3AV8A

Refined structure of plant-type [2fe-2s] ferredoxin i from aphanothece sacrum at 1.46 a resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
97
structure length
97
Chain Sequence
b'ASYKVTLKTPDGDNVITVPDDEYILDVAEEQGLDLPYSCRAGACSTCAGKLVSGPAPDQSDQSFLDDDQIQAGYILTCVAYPTGDCVIETHKEEALY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-1
molecule tags Electron transport
source organism Aphanothece sacrum
publication title Mapping of protein-protein interaction sites in the plant-type [2Fe-2S] ferredoxin.
pubmed doi rcsb
total genus 25
structure length 97
sequence length 97
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3av8A00
1JRPA 3AEBB 1TYGB 1WGKA 3B2GA 1YQ4B 4N59A 4YTPB 1N5WA 1ROEA 1GPXA 1IUEA 1YJIA 5EE3A 3AM9A 3AEDB 2K9XA 3P4QB 3P4PB 4US9A 5G5HA 1FO4A 3SFDB 1E6EB 3AE7B 2Q5WD 1NI3A 1B9RA 1L5PA 3NVYA 3VRBB 1N5XA 4HRSA 3AE3B 1FMAD 1JWBD 5EE9A 1WXQA 3WCQA 1DOXA 2MJ3A 3P4SB 4ITKA 1QLBB 4JWSC 4WWMA 3PO0A 3ZYYX 4ZHOA 2WDQB 1N60A 3CIRB 1KF6B 1SF0A 4C7ZA 1L6VA 1NEKB 1QOGA 1TKYA 3AEFB 4IDIA 4C80A 1FRRA 4FXCA 3EUB2 3W5VB 4YXDB 2WDVB 3AE5B 1E7PB 5EE0A 1NYQA 2H89B 2JX5A 1OQRA 2QJLA 3B2FA 2WS3B 3RPFC 2DWQA 1JQ4A 2G1EA 2BT6A 2M56B 3AE8B 1DOIA 1XLNA 2WQYB 4N58A 1FRDA 1V8CA 2CU3A 1PUTA 1TKGA 1XLPA 3AE6B 2N0SB 4WQMA 5C3JB 4HROA 1QF6A 1WRIA 1ZUD2 1FFVA 1QOBA 1L0VB 2KMMA 3HVZA 3AEGB 1RFKA 2PIAA 1SIJA 3AH7A 3FC4A 4YT0B 1CZPA 1FXIA 1TKEA 2CJOA 1VJKA 1WWTA 2WDRB 1RYJA 1V97A 1FXAA 3FAHA 4USAA 3W5UB 1EWYC 3B9JA 1QOFA 3HUIA 1N61A 2OHFA 1E9MA 1FFUA 1RM6C 2MJDA 3AECB 5G5GA 4ZHPA 1GAQB 2BS4B 3BIID 2LEKA 1TJEA 3LXFA 3L4PA 1VLBA 2KAJA 1FM0D 3AV8A 2K22A 2MJEA 1XLQA 1VDVA 1NENB 2L83A 2HTME 1PFDA 3DWMA 4YTNB 1F0ZA 5AUIA 1AYFA 2L52A 2W54A 2AX5A 2DBYA 3P1MA 4JWUC 1JALA 4YSYB 1L6UA 4KX6B 3AE1B 2M19A 3SFEB 1FIQA 3AB5A 1ZP0B 1YJJA 1ZXIA 3NS1A 3CWIA 4YSXB 4LTUA 2WU2B 1WYGA 2WLBA 4YSZB 5MPOA 2W55A 1N63A 1OQQA 1E10A 1KFYB 2FBWB 2Y5CA 1ZOYB 2H88B 1J7AA 1AWDA 1PDXA 2WU5B 4P6VF 3NVWA 2MH7A 5H92C 1N62A 4ZOHC 3SR6A 1J7BA 1JWAD 4C7YA 2PVGC 1JW9D 2BS3B 1UWMA 3VR9B 2B76B 3VRAB 3AE9B 4YTMB 1QOAA 1XO3A 3ETRA 3LB8C 3AEAB 4A9AA 5AUKA 1JROA 4US8A 1NYRA 3HRDD 3AE4B 3NVVA 3AN1A 3DWGC 3AE2B 5EE1A 1QT9A 1T3QA 2EKIA 5C2TB 1CJEA 4N6EB 1RWSA 1J7CA 1DGJA 1I7HA 5GXGB 5H8YE 2E3TA 2W3SA 3VR8B 1OFFA 1YQ3B 2CJNA 1R7SA 3AEEB 3P63A 3ABVB 2WP9B 1NVID 1XLOA 3W9CB 1DOYA 3KWLA 3NVZA 1E0ZA 4JX1C 2JQRB 2PVOD 1A70A 2W3RA 2PKOA 2K5PA 2QIEB 3P4RB 2BS2B 3NRZA 3AMZA 2ACZB 1SB3C 1KRHA
chains in the Genus database with same CATH superfamily
2I38A 1WZ3A 3DHGC 1L4DB 5CHWA 4XC2A 3RNFC 2RDBC 2K6QA 1SGHA 3RMKC 2SEBD 5E6OA 3Q3FA 1V81A 3WCQA 2LASA 4ITKA 3KH0A 2KFKA 5LNK1 3PLVA 3W5VB 3AE5B 3V60A 2N1VA 1XD3B 2IBIB 2IGHA 4HLEA 2DWQA 2G1EA 3R2IA 3PRPB 4MELA 1FCCC 1FRDA 1EWCA 4DQOC 2FUHB 4R3DA 1T0QC 3U7DA 1L0VB 3A33B 3IVFA 1RYJA 1RM6C 4ZHPA 4M00A 4L2YA 4ZRPA 3IT4B 2MBQA 4N9F4 4OZBA 2KOXA 2Y3AA 3DWMA 2AQ3B 4XX5A 3BK1A 2M19A 1BXTA 1IGDA 2C7HA 2FBWB 3ZRFA 4BBNF 4W9DA 3QIJA 1T0RC 3QC8B 2KTRB 3SR6A 2D10A 2ZJDA 3V62A 3LB8C 1WX7A 1XXGA 3ONSA 2NTTA 5EE1A 2EKIA 5FR3A 2WXKA 4GDLB 5KHOA 1P1AA 4AS1A 1XLOA 2INPE 4YWGG 2ZCCA 3UF8A 3TMPB 5G2NA 2MJEA 2VRRB 4GLSC 4RF0A 4W9CA 3ZGZA 3DCGA 3PHXB 4B0EA 4KSLC 1Q10A 3QA8A 2BWES 3NZ3A 3M95A 3T3NA 3GE3C 1UUPA 3CF6E 4K7SA 4RF1A 3V3XA 4IOIE 1MPEA 4TMAB 2LRUA 2QMTA 4NJ6A 3DBRB 4CQNA 4HEA1 1V9JA 1PUTA 1XLPA 4HROA 4LNKA 1KJTA 2WXLA 1MJDA 3FC4A 4YT0B 2KKCA 4EUTA 1E8WA 2I1KA 2N7JA 2WXOA 2FNJB 3DPDA 2LEKA 1FM0D 1MFWA 2XEWA 3AU4A 2M4NA 4GDKA 1Y8RC 4RM9A 1NDDA 2DBYA 2ZW1A 3AI5A 4W9JA 1LXDA 4G50A 3OAWA 4K1RB 1C77A 3Q8FA 2WLBA 3R3MA 2K25A 2KLCA 2V3PA 4IM3A 5J17A 4PS7A 1JWAD 2EMSA 4C7YA 1GNUA 3RT3B 2IDYA 3ZNGC 4KDIC 3VR9B 2INCC 1WR6E 1QOAA 3V6EB 5EDSA 2RMMA 2INNE 5AUKA 4WJNA 2KJHB 1VZ7A 4US8A 1IBXA 1TT5B 3N3KB 4GGQA 2G4SA 3DWGC 5AZGA 3HK0A 1TY2A 2N9PC 3PS6A 3ABVB 4E3CA 2AWTA 1T5XD 2LHDA 3IAS1 4D2KA 5J2RA 2NR2A 4S17A 5IA7A 1KLGD 4YTPB 2Z0DB 3BYYB 2L76A 2DZMA 1WY8A 1FMAD 2RPQA 3DVNV 4IW0A 4ZHOA 4KIKB 2MEKA 3MJWA 2UYZB 1WMHB 4WQOB 3SU8X 2BBCA 4GU2A 3VDZA 2JYTA 3OWEB 3B2FA 1GG3A 1ZGUB 2ZVOA 4FLHA 2BPSA 2SAKA 3HM6X 2WQYB 4HKQA 5AZHA 3AE6B 4XZ4A 3DDCB 3LDZE 4HPPA 1QF6A 4PS3A 4BKSD 1XEEA 3UI3A 4LDTB 2IGDA 1OEYA 2QHOA 1EU3A 4REZA 1TKEA 1GB1A 3FAHA 4USAA 1LGRA 3TUOA 1N61A 1RFAA 4KDLB 2HDEA 5CTRC 2I1JA 1VDVA 3Q14C 2CS4A 2V4LA 5AUIA 1AYFA 3KQ4A 1I4QA 3H9DA 4YSYB 1WGGA 2KK8A 1YJJA 3QCAA 5MPOA 5C23A 2G4DB 1LO5D 2NBUA 4MJSB 2LGIA 2MH7A 4MACA 5JZEB 1CK1A 2LJIA 5DCNA 2DZIA 2DX5B 2BS3B 3ML9A 4ANWA 1JROA 4PYUA 3PPAA 3AE4B 4M01A 3AN1A 2MBBB 2WX0A 3GP7A 1A5RA 1F2RC 1T3QA 2V9HA 2O2VA 5D6JB 2MWSB 2KQ4X 2LI5A 1IYFA 2J0JA 4FA6A 1NVID 2N4FA 2JQRB 2YEPF 3N20C 2JPHA 1KRHA 3ZKJC 5DPRA 2K9XA 1T0YA 3SFDB 2NMQA 1E6EB 2R61A 3ZNZB 1YN3A 2XK5B 3ZNID 2MRPA 1WGYA 4JWSC 4IWPA 4A3OA 3AEFB 1ZKHA 3PRZA 4W9FA 1SIFA 1YOVB 5DPSA 2D2QA 1OQRA 1V5OA 2VZKB 1ESFA 3NJTA 2ZW0A 2RR9A 4BAXA 4K3CA 4DBGA 3TSSA 4BOZB 3QWZB 3SHQA 3ZTCA 2BYTA 1V97A 4QAYA 4GIVA 2KYWA 2K3UA 1YJ1A 3T8MA 2L05A 2LGSA 1E8XA 3CWIA 1ZE3D 3C8YA 1WYGA 4MM3B 3VUWA 1ZOYB 1WJNA 1FCLA 3NVWA 2MBOA 2PEAA 4J6IA 2WXFA 1E7VA 3Q6BA 1N62A 2EELA 4JIOU 4YTMB 1D4BA 5HFYA 4RGNA 2NBWB 4WAFA 3GB1A 3I5JC 3KUDB 2JWZA 4DHJD 1PGXA 3IAM1 1QQRA 2MP2A 3D32A 1WFYA 3VXWA 2AL6A 1ZXHA 1EM7A 2DENB 4EZLA 3ENEA 2ZVNA 1A70A 5E6NA 2JXXA 4MH8A 3GZNB 1YIWA 5IKCM 2BKFA 1N5WA 1GPXA 4M8MA 3EGRA 1WJ4A 1WJUA 2JVCA 3MC8A 1B9RA 2WGSA 1TIFA 4AWJA 1Z5SB 5EE9A 1P3QU 1DOXA 4HK2A 4FJZA 2JY6A 3P4SB 4E74A 4WWMA 3RZFA 1FEHA 4ASWC 1N60A 1KLVA 4MGYE 1FRRA 3NOBA 3EC8A 1UNSA 4A90A 1UBQA 3DBHI 3OLMD 4RGMA 2K8HA 4NAWA 3WAPA 1WM3A 3IBEA 4W9KA 4DHZE 3SEBA 2D3BA 1QOBA 5DPWA 4C4VB 3AEGB 2A4ZA 1U4AA 3KUZA 2GBJA 1MI0A 4MT5A 3T3OA 2Z8LA 1J19A 1EWYC 4WIPA 2KDEB 3BIID 4LJOB 1TJEA 3N1ZC 3DBLI 3L08A 1SEBD 1EO6A 4YSXB 2LJ5A 2WU2B 2DZKA 1MHHE 4TQ1A 1WI0A 3N9YC 2IGGA 1TS5A 1IBXB 3PLUA 4IG7B 1Q0WB 4DHJB 3KWVA 3AE9B 4A9AA 2J0KA 3BK2A 2DAJA 3ZJTA 4GOCA 1P9DU 2CHWA 2OEDA 4HXDA 2N1WA 5L95C 5LXIB 1J7CA 5GXGB 3VR8B 5HKHA 3KYCD 1DOYA 5D2MB 1C4AA 4JX1C 1WYWB 3TEYA 2C5LC 3EECA 3RNAC 4HVBA 4G0NB 3GS2A 2WXIA 2KACA 2GLSA 4US9A 3BVGA 2JU6X 1C9FA 3NHEB 2Q5WD 4TQ0A 4MM3A 4H2AA 2G9HD 3W1SC 3Q3OC 1SF0A 4NJ7A 1QOGA 1LFDA 4YXDB 2PTLA 1UH6A 4NJCA 1M4VA 1RRBA 2EMTA 3Q3JA 1JMLA 1RLFA 2FCQA 2KXJA 1UZXB 2VZKD 3EFUA 2KC1A 2J42A 1ZUD2 1OTRB 3A4SC 2BQQA 4IWQA 2KDIA 3L17A 2IO0B 2KMMA 2G45B 3DOWA 3HVZA 3VHTC 3A1QB 4WURA 2FUG1 1F1HA 3UINB 1FXIA 2CJOA 2L0TA 1ET6A 3N1XC 3A9JA 2JT4B 1WXAA 1UGJA 3L16A 4AOFA 4I6NB 1F9JA 2C9WB 2WYQA 4HWIB 2B3AA 2QC8A 2OJRA 3C19A 3JSVA 2WXMA 3Q3MC 2JZPA 4TSSA 3R66C 1E10A 1JCKB 2NS5A 2Y5CA 4PK1A 2H88B 1PDXA 3CSTA 1L4ZB 2IPKD 3ALBA 2N7DA 4DWFA 3ZNHB 1E8ZA 1C79A 4NNJB 3AXCA 5C1ZA 3GE8C 4MH0E 5TR5A 5IAAC 2KTRA 2OJWA 3ZJVA 2QEJC 3W1SA 3ZIMA 2BB5A 4KIKA 4M0WA 2IO3B 3DVNU 1H8CA 2C7MB 1BT0A 3DBLB 1E0ZA 1K51A 4K3BA 2MQJA 1KLUD 2Z59B 2XN9C 3BYTB 1HTQA 4GSWA 3L54A 2BKRB 3P42A 4HRSA 3VTVA 1TZOA 1WZ0A 3M62B 2M17A 4C7ZA 2QILA 2VH1A 1UF0A 2H89B 2WHIA 1XCQL 4LJPB 1JQ4A 1CMXB 1TKGA 3DHIC 3JW0X 3NUHB 4DDGD 4MJSA 4AP4C 4OZAA 3WA0A 1WSPA 1VCBA 1EF5A 4RFBA 1SIJA 4F1SA 2O6VD 3HM3A 5HI1A 1IPGA 3AECB 2KAJA 3DBSA 1ENFA 1I42A 4XGAB 2AX5A 2V1YA 2R2QA 3P1MA 4IM0A 3BVMA 4DXFA 4HDOA 1C78A 2KZRA 2YVCA 4YSZB 1OQQA 1ZDVA 4KVGB 2KDMA 3V05A 1LM8B 3QAQA 3U7ZA 1JW9D 3ZUNA 5T8IA 4A20A 1ISNA 5CX3A 2GBKA 1V49A 2D3CA 1SJHD 5H8YE 2L32A 4ACFA 1RAXA 2AYOB 1HTOA 4TKNA 2KWCA 4KGSA 1TGZB 2JYEA 2W3RA 2D3AA 3U2SC 4B9KA 5JXVA 1WGHA 1OGWA 3BZDB 4OHJA 1HXYD 1ROEA 3VAWA 4TV3A 1TS4A 1K52A 1FO4A 3APDA 1WJ6A 5E6PA 4II3B 3IFWB 3PREA 1JWBD 1WXQA 2G3QB 1I4GA 3CMMB 2L1AA 1L6VA 4C80A 4I6LB 3PHWB 3V6CB 1SE4A 4KGTA 2O6VB 3U30A 3Q8CA 2KN4A 1P0RA 2K6DB 2KN5A 3FKYA 2KVRA 3R7RA 3N1YC 1CZPA 1WF9A 2XK5A 2W9NA 1FXAA 3MC9A 3X0WA 2DHZA 1GAQB 2KLGA 4IC7B 1E8YA 2KANA 5L83A 1UWXA 3RNEC 4G11A 5BO4B 2KMAA 4ARCA 1Y56A 3H7SA 4JE3B 4GXBA 3R2TA 2HTHA 3B0AA 1KFYB 2GRIA 1C4CA 2WU5B 2FIFA 2QSDA 2KX0A 1FD6A 2N9XA 1J7BA 1I35A 2GBNA 2B76B 2BGFA 2WXHA 4NY0A 1FXTB 3GZNI 1NYRA 4HCPB 2KHWB 3AE2B 2GI9A 4LLGM 3NZUA 1I7HA 2MA9B 3NZSA 1I4XA 1QKZA 5GMVA 2QIEB 3ZVVA 3U52E 3I3TB 2ACZB 3PZDA 2UU7A 3B2GA 3Q3NC 2KJRA 4B0MA 2N7EA 3AEDB 2LGYA 4E71A 2ZNVB 3VH4B 2NPTB 2WXNA 1XQQA 2DYOA 1K50A 2FAZA 1D5MC 5LLIA 1BMLC 3PGEA 1KF6B 2CHZA 2LFIA 2X8XX 3I9V1 4K7UA 3M63B 4IDIA 1L2NA 4A55A 3UIPB 1QILA 2Y5BB 3KW5B 5TSSA 1NYQA 1XT9B 3KYDD 2KT7A 1VD2A 2D07B 1HZ6A 3QK0A 3W1YA 4MSMB 3I57A 2N9EB 5AZFA 4ICVA 3A9JB 1FFVA 2GBRA 2PIAA 2ZPYA 3AH7A 1VJKA 2L00B 4JQWC 3W5UB 3WIMA 3JSVB 3HUIA 5G5GA 1FFUA 1HA5A 4NZLB 4ANVA 1STEA 1WXSA 1ACCA 1KTKA 3TCAA 4FHKA 1L6UA 2K1FA 5D3DA 3RNCC 4IM2A 2RD0A 1S1QB 3P2BA 4BKTA 1FNVA 4P16A 4C56C 5BMHA 2YLMA 1FNUA 2GMIC 2ZPNA 5JHBA 1F52A 1R4NI 2HJ8A 3AEEB 5IOIA 4LCDE 1GJZA 1AARA 1TZ1A 2MLBA 1YQBA 3MHSD 3W2DA 4HJGE 1TYGB 2M0AA 2TSSA 2BF8B 2LVQA 4FADA 5EE3A 4KGRA 1WXMA 3I63C 3P4QB 1KM7A 1T6BX 4O1NA 3VTUA 4M0WB 4W9HA 2AQ2B 2N9KA 2V3NA 4JLCA 2BYVE 1IP9A 2J52A 4TUUA 4BKGA 1OEYJ 1YMHE 1WM2A 5JHAA 4OVUA 2QJLA 1Q5WB 3IT6B 3RPFC 3VUXA 2FCNA 2K0PA 1XF5L 2DLBA 4LNFA 2MW5A 4A3PA 5J18A 4XWTA 1E5WA 1MHXA 5E6JA 1J0GA 2KMCA 3ML8A 3FILA 2OHFA 4BZAA 1PYWD 3Q8AA 3UQAA 3LXFA 2W82A 3AV8A 3RI7C 1R4MB 1TY0A 2CHXA 4B6WA 2L83A 1MVKA 4YTNB 4ZYNA 3RULA 2L52A 3MP9A 4AJWA 2KQ7A 3KLSX 3EA6A 4JL9A 3L10B 1YN5A 2AQ1B 3A4RA 2PLPA 3GOEA 1WGDA 5BYRA 2MHJA 2KD0A 1UWMA 4EZKA 2PE9A 2HD5B 4P1BC 5HHDG 4LNNA 4XWWA 2RPVA 4BOSC 2O6VA 2D5GA 2DYMA 4K81A 1AW7A 3ECIA 4RCOA 2L3ZA 2NBVB 1R7SA 1MG4A 1TTNA 3IXSA 5IP4D 4OVVA 2LHEA 3WALA 2L8JA 2MX2A 3AEBB 3H6NA 1WGKA 5G55A 4EZJA 4RNAA 5G5HA 3ZXRA 3LJ3A 3IG3A 4DK5A 2XNAC 3AE3B 2PE6B 4CYEA 2MJ3A 3EFCA 4OVZA 4IKGA 4F7ZA 1QLBB 3ZYYX 2ICIA 3ZDTA 3ZXVA 5BYQA 4FXCA 3EUB2 3VQIA 2RDHA 2KVZA 1JWUD 4ARIA 3AE8B 4AUQC 1DOIA 1XLNA 1V8CA 2J7QB 4WQMA 1R4NB 4FBJB 3NY5A 3EHVA 4AJYB 2GB1A 1AN8A 1WX9A 1YNTE 3WAMA 4MGIE 1WWTA 4UDUC 3B9JA 3NS1A 4URKA 3RN9C 2C60A 1QZEA 3Q69A 2Y5PA 1XLQA 2JZZA 4ANUA 1JALA 3UGBB 2LRWA 1ZP0B 3APFA 2NPTA 1X1MA 2W55A 1AWDA 2KFKB 3M3JA 5H92C 3Q8EA 1JWSD 2IY0B 2KQSA 2J0MA 4KZCA 4P7IA 2C7NB 4W9EA 1ZPSA 1B1ZA 2LVOA 1V2YA 4WWNA 3AEAB 3HRDD 3R7QA 2REXA 4KKJA 1YN4A 2K39A 2MBEA 2OOBB 2PMVA 3H7PB 4MGZE 1CJEA 1RWSA 3A1QA 3TL5A 4KV2A 5AEKB 1YQ3B 3KVFB 2HE7A 3PSEB 3APCA 3P4RB 2PJHA 1YD8U 2LUEA 2N9LA 2KFJA 5D94A 2ZNVC 4W9GA 2WWZA 1NI3A 3HIZA 1GC6A 3RNGC 2WDQB 2ONQA 4XDDA 3PVLA 4WWPA 2IYDB 2NCNA 4AQ7A 1GC7A 3J9CA 2NTSA 4NPNA 3VTWA 2BT6A 2IZVB 4N58A 5C3JB 4DDID 2LUMA 2N0SB 3E56A 2M1MA 2A5UA 1IGCA 2LXCA 1BUIC 4HJKA 3T9LA 2YEPB 1XCTL 1YX5B 1WR1A 2WNMA 2MJDA 1V1PA 4FJYA 1SE2A 2DZJA 1VLBA 1WX8A 1E7UA 1V6EA 2KX3A 5CHFA 4JWUC 4RM8A 3Q8BA 2CR5A 1H4RA 1FPYA 4DHZB 3N32A 4PT5A 5I4DA 2L0FA 2M8SA 1Q1OA 2E6XA 3QX1A 2JWUA 3PZ8A 4LNOA 2D11A 1P7EA 1WXVA 4P1CC 2INDC 2WXRA 1PQSA 1I4HA 4N6EB 3VH3B 3SDLC 2AEHA 1VR9A 2WP9B 1T0SC 3NVZA 1WIAA 2D3GA 1C1YB 2PVOD 2IY1B 3H7PA 2PKOA 3K9PB 2BTEA 3ZTDA 1JRPA 3O65B 4GDKB 4C4VA 1MG8A 2CU1A 1JWMD 4RMAA 2IO1B 4WH4A 1TKYA 3RD2A 1WE7A 3OJ3A 3DHHC 3L0WB 2WDVB 1E7PB 2QDFA 2MCNB 2MBHA 2M56B 2GBMA 1HE8A 1VZ6A 3MC0B 4NQLB 2CU3A 4DXAB 1G6JA 3TBLD 1WRIA 2CKHB 1V1OA 3TEWA 4HDQA 1KOTA 1WGRA 4WJQA 1C4PA 1EUVB 4IWOA 2K8CA 4A8XC 5IO9A 1QOFA 4HPMB 2BS4B 2UWQA 1KH0A 1D3ZA 1NENB 2J53A 3CSFA 4PYZA 3URYA 3UQBA 5FKAC 1P7FA 2WXQA 1FIQA 5D3IB 2I2YA 1NBFC 4OW0A 3H1UA 4EE2A 1N63A 1L0XB 2DYBA 4KSKC 3BWUD 3TIXA 3DVGX 4L23A 4BVUC 2LGXA 2BYFA 1LQBA 1HQRD 3ETRA 4KKIA 3RFZB 1V80A 2FCSA 1FNWA 2FCMA 1I4PA 3RZWC 5KHQA 2RSUA 3ZDMC 5C2TB 2BYEA 3ZJUA 2E3TA 2W3SA 2BVCA 2KO3A 2CJNA 3W9CB 4GMVA 3QQ8B 2JSVX 4CHKA 3NRZA 3AMZA 4HPLB 3QHTA 2ON8A 4WAAA 1SE3A 4NQKE 1SXTA 2FE8A 3P4PB 3UIOB 2WXJA 1N6ZA 3NVYA 2WXGA 4WWOA 1WMHA 4EKUA 4WJOA 2JXTA 1P98A 4JPSA 4OZCA 2KWDA 1WRDB 1WE6A 2JX5A 1V5TA 3R8BA 3C0RB 3JVZX 1TBEA 4BBNC 2NVUI 4MDKE 3B1LX 3L13A 2MP2B 3DVGY 1CQVA 1J8CA 2XBBC 2WDRB 2IJ0A 3LYYA 1E9MA 1SSNA 2LWPA 3L4PA 3RYTA 4ZRIA 4RGOS 2V0GA 4HKZE 1JRUA 2HTME 3VUYA 1F0ZA 3K9OB 4YL8A 3B08A 4L1BA 4KX6B 3AE1B 4LK0M 2ZEQA 1L0YB 4LTUA 4XDCA 3E9SA 1GB4A 2R2OA 1J7AA 2IO2B 2LD9A 4P6VF 4ZOHC 4ZRKA 3ZRCA 5IN7A 4ZDVA 2DNFA 3OJ4B 4W9LA 2L7RA 1D5ZC 3PTFC 4NAWB 3BINA 1E90A 3RNBC 4ZRJA 1VRAB 3HVDA 3DQVA 1DYQA 1C3TA 1QT9A 3PV1A 1ZW7A 2DAFA 4BKSA 2JRHA 2KWVB 3KWLA 1ET9A 4NAMA 3QJZA 2K5PA 2LVPA 2VH2A 3AU5A 4I6PA 2WXPA 4LDTD 4KZ0A 4DXGA 2QCZA 1IUEA 1YJIA 3AM9A 1R4MI 3DBHB 5LXHA 2HJ1A 4Q2JA 2AL3A 2KTFA 3RCZA 2KDBA 5BMIA 4RGTA 2ZZPB 4FN2A 2MSED 3CIRB 4FJVB 1NEKB 3MHZA 3MFGA 1V86A 3JYUA 5EE0A 3O13A 4IUMB 4EEWA 2WS3B 2GOWA 2WDTB 1EF1A 3NG0A 3DBRI 4GB9A 4WJPA 2PPHA 3MJ5A 1GOZA 2M0XA 3X23A 1UGMA 3WANA 1RFKA 5FR6A 2JRIB 2LGDA 3NS8A 4MSQB 5BYSA 2BB6A 3AULA 3A9KB 2JF5A 3U8ZA 4M02A 2V4IB 2K22A 3BVZA 4PS8A 4CO7A 3FILB 3SFEB 1ZXIA 2J4XA 3PT2B 3OG5A 4EFOA 2KWUB 5BMGA 2KC2A 1Z2MA 2PVGC 3KUCB 4ZYSA 1V1PB 1YX6B 4ICUA 3ZLZA 4MGKE 4B95A 3ZW3A 1PGAA 5D7GA 2KJ6A 1DGJA 2RDGA 3TJPA 1TS2A 1VZ8A 2BWFA 4ANXA 2V3SA 1I4RA 1D5XC 2BS2B 1SBBB 2LZ6A 1EU4A 2RGFA 3SD5A 2KDFB 1SB3C 4XE0A 4A6QA 4FHJA 1YQ4B 4N59A 1PGBA 3AE7B 1L5PA 5DPTA 3U4EG 3VRBB 1N5XA 2FIDA 4LNIA 3Q2AC 1F2RI 4F8CB 3PO0A 1TS3A 3TEZA 1GUAB 5HG2A 4K7WA 2O2VB 2JZ3B 1S3SG 3RUIB 2ASQA 1ZDXA 1C76A 3VVWB 3HHMA 1M94A 1L7YA 4GDLA 3PRMB 5FK9C 2K8BA 3V61A 3TEXA 2EKEC 4JGHB 3BY4B 3ZO5B 4J3OD 1K8RB 2X38A 1UELA 1UBIA 4W9IA 1PFDA 1WH3A 2W54A 3H8HA 4MEMA 4ZRQA 1OQYA 2KNBA 1D6EC 3AB5A 4C00A 2BW2A 2PW9A 4HCNB 1HZ5A 4II2B 4S0RA 2JUOA 3PZ7A 1NI2A 1SJED 2ZCBA 4XYCA 3N30A 3S2AA 4M8NA 3QARA 5JH5C 1SE9A 3VRAB 1XO3A 3IHPC 5CHVC 3NVVA 2LXAA 2Z0EB 4GN1A 2WX1A 3VFKA 1F77A 1OFFA 4X57B 3P63A 3MTNB 4G3XB 1HEZE 2LMCA 3A9KA 3ZQ4A 4FULA 1K53A 1UD7A 4BFRA 4EOYA 3WAOA 4RH6A
chains in the Genus database with same CATH topology
1JRPA 2I38A 3B2GA 1L4DB 1N5WA 1GPXA 4B0MA 3AEDB 3EGRA 4GDKB 1B9RA 2SEBD 1JWMD 2WXNA 2DYOA 5EE9A 1DOXA 3WCQA 3P4SB 1K50A 1D5MC 4ITKA 4WWMA 1FEHA 1BMLC 1N60A 1KF6B 3I9V1 2LFIA 4WH4A 5BYSA 1TKYA 4IDIA 5LNK1 1FRRA 4A55A 1QILA 3W5VB 2WDVB 3AE5B 1E7PB 5TSSA 1NYQA 1UNSA 4A90A 2IGHA 2DWQA 2G1EA 3R2IA 1HZ6A 2M56B 1VZ6A 4RGMA 1FCCC 3MC0B 1FRDA 2CU3A 1EWCA 4DQOC 3SEBA 3I57A 1WRIA 1V1OA 3TEWA 4R3DA 1FFVA 1QOBA 1L0VB 3AEGB 1C4PA 2PIAA 3AH7A 4A8XC 1VJKA 1MI0A 1RYJA 4MT5A 3T3OA 2Z8LA 3W5UB 1EWYC 4WIPA 1QOFA 3HUIA 5G5GA 1FFUA 1RM6C 4ZHPA 2BS4B 3BIID 1TJEA 4L2YA 1HA5A 4NZLB 4ZRPA 3IT4B 1STEA 4OZBA 1KH0A 1ACCA 1NENB 2Y3AA 3DWMA 2J53A 3URYA 1KTKA 5FKAC 2AQ3B 1P7FA 1L6UA 3BK1A 2WXQA 1SEBD 2M19A 1FIQA 5D3IB 2I2YA 1BXTA 4YSXB 2WU2B 4OW0A 5D3DA 4EE2A 1MHHE 1N63A 1IGDA 2FBWB 4TQ1A 1L0XB 3N9YC 2IGGA 1TS5A 3BWUD 3SR6A 1IBXB 4L23A 1FNVA 3KWVA 4P16A 3AE9B 1HQRD 3ETRA 3LB8C 4KKIA 4A9AA 4C56C 3RFZB 5BMHA 3BK2A 3ZJTA 1FNWA 2OEDA 1FNUA 1XXGA 2NTTA 1I4PA 5EE1A 2EKIA 5FR3A 5C2TB 1J7CA 2WXKA 4GDLB 5GXGB 3VR8B 2E3TA 2W3SA 3ZJUA 2CJNA 4AS1A 3AEEB 3W9CB 1XLOA 2INPE 1DOYA 4YWGG 1C4AA 4JX1C 2JSVX 3NRZA 3AMZA 3TEYA 2ON8A 3W2DA 4HJGE 2MJEA 1TYGB 3GS2A 2WXIA 2M0AA 1SE3A 2KACA 2TSSA 4GLSC 4RF0A 3ZGZA 5EE3A 4KGRA 4US9A 1SXTA 2FE8A 3BVGA 3P4QB 3P4PB 4B0EA 2JU6X 2WXJA 4TQ0A 2Q5WD 1C9FA 1T6BX 4O1NA 3NVYA 2WXGA 4H2AA 1Q10A 2G9HD 2JXTA 2AQ2B 2N9KA 3NZ3A 3T3NA 1UUPA 2V3NA 4JPSA 1SF0A 4RF1A 1QOGA 4OZCA 2KWDA 4YXDB 2J52A 3V3XA 2PTLA 2JX5A 1YMHE 4IOIE 1M4VA 1MPEA 4NJCA 4TMAB 2QMTA 2QJLA 3IT6B 3RPFC 2K0PA 1XF5L 3R8BA 1JMLA 2DLBA 4CQNA 4HEA1 1PUTA 1XLPA 2VZKD 4HROA 2J42A 1ZUD2 4XWTA 1CQVA 2WXLA 1MHXA 2KMMA 3HVZA 3FC4A 4WURA 2FUG1 4YT0B 2WDRB 1FXIA 2CJOA 5E6JA 1ET6A 2IJ0A 3FILA 3LYYA 2OHFA 1E9MA 1PYWD 1SSNA 3Q8AA 2N7JA 2WXOA 1UGJA 2LEKA 3LXFA 3L4PA 1FM0D 2W82A 3AV8A 4RGOS 1TY0A 2V0GA 2L83A 1MVKA 2HTME 4HKZE 4YTNB 1F0ZA 2L52A 2WXMA 3MP9A 2DBYA 2ZW1A 2JZPA 4L1BA 4KX6B 3AE1B 3KLSX 4TSSA 4LK0M 1L0YB 4LTUA 4XDCA 1C77A 3Q8FA 3EA6A 2WLBA 1E10A 3E9SA 1JCKB 2V3PA 1GB4A 1YN5A 2AQ1B 2Y5CA 2H88B 1J7AA 1PDXA 1L4ZB 2IPKD 2PLPA 4P6VF 4ZOHC 5BYRA 4C7YA 1JWAD 1C79A 2IDYA 1UWMA 3VR9B 1D5ZC 1QOAA 5HHDG 4NAWB 2RMMA 2INNE 5AUKA 1VZ7A 4US8A 2RPVA 4XWWA 1IBXA 3ZJVA 2QEJC 3W1SA 2BB5A 2D5GA 2BTEA 2DYMA 4M0WA 1VRAB 3DWGC 3HVDA 1DYQA 1QT9A 1AW7A 4RCOA 1TY2A 1R7SA 3ABVB 3KWLA 3IXSA 1E0ZA 1ET9A 4NAMA 2K5PA 1K51A 2LHEA 1T5XD 2LHDA 3IAS1 4D2KA 1KLUD 3AEBB 2WXPA 2XN9C 1WGKA 1KLGD 3BYTB 4YTPB 4DXGA 4RNAA 1IUEA 1YJIA 3BYYB 3AM9A 5G5HA 3P42A 2XNAC 4HRSA 3AE3B 1FMAD 1TZOA 4Q2JA 2MJ3A 4OVZA 4IKGA 1QLBB 4RGTA 5BMIA 3ZYYX 4ZHOA 2ICIA 3CIRB 2MEKA 4C7ZA 5BYQA 1NEKB 2QILA 3MHZA 3MFGA 4FXCA 3EUB2 3VQIA 2RDHA 5EE0A 2BBCA 2H89B 3O13A 1XCQL 2JYTA 3OWEB 1JWUD 3B2FA 2WS3B 1JQ4A 2SAKA 4ARIA 3AE8B 1DOIA 1XLNA 2WQYB 4HKQA 1V8CA 1TKGA 3AE6B 4WQMA 3NUHB 1QF6A 3MJ5A 1GOZA 1XEEA 4OZAA 3UI3A 1WSPA 2IGDA 2GB1A 4RFBA 1AN8A 1RFKA 1EU3A 1SIJA 1YNTE 4REZA 1TKEA 1WWTA 4UDUC 1GB1A 3FAHA 2BB6A 4USAA 4RH6A 3B9JA 3NS1A 5HI1A 3TUOA 1N61A 3AECB 2HDEA 2KAJA 2V4IB 3Q69A 2K22A 2Y5PA 3BVZA 1XLQA 1ENFA 1VDVA 5AUIA 3FILB 1AYFA 2AX5A 3KQ4A 1I4QA 3P1MA 4YSYB 1JALA 3SFEB 3BVMA 4DXFA 1ZP0B 1YJJA 1C78A 1ZXIA 2J4XA 4YSZB 5MPOA 2W55A 1OQQA 1ZDVA 1AWDA 1LO5D 2LGIA 2MH7A 4MACA 5H92C 2KDMA 3V05A 1CK1A 2LJIA 5BMGA 3Q8EA 1JWSD 3U7ZA 2PVGC 1JW9D 4ZYSA 2BS3B 1ZPSA 1B1ZA 1V1PB 5T8IA 3AEAB 1JROA 3HRDD 3AE4B 4KKJA 1YN4A 3AN1A 3GP7A 2PMVA 1PGAA 1F2RC 1T3QA 5D7GA 1CJEA 1SJHD 1RWSA 5H8YE 1DGJA 2L32A 2RDGA 2KQ4X 1TS2A 1YQ3B 1VZ8A 1NVID 1I4RA 2JQRB 4KGSA 1D5XC 2YEPF 2JYEA 2W3RA 3P4RB 2BS2B 1SBBB 3U2SC 1EU4A 5JXVA 1SB3C 1KRHA 4XE0A 3BZDB 4A6QA 2N9LA 4OHJA 1YQ4B 4N59A 1HXYD 1ROEA 1TS4A 2K9XA 1K52A 3SFDB 2NMQA 1FO4A 1E6EB 2R61A 1PGBA 1YN3A 1NI3A 3AE7B 1L5PA 3U4EG 3VRBB 1N5XA 1JWBD 1WXQA 1F2RI 4JWSC 1I4GA 3PO0A 2WDQB 1TS3A 2ONQA 2L1AA 1L6VA 4XDDA 3AEFB 3TEZA 4C80A 5HG2A 4AQ7A 3J9CA 1OQRA 2NTSA 2VZKB 1SE4A 4KGTA 1ESFA 2BT6A 1ZDXA 3Q8CA 4N58A 1C76A 5C3JB 2LUMA 2N0SB 2ZW0A 2KN4A 3E56A 1IGCA 1BUIC 3TSSA 2YEPB 1XCTL 5FK9C 1CZPA 3TEXA 2WNMA 1V97A 2BYTA 1FXAA 4J3OD 2MJDA 1V1PA 1GAQB 1SE2A 2X38A 1VLBA 2K3UA 1PFDA 1UWXA 2W54A 3H8HA 4JWUC 4ZRQA 3Q8BA 4ARCA 1Y56A 1D6EC 3AB5A 4JE3B 3CWIA 3R2TA 1ZE3D 3C8YA 2BW2A 1WYGA 4MM3B 1KFYB 2PW9A 1ZOYB 1HZ5A 2GRIA 3PZ7A 4PT5A 1C4CA 1FCLA 2WU5B 3NVWA 5I4DA 2QSDA 2WXFA 1N62A 1FD6A 1SJED 1J7BA 2EELA 2E6XA 2B76B 2WXHA 3VRAB 4YTMB 1D4BA 2JWUA 1XO3A 5HFYA 3PZ8A 4RGNA 1NYRA 4WAFA 3GB1A 3NVVA 1P7EA 3AE2B 2WXRA 2GI9A 1I4HA 1PGXA 4LLGM 4N6EB 3IAM1 1I7HA 1QQRA 1F77A 1OFFA 1VR9A 1ZXHA 3P63A 1EM7A 2WP9B 1I4XA 3NVZA 1QKZA 2LMCA 1HEZE 2PVOD 1A70A 3ZQ4A 4MH8A 2PKOA 2QIEB 3U52E 1K53A 2ACZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JRP A;  3AEB B;  1TYG B;  1WGK A;  3B2G A;  1YQ4 B;  4N59 A;  4YTP B;  1N5W A;  1ROE A;  1GPX A;  1IUE A;  1YJI A;  5EE3 A;  3AM9 A;  3AED B;  2K9X A;  3P4Q B;  3P4P B;  4US9 A;  5G5H A;  1FO4 A;  3SFD B;  1E6E B;  3AE7 B;  2Q5W D;  1NI3 A;  1B9R A;  1L5P A;  3NVY A;  3VRB B;  1N5X A;  4HRS A;  3AE3 B;  1FMA D;  1JWB D;  5EE9 A;  1WXQ A;  3WCQ A;  1DOX A;  2MJ3 A;  3P4S B;  4ITK A;  1QLB B;  4JWS C;  4WWM A;  3PO0 A;  3ZYY X;  4ZHO A;  2WDQ B;  1N60 A;  3CIR B;  1KF6 B;  1SF0 A;  4C7Z A;  1L6V A;  1NEK B;  1QOG A;  1TKY A;  3AEF B;  4IDI A;  4C80 A;  1FRR A;  4FXC A;  3EUB 2;  3W5V B;  4YXD B;  2WDV B;  3AE5 B;  1E7P B;  5EE0 A;  1NYQ A;  2H89 B;  2JX5 A;  1OQR A;  2QJL A;  3B2F A;  2WS3 B;  3RPF C;  2DWQ A;  1JQ4 A;  2G1E A;  2BT6 A;  2M56 B;  3AE8 B;  1DOI A;  1XLN A;  2WQY B;  4N58 A;  1FRD A;  1V8C A;  2CU3 A;  1PUT A;  1TKG A;  1XLP A;  3AE6 B;  2N0S B;  4WQM A;  5C3J B;  4HRO A;  1QF6 A;  1WRI A;  1ZUD 2;  1FFV A;  1QOB A;  1L0V B;  2KMM A;  3HVZ A;  3AEG B;  1RFK A;  2PIA A;  1SIJ A;  3AH7 A;  3FC4 A;  4YT0 B;  1CZP A;  1FXI A;  1TKE A;  2CJO A;  1VJK A;  1WWT A;  2WDR B;  1RYJ A;  1V97 A;  1FXA A;  3FAH A;  4USA A;  3W5U B;  1EWY C;  3B9J A;  1QOF A;  3HUI A;  1N61 A;  2OHF A;  1E9M A;  1FFU A;  1RM6 C;  2MJD A;  3AEC B;  5G5G A;  4ZHP A;  1GAQ B;  2BS4 B;  3BII D;  2LEK A;  1TJE A;  3LXF A;  3L4P A;  1VLB A;  2KAJ A;  1FM0 D;  3AV8 A;  2K22 A;  2MJE A;  1XLQ A;  1VDV A;  1NEN B;  2L83 A;  2HTM E;  1PFD A;  3DWM A;  4YTN B;  1F0Z A;  5AUI A;  1AYF A;  2L52 A;  2W54 A;  2AX5 A;  2DBY A;  3P1M A;  4JWU C;  1JAL A;  4YSY B;  1L6U A;  4KX6 B;  3AE1 B;  2M19 A;  3SFE B;  1FIQ A;  3AB5 A;  1ZP0 B;  1YJJ A;  1ZXI A;  3NS1 A;  3CWI A;  4YSX B;  4LTU A;  2WU2 B;  1WYG A;  2WLB A;  4YSZ B;  5MPO A;  2W55 A;  1N63 A;  1OQQ A;  1E10 A;  1KFY B;  2FBW B;  2Y5C A;  1ZOY B;  2H88 B;  1J7A A;  1AWD A;  1PDX A;  2WU5 B;  4P6V F;  3NVW A;  2MH7 A;  5H92 C;  1N62 A;  4ZOH C;  3SR6 A;  1J7B A;  1JWA D;  4C7Y A;  2PVG C;  1JW9 D;  2BS3 B;  1UWM A;  3VR9 B;  2B76 B;  3VRA B;  3AE9 B;  4YTM B;  1QOA A;  1XO3 A;  3ETR A;  3LB8 C;  3AEA B;  4A9A A;  5AUK A;  1JRO A;  4US8 A;  1NYR A;  3HRD D;  3AE4 B;  3NVV A;  3AN1 A;  3DWG C;  3AE2 B;  5EE1 A;  1QT9 A;  1T3Q A;  2EKI A;  5C2T B;  1CJE A;  4N6E B;  1RWS A;  1J7C A;  1DGJ A;  1I7H A;  5GXG B;  5H8Y E;  2E3T A;  2W3S A;  3VR8 B;  1OFF A;  1YQ3 B;  2CJN A;  1R7S A;  3AEE B;  3P63 A;  3ABV B;  2WP9 B;  1NVI D;  1XLO A;  3W9C B;  1DOY A;  3KWL A;  3NVZ A;  1E0Z A;  4JX1 C;  2JQR B;  2PVO D;  1A70 A;  2W3R A;  2PKO A;  2K5P A;  2QIE B;  3P4R B;  2BS2 B;  3NRZ A;  3AMZ A;  2ACZ B;  1SB3 C;  1KRH A; 
#chains in the Genus database with same CATH topology
 2I38 A;  1WZ3 A;  3DHG C;  1L4D B;  5CHW A;  4XC2 A;  3RNF C;  2RDB C;  2K6Q A;  1SGH A;  3RMK C;  2SEB D;  5E6O A;  3Q3F A;  1V81 A;  3WCQ A;  2LAS A;  4ITK A;  3KH0 A;  2KFK A;  5LNK 1;  3PLV A;  3W5V B;  3AE5 B;  3V60 A;  2N1V A;  1XD3 B;  2IBI B;  2IGH A;  4HLE A;  2DWQ A;  2G1E A;  3R2I A;  3PRP B;  4MEL A;  1FCC C;  1FRD A;  1EWC A;  4DQO C;  2FUH B;  4R3D A;  1T0Q C;  3U7D A;  1L0V B;  3A33 B;  3IVF A;  1RYJ A;  1RM6 C;  4ZHP A;  4M00 A;  4L2Y A;  4ZRP A;  3IT4 B;  2MBQ A;  4N9F 4;  4OZB A;  2KOX A;  2Y3A A;  3DWM A;  2AQ3 B;  4XX5 A;  3BK1 A;  2M19 A;  1BXT A;  1IGD A;  2C7H A;  2FBW B;  3ZRF A;  4BBN F;  4W9D A;  3QIJ A;  1T0R C;  3QC8 B;  2KTR B;  3SR6 A;  2D10 A;  2ZJD A;  3V62 A;  3LB8 C;  1WX7 A;  1XXG A;  3ONS A;  2NTT A;  5EE1 A;  2EKI A;  5FR3 A;  2WXK A;  4GDL B;  5KHO A;  1P1A A;  4AS1 A;  1XLO A;  2INP E;  4YWG G;  2ZCC A;  3UF8 A;  3TMP B;  5G2N A;  2MJE A;  2VRR B;  4GLS C;  4RF0 A;  4W9C A;  3ZGZ A;  3DCG A;  3PHX B;  4B0E A;  4KSL C;  1Q10 A;  3QA8 A;  2BWE S;  3NZ3 A;  3M95 A;  3T3N A;  3GE3 C;  1UUP A;  3CF6 E;  4K7S A;  4RF1 A;  3V3X A;  4IOI E;  1MPE A;  4TMA B;  2LRU A;  2QMT A;  4NJ6 A;  3DBR B;  4CQN A;  4HEA 1;  1V9J A;  1PUT A;  1XLP A;  4HRO A;  4LNK A;  1KJT A;  2WXL A;  1MJD A;  3FC4 A;  4YT0 B;  2KKC A;  4EUT A;  1E8W A;  2I1K A;  2N7J A;  2WXO A;  2FNJ B;  3DPD A;  2LEK A;  1FM0 D;  1MFW A;  2XEW A;  3AU4 A;  2M4N A;  4GDK A;  1Y8R C;  4RM9 A;  1NDD A;  2DBY A;  2ZW1 A;  3AI5 A;  4W9J A;  1LXD A;  4G50 A;  3OAW A;  4K1R B;  1C77 A;  3Q8F A;  2WLB A;  3R3M A;  2K25 A;  2KLC A;  2V3P A;  4IM3 A;  5J17 A;  4PS7 A;  1JWA D;  2EMS A;  4C7Y A;  1GNU A;  3RT3 B;  2IDY A;  3ZNG C;  4KDI C;  3VR9 B;  2INC C;  1WR6 E;  1QOA A;  3V6E B;  5EDS A;  2RMM A;  2INN E;  5AUK A;  4WJN A;  2KJH B;  1VZ7 A;  4US8 A;  1IBX A;  1TT5 B;  3N3K B;  4GGQ A;  2G4S A;  3DWG C;  5AZG A;  3HK0 A;  1TY2 A;  2N9P C;  3PS6 A;  3ABV B;  4E3C A;  2AWT A;  1T5X D;  2LHD A;  3IAS 1;  4D2K A;  5J2R A;  2NR2 A;  4S17 A;  5IA7 A;  1KLG D;  4YTP B;  2Z0D B;  3BYY B;  2L76 A;  2DZM A;  1WY8 A;  1FMA D;  2RPQ A;  3DVN V;  4IW0 A;  4ZHO A;  4KIK B;  2MEK A;  3MJW A;  2UYZ B;  1WMH B;  4WQO B;  3SU8 X;  2BBC A;  4GU2 A;  3VDZ A;  2JYT A;  3OWE B;  3B2F A;  1GG3 A;  1ZGU B;  2ZVO A;  4FLH A;  2BPS A;  2SAK A;  3HM6 X;  2WQY B;  4HKQ A;  5AZH A;  3AE6 B;  4XZ4 A;  3DDC B;  3LDZ E;  4HPP A;  1QF6 A;  4PS3 A;  4BKS D;  1XEE A;  3UI3 A;  4LDT B;  2IGD A;  1OEY A;  2QHO A;  1EU3 A;  4REZ A;  1TKE A;  1GB1 A;  3FAH A;  4USA A;  1LGR A;  3TUO A;  1N61 A;  1RFA A;  4KDL B;  2HDE A;  5CTR C;  2I1J A;  1VDV A;  3Q14 C;  2CS4 A;  2V4L A;  5AUI A;  1AYF A;  3KQ4 A;  1I4Q A;  3H9D A;  4YSY B;  1WGG A;  2KK8 A;  1YJJ A;  3QCA A;  5MPO A;  5C23 A;  2G4D B;  1LO5 D;  2NBU A;  4MJS B;  2LGI A;  2MH7 A;  4MAC A;  5JZE B;  1CK1 A;  2LJI A;  5DCN A;  2DZI A;  2DX5 B;  2BS3 B;  3ML9 A;  4ANW A;  1JRO A;  4PYU A;  3PPA A;  3AE4 B;  4M01 A;  3AN1 A;  2MBB B;  2WX0 A;  3GP7 A;  1A5R A;  1F2R C;  1T3Q A;  2V9H A;  2O2V A;  5D6J B;  2MWS B;  2KQ4 X;  2LI5 A;  1IYF A;  2J0J A;  4FA6 A;  1NVI D;  2N4F A;  2JQR B;  2YEP F;  3N20 C;  2JPH A;  1KRH A;  3ZKJ C;  5DPR A;  2K9X A;  1T0Y A;  3SFD B;  2NMQ A;  1E6E B;  2R61 A;  3ZNZ B;  1YN3 A;  2XK5 B;  3ZNI D;  2MRP A;  1WGY A;  4JWS C;  4IWP A;  4A3O A;  3AEF B;  1ZKH A;  3PRZ A;  4W9F A;  1SIF A;  1YOV B;  5DPS A;  2D2Q A;  1OQR A;  1V5O A;  2VZK B;  1ESF A;  3NJT A;  2ZW0 A;  2RR9 A;  4BAX A;  4K3C A;  4DBG A;  3TSS A;  4BOZ B;  3QWZ B;  3SHQ A;  3ZTC A;  2BYT A;  1V97 A;  4QAY A;  4GIV A;  2KYW A;  2K3U A;  1YJ1 A;  3T8M A;  2L05 A;  2LGS A;  1E8X A;  3CWI A;  1ZE3 D;  3C8Y A;  1WYG A;  4MM3 B;  3VUW A;  1ZOY B;  1WJN A;  1FCL A;  3NVW A;  2MBO A;  2PEA A;  4J6I A;  2WXF A;  1E7V A;  3Q6B A;  1N62 A;  2EEL A;  4JIO U;  4YTM B;  1D4B A;  5HFY A;  4RGN A;  2NBW B;  4WAF A;  3GB1 A;  3I5J C;  3KUD B;  2JWZ A;  4DHJ D;  1PGX A;  3IAM 1;  1QQR A;  2MP2 A;  3D32 A;  1WFY A;  3VXW A;  2AL6 A;  1ZXH A;  1EM7 A;  2DEN B;  4EZL A;  3ENE A;  2ZVN A;  1A70 A;  5E6N A;  2JXX A;  4MH8 A;  3GZN B;  1YIW A;  5IKC M;  2BKF A;  1N5W A;  1GPX A;  4M8M A;  3EGR A;  1WJ4 A;  1WJU A;  2JVC A;  3MC8 A;  1B9R A;  2WGS A;  1TIF A;  4AWJ A;  1Z5S B;  5EE9 A;  1P3Q U;  1DOX A;  4HK2 A;  4FJZ A;  2JY6 A;  3P4S B;  4E74 A;  4WWM A;  3RZF A;  1FEH A;  4ASW C;  1N60 A;  1KLV A;  4MGY E;  1FRR A;  3NOB A;  3EC8 A;  1UNS A;  4A90 A;  1UBQ A;  3DBH I;  3OLM D;  4RGM A;  2K8H A;  4NAW A;  3WAP A;  1WM3 A;  3IBE A;  4W9K A;  4DHZ E;  3SEB A;  2D3B A;  1QOB A;  5DPW A;  4C4V B;  3AEG B;  2A4Z A;  1U4A A;  3KUZ A;  2GBJ A;  1MI0 A;  4MT5 A;  3T3O A;  2Z8L A;  1J19 A;  1EWY C;  4WIP A;  2KDE B;  3BII D;  4LJO B;  1TJE A;  3N1Z C;  3DBL I;  3L08 A;  1SEB D;  1EO6 A;  4YSX B;  2LJ5 A;  2WU2 B;  2DZK A;  1MHH E;  4TQ1 A;  1WI0 A;  3N9Y C;  2IGG A;  1TS5 A;  1IBX B;  3PLU A;  4IG7 B;  1Q0W B;  4DHJ B;  3KWV A;  3AE9 B;  4A9A A;  2J0K A;  3BK2 A;  2DAJ A;  3ZJT A;  4GOC A;  1P9D U;  2CHW A;  2OED A;  4HXD A;  2N1W A;  5L95 C;  5LXI B;  1J7C A;  5GXG B;  3VR8 B;  5HKH A;  3KYC D;  1DOY A;  5D2M B;  1C4A A;  4JX1 C;  1WYW B;  3TEY A;  2C5L C;  3EEC A;  3RNA C;  4HVB A;  4G0N B;  3GS2 A;  2WXI A;  2KAC A;  2GLS A;  4US9 A;  3BVG A;  2JU6 X;  1C9F A;  3NHE B;  2Q5W D;  4TQ0 A;  4MM3 A;  4H2A A;  2G9H D;  3W1S C;  3Q3O C;  1SF0 A;  4NJ7 A;  1QOG A;  1LFD A;  4YXD B;  2PTL A;  1UH6 A;  4NJC A;  1M4V A;  1RRB A;  2EMT A;  3Q3J A;  1JML A;  1RLF A;  2FCQ A;  2KXJ A;  1UZX B;  2VZK D;  3EFU A;  2KC1 A;  2J42 A;  1ZUD 2;  1OTR B;  3A4S C;  2BQQ A;  4IWQ A;  2KDI A;  3L17 A;  2IO0 B;  2KMM A;  2G45 B;  3DOW A;  3HVZ A;  3VHT C;  3A1Q B;  4WUR A;  2FUG 1;  1F1H A;  3UIN B;  1FXI A;  2CJO A;  2L0T A;  1ET6 A;  3N1X C;  3A9J A;  2JT4 B;  1WXA A;  1UGJ A;  3L16 A;  4AOF A;  4I6N B;  1F9J A;  2C9W B;  2WYQ A;  4HWI B;  2B3A A;  2QC8 A;  2OJR A;  3C19 A;  3JSV A;  2WXM A;  3Q3M C;  2JZP A;  4TSS A;  3R66 C;  1E10 A;  1JCK B;  2NS5 A;  2Y5C A;  4PK1 A;  2H88 B;  1PDX A;  3CST A;  1L4Z B;  2IPK D;  3ALB A;  2N7D A;  4DWF A;  3ZNH B;  1E8Z A;  1C79 A;  4NNJ B;  3AXC A;  5C1Z A;  3GE8 C;  4MH0 E;  5TR5 A;  5IAA C;  2KTR A;  2OJW A;  3ZJV A;  2QEJ C;  3W1S A;  3ZIM A;  2BB5 A;  4KIK A;  4M0W A;  2IO3 B;  3DVN U;  1H8C A;  2C7M B;  1BT0 A;  3DBL B;  1E0Z A;  1K51 A;  4K3B A;  2MQJ A;  1KLU D;  2Z59 B;  2XN9 C;  3BYT B;  1HTQ A;  4GSW A;  3L54 A;  2BKR B;  3P42 A;  4HRS A;  3VTV A;  1TZO A;  1WZ0 A;  3M62 B;  2M17 A;  4C7Z A;  2QIL A;  2VH1 A;  1UF0 A;  2H89 B;  2WHI A;  1XCQ L;  4LJP B;  1JQ4 A;  1CMX B;  1TKG A;  3DHI C;  3JW0 X;  3NUH B;  4DDG D;  4MJS A;  4AP4 C;  4OZA A;  3WA0 A;  1WSP A;  1VCB A;  1EF5 A;  4RFB A;  1SIJ A;  4F1S A;  2O6V D;  3HM3 A;  5HI1 A;  1IPG A;  3AEC B;  2KAJ A;  3DBS A;  1ENF A;  1I42 A;  4XGA B;  2AX5 A;  2V1Y A;  2R2Q A;  3P1M A;  4IM0 A;  3BVM A;  4DXF A;  4HDO A;  1C78 A;  2KZR A;  2YVC A;  4YSZ B;  1OQQ A;  1ZDV A;  4KVG B;  2KDM A;  3V05 A;  1LM8 B;  3QAQ A;  3U7Z A;  1JW9 D;  3ZUN A;  5T8I A;  4A20 A;  1ISN A;  5CX3 A;  2GBK A;  1V49 A;  2D3C A;  1SJH D;  5H8Y E;  2L32 A;  4ACF A;  1RAX A;  2AYO B;  1HTO A;  4TKN A;  2KWC A;  4KGS A;  1TGZ B;  2JYE A;  2W3R A;  2D3A A;  3U2S C;  4B9K A;  5JXV A;  1WGH A;  1OGW A;  3BZD B;  4OHJ A;  1HXY D;  1ROE A;  3VAW A;  4TV3 A;  1TS4 A;  1K52 A;  1FO4 A;  3APD A;  1WJ6 A;  5E6P A;  4II3 B;  3IFW B;  3PRE A;  1JWB D;  1WXQ A;  2G3Q B;  1I4G A;  3CMM B;  2L1A A;  1L6V A;  4C80 A;  4I6L B;  3PHW B;  3V6C B;  1SE4 A;  4KGT A;  2O6V B;  3U30 A;  3Q8C A;  2KN4 A;  1P0R A;  2K6D B;  2KN5 A;  3FKY A;  2KVR A;  3R7R A;  3N1Y C;  1CZP A;  1WF9 A;  2XK5 A;  2W9N A;  1FXA A;  3MC9 A;  3X0W A;  2DHZ A;  1GAQ B;  2KLG A;  4IC7 B;  1E8Y A;  2KAN A;  5L83 A;  1UWX A;  3RNE C;  4G11 A;  5BO4 B;  2KMA A;  4ARC A;  1Y56 A;  3H7S A;  4JE3 B;  4GXB A;  3R2T A;  2HTH A;  3B0A A;  1KFY B;  2GRI A;  1C4C A;  2WU5 B;  2FIF A;  2QSD A;  2KX0 A;  1FD6 A;  2N9X A;  1J7B A;  1I35 A;  2GBN A;  2B76 B;  2BGF A;  2WXH A;  4NY0 A;  1FXT B;  3GZN I;  1NYR A;  4HCP B;  2KHW B;  3AE2 B;  2GI9 A;  4LLG M;  3NZU A;  1I7H A;  2MA9 B;  3NZS A;  1I4X A;  1QKZ A;  5GMV A;  2QIE B;  3ZVV A;  3U52 E;  3I3T B;  2ACZ B;  3PZD A;  2UU7 A;  3B2G A;  3Q3N C;  2KJR A;  4B0M A;  2N7E A;  3AED B;  2LGY A;  4E71 A;  2ZNV B;  3VH4 B;  2NPT B;  2WXN A;  1XQQ A;  2DYO A;  1K50 A;  2FAZ A;  1D5M C;  5LLI A;  1BML C;  3PGE A;  1KF6 B;  2CHZ A;  2LFI A;  2X8X X;  3I9V 1;  4K7U A;  3M63 B;  4IDI A;  1L2N A;  4A55 A;  3UIP B;  1QIL A;  2Y5B B;  3KW5 B;  5TSS A;  1NYQ A;  1XT9 B;  3KYD D;  2KT7 A;  1VD2 A;  2D07 B;  1HZ6 A;  3QK0 A;  3W1Y A;  4MSM B;  3I57 A;  2N9E B;  5AZF A;  4ICV A;  3A9J B;  1FFV A;  2GBR A;  2PIA A;  2ZPY A;  3AH7 A;  1VJK A;  2L00 B;  4JQW C;  3W5U B;  3WIM A;  3JSV B;  3HUI A;  5G5G A;  1FFU A;  1HA5 A;  4NZL B;  4ANV A;  1STE A;  1WXS A;  1ACC A;  1KTK A;  3TCA A;  4FHK A;  1L6U A;  2K1F A;  5D3D A;  3RNC C;  4IM2 A;  2RD0 A;  1S1Q B;  3P2B A;  4BKT A;  1FNV A;  4P16 A;  4C56 C;  5BMH A;  2YLM A;  1FNU A;  2GMI C;  2ZPN A;  5JHB A;  1F52 A;  1R4N I;  2HJ8 A;  3AEE B;  5IOI A;  4LCD E;  1GJZ A;  1AAR A;  1TZ1 A;  2MLB A;  1YQB A;  3MHS D;  3W2D A;  4HJG E;  1TYG B;  2M0A A;  2TSS A;  2BF8 B;  2LVQ A;  4FAD A;  5EE3 A;  4KGR A;  1WXM A;  3I63 C;  3P4Q B;  1KM7 A;  1T6B X;  4O1N A;  3VTU A;  4M0W B;  4W9H A;  2AQ2 B;  2N9K A;  2V3N A;  4JLC A;  2BYV E;  1IP9 A;  2J52 A;  4TUU A;  4BKG A;  1OEY J;  1YMH E;  1WM2 A;  5JHA A;  4OVU A;  2QJL A;  1Q5W B;  3IT6 B;  3RPF C;  3VUX A;  2FCN A;  2K0P A;  1XF5 L;  2DLB A;  4LNF A;  2MW5 A;  4A3P A;  5J18 A;  4XWT A;  1E5W A;  1MHX A;  5E6J A;  1J0G A;  2KMC A;  3ML8 A;  3FIL A;  2OHF A;  4BZA A;  1PYW D;  3Q8A A;  3UQA A;  3LXF A;  2W82 A;  3AV8 A;  3RI7 C;  1R4M B;  1TY0 A;  2CHX A;  4B6W A;  2L83 A;  1MVK A;  4YTN B;  4ZYN A;  3RUL A;  2L52 A;  3MP9 A;  4AJW A;  2KQ7 A;  3KLS X;  3EA6 A;  4JL9 A;  3L10 B;  1YN5 A;  2AQ1 B;  3A4R A;  2PLP A;  3GOE A;  1WGD A;  5BYR A;  2MHJ A;  2KD0 A;  1UWM A;  4EZK A;  2PE9 A;  2HD5 B;  4P1B C;  5HHD G;  4LNN A;  4XWW A;  2RPV A;  4BOS C;  2O6V A;  2D5G A;  2DYM A;  4K81 A;  1AW7 A;  3ECI A;  4RCO A;  2L3Z A;  2NBV B;  1R7S A;  1MG4 A;  1TTN A;  3IXS A;  5IP4 D;  4OVV A;  2LHE A;  3WAL A;  2L8J A;  2MX2 A;  3AEB B;  3H6N A;  1WGK A;  5G55 A;  4EZJ A;  4RNA A;  5G5H A;  3ZXR A;  3LJ3 A;  3IG3 A;  4DK5 A;  2XNA C;  3AE3 B;  2PE6 B;  4CYE A;  2MJ3 A;  3EFC A;  4OVZ A;  4IKG A;  4F7Z A;  1QLB B;  3ZYY X;  2ICI A;  3ZDT A;  3ZXV A;  5BYQ A;  4FXC A;  3EUB 2;  3VQI A;  2RDH A;  2KVZ A;  1JWU D;  4ARI A;  3AE8 B;  4AUQ C;  1DOI A;  1XLN A;  1V8C A;  2J7Q B;  4WQM A;  1R4N B;  4FBJ B;  3NY5 A;  3EHV A;  4AJY B;  2GB1 A;  1AN8 A;  1WX9 A;  1YNT E;  3WAM A;  4MGI E;  1WWT A;  4UDU C;  3B9J A;  3NS1 A;  4URK A;  3RN9 C;  2C60 A;  1QZE A;  3Q69 A;  2Y5P A;  1XLQ A;  2JZZ A;  4ANU A;  1JAL A;  3UGB B;  2LRW A;  1ZP0 B;  3APF A;  2NPT A;  1X1M A;  2W55 A;  1AWD A;  2KFK B;  3M3J A;  5H92 C;  3Q8E A;  1JWS D;  2IY0 B;  2KQS A;  2J0M A;  4KZC A;  4P7I A;  2C7N B;  4W9E A;  1ZPS A;  1B1Z A;  2LVO A;  1V2Y A;  4WWN A;  3AEA B;  3HRD D;  3R7Q A;  2REX A;  4KKJ A;  1YN4 A;  2K39 A;  2MBE A;  2OOB B;  2PMV A;  3H7P B;  4MGZ E;  1CJE A;  1RWS A;  3A1Q A;  3TL5 A;  4KV2 A;  5AEK B;  1YQ3 B;  3KVF B;  2HE7 A;  3PSE B;  3APC A;  3P4R B;  2PJH A;  1YD8 U;  2LUE A;  2N9L A;  2KFJ A;  5D94 A;  2ZNV C;  4W9G A;  2WWZ A;  1NI3 A;  3HIZ A;  1GC6 A;  3RNG C;  2WDQ B;  2ONQ A;  4XDD A;  3PVL A;  4WWP A;  2IYD B;  2NCN A;  4AQ7 A;  1GC7 A;  3J9C A;  2NTS A;  4NPN A;  3VTW A;  2BT6 A;  2IZV B;  4N58 A;  5C3J B;  4DDI D;  2LUM A;  2N0S B;  3E56 A;  2M1M A;  2A5U A;  1IGC A;  2LXC A;  1BUI C;  4HJK A;  3T9L A;  2YEP B;  1XCT L;  1YX5 B;  1WR1 A;  2WNM A;  2MJD A;  1V1P A;  4FJY A;  1SE2 A;  2DZJ A;  1VLB A;  1WX8 A;  1E7U A;  1V6E A;  2KX3 A;  5CHF A;  4JWU C;  4RM8 A;  3Q8B A;  2CR5 A;  1H4R A;  1FPY A;  4DHZ B;  3N32 A;  4PT5 A;  5I4D A;  2L0F A;  2M8S A;  1Q1O A;  2E6X A;  3QX1 A;  2JWU A;  3PZ8 A;  4LNO A;  2D11 A;  1P7E A;  1WXV A;  4P1C C;  2IND C;  2WXR A;  1PQS A;  1I4H A;  4N6E B;  3VH3 B;  3SDL C;  2AEH A;  1VR9 A;  2WP9 B;  1T0S C;  3NVZ A;  1WIA A;  2D3G A;  1C1Y B;  2PVO D;  2IY1 B;  3H7P A;  2PKO A;  3K9P B;  2BTE A;  3ZTD A;  1JRP A;  3O65 B;  4GDK B;  4C4V A;  1MG8 A;  2CU1 A;  1JWM D;  4RMA A;  2IO1 B;  4WH4 A;  1TKY A;  3RD2 A;  1WE7 A;  3OJ3 A;  3DHH C;  3L0W B;  2WDV B;  1E7P B;  2QDF A;  2MCN B;  2MBH A;  2M56 B;  2GBM A;  1HE8 A;  1VZ6 A;  3MC0 B;  4NQL B;  2CU3 A;  4DXA B;  1G6J A;  3TBL D;  1WRI A;  2CKH B;  1V1O A;  3TEW A;  4HDQ A;  1KOT A;  1WGR A;  4WJQ A;  1C4P A;  1EUV B;  4IWO A;  2K8C A;  4A8X C;  5IO9 A;  1QOF A;  4HPM B;  2BS4 B;  2UWQ A;  1KH0 A;  1D3Z A;  1NEN B;  2J53 A;  3CSF A;  4PYZ A;  3URY A;  3UQB A;  5FKA C;  1P7F A;  2WXQ A;  1FIQ A;  5D3I B;  2I2Y A;  1NBF C;  4OW0 A;  3H1U A;  4EE2 A;  1N63 A;  1L0X B;  2DYB A;  4KSK C;  3BWU D;  3TIX A;  3DVG X;  4L23 A;  4BVU C;  2LGX A;  2BYF A;  1LQB A;  1HQR D;  3ETR A;  4KKI A;  3RFZ B;  1V80 A;  2FCS A;  1FNW A;  2FCM A;  1I4P A;  3RZW C;  5KHQ A;  2RSU A;  3ZDM C;  5C2T B;  2BYE A;  3ZJU A;  2E3T A;  2W3S A;  2BVC A;  2KO3 A;  2CJN A;  3W9C B;  4GMV A;  3QQ8 B;  2JSV X;  4CHK A;  3NRZ A;  3AMZ A;  4HPL B;  3QHT A;  2ON8 A;  4WAA A;  1SE3 A;  4NQK E;  1SXT A;  2FE8 A;  3P4P B;  3UIO B;  2WXJ A;  1N6Z A;  3NVY A;  2WXG A;  4WWO A;  1WMH A;  4EKU A;  4WJO A;  2JXT A;  1P98 A;  4JPS A;  4OZC A;  2KWD A;  1WRD B;  1WE6 A;  2JX5 A;  1V5T A;  3R8B A;  3C0R B;  3JVZ X;  1TBE A;  4BBN C;  2NVU I;  4MDK E;  3B1L X;  3L13 A;  2MP2 B;  3DVG Y;  1CQV A;  1J8C A;  2XBB C;  2WDR B;  2IJ0 A;  3LYY A;  1E9M A;  1SSN A;  2LWP A;  3L4P A;  3RYT A;  4ZRI A;  4RGO S;  2V0G A;  4HKZ E;  1JRU A;  2HTM E;  3VUY A;  1F0Z A;  3K9O B;  4YL8 A;  3B08 A;  4L1B A;  4KX6 B;  3AE1 B;  4LK0 M;  2ZEQ A;  1L0Y B;  4LTU A;  4XDC A;  3E9S A;  1GB4 A;  2R2O A;  1J7A A;  2IO2 B;  2LD9 A;  4P6V F;  4ZOH C;  4ZRK A;  3ZRC A;  5IN7 A;  4ZDV A;  2DNF A;  3OJ4 B;  4W9L A;  2L7R A;  1D5Z C;  3PTF C;  4NAW B;  3BIN A;  1E90 A;  3RNB C;  4ZRJ A;  1VRA B;  3HVD A;  3DQV A;  1DYQ A;  1C3T A;  1QT9 A;  3PV1 A;  1ZW7 A;  2DAF A;  4BKS A;  2JRH A;  2KWV B;  3KWL A;  1ET9 A;  4NAM A;  3QJZ A;  2K5P A;  2LVP A;  2VH2 A;  3AU5 A;  4I6P A;  2WXP A;  4LDT D;  4KZ0 A;  4DXG A;  2QCZ A;  1IUE A;  1YJI A;  3AM9 A;  1R4M I;  3DBH B;  5LXH A;  2HJ1 A;  4Q2J A;  2AL3 A;  2KTF A;  3RCZ A;  2KDB A;  5BMI A;  4RGT A;  2ZZP B;  4FN2 A;  2MSE D;  3CIR B;  4FJV B;  1NEK B;  3MHZ A;  3MFG A;  1V86 A;  3JYU A;  5EE0 A;  3O13 A;  4IUM B;  4EEW A;  2WS3 B;  2GOW A;  2WDT B;  1EF1 A;  3NG0 A;  3DBR I;  4GB9 A;  4WJP A;  2PPH A;  3MJ5 A;  1GOZ A;  2M0X A;  3X23 A;  1UGM A;  3WAN A;  1RFK A;  5FR6 A;  2JRI B;  2LGD A;  3NS8 A;  4MSQ B;  5BYS A;  2BB6 A;  3AUL A;  3A9K B;  2JF5 A;  3U8Z A;  4M02 A;  2V4I B;  2K22 A;  3BVZ A;  4PS8 A;  4CO7 A;  3FIL B;  3SFE B;  1ZXI A;  2J4X A;  3PT2 B;  3OG5 A;  4EFO A;  2KWU B;  5BMG A;  2KC2 A;  1Z2M A;  2PVG C;  3KUC B;  4ZYS A;  1V1P B;  1YX6 B;  4ICU A;  3ZLZ A;  4MGK E;  4B95 A;  3ZW3 A;  1PGA A;  5D7G A;  2KJ6 A;  1DGJ A;  2RDG A;  3TJP A;  1TS2 A;  1VZ8 A;  2BWF A;  4ANX A;  2V3S A;  1I4R A;  1D5X C;  2BS2 B;  1SBB B;  2LZ6 A;  1EU4 A;  2RGF A;  3SD5 A;  2KDF B;  1SB3 C;  4XE0 A;  4A6Q A;  4FHJ A;  1YQ4 B;  4N59 A;  1PGB A;  3AE7 B;  1L5P A;  5DPT A;  3U4E G;  3VRB B;  1N5X A;  2FID A;  4LNI A;  3Q2A C;  1F2R I;  4F8C B;  3PO0 A;  1TS3 A;  3TEZ A;  1GUA B;  5HG2 A;  4K7W A;  2O2V B;  2JZ3 B;  1S3S G;  3RUI B;  2ASQ A;  1ZDX A;  1C76 A;  3VVW B;  3HHM A;  1M94 A;  1L7Y A;  4GDL A;  3PRM B;  5FK9 C;  2K8B A;  3V61 A;  3TEX A;  2EKE C;  4JGH B;  3BY4 B;  3ZO5 B;  4J3O D;  1K8R B;  2X38 A;  1UEL A;  1UBI A;  4W9I A;  1PFD A;  1WH3 A;  2W54 A;  3H8H A;  4MEM A;  4ZRQ A;  1OQY A;  2KNB A;  1D6E C;  3AB5 A;  4C00 A;  2BW2 A;  2PW9 A;  4HCN B;  1HZ5 A;  4II2 B;  4S0R A;  2JUO A;  3PZ7 A;  1NI2 A;  1SJE D;  2ZCB A;  4XYC A;  3N30 A;  3S2A A;  4M8N A;  3QAR A;  5JH5 C;  1SE9 A;  3VRA B;  1XO3 A;  3IHP C;  5CHV C;  3NVV A;  2LXA A;  2Z0E B;  4GN1 A;  2WX1 A;  3VFK A;  1F77 A;  1OFF A;  4X57 B;  3P63 A;  3MTN B;  4G3X B;  1HEZ E;  2LMC A;  3A9K A;  3ZQ4 A;  4FUL A;  1K53 A;  1UD7 A;  4BFR A;  4EOY A;  3WAO A;  4RH6 A; 
#chains in the Genus database with same CATH homology
 1JRP A;  2I38 A;  3B2G A;  1L4D B;  1N5W A;  1GPX A;  4B0M A;  3AED B;  3EGR A;  4GDK B;  1B9R A;  2SEB D;  1JWM D;  2WXN A;  2DYO A;  5EE9 A;  1DOX A;  3WCQ A;  3P4S B;  1K50 A;  1D5M C;  4ITK A;  4WWM A;  1FEH A;  1BML C;  1N60 A;  1KF6 B;  3I9V 1;  2LFI A;  4WH4 A;  5BYS A;  1TKY A;  4IDI A;  5LNK 1;  1FRR A;  4A55 A;  1QIL A;  3W5V B;  2WDV B;  3AE5 B;  1E7P B;  5TSS A;  1NYQ A;  1UNS A;  4A90 A;  2IGH A;  2DWQ A;  2G1E A;  3R2I A;  1HZ6 A;  2M56 B;  1VZ6 A;  4RGM A;  1FCC C;  3MC0 B;  1FRD A;  2CU3 A;  1EWC A;  4DQO C;  3SEB A;  3I57 A;  1WRI A;  1V1O A;  3TEW A;  4R3D A;  1FFV A;  1QOB A;  1L0V B;  3AEG B;  1C4P A;  2PIA A;  3AH7 A;  4A8X C;  1VJK A;  1MI0 A;  1RYJ A;  4MT5 A;  3T3O A;  2Z8L A;  3W5U B;  1EWY C;  4WIP A;  1QOF A;  3HUI A;  5G5G A;  1FFU A;  1RM6 C;  4ZHP A;  2BS4 B;  3BII D;  1TJE A;  4L2Y A;  1HA5 A;  4NZL B;  4ZRP A;  3IT4 B;  1STE A;  4OZB A;  1KH0 A;  1ACC A;  1NEN B;  2Y3A A;  3DWM A;  2J53 A;  3URY A;  1KTK A;  5FKA C;  2AQ3 B;  1P7F A;  1L6U A;  3BK1 A;  2WXQ A;  1SEB D;  2M19 A;  1FIQ A;  5D3I B;  2I2Y A;  1BXT A;  4YSX B;  2WU2 B;  4OW0 A;  5D3D A;  4EE2 A;  1MHH E;  1N63 A;  1IGD A;  2FBW B;  4TQ1 A;  1L0X B;  3N9Y C;  2IGG A;  1TS5 A;  3BWU D;  3SR6 A;  1IBX B;  4L23 A;  1FNV A;  3KWV A;  4P16 A;  3AE9 B;  1HQR D;  3ETR A;  3LB8 C;  4KKI A;  4A9A A;  4C56 C;  3RFZ B;  5BMH A;  3BK2 A;  3ZJT A;  1FNW A;  2OED A;  1FNU A;  1XXG A;  2NTT A;  1I4P A;  5EE1 A;  2EKI A;  5FR3 A;  5C2T B;  1J7C A;  2WXK A;  4GDL B;  5GXG B;  3VR8 B;  2E3T A;  2W3S A;  3ZJU A;  2CJN A;  4AS1 A;  3AEE B;  3W9C B;  1XLO A;  2INP E;  1DOY A;  4YWG G;  1C4A A;  4JX1 C;  2JSV X;  3NRZ A;  3AMZ A;  3TEY A;  2ON8 A;  3W2D A;  4HJG E;  2MJE A;  1TYG B;  3GS2 A;  2WXI A;  2M0A A;  1SE3 A;  2KAC A;  2TSS A;  4GLS C;  4RF0 A;  3ZGZ A;  5EE3 A;  4KGR A;  4US9 A;  1SXT A;  2FE8 A;  3BVG A;  3P4Q B;  3P4P B;  4B0E A;  2JU6 X;  2WXJ A;  4TQ0 A;  2Q5W D;  1C9F A;  1T6B X;  4O1N A;  3NVY A;  2WXG A;  4H2A A;  1Q10 A;  2G9H D;  2JXT A;  2AQ2 B;  2N9K A;  3NZ3 A;  3T3N A;  1UUP A;  2V3N A;  4JPS A;  1SF0 A;  4RF1 A;  1QOG A;  4OZC A;  2KWD A;  4YXD B;  2J52 A;  3V3X A;  2PTL A;  2JX5 A;  1YMH E;  4IOI E;  1M4V A;  1MPE A;  4NJC A;  4TMA B;  2QMT A;  2QJL A;  3IT6 B;  3RPF C;  2K0P A;  1XF5 L;  3R8B A;  1JML A;  2DLB A;  4CQN A;  4HEA 1;  1PUT A;  1XLP A;  2VZK D;  4HRO A;  2J42 A;  1ZUD 2;  4XWT A;  1CQV A;  2WXL A;  1MHX A;  2KMM A;  3HVZ A;  3FC4 A;  4WUR A;  2FUG 1;  4YT0 B;  2WDR B;  1FXI A;  2CJO A;  5E6J A;  1ET6 A;  2IJ0 A;  3FIL A;  3LYY A;  2OHF A;  1E9M A;  1PYW D;  1SSN A;  3Q8A A;  2N7J A;  2WXO A;  1UGJ A;  2LEK A;  3LXF A;  3L4P A;  1FM0 D;  2W82 A;  3AV8 A;  4RGO S;  1TY0 A;  2V0G A;  2L83 A;  1MVK A;  2HTM E;  4HKZ E;  4YTN B;  1F0Z A;  2L52 A;  2WXM A;  3MP9 A;  2DBY A;  2ZW1 A;  2JZP A;  4L1B A;  4KX6 B;  3AE1 B;  3KLS X;  4TSS A;  4LK0 M;  1L0Y B;  4LTU A;  4XDC A;  1C77 A;  3Q8F A;  3EA6 A;  2WLB A;  1E10 A;  3E9S A;  1JCK B;  2V3P A;  1GB4 A;  1YN5 A;  2AQ1 B;  2Y5C A;  2H88 B;  1J7A A;  1PDX A;  1L4Z B;  2IPK D;  2PLP A;  4P6V F;  4ZOH C;  5BYR A;  4C7Y A;  1JWA D;  1C79 A;  2IDY A;  1UWM A;  3VR9 B;  1D5Z C;  1QOA A;  5HHD G;  4NAW B;  2RMM A;  2INN E;  5AUK A;  1VZ7 A;  4US8 A;  2RPV A;  4XWW A;  1IBX A;  3ZJV A;  2QEJ C;  3W1S A;  2BB5 A;  2D5G A;  2BTE A;  2DYM A;  4M0W A;  1VRA B;  3DWG C;  3HVD A;  1DYQ A;  1QT9 A;  1AW7 A;  4RCO A;  1TY2 A;  1R7S A;  3ABV B;  3KWL A;  3IXS A;  1E0Z A;  1ET9 A;  4NAM A;  2K5P A;  1K51 A;  2LHE A;  1T5X D;  2LHD A;  3IAS 1;  4D2K A;  1KLU D;  3AEB B;  2WXP A;  2XN9 C;  1WGK A;  1KLG D;  3BYT B;  4YTP B;  4DXG A;  4RNA A;  1IUE A;  1YJI A;  3BYY B;  3AM9 A;  5G5H A;  3P42 A;  2XNA C;  4HRS A;  3AE3 B;  1FMA D;  1TZO A;  4Q2J A;  2MJ3 A;  4OVZ A;  4IKG A;  1QLB B;  4RGT A;  5BMI A;  3ZYY X;  4ZHO A;  2ICI A;  3CIR B;  2MEK A;  4C7Z A;  5BYQ A;  1NEK B;  2QIL A;  3MHZ A;  3MFG A;  4FXC A;  3EUB 2;  3VQI A;  2RDH A;  5EE0 A;  2BBC A;  2H89 B;  3O13 A;  1XCQ L;  2JYT A;  3OWE B;  1JWU D;  3B2F A;  2WS3 B;  1JQ4 A;  2SAK A;  4ARI A;  3AE8 B;  1DOI A;  1XLN A;  2WQY B;  4HKQ A;  1V8C A;  1TKG A;  3AE6 B;  4WQM A;  3NUH B;  1QF6 A;  3MJ5 A;  1GOZ A;  1XEE A;  4OZA A;  3UI3 A;  1WSP A;  2IGD A;  2GB1 A;  4RFB A;  1AN8 A;  1RFK A;  1EU3 A;  1SIJ A;  1YNT E;  4REZ A;  1TKE A;  1WWT A;  4UDU C;  1GB1 A;  3FAH A;  2BB6 A;  4USA A;  4RH6 A;  3B9J A;  3NS1 A;  5HI1 A;  3TUO A;  1N61 A;  3AEC B;  2HDE A;  2KAJ A;  2V4I B;  3Q69 A;  2K22 A;  2Y5P A;  3BVZ A;  1XLQ A;  1ENF A;  1VDV A;  5AUI A;  3FIL B;  1AYF A;  2AX5 A;  3KQ4 A;  1I4Q A;  3P1M A;  4YSY B;  1JAL A;  3SFE B;  3BVM A;  4DXF A;  1ZP0 B;  1YJJ A;  1C78 A;  1ZXI A;  2J4X A;  4YSZ B;  5MPO A;  2W55 A;  1OQQ A;  1ZDV A;  1AWD A;  1LO5 D;  2LGI A;  2MH7 A;  4MAC A;  5H92 C;  2KDM A;  3V05 A;  1CK1 A;  2LJI A;  5BMG A;  3Q8E A;  1JWS D;  3U7Z A;  2PVG C;  1JW9 D;  4ZYS A;  2BS3 B;  1ZPS A;  1B1Z A;  1V1P B;  5T8I A;  3AEA B;  1JRO A;  3HRD D;  3AE4 B;  4KKJ A;  1YN4 A;  3AN1 A;  3GP7 A;  2PMV A;  1PGA A;  1F2R C;  1T3Q A;  5D7G A;  1CJE A;  1SJH D;  1RWS A;  5H8Y E;  1DGJ A;  2L32 A;  2RDG A;  2KQ4 X;  1TS2 A;  1YQ3 B;  1VZ8 A;  1NVI D;  1I4R A;  2JQR B;  4KGS A;  1D5X C;  2YEP F;  2JYE A;  2W3R A;  3P4R B;  2BS2 B;  1SBB B;  3U2S C;  1EU4 A;  5JXV A;  1SB3 C;  1KRH A;  4XE0 A;  3BZD B;  4A6Q A;  2N9L A;  4OHJ A;  1YQ4 B;  4N59 A;  1HXY D;  1ROE A;  1TS4 A;  2K9X A;  1K52 A;  3SFD B;  2NMQ A;  1FO4 A;  1E6E B;  2R61 A;  1PGB A;  1YN3 A;  1NI3 A;  3AE7 B;  1L5P A;  3U4E G;  3VRB B;  1N5X A;  1JWB D;  1WXQ A;  1F2R I;  4JWS C;  1I4G A;  3PO0 A;  2WDQ B;  1TS3 A;  2ONQ A;  2L1A A;  1L6V A;  4XDD A;  3AEF B;  3TEZ A;  4C80 A;  5HG2 A;  4AQ7 A;  3J9C A;  1OQR A;  2NTS A;  2VZK B;  1SE4 A;  4KGT A;  1ESF A;  2BT6 A;  1ZDX A;  3Q8C A;  4N58 A;  1C76 A;  5C3J B;  2LUM A;  2N0S B;  2ZW0 A;  2KN4 A;  3E56 A;  1IGC A;  1BUI C;  3TSS A;  2YEP B;  1XCT L;  5FK9 C;  1CZP A;  3TEX A;  2WNM A;  1V97 A;  2BYT A;  1FXA A;  4J3O D;  2MJD A;  1V1P A;  1GAQ B;  1SE2 A;  2X38 A;  1VLB A;  2K3U A;  1PFD A;  1UWX A;  2W54 A;  3H8H A;  4JWU C;  4ZRQ A;  3Q8B A;  4ARC A;  1Y56 A;  1D6E C;  3AB5 A;  4JE3 B;  3CWI A;  3R2T A;  1ZE3 D;  3C8Y A;  2BW2 A;  1WYG A;  4MM3 B;  1KFY B;  2PW9 A;  1ZOY B;  1HZ5 A;  2GRI A;  3PZ7 A;  4PT5 A;  1C4C A;  1FCL A;  2WU5 B;  3NVW A;  5I4D A;  2QSD A;  2WXF A;  1N62 A;  1FD6 A;  1SJE D;  1J7B A;  2EEL A;  2E6X A;  2B76 B;  2WXH A;  3VRA B;  4YTM B;  1D4B A;  2JWU A;  1XO3 A;  5HFY A;  3PZ8 A;  4RGN A;  1NYR A;  4WAF A;  3GB1 A;  3NVV A;  1P7E A;  3AE2 B;  2WXR A;  2GI9 A;  1I4H A;  1PGX A;  4LLG M;  4N6E B;  3IAM 1;  1I7H A;  1QQR A;  1F77 A;  1OFF A;  1VR9 A;  1ZXH A;  3P63 A;  1EM7 A;  2WP9 B;  1I4X A;  3NVZ A;  1QKZ A;  2LMC A;  1HEZ E;  2PVO D;  1A70 A;  3ZQ4 A;  4MH8 A;  2PKO A;  2QIE B;  3U52 E;  1K53 A;  2ACZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...