3AVCA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Recombination/inhibitor
molecule keywords Integrase
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avcA00
1RDDA 3OYMA 1T7PA 1B9FA 3C6TA 4PQUA 2RKIA 5DMRA 1LWFA 4LY7A 3AO2A 1JXEA 3SV4A 5SZTA 4J2AA 4H4OA 3HK2A 2P1JA 4CK3A 2HB5A 1HNIA 1HQUA 3ZSZA 4E89A 1WNSA 1NK4A 2DTUA 1BGXT 3RRGA 3EY1A 3AA3A 1C0TA 4E19A 3V81A 4F2SA 3NH1A 4CJTA 4EP4A 4HUFA 4CGIA 1D5AA 3KD5E 4FJ9A 1NJXA 4DSEA 4Z0UA 1RCHA 1QSYA 5KGXA 4FW1A 4N5SA 1S5JA 1XWLA 1RBVA 4FJXA 4O5BA 4OPKA 1BQMA 3RR8A 4R5PA 1IKYA 3VQ8A 1TL3A 2OYQA 1FKPA 1CLQA 1KSPA 4FYDA 5FDLA 1IH7A 1CXQA 3P5JA 3DOLA 1JL1A 4CERA 3RR7A 1I3AA 4CFAA 2QKBA 3VQ7A 4FLXA 2BANA 4CJQA 2IC3A 4CIEA 3KK1A 4M45A 1U47A 3DI6A 4FLTA 2IDOA 3RRHA 4LH5A 5CYQA 1XHXA 4B9MA 4DU1A 3B6PA 2HNYA 3AVAA 4CEFA 4W5OA 1TK5A 4QCLA 1ASWA 4FM2A 1RTDA 1ZYQA 4AHVA 1Q9XA 4HVJA 4W5TA 3LWMA 1REVA 1XI1A 3OS0A 3D45A 2G8UA 4BWMA 3S3NA 4PUOA 1YTUA 5SWMA 4JS4A 4OKEA 2RF2A 3ISNC 4FK4A 2Q3SA 2PZSA 1WAFA 3ZCMA 1FXXA 1Z26A 4CJ3A 4B9LA 2G8IA 2FC0A 1TAQA 4CJRA 3V1QA 4Z4FA 1QSLA 4FLVA 3MEGA 1BL3A 1IO2A 3OYEA 1SL2A 3PX6A 5E41A 2RN2A 3TARA 1RTIA 3ZSVA 3EYZA 1VK0A 1YT3A 3BGRA 3HP6A 3H08A 3NDKA 1D9DA 1RDCA 3RMCA 4NCBA 4CJSA 1EKEA 4KTZA 4PA1A 4DFKA 1R0AA 3LWLA 1S6PA 1NK0A 1ZBHA 4DSKA 1QTMA 2A1RA 1KVBA 3TABA 4B3OA 4HUGA 4CEDA 1G15A 4DLGA 2OPSA 2ZE2A 3O3FA 3KLFA 3TR8A 4JRQA 4DTUA 1Q9YA 4NYFA 2LSNA 4E7KA 4AHSA 4KHWA 4DS4A 3V9WA 1NJWA 4CFDA 4YNQA 2NUBA 3V9SA 3WNEA 1BCOA 1QS4A 3T19A 2WONA 1S1TA 2DFFA 3OYDA 1B9DA 3F73A 2PY5A 2Z1JA 4KPYA 4BDZA 4Z4EA 1KLMA 1WSJA 3T1AA 4CJVA 4CK1A 4DFJA 2KTQA 2OPRA 4DSIA 4O44A 5I3UA 2OPQA 1RDBA 4GMJB 3NE6A 2KFZA 3LP2A 1TKTA 1RT4A 4KB1A 1Y97A 2Z1IA 5HP1A 1HYVA 1S1XA 1VSDA 3I0SA 3HT3A 4DTOA 1W0HA 4K8XA 4KHUA 4M3TA 3AVMA 1C1AA 4CJEA 3QO9A 4FXDA 4ID1A 3VQCA 3QEVA 3QINA 4I7FA 4CEQA 3HVRA 1KVCA 1ZBFA 4FJNA 4CF1A 1GOCA 1NJZA 1YVUA 3KD1E 2YNFA 3VQDA 4LH4A 1S6QA 1J54A 4E7JA 4FJMA 2F96A 4AHTA 3VQ4A 1RNHA 3NGZA 4YFUA 3HSTB 5C24A 4B9UA 3V1OA 3ZSXA 3AO3A 4KHQA 4CEZA 4IBNA 1X1PA 1KFDA 4E7IA 1WSHA 5J2MA 5JS2A 3IRXA 2O4GA 1L3SA 1GOAA 3DMJA 3AVFA 1GOBA 4HHTA 5C25A 4IFYA 4I9QA 3V4IA 2QK9A 3QLHA 2E4LA 4DQSA 3KIOA 2G8WA 3UIQA 3AVJA 2D0CA 4CIFA 3OS2A 3ULDA 1JL2A 3LZIA 4FCYA 2EX3A 4HTUA 2X74A 3NF8A 4EP5A 1BISA 5J2QA 4FJGA 3TAEA 3K5MA 3SYZA 4DSFA 3DRRA 4C8MA 3ZSOA 3SQ1A 1BCMA 3IG1A 5K14A 3ZSQA 1TL1A 3LPTA 4FJLA 3QETA 3CYMA 3G10A 4N47A 3L2WA 4M3XA 3JYTA 3L3UA 4Y1CA 3L3VA 3TAPA 3O4QA 4J2DA 2O4IA 3HM9A 3OYNA 4Z4HA 1JLEA 1IKWA 3L2VA 4G1QA 1HMVA 3AVHA 3OYFA 4O0IA 2VWJA 4E3SA 1S9GA 3S3OA 2JGUA 3THVA 3QNNA 3EZ5A 3LANA 2DFHA 3AVGA 1WN7A 4NYNA 4FJJA 3AV9A 1VSKA 3F9KA 4CFCA 3HPHA 1EETA 5HRNA 4DTXA 4N56A 4FK2A 1S1UA 1W9HA 4ICLA 3C6UA 4M3RA 3U6FA 3RMBA 4QOZB 2HHVA 1ASVA 3OY9A 4CHYA 1KRPA 4IKFA 3SQ2A 3OJSA 4AHUA 4FLYA 4BDPA 3OYGA 3OYAA 1C1CA 4I2PA 4QAGA 4B8CA 4JS5A 2HNZA 2Y1IA 2PYJA 3SPZA 3U3YA 5FRNA 1RT1A 3CFOA 4CGDA 1X9MA 2HHSA 2KFNA 4KO0A 4Y1DA 3NCIA 3LALA 4FZYA 3VQ6A 3AA5X 1KCFA 1VRTA 4RG8A 1HYZA 3CQ8A 4O0JA 4C8KA 4CF2A 1NK5A 5D3GA 4CF0A 1HJRA 2YNIA 1UA1A 2YHAA 2F8TA 4OLAA 4BE2A 3L8BA 4H4MA 4J2EA 4KI4A 1JLGA 3VQPA 4CHQA 4KB0A 4FLWA 1J5OA 4AILC 4H8KA 3TAFA 2B6AA 1TGOA 4ELVA 4OGEA 1WSFA 2D0AA 3AVKA 1UOCA 5HRPA 1NOZA 1VSHA 4DF4A 4DSJA 1NKCA 3ALYA 4DWIA 4ID5A 4E7LA 1VSLA 4CEEA 3K5NA 4ZTJA 3DLHA 2FBXA 3AVLA 1VSEA 2OPPA 3CG7A 4M3YA 1LAWA 3SI6A 1JLFA 2XY6A 4M3UA 2HHQA 4F3TA 4F8RA 2IS3A 3HXMA 4CJPA 4DS5A 1WSIA 4C8LA 3TANA 3KKRA 1NOYA 3AVBA 4CJFA 4CJUA 4IG0A 3PX4A 4RW8A 4Q0BA 1NK6A 1MU2A 2VWKA 1LW0A 4FJ5A 1TKZA 3MECA 4HCCA 5KRSA 1JXBA 3KKSA 3NHGA 1LWCA 1D9FA 3OS1A 4BWJA 2D0BA 1JLQA 4CFBA 1VSFA 4N76A 3SUQA 4PWDA 5JS1A 3OYCA 5HRRA 1LAVA 4B9SA 3IS9A 5HRSA 3O3HA 1BI4B 4KFBA 1VRUA 4E1MA 2XO7A 3ZT3A 4CGFA 2ITGA 4E0DA 2ATQA 1NK9A 1SKWA 4NCGA 3SQ4A 1RT2A 2X78A 3K5OA 3SUOA 1RTHA 3OYLA 3OYIA 1U45A 4CIGA 1DTTA 2OZMA 2D5RA 1BI4A 2R7YA 2QKKA 4DF8A 1JLCA 2YNHA 3AA2A 4DG1A 4WE1A 4KTQA 2X6SA 3PUFA 1YTAA 4CGHA 3I8DA 3S3MA 4DTPA 1RBTA 3AO4A 4CEAA 2YNGA 2GUIA 4W5NA 3P1GA 3M8RA 1TK0A 2G8FA 1QQCA 3A2FA 1S1VA 4IG3A 3VQBA 1RDAA 3NGYA 2HVHA 1LV5A 1WSGA 2Z1HA 5I42A 3QEIA 3RWUA 1TV6A 1NK7A 3OYBA 1RT5A 3RTVA 1X9WA 4DQPA 1FKOA 3OVNA 3T3FA 2BDPA 2ZQBA 3DYAA 2FBVA 5CZ1A 1ZBUA 2G8VA 4KTWA 3QIOA 2P51A 3M8QA 3VQ9A 1NKBA 1XHZA 4DLEA 4GW6A 3SCXA 2GBZA 4EZ6A 4DTMA 1EX4A 4N41A 4FJIA 4W5QA 4C8OA 1J53A 1CZBA 3LP1A 3HP9A 3AVNA 3M8PA 4OVLA 1KFSA 1BHLA 4CHNA 3AO1A 1CZ9A 3O4NA 1SKSA 1SUQA 2DFEA 3VN5A 4KREA 3NBPA 4FVMA 3VQQA 2A1SA 5FRMA 1RT6A 4CECA 1ITGA 1C6VA 5KI6A 4CHPA 4Q5VA 3HYFA 3KLGA 4I2QA 4KV8A 3QNOA 3NGIA 2YHBA 3PO5A 4M3WA 3NH0A 4BE0A 3AVCA 1WAJA 3NF9A 4L8RB 4DTSA 3S9HA 3MXIA 1U49A 4ELTA 2HHTA 2OZSA 4CE9A 1JLAA 2Y1JA 4CF8A 1BIZA 2AJQA 3KK2A 3RMAA 2G8HA 4Z4GA 3MEEA 5J2PA 4K8ZA 2HVIA 1RBSA 3SQ0A 1T03A 5KGWA 3LAKA 4OKKA 2P5GA 3CFPA 3NH2A 1C0UA 3HJFA 4CF9A 2IAJA 3ZT2A 1B92A 3LPUA 2HHWA 2YKMA 2KZMA 1FK9A 4FLUA 4OLBA 1NKEA 4JLHA 5HROA 1L3UA 3L2QA 4CJ4A 1UAXA 4RW4A 4KRFA 4FLZA 4C8NA 3TWHA 3K5LA 4E7HA 4CJLA 3ZT4A 1L3TA 4Z4IA 4ZTFA 3CFRA 2F8SA 4F2RA 1NK8A 3VQ5A 4FM0A 1QSSA 5FROA 4CK2A 4CJWA 4B9TA 1O1WA 5CYMA 4DQRA 3NF6A 2X6NA 1L3VA 3VQEA 1KLNA 4KHNA 3SZ2A 4J2BA 4B08A 1JLBA 4GVMA 3K57A 5J2NA 1SKRA 3HL8A 4DTJA 3LP0A 3G0ZA 3WNGA 1I39A 4UQGA 3ZSRA 2HHUA 1VSMA 1U04A 3L2RA 5EU7A 4HUEA 4DU3A 3ASMA 3MXMA 1KTQA 1A5XA 3QERA 3SUNA 4Z4CA 2E6MA 3DLRA 3KLIA 2XHBA 2B5JA 4CEBA 5T7BA 4KHYA 1UA0A 4O55A 1HQEA 2PYLA 3KJVA 3AO5A 2HW3A 1TKDA 4OGCA 4DMNA 4FJHA 4CHZA 4CHOA 1HRHA 3HVTA 4F4KA 3KK3A 1EP4A 1RILA 1VSJA 3CM5A 1SL0A 2VG6A 3SNNA 4LSNA 1HPZA 4I9LA 5CY4A 3LDSA 4DSLA 2HHXA 2VG5A 1HNVA 2WOMA 4RW6A 3V9UA 1RT3A 1X9SA 2W42A 3KTQA 4FJ7A 4AHCA 1XC9A 4B9VA 3ZT1A 3V9XA 3NFAA 4IDKA 1RBRA 2RPIA 3HPOA 1LW2A 2Z1GA 4CGGA 3OYHA 1KVAA 3KLHA 3BDPA 1D8YA 2P5OA 4E1NA 1TK8A 4RW7A 1QE1A 2FBYA 3HPGA 2YKNA 4CESA 3NAEA 1U48A 4IFVA 3D0PA 3C95A 1DLOA 2EHGA 1TAUA 1ASUA 1CXUA 1RTJA 4NCAA 1BIUA 2KQ2A 5KRTA 4FM1A 1J9AA 2OA8A 1IKXA 1TVRA 5CZ2A 3DM2A 3K2PA 3B6OA 4OKJA 2IOCA 4DQQA 1TKXA 5C42A 3FFIA 4XIUA 3K59A 3OJUA 3TI0A 4M3ZA 3DLBA 3ITHA 3K58A 3QEXA 1K6YA 3MXJA 3ZT0A 3MAQA 4W5RA 3IAYA 2XY5A 1SL1A 3SJJA 1IKVA 2BGGA 4B9NA 1JKHA 4DTRA 4ZHRA 1S9EA 1ZBLA 3KLEA 3HO1A 2QXFA 2VG7A 4KAZA 3VQAA 1BQNA 1WLJA 2XY8A 3ZSWA 4M41A 3DOKA 1RT7A 4M42A 4O4GA 3V6DA 1DTQA 3C94A 1SV5A 2E6LA 2FBTA 3DLGA 3QIPA 3QESA 3PY8A 4FW2A 2KW4A 3DLKA 3TAQA 3O3GA 2XRIA 4BE1A 3ZSYA 4OJRA 1N6QA 3SV3A 1C1BA 3PV8A 1EXQA 4JRPA 2XY7A 5HLFA 2G8KA 4DQIA 1T8EA 3LAMA 3VA0A 2KZZA 3DRPA 4FJKA 1A5VA 1ZBIA 4TSXA 3LZJA 1NJYA 3V9ZA 1VSIA 4CJKA 3M8SA 4LD0A 4CEOA 4KI6A 3DRSA 3WNFA 1QHTA 4F3OA 2DY4A 3MEDA 4MFBA 2JLEA 3PX0A 1C0MA 5J1EA 3L2UA 1A5WA 2B4JA 3OYKA 4FZXC 3WNHA 3OYJA 4LSLA 1T05A 4FZZA 4HCBA 2I5JA 4DTNA 1LWEA 4DFMA 3RMDA 5DK5A 1F21A 3JSMA 1Q8IA 4AH9A 3SUPA 1IG9A 3LP3A 4DU4A 4CCHA 3TAMA 4AHRA 4KHSA 3SPYA 1Z25A 1UWBA 2ETJA 3VA3A 5KTQA 1S1WA 2HNDA 4CJ5A 4FK0A 4ELUA 2ZD1A 4PY5A 3U3GA 4CGJA 4BDYA 4FJ8A 4B8AB 4OPJA 1HYSA 3AVIA 3CM6A 2IGIA 3I0RA 4MQ3A 1N5YA 3AA4A 1U4BA 3DLEA 4BACA 4DFPA 3QEPA 3E01A 1L5UA 1RBUA 4RW9A 1WSEA 2BE2A 3NF7A 3P83D 2GV9A 5HBMA 4KKOA 3QEWA 4EZ9A 2YV0X 3TAGA 3V1RA 3PO4A 2HMIA
chains in the Genus database with same CATH superfamily
4AM6A 1RDDA 1B9FA 3C6TA 5DMRA 1LWFA 1JXEA 4HTLA 5JVHL 2DTUA 3H45C 3RRGA 2QWLA 4YDUA 4E19A 4F2SA 2UXBK 1YIJN 4CJTA 4EP4A 1RFQA 1D5AA 2OANA 3IUCA 4DSEA 1RCHA 4H0XB 5EXWA 1QSYA 4FW1A 5M1OA 4DV3K 3THXA 1S5JA 3RR8A 2OYQA 4E1JA 5FDLA 3DOLA 4CERA 3VQ7A 3H3OB 4KH5A 4CIEA 3KK1A 4M45A 5CYQA 3LM9A 1XHXA 2GTDA 1E4GT 4AHVA 3CIPA 3LWMA 1JJ2M 1XI1A 4PKHA 3OS0A 3D45A 4BWMA 4DB3A 1N36K 3K0SA 1N32K 2UXDK 3OHRA 4X64K 2FC0A 4Z4FA 3H46O 4H0VB 1BL3A 1M90O 3OYEA 1W97L 3CJCA 3ZSVA 3EYZA 1Q7YO 4NCBA 1RDCA 4KTZA 1WBDA 3LWLA 1TUYA 1KVBA 3TABA 4HUGA 2ZE2A 3TR8A 3DXMB 4E7KA 1NGGA 4AHSA 1S22A 3FZMA 4ILGB 4YNQA 2NUBA 3NVMA 4DR7K 2IVNA 3H3NO 1B9DA 4Z4EA 4BDZA 1KLMA 1WSJA 1C0FA 3T1AA 4CJVA 2P9PB 2KTQA 2OPRA 3EKUA 4O44A 2OPQA 4GMJB 3UKUA 3FZKA 4KB1A 5FPEA 2Z1IA 3RSEA 1VSDA 3GL1A 4KHUA 4JKDA 3R8EA 3AVMA 3O9RA 4NLCA 3QEVA 4CEQA 3G4SN 1Z05A 1ZBFA 4FJNA 3PSIA 2IVOA 1NJZA 2YNFA 1S6QA 4FVUA 3VQ4A 1RNHA 2KKZA 2ZGZA 4YFUA 5C24A 4DV1K 3R1XA 4CEZA 4IBNA 1X1PA 5J2MA 3DAWA 5A2QO 3IFRA 4ILHA 1HUXA 3QLHA 5AQMA 1H1VA 5B8HA 2I7NA 4O8UA 3LZIA 3VERA 3NF8A 1BISA 5J2QA 2EWSA 3ZSOA 5K14A 1TL1A 3LPTA 5AQXA 3CYMA 3L2WA 4M3XA 1W7AA 4Y1CA 3TAPA 3B8AX 2O4IA 3AVHA 4O0IA 1S9GA 3THVA 3WUHA 3I56N 2DFHA 3T69A 1T44A 4BRKA 1WN7A 4NYNA 3F9KA 4DTXA 4FK2A 4ICLA 3U6FA 3C6UA 4FWRA 4B1ZA 1Q82O 4CHYA 1NLVA 4DUYK 4FWKA 4FLYA 3UKUB 3OYGA 4B8CA 4QAGA 1ZBHA 2V7YA 3QBWA 1RGIA 2Q2RA 4CGDA 4WYBA 4BRQA 4KO0A 4Y1DA 4FZYA 4O0JA 4C8KA 1NK5A 4CBWA 4A57A 4CF0A 1UA1A 2F8TA 3JXUA 4J2EA 4KB0A 1S72N 1JCEA 2B6AA 4OGEA 2D0AA 1UOCA 5HRPA 4IO9L 4DF4A 4JKFA 1GLBG 2HOEA 2A41A 3K5NA 4ZTJA 2FBXA 3BUZB 2QW9A 1VSEA 2OPPA 5AQOA 3BF3A 1V4SA 4LF4K 3SI6A 1ZXOA 4CJPA 4DS5A 3TANA 4CJFA 2VYPA 4IG0A 3PX4A 4RW8A 4JV5K 3MECA 4RCHA 4HCCA 1LWCA 4BWJA 2D0BA 4F9OA 4CFBA 4N76A 4K0KK 1LAVA 4M7YA 3IDHA 2XO7A 3ZT3A 2ITGA 4H03B 3SQ4A 2W40A 3ENHA 4KH4A 2D5RA 2R7YA 2QKKA 4DF8A 5AQFA 3ZX0A 4CZEA 3I8DA 3J8AA 3S3MA 4LFBK 3T1YK 3AO4A 4ISFA 4DR4K 5CHIA 3M8RA 2O8CB 1QQCA 3A2FA 1S1VA 4YHHK 4IG3A 1LV5A 1ILYA 1BWFO 2Z1HA 4KH6A 2BUPA 4DQPA 3L4IA 3EN9A 2FBVA 2VWBA 4KTWA 1NKBA 4FPAA 2GBZA 4EZ6A 3PSFA 4W5QA 1CZBA 3LP1A 3HP9A 4OVLA 1KFSA 3DXKA 1CZ9A 2E1ZA 4H0OA 1SUQA 3FLCO 3HRGA 3F2KA 3VQQA 2AA4A 5KI6A 4I2QA 3NGIA 4C1NK 4BE0A 1HNXK 3CCLN 2HHTA 1KD1O 1U49A 3VGLA 1JLAA 2Y1JA 4CF8A 1BIZA 2AJQA 4YOYA 2G8HA 4Z4GA 3MEEA 5J2PA 4K8ZA 4Z94A 3CC7N 3SK3A 1T03A 3HTVA 2ZM6K 1QVFM 1C0UA 3HJFA 5F2RA 3WT0A 1B92A 2CH5A 2CGKA 2HHWA 1HNWK 3A5LC 1ZC6A 3MX5A 4FLUA 2A6AA 3OA9A 1NKEA 5HROA 2GEMA 4CJ4A 1UAXA 4RW4A 4KRFA 3FR0A 1N33K 4FLZA 3LM2A 4C8NA 3MMVA 3TWHA 4V19S 2E2OA 3ZT4A 5M1QA 4JKGB 1O1WA 4CZHA 3NF6A 2X6NA 4KHNA 4B08A 1JLBA 3P39A 5J2NA 2NRZA 3WNGA 4UQGA 4BC5A 1VSMA 1U04A 2D0PA 4DU3A 2D4WA 1A5XA 1VAZA 2E6MA 3KLIA 1FJGK 4KHYA 4BRIA 4O55A 1BA0A 1TKDA 4JYAK 4FJHA 4CHZA 1HRHA 3KK3A 1EP4A 1RILA 4WQ5A 1SL0A 1K9MO 2QKBA 4LSNA 1HPZA 4O8KA 2WOMA 2W42A 4FJ7A 1XC9A 3V9XA 1RBRA 2Z1GA 1D4XA 3BDPA 1YXQA 2P5OA 2I7PA 1TK8A 3HPGA 4H5RA 2YKNA 3D0PA 2EHGA 1ZBSA 1ASUA 1CXUA 3LDLA 4NCAA 5KRTA 1J9AA 5CZ2A 4DKWA 5EOYA 2IOCA 3KWGA 1TKXA 3Q7CA 4XIUA 4QS7A 3U4LA 3WEEB 4B1YB 1K6YA 3ZETA 3ZT0A 4QS8A 1IBLK 3G25A 3IAYA 3C7NA 2XY5A 2ASOA 1XNQK 5C15A 1BG3A 5AQPA 1OH5A 5GIPA 3FZLA 3LL3A 3TU5A 4KAZA 1WLJA 2XY8A 3ZSWA 4M41A 5KQDA 3AARA 4O4GA 2ZWHA 5AZIA 3SAFA 2E6LA 3QESA 5FPNA 2ASPA 2KW4A 5ADXH 1VQ4N 3R6MA 3O9TA 4CI6A 4JRPA 5I9EB 2XY7A 2G8KA 2A40A 1ZBIA 1NM1A 1NJYA 4LD0A 4CEOA 5LMNK 3L4QA 3C6HA 4F3OA 3RVCA 3MCAB 1Q81O 1C0MA 2YJEA 2B4JA 3MN5A 3WNHA 4LSLA 2I5JA 5KPRA 3I33A 1DKGD 1Q8IA 4AH9A 3TSQA 1YVNA 4CCHA 3CMEN 2UUCK 3P4IA 4IFEA 4OPJA 2FF6A 4FPBA 2FLOA 1N5YA 3UKRA 3CQYA 3DLEA 4BACA 3QEPA 5JLHA 1W2BM 2BE2A 3P83D 4EZ9A 4KKOA 4YOTA 4DV6K 3TAGA 3V1RA 1ATRA 4DV7K 2HMIA 3G6EN 1DEJA 5DM6L 3OYMA 4PQUA 2RKIA 3SV4A 5SZTA 4CK3A 1HNIA 1HQUA 1WNSA 5AQYA 4JN4A 1C0TA 5FPDA 2V51B 5AQQA 3NH1A 3CJ1A 1KC8O 1NJXA 4A2AA 4R79A 3AGRA 5F1XA 4N5SA 4BVOA 5C2DA 5BR8K 4FJXA 4O5BA 1BQMA 4R5PA 3VQ8A 1KSPA 3L0QA 4FYDA 1IH7A 3P5JA 3C65A 2JWLA 1JL1A 1VHXA 3VF6A 4CFAA 5E84A 2FSKA 4CJQA 4FLTA 4LH5A 4PKGA 3B6PA 3O9UA 5C10A 1QQMA 4PKIA 1Z6RA 4QCLA 4CZMA 4I6MA 1ASWA 4FM2A 1YJWN 3ZEUA 1DGKN 4H0PA 2YHXA 1YTUA 4JS4A 4FK4A 1XUPO 2Q3SA 1BOTO 3ZCMA 1FXXA 4NXMK 1TAQA 2CGJA 3ZX2A 1VQON 3PX6A 5E41A 2GX9A 2Q0RA 3VTHA 1VK0A 1YT3A 3HP6A 3NDKA 2QWRA 1D9DA 2OTJN 4CJSA 1EKEA 4DFKA 1NMNA 4IOAL 2YI1A 4JHDB 3VEVA 4B3OA 2W6LA 3KLFA 3VF2A 4UY8O 4DTUA 1Q9YA 2LSNA 4KHWA 1O13A 2WC9A 4DS4A 1NJWA 1BCOA 3F73A 1S1TA 4KPYA 2Z1JA 1VQNN 4DFJA 2VQFK 4DSIA 3THWB 5F0XA 1RDBA 3NE6A 1K8KA 5EY4A 5HP1A 3JAMO 2V52B 3HT3A 5BREA 3O9QA 3QO9A 3VQCA 3QINA 3SAGA 4JD2A 4X65K 2P9NA 4CF1A 3H1VX 4A5AA 4GV3A 2QEXN 4GV9A 1T6DA 3KD1E 2F96A 3NGZA 3P31A 4B9UA 4CZKA 2O4GA 4BQLA 1T3VA 4HHTA 4IFYA 2GWKA 5AR0A 3CHWA 4WFAL 4DQSA 4J8FA 2D0CA 4CIFA 2D0OA 3OS2A 3ULDA 4HTUA 1J6ZA 1RDWX 3VEXA 3K5MA 3ENOA 3LDQA 4JKEA 3QETA 3ULEA 4PL7A 4N47A 4FWLA 3JYTA 3WQUA 3HM9A 1S3XA 1OH7A 4G1QA 5AQUA 2JGUA 1G99A 3QNNA 3LANA 1NGFA 3AV9A 1VSKA 5AQHA 4M3RA 3GOIA 2WUSA 4BREA 5BRHA 4H0TB 1C1CA 2PYJA 1NWKA 3CFOA 5AQGA 1X9MA 2HHSA 2KFNA 3HZ6A 3LALA 3AA5X 1KCFA 5TKWA 4RG8A 3CQ8A 4JI0K 1NGBA 4CF2A 4DV5K 5D3GA 3HM8A 1YUWA 4FOEA 2YHAA 1QHAA 3VQPA 3MDQA 4AILC 2ZF5O 3O8MA 1NOZA 3ALYA 5BN9A 4BGBA 1U2VB 3ID8A 1HNZK 3GDQA 1K73O 3DLHA 3VF4A 1KQSM 4QS9A 4FWQA 4M3YA 1LAWA 2XY6A 1U2VA 5GIOA 4M3UA 4F8RA 3KKRA 1NOYA 1YJ9N 4JKAA 1HR0K 2RHKA 4FWPA 4Q0BA 1NK6A 3UE5A 2VWKA 1WUAA 5DM7L 3CERA 3K9KA 3ZX3A 4PWDA 3OYCA 3M1FA 4KFBA 2VQEK 1RT2A 2BTFA 3OYIA 4CIGA 1DTTA 1KAXA 1JLCA 2YNHA 3MN7A 2ZJPL 4CGHA 1RBTA 3U8XA 4W5NA 3P1GA 1TK0A 2G8FA 1NGDA 3QMLA 5AQLA 3A5NC 1RDAA 3NGYA 3VQBA 2HVHA 3D7EO 5AZJB 3QEIA 3OYBA 1RT5A 1FKOA 3OVNA 3T3FA 2BDPA 5BN8A 2GUPA 3QIOA 4BRFA 3W0LA 1BO5O 4GW6A 4EAHD 1YI2N 4CZLA 1EX4A 4FJIA 1YJNN 3AVNA 3M8PA 1BDGA 4Y0WA 3O4NA 2DFEA 4MO4A 4KREA 2P9SB 1MA9B 2A1SA 5E26A 5FRMA 1E4FT 4Q5VA 3HYFA 3KLGA 3WQTA 3TSPA 3BP8A 3NF9A 1WAJA 4DTSA 3S9HA 4ELTA 2P9IA 4MLHA 3RMAA 4CD3A 4ILJA 2HVIA 2P9IB 2NRHA 4K43A 3LAKA 5LY3A 3WXJA 2P9LA 3ZT2A 1OVYA 4EIAA 1NGAA 4JLHA 1MWMA 1L3UA 4OPHA 2WTUA 2VCPA 4CJLA 4Z4IA 3CFRA 4F2RA 1R59O 3VQ5A 4FM0A 5FROA 4CJWA 5CYMA 1KLNA 4J2BA 1BA1A 3LP0A 2HHUA 3L2RA 4JI4K 1TYQB 1KTQA 3SUNA 4AM7A 4CEBA 1UA0A 1HQEA 3VPZA 3C0BA 3KJVA 2QWNA 2E2PA 4CHOA 3J7ZO 1GLAG 3CM5A 3VGKA 2VG6A 2HHXA 4I9LA 3J7YP 3V9UA 1X3NA 4AHCA 5AJ3K 3ZT1A 2RPIA 4CGGA 3KLHA 1D8YA 5ADXA 1VQ7N 1QE1A 3ZLJA 4JKBA 3MN6A 3C95A 1DLOA 5BR9A 1TAUA 2OA8A 1TVRA 4JI5K 3QBXA 3K2PA 4DQQA 5C42A 3TI0A 3K58A 3MAQA 4H5TA 4BRNA 5FPMA 1Y64A 3N4PA 3ZETB 3SJJA 2BGGA 4B9NA 1JKHA 4ZHRA 1S9EA 1ZBLA 4JKCA 4RTFD 4BRLA 1BQNA 4BR2A 3O5BA 3DOKA 4L3QA 4FL9A 4LF8K 1DTQA 3FGUA 3THXB 3TAQA 3O3GA 2XRIA 1N6QA 2O8FA 4YOXA 3SV3A 1EXQA 1GLCG 3VTIA 2Q31A 4MLEA 4GY2B 1A5VA 4OPAA 2A42A 3A0IX 4TSXA 2J4RA 1VSIA 4IEIA 4NB4A 1QHTA 4LFAK 3PIOL 3KHYA 4IXCA 1VQ5N 1A5WA 1T05A 4CW7B 4DTNA 3FZFA 1QQOA 3SUPA 3LP3A 4DU4A 4YORA 2HBKA 3MX2A 3TAMA 4AHRA 4KHSA 4K42A 1Z25A 4CJ5A 1EQYA 5BPLA 4A5BA 2ZD1A 5M1FA 4PY5A 4BDYA 3F5TA 4B8AB 4ISEA 3CM6A 4MQ3A 5BPMA 5AQZA 4WQ4C 3E9LA 4M7XA 3E01A 5HBMA 3QEWA 3WEEA 2HBLA 4IDHA 4BR5A 4HCBA 5AQKA 1T7PA 3AO2A 4J2AA 1N8RO 2P1JA 2HB5A 3VESA 4E89A 1NK4A 1BGXT 3EY1A 3AA3A 4DQ8A 3V81A 1GLFO 4DR6K 4HUFA 3N4QA 4CGIA 3EZWA 4HWIA 4Z0UA 2O8EB 5M1PA 3CD6N 1RBVA 3R3LA 4CBUA 4OPKA 1IKYA 1TL3A 1FKPA 4B1UB 3OBYA 4JK9A 3SMSA 5LJVA 3RR7A 4CBXA 1I3AA 4FLXA 2BANA 2BH1A 2IC3A 1U47A 3A5OC 2IDOA 3OW2M 3RRHA 5IWAK 4B1VA 4B9MA 2HNYA 4CEFA 1NGJA 1GLDG 4IWVA 4B1XB 1RDUA 4HVJA 1Q9XA 1REVA 4MO5A 4OKEA 3CCSN 2RF2A 3ISNC 4U7BA 1FW6A 1QZ5A 3C6AA 2G8IA 3EE8A 3E66A 3V1QA 2KLAA 3KK7A 4FLVA 3MEGA 3HBTA 4DR2K 2RN2A 3TARA 1RTIA 5GAHP 1C0GA 3TTCA 3BGRA 4IZ9A 3RMCA 1DT9A 2YJFA 1R0AA 4FSVA 1QVGM 1K8AO 4WF9L 1QTMA 4DSKA 3FZHA 4CEDA 4DV2K 2OPSA 3CC4N 1VQPN 3EEQA 4NYFA 1EO1A 3V9WA 4CFDA 3V9SA 3WNEA 1QS4A 3SLCA 4PHTX 2WONA 3OYDA 2PY5A 1K8KB 1XC3A 2NZTA 2IVPA 4CK1A 3SBGA 1P8ZA 4LF9K 4OX9K 1N34K 5I3UA 2FF3B 2KFZA 5C0YA 3LP2A 1TKTA 1RT4A 2ITMA 3AY9A 1YHQN 1Y97A 4JD2B 3ATVA 3I0SA 4M3TA 1ATSA 4B3RK 3THYB 3HVRA 1KVCA 1I94K 1GOCA 4G9ZA 4DR3K 3CJ7A 1WOQA 1YVUA 3VQDA 1J54A 3QICA 4FJMA 1NGIA 2NRWA 4AHTA 5M1KA 3J80O 2OCEA 3ZSXA 4KHQA 3JS6A 3CF5L 4E7IA 1KFDA 4IJAA 5JS2A 3LDNA 5CE3A 3AVFA 2UU9K 3OBWA 1ESVA 3AGKA 1T6CA 1NMDA 2E4LA 2HSTA 3KIOA 3UIQA 2HBMA 1JL2A 3ULEB 2X74A 4EP5A 3TAEA 4K25A 3SYZA 4DSFA 3DRRA 4C8MA 1XMOK 4FWNA 1BCMA 3IG1A 3ZSQA 4FJLA 3G10A 3SAHA 4JKHA 1QZ6A 2NRXA 3O4QA 3CCRN 3Q7BA 4BC2A 4Z4HA 3OYFA 4JNEA 2VWJA 2HF4A 4BQZA 3AVGA 5ELZA 1SAZA 1BU6O 5HRNA 4QOZB 1ASVA 4IKFA 1KRPA 2JWKA 2P9PA 3SQ2A 2UXCK 3OJSA 4AHUA 3OYAA 4I2PA 4JS5A 2HNZA 3SPZA 1NGHA 2Q97A 3U3YA 5FRNA 4WQ4A 3O9SA 1VRTA 1HKGA 5AQWA 2YNIA 3CJ9A 4CHQA 5AQNA 3VEZA 4AF1A 4JI3K 3TAFA 4ELVA 3NVKA 3AVKA 2HF3A 2FSNA 1NKCA 4KHPK 1OH6A 4E7LA 3CCQN 3O4WA 3TTFA 3AVLA 2O8BA 3CG7A 2HHQA 5AQSA 4A59A 2Q1NA 3HXMA 4C8LA 5EVZA 1OVQA 1LW0A 1TKZA 1JXBA 3NHGA 3O80A 1GLEG 2GWJA 1VSFA 2H3GX 3D6RA 3IS9A 5HRSA 1BI4B 1VRUA 4CGFA 4E0DA 2ATQA 1NK9A 1SKWA 4BC3A 4B3TK 5HL7L 3K5OA 1RTHA 4XH4A 1U45A 1SQKA 4BROA 1BI4A 2PFUA 3AA2A 4DG1A 5BPNA 2X6SA 3PUFA 1YTAA 4PL8A 4FWOA 2O8DB 2GUIA 3D2EB 5M1NA 3CCJN 3ATUA 2NRVA 5I42A 3M6GA 3RWUA 1TV6A 3QDKA 1NK7A 3RTVA 1X9WA 2E2QA 2QWPA 5CZ1A 2P51A 3VQ9A 4A61A 3CETA 3CQXA 2P9SA 3ZYYX 4N41A 1NJIO 1BHLA 3BY5A 3AO1A 5AQVA 4JI7K 3BZCA 1VQ9N 4FWMA 2QXLA 4CECA 3TSUA 4YY3K 3D2FB 3QNOA 3K9JA 2YHBA 1HX1A 4M3WA 4BG9A 3NH0A 1NBWA 3AVCA 2O8BB 3TTDA 3MXIA 2FSJA 3HOTA 3TPQA 2WFBA 2ASMA 4GKJK 4FWSA 3SQ0A 1Q86O 4OKKA 5KPTA 2QWMA 3CFPA 3NH2A 4CF9A 5AQRA 2IAJA 2YKMA 2KZMA 3SMPA 1IG8A 4WQ5C 3SBTA 4K41A 3VMFB 3L2QA 3A5MC 3K5LA 5AQIA 3EL2A 2F8SA 5GINA 1LCUA 3LDOA 1YF5L 4B9TA 2W41A 3SZ2A 2O8FB 4GVMA 2ZJQL 3K57A 1SKRA 5FLXO 3HL8A 4DTJA 4LF7K 3G0ZA 1I39A 5AQTA 3ZSRA 4HUEA 5EU7A 3ASMA 3QERA 5C2FA 3WXKA 1XNRK 3FE1A 3AO5A 1IBKK 2HW3A 4OGCA 4DMNA 3E9PA 3HVTA 1VSJA 1EWRA 3LDSA 4DSLA 1HNVA 1GLJO 4RW6A 4CVNE 3BF1A 3CPWM 1X9SA 4NXNK 4B9VA 5GAGP 4IDKA 4CZFA 1P90A 3VGMA 3HPOA 1LW2A 1KVAA 3W3DA 2FBYA 1NGCA 4KBOA 1U48A 5MLCQ 4FOIA 3F9MA 4JAXA 4BC4A 1RTJA 2E8AA 1BIUA 2KQ2A 3AAQA 3DM2A 3B6OA 4OKJA 3H6EA 3K59A 3OJUA 4M3ZA 3QEXA 2CGLA 2Q0UA 3OTOK 2F9WA 1SL1A 2F4VK 2GELA 1IKVA 1KAYA 3UB5A 4B3MK 1NNEA 1KAZA 1NG9A 3KLEA 2QXFA 2VG7A 1VQ6N 2ZGYA 4H0YB 4JI1K 1SV5A 3CI5A 3DLGA 3EO3A 2W6KA 3QIPA 4JKGA 3PY8A 4FW2A 4H5NA 3DLKA 4BE1A 4OJRA 4DQIA 3MCPA 2NLXA 3LAMA 1BUPA 3DRPA 2P9KB 2HMPA 4O5FA 3LZJA 1JCGA 3M8SA 3WNFA 1VQMN 2P9UB 1CZAN 3MEDA 4MFBA 3PX0A 5J1EA 4FZXC 3IMXA 4FZZA 4DFMA 3CJBA 3RMDA 4A62A 1IG9A 4CZGA 3LDPA 4JI2K 3UKRB 3SPYA 2ETJA 3VA3A 5KTQA 1S1WA 3O1BA 3J81O 4XH5A 3T7ZA 3U3GA 4FJ8A 5JICA 4BGAA 2IIRA 3AVIA 3AA4A 5LMUK 1U4BA 4ISGA 1VQ8N 1LOTB 3DWLA 3WXLA 1WSEA 3O1WA 5LL6Z 4LY7A 3S41A 4H4OA 3HK2A 3DJCA 1YAGA 3KZBA 3ZSZA 4BR9A 5IT9O 5LJWA 1M1KO 4WFNL 1HKCA 4BRHA 3M5RA 4CD1A 3KD5E 4FJ9A 4NLBA 5KGXA 4NO7A 4BVPA 1XWLA 4X62K 1CLQA 2F7TA 1CXQA 3VETA 5KPZA 4BRCA 4LC9B 3GE1A 1WBBA 3DI6A 3NMUA 4DU1A 4BRPA 2P9UA 3AVAA 3EKSA 4W5OA 1TK5A 1RTDA 1ZYQA 4YOWA 4W5TA 2QWQA 4C23A 3CJAA 2G8UA 3PLAA 4PUOA 3S3NA 3QFPA 5SWMA 4YOUA 3ZEUB 4XH1A 2PZSA 1WAFA 2NRTA 4DV4K 1Z26A 4CJ3A 4B9LA 4CJRA 3I55N 1QSLA 4WFBL 2NNWA 1IO2A 2VGNA 1SL2A 2UYTA 3EE9A 3QB0A 4BG8A 3H08A 4PA1A 4H5VA 1NK0A 1S6PA 2QI2A 3VEWA 2A1RA 1IJJA 1G15A 1U6ZA 4JRQA 3O3FA 4DLGA 2PBDA 4JHDA 3HOSA 3THWA 2E2NA 3CXCM 3T19A 2DFFA 3DXMA 4DCHA 4BRGA 2O8EA 5GAEP 4JEPA 3WXIA 1HYVA 1S1XA 4K8XA 4DTOA 1W0HA 1C1AA 4CJEA 4FXDA 3FFKB 2KHOA 4ID1A 4I7FA 4E7JA 4LH4A 4EHUA 1IBMK 3THYA 4FO0A 4MDBA 3HSTB 3V1OA 4B9QA 3AO3A 4DR5K 1WSHA 4I6MB 3IRXA 1L3SA 2A3ZA 1GOAA 3DMJA 1GOBA 5C25A 4I9QA 3PIPL 3V4IA 2QK9A 3U9ZA 2ZJRL 3CCUN 3O08A 4YOVA 2G8WA 4IOXA 3AVJA 4C1NI 5BRFA 4FCYA 2EX3A 4FJGA 3VENA 3SQ1A 4BR7A 3MWTA 3L6QA 1QQNA 3L3UA 3L3VA 5C12A 1SS6A 4J2DA 3QFUA 3OYNA 1JLEA 1IKWA 3L2VA 1HMVA 4BR0A 1VQKN 2VGMA 4E3SA 3S3OA 3M3ZA 3EZ5A 4BR4A 3ID6A 4FJJA 1X3MA 4CFCA 3HPHA 1EETA 4N56A 1S1UA 1W9HA 3RMBA 2HHVA 3D2EA 3OY9A 2QWOA 1E3MA 4BDPA 2Y1IA 3AAPA 1KXPA 3H1QA 1RT1A 3RSEB 3E9OA 3NCIA 3VQ6A 1V4TA 1HYZA 3MWPA 4B1WB 1HJRA 2P9NB 1HPMA 3R9PA 4OLAA 4LF6K 4BE2A 3L8BA 4H4MA 4KI4A 1JLGA 4FLWA 1J5OA 5AQJA 4JK8A 4GKKK 4H8KA 1TGOA 1WSFA 1VSHA 4DV0K 4DSJA 4DWIA 4MDAA 4ID5A 5AFUH 2YHWA 3D2FA 1VSLA 4AQYK 4CEEA 4B3SK 1YITN 4M63C 1JLFA 2DPNA 4X66K 4F3TA 3CPEA 2IS3A 3CCEN 1WSIA 2E20A 4XEIA 3AVBA 4CJUA 1MU2A 4FJ5A 5KRSA 2HBJA 3KKSA 4GVEA 1D9FA 3OS1A 2P9LB 1JLQA 2YX6A 4GV6A 3SUQA 3GG4A 5JS1A 5HRRA 4B9SA 3O3HA 4E1MA 4NCGA 4U67L 2X78A 3SUOA 3OYLA 2O8DA 2OZMA 2O8CA 5BRDA 4WE1A 1VQLN 4KTQA 4DTPA 1GLLO 4CEAA 2YNGA 2YCHA 1SZ2A 3SJHA 4RWTA 5JMVA 1WSGA 2D1KA 3CCVN 2ZQBA 3DYAA 4DR1K 2G8VA 1ZBUA 3M8QA 5AZJA 1HKBA 4CJ7A 4WCEL 1HJOA 4DLEA 3SCXA 1XHZA 3O6WA 2QTDA 4DTMA 4C8OA 1J53A 3KWIA 1OH8A 4CHNA 4IOCL 1SKSA 2E5LK 3VN5A 1HLUA 3NBPA 4JK7A 4FVMA 5AFUA 1J5EK 4EHTA 1RT6A 1ITGA 1C6VA 3ENBA 4CHPA 4KV8A 2UUAK 2Q36A 3PO5A 3J7AP 4L8RB 3CCMN 2OZSA 4CE9A 3BEXA 2A5XA 4DUZK 3KK2A 5KQ8A 1RBSA 3U9DA 5KGWA 1OKJA 2P5GA 1JCFA 4LFCK 3G71N 2E88A 3HI0A 4GNIA 4DHYA 3LPUA 3C7NB 1FK9A 4IO8A 3DLLL 4OLBA 2FXUA 2RE2A 3WXMB 5TKYA 5H1SQ 4E7HA 1L3TA 4ZTFA 5AZIB 5GADP 1NK8A 3VEOA 1MDUB 1QSSA 4CK2A 1WB9A 4A2BA 2UUBK 2PAVA 4DQRA 2AP1A 1L3VA 3VQEA 2E1YA 3IKMA 3MN9A 2HHHK 3MXMA 4Z4CA 1MWKA 3DLRA 4LF5K 2XHBA 2B5JA 5T7BA 2PYLA 1ATNA 3I8BA 4CZJA 4BY9C 2F9TA 4F4KA 3HSCA 3DXKB 3SNNA 5CY4A 4JI8K 2VG5A 3T1HK 1RT3A 3GBTA 4BRAA 2YHYA 3KTQA 2V7ZA 3NFAA 4YDUC 3OYHA 3VEYA 4E1NA 4RW7A 1IV0A 4CESA 3NAEA 4IFVA 3BZKA 5JLFA 4FM1A 1IKXA 3FFIA 3DLBA 3ITHA 3MXJA 4W5RA 2QM1A 5CR4A 1NGEA 1EWQA 4BRDA 4DTRA 4BRMA 3HO1A 1XMQK 3MK6A 3VQAA 1XQSC 5HOOA 1Q18A 1RT7A 4M42A 3V6DA 2CH6A 3C94A 3P38A 2FBTA 2WBNA 3E1YA 2QA4N 3ZSYA 2OTLN 5JVGL 1C1BA 3PV8A 5HLFA 1T8EA 4OO1J 4CZIA 3VA0A 4JI6K 2KZZA 4FJKA 1TYQA 3V9ZA 4CJKA 4KI6A 3DRSA 2P9KA 2DY4A 2JLEA 3L2UA 3OYKA 3OYJA 3VOVA 1LWEA 5DK5A 1F21A 4H5WA 3JSMA 1NU0A 4EFHA 1TUUA 2NRRA 1X9JA 4IJNA 1UWBA 2HNDA 4FK0A 4ELUA 5EX5A 3A8YA 4CGJA 1HYSA 2IGIA 3I0RA 3KVGA 3CMAN 4IEEA 4DFPA 1L5UA 3CC2N 1RBUA 4RW9A 3NF7A 2GV9A 2YV0X 3PO4A
chains in the Genus database with same CATH topology
1RDDA 3OYMA 1T7PA 1B9FA 3C6TA 4PQUA 2RKIA 5DMRA 1LWFA 4LY7A 3AO2A 1JXEA 3SV4A 5SZTA 4J2AA 4H4OA 3HK2A 2P1JA 4CK3A 2HB5A 1HNIA 1HQUA 3ZSZA 4E89A 1WNSA 1NK4A 2DTUA 1BGXT 3RRGA 3EY1A 3AA3A 1C0TA 4E19A 3V81A 4F2SA 3NH1A 4CJTA 4EP4A 4HUFA 4CGIA 1D5AA 3KD5E 4FJ9A 1NJXA 4DSEA 4Z0UA 1RCHA 1QSYA 5KGXA 4FW1A 4N5SA 1S5JA 1XWLA 1RBVA 4FJXA 4O5BA 4OPKA 1BQMA 3RR8A 4R5PA 1IKYA 3VQ8A 1TL3A 2OYQA 1FKPA 1CLQA 1KSPA 4FYDA 5FDLA 1IH7A 1CXQA 3P5JA 3DOLA 1JL1A 4CERA 3RR7A 1I3AA 4CFAA 2QKBA 3VQ7A 4FLXA 2BANA 4CJQA 2IC3A 4CIEA 3KK1A 4M45A 1U47A 3DI6A 4FLTA 2IDOA 3RRHA 4LH5A 5CYQA 1XHXA 4B9MA 4DU1A 3B6PA 2HNYA 3AVAA 4CEFA 4W5OA 1TK5A 4QCLA 1ASWA 4FM2A 1RTDA 1ZYQA 4AHVA 1Q9XA 4HVJA 4W5TA 3LWMA 1REVA 1XI1A 3OS0A 3D45A 2G8UA 4BWMA 3S3NA 4PUOA 1YTUA 5SWMA 4JS4A 4OKEA 2RF2A 3ISNC 4FK4A 2Q3SA 2PZSA 1WAFA 3ZCMA 1FXXA 1Z26A 4CJ3A 4B9LA 2G8IA 2FC0A 1TAQA 4CJRA 3V1QA 4Z4FA 1QSLA 4FLVA 3MEGA 1BL3A 1IO2A 3OYEA 1SL2A 3PX6A 5E41A 2RN2A 3TARA 1RTIA 3ZSVA 3EYZA 1VK0A 1YT3A 3BGRA 3HP6A 3H08A 3NDKA 1D9DA 1RDCA 3RMCA 4NCBA 4CJSA 1EKEA 4KTZA 4PA1A 4DFKA 1R0AA 3LWLA 1S6PA 1NK0A 1ZBHA 4DSKA 1QTMA 2A1RA 1KVBA 3TABA 4B3OA 4HUGA 4CEDA 1G15A 4DLGA 2OPSA 2ZE2A 3O3FA 3KLFA 3TR8A 4JRQA 4DTUA 1Q9YA 4NYFA 2LSNA 4E7KA 4AHSA 4KHWA 4DS4A 3V9WA 1NJWA 4CFDA 4YNQA 2NUBA 3V9SA 3WNEA 1BCOA 1QS4A 3T19A 2WONA 1S1TA 2DFFA 3OYDA 1B9DA 3F73A 2PY5A 2Z1JA 4KPYA 4BDZA 4Z4EA 1KLMA 1WSJA 3T1AA 4CJVA 4CK1A 4DFJA 2KTQA 2OPRA 4DSIA 4O44A 5I3UA 2OPQA 1RDBA 4GMJB 3NE6A 2KFZA 3LP2A 1TKTA 1RT4A 4KB1A 1Y97A 2Z1IA 5HP1A 1HYVA 1S1XA 1VSDA 3I0SA 3HT3A 4DTOA 1W0HA 4K8XA 4KHUA 4M3TA 3AVMA 1C1AA 4CJEA 3QO9A 4FXDA 4ID1A 3VQCA 3QEVA 3QINA 4I7FA 4CEQA 3HVRA 1KVCA 1ZBFA 4FJNA 4CF1A 1GOCA 1NJZA 1YVUA 3KD1E 2YNFA 3VQDA 4LH4A 1S6QA 1J54A 4E7JA 4FJMA 2F96A 4AHTA 3VQ4A 1RNHA 3NGZA 4YFUA 3HSTB 5C24A 4B9UA 3V1OA 3ZSXA 3AO3A 4KHQA 4CEZA 4IBNA 1X1PA 1KFDA 4E7IA 1WSHA 5J2MA 5JS2A 3IRXA 2O4GA 1L3SA 1GOAA 3DMJA 3AVFA 1GOBA 4HHTA 5C25A 4IFYA 4I9QA 3V4IA 2QK9A 3QLHA 2E4LA 4DQSA 3KIOA 2G8WA 3UIQA 3AVJA 2D0CA 4CIFA 3OS2A 3ULDA 1JL2A 3LZIA 4FCYA 2EX3A 4HTUA 2X74A 3NF8A 4EP5A 1BISA 5J2QA 4FJGA 3TAEA 3K5MA 3SYZA 4DSFA 3DRRA 4C8MA 3ZSOA 3SQ1A 1BCMA 3IG1A 5K14A 3ZSQA 1TL1A 3LPTA 4FJLA 3QETA 3CYMA 3G10A 4N47A 3L2WA 4M3XA 3JYTA 3L3UA 4Y1CA 3L3VA 3TAPA 3O4QA 4J2DA 2O4IA 3HM9A 3OYNA 4Z4HA 1JLEA 1IKWA 3L2VA 4G1QA 1HMVA 3AVHA 3OYFA 4O0IA 2VWJA 4E3SA 1S9GA 3S3OA 2JGUA 3THVA 3QNNA 3EZ5A 3LANA 2DFHA 3AVGA 1WN7A 4NYNA 4FJJA 3AV9A 1VSKA 3F9KA 4CFCA 3HPHA 1EETA 5HRNA 4DTXA 4N56A 4FK2A 1S1UA 1W9HA 4ICLA 3C6UA 4M3RA 3U6FA 3RMBA 4QOZB 2HHVA 1ASVA 3OY9A 4CHYA 1KRPA 4IKFA 3SQ2A 3OJSA 4AHUA 4FLYA 4BDPA 3OYGA 3OYAA 1C1CA 4I2PA 4QAGA 4B8CA 4JS5A 2HNZA 2Y1IA 2PYJA 3SPZA 3U3YA 5FRNA 1RT1A 3CFOA 4CGDA 1X9MA 2HHSA 2KFNA 4KO0A 4Y1DA 3NCIA 3LALA 4FZYA 3VQ6A 3AA5X 1KCFA 1VRTA 4RG8A 1HYZA 3CQ8A 4O0JA 4C8KA 4CF2A 1NK5A 5D3GA 4CF0A 1HJRA 2YNIA 1UA1A 2YHAA 2F8TA 4OLAA 4BE2A 3L8BA 4H4MA 4J2EA 4KI4A 1JLGA 3VQPA 4CHQA 4KB0A 4FLWA 1J5OA 4AILC 4H8KA 3TAFA 2B6AA 1TGOA 4ELVA 4OGEA 1WSFA 2D0AA 3AVKA 1UOCA 5HRPA 1NOZA 1VSHA 4DF4A 4DSJA 1NKCA 3ALYA 4DWIA 4ID5A 4E7LA 1VSLA 4CEEA 3K5NA 4ZTJA 3DLHA 2FBXA 3AVLA 1VSEA 2OPPA 3CG7A 4M3YA 1LAWA 3SI6A 1JLFA 2XY6A 4M3UA 2HHQA 4F3TA 4F8RA 2IS3A 3HXMA 4CJPA 4DS5A 1WSIA 4C8LA 3TANA 3KKRA 1NOYA 3AVBA 4CJFA 4CJUA 4IG0A 3PX4A 4RW8A 4Q0BA 1NK6A 1MU2A 2VWKA 1LW0A 4FJ5A 1TKZA 3MECA 4HCCA 5KRSA 1JXBA 3KKSA 3NHGA 1LWCA 1D9FA 3OS1A 4BWJA 2D0BA 1JLQA 4CFBA 1VSFA 4N76A 3SUQA 4PWDA 5JS1A 3OYCA 5HRRA 1LAVA 4B9SA 3IS9A 5HRSA 3O3HA 1BI4B 4KFBA 1VRUA 4E1MA 2XO7A 3ZT3A 4CGFA 2ITGA 4E0DA 2ATQA 1NK9A 1SKWA 4NCGA 3SQ4A 1RT2A 2X78A 3K5OA 3SUOA 1RTHA 3OYLA 3OYIA 1U45A 4CIGA 1DTTA 2OZMA 2D5RA 1BI4A 2R7YA 2QKKA 4DF8A 1JLCA 2YNHA 3AA2A 4DG1A 4WE1A 4KTQA 2X6SA 3PUFA 1YTAA 4CGHA 3I8DA 3S3MA 4DTPA 1RBTA 3AO4A 4CEAA 2YNGA 2GUIA 4W5NA 3P1GA 3M8RA 1TK0A 2G8FA 1QQCA 3A2FA 1S1VA 4IG3A 3VQBA 1RDAA 3NGYA 2HVHA 1LV5A 1WSGA 2Z1HA 5I42A 3QEIA 3RWUA 1TV6A 1NK7A 3OYBA 1RT5A 3RTVA 1X9WA 4DQPA 1FKOA 3OVNA 3T3FA 2BDPA 2ZQBA 3DYAA 2FBVA 5CZ1A 1ZBUA 2G8VA 4KTWA 3QIOA 2P51A 3M8QA 3VQ9A 1NKBA 1XHZA 4DLEA 4GW6A 3SCXA 2GBZA 4EZ6A 4DTMA 1EX4A 4N41A 4FJIA 4W5QA 4C8OA 1J53A 1CZBA 3LP1A 3HP9A 3AVNA 3M8PA 4OVLA 1KFSA 1BHLA 4CHNA 3AO1A 1CZ9A 3O4NA 1SKSA 1SUQA 2DFEA 3VN5A 4KREA 3NBPA 4FVMA 3VQQA 2A1SA 5FRMA 1RT6A 4CECA 1ITGA 1C6VA 5KI6A 4CHPA 4Q5VA 3HYFA 3KLGA 4I2QA 4KV8A 3QNOA 3NGIA 2YHBA 3PO5A 4M3WA 3NH0A 4BE0A 3AVCA 1WAJA 3NF9A 4L8RB 4DTSA 3S9HA 3MXIA 1U49A 4ELTA 2HHTA 2OZSA 4CE9A 1JLAA 2Y1JA 4CF8A 1BIZA 2AJQA 3KK2A 3RMAA 2G8HA 4Z4GA 3MEEA 5J2PA 4K8ZA 2HVIA 1RBSA 3SQ0A 1T03A 5KGWA 3LAKA 4OKKA 2P5GA 3CFPA 3NH2A 1C0UA 3HJFA 4CF9A 2IAJA 3ZT2A 1B92A 3LPUA 2HHWA 2YKMA 2KZMA 1FK9A 4FLUA 4OLBA 1NKEA 4JLHA 5HROA 1L3UA 3L2QA 4CJ4A 1UAXA 4RW4A 4KRFA 4FLZA 4C8NA 3TWHA 3K5LA 4E7HA 4CJLA 3ZT4A 1L3TA 4Z4IA 4ZTFA 3CFRA 2F8SA 4F2RA 1NK8A 3VQ5A 4FM0A 1QSSA 5FROA 4CK2A 4CJWA 4B9TA 1O1WA 5CYMA 4DQRA 3NF6A 2X6NA 1L3VA 3VQEA 1KLNA 4KHNA 3SZ2A 4J2BA 4B08A 1JLBA 4GVMA 3K57A 5J2NA 1SKRA 3HL8A 4DTJA 3LP0A 3G0ZA 3WNGA 1I39A 4UQGA 3ZSRA 2HHUA 1VSMA 1U04A 3L2RA 5EU7A 4HUEA 4DU3A 3ASMA 3MXMA 1KTQA 1A5XA 3QERA 3SUNA 4Z4CA 2E6MA 3DLRA 3KLIA 2XHBA 2B5JA 4CEBA 5T7BA 4KHYA 1UA0A 4O55A 1HQEA 2PYLA 3KJVA 3AO5A 2HW3A 1TKDA 4OGCA 4DMNA 4FJHA 4CHZA 4CHOA 1HRHA 3HVTA 4F4KA 3KK3A 1EP4A 1RILA 1VSJA 3CM5A 1SL0A 2VG6A 3SNNA 4LSNA 1HPZA 4I9LA 5CY4A 3LDSA 4DSLA 2HHXA 2VG5A 1HNVA 2WOMA 4RW6A 3V9UA 1RT3A 1X9SA 2W42A 3KTQA 4FJ7A 4AHCA 1XC9A 4B9VA 3ZT1A 3V9XA 3NFAA 4IDKA 1RBRA 2RPIA 3HPOA 1LW2A 2Z1GA 4CGGA 3OYHA 1KVAA 3KLHA 3BDPA 1D8YA 2P5OA 4E1NA 1TK8A 4RW7A 1QE1A 2FBYA 3HPGA 2YKNA 4CESA 3NAEA 1U48A 4IFVA 3D0PA 3C95A 1DLOA 2EHGA 1TAUA 1ASUA 1CXUA 1RTJA 4NCAA 1BIUA 2KQ2A 5KRTA 4FM1A 1J9AA 2OA8A 1IKXA 1TVRA 5CZ2A 3DM2A 3K2PA 3B6OA 4OKJA 2IOCA 4DQQA 1TKXA 5C42A 3FFIA 4XIUA 3K59A 3OJUA 3TI0A 4M3ZA 3DLBA 3ITHA 3K58A 3QEXA 1K6YA 3MXJA 3ZT0A 3MAQA 4W5RA 3IAYA 2XY5A 1SL1A 3SJJA 1IKVA 2BGGA 4B9NA 1JKHA 4DTRA 4ZHRA 1S9EA 1ZBLA 3KLEA 3HO1A 2QXFA 2VG7A 4KAZA 3VQAA 1BQNA 1WLJA 2XY8A 3ZSWA 4M41A 3DOKA 1RT7A 4M42A 4O4GA 3V6DA 1DTQA 3C94A 1SV5A 2E6LA 2FBTA 3DLGA 3QIPA 3QESA 3PY8A 4FW2A 2KW4A 3DLKA 3TAQA 3O3GA 2XRIA 4BE1A 3ZSYA 4OJRA 1N6QA 3SV3A 1C1BA 3PV8A 1EXQA 4JRPA 2XY7A 5HLFA 2G8KA 4DQIA 1T8EA 3LAMA 3VA0A 2KZZA 3DRPA 4FJKA 1A5VA 1ZBIA 4TSXA 3LZJA 1NJYA 3V9ZA 1VSIA 4CJKA 3M8SA 4LD0A 4CEOA 4KI6A 3DRSA 3WNFA 1QHTA 4F3OA 2DY4A 3MEDA 4MFBA 2JLEA 3PX0A 1C0MA 5J1EA 3L2UA 1A5WA 2B4JA 3OYKA 4FZXC 3WNHA 3OYJA 4LSLA 1T05A 4FZZA 4HCBA 2I5JA 4DTNA 1LWEA 4DFMA 3RMDA 5DK5A 1F21A 3JSMA 1Q8IA 4AH9A 3SUPA 1IG9A 3LP3A 4DU4A 4CCHA 3TAMA 4AHRA 4KHSA 3SPYA 1Z25A 1UWBA 2ETJA 3VA3A 5KTQA 1S1WA 2HNDA 4CJ5A 4FK0A 4ELUA 2ZD1A 4PY5A 3U3GA 4CGJA 4BDYA 4FJ8A 4B8AB 4OPJA 1HYSA 3AVIA 3CM6A 2IGIA 3I0RA 4MQ3A 1N5YA 3AA4A 1U4BA 3DLEA 4BACA 4DFPA 3QEPA 3E01A 1L5UA 1RBUA 4RW9A 1WSEA 2BE2A 3NF7A 3P83D 2GV9A 5HBMA 4KKOA 3QEWA 4EZ9A 2YV0X 3TAGA 3V1RA 3PO4A 2HMIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RDD A;  3OYM A;  1T7P A;  1B9F A;  3C6T A;  4PQU A;  2RKI A;  5DMR A;  1LWF A;  4LY7 A;  3AO2 A;  1JXE A;  3SV4 A;  5SZT A;  4J2A A;  4H4O A;  3HK2 A;  2P1J A;  4CK3 A;  2HB5 A;  1HNI A;  1HQU A;  3ZSZ A;  4E89 A;  1WNS A;  1NK4 A;  2DTU A;  1BGX T;  3RRG A;  3EY1 A;  3AA3 A;  1C0T A;  4E19 A;  3V81 A;  4F2S A;  3NH1 A;  4CJT A;  4EP4 A;  4HUF A;  4CGI A;  1D5A A;  3KD5 E;  4FJ9 A;  1NJX A;  4DSE A;  4Z0U A;  1RCH A;  1QSY A;  5KGX A;  4FW1 A;  4N5S A;  1S5J A;  1XWL A;  1RBV A;  4FJX A;  4O5B A;  4OPK A;  1BQM A;  3RR8 A;  4R5P A;  1IKY A;  3VQ8 A;  1TL3 A;  2OYQ A;  1FKP A;  1CLQ A;  1KSP A;  4FYD A;  5FDL A;  1IH7 A;  1CXQ A;  3P5J A;  3DOL A;  1JL1 A;  4CER A;  3RR7 A;  1I3A A;  4CFA A;  2QKB A;  3VQ7 A;  4FLX A;  2BAN A;  4CJQ A;  2IC3 A;  4CIE A;  3KK1 A;  4M45 A;  1U47 A;  3DI6 A;  4FLT A;  2IDO A;  3RRH A;  4LH5 A;  5CYQ A;  1XHX A;  4B9M A;  4DU1 A;  3B6P A;  2HNY A;  3AVA A;  4CEF A;  4W5O A;  1TK5 A;  4QCL A;  1ASW A;  4FM2 A;  1RTD A;  1ZYQ A;  4AHV A;  1Q9X A;  4HVJ A;  4W5T A;  3LWM A;  1REV A;  1XI1 A;  3OS0 A;  3D45 A;  2G8U A;  4BWM A;  3S3N A;  4PUO A;  1YTU A;  5SWM A;  4JS4 A;  4OKE A;  2RF2 A;  3ISN C;  4FK4 A;  2Q3S A;  2PZS A;  1WAF A;  3ZCM A;  1FXX A;  1Z26 A;  4CJ3 A;  4B9L A;  2G8I A;  2FC0 A;  1TAQ A;  4CJR A;  3V1Q A;  4Z4F A;  1QSL A;  4FLV A;  3MEG A;  1BL3 A;  1IO2 A;  3OYE A;  1SL2 A;  3PX6 A;  5E41 A;  2RN2 A;  3TAR A;  1RTI A;  3ZSV A;  3EYZ A;  1VK0 A;  1YT3 A;  3BGR A;  3HP6 A;  3H08 A;  3NDK A;  1D9D A;  1RDC A;  3RMC A;  4NCB A;  4CJS A;  1EKE A;  4KTZ A;  4PA1 A;  4DFK A;  1R0A A;  3LWL A;  1S6P A;  1NK0 A;  1ZBH A;  4DSK A;  1QTM A;  2A1R A;  1KVB A;  3TAB A;  4B3O A;  4HUG A;  4CED A;  1G15 A;  4DLG A;  2OPS A;  2ZE2 A;  3O3F A;  3KLF A;  3TR8 A;  4JRQ A;  4DTU A;  1Q9Y A;  4NYF A;  2LSN A;  4E7K A;  4AHS A;  4KHW A;  4DS4 A;  3V9W A;  1NJW A;  4CFD A;  4YNQ A;  2NUB A;  3V9S A;  3WNE A;  1BCO A;  1QS4 A;  3T19 A;  2WON A;  1S1T A;  2DFF A;  3OYD A;  1B9D A;  3F73 A;  2PY5 A;  2Z1J A;  4KPY A;  4BDZ A;  4Z4E A;  1KLM A;  1WSJ A;  3T1A A;  4CJV A;  4CK1 A;  4DFJ A;  2KTQ A;  2OPR A;  4DSI A;  4O44 A;  5I3U A;  2OPQ A;  1RDB A;  4GMJ B;  3NE6 A;  2KFZ A;  3LP2 A;  1TKT A;  1RT4 A;  4KB1 A;  1Y97 A;  2Z1I A;  5HP1 A;  1HYV A;  1S1X A;  1VSD A;  3I0S A;  3HT3 A;  4DTO A;  1W0H A;  4K8X A;  4KHU A;  4M3T A;  3AVM A;  1C1A A;  4CJE A;  3QO9 A;  4FXD A;  4ID1 A;  3VQC A;  3QEV A;  3QIN A;  4I7F A;  4CEQ A;  3HVR A;  1KVC A;  1ZBF A;  4FJN A;  4CF1 A;  1GOC A;  1NJZ A;  1YVU A;  3KD1 E;  2YNF A;  3VQD A;  4LH4 A;  1S6Q A;  1J54 A;  4E7J A;  4FJM A;  2F96 A;  4AHT A;  3VQ4 A;  1RNH A;  3NGZ A;  4YFU A;  3HST B;  5C24 A;  4B9U A;  3V1O A;  3ZSX A;  3AO3 A;  4KHQ A;  4CEZ A;  4IBN A;  1X1P A;  1KFD A;  4E7I A;  1WSH A;  5J2M A;  5JS2 A;  3IRX A;  2O4G A;  1L3S A;  1GOA A;  3DMJ A;  3AVF A;  1GOB A;  4HHT A;  5C25 A;  4IFY A;  4I9Q A;  3V4I A;  2QK9 A;  3QLH A;  2E4L A;  4DQS A;  3KIO A;  2G8W A;  3UIQ A;  3AVJ A;  2D0C A;  4CIF A;  3OS2 A;  3ULD A;  1JL2 A;  3LZI A;  4FCY A;  2EX3 A;  4HTU A;  2X74 A;  3NF8 A;  4EP5 A;  1BIS A;  5J2Q A;  4FJG A;  3TAE A;  3K5M A;  3SYZ A;  4DSF A;  3DRR A;  4C8M A;  3ZSO A;  3SQ1 A;  1BCM A;  3IG1 A;  5K14 A;  3ZSQ A;  1TL1 A;  3LPT A;  4FJL A;  3QET A;  3CYM A;  3G10 A;  4N47 A;  3L2W A;  4M3X A;  3JYT A;  3L3U A;  4Y1C A;  3L3V A;  3TAP A;  3O4Q A;  4J2D A;  2O4I A;  3HM9 A;  3OYN A;  4Z4H A;  1JLE A;  1IKW A;  3L2V A;  4G1Q A;  1HMV A;  3AVH A;  3OYF A;  4O0I A;  2VWJ A;  4E3S A;  1S9G A;  3S3O A;  2JGU A;  3THV A;  3QNN A;  3EZ5 A;  3LAN A;  2DFH A;  3AVG A;  1WN7 A;  4NYN A;  4FJJ A;  3AV9 A;  1VSK A;  3F9K A;  4CFC A;  3HPH A;  1EET A;  5HRN A;  4DTX A;  4N56 A;  4FK2 A;  1S1U A;  1W9H A;  4ICL A;  3C6U A;  4M3R A;  3U6F A;  3RMB A;  4QOZ B;  2HHV A;  1ASV A;  3OY9 A;  4CHY A;  1KRP A;  4IKF A;  3SQ2 A;  3OJS A;  4AHU A;  4FLY A;  4BDP A;  3OYG A;  3OYA A;  1C1C A;  4I2P A;  4QAG A;  4B8C A;  4JS5 A;  2HNZ A;  2Y1I A;  2PYJ A;  3SPZ A;  3U3Y A;  5FRN A;  1RT1 A;  3CFO A;  4CGD A;  1X9M A;  2HHS A;  2KFN A;  4KO0 A;  4Y1D A;  3NCI A;  3LAL A;  4FZY A;  3VQ6 A;  3AA5 X;  1KCF A;  1VRT A;  4RG8 A;  1HYZ A;  3CQ8 A;  4O0J A;  4C8K A;  4CF2 A;  1NK5 A;  5D3G A;  4CF0 A;  1HJR A;  2YNI A;  1UA1 A;  2YHA A;  2F8T A;  4OLA A;  4BE2 A;  3L8B A;  4H4M A;  4J2E A;  4KI4 A;  1JLG A;  3VQP A;  4CHQ A;  4KB0 A;  4FLW A;  1J5O A;  4AIL C;  4H8K A;  3TAF A;  2B6A A;  1TGO A;  4ELV A;  4OGE A;  1WSF A;  2D0A A;  3AVK A;  1UOC A;  5HRP A;  1NOZ A;  1VSH A;  4DF4 A;  4DSJ A;  1NKC A;  3ALY A;  4DWI A;  4ID5 A;  4E7L A;  1VSL A;  4CEE A;  3K5N A;  4ZTJ A;  3DLH A;  2FBX A;  3AVL A;  1VSE A;  2OPP A;  3CG7 A;  4M3Y A;  1LAW A;  3SI6 A;  1JLF A;  2XY6 A;  4M3U A;  2HHQ A;  4F3T A;  4F8R A;  2IS3 A;  3HXM A;  4CJP A;  4DS5 A;  1WSI A;  4C8L A;  3TAN A;  3KKR A;  1NOY A;  3AVB A;  4CJF A;  4CJU A;  4IG0 A;  3PX4 A;  4RW8 A;  4Q0B A;  1NK6 A;  1MU2 A;  2VWK A;  1LW0 A;  4FJ5 A;  1TKZ A;  3MEC A;  4HCC A;  5KRS A;  1JXB A;  3KKS A;  3NHG A;  1LWC A;  1D9F A;  3OS1 A;  4BWJ A;  2D0B A;  1JLQ A;  4CFB A;  1VSF A;  4N76 A;  3SUQ A;  4PWD A;  5JS1 A;  3OYC A;  5HRR A;  1LAV A;  4B9S A;  3IS9 A;  5HRS A;  3O3H A;  1BI4 B;  4KFB A;  1VRU A;  4E1M A;  2XO7 A;  3ZT3 A;  4CGF A;  2ITG A;  4E0D A;  2ATQ A;  1NK9 A;  1SKW A;  4NCG A;  3SQ4 A;  1RT2 A;  2X78 A;  3K5O A;  3SUO A;  1RTH A;  3OYL A;  3OYI A;  1U45 A;  4CIG A;  1DTT A;  2OZM A;  2D5R A;  1BI4 A;  2R7Y A;  2QKK A;  4DF8 A;  1JLC A;  2YNH A;  3AA2 A;  4DG1 A;  4WE1 A;  4KTQ A;  2X6S A;  3PUF A;  1YTA A;  4CGH A;  3I8D A;  3S3M A;  4DTP A;  1RBT A;  3AO4 A;  4CEA A;  2YNG A;  2GUI A;  4W5N A;  3P1G A;  3M8R A;  1TK0 A;  2G8F A;  1QQC A;  3A2F A;  1S1V A;  4IG3 A;  3VQB A;  1RDA A;  3NGY A;  2HVH A;  1LV5 A;  1WSG A;  2Z1H A;  5I42 A;  3QEI A;  3RWU A;  1TV6 A;  1NK7 A;  3OYB A;  1RT5 A;  3RTV A;  1X9W A;  4DQP A;  1FKO A;  3OVN A;  3T3F A;  2BDP A;  2ZQB A;  3DYA A;  2FBV A;  5CZ1 A;  1ZBU A;  2G8V A;  4KTW A;  3QIO A;  2P51 A;  3M8Q A;  3VQ9 A;  1NKB A;  1XHZ A;  4DLE A;  4GW6 A;  3SCX A;  2GBZ A;  4EZ6 A;  4DTM A;  1EX4 A;  4N41 A;  4FJI A;  4W5Q A;  4C8O A;  1J53 A;  1CZB A;  3LP1 A;  3HP9 A;  3AVN A;  3M8P A;  4OVL A;  1KFS A;  1BHL A;  4CHN A;  3AO1 A;  1CZ9 A;  3O4N A;  1SKS A;  1SUQ A;  2DFE A;  3VN5 A;  4KRE A;  3NBP A;  4FVM A;  3VQQ A;  2A1S A;  5FRM A;  1RT6 A;  4CEC A;  1ITG A;  1C6V A;  5KI6 A;  4CHP A;  4Q5V A;  3HYF A;  3KLG A;  4I2Q A;  4KV8 A;  3QNO A;  3NGI A;  2YHB A;  3PO5 A;  4M3W A;  3NH0 A;  4BE0 A;  3AVC A;  1WAJ A;  3NF9 A;  4L8R B;  4DTS A;  3S9H A;  3MXI A;  1U49 A;  4ELT A;  2HHT A;  2OZS A;  4CE9 A;  1JLA A;  2Y1J A;  4CF8 A;  1BIZ A;  2AJQ A;  3KK2 A;  3RMA A;  2G8H A;  4Z4G A;  3MEE A;  5J2P A;  4K8Z A;  2HVI A;  1RBS A;  3SQ0 A;  1T03 A;  5KGW A;  3LAK A;  4OKK A;  2P5G A;  3CFP A;  3NH2 A;  1C0U A;  3HJF A;  4CF9 A;  2IAJ A;  3ZT2 A;  1B92 A;  3LPU A;  2HHW A;  2YKM A;  2KZM A;  1FK9 A;  4FLU A;  4OLB A;  1NKE A;  4JLH A;  5HRO A;  1L3U A;  3L2Q A;  4CJ4 A;  1UAX A;  4RW4 A;  4KRF A;  4FLZ A;  4C8N A;  3TWH A;  3K5L A;  4E7H A;  4CJL A;  3ZT4 A;  1L3T A;  4Z4I A;  4ZTF A;  3CFR A;  2F8S A;  4F2R A;  1NK8 A;  3VQ5 A;  4FM0 A;  1QSS A;  5FRO A;  4CK2 A;  4CJW A;  4B9T A;  1O1W A;  5CYM A;  4DQR A;  3NF6 A;  2X6N A;  1L3V A;  3VQE A;  1KLN A;  4KHN A;  3SZ2 A;  4J2B A;  4B08 A;  1JLB A;  4GVM A;  3K57 A;  5J2N A;  1SKR A;  3HL8 A;  4DTJ A;  3LP0 A;  3G0Z A;  3WNG A;  1I39 A;  4UQG A;  3ZSR A;  2HHU A;  1VSM A;  1U04 A;  3L2R A;  5EU7 A;  4HUE A;  4DU3 A;  3ASM A;  3MXM A;  1KTQ A;  1A5X A;  3QER A;  3SUN A;  4Z4C A;  2E6M A;  3DLR A;  3KLI A;  2XHB A;  2B5J A;  4CEB A;  5T7B A;  4KHY A;  1UA0 A;  4O55 A;  1HQE A;  2PYL A;  3KJV A;  3AO5 A;  2HW3 A;  1TKD A;  4OGC A;  4DMN A;  4FJH A;  4CHZ A;  4CHO A;  1HRH A;  3HVT A;  4F4K A;  3KK3 A;  1EP4 A;  1RIL A;  1VSJ A;  3CM5 A;  1SL0 A;  2VG6 A;  3SNN A;  4LSN A;  1HPZ A;  4I9L A;  5CY4 A;  3LDS A;  4DSL A;  2HHX A;  2VG5 A;  1HNV A;  2WOM A;  4RW6 A;  3V9U A;  1RT3 A;  1X9S A;  2W42 A;  3KTQ A;  4FJ7 A;  4AHC A;  1XC9 A;  4B9V A;  3ZT1 A;  3V9X A;  3NFA A;  4IDK A;  1RBR A;  2RPI A;  3HPO A;  1LW2 A;  2Z1G A;  4CGG A;  3OYH A;  1KVA A;  3KLH A;  3BDP A;  1D8Y A;  2P5O A;  4E1N A;  1TK8 A;  4RW7 A;  1QE1 A;  2FBY A;  3HPG A;  2YKN A;  4CES A;  3NAE A;  1U48 A;  4IFV A;  3D0P A;  3C95 A;  1DLO A;  2EHG A;  1TAU A;  1ASU A;  1CXU A;  1RTJ A;  4NCA A;  1BIU A;  2KQ2 A;  5KRT A;  4FM1 A;  1J9A A;  2OA8 A;  1IKX A;  1TVR A;  5CZ2 A;  3DM2 A;  3K2P A;  3B6O A;  4OKJ A;  2IOC A;  4DQQ A;  1TKX A;  5C42 A;  3FFI A;  4XIU A;  3K59 A;  3OJU A;  3TI0 A;  4M3Z A;  3DLB A;  3ITH A;  3K58 A;  3QEX A;  1K6Y A;  3MXJ A;  3ZT0 A;  3MAQ A;  4W5R A;  3IAY A;  2XY5 A;  1SL1 A;  3SJJ A;  1IKV A;  2BGG A;  4B9N A;  1JKH A;  4DTR A;  4ZHR A;  1S9E A;  1ZBL A;  3KLE A;  3HO1 A;  2QXF A;  2VG7 A;  4KAZ A;  3VQA A;  1BQN A;  1WLJ A;  2XY8 A;  3ZSW A;  4M41 A;  3DOK A;  1RT7 A;  4M42 A;  4O4G A;  3V6D A;  1DTQ A;  3C94 A;  1SV5 A;  2E6L A;  2FBT A;  3DLG A;  3QIP A;  3QES A;  3PY8 A;  4FW2 A;  2KW4 A;  3DLK A;  3TAQ A;  3O3G A;  2XRI A;  4BE1 A;  3ZSY A;  4OJR A;  1N6Q A;  3SV3 A;  1C1B A;  3PV8 A;  1EXQ A;  4JRP A;  2XY7 A;  5HLF A;  2G8K A;  4DQI A;  1T8E A;  3LAM A;  3VA0 A;  2KZZ A;  3DRP A;  4FJK A;  1A5V A;  1ZBI A;  4TSX A;  3LZJ A;  1NJY A;  3V9Z A;  1VSI A;  4CJK A;  3M8S A;  4LD0 A;  4CEO A;  4KI6 A;  3DRS A;  3WNF A;  1QHT A;  4F3O A;  2DY4 A;  3MED A;  4MFB A;  2JLE A;  3PX0 A;  1C0M A;  5J1E A;  3L2U A;  1A5W A;  2B4J A;  3OYK A;  4FZX C;  3WNH A;  3OYJ A;  4LSL A;  1T05 A;  4FZZ A;  4HCB A;  2I5J A;  4DTN A;  1LWE A;  4DFM A;  3RMD A;  5DK5 A;  1F21 A;  3JSM A;  1Q8I A;  4AH9 A;  3SUP A;  1IG9 A;  3LP3 A;  4DU4 A;  4CCH A;  3TAM A;  4AHR A;  4KHS A;  3SPY A;  1Z25 A;  1UWB A;  2ETJ A;  3VA3 A;  5KTQ A;  1S1W A;  2HND A;  4CJ5 A;  4FK0 A;  4ELU A;  2ZD1 A;  4PY5 A;  3U3G A;  4CGJ A;  4BDY A;  4FJ8 A;  4B8A B;  4OPJ A;  1HYS A;  3AVI A;  3CM6 A;  2IGI A;  3I0R A;  4MQ3 A;  1N5Y A;  3AA4 A;  1U4B A;  3DLE A;  4BAC A;  4DFP A;  3QEP A;  3E01 A;  1L5U A;  1RBU A;  4RW9 A;  1WSE A;  2BE2 A;  3NF7 A;  3P83 D;  2GV9 A;  5HBM A;  4KKO A;  3QEW A;  4EZ9 A;  2YV0 X;  3TAG A;  3V1R A;  3PO4 A;  2HMI A; 
#chains in the Genus database with same CATH topology
 4AM6 A;  1RDD A;  1B9F A;  3C6T A;  5DMR A;  1LWF A;  1JXE A;  4HTL A;  5JVH L;  2DTU A;  3H45 C;  3RRG A;  2QWL A;  4YDU A;  4E19 A;  4F2S A;  2UXB K;  1YIJ N;  4CJT A;  4EP4 A;  1RFQ A;  1D5A A;  2OAN A;  3IUC A;  4DSE A;  1RCH A;  4H0X B;  5EXW A;  1QSY A;  4FW1 A;  5M1O A;  4DV3 K;  3THX A;  1S5J A;  3RR8 A;  2OYQ A;  4E1J A;  5FDL A;  3DOL A;  4CER A;  3VQ7 A;  3H3O B;  4KH5 A;  4CIE A;  3KK1 A;  4M45 A;  5CYQ A;  3LM9 A;  1XHX A;  2GTD A;  1E4G T;  4AHV A;  3CIP A;  3LWM A;  1JJ2 M;  1XI1 A;  4PKH A;  3OS0 A;  3D45 A;  4BWM A;  4DB3 A;  1N36 K;  3K0S A;  1N32 K;  2UXD K;  3OHR A;  4X64 K;  2FC0 A;  4Z4F A;  3H46 O;  4H0V B;  1BL3 A;  1M90 O;  3OYE A;  1W97 L;  3CJC A;  3ZSV A;  3EYZ A;  1Q7Y O;  4NCB A;  1RDC A;  4KTZ A;  1WBD A;  3LWL A;  1TUY A;  1KVB A;  3TAB A;  4HUG A;  2ZE2 A;  3TR8 A;  3DXM B;  4E7K A;  1NGG A;  4AHS A;  1S22 A;  3FZM A;  4ILG B;  4YNQ A;  2NUB A;  3NVM A;  4DR7 K;  2IVN A;  3H3N O;  1B9D A;  4Z4E A;  4BDZ A;  1KLM A;  1WSJ A;  1C0F A;  3T1A A;  4CJV A;  2P9P B;  2KTQ A;  2OPR A;  3EKU A;  4O44 A;  2OPQ A;  4GMJ B;  3UKU A;  3FZK A;  4KB1 A;  5FPE A;  2Z1I A;  3RSE A;  1VSD A;  3GL1 A;  4KHU A;  4JKD A;  3R8E A;  3AVM A;  3O9R A;  4NLC A;  3QEV A;  4CEQ A;  3G4S N;  1Z05 A;  1ZBF A;  4FJN A;  3PSI A;  2IVO A;  1NJZ A;  2YNF A;  1S6Q A;  4FVU A;  3VQ4 A;  1RNH A;  2KKZ A;  2ZGZ A;  4YFU A;  5C24 A;  4DV1 K;  3R1X A;  4CEZ A;  4IBN A;  1X1P A;  5J2M A;  3DAW A;  5A2Q O;  3IFR A;  4ILH A;  1HUX A;  3QLH A;  5AQM A;  1H1V A;  5B8H A;  2I7N A;  4O8U A;  3LZI A;  3VER A;  3NF8 A;  1BIS A;  5J2Q A;  2EWS A;  3ZSO A;  5K14 A;  1TL1 A;  3LPT A;  5AQX A;  3CYM A;  3L2W A;  4M3X A;  1W7A A;  4Y1C A;  3TAP A;  3B8A X;  2O4I A;  3AVH A;  4O0I A;  1S9G A;  3THV A;  3WUH A;  3I56 N;  2DFH A;  3T69 A;  1T44 A;  4BRK A;  1WN7 A;  4NYN A;  3F9K A;  4DTX A;  4FK2 A;  4ICL A;  3U6F A;  3C6U A;  4FWR A;  4B1Z A;  1Q82 O;  4CHY A;  1NLV A;  4DUY K;  4FWK A;  4FLY A;  3UKU B;  3OYG A;  4B8C A;  4QAG A;  1ZBH A;  2V7Y A;  3QBW A;  1RGI A;  2Q2R A;  4CGD A;  4WYB A;  4BRQ A;  4KO0 A;  4Y1D A;  4FZY A;  4O0J A;  4C8K A;  1NK5 A;  4CBW A;  4A57 A;  4CF0 A;  1UA1 A;  2F8T A;  3JXU A;  4J2E A;  4KB0 A;  1S72 N;  1JCE A;  2B6A A;  4OGE A;  2D0A A;  1UOC A;  5HRP A;  4IO9 L;  4DF4 A;  4JKF A;  1GLB G;  2HOE A;  2A41 A;  3K5N A;  4ZTJ A;  2FBX A;  3BUZ B;  2QW9 A;  1VSE A;  2OPP A;  5AQO A;  3BF3 A;  1V4S A;  4LF4 K;  3SI6 A;  1ZXO A;  4CJP A;  4DS5 A;  3TAN A;  4CJF A;  2VYP A;  4IG0 A;  3PX4 A;  4RW8 A;  4JV5 K;  3MEC A;  4RCH A;  4HCC A;  1LWC A;  4BWJ A;  2D0B A;  4F9O A;  4CFB A;  4N76 A;  4K0K K;  1LAV A;  4M7Y A;  3IDH A;  2XO7 A;  3ZT3 A;  2ITG A;  4H03 B;  3SQ4 A;  2W40 A;  3ENH A;  4KH4 A;  2D5R A;  2R7Y A;  2QKK A;  4DF8 A;  5AQF A;  3ZX0 A;  4CZE A;  3I8D A;  3J8A A;  3S3M A;  4LFB K;  3T1Y K;  3AO4 A;  4ISF A;  4DR4 K;  5CHI A;  3M8R A;  2O8C B;  1QQC A;  3A2F A;  1S1V A;  4YHH K;  4IG3 A;  1LV5 A;  1ILY A;  1BWF O;  2Z1H A;  4KH6 A;  2BUP A;  4DQP A;  3L4I A;  3EN9 A;  2FBV A;  2VWB A;  4KTW A;  1NKB A;  4FPA A;  2GBZ A;  4EZ6 A;  3PSF A;  4W5Q A;  1CZB A;  3LP1 A;  3HP9 A;  4OVL A;  1KFS A;  3DXK A;  1CZ9 A;  2E1Z A;  4H0O A;  1SUQ A;  3FLC O;  3HRG A;  3F2K A;  3VQQ A;  2AA4 A;  5KI6 A;  4I2Q A;  3NGI A;  4C1N K;  4BE0 A;  1HNX K;  3CCL N;  2HHT A;  1KD1 O;  1U49 A;  3VGL A;  1JLA A;  2Y1J A;  4CF8 A;  1BIZ A;  2AJQ A;  4YOY A;  2G8H A;  4Z4G A;  3MEE A;  5J2P A;  4K8Z A;  4Z94 A;  3CC7 N;  3SK3 A;  1T03 A;  3HTV A;  2ZM6 K;  1QVF M;  1C0U A;  3HJF A;  5F2R A;  3WT0 A;  1B92 A;  2CH5 A;  2CGK A;  2HHW A;  1HNW K;  3A5L C;  1ZC6 A;  3MX5 A;  4FLU A;  2A6A A;  3OA9 A;  1NKE A;  5HRO A;  2GEM A;  4CJ4 A;  1UAX A;  4RW4 A;  4KRF A;  3FR0 A;  1N33 K;  4FLZ A;  3LM2 A;  4C8N A;  3MMV A;  3TWH A;  4V19 S;  2E2O A;  3ZT4 A;  5M1Q A;  4JKG B;  1O1W A;  4CZH A;  3NF6 A;  2X6N A;  4KHN A;  4B08 A;  1JLB A;  3P39 A;  5J2N A;  2NRZ A;  3WNG A;  4UQG A;  4BC5 A;  1VSM A;  1U04 A;  2D0P A;  4DU3 A;  2D4W A;  1A5X A;  1VAZ A;  2E6M A;  3KLI A;  1FJG K;  4KHY A;  4BRI A;  4O55 A;  1BA0 A;  1TKD A;  4JYA K;  4FJH A;  4CHZ A;  1HRH A;  3KK3 A;  1EP4 A;  1RIL A;  4WQ5 A;  1SL0 A;  1K9M O;  2QKB A;  4LSN A;  1HPZ A;  4O8K A;  2WOM A;  2W42 A;  4FJ7 A;  1XC9 A;  3V9X A;  1RBR A;  2Z1G A;  1D4X A;  3BDP A;  1YXQ A;  2P5O A;  2I7P A;  1TK8 A;  3HPG A;  4H5R A;  2YKN A;  3D0P A;  2EHG A;  1ZBS A;  1ASU A;  1CXU A;  3LDL A;  4NCA A;  5KRT A;  1J9A A;  5CZ2 A;  4DKW A;  5EOY A;  2IOC A;  3KWG A;  1TKX A;  3Q7C A;  4XIU A;  4QS7 A;  3U4L A;  3WEE B;  4B1Y B;  1K6Y A;  3ZET A;  3ZT0 A;  4QS8 A;  1IBL K;  3G25 A;  3IAY A;  3C7N A;  2XY5 A;  2ASO A;  1XNQ K;  5C15 A;  1BG3 A;  5AQP A;  1OH5 A;  5GIP A;  3FZL A;  3LL3 A;  3TU5 A;  4KAZ A;  1WLJ A;  2XY8 A;  3ZSW A;  4M41 A;  5KQD A;  3AAR A;  4O4G A;  2ZWH A;  5AZI A;  3SAF A;  2E6L A;  3QES A;  5FPN A;  2ASP A;  2KW4 A;  5ADX H;  1VQ4 N;  3R6M A;  3O9T A;  4CI6 A;  4JRP A;  5I9E B;  2XY7 A;  2G8K A;  2A40 A;  1ZBI A;  1NM1 A;  1NJY A;  4LD0 A;  4CEO A;  5LMN K;  3L4Q A;  3C6H A;  4F3O A;  3RVC A;  3MCA B;  1Q81 O;  1C0M A;  2YJE A;  2B4J A;  3MN5 A;  3WNH A;  4LSL A;  2I5J A;  5KPR A;  3I33 A;  1DKG D;  1Q8I A;  4AH9 A;  3TSQ A;  1YVN A;  4CCH A;  3CME N;  2UUC K;  3P4I A;  4IFE A;  4OPJ A;  2FF6 A;  4FPB A;  2FLO A;  1N5Y A;  3UKR A;  3CQY A;  3DLE A;  4BAC A;  3QEP A;  5JLH A;  1W2B M;  2BE2 A;  3P83 D;  4EZ9 A;  4KKO A;  4YOT A;  4DV6 K;  3TAG A;  3V1R A;  1ATR A;  4DV7 K;  2HMI A;  3G6E N;  1DEJ A;  5DM6 L;  3OYM A;  4PQU A;  2RKI A;  3SV4 A;  5SZT A;  4CK3 A;  1HNI A;  1HQU A;  1WNS A;  5AQY A;  4JN4 A;  1C0T A;  5FPD A;  2V51 B;  5AQQ A;  3NH1 A;  3CJ1 A;  1KC8 O;  1NJX A;  4A2A A;  4R79 A;  3AGR A;  5F1X A;  4N5S A;  4BVO A;  5C2D A;  5BR8 K;  4FJX A;  4O5B A;  1BQM A;  4R5P A;  3VQ8 A;  1KSP A;  3L0Q A;  4FYD A;  1IH7 A;  3P5J A;  3C65 A;  2JWL A;  1JL1 A;  1VHX A;  3VF6 A;  4CFA A;  5E84 A;  2FSK A;  4CJQ A;  4FLT A;  4LH5 A;  4PKG A;  3B6P A;  3O9U A;  5C10 A;  1QQM A;  4PKI A;  1Z6R A;  4QCL A;  4CZM A;  4I6M A;  1ASW A;  4FM2 A;  1YJW N;  3ZEU A;  1DGK N;  4H0P A;  2YHX A;  1YTU A;  4JS4 A;  4FK4 A;  1XUP O;  2Q3S A;  1BOT O;  3ZCM A;  1FXX A;  4NXM K;  1TAQ A;  2CGJ A;  3ZX2 A;  1VQO N;  3PX6 A;  5E41 A;  2GX9 A;  2Q0R A;  3VTH A;  1VK0 A;  1YT3 A;  3HP6 A;  3NDK A;  2QWR A;  1D9D A;  2OTJ N;  4CJS A;  1EKE A;  4DFK A;  1NMN A;  4IOA L;  2YI1 A;  4JHD B;  3VEV A;  4B3O A;  2W6L A;  3KLF A;  3VF2 A;  4UY8 O;  4DTU A;  1Q9Y A;  2LSN A;  4KHW A;  1O13 A;  2WC9 A;  4DS4 A;  1NJW A;  1BCO A;  3F73 A;  1S1T A;  4KPY A;  2Z1J A;  1VQN N;  4DFJ A;  2VQF K;  4DSI A;  3THW B;  5F0X A;  1RDB A;  3NE6 A;  1K8K A;  5EY4 A;  5HP1 A;  3JAM O;  2V52 B;  3HT3 A;  5BRE A;  3O9Q A;  3QO9 A;  3VQC A;  3QIN A;  3SAG A;  4JD2 A;  4X65 K;  2P9N A;  4CF1 A;  3H1V X;  4A5A A;  4GV3 A;  2QEX N;  4GV9 A;  1T6D A;  3KD1 E;  2F96 A;  3NGZ A;  3P31 A;  4B9U A;  4CZK A;  2O4G A;  4BQL A;  1T3V A;  4HHT A;  4IFY A;  2GWK A;  5AR0 A;  3CHW A;  4WFA L;  4DQS A;  4J8F A;  2D0C A;  4CIF A;  2D0O A;  3OS2 A;  3ULD A;  4HTU A;  1J6Z A;  1RDW X;  3VEX A;  3K5M A;  3ENO A;  3LDQ A;  4JKE A;  3QET A;  3ULE A;  4PL7 A;  4N47 A;  4FWL A;  3JYT A;  3WQU A;  3HM9 A;  1S3X A;  1OH7 A;  4G1Q A;  5AQU A;  2JGU A;  1G99 A;  3QNN A;  3LAN A;  1NGF A;  3AV9 A;  1VSK A;  5AQH A;  4M3R A;  3GOI A;  2WUS A;  4BRE A;  5BRH A;  4H0T B;  1C1C A;  2PYJ A;  1NWK A;  3CFO A;  5AQG A;  1X9M A;  2HHS A;  2KFN A;  3HZ6 A;  3LAL A;  3AA5 X;  1KCF A;  5TKW A;  4RG8 A;  3CQ8 A;  4JI0 K;  1NGB A;  4CF2 A;  4DV5 K;  5D3G A;  3HM8 A;  1YUW A;  4FOE A;  2YHA A;  1QHA A;  3VQP A;  3MDQ A;  4AIL C;  2ZF5 O;  3O8M A;  1NOZ A;  3ALY A;  5BN9 A;  4BGB A;  1U2V B;  3ID8 A;  1HNZ K;  3GDQ A;  1K73 O;  3DLH A;  3VF4 A;  1KQS M;  4QS9 A;  4FWQ A;  4M3Y A;  1LAW A;  2XY6 A;  1U2V A;  5GIO A;  4M3U A;  4F8R A;  3KKR A;  1NOY A;  1YJ9 N;  4JKA A;  1HR0 K;  2RHK A;  4FWP A;  4Q0B A;  1NK6 A;  3UE5 A;  2VWK A;  1WUA A;  5DM7 L;  3CER A;  3K9K A;  3ZX3 A;  4PWD A;  3OYC A;  3M1F A;  4KFB A;  2VQE K;  1RT2 A;  2BTF A;  3OYI A;  4CIG A;  1DTT A;  1KAX A;  1JLC A;  2YNH A;  3MN7 A;  2ZJP L;  4CGH A;  1RBT A;  3U8X A;  4W5N A;  3P1G A;  1TK0 A;  2G8F A;  1NGD A;  3QML A;  5AQL A;  3A5N C;  1RDA A;  3NGY A;  3VQB A;  2HVH A;  3D7E O;  5AZJ B;  3QEI A;  3OYB A;  1RT5 A;  1FKO A;  3OVN A;  3T3F A;  2BDP A;  5BN8 A;  2GUP A;  3QIO A;  4BRF A;  3W0L A;  1BO5 O;  4GW6 A;  4EAH D;  1YI2 N;  4CZL A;  1EX4 A;  4FJI A;  1YJN N;  3AVN A;  3M8P A;  1BDG A;  4Y0W A;  3O4N A;  2DFE A;  4MO4 A;  4KRE A;  2P9S B;  1MA9 B;  2A1S A;  5E26 A;  5FRM A;  1E4F T;  4Q5V A;  3HYF A;  3KLG A;  3WQT A;  3TSP A;  3BP8 A;  3NF9 A;  1WAJ A;  4DTS A;  3S9H A;  4ELT A;  2P9I A;  4MLH A;  3RMA A;  4CD3 A;  4ILJ A;  2HVI A;  2P9I B;  2NRH A;  4K43 A;  3LAK A;  5LY3 A;  3WXJ A;  2P9L A;  3ZT2 A;  1OVY A;  4EIA A;  1NGA A;  4JLH A;  1MWM A;  1L3U A;  4OPH A;  2WTU A;  2VCP A;  4CJL A;  4Z4I A;  3CFR A;  4F2R A;  1R59 O;  3VQ5 A;  4FM0 A;  5FRO A;  4CJW A;  5CYM A;  1KLN A;  4J2B A;  1BA1 A;  3LP0 A;  2HHU A;  3L2R A;  4JI4 K;  1TYQ B;  1KTQ A;  3SUN A;  4AM7 A;  4CEB A;  1UA0 A;  1HQE A;  3VPZ A;  3C0B A;  3KJV A;  2QWN A;  2E2P A;  4CHO A;  3J7Z O;  1GLA G;  3CM5 A;  3VGK A;  2VG6 A;  2HHX A;  4I9L A;  3J7Y P;  3V9U A;  1X3N A;  4AHC A;  5AJ3 K;  3ZT1 A;  2RPI A;  4CGG A;  3KLH A;  1D8Y A;  5ADX A;  1VQ7 N;  1QE1 A;  3ZLJ A;  4JKB A;  3MN6 A;  3C95 A;  1DLO A;  5BR9 A;  1TAU A;  2OA8 A;  1TVR A;  4JI5 K;  3QBX A;  3K2P A;  4DQQ A;  5C42 A;  3TI0 A;  3K58 A;  3MAQ A;  4H5T A;  4BRN A;  5FPM A;  1Y64 A;  3N4P A;  3ZET B;  3SJJ A;  2BGG A;  4B9N A;  1JKH A;  4ZHR A;  1S9E A;  1ZBL A;  4JKC A;  4RTF D;  4BRL A;  1BQN A;  4BR2 A;  3O5B A;  3DOK A;  4L3Q A;  4FL9 A;  4LF8 K;  1DTQ A;  3FGU A;  3THX B;  3TAQ A;  3O3G A;  2XRI A;  1N6Q A;  2O8F A;  4YOX A;  3SV3 A;  1EXQ A;  1GLC G;  3VTI A;  2Q31 A;  4MLE A;  4GY2 B;  1A5V A;  4OPA A;  2A42 A;  3A0I X;  4TSX A;  2J4R A;  1VSI A;  4IEI A;  4NB4 A;  1QHT A;  4LFA K;  3PIO L;  3KHY A;  4IXC A;  1VQ5 N;  1A5W A;  1T05 A;  4CW7 B;  4DTN A;  3FZF A;  1QQO A;  3SUP A;  3LP3 A;  4DU4 A;  4YOR A;  2HBK A;  3MX2 A;  3TAM A;  4AHR A;  4KHS A;  4K42 A;  1Z25 A;  4CJ5 A;  1EQY A;  5BPL A;  4A5B A;  2ZD1 A;  5M1F A;  4PY5 A;  4BDY A;  3F5T A;  4B8A B;  4ISE A;  3CM6 A;  4MQ3 A;  5BPM A;  5AQZ A;  4WQ4 C;  3E9L A;  4M7X A;  3E01 A;  5HBM A;  3QEW A;  3WEE A;  2HBL A;  4IDH A;  4BR5 A;  4HCB A;  5AQK A;  1T7P A;  3AO2 A;  4J2A A;  1N8R O;  2P1J A;  2HB5 A;  3VES A;  4E89 A;  1NK4 A;  1BGX T;  3EY1 A;  3AA3 A;  4DQ8 A;  3V81 A;  1GLF O;  4DR6 K;  4HUF A;  3N4Q A;  4CGI A;  3EZW A;  4HWI A;  4Z0U A;  2O8E B;  5M1P A;  3CD6 N;  1RBV A;  3R3L A;  4CBU A;  4OPK A;  1IKY A;  1TL3 A;  1FKP A;  4B1U B;  3OBY A;  4JK9 A;  3SMS A;  5LJV A;  3RR7 A;  4CBX A;  1I3A A;  4FLX A;  2BAN A;  2BH1 A;  2IC3 A;  1U47 A;  3A5O C;  2IDO A;  3OW2 M;  3RRH A;  5IWA K;  4B1V A;  4B9M A;  2HNY A;  4CEF A;  1NGJ A;  1GLD G;  4IWV A;  4B1X B;  1RDU A;  4HVJ A;  1Q9X A;  1REV A;  4MO5 A;  4OKE A;  3CCS N;  2RF2 A;  3ISN C;  4U7B A;  1FW6 A;  1QZ5 A;  3C6A A;  2G8I A;  3EE8 A;  3E66 A;  3V1Q A;  2KLA A;  3KK7 A;  4FLV A;  3MEG A;  3HBT A;  4DR2 K;  2RN2 A;  3TAR A;  1RTI A;  5GAH P;  1C0G A;  3TTC A;  3BGR A;  4IZ9 A;  3RMC A;  1DT9 A;  2YJF A;  1R0A A;  4FSV A;  1QVG M;  1K8A O;  4WF9 L;  1QTM A;  4DSK A;  3FZH A;  4CED A;  4DV2 K;  2OPS A;  3CC4 N;  1VQP N;  3EEQ A;  4NYF A;  1EO1 A;  3V9W A;  4CFD A;  3V9S A;  3WNE A;  1QS4 A;  3SLC A;  4PHT X;  2WON A;  3OYD A;  2PY5 A;  1K8K B;  1XC3 A;  2NZT A;  2IVP A;  4CK1 A;  3SBG A;  1P8Z A;  4LF9 K;  4OX9 K;  1N34 K;  5I3U A;  2FF3 B;  2KFZ A;  5C0Y A;  3LP2 A;  1TKT A;  1RT4 A;  2ITM A;  3AY9 A;  1YHQ N;  1Y97 A;  4JD2 B;  3ATV A;  3I0S A;  4M3T A;  1ATS A;  4B3R K;  3THY B;  3HVR A;  1KVC A;  1I94 K;  1GOC A;  4G9Z A;  4DR3 K;  3CJ7 A;  1WOQ A;  1YVU A;  3VQD A;  1J54 A;  3QIC A;  4FJM A;  1NGI A;  2NRW A;  4AHT A;  5M1K A;  3J80 O;  2OCE A;  3ZSX A;  4KHQ A;  3JS6 A;  3CF5 L;  4E7I A;  1KFD A;  4IJA A;  5JS2 A;  3LDN A;  5CE3 A;  3AVF A;  2UU9 K;  3OBW A;  1ESV A;  3AGK A;  1T6C A;  1NMD A;  2E4L A;  2HST A;  3KIO A;  3UIQ A;  2HBM A;  1JL2 A;  3ULE B;  2X74 A;  4EP5 A;  3TAE A;  4K25 A;  3SYZ A;  4DSF A;  3DRR A;  4C8M A;  1XMO K;  4FWN A;  1BCM A;  3IG1 A;  3ZSQ A;  4FJL A;  3G10 A;  3SAH A;  4JKH A;  1QZ6 A;  2NRX A;  3O4Q A;  3CCR N;  3Q7B A;  4BC2 A;  4Z4H A;  3OYF A;  4JNE A;  2VWJ A;  2HF4 A;  4BQZ A;  3AVG A;  5ELZ A;  1SAZ A;  1BU6 O;  5HRN A;  4QOZ B;  1ASV A;  4IKF A;  1KRP A;  2JWK A;  2P9P A;  3SQ2 A;  2UXC K;  3OJS A;  4AHU A;  3OYA A;  4I2P A;  4JS5 A;  2HNZ A;  3SPZ A;  1NGH A;  2Q97 A;  3U3Y A;  5FRN A;  4WQ4 A;  3O9S A;  1VRT A;  1HKG A;  5AQW A;  2YNI A;  3CJ9 A;  4CHQ A;  5AQN A;  3VEZ A;  4AF1 A;  4JI3 K;  3TAF A;  4ELV A;  3NVK A;  3AVK A;  2HF3 A;  2FSN A;  1NKC A;  4KHP K;  1OH6 A;  4E7L A;  3CCQ N;  3O4W A;  3TTF A;  3AVL A;  2O8B A;  3CG7 A;  2HHQ A;  5AQS A;  4A59 A;  2Q1N A;  3HXM A;  4C8L A;  5EVZ A;  1OVQ A;  1LW0 A;  1TKZ A;  1JXB A;  3NHG A;  3O80 A;  1GLE G;  2GWJ A;  1VSF A;  2H3G X;  3D6R A;  3IS9 A;  5HRS A;  1BI4 B;  1VRU A;  4CGF A;  4E0D A;  2ATQ A;  1NK9 A;  1SKW A;  4BC3 A;  4B3T K;  5HL7 L;  3K5O A;  1RTH A;  4XH4 A;  1U45 A;  1SQK A;  4BRO A;  1BI4 A;  2PFU A;  3AA2 A;  4DG1 A;  5BPN A;  2X6S A;  3PUF A;  1YTA A;  4PL8 A;  4FWO A;  2O8D B;  2GUI A;  3D2E B;  5M1N A;  3CCJ N;  3ATU A;  2NRV A;  5I42 A;  3M6G A;  3RWU A;  1TV6 A;  3QDK A;  1NK7 A;  3RTV A;  1X9W A;  2E2Q A;  2QWP A;  5CZ1 A;  2P51 A;  3VQ9 A;  4A61 A;  3CET A;  3CQX A;  2P9S A;  3ZYY X;  4N41 A;  1NJI O;  1BHL A;  3BY5 A;  3AO1 A;  5AQV A;  4JI7 K;  3BZC A;  1VQ9 N;  4FWM A;  2QXL A;  4CEC A;  3TSU A;  4YY3 K;  3D2F B;  3QNO A;  3K9J A;  2YHB A;  1HX1 A;  4M3W A;  4BG9 A;  3NH0 A;  1NBW A;  3AVC A;  2O8B B;  3TTD A;  3MXI A;  2FSJ A;  3HOT A;  3TPQ A;  2WFB A;  2ASM A;  4GKJ K;  4FWS A;  3SQ0 A;  1Q86 O;  4OKK A;  5KPT A;  2QWM A;  3CFP A;  3NH2 A;  4CF9 A;  5AQR A;  2IAJ A;  2YKM A;  2KZM A;  3SMP A;  1IG8 A;  4WQ5 C;  3SBT A;  4K41 A;  3VMF B;  3L2Q A;  3A5M C;  3K5L A;  5AQI A;  3EL2 A;  2F8S A;  5GIN A;  1LCU A;  3LDO A;  1YF5 L;  4B9T A;  2W41 A;  3SZ2 A;  2O8F B;  4GVM A;  2ZJQ L;  3K57 A;  1SKR A;  5FLX O;  3HL8 A;  4DTJ A;  4LF7 K;  3G0Z A;  1I39 A;  5AQT A;  3ZSR A;  4HUE A;  5EU7 A;  3ASM A;  3QER A;  5C2F A;  3WXK A;  1XNR K;  3FE1 A;  3AO5 A;  1IBK K;  2HW3 A;  4OGC A;  4DMN A;  3E9P A;  3HVT A;  1VSJ A;  1EWR A;  3LDS A;  4DSL A;  1HNV A;  1GLJ O;  4RW6 A;  4CVN E;  3BF1 A;  3CPW M;  1X9S A;  4NXN K;  4B9V A;  5GAG P;  4IDK A;  4CZF A;  1P90 A;  3VGM A;  3HPO A;  1LW2 A;  1KVA A;  3W3D A;  2FBY A;  1NGC A;  4KBO A;  1U48 A;  5MLC Q;  4FOI A;  3F9M A;  4JAX A;  4BC4 A;  1RTJ A;  2E8A A;  1BIU A;  2KQ2 A;  3AAQ A;  3DM2 A;  3B6O A;  4OKJ A;  3H6E A;  3K59 A;  3OJU A;  4M3Z A;  3QEX A;  2CGL A;  2Q0U A;  3OTO K;  2F9W A;  1SL1 A;  2F4V K;  2GEL A;  1IKV A;  1KAY A;  3UB5 A;  4B3M K;  1NNE A;  1KAZ A;  1NG9 A;  3KLE A;  2QXF A;  2VG7 A;  1VQ6 N;  2ZGY A;  4H0Y B;  4JI1 K;  1SV5 A;  3CI5 A;  3DLG A;  3EO3 A;  2W6K A;  3QIP A;  4JKG A;  3PY8 A;  4FW2 A;  4H5N A;  3DLK A;  4BE1 A;  4OJR A;  4DQI A;  3MCP A;  2NLX A;  3LAM A;  1BUP A;  3DRP A;  2P9K B;  2HMP A;  4O5F A;  3LZJ A;  1JCG A;  3M8S A;  3WNF A;  1VQM N;  2P9U B;  1CZA N;  3MED A;  4MFB A;  3PX0 A;  5J1E A;  4FZX C;  3IMX A;  4FZZ A;  4DFM A;  3CJB A;  3RMD A;  4A62 A;  1IG9 A;  4CZG A;  3LDP A;  4JI2 K;  3UKR B;  3SPY A;  2ETJ A;  3VA3 A;  5KTQ A;  1S1W A;  3O1B A;  3J81 O;  4XH5 A;  3T7Z A;  3U3G A;  4FJ8 A;  5JIC A;  4BGA A;  2IIR A;  3AVI A;  3AA4 A;  5LMU K;  1U4B A;  4ISG A;  1VQ8 N;  1LOT B;  3DWL A;  3WXL A;  1WSE A;  3O1W A;  5LL6 Z;  4LY7 A;  3S41 A;  4H4O A;  3HK2 A;  3DJC A;  1YAG A;  3KZB A;  3ZSZ A;  4BR9 A;  5IT9 O;  5LJW A;  1M1K O;  4WFN L;  1HKC A;  4BRH A;  3M5R A;  4CD1 A;  3KD5 E;  4FJ9 A;  4NLB A;  5KGX A;  4NO7 A;  4BVP A;  1XWL A;  4X62 K;  1CLQ A;  2F7T A;  1CXQ A;  3VET A;  5KPZ A;  4BRC A;  4LC9 B;  3GE1 A;  1WBB A;  3DI6 A;  3NMU A;  4DU1 A;  4BRP A;  2P9U A;  3AVA A;  3EKS A;  4W5O A;  1TK5 A;  1RTD A;  1ZYQ A;  4YOW A;  4W5T A;  2QWQ A;  4C23 A;  3CJA A;  2G8U A;  3PLA A;  4PUO A;  3S3N A;  3QFP A;  5SWM A;  4YOU A;  3ZEU B;  4XH1 A;  2PZS A;  1WAF A;  2NRT A;  4DV4 K;  1Z26 A;  4CJ3 A;  4B9L A;  4CJR A;  3I55 N;  1QSL A;  4WFB L;  2NNW A;  1IO2 A;  2VGN A;  1SL2 A;  2UYT A;  3EE9 A;  3QB0 A;  4BG8 A;  3H08 A;  4PA1 A;  4H5V A;  1NK0 A;  1S6P A;  2QI2 A;  3VEW A;  2A1R A;  1IJJ A;  1G15 A;  1U6Z A;  4JRQ A;  3O3F A;  4DLG A;  2PBD A;  4JHD A;  3HOS A;  3THW A;  2E2N A;  3CXC M;  3T19 A;  2DFF A;  3DXM A;  4DCH A;  4BRG A;  2O8E A;  5GAE P;  4JEP A;  3WXI A;  1HYV A;  1S1X A;  4K8X A;  4DTO A;  1W0H A;  1C1A A;  4CJE A;  4FXD A;  3FFK B;  2KHO A;  4ID1 A;  4I7F A;  4E7J A;  4LH4 A;  4EHU A;  1IBM K;  3THY A;  4FO0 A;  4MDB A;  3HST B;  3V1O A;  4B9Q A;  3AO3 A;  4DR5 K;  1WSH A;  4I6M B;  3IRX A;  1L3S A;  2A3Z A;  1GOA A;  3DMJ A;  1GOB A;  5C25 A;  4I9Q A;  3PIP L;  3V4I A;  2QK9 A;  3U9Z A;  2ZJR L;  3CCU N;  3O08 A;  4YOV A;  2G8W A;  4IOX A;  3AVJ A;  4C1N I;  5BRF A;  4FCY A;  2EX3 A;  4FJG A;  3VEN A;  3SQ1 A;  4BR7 A;  3MWT A;  3L6Q A;  1QQN A;  3L3U A;  3L3V A;  5C12 A;  1SS6 A;  4J2D A;  3QFU A;  3OYN A;  1JLE A;  1IKW A;  3L2V A;  1HMV A;  4BR0 A;  1VQK N;  2VGM A;  4E3S A;  3S3O A;  3M3Z A;  3EZ5 A;  4BR4 A;  3ID6 A;  4FJJ A;  1X3M A;  4CFC A;  3HPH A;  1EET A;  4N56 A;  1S1U A;  1W9H A;  3RMB A;  2HHV A;  3D2E A;  3OY9 A;  2QWO A;  1E3M A;  4BDP A;  2Y1I A;  3AAP A;  1KXP A;  3H1Q A;  1RT1 A;  3RSE B;  3E9O A;  3NCI A;  3VQ6 A;  1V4T A;  1HYZ A;  3MWP A;  4B1W B;  1HJR A;  2P9N B;  1HPM A;  3R9P A;  4OLA A;  4LF6 K;  4BE2 A;  3L8B A;  4H4M A;  4KI4 A;  1JLG A;  4FLW A;  1J5O A;  5AQJ A;  4JK8 A;  4GKK K;  4H8K A;  1TGO A;  1WSF A;  1VSH A;  4DV0 K;  4DSJ A;  4DWI A;  4MDA A;  4ID5 A;  5AFU H;  2YHW A;  3D2F A;  1VSL A;  4AQY K;  4CEE A;  4B3S K;  1YIT N;  4M63 C;  1JLF A;  2DPN A;  4X66 K;  4F3T A;  3CPE A;  2IS3 A;  3CCE N;  1WSI A;  2E20 A;  4XEI A;  3AVB A;  4CJU A;  1MU2 A;  4FJ5 A;  5KRS A;  2HBJ A;  3KKS A;  4GVE A;  1D9F A;  3OS1 A;  2P9L B;  1JLQ A;  2YX6 A;  4GV6 A;  3SUQ A;  3GG4 A;  5JS1 A;  5HRR A;  4B9S A;  3O3H A;  4E1M A;  4NCG A;  4U67 L;  2X78 A;  3SUO A;  3OYL A;  2O8D A;  2OZM A;  2O8C A;  5BRD A;  4WE1 A;  1VQL N;  4KTQ A;  4DTP A;  1GLL O;  4CEA A;  2YNG A;  2YCH A;  1SZ2 A;  3SJH A;  4RWT A;  5JMV A;  1WSG A;  2D1K A;  3CCV N;  2ZQB A;  3DYA A;  4DR1 K;  2G8V A;  1ZBU A;  3M8Q A;  5AZJ A;  1HKB A;  4CJ7 A;  4WCE L;  1HJO A;  4DLE A;  3SCX A;  1XHZ A;  3O6W A;  2QTD A;  4DTM A;  4C8O A;  1J53 A;  3KWI A;  1OH8 A;  4CHN A;  4IOC L;  1SKS A;  2E5L K;  3VN5 A;  1HLU A;  3NBP A;  4JK7 A;  4FVM A;  5AFU A;  1J5E K;  4EHT A;  1RT6 A;  1ITG A;  1C6V A;  3ENB A;  4CHP A;  4KV8 A;  2UUA K;  2Q36 A;  3PO5 A;  3J7A P;  4L8R B;  3CCM N;  2OZS A;  4CE9 A;  3BEX A;  2A5X A;  4DUZ K;  3KK2 A;  5KQ8 A;  1RBS A;  3U9D A;  5KGW A;  1OKJ A;  2P5G A;  1JCF A;  4LFC K;  3G71 N;  2E88 A;  3HI0 A;  4GNI A;  4DHY A;  3LPU A;  3C7N B;  1FK9 A;  4IO8 A;  3DLL L;  4OLB A;  2FXU A;  2RE2 A;  3WXM B;  5TKY A;  5H1S Q;  4E7H A;  1L3T A;  4ZTF A;  5AZI B;  5GAD P;  1NK8 A;  3VEO A;  1MDU B;  1QSS A;  4CK2 A;  1WB9 A;  4A2B A;  2UUB K;  2PAV A;  4DQR A;  2AP1 A;  1L3V A;  3VQE A;  2E1Y A;  3IKM A;  3MN9 A;  2HHH K;  3MXM A;  4Z4C A;  1MWK A;  3DLR A;  4LF5 K;  2XHB A;  2B5J A;  5T7B A;  2PYL A;  1ATN A;  3I8B A;  4CZJ A;  4BY9 C;  2F9T A;  4F4K A;  3HSC A;  3DXK B;  3SNN A;  5CY4 A;  4JI8 K;  2VG5 A;  3T1H K;  1RT3 A;  3GBT A;  4BRA A;  2YHY A;  3KTQ A;  2V7Z A;  3NFA A;  4YDU C;  3OYH A;  3VEY A;  4E1N A;  4RW7 A;  1IV0 A;  4CES A;  3NAE A;  4IFV A;  3BZK A;  5JLF A;  4FM1 A;  1IKX A;  3FFI A;  3DLB A;  3ITH A;  3MXJ A;  4W5R A;  2QM1 A;  5CR4 A;  1NGE A;  1EWQ A;  4BRD A;  4DTR A;  4BRM A;  3HO1 A;  1XMQ K;  3MK6 A;  3VQA A;  1XQS C;  5HOO A;  1Q18 A;  1RT7 A;  4M42 A;  3V6D A;  2CH6 A;  3C94 A;  3P38 A;  2FBT A;  2WBN A;  3E1Y A;  2QA4 N;  3ZSY A;  2OTL N;  5JVG L;  1C1B A;  3PV8 A;  5HLF A;  1T8E A;  4OO1 J;  4CZI A;  3VA0 A;  4JI6 K;  2KZZ A;  4FJK A;  1TYQ A;  3V9Z A;  4CJK A;  4KI6 A;  3DRS A;  2P9K A;  2DY4 A;  2JLE A;  3L2U A;  3OYK A;  3OYJ A;  3VOV A;  1LWE A;  5DK5 A;  1F21 A;  4H5W A;  3JSM A;  1NU0 A;  4EFH A;  1TUU A;  2NRR A;  1X9J A;  4IJN A;  1UWB A;  2HND A;  4FK0 A;  4ELU A;  5EX5 A;  3A8Y A;  4CGJ A;  1HYS A;  2IGI A;  3I0R A;  3KVG A;  3CMA N;  4IEE A;  4DFP A;  1L5U A;  3CC2 N;  1RBU A;  4RW9 A;  3NF7 A;  2GV9 A;  2YV0 X;  3PO4 A; 
#chains in the Genus database with same CATH homology
 1RDD A;  3OYM A;  1T7P A;  1B9F A;  3C6T A;  4PQU A;  2RKI A;  5DMR A;  1LWF A;  4LY7 A;  3AO2 A;  1JXE A;  3SV4 A;  5SZT A;  4J2A A;  4H4O A;  3HK2 A;  2P1J A;  4CK3 A;  2HB5 A;  1HNI A;  1HQU A;  3ZSZ A;  4E89 A;  1WNS A;  1NK4 A;  2DTU A;  1BGX T;  3RRG A;  3EY1 A;  3AA3 A;  1C0T A;  4E19 A;  3V81 A;  4F2S A;  3NH1 A;  4CJT A;  4EP4 A;  4HUF A;  4CGI A;  1D5A A;  3KD5 E;  4FJ9 A;  1NJX A;  4DSE A;  4Z0U A;  1RCH A;  1QSY A;  5KGX A;  4FW1 A;  4N5S A;  1S5J A;  1XWL A;  1RBV A;  4FJX A;  4O5B A;  4OPK A;  1BQM A;  3RR8 A;  4R5P A;  1IKY A;  3VQ8 A;  1TL3 A;  2OYQ A;  1FKP A;  1CLQ A;  1KSP A;  4FYD A;  5FDL A;  1IH7 A;  1CXQ A;  3P5J A;  3DOL A;  1JL1 A;  4CER A;  3RR7 A;  1I3A A;  4CFA A;  2QKB A;  3VQ7 A;  4FLX A;  2BAN A;  4CJQ A;  2IC3 A;  4CIE A;  3KK1 A;  4M45 A;  1U47 A;  3DI6 A;  4FLT A;  2IDO A;  3RRH A;  4LH5 A;  5CYQ A;  1XHX A;  4B9M A;  4DU1 A;  3B6P A;  2HNY A;  3AVA A;  4CEF A;  4W5O A;  1TK5 A;  4QCL A;  1ASW A;  4FM2 A;  1RTD A;  1ZYQ A;  4AHV A;  1Q9X A;  4HVJ A;  4W5T A;  3LWM A;  1REV A;  1XI1 A;  3OS0 A;  3D45 A;  2G8U A;  4BWM A;  3S3N A;  4PUO A;  1YTU A;  5SWM A;  4JS4 A;  4OKE A;  2RF2 A;  3ISN C;  4FK4 A;  2Q3S A;  2PZS A;  1WAF A;  3ZCM A;  1FXX A;  1Z26 A;  4CJ3 A;  4B9L A;  2G8I A;  2FC0 A;  1TAQ A;  4CJR A;  3V1Q A;  4Z4F A;  1QSL A;  4FLV A;  3MEG A;  1BL3 A;  1IO2 A;  3OYE A;  1SL2 A;  3PX6 A;  5E41 A;  2RN2 A;  3TAR A;  1RTI A;  3ZSV A;  3EYZ A;  1VK0 A;  1YT3 A;  3BGR A;  3HP6 A;  3H08 A;  3NDK A;  1D9D A;  1RDC A;  3RMC A;  4NCB A;  4CJS A;  1EKE A;  4KTZ A;  4PA1 A;  4DFK A;  1R0A A;  3LWL A;  1S6P A;  1NK0 A;  1ZBH A;  4DSK A;  1QTM A;  2A1R A;  1KVB A;  3TAB A;  4B3O A;  4HUG A;  4CED A;  1G15 A;  4DLG A;  2OPS A;  2ZE2 A;  3O3F A;  3KLF A;  3TR8 A;  4JRQ A;  4DTU A;  1Q9Y A;  4NYF A;  2LSN A;  4E7K A;  4AHS A;  4KHW A;  4DS4 A;  3V9W A;  1NJW A;  4CFD A;  4YNQ A;  2NUB A;  3V9S A;  3WNE A;  1BCO A;  1QS4 A;  3T19 A;  2WON A;  1S1T A;  2DFF A;  3OYD A;  1B9D A;  3F73 A;  2PY5 A;  2Z1J A;  4KPY A;  4BDZ A;  4Z4E A;  1KLM A;  1WSJ A;  3T1A A;  4CJV A;  4CK1 A;  4DFJ A;  2KTQ A;  2OPR A;  4DSI A;  4O44 A;  5I3U A;  2OPQ A;  1RDB A;  4GMJ B;  3NE6 A;  2KFZ A;  3LP2 A;  1TKT A;  1RT4 A;  4KB1 A;  1Y97 A;  2Z1I A;  5HP1 A;  1HYV A;  1S1X A;  1VSD A;  3I0S A;  3HT3 A;  4DTO A;  1W0H A;  4K8X A;  4KHU A;  4M3T A;  3AVM A;  1C1A A;  4CJE A;  3QO9 A;  4FXD A;  4ID1 A;  3VQC A;  3QEV A;  3QIN A;  4I7F A;  4CEQ A;  3HVR A;  1KVC A;  1ZBF A;  4FJN A;  4CF1 A;  1GOC A;  1NJZ A;  1YVU A;  3KD1 E;  2YNF A;  3VQD A;  4LH4 A;  1S6Q A;  1J54 A;  4E7J A;  4FJM A;  2F96 A;  4AHT A;  3VQ4 A;  1RNH A;  3NGZ A;  4YFU A;  3HST B;  5C24 A;  4B9U A;  3V1O A;  3ZSX A;  3AO3 A;  4KHQ A;  4CEZ A;  4IBN A;  1X1P A;  1KFD A;  4E7I A;  1WSH A;  5J2M A;  5JS2 A;  3IRX A;  2O4G A;  1L3S A;  1GOA A;  3DMJ A;  3AVF A;  1GOB A;  4HHT A;  5C25 A;  4IFY A;  4I9Q A;  3V4I A;  2QK9 A;  3QLH A;  2E4L A;  4DQS A;  3KIO A;  2G8W A;  3UIQ A;  3AVJ A;  2D0C A;  4CIF A;  3OS2 A;  3ULD A;  1JL2 A;  3LZI A;  4FCY A;  2EX3 A;  4HTU A;  2X74 A;  3NF8 A;  4EP5 A;  1BIS A;  5J2Q A;  4FJG A;  3TAE A;  3K5M A;  3SYZ A;  4DSF A;  3DRR A;  4C8M A;  3ZSO A;  3SQ1 A;  1BCM A;  3IG1 A;  5K14 A;  3ZSQ A;  1TL1 A;  3LPT A;  4FJL A;  3QET A;  3CYM A;  3G10 A;  4N47 A;  3L2W A;  4M3X A;  3JYT A;  3L3U A;  4Y1C A;  3L3V A;  3TAP A;  3O4Q A;  4J2D A;  2O4I A;  3HM9 A;  3OYN A;  4Z4H A;  1JLE A;  1IKW A;  3L2V A;  4G1Q A;  1HMV A;  3AVH A;  3OYF A;  4O0I A;  2VWJ A;  4E3S A;  1S9G A;  3S3O A;  2JGU A;  3THV A;  3QNN A;  3EZ5 A;  3LAN A;  2DFH A;  3AVG A;  1WN7 A;  4NYN A;  4FJJ A;  3AV9 A;  1VSK A;  3F9K A;  4CFC A;  3HPH A;  1EET A;  5HRN A;  4DTX A;  4N56 A;  4FK2 A;  1S1U A;  1W9H A;  4ICL A;  3C6U A;  4M3R A;  3U6F A;  3RMB A;  4QOZ B;  2HHV A;  1ASV A;  3OY9 A;  4CHY A;  1KRP A;  4IKF A;  3SQ2 A;  3OJS A;  4AHU A;  4FLY A;  4BDP A;  3OYG A;  3OYA A;  1C1C A;  4I2P A;  4QAG A;  4B8C A;  4JS5 A;  2HNZ A;  2Y1I A;  2PYJ A;  3SPZ A;  3U3Y A;  5FRN A;  1RT1 A;  3CFO A;  4CGD A;  1X9M A;  2HHS A;  2KFN A;  4KO0 A;  4Y1D A;  3NCI A;  3LAL A;  4FZY A;  3VQ6 A;  3AA5 X;  1KCF A;  1VRT A;  4RG8 A;  1HYZ A;  3CQ8 A;  4O0J A;  4C8K A;  4CF2 A;  1NK5 A;  5D3G A;  4CF0 A;  1HJR A;  2YNI A;  1UA1 A;  2YHA A;  2F8T A;  4OLA A;  4BE2 A;  3L8B A;  4H4M A;  4J2E A;  4KI4 A;  1JLG A;  3VQP A;  4CHQ A;  4KB0 A;  4FLW A;  1J5O A;  4AIL C;  4H8K A;  3TAF A;  2B6A A;  1TGO A;  4ELV A;  4OGE A;  1WSF A;  2D0A A;  3AVK A;  1UOC A;  5HRP A;  1NOZ A;  1VSH A;  4DF4 A;  4DSJ A;  1NKC A;  3ALY A;  4DWI A;  4ID5 A;  4E7L A;  1VSL A;  4CEE A;  3K5N A;  4ZTJ A;  3DLH A;  2FBX A;  3AVL A;  1VSE A;  2OPP A;  3CG7 A;  4M3Y A;  1LAW A;  3SI6 A;  1JLF A;  2XY6 A;  4M3U A;  2HHQ A;  4F3T A;  4F8R A;  2IS3 A;  3HXM A;  4CJP A;  4DS5 A;  1WSI A;  4C8L A;  3TAN A;  3KKR A;  1NOY A;  3AVB A;  4CJF A;  4CJU A;  4IG0 A;  3PX4 A;  4RW8 A;  4Q0B A;  1NK6 A;  1MU2 A;  2VWK A;  1LW0 A;  4FJ5 A;  1TKZ A;  3MEC A;  4HCC A;  5KRS A;  1JXB A;  3KKS A;  3NHG A;  1LWC A;  1D9F A;  3OS1 A;  4BWJ A;  2D0B A;  1JLQ A;  4CFB A;  1VSF A;  4N76 A;  3SUQ A;  4PWD A;  5JS1 A;  3OYC A;  5HRR A;  1LAV A;  4B9S A;  3IS9 A;  5HRS A;  3O3H A;  1BI4 B;  4KFB A;  1VRU A;  4E1M A;  2XO7 A;  3ZT3 A;  4CGF A;  2ITG A;  4E0D A;  2ATQ A;  1NK9 A;  1SKW A;  4NCG A;  3SQ4 A;  1RT2 A;  2X78 A;  3K5O A;  3SUO A;  1RTH A;  3OYL A;  3OYI A;  1U45 A;  4CIG A;  1DTT A;  2OZM A;  2D5R A;  1BI4 A;  2R7Y A;  2QKK A;  4DF8 A;  1JLC A;  2YNH A;  3AA2 A;  4DG1 A;  4WE1 A;  4KTQ A;  2X6S A;  3PUF A;  1YTA A;  4CGH A;  3I8D A;  3S3M A;  4DTP A;  1RBT A;  3AO4 A;  4CEA A;  2YNG A;  2GUI A;  4W5N A;  3P1G A;  3M8R A;  1TK0 A;  2G8F A;  1QQC A;  3A2F A;  1S1V A;  4IG3 A;  3VQB A;  1RDA A;  3NGY A;  2HVH A;  1LV5 A;  1WSG A;  2Z1H A;  5I42 A;  3QEI A;  3RWU A;  1TV6 A;  1NK7 A;  3OYB A;  1RT5 A;  3RTV A;  1X9W A;  4DQP A;  1FKO A;  3OVN A;  3T3F A;  2BDP A;  2ZQB A;  3DYA A;  2FBV A;  5CZ1 A;  1ZBU A;  2G8V A;  4KTW A;  3QIO A;  2P51 A;  3M8Q A;  3VQ9 A;  1NKB A;  1XHZ A;  4DLE A;  4GW6 A;  3SCX A;  2GBZ A;  4EZ6 A;  4DTM A;  1EX4 A;  4N41 A;  4FJI A;  4W5Q A;  4C8O A;  1J53 A;  1CZB A;  3LP1 A;  3HP9 A;  3AVN A;  3M8P A;  4OVL A;  1KFS A;  1BHL A;  4CHN A;  3AO1 A;  1CZ9 A;  3O4N A;  1SKS A;  1SUQ A;  2DFE A;  3VN5 A;  4KRE A;  3NBP A;  4FVM A;  3VQQ A;  2A1S A;  5FRM A;  1RT6 A;  4CEC A;  1ITG A;  1C6V A;  5KI6 A;  4CHP A;  4Q5V A;  3HYF A;  3KLG A;  4I2Q A;  4KV8 A;  3QNO A;  3NGI A;  2YHB A;  3PO5 A;  4M3W A;  3NH0 A;  4BE0 A;  3AVC A;  1WAJ A;  3NF9 A;  4L8R B;  4DTS A;  3S9H A;  3MXI A;  1U49 A;  4ELT A;  2HHT A;  2OZS A;  4CE9 A;  1JLA A;  2Y1J A;  4CF8 A;  1BIZ A;  2AJQ A;  3KK2 A;  3RMA A;  2G8H A;  4Z4G A;  3MEE A;  5J2P A;  4K8Z A;  2HVI A;  1RBS A;  3SQ0 A;  1T03 A;  5KGW A;  3LAK A;  4OKK A;  2P5G A;  3CFP A;  3NH2 A;  1C0U A;  3HJF A;  4CF9 A;  2IAJ A;  3ZT2 A;  1B92 A;  3LPU A;  2HHW A;  2YKM A;  2KZM A;  1FK9 A;  4FLU A;  4OLB A;  1NKE A;  4JLH A;  5HRO A;  1L3U A;  3L2Q A;  4CJ4 A;  1UAX A;  4RW4 A;  4KRF A;  4FLZ A;  4C8N A;  3TWH A;  3K5L A;  4E7H A;  4CJL A;  3ZT4 A;  1L3T A;  4Z4I A;  4ZTF A;  3CFR A;  2F8S A;  4F2R A;  1NK8 A;  3VQ5 A;  4FM0 A;  1QSS A;  5FRO A;  4CK2 A;  4CJW A;  4B9T A;  1O1W A;  5CYM A;  4DQR A;  3NF6 A;  2X6N A;  1L3V A;  3VQE A;  1KLN A;  4KHN A;  3SZ2 A;  4J2B A;  4B08 A;  1JLB A;  4GVM A;  3K57 A;  5J2N A;  1SKR A;  3HL8 A;  4DTJ A;  3LP0 A;  3G0Z A;  3WNG A;  1I39 A;  4UQG A;  3ZSR A;  2HHU A;  1VSM A;  1U04 A;  3L2R A;  5EU7 A;  4HUE A;  4DU3 A;  3ASM A;  3MXM A;  1KTQ A;  1A5X A;  3QER A;  3SUN A;  4Z4C A;  2E6M A;  3DLR A;  3KLI A;  2XHB A;  2B5J A;  4CEB A;  5T7B A;  4KHY A;  1UA0 A;  4O55 A;  1HQE A;  2PYL A;  3KJV A;  3AO5 A;  2HW3 A;  1TKD A;  4OGC A;  4DMN A;  4FJH A;  4CHZ A;  4CHO A;  1HRH A;  3HVT A;  4F4K A;  3KK3 A;  1EP4 A;  1RIL A;  1VSJ A;  3CM5 A;  1SL0 A;  2VG6 A;  3SNN A;  4LSN A;  1HPZ A;  4I9L A;  5CY4 A;  3LDS A;  4DSL A;  2HHX A;  2VG5 A;  1HNV A;  2WOM A;  4RW6 A;  3V9U A;  1RT3 A;  1X9S A;  2W42 A;  3KTQ A;  4FJ7 A;  4AHC A;  1XC9 A;  4B9V A;  3ZT1 A;  3V9X A;  3NFA A;  4IDK A;  1RBR A;  2RPI A;  3HPO A;  1LW2 A;  2Z1G A;  4CGG A;  3OYH A;  1KVA A;  3KLH A;  3BDP A;  1D8Y A;  2P5O A;  4E1N A;  1TK8 A;  4RW7 A;  1QE1 A;  2FBY A;  3HPG A;  2YKN A;  4CES A;  3NAE A;  1U48 A;  4IFV A;  3D0P A;  3C95 A;  1DLO A;  2EHG A;  1TAU A;  1ASU A;  1CXU A;  1RTJ A;  4NCA A;  1BIU A;  2KQ2 A;  5KRT A;  4FM1 A;  1J9A A;  2OA8 A;  1IKX A;  1TVR A;  5CZ2 A;  3DM2 A;  3K2P A;  3B6O A;  4OKJ A;  2IOC A;  4DQQ A;  1TKX A;  5C42 A;  3FFI A;  4XIU A;  3K59 A;  3OJU A;  3TI0 A;  4M3Z A;  3DLB A;  3ITH A;  3K58 A;  3QEX A;  1K6Y A;  3MXJ A;  3ZT0 A;  3MAQ A;  4W5R A;  3IAY A;  2XY5 A;  1SL1 A;  3SJJ A;  1IKV A;  2BGG A;  4B9N A;  1JKH A;  4DTR A;  4ZHR A;  1S9E A;  1ZBL A;  3KLE A;  3HO1 A;  2QXF A;  2VG7 A;  4KAZ A;  3VQA A;  1BQN A;  1WLJ A;  2XY8 A;  3ZSW A;  4M41 A;  3DOK A;  1RT7 A;  4M42 A;  4O4G A;  3V6D A;  1DTQ A;  3C94 A;  1SV5 A;  2E6L A;  2FBT A;  3DLG A;  3QIP A;  3QES A;  3PY8 A;  4FW2 A;  2KW4 A;  3DLK A;  3TAQ A;  3O3G A;  2XRI A;  4BE1 A;  3ZSY A;  4OJR A;  1N6Q A;  3SV3 A;  1C1B A;  3PV8 A;  1EXQ A;  4JRP A;  2XY7 A;  5HLF A;  2G8K A;  4DQI A;  1T8E A;  3LAM A;  3VA0 A;  2KZZ A;  3DRP A;  4FJK A;  1A5V A;  1ZBI A;  4TSX A;  3LZJ A;  1NJY A;  3V9Z A;  1VSI A;  4CJK A;  3M8S A;  4LD0 A;  4CEO A;  4KI6 A;  3DRS A;  3WNF A;  1QHT A;  4F3O A;  2DY4 A;  3MED A;  4MFB A;  2JLE A;  3PX0 A;  1C0M A;  5J1E A;  3L2U A;  1A5W A;  2B4J A;  3OYK A;  4FZX C;  3WNH A;  3OYJ A;  4LSL A;  1T05 A;  4FZZ A;  4HCB A;  2I5J A;  4DTN A;  1LWE A;  4DFM A;  3RMD A;  5DK5 A;  1F21 A;  3JSM A;  1Q8I A;  4AH9 A;  3SUP A;  1IG9 A;  3LP3 A;  4DU4 A;  4CCH A;  3TAM A;  4AHR A;  4KHS A;  3SPY A;  1Z25 A;  1UWB A;  2ETJ A;  3VA3 A;  5KTQ A;  1S1W A;  2HND A;  4CJ5 A;  4FK0 A;  4ELU A;  2ZD1 A;  4PY5 A;  3U3G A;  4CGJ A;  4BDY A;  4FJ8 A;  4B8A B;  4OPJ A;  1HYS A;  3AVI A;  3CM6 A;  2IGI A;  3I0R A;  4MQ3 A;  1N5Y A;  3AA4 A;  1U4B A;  3DLE A;  4BAC A;  4DFP A;  3QEP A;  3E01 A;  1L5U A;  1RBU A;  4RW9 A;  1WSE A;  2BE2 A;  3NF7 A;  3P83 D;  2GV9 A;  5HBM A;  4KKO A;  3QEW A;  4EZ9 A;  2YV0 X;  3TAG A;  3V1R A;  3PO4 A;  2HMI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...