;  2ON8 A;  2GOW A;  2Y5C A;  2G3Q B;  1N63 A;  2E3T A;  4GIV A;  4ANW A;  2EEL A;  3FKY A;  3P4R B;  1FEH A;  1CK1 A;  3A4R A;  2QHO A;  3U4E G;  1VZ6 A;  3QK0 A;  1K53 A;  1XLP A;  3QC8 B;  1E8X A;  5IA7 A;  2LXC A;  3A9K A;  4A90 A;  4GN1 A;  3KWL A;  3MHZ A;  3OJ4 B;  4M0W B;  3PRP B;  1H8C A;  2A4Z A;  3Q8C A;  2CHW A;  5D94 A;  2RDH A;  3SU8 X;  4ZHP A;  1T3Q A;  3I3T B;  2KJH B;  2GI9 A;  4FJZ A;  4JX1 C;  5H8Y E;  4A9A A;  4PYZ A;  3AE4 B;  2C9W B;  1CZP A;  1WIA A;  2PJH A;  2VRR B;  1RFK A;  2I2Y A;  2QJL A;  4RMA A;  5HI1 A;  2CJN A;  1UZX B;  4IM3 A;  2ZW0 A;  4GDL A;  3DPD A;  4DHZ B;  4XDC A;  3L0W B;  2PVG C;  2K9X A;  1E10 A;  4NJ6 A;  3U8Z A;  5G2N A;  2BF8 B;  3APD A;  4BBN C;  1EF1 A;  3ZJU A;  5J18 A;  4WIP A;  3UIN B;  3GE3 C;  3P4Q B;  1V2Y A;  2NTT A;  2C5L C;  2J52 A;  1F1H A;  4EZL A;  4F7Z A;  1NI3 A;  3VDZ A;  2AEH A;  3M63 B;  4E3C A;  2YVC A;  3AU4 A;  2K1F A;  1GB4 A;  4A55 A;  2N9E B;  1GUA B;  1NYR A;  1WGG A;  2J53 A;  3KW5 B;  5AZG A;  1JWS D;  2MX2 A;  2JVC A;  5JXV A;  3QAQ A;  4HXD A;  1KM7 A;  2KXJ A;  2L1A A;  2W3R A;  4XC2 A;  3SEB A;  2LXA A;  3E56 A;  4WWN A;  5EDS A;  1OTR B;  2NPT A;  4IOI E;  5JHA A;  1WX8 A;  2UU7 A;  2LD9 A;  2RGF A;  4GMV A;  4XZ4 A;  4F1S A;  2L3Z A;  3EA6 A;  2MA9 B;  4M8N A;  3VFK A;  2ZPY A;  4ANX A;  4KIK B;  1S1Q B;  3TSS A;  4DHZ E;  2C60 A;  3BIN A;  1RLF A;  1V80 A;  1ZPS A;  2YLM A;  2ZCC A;  2KLG A;  4GOC A;  1L6U A;  1YIW A;  1DOX A;  2KWU B;  1SF0 A;  2N4F A;  1ZE3 D;  1AN8 A;  2XN9 C;  3IT6 B;  4NPN A;  3T9L A;  4FJV B;  4W9E A;  2MP2 B;  2MBE A;  1C4A A;  2LRU A;  2LWP A;  5CTR C;  2TSS A;  3VQI A;  5DPR A;  4A3P A;  4GSW A;  2MSE D;  3A9J B;  1OFF A;  1UD7 A;  3HM3 A;  4DK5 A;  1RRB A; 
#chains in the Genus database with same CATH homology
 2M0A A;  1MHH E;  4TQ1 A;  4TMA B;  3ZYY X;  2YEP F;  3HVZ A;  4JPS A;  1JWB D;  1MPE A;  2BS2 B;  1YJJ A;  5HFY A;  1C78 A;  2LJI A;  2MH7 A;  4YTN B;  4NZL B;  3W1S A;  4CQN A;  1PGA A;  3AMZ A;  1F2R I;  4RH6 A;  4RGN A;  4XE0 A;  2K3U A;  1P7F A;  2N9K A;  3B2G A;  2IDY A;  1FXA A;  4RNA A;  5G5H A;  3Q8A A;  1C77 A;  5EE9 A;  3V05 A;  3U52 E;  3W9C B;  4C56 C;  3GB1 A;  1K52 A;  3RPF C;  4D2K A;  4YTM B;  2J42 A;  2JZP A;  3NS1 A;  5H92 C;  1YNT E;  1WSP A;  4OZA A;  2JU6 X;  2MJD A;  4ITK A;  3VRA B;  1ESF A;  2BT6 A;  1BML C;  1JWU D;  1QIL A;  4US9 A;  1N61 A;  3VR8 B;  2JQR B;  3T3O A;  2WU2 B;  3NVY A;  4JWS C;  1XCT L;  3W5U B;  1SB3 C;  4XDD A;  3BVZ A;  5D7G A;  3SFE B;  1EM7 A;  1EU4 A;  2BBC A;  1KRH A;  5G5G A;  1UUP A;  1KLG D;  1JML A;  1BUI C;  2WXI A;  3FIL A;  1HA5 A;  2ZW1 A;  4DXF A;  3P4P B;  2EKI A;  2PIA A;  3ZQ4 A;  4C80 A;  1KFY B;  3BWU D;  1XCQ L;  1JAL A;  3TUO A;  2RPV A;  3B9J A;  2ONQ A;  4GDL B;  5FR3 A;  4LK0 M;  2AQ1 B;  5D3I B;  1ET9 A;  1E6E B;  1QOA A;  2I38 A;  2PLP A;  3W2D A;  5HHD G;  1UNS A;  1RM6 C;  1TJE A;  2AX5 A;  3NUH B;  4NAM A;  1Q10 A;  1AYF A;  2LUM A;  2DWQ A;  2Y5P A;  4HRS A;  3TEZ A;  2LHE A;  4FXC A;  2CU3 A;  4KGR A;  1L0X B;  2L52 A;  2J4X A;  3P63 A;  5I4D A;  1L4D B;  1L4Z B;  1E7P B;  2G9H D;  2KMM A;  1L5P A;  3AEB B;  4M0W A;  1NVI D;  4WAF A;  3NVV A;  2V3N A;  3AE9 B;  1YN4 A;  3CWI A;  3AM9 A;  4P16 A;  3MFG A;  2PW9 A;  3AED B;  2WDQ B;  1P7E A;  5BMI A;  3SR6 A;  2WLB A;  1QT9 A;  4KGS A;  5BYQ A;  3T3N A;  1NEN B;  2MJ3 A;  5C2T B;  4Q2J A;  5MPO A;  2JXT A;  1I4R A;  1OQQ A;  4OZC A;  2WNM A;  4P6V F;  5D3D A;  3WCQ A;  3SFD B;  1PYW D;  1E9M A;  1YN5 A;  2Q5W D;  4TQ0 A;  3W5V B;  1F77 A;  4MT5 A;  4B0M A;  2IJ0 A;  3KQ4 A;  1FCC C;  3AE5 B;  4WQM A;  1IBX B;  1J7A A;  1SBB B;  2HDE A;  1V1O A;  2BTE A;  1I4X A;  2E6X A;  1FRR A;  4USA A;  1F0Z A;  1TY0 A;  2WXM A;  1BXT A;  3Q8E A;  4ZHO A;  3TEW A;  1ZOY B;  2QSD A;  1CJE A;  1RYJ A;  4NJC A;  1PDX A;  4US8 A;  5C3J B;  4RGT A;  1EWY C;  1DOI A;  2PKO A;  1JQ4 A;  1FNW A;  1PUT A;  2K5P A;  2WXP A;  3EGR A;  1TS2 A;  1FIQ A;  3AE6 B;  2V0G A;  2AQ2 B;  2IPK D;  2PTL A;  5BMH A;  4LTU A;  1L6V A;  3V3X A;  2B76 B;  4ZRQ A;  1RWS A;  4YWG G;  1VDV A;  1N5X A;  2M56 B;  3BZD B;  3NVZ A;  1UWX A;  3DWM A;  1XLO A;  2JWU A;  3R8B A;  4RF1 A;  2HTM E;  2INP E;  1HXY D;  1WWT A;  2H88 B;  4GLS C;  1Y56 A;  1DYQ A;  2WXF A;  2WXL A;  1YN3 A;  1CQV A;  4JWU C;  2WQY B;  1WYG A;  1ZP0 B;  1T5X D;  3LYY A;  4KGT A;  3TEY A;  3PZ7 A;  3IXS A;  2M19 A;  3Q8F A;  4ZYS A;  2WU5 B;  3Q8B A;  3NRZ A;  4A6Q A;  1DOY A;  4L1B A;  1QOB A;  3IAM 1;  2XNA C;  1SE2 A;  5AUI A;  4WWM A;  2WXH A;  4ZOH C;  3BII D;  1MI0 A;  4OZB A;  2DYO A;  1TS5 A;  3GS2 A;  1XEE A;  2KWD A;  4A8X C;  1K51 A;  2SEB D;  3KLS X;  3MJ5 A;  1FMA D;  2GB1 A;  4OW0 A;  2KQ4 X;  1HQR D;  1K50 A;  1UGJ A;  1I7H A;  1YQ4 B;  3AB5 A;  3MC0 B;  1ET6 A;  1FD6 A;  1TKG A;  2AQ3 B;  1I4H A;  2GRI A;  1DGJ A;  5EE1 A;  1V8C A;  2QMT A;  1D5Z C;  3O13 A;  2PVO D;  2WXN A;  4ARC A;  1B9R A;  1NEK B;  1JW9 D;  1SJE D;  4KX6 B;  1GPX A;  1QOF A;  3NVW A;  4IKG A;  4LLG M;  2LFI A;  3AEG B;  4HKZ E;  3U7Z A;  2VZK B;  1ENF A;  1F2R C;  1ROE A;  2YEP B;  4RF0 A;  2L83 A;  3I57 A;  1J7B A;  1SSN A;  2NTS A;  1C79 A;  2V3P A;  2BYT A;  3AH7 A;  4R3D A;  1T6B X;  1SE3 A;  5EE0 A;  3GP7 A;  5E6J A;  2INN E;  3AV8 A;  4RGO S;  1TS4 A;  2RMM A;  5LNK 1;  3BYY B;  1QOG A;  1FCL A;  1VLB A;  3EUB 2;  3I9V 1;  2ACZ B;  3Q69 A;  2KDM A;  4N58 A;  1I4Q A;  2BW2 A;  1I4P A;  1TY2 A;  3P4S B;  4DQO C;  4YSZ B;  2K0P A;  4IDI A;  4RFB A;  4DXG A;  3AE7 B;  3BK2 A;  1N5W A;  1KTK A;  1KF6 B;  2Z8L A;  3FIL B;  1D5M C;  1HEZ E;  1N62 A;  3ZGZ A;  3C8Y A;  4XWW A;  3FC4 A;  1PGX A;  1QQR A;  5AUK A;  1V1P B;  2ON8 A;  1WXQ A;  1VZ7 A;  2Y5C A;  2SAK A;  1N63 A;  1PFD A;  2E3T A;  2N9L A;  1EU3 A;  2EEL A;  1D5X C;  1TZO A;  3P4R B;  2RDG A;  4YSY B;  1FEH A;  2V4I B;  2W82 A;  3RFZ B;  1CK1 A;  3U4E G;  1KH0 A;  3AN1 A;  4KKJ A;  1VZ6 A;  2WXO A;  1K53 A;  1XLP A;  3CIR B;  1XO3 A;  1C76 A;  2LGI A;  4RGM A;  1GOZ A;  4A90 A;  1XLN A;  4KKI A;  3KWL A;  1D6E C;  3MHZ A;  1PGB A;  1HZ5 A;  2QEJ C;  3AE8 B;  4YXD B;  1I4G A;  2JX5 A;  1FNV A;  2K22 A;  1B1Z A;  3IAS 1;  1ZUD 2;  1STE A;  3B2F A;  3J9C A;  3LB8 C;  2WXK A;  2KN4 A;  3AEE B;  1V97 A;  2OED A;  3Q8C A;  2BS4 B;  1VRA B;  1QLB B;  1E0Z A;  1ZDV A;  1FFU A;  2RDH A;  4PT5 A;  2JYE A;  1L0Y B;  1WRI A;  4ZHP A;  1SIJ A;  1T3Q A;  4WUR A;  1QKZ A;  1J7C A;  4WH4 A;  4B0E A;  4XWT A;  5HG2 A;  1HZ6 A;  2GI9 A;  2W3S A;  1AWD A;  4JX1 C;  2D5G A;  2LHD A;  5H8Y E;  3TEX A;  1JCK B;  3U2S C;  4A9A A;  3AE4 B;  1FFV A;  2IGH A;  3VRB B;  1VR9 A;  1FXI A;  1CZP A;  4JE3 B;  5TSS A;  1RFK A;  2BS3 B;  2QJL A;  2I2Y A;  3LXF A;  2L32 A;  2CJN A;  5HI1 A;  3HVD A;  1SEB D;  4H2A A;  2ZW0 A;  2WDR B;  1FO4 A;  4C7Z A;  4XDC A;  2PVG C;  2Y3A A;  4RCO A;  2DYM A;  1OQR A;  3P1M A;  1VJK A;  2H89 B;  2K9X A;  1NYQ A;  2R61 A;  1E10 A;  4MM3 B;  4AS1 A;  2MEK A;  3P42 A;  4HRO A;  2WS3 B;  2W54 A;  1ZXH A;  4L2Y A;  1LO5 D;  2WXR A;  2QIL A;  3IT4 B;  3ZJU A;  1QF6 A;  5FKA C;  4J3O D;  1FM0 D;  1GAQ B;  2FBW B;  2MJE A;  4WIP A;  3ETR A;  4L23 A;  5T8I A;  3P4Q B;  5BYS A;  2NTT A;  1SXT A;  1L0V B;  2J52 A;  3UI3 A;  2QIE B;  1N60 A;  4AQ7 A;  4C7Y A;  1TKE A;  1JWA D;  1FNU A;  3HUI A;  4OVZ A;  1SE4 A;  1TKY A;  2N0S B;  1NI3 A;  4EE2 A;  1GB1 A;  4REZ A;  2X38 A;  3H8H A;  1GB4 A;  4A55 A;  2DBY A;  5BMG A;  3AEF B;  1XLQ A;  3KWV A;  4GDK B;  3PZ8 A;  2VZK D;  1IGD A;  1JWM D;  2WXG A;  5EE3 A;  1NYR A;  1JRO A;  2J53 A;  2IGG A;  2N7J A;  4N6E B;  1V1P A;  1IUE A;  1JWS D;  3PO0 A;  2BB6 A;  5JXV A;  1IBX A;  2ICI A;  3AE3 B;  4ZRP A;  2L1A A;  2W3R A;  3BK1 A;  3SEB A;  1XF5 L;  2KAC A;  3NZ3 A;  1MVK A;  2PMV A;  4ARI A;  3E56 A;  1C4P A;  4YSX B;  1M4V A;  3URY A;  1TYG B;  2WP9 B;  4MAC A;  2DLB A;  4HKQ A;  3ZJV A;  1SJH D;  1WGK A;  2BB5 A;  4YTP B;  4IOI E;  4O1N A;  3DWG C;  3MP9 A;  2WDV B;  3FAH A;  2WXQ A;  2OHF A;  3EA6 A;  3L4P A;  3TSS A;  1YMH E;  4NAW B;  3ZJT A;  1XXG A;  1ZPS A;  3BYT B;  3R2I A;  2IGD A;  3VR9 B;  2G1E A;  1L6U A;  4YT0 B;  5FK9 C;  1DOX A;  1ZDX A;  1FRD A;  1YQ3 B;  2KAJ A;  1SF0 A;  1YJI A;  2FE8 A;  4UDU C;  4MH8 A;  1R7S A;  1ZE3 D;  1AN8 A;  1TS3 A;  2XN9 C;  1EWC A;  3AEC B;  3IT6 B;  5GXG B;  3R2T A;  2WXJ A;  3BVM A;  5BYR A;  3OWE B;  1A70 A;  1C9F A;  1C4A A;  2W55 A;  1C4C A;  1ACC A;  4HJG E;  2TSS A;  3AEA B;  3VQI A;  2JYT A;  2LMC A;  3E9S A;  1MHX A;  1AW7 A;  3BVG A;  1KLU D;  1D4B A;  2NMQ A;  2LEK A;  3AE2 B;  1JRP A;  1ZXI A;  2CJO A;  3AE1 B;  3ABV B;  4TSS A;  1OFF A;  1UWM A;  1IGC A;  3HRD D;  4N59 A;  2JSV X;  4HEA 1;  3N9Y C;  4OHJ A;  1VZ8 A;  2FUG 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...