3AVCA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Recombination/inhibitor
molecule keywords Integrase
total genus 57
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avcA00
4KB0A 4DQSA 1WN7A 4NCAA 4M3RA 3VQBA 1QSSA 2RN2A 1S1VA 3SYZA 1NJXA 5HRNA 4IBNA 5SZTA 3EYZA 3AVBA 3MEGA 3O3GA 4FK0A 3NAEA 3OY9A 1TK8A 2PZSA 1TKZA 2OYQA 1NK6A 4IFVA 1HYSA 1TK0A 3TAQA 3C94A 1LW0A 1ZBFA 1T7PA 1I39A 3NF8A 3LP1A 3SI6A 3U6FA 2P5GA 3I8DA 3HO1A 4E7KA 3KIOA 4CEEA 4CJVA 4I2PA 3MAQA 1IKVA 2YNHA 3TR8A 3JYTA 3ULDA 5JS1A 4HUEA 2X78A 4DQPA 2Q3SA 2BGGA 4Z4GA 1KVCA 2BE2A 4DMNA 4PQUA 4DFPA 4BE0A 3VQ6A 2E6MA 4KFBA 3OYKA 1NOYA 1WAJA 4OGEA 4HUGA 4B9VA 4Z4FA 4E0DA 1RBRA 1BI4B 3HVTA 3OJSA 4FM0A 2G8WA 3L8BA 5C42A 1BISA 4Y1DA 4B9MA 3HVRA 3QEPA 3MEDA 4CE9A 4C8MA 4N47A 1HMVA 4R5PA 1SUQA 4FK2A 4GW6A 4CF0A 3QERA 4DTJA 4J2AA 2HNDA 1O1WA 1HQUA 2ATQA 2YKMA 2Z1IA 5HRRA 3L2VA 3HXMA 1L5UA 4PWDA 3OYCA 4I9LA 1BIUA 2WONA 2YNIA 2Z1GA 3LDSA 4KKOA 4RW8A 4DSEA 1RT3A 3ZSRA 2FBVA 1D9FA 3LWMA 3V9XA 4N56A 1T05A 4RW9A 3VQ8A 5CYMA 3TAFA 1X9WA 2DTUA 4ID5A 2WOMA 4W5RA 4F2RA 4IKFA 2A1RA 3K5NA 4Z4EA 2YHBA 3TAEA 1UA0A 1C1BA 3SUQA 4N41A 1LWCA 4M45A 4FLTA 4OKJA 5KRTA 3B6PA 1FKOA 1S1XA 4CESA 4LSNA 1BIZA 3V9UA 4CEFA 1UAXA 4N5SA 3O4NA 4I2QA 5EU7A 4LD0A 3T3FA 4BWJA 3RRGA 2KFNA 4CJPA 3VQ4A 4FLUA 1JXBA 1F21A 1VSJA 3ALYA 3T19A 4IDKA 4CHPA 1KVBA 4BDPA 3TABA 4KHQA 4CCHA 2P5OA 1D5AA 1WSFA 1Z25A 2IGIA 3E01A 1CZ9A 2IOCA 4M41A 3VQPA 3ZT2A 3CFRA 1ZBLA 1D9DA 3AVGA 2YNGA 3DI6A 1HYVA 4CJSA 3ZCMA 1EP4A 1KCFA 4IFYA 3WNEA 3NH0A 3KD5E 3K5MA 1W9HA 3TI0A 3RMAA 3AVFA 1CLQA 1RBSA 2F8TA 4CJLA 1A5VA 4HTUA 4FCYA 3MXMA 4DTUA 5KTQA 2EX3A 1VSHA 1KTQA 1RBTA 1TL3A 3HP9A 3AO4A 4NCGA 3T1AA 4CEDA 1JXEA 3KK1A 4CFAA 4QAGA 4E1MA 4FLYA 1RTJA 3UIQA 4KAZA 1QE1A 4B9LA 4FJXA 1LAVA 1S6QA 3DYAA 2XY6A 2G8KA 2KZMA 3RR8A 1DLOA 2DFEA 4IG0A 3OYIA 4CFCA 5T7BA 2G8UA 2HMIA 1B9FA 1RT1A 3KLGA 3NDKA 1Y97A 1LV5A 1EETA 3AO3A 1HNVA 4E3SA 4DLEA 3HJFA 3D0PA 1S1UA 1SKSA 1ASVA 3I0SA 3QO9A 2OPQA 2B6AA 3DMJA 1S5JA 4OVLA 4AHSA 1RTIA 4CHNA 4DSIA 1S6PA 3P5JA 3DLRA 3DOKA 3OS2A 1RT4A 4DFKA 1ZYQA 2VWJA 1VK0A 5DMRA 2Y1JA 2HHTA 1ASUA 3SPZA 3OYMA 3ZSQA 3SJJA 3V9WA 4B8AB 1JLBA 4ICLA 4KTWA 4DQQA 3WNHA 3AVHA 3O4QA 3S3MA 2G8FA 3QLHA 2KTQA 3CQ8A 1JL1A 3OJUA 1J53A 4DWIA 3B6OA 4FYDA 4CEOA 3WNGA 1TKTA 4OKEA 1CZBA 4M42A 2FC0A 3M8PA 4HUFA 4FZZA 1TAUA 4W5QA 1BL3A 2X6SA 1RNHA 2F96A 3O3FA 3TAMA 4Z4CA 3K5LA 4B9NA 4QCLA 2HHWA 2HNZA 4HHTA 4ELUA 3A2FA 3NF9A 1WSEA 2B5JA 2HNYA 4ELTA 1ZBHA 4E7JA 1C0TA 5CYQA 4FJLA 3AVCA 3TWHA 3LPUA 4O55A 4FJ5A 1XWLA 4RW7A 1HPZA 1XC9A 4FZYA 1WSJA 1J54A 1RDCA 3NGIA 3EY1A 4JLHA 5J2QA 2F8SA 4KV8A 1SL0A 4M3ZA 3DLHA 3AA4A 4BACA 3THVA 4KTQA 3DRPA 1NKBA 3S3NA 1SKRA 1B9DA 1RBVA 2D0BA 4RW4A 3OYNA 3M8RA 3V9ZA 2ITGA 4C8NA 2B4JA 1Q9YA 4JS5A 1YVUA 2FBTA 2QK9A 2PYJA 2XY8A 4DFJA 4YFUA 4DS4A 4FJIA 1TKXA 5CZ2A 4EZ9A 4CJKA 3NCIA 3SUOA 1KLNA 2G8VA 2IDOA 4B8CA 4E7LA 3I0RA 1A5WA 3VA3A 4DTOA 5KGWA 4ZTJA 3V1QA 1SL1A 1JLQA 3VN5A 3MXIA 4CGGA 2X74A 4DFMA 4F2SA 1VRUA 4J2BA 1RTDA 4PUOA 3K59A 1IH7A 4B3OA 3K2PA 1TVRA 1NK7A 1L3TA 3V9SA 1NK8A 2BDPA 4PY5A 2HW3A 1JLAA 1RDAA 1Z26A 4ZTFA 1NKCA 3DM2A 4AHVA 5FROA 1T8EA 3KD1E 3EZ5A 3IAYA 3V1OA 5HP1A 1TGOA 3DOLA 2XHBA 4FLVA 3SQ2A 3SV4A 1TL1A 1EKEA 2O4IA 2P1JA 4Y1CA 3DLGA 3SQ4A 2OPRA 1GOAA 4CF8A 3U3YA 1WNSA 1L3VA 4OPKA 1QSYA 4O4GA 4DLGA 4CGIA 3QEXA 4CJUA 2Z1JA 4HVJA 3QETA 4CJTA 4FW2A 4AH9A 4FJJA 1NJYA 3BGRA 3OYBA 3SUPA 1QQCA 4RW6A 3LP3A 3NGYA 4EP5A 3HP6A 3DRRA 3VQ5A 5KGXA 3RR7A 1JLCA 1U48A 4KI4A 5C25A 4K8ZA 4DTXA 4M3TA 3NHGA 4DS5A 3LANA 4B08A 3QEWA 2R7YA 1VRTA 4CGJA 1UA1A 3AVNA 5HRPA 1X9SA 4CJ5A 1U47A 3RMBA 1B92A 3NF6A 3ZT3A 3KLHA 3AVKA 1CXUA 4O44A 2ZD1A 3KLIA 4GVMA 1EX4A 3VQAA 4F3OA 3IG1A 4CFBA 5FRNA 2DY4A 3OYLA 1QSLA 1BQMA 4CGHA 1NK5A 1JLEA 1FKPA 4AHRA 4DTPA 4FLZA 4O0JA 3CM5A 2QKBA 4W5TA 4C8OA 2G8HA 1BI4A 3RMCA 1ASWA 3IRXA 4FXDA 3AO1A 1MU2A 1L3UA 2HVIA 4J2DA 3AA2A 1N6QA 2XRIA 3CFPA 4JRPA 4FK4A 3L2QA 3PO5A 1EXQA 4CK2A 1K6YA 1J5OA 3VQ9A 2VWKA 1UOCA 4OGCA 2RKIA 4JRQA 1SV5A 1KLMA 2BANA 4DTMA 3HK2A 3OYHA 3M8QA 4CK3A 5I3UA 3AVJA 4DSLA 3SPYA 2QKKA 1C0MA 3NE6A 4ELVA 4CJ4A 1HYZA 4FJGA 2FBYA 4EP4A 3C6UA 1HJRA 4DU3A 1VSDA 3RTVA 2JGUA 5I42A 1U4BA 4O5BA 2OZMA 1YTAA 1BCMA 1FK9A 4F3TA 3RMDA 3DLEA 1GOBA 2E6LA 4CF2A 4DTNA 2Z1HA 4LH4A 5DK5A 2YHAA 1LWFA 3NBPA 3WNFA 1BGXT 3NFAA 4CJ3A 1R0AA 3HM9A 4NYFA 4JS4A 4FLXA 4M3WA 3NF7A 4FW1A 4E7HA 3PX6A 5HROA 1BHLA 1C6VA 3HPGA 5CZ1A 4CERA 1D8YA 4CGFA 4M3XA 3LZIA 4M3YA 4OLAA 1WSGA 3ZSYA 1CXQA 1QHTA 4HCBA 1IG9A 4CEAA 3ZT4A 3KLFA 3BDPA 1LW2A 1LWEA 2XY5A 3AVAA 3M8SA 4K8XA 4CECA 3HL8A 1TAQA 1KVAA 3AA3A 3MXJA 1RT2A 3C95A 3SCXA 4C8KA 4EZ6A 2D0AA 5CY4A 5C24A 3VQ7A 3ISNC 4BDYA 2O4GA 1NKEA 1IKXA 1HRHA 4FLWA 4AILC 1XHZA 4L8RB 3KTQA 3OVNA 3OYGA 1QTMA 4CF1A 1T03A 4NCBA 2ETJA 4KI6A 2KZZA 4E1NA 3HPHA 3AVIA 2DFHA 4DU1A 3ZT1A 4KHYA 1VSKA 3DLKA 2D0CA 3AO2A 3QEVA 3PX4A 3K58A 2EHGA 3ZSOA 4CHYA 4I9QA 4FJ9A 1KSPA 1S9GA 3ZSXA 2PY5A 4CHZA 3KJVA 3LAKA 1DTQA 3AO5A 4PA1A 3V81A 1XI1A 1YT3A 1SL2A 1YTUA 5J2PA 4B9UA 4IG3A 3L2WA 4DF8A 2W42A 4AHTA 4FJ7A 3KK3A 3IS9A 1S1WA 3AA5X 3AVMA 1U04A 4AHCA 4CJFA 4CK1A 4CGDA 4ZHRA 3AVLA 3F73A 4CFDA 3RRHA 2D5RA 4FJ8A 4CF9A 3VA0A 3LP0A 4H4OA 3HPOA 2YV0X 1JKHA 3LZJA 1IKWA 1W0HA 3F9KA 1UWBA 1RT6A 4KHSA 1WAFA 5K14A 3D45A 5KI6A 3OYAA 1VSLA 3P83D 2QXFA 2KFZA 1J9AA 4CJRA 1NJWA 4FJNA 1KFDA 1NK4A 4GMJB 3MECA 1HNIA 4FVMA 4KO0A 3ZSVA 4DSKA 1ITGA 2HHVA 3LPTA 2VG6A 3VQQA 4KRFA 4DQRA 4WE1A 3DRSA 1U45A 2FBXA 3SQ1A 1FXXA 4B9TA 3SZ2A 4M3UA 4B9SA 2DFFA 4NYNA 4CJWA 4H8KA 1RILA 2GV9A 1WLJA 1SKWA 2I5JA 4FZXC 4J2EA 1RDBA 1RCHA 3U3GA 4CHOA 4E19A 3QNOA 1NOZA 1VSMA 2KW4A 2X6NA 3LAMA 4MFBA 4BWMA 4W5OA 4CJEA 4DF4A 3TANA 3S9HA 3V4IA 2XY7A 2HVHA 3QEIA 1RTHA 4DTRA 2GBZA 2IC3A 2ZQBA 4MQ3A 3ASMA 3L3VA 2G8IA 1L3SA 5HLFA 1GOCA 4UQGA 4CHQA 3ITHA 2YNFA 2OZSA 5SWMA 3L3UA 1QS4A 3HT3A 5HBMA 1ZBUA 3ZSZA 3OYJA 3L2UA 4Z4IA 4CIEA 3KK2A 1TV6A 4N76A 4KTZA 1ZBIA 2RF2A 3VQCA 5J2MA 1NK9A 4RG8A 1JL2A 3VQDA 2IS3A 1U49A 2NUBA 3CFOA 4CEQA 4FM1A 1TKDA 3C6TA 3G0ZA 4HCCA 4KHNA 3KLEA 2HHSA 1LAWA 1N5YA 1WSIA 3NH1A 1KFSA 4DSJA 4TSXA 1JLFA 1VSIA 2VG5A 4YNQA 4DTSA 1S9EA 5FRMA 4E89A 3V1RA 1C1AA 2VG7A 3CM6A 2XO7A 4OLBA 2JLEA 3KKSA 4H4MA 4AHUA 3OS0A 3O3HA 3PX0A 3PO4A 4CEZA 3NH2A 4QOZB 5JS2A 4O0IA 3QINA 4XIUA 4FJKA 5HRSA 3PV8A 3OYEA 1VSEA 3S3OA 4ID1A 4I7FA 1VSFA 5J1EA 1X9MA 3SNNA 1Q9XA 1RT5A 3LP2A 3CG7A 4C8LA 4CJQA 3PY8A 4OKKA 4OPJA 4LY7A 1RT7A 3KKRA 2AJQA 3G10A 4BDZA 1HQEA 1I3AA 3PUFA 4FM2A 4DQIA 3OYDA 5D3GA 1NK0A 1IO2A 2YKNA 1RBUA 3ZT0A 4BE1A 3SV3A 3V6DA 3TAPA 4KPYA 2HHUA 2GUIA 4OJRA 4KHUA 1A5XA 3P1GA 3TAGA 1KRPA 3QIPA 1C0UA 4E7IA 3QNNA 2OA8A 1BCOA 5KRSA 3DLBA 4KB1A 2LSNA 1IKYA 4Q5VA 3AV9A 3VQEA 4BE2A 2HHQA 4F4KA 4W5NA 4LH5A 4FJHA 1DTTA 3NGZA 4KREA 1C1CA 5J2NA 1BQNA 2OPPA 1WSHA 3ZSWA 2Y1IA 4G1QA 4Z0UA 2P51A 3CYMA 3FFIA 1G15A 4CIGA 1NJZA 1RDDA 3K57A 4DSFA 3K5OA 3JSMA 3OYFA 3OS1A 2PYLA 1TK5A 5FDLA 2E4LA 3SUNA 2A1SA 2KQ2A 2OPSA 1REVA 2HHXA 2ZE2A 3H08A 3QESA 4F8RA 4CIFA 4Q0BA 2HB5A 3RWUA 1S1TA 3LALA 3SQ0A 3HSTB 2IAJA 4Z4HA 4CEBA 3LWLA 4KHWA 3L2RA 4DG1A 1XHXA 3QIOA 5E41A 3HYFA 2RPIA 4LSLA 4DU4A 4FJMA 3TARA 1X1PA 3MEEA 1JLGA 1Q8IA
chains in the Genus database with same CATH superfamily
1NBWA 3WXIA 4GNIA 3VQBA 2RN2A 5HRNA 4IBNA 2OYQA 4NLBA 1LW0A 1I39A 1NMDA 3I56N 3A5OC 3KIOA 5CR4A 3ULDA 3A5NC 4DKWA 3CC4N 3U8XA 2IIRA 1KVCA 3OBYA 4M7XA 1M90O 4BE0A 2E6MA 3OYKA 3HVTA 1BA1A 3OJSA 5C42A 5EVZA 4Y1DA 3CCJN 1YJ9N 4B9MA 3HTVA 2F9TA 2UUAK 2GELA 4N47A 5AQKA 5IWAK 4J2AA 5HRRA 1HQUA 4CVNE 3L2VA 1VAZA 3M6GA 1BIUA 2WONA 2YNIA 2VWBA 1T05A 2DTUA 4N56A 3C7NA 3VQ8A 5CYMA 1X9WA 2RE2A 4JKAA 4W5RA 4F2RA 4IKFA 2A1RA 3ENBA 2YHBA 1UA0A 1VQ6N 1C1BA 1LWCA 2IVPA 4FLTA 4CESA 3V9UA 3SLCA 1UAXA 3O4NA 4JHDA 1E4FT 4BR5A 4ILHA 1HKBA 1WB9A 3VQ4A 4LF8K 4LC9B 2P9PA 1VSJA 3EE9A 2QWLA 3HOSA 4BDPA 2NRRA 1D5AA 3CFRA 2IGIA 1ZBLA 1CZ9A 4L3QA 4HWIA 3UB5A 1S72N 4FWQA 3NH0A 3WEEB 1U2VB 4ILJA 3PLAA 1CLQA 4JKBA 4CZKA 4HTUA 4FCYA 4DV2K 2HHHK 1RBTA 1TL3A 3AO4A 3HI0A 4CEDA 3KK1A 3AAQA 4QAGA 4CFAA 4E1MA 2E5LK 4B9LA 2O8DB 1O13A 3D2EB 3QMLA 2DFEA 4IG0A 3UKRB 2G8UA 3SAHA 4B1VA 3KLGA 5AQWA 4KH5A 3PIPL 3HJFA 3D0PA 1S1UA 1SKSA 3I0SA 3K9JA 1ZBSA 2I7PA 3H46O 4AQYK 4DSIA 3P5JA 2JWLA 3DLRA 3DOKA 3OS2A 3FZLA 2HHTA 3SPZA 4DQQA 4KTWA 3AVHA 3O4QA 3HZ6A 5BPNA 1ATSA 3OJUA 3VETA 4DWIA 4IDHA 3DXKA 4FYDA 1TKTA 4H0YB 4M42A 2HF3A 3M8PA 4W5QA 1BL3A 4Z4CA 4HHTA 4JI0K 1RDUA 4ELTA 1ZBHA 1I94K 3CJ7A 3DJCA 4FJLA 3TWHA 4DV3K 4FJ5A 1XWLA 1WSJA 1RDCA 4KHPK 4JLHA 5J2QA 5ADXA 5LJWA 4BACA 3SBTA 4C1NI 3O8MA 1BUPA 3OYNA 3M8RA 2ITGA 3EN9A 1N36K 4EZ9A 4XEIA 1GLJO 3K0SA 5AZIA 4FWSA 4MDBA 2P9IB 3Q7BA 4DTOA 4H5NA 3O9UA 2CGKA 1JLQA 1SL1A 2E2PA 2UXCK 4F2SA 4J2BA 1TVRA 3FLCO 1L3TA 2BDPA 3AARA 4FOIA 4ZTFA 3DM2A 1NGCA 5FROA 3KD1E 4H03B 5HP1A 2XHBA 1HNXK 4IWVA 2P1JA 3SQ4A 1GOAA 2Q36A 2UUCK 1QSYA 1VQ9N 4DLGA 3QEXA 2Z1JA 2F4VK 1X3MA 4FJJA 4FW2A 1NJYA 3OYBA 1QQCA 4RW6A 4FWPA 5HOOA 2ZGZA 4H5WA 5LJVA 1VRTA 1N32K 1E4GT 3NF6A 3QFUA 3AVKA 1CXUA 3FZHA 3CPWM 3TTDA 1KAYA 2Q0RA 5FRNA 2DY4A 1QSLA 3KZBA 4GVEA 1FKPA 4FLZA 3U4LA 2QKBA 4W5TA 3O6WA 1BI4A 3IRXA 5H1SQ 3CCQN 2J4RA 1VQ4N 2ITMA 4DQ8A 4I6MA 3L2QA 1EXQA 4BR2A 1E3MA 3H45C 4IJAA 3SPYA 1C0MA 3NE6A 4ELVA 3G4SN 1T6DA 1HJRA 3L6QA 4DU3A 5BR8K 5BPLA 1YTAA 4CZEA 3QFPA 4F3TA 4DTNA 2Q2RA 4BRGA 5DK5A 1LWFA 3NFAA 4M3WA 4JS4A 4NYFA 3DXMA 1C6VA 2EWSA 4CERA 4M3XA 3LZIA 4M3YA 4M63C 4OLAA 3VGLA 4HCBA 4CEAA 3ZT4A 5C12A 1LWEA 2XY5A 4K8XA 4GKKK 3N4QA 1NNEA 3MXJA 1RT2A 2ZM6K 1G99A 2P9IA 5CY4A 1SS6A 1RFQA 4BDYA 2O4GA 2QTDA 1WOQA 1YITN 3BEXA 2NRXA 3FZFA 2WBNA 4KI6A 4DUYK 5LY3A 4KHYA 1VSKA 1IG8A 3QEVA 2EHGA 4I9QA 1KSPA 1S9GA 3ZSXA 2E8AA 3LAKA 3GL1A 1NG9A 4IG3A 3VF2A 4FJ7A 1S1WA 2NNWA 4ZHRA 2P9NB 5FPMA 4BC5A 3L0QA 3LP0A 1NGBA 2VQEK 3F9KA 1BU6O 3OYAA 2FF6A 3D45A 4GKJK 4K43A 3ATVA 1CZAN 3VEOA 4CJRA 4FJNA 3MN6A 1NK4A 5JICA 4CBWA 4DSKA 2HHVA 5BR9A 4DQRA 5AQFA 3ID8A 4B9TA 5AQXA 1WLJA 4BG8A 1RCHA 4E19A 1NOZA 2KW4A 3O1WA 5KQDA 4DV5K 4CJEA 4BR4A 4DTRA 1NGJA 1BO5O 4MQ3A 3ASMA 2G8IA 1L3SA 3OTOK 3T7ZA 4CHQA 1YI2N 1EWRA 4X64K 1D4XA 2D0PA 2FF3B 4CIEA 2AP1A 3EKUA 3VQCA 5J2MA 1JL2A 3H1VX 3H1QA 2IS3A 1U49A 3SMSA 3CFOA 1TKDA 4UY8O 3VPZA 4KHNA 3VF4A 1WSIA 4DSJA 1K9MO 4YNQA 3U9DA 2QWMA 3CM6A 2JLEA 4AHUA 3J8AA 3O3HA 4A2BA 2A41A 2NRVA 3OYEA 4CJ7A 3MCPA 5J1EA 1X9MA 5AQUA 3FZMA 3GG4A 5C15A 3PY8A 4OPJA 2O8EB 2QXLA 3A8YA 3E66A 2AJQA 3G10A 3T1HK 4DQIA 5D3GA 4EAHD 1RBUA 4BE1A 5F1XA 3SV3A 2GUIA 4BRIA 3P1GA 1S3XA 4E7IA 4KB1A 4Q5VA 3HSCA 2D4WA 4LH5A 5C10A 4KREA 3JXUA 1DT9A 5BRFA 4A57A 5E26A 3ZSWA 2ASPA 2P51A 3CYMA 4CIGA 1RDDA 1KAXA 3OYFA 4K0KK 1JCEA 2A1SA 1REVA 3THYB 1QVGM 2HHXA 3IDHA 4CIFA 4IOCL 2HB5A 2NZTA 3RWUA 3LALA 2CGJA 3WUHA 4DU4A 2NRTA 3TARA 3MEEA 2CGLA 1QSSA 4NB4A 5SZTA 3EYZA 2E1ZA 1R59O 1TKZA 1NK6A 3C0BA 1V4TA 3QBWA 1T7PA 1XC3A 3LP1A 1JCFA 3CQYA 4E7KA 2UUBK 4CEEA 3MAQA 3JYTA 5M1FA 1NGAA 4HUEA 3J7YP 1YHQN 2QWPA 4CZIA 3VQ6A 4KFBA 2A3ZA 4OGEA 4B9VA 4Z4FA 4E0DA 4FM0A 2HOEA 1EQYA 3MEDA 4CE9A 4C8MA 2PAVA 4DTJA 2A5XA 3G71N 1HJOA 2D1KA 3HXMA 2V7ZA 1W2BM 3LDSA 4BROA 1RT3A 3ZSRA 2FBVA 3LWMA 1W7AA 3TSPA 4ID5A 5C2FA 2WOMA 4Z4EA 4N41A 3SUQA 4JKHA 4LSNA 4I2QA 4LD0A 3RRGA 3CF5L 4JKEA 1F21A 1DGKN 5GIPA 3ALYA 5MLCQ 1WSFA 3VQPA 3VENA 3ZT2A 2IOCA 3WXLA 2WFBA 3EKSA 2YNGA 3BZCA 2P9LA 4LFCK 3KK7A 3EO3A 4CJSA 1EP4A 3RMAA 1RDWX 1XMOK 2F8TA 1A5VA 5JVHL 3F9MA 4WFAL 4B3RK 5KTQA 2EX3A 1VSHA 3HP9A 5FLXO 4NCGA 4PL7A 3GE1A 3UIQA 1RTJA 4FJXA 1QE1A 4JD2B 1LAVA 3DYAA 4DV6K 1T6CA 2HSTA 1DLOA 4C1NK 3RR8A 4CFCA 4JKCA 5T7BA 4IJNA 1B9FA 5M1QA 2YJEA 5M1KA 2QA4N 4E3SA 3AGKA 3QO9A 2B6AA 3DMJA 1S5JA 4AHSA 3LM2A 1S6PA 3SJHA 4MDAA 1RT4A 4DFKA 1HPMA 2VWJA 5DMRA 3ZSQA 3SJJA 1JLBA 4ICLA 3S3MA 1XQSC 2G8FA 3QLHA 1DEJA 2KTQA 3CQ8A 1GLLO 4OKEA 5AQMA 1GLDG 1TAUA 4HUFA 2O8FA 4NO7A 4QCLA 3RVCA 4CZMA 4ELUA 1YF5L 3A2FA 4E7JA 4A62A 1C0TA 1IBKK 3CC7N 3NGIA 3EY1A 2FSNA 4YORA 1SL0A 4GV3A 4M3ZA 4PKGA 3DLHA 3AA4A 3G6EN 1JCGA 4KTQA 2KKZA 4FVUA 3DRPA 1NKBA 3S3NA 4ISGA 3THXA 5BRDA 1Q9YA 4RW4A 3EEQA 4JK8A 1XUPO 2B4JA 1W97L 4JS5A 4PHTX 2QK9A 5AQOA 2PYJA 2XY8A 4JKGB 3DWLA 2QWQA 4DS4A 1T44A 5CZ2A 4WCEL 2YHYA 4IEEA 3SUOA 3CPEA 4LFBK 2G8VA 3O08A 2P9UB 4E7LA 3I0RA 1A5WA 5KGWA 4IO8A 3D2EA 3MXIA 3UKRA 1XMQK 4PUOA 2Q97A 1IH7A 1TUYA 5CHIA 1NK8A 3VEWA 1KAZA 1RDAA 2P9KB 2YX6A 1NKCA 4AHVA 3EZ5A 3IAYA 3V1OA 1TGOA 5I9EB 5AZJA 3SV4A 3SQ2A 4BREA 2OTLN 3DLGA 2OPRA 4CF8A 1WNSA 2RHKA 4O4GA 4CGIA 1OKJA 3ZLJA 4BRHA 3NGYA 3HP6A 3DRRA 3VQ5A 4WQ5A 5KGXA 3RR7A 3LDLA 4FO0A 4K8ZA 3BZKA 4DTXA 4LF7K 3WXMB 1IJJA 5C0YA 4JNEA 3ZYYX 4NXNK 1ESVA 1UA1A 3WXKA 3AVNA 3TSUA 5HRPA 1X9SA 4CJ5A 4OO1J 1GLAG 3KLHA 3ZT3A 2ZD1A 4GVMA 4OPAA 5BN9A 3VTHA 3IG1A 4CFBA 2PBDA 1BQMA 3MX5A 4CGHA 4DTPA 1NK5A 3CM5A 4C8OA 2G8HA 2UU9K 3KWIA 2HVIA 4J2DA 3AA2A 3C65A 2XRIA 3CFPA 4JRPA 3VEXA 1K6YA 2E2OA 1J5OA 2OTJN 4CD1A 2VWKA 3CERA 1UOCA 4RCHA 4BGBA 2RKIA 3O9RA 1SZ2A 4C23A 3AVJA 4BRDA 2QKKA 3VGKA 1HYZA 2FBYA 3E9OA 5B8HA 1VSDA 2NRWA 2JGUA 3RTVA 5I42A 2HBMA 2OZMA 3RMDA 3DLEA 4PKIA 4H0TB 4Z94A 4LH4A 3NBPA 4DR7K 4JN4A 1BGXT 3HM9A 1TUUA 3NF7A 4FW1A 4E7HA 3HPGA 4IXCA 5CZ1A 1HNWK 1D8YA 2D0OA 1WSGA 2ZJRL 3A5MC 3J81O 1IG9A 3BDPA 3KLFA 3EL2A 2FXUA 1TAQA 1KVAA 3M1FA 3SCXA 3UKUA 5AQTA 5C24A 3HK2A 3G25A 1HRHA 1XHZA 3OVNA 3NVKA 5GADP 4NCBA 1Z05A 4E1NA 4CZFA 2DFHA 1SQKA 3ZT1A 1VQLN 3DLKA 5C2DA 3K58A 3PX4A 5JVGL 1HNZK 4FJ9A 4M7YA 5AZJB 1DTQA 3O9TA 3WQTA 3CMAN 1XI1A 4BRQA 5J2PA 2O8CB 3MX2A 4B9UA 4DF8A 4AHTA 4I6MB 3CCUN 1QQNA 4DCHA 1U04A 4AHCA 4F8RA 3AVLA 2D5RA 3R8EA 1VQON 2YV0X 1IKWA 1LOTB 3BF1A 1UWBA 1RT6A 4JK7A 1WAFA 5K14A 4CBXA 2QWRA 1U2VA 1GLEG 3MECA 1HNIA 4YOUA 3BUZB 4WQ5C 4WQ4C 3VQQA 1C0GA 2FBXA 1FXXA 2VCPA 3KWGA 3LM9A 3DXMB 2GV9A 3SK3A 2I5JA 1SKWA 3U3GA 5ADXH 2O8BA 2X6NA 4H0PA 3LAMA 4W5OA 2Q1NA 1RTHA 4JI5K 3L3VA 5AQJA 5HLFA 3ITHA 4KH6A 5SWMA 3L3UA 5HBMA 3ZSZA 3KK2A 2RF2A 3OBWA 1NK9A 4A2AA 2H3GX 5AQPA 4HCCA 3IMXA 3DLLL 4DR6K 1FJGK 1S9EA 3PSIA 3WT0A 5FRMA 1M1KO 3OS0A 3PO4A 4B1XB 4YOVA 4O0IA 3CI5A 4XIUA 4FJKA 5HRSA 2P9NA 3TTFA 4ID1A 4I7FA 1RT5A 3LP2A 4C8LA 4LY7A 3KKRA 4BDZA 3PUFA 2WTUA 3OYDA 1S22A 1NK0A 1X3NA 4IO9L 3QIPA 4B9QA 3QNNA 2OA8A 2LSNA 1IKYA 3VQEA 1WUAA 1DTTA 4JI1K 3R6MA 4MO4A 1C1CA 1LCUA 1Z6RA 2W40A 1BQNA 3PIOL 1WSHA 2O8FB 3B8AX 3D2FB 3QBXA 3JAMO 3OS1A 4A5AA 1TK5A 3CCLN 2E4LA 3GBTA 3H08A 1S1TA 4Z4HA 4H5TA 3L2RA 4KHWA 5E41A 4YY3K 4LSLA 2RPIA 3J7ZO 1IBMK 1NGDA 3WNEA 2HBJA 4M3RA 1S1VA 3A0IX 3SYZA 2E2QA 1OH5A 3MEGA 3O3GA 1VQ8N 4FK0A 3OY9A 4IFVA 5JMVA 1HYSA 1NGEA 1BG3A 1ZBFA 5KPRA 5BREA 3SI6A 2P5GA 3BP8A 2QW9A 3I8DA 2IVOA 4I2PA 2YNHA 5JS1A 3MDQA 3ULEB 3TTCA 2Q3SA 2BGGA 4Z4GA 2BE2A 4PQUA 2P9KA 4DFPA 1K8KA 3GOIA 2WC9A 4BRPA 3CJ9A 3M3ZA 1BI4B 1VQ5N 3L8BA 2G8WA 3HVRA 3QEPA 5CE3A 4R5PA 1SUQA 4FK2A 4GW6A 1VHXA 4CF0A 3WXJA 2YKMA 2Z1IA 4PWDA 1J5EK 3OYCA 2Z1GA 4KKOA 4DSEA 4ISEA 3OA9A 3V9XA 4EHTA 3TAFA 3K5NA 4LFAK 1KQSM 2YCHA 4BVOA 4M45A 1QHAA 5KRTA 1FKOA 1QZ6A 1S1XA 4J8FA 3K9KA 4CEFA 5EU7A 3T3FA 4CJPA 2V51B 1JXBA 3D7EO 4IDKA 4CHPA 1KVBA 5DM7L 4KHQA 4CCHA 1Z25A 3E01A 2HBKA 3RSEB 4M41A 1D9DA 3AVGA 3VTIA 1Y64A 3KD5E 4YOWA 3K5MA 1W9HA 1RBSA 3THWB 3HBTA 2VYPA 4DTUA 4GV9A 4XH5A 5EX5A 3T1AA 2AA4A 5FPNA 4KAZA 2XY6A 1S6QA 4FOEA 4IEIA 2G8KA 1YJWN 3NDKA 3AO3A 2ZWHA 3W3DA 1ASVA 5GIOA 3Q7CA 1QZ5A 1MWKA 1ZYQA 5LMNK 2Y1JA 4AF1A 1ASUA 2GWJA 4CZGA 3V9WA 3WNHA 2FSJA 1P8ZA 1J53A 3B6OA 3OW2M 3WNGA 1CZBA 4FZZA 4B9NA 3K5LA 2E88A 2Q31A 4K25A 2HNYA 2B5JA 2CH5A 2ASMA 5CYQA 5TKWA 4O55A 4FZYA 1HPZA 5AQYA 1J54A 5M1OA 1OVYA 4EIAA 4DR4K 2F8SA 3CJAA 2W6KA 2BTFA 3CC2N 2GEMA 4HTLA 5IT9O 2P9LB 1SKRA 1B9DA 1RBVA 2D0BA 3P38A 1VQNN 4C8NA 2F9WA 3BY5A 1YVUA 2FBTA 2A42A 2HMPA 4DFJA 3A5LC 5A2QO 3VESA 1TKXA 1FW6A 1C0FA 1MWMA 2O8DA 2IDOA 4B8CA 4IZ9A 3VA3A 3VN5A 4YDUA 2X74A 4DUZK 5JLFA 1VRUA 4B3OA 3K2PA 2HW3A 4PY5A 3ZETA 2BH1A 3LL3A 4BRAA 1JLAA 1T8EA 3CCMN 3ZEUA 3DOLA 4FLVA 1BA0A 3LDOA 1TL1A 1EKEA 1TYQB 2NRHA 4Y1CA 1GLBG 2HF4A 4CJUA 4HVJA 3MCAB 1NGIA 4AH9A 4CJTA 4BR9A 3LP3A 1J6ZA 4EP5A 1ATNA 1JLCA 2NRZA 4JI4K 1U48A 5C25A 4M3TA 3CD6N 4FWRA 4DS5A 4DV0K 3LANA 4B08A 1Q7YO 4B3TK 4CGJA 2ASOA 3VERA 3RMBA 1B92A 4F3OA 3KLIA 3VQAA 4MLHA 3W0LA 4AHRA 3J7AP 4O0JA 1VQMN 3LDQA 3RMCA 1ASWA 1ATRA 4FXDA 3AO1A 1MU2A 1L3UA 1ZC6A 4FK4A 4CK2A 3VQ9A 1HKCA 3CETA 3R1XA 3THWA 4OGCA 3QICA 4YHHK 1SV5A 1KLMA 2BANA 3C7NB 5I3UA 2E2NA 4DSLA 2V7YA 3P4IA 1H1VA 4CJ4A 1OH7A 3R3LA 3M5RA 3MWPA 4DV4K 1U4BA 1NU0A 2E6LA 2Z1HA 3VF6A 2YHAA 3WNFA 3ULEA 4CJ3A 4FLXA 4AM6A 5AQGA 1K8KB 4CGFA 3CCSN 4IFEA 1N33K 4BG9A 1CXQA 4XH1A 1LW2A 2QI2A 3AVAA 5AQSA 4XH4A 3C95A 2D0AA 5LMUK 5AQVA 4L8RB 1IKXA 4FWLA 4AILC 3VOVA 3KTQA 3OYGA 1QTMA 4CF1A 3ENOA 4H0XB 2ETJA 3ZETB 3HPHA 5F0XA 3AVIA 4DU1A 1MA9B 4JAXA 1P90A 4O8UA 2QM1A 4CHYA 3VEZA 3VMFB 2PY5A 4CHZA 1VQPN 1NGHA 4PA1A 4B1UB 3V81A 1NMNA 1SL2A 1YTUA 3L2WA 2A6AA 3AVMA 4CJFA 4JEPA 3SQ1A 4JI7K 3KHYA 4H4OA 3U9ZA 5FPDA 4KHSA 3P83D 1GLFO 5AR0A 2YI1A 3DAWA 3PSFA 1NJWA 1KFDA 2WUSA 4BR7A 3ZSVA 4YDUC 4U67L 1ITGA 3LPTA 4KRFA 2YHWA 3VEYA 4WE1A 5AQRA 3SZ2A 4CJWA 4H8KA 4J2EA 4Y0WA 2IVNA 1RDBA 4BWMA 1VSMA 4MFBA 3ENHA 1HUXA 3I33A 3V4IA 2XY7A 4JV5K 1GLCG 4IOXA 2GBZA 2IC3A 2NLXA 1GOCA 3O9QA 2YNFA 2OZSA 3KVGA 3CJCA 1QS4A 3L2UA 4A59A 4N76A 4RG8A 2UXBK 2NUBA 3QDKA 3C6TA 3G0ZA 2E1YA 3KLEA 2HHSA 3ID6A 4JI2K 4JI8K 3TU5A 2VG5A 4DTSA 3I55N 3AY9A 4BRKA 3V1RA 2VG7A 1DKGD 2XO7A 3KKSA 4H4MA 2O8CA 3F5TA 3ZX0A 4CEZA 5JS2A 3QINA 4JHDB 3CMEN 3SNNA 1Q9XA 3FFKB 4CJQA 4OKKA 3H6EA 1RT7A 3THXB 4FM2A 4H5RA 1IO2A 3ZT0A 5BN8A 3V6DA 4KPYA 5GINA 2HHUA 4JKGA 4OJRA 2A40A 1A5XA 2UXDK 1KRPA 1C0UA 4JKDA 3ATUA 3SMPA 2HHQA 4W5NA 3TSQA 3NGZA 4JK9A 2P9UA 5J2NA 2Q0UA 3E9LA 2W41A 5DM6L 3IUCA 4G1QA 1ZXOA 2OCEA 2FLOA 4LF9K 3K5OA 3JSMA 3CCEN 2PYLA 4EHUA 3JS6A 3O80A 1NLVA 4V19S 2KQ2A 2OPSA 2JWKA 2ZE2A 4H0VB 3SQ0A 4NXMK 1BOTO 2P9PB 3LDNA 4DG1A 1XHXA 3HYFA 1HX1A 1X1PA 1JLGA 1Q8IA 4KB0A 4DQSA 1WN7A 4NCAA 1NJXA 2QEXN 5M1PA 3AVBA 3FGUA 4QS8A 3NAEA 1TK8A 3L4QA 2PZSA 3H3OB 1TK0A 3P39A 4WFBL 3TAQA 3C94A 4BQZA 3NF8A 4GY2B 3U6FA 4BVPA 2ZJQL 3HO1A 4FSVA 3CCRN 4CJVA 1XNRK 1IKVA 3TR8A 2X78A 4DQPA 4JD2A 4K42A 4BQLA 4DMNA 4O8KA 1QQMA 4BR0A 2UYTA 4FWNA 1NOYA 1WAJA 2PFUA 4FPAA 4HUGA 1K73O 4CI6A 1RBRA 4PKHA 2E20A 3C6AA 3L4IA 4B1WB 1BISA 3NMUA 1RGIA 1HMVA 2YHXA 4DB3A 4DR3K 4EFHA 3QERA 2HNDA 1O1WA 3UE5A 2ATQA 1L5UA 3VGMA 4WYBA 4I9LA 4BRNA 3MN5A 4RW8A 1D9FA 4G9ZA 4RW9A 5GAHP 5E84A 5AZIB 5AFUA 4X66K 1HLUA 3TAEA 3DXKB 5ELZA 4OKJA 3B6PA 4GV6A 3CQXA 4BRLA 3IFRA 1BIZA 4BGAA 2CH6A 4DR5K 1NWKA 4N5SA 2ZGYA 3CIPA 2BUPA 4BWJA 2KFNA 3I8BA 5BRHA 3FE1A 4FLUA 3N4PA 3T19A 4DR1K 1HR0K 1Q82O 3TABA 2P5OA 4B1YB 4FWKA 3DI6A 1HYVA 5KQ8A 4F9OA 4RTFD 4JI3K 3ZCMA 1KCFA 4IFYA 3TI0A 1N8RO 3AVFA 4CJLA 4OX9K 3MXMA 3J80O 1YUWA 2I7NA 3D2FA 1KTQA 1JXEA 4FLYA 5GAGP 4R79A 4B3MK 2KZMA 3OYIA 2HMIA 1RT1A 1LV5A 1Y97A 1EETA 1HNVA 4AM7A 4DLEA 3HM8A 2OPQA 3HOTA 4O5FA 5AQHA 4OVLA 1RTIA 2W6LA 4CHNA 2VQFK 5AQNA 1VK0A 4BRMA 2F7TA 3OYMA 4B8AB 2KHOA 1OH6A 1JL1A 2GTDA 4B1ZA 3E9PA 3FR0A 4CEOA 4DV1K 2FC0A 2X6SA 1T3VA 1RNHA 2GX9A 2F96A 3O3FA 3TAMA 1VQ7N 2HHWA 2HNZA 3CHWA 3NF9A 1WSEA 4JI6K 1QQOA 4NLCA 3AVCA 3LPUA 4RW7A 1XC9A 2P9SB 4LF5K 1NGGA 2QWOA 4KV8A 1WBBA 3THVA 4PL8A 3V9ZA 1BDGA 1NGFA 2VGMA 4BRCA 4YFUA 2VGNA 4FJIA 4CJKA 3EE8A 3NCIA 1OVQA 1KLNA 3CJBA 4CBUA 2FSKA 1IV0A 4ZTJA 3V1QA 1WBDA 3MWTA 4CGGA 4DFMA 3ZX3A 4JKFA 4MO5A 1RTDA 1HKGA 1XNQK 3K59A 1YIJN 1NK7A 3V9SA 1Z26A 2YJFA 4FL9A 5AJ3K 3RSEA 4IOAL 2O4IA 4CZJA 5FPEA 1OH8A 3U3YA 3AGRA 1L3VA 4OPKA 2HBLA 5KPZA 3QETA 3T1YK 2QWNA 3BGRA 3SUPA 5KPTA 4YOYA 3CXCM 4KH4A 4KI4A 2KLAA 3NHGA 1BWFO 3MK6A 3QEWA 3O5BA 3FZKA 2R7YA 1YXQA 1U47A 4O44A 1EX4A 4WFNL 1VQKN 4A5BA 3OYLA 1JLEA 4OPHA 4CD3A 3C6HA 1N34K 3IKMA 1N6QA 3PO5A 1YAGA 5EXWA 4JRQA 3SAGA 4DTMA 3OYHA 3M8QA 4CK3A 3EZWA 4ILGB 3MMVA 3SAFA 4FJGA 4EP4A 3C6UA 5EOYA 4A61A 1KC8O 4O5BA 1BCMA 1FK9A 1GOBA 4CF2A 1R0AA 1Q18A 2DPNA 1JJ2M 3PX6A 5HROA 1BHLA 3ZSYA 1QHTA 4BC4A 5AQIA 3M8SA 4CECA 3WEEA 3HL8A 3O1BA 3AA3A 4K41A 4C8KA 1MDUB 4EZ6A 3R9PA 4H5VA 3VQ7A 3ISNC 1NKEA 1EWQA 4FLWA 4CZHA 1T03A 2KZZA 5LL6Z 3H3NO 2P9SA 1QVFM 2D0CA 3AO2A 3ZEUB 3ZSOA 3OHRA 4JYAK 3KJVA 1TYQA 3AO5A 4BC2A 1YT3A 2W42A 3KK3A 3HRGA 3IS9A 3AA5X 3F73A 4CK1A 3AAPA 4FJ8A 4CGDA 3S41A 4CFDA 3RRHA 3VEVA 3THYA 4CF9A 3VA0A 3HPOA 1X9JA 4LF4K 3LZJA 1JKHA 4YOTA 1W0HA 2O8EA 5TKYA 2OANA 5KI6A 1VSLA 2KFZA 2QXFA 3E1YA 1YJNN 1J9AA 3WQUA 4GMJB 5AQQA 3GDQA 4FVMA 4KO0A 4BY9C 2VG6A 1U45A 3DRSA 5AQLA 4M3UA 4B9SA 2DFFA 4NYNA 3O9SA 1RILA 4Q0BA 4FZXC 4CHOA 3QNOA 4KBOA 4DF4A 2GWKA 4DR2K 3TANA 5HL7L 2HVHA 3CJ1A 3S9HA 5AFUH 3CCVN 3QEIA 4X62K 2ZQBA 3F2KA 4QS7A 4BC3A 4UQGA 1EO1A 3HT3A 3P31A 1ZBUA 3UKUB 3OYJA 4Z4IA 2V52B 3LDPA 1TV6A 4KTZA 1ZBIA 3VQDA 4CEQA 4FPBA 4FM1A 5M1NA 4DHYA 2ZJPL 1LAWA 1N5YA 3NH1A 3NVMA 1KFSA 1SAZA 4TSXA 3ZX2A 1JLFA 5EY4A 1VSIA 1KXPA 5F2RA 4E89A 4U7BA 1C1AA 5BPMA 3BF3A 4LF6K 4OLBA 4BRFA 3PX0A 3NH2A 4QOZB 3O4WA 1K8AO 2ZF5O 4WF9L 3PV8A 1VSEA 4E1JA 3S3OA 1VSFA 4MLEA 1Q86O 3CG7A 4RWTA 4X65K 3T69A 1HQEA 1I3AA 4QS9A 2YKNA 3TAPA 4KHUA 3TAGA 3DLBA 1BCOA 5KRSA 3AV9A 3TPQA 4BE2A 1KD1O 4F4KA 4FWOA 2GUPA 4FJHA 5GAEP 2OPPA 2O8BB 4CW7B 4Z0UA 4DV7K 2Y1IA 4CZLA 3FFIA 1G15A 1NM1A 1NJZA 1Q81O 3K57A 4DSFA 4WQ4A 3MN9A 1V4SA 4H0OA 5FDLA 3SUNA 1ILYA 1U6ZA 3SBGA 1YVNA 3D6RA 5AQZA 5JLHA 3QESA 1IBLK 3QB0A 4ISFA 4FWMA 1NJIO 4YOXA 3HSTB 2IAJA 3LWLA 4CEBA 3QIOA 4FJMA 3MN7A 4B3SK
chains in the Genus database with same CATH topology
4KB0A 4DQSA 1WN7A 4NCAA 4M3RA 3VQBA 1QSSA 2RN2A 1S1VA 3SYZA 1NJXA 5HRNA 4IBNA 5SZTA 3EYZA 3AVBA 3MEGA 3O3GA 4FK0A 3NAEA 3OY9A 1TK8A 2PZSA 1TKZA 2OYQA 1NK6A 4IFVA 1HYSA 1TK0A 3TAQA 3C94A 1LW0A 1ZBFA 1T7PA 1I39A 3NF8A 3LP1A 3SI6A 3U6FA 2P5GA 3I8DA 3HO1A 4E7KA 3KIOA 4CEEA 4CJVA 4I2PA 3MAQA 1IKVA 2YNHA 3TR8A 3JYTA 3ULDA 5JS1A 4HUEA 2X78A 4DQPA 2Q3SA 2BGGA 4Z4GA 1KVCA 2BE2A 4DMNA 4PQUA 4DFPA 4BE0A 3VQ6A 2E6MA 4KFBA 3OYKA 1NOYA 1WAJA 4OGEA 4HUGA 4B9VA 4Z4FA 4E0DA 1RBRA 1BI4B 3HVTA 3OJSA 4FM0A 2G8WA 3L8BA 5C42A 1BISA 4Y1DA 4B9MA 3HVRA 3QEPA 3MEDA 4CE9A 4C8MA 4N47A 1HMVA 4R5PA 1SUQA 4FK2A 4GW6A 4CF0A 3QERA 4DTJA 4J2AA 2HNDA 1O1WA 1HQUA 2ATQA 2YKMA 2Z1IA 5HRRA 3L2VA 3HXMA 1L5UA 4PWDA 3OYCA 4I9LA 1BIUA 2WONA 2YNIA 2Z1GA 3LDSA 4KKOA 4RW8A 4DSEA 1RT3A 3ZSRA 2FBVA 1D9FA 3LWMA 3V9XA 4N56A 1T05A 4RW9A 3VQ8A 5CYMA 3TAFA 1X9WA 2DTUA 4ID5A 2WOMA 4W5RA 4F2RA 4IKFA 2A1RA 3K5NA 4Z4EA 2YHBA 3TAEA 1UA0A 1C1BA 3SUQA 4N41A 1LWCA 4M45A 4FLTA 4OKJA 5KRTA 3B6PA 1FKOA 1S1XA 4CESA 4LSNA 1BIZA 3V9UA 4CEFA 1UAXA 4N5SA 3O4NA 4I2QA 5EU7A 4LD0A 3T3FA 4BWJA 3RRGA 2KFNA 4CJPA 3VQ4A 4FLUA 1JXBA 1F21A 1VSJA 3ALYA 3T19A 4IDKA 4CHPA 1KVBA 4BDPA 3TABA 4KHQA 4CCHA 2P5OA 1D5AA 1WSFA 1Z25A 2IGIA 3E01A 1CZ9A 2IOCA 4M41A 3VQPA 3ZT2A 3CFRA 1ZBLA 1D9DA 3AVGA 2YNGA 3DI6A 1HYVA 4CJSA 3ZCMA 1EP4A 1KCFA 4IFYA 3WNEA 3NH0A 3KD5E 3K5MA 1W9HA 3TI0A 3RMAA 3AVFA 1CLQA 1RBSA 2F8TA 4CJLA 1A5VA 4HTUA 4FCYA 3MXMA 4DTUA 5KTQA 2EX3A 1VSHA 1KTQA 1RBTA 1TL3A 3HP9A 3AO4A 4NCGA 3T1AA 4CEDA 1JXEA 3KK1A 4CFAA 4QAGA 4E1MA 4FLYA 1RTJA 3UIQA 4KAZA 1QE1A 4B9LA 4FJXA 1LAVA 1S6QA 3DYAA 2XY6A 2G8KA 2KZMA 3RR8A 1DLOA 2DFEA 4IG0A 3OYIA 4CFCA 5T7BA 2G8UA 2HMIA 1B9FA 1RT1A 3KLGA 3NDKA 1Y97A 1LV5A 1EETA 3AO3A 1HNVA 4E3SA 4DLEA 3HJFA 3D0PA 1S1UA 1SKSA 1ASVA 3I0SA 3QO9A 2OPQA 2B6AA 3DMJA 1S5JA 4OVLA 4AHSA 1RTIA 4CHNA 4DSIA 1S6PA 3P5JA 3DLRA 3DOKA 3OS2A 1RT4A 4DFKA 1ZYQA 2VWJA 1VK0A 5DMRA 2Y1JA 2HHTA 1ASUA 3SPZA 3OYMA 3ZSQA 3SJJA 3V9WA 4B8AB 1JLBA 4ICLA 4KTWA 4DQQA 3WNHA 3AVHA 3O4QA 3S3MA 2G8FA 3QLHA 2KTQA 3CQ8A 1JL1A 3OJUA 1J53A 4DWIA 3B6OA 4FYDA 4CEOA 3WNGA 1TKTA 4OKEA 1CZBA 4M42A 2FC0A 3M8PA 4HUFA 4FZZA 1TAUA 4W5QA 1BL3A 2X6SA 1RNHA 2F96A 3O3FA 3TAMA 4Z4CA 3K5LA 4B9NA 4QCLA 2HHWA 2HNZA 4HHTA 4ELUA 3A2FA 3NF9A 1WSEA 2B5JA 2HNYA 4ELTA 1ZBHA 4E7JA 1C0TA 5CYQA 4FJLA 3AVCA 3TWHA 3LPUA 4O55A 4FJ5A 1XWLA 4RW7A 1HPZA 1XC9A 4FZYA 1WSJA 1J54A 1RDCA 3NGIA 3EY1A 4JLHA 5J2QA 2F8SA 4KV8A 1SL0A 4M3ZA 3DLHA 3AA4A 4BACA 3THVA 4KTQA 3DRPA 1NKBA 3S3NA 1SKRA 1B9DA 1RBVA 2D0BA 4RW4A 3OYNA 3M8RA 3V9ZA 2ITGA 4C8NA 2B4JA 1Q9YA 4JS5A 1YVUA 2FBTA 2QK9A 2PYJA 2XY8A 4DFJA 4YFUA 4DS4A 4FJIA 1TKXA 5CZ2A 4EZ9A 4CJKA 3NCIA 3SUOA 1KLNA 2G8VA 2IDOA 4B8CA 4E7LA 3I0RA 1A5WA 3VA3A 4DTOA 5KGWA 4ZTJA 3V1QA 1SL1A 1JLQA 3VN5A 3MXIA 4CGGA 2X74A 4DFMA 4F2SA 1VRUA 4J2BA 1RTDA 4PUOA 3K59A 1IH7A 4B3OA 3K2PA 1TVRA 1NK7A 1L3TA 3V9SA 1NK8A 2BDPA 4PY5A 2HW3A 1JLAA 1RDAA 1Z26A 4ZTFA 1NKCA 3DM2A 4AHVA 5FROA 1T8EA 3KD1E 3EZ5A 3IAYA 3V1OA 5HP1A 1TGOA 3DOLA 2XHBA 4FLVA 3SQ2A 3SV4A 1TL1A 1EKEA 2O4IA 2P1JA 4Y1CA 3DLGA 3SQ4A 2OPRA 1GOAA 4CF8A 3U3YA 1WNSA 1L3VA 4OPKA 1QSYA 4O4GA 4DLGA 4CGIA 3QEXA 4CJUA 2Z1JA 4HVJA 3QETA 4CJTA 4FW2A 4AH9A 4FJJA 1NJYA 3BGRA 3OYBA 3SUPA 1QQCA 4RW6A 3LP3A 3NGYA 4EP5A 3HP6A 3DRRA 3VQ5A 5KGXA 3RR7A 1JLCA 1U48A 4KI4A 5C25A 4K8ZA 4DTXA 4M3TA 3NHGA 4DS5A 3LANA 4B08A 3QEWA 2R7YA 1VRTA 4CGJA 1UA1A 3AVNA 5HRPA 1X9SA 4CJ5A 1U47A 3RMBA 1B92A 3NF6A 3ZT3A 3KLHA 3AVKA 1CXUA 4O44A 2ZD1A 3KLIA 4GVMA 1EX4A 3VQAA 4F3OA 3IG1A 4CFBA 5FRNA 2DY4A 3OYLA 1QSLA 1BQMA 4CGHA 1NK5A 1JLEA 1FKPA 4AHRA 4DTPA 4FLZA 4O0JA 3CM5A 2QKBA 4W5TA 4C8OA 2G8HA 1BI4A 3RMCA 1ASWA 3IRXA 4FXDA 3AO1A 1MU2A 1L3UA 2HVIA 4J2DA 3AA2A 1N6QA 2XRIA 3CFPA 4JRPA 4FK4A 3L2QA 3PO5A 1EXQA 4CK2A 1K6YA 1J5OA 3VQ9A 2VWKA 1UOCA 4OGCA 2RKIA 4JRQA 1SV5A 1KLMA 2BANA 4DTMA 3HK2A 3OYHA 3M8QA 4CK3A 5I3UA 3AVJA 4DSLA 3SPYA 2QKKA 1C0MA 3NE6A 4ELVA 4CJ4A 1HYZA 4FJGA 2FBYA 4EP4A 3C6UA 1HJRA 4DU3A 1VSDA 3RTVA 2JGUA 5I42A 1U4BA 4O5BA 2OZMA 1YTAA 1BCMA 1FK9A 4F3TA 3RMDA 3DLEA 1GOBA 2E6LA 4CF2A 4DTNA 2Z1HA 4LH4A 5DK5A 2YHAA 1LWFA 3NBPA 3WNFA 1BGXT 3NFAA 4CJ3A 1R0AA 3HM9A 4NYFA 4JS4A 4FLXA 4M3WA 3NF7A 4FW1A 4E7HA 3PX6A 5HROA 1BHLA 1C6VA 3HPGA 5CZ1A 4CERA 1D8YA 4CGFA 4M3XA 3LZIA 4M3YA 4OLAA 1WSGA 3ZSYA 1CXQA 1QHTA 4HCBA 1IG9A 4CEAA 3ZT4A 3KLFA 3BDPA 1LW2A 1LWEA 2XY5A 3AVAA 3M8SA 4K8XA 4CECA 3HL8A 1TAQA 1KVAA 3AA3A 3MXJA 1RT2A 3C95A 3SCXA 4C8KA 4EZ6A 2D0AA 5CY4A 5C24A 3VQ7A 3ISNC 4BDYA 2O4GA 1NKEA 1IKXA 1HRHA 4FLWA 4AILC 1XHZA 4L8RB 3KTQA 3OVNA 3OYGA 1QTMA 4CF1A 1T03A 4NCBA 2ETJA 4KI6A 2KZZA 4E1NA 3HPHA 3AVIA 2DFHA 4DU1A 3ZT1A 4KHYA 1VSKA 3DLKA 2D0CA 3AO2A 3QEVA 3PX4A 3K58A 2EHGA 3ZSOA 4CHYA 4I9QA 4FJ9A 1KSPA 1S9GA 3ZSXA 2PY5A 4CHZA 3KJVA 3LAKA 1DTQA 3AO5A 4PA1A 3V81A 1XI1A 1YT3A 1SL2A 1YTUA 5J2PA 4B9UA 4IG3A 3L2WA 4DF8A 2W42A 4AHTA 4FJ7A 3KK3A 3IS9A 1S1WA 3AA5X 3AVMA 1U04A 4AHCA 4CJFA 4CK1A 4CGDA 4ZHRA 3AVLA 3F73A 4CFDA 3RRHA 2D5RA 4FJ8A 4CF9A 3VA0A 3LP0A 4H4OA 3HPOA 2YV0X 1JKHA 3LZJA 1IKWA 1W0HA 3F9KA 1UWBA 1RT6A 4KHSA 1WAFA 5K14A 3D45A 5KI6A 3OYAA 1VSLA 3P83D 2QXFA 2KFZA 1J9AA 4CJRA 1NJWA 4FJNA 1KFDA 1NK4A 4GMJB 3MECA 1HNIA 4FVMA 4KO0A 3ZSVA 4DSKA 1ITGA 2HHVA 3LPTA 2VG6A 3VQQA 4KRFA 4DQRA 4WE1A 3DRSA 1U45A 2FBXA 3SQ1A 1FXXA 4B9TA 3SZ2A 4M3UA 4B9SA 2DFFA 4NYNA 4CJWA 4H8KA 1RILA 2GV9A 1WLJA 1SKWA 2I5JA 4FZXC 4J2EA 1RDBA 1RCHA 3U3GA 4CHOA 4E19A 3QNOA 1NOZA 1VSMA 2KW4A 2X6NA 3LAMA 4MFBA 4BWMA 4W5OA 4CJEA 4DF4A 3TANA 3S9HA 3V4IA 2XY7A 2HVHA 3QEIA 1RTHA 4DTRA 2GBZA 2IC3A 2ZQBA 4MQ3A 3ASMA 3L3VA 2G8IA 1L3SA 5HLFA 1GOCA 4UQGA 4CHQA 3ITHA 2YNFA 2OZSA 5SWMA 3L3UA 1QS4A 3HT3A 5HBMA 1ZBUA 3ZSZA 3OYJA 3L2UA 4Z4IA 4CIEA 3KK2A 1TV6A 4N76A 4KTZA 1ZBIA 2RF2A 3VQCA 5J2MA 1NK9A 4RG8A 1JL2A 3VQDA 2IS3A 1U49A 2NUBA 3CFOA 4CEQA 4FM1A 1TKDA 3C6TA 3G0ZA 4HCCA 4KHNA 3KLEA 2HHSA 1LAWA 1N5YA 1WSIA 3NH1A 1KFSA 4DSJA 4TSXA 1JLFA 1VSIA 2VG5A 4YNQA 4DTSA 1S9EA 5FRMA 4E89A 3V1RA 1C1AA 2VG7A 3CM6A 2XO7A 4OLBA 2JLEA 3KKSA 4H4MA 4AHUA 3OS0A 3O3HA 3PX0A 3PO4A 4CEZA 3NH2A 4QOZB 5JS2A 4O0IA 3QINA 4XIUA 4FJKA 5HRSA 3PV8A 3OYEA 1VSEA 3S3OA 4ID1A 4I7FA 1VSFA 5J1EA 1X9MA 3SNNA 1Q9XA 1RT5A 3LP2A 3CG7A 4C8LA 4CJQA 3PY8A 4OKKA 4OPJA 4LY7A 1RT7A 3KKRA 2AJQA 3G10A 4BDZA 1HQEA 1I3AA 3PUFA 4FM2A 4DQIA 3OYDA 5D3GA 1NK0A 1IO2A 2YKNA 1RBUA 3ZT0A 4BE1A 3SV3A 3V6DA 3TAPA 4KPYA 2HHUA 2GUIA 4OJRA 4KHUA 1A5XA 3P1GA 3TAGA 1KRPA 3QIPA 1C0UA 4E7IA 3QNNA 2OA8A 1BCOA 5KRSA 3DLBA 4KB1A 2LSNA 1IKYA 4Q5VA 3AV9A 3VQEA 4BE2A 2HHQA 4F4KA 4W5NA 4LH5A 4FJHA 1DTTA 3NGZA 4KREA 1C1CA 5J2NA 1BQNA 2OPPA 1WSHA 3ZSWA 2Y1IA 4G1QA 4Z0UA 2P51A 3CYMA 3FFIA 1G15A 4CIGA 1NJZA 1RDDA 3K57A 4DSFA 3K5OA 3JSMA 3OYFA 3OS1A 2PYLA 1TK5A 5FDLA 2E4LA 3SUNA 2A1SA 2KQ2A 2OPSA 1REVA 2HHXA 2ZE2A 3H08A 3QESA 4F8RA 4CIFA 4Q0BA 2HB5A 3RWUA 1S1TA 3LALA 3SQ0A 3HSTB 2IAJA 4Z4HA 4CEBA 3LWLA 4KHWA 3L2RA 4DG1A 1XHXA 3QIOA 5E41A 3HYFA 2RPIA 4LSLA 4DU4A 4FJMA 3TARA 1X1PA 3MEEA 1JLGA 1Q8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KB0 A;  4DQS A;  1WN7 A;  4NCA A;  4M3R A;  3VQB A;  1QSS A;  2RN2 A;  1S1V A;  3SYZ A;  1NJX A;  5HRN A;  4IBN A;  5SZT A;  3EYZ A;  3AVB A;  3MEG A;  3O3G A;  4FK0 A;  3NAE A;  3OY9 A;  1TK8 A;  2PZS A;  1TKZ A;  2OYQ A;  1NK6 A;  4IFV A;  1HYS A;  1TK0 A;  3TAQ A;  3C94 A;  1LW0 A;  1ZBF A;  1T7P A;  1I39 A;  3NF8 A;  3LP1 A;  3SI6 A;  3U6F A;  2P5G A;  3I8D A;  3HO1 A;  4E7K A;  3KIO A;  4CEE A;  4CJV A;  4I2P A;  3MAQ A;  1IKV A;  2YNH A;  3TR8 A;  3JYT A;  3ULD A;  5JS1 A;  4HUE A;  2X78 A;  4DQP A;  2Q3S A;  2BGG A;  4Z4G A;  1KVC A;  2BE2 A;  4DMN A;  4PQU A;  4DFP A;  4BE0 A;  3VQ6 A;  2E6M A;  4KFB A;  3OYK A;  1NOY A;  1WAJ A;  4OGE A;  4HUG A;  4B9V A;  4Z4F A;  4E0D A;  1RBR A;  1BI4 B;  3HVT A;  3OJS A;  4FM0 A;  2G8W A;  3L8B A;  5C42 A;  1BIS A;  4Y1D A;  4B9M A;  3HVR A;  3QEP A;  3MED A;  4CE9 A;  4C8M A;  4N47 A;  1HMV A;  4R5P A;  1SUQ A;  4FK2 A;  4GW6 A;  4CF0 A;  3QER A;  4DTJ A;  4J2A A;  2HND A;  1O1W A;  1HQU A;  2ATQ A;  2YKM A;  2Z1I A;  5HRR A;  3L2V A;  3HXM A;  1L5U A;  4PWD A;  3OYC A;  4I9L A;  1BIU A;  2WON A;  2YNI A;  2Z1G A;  3LDS A;  4KKO A;  4RW8 A;  4DSE A;  1RT3 A;  3ZSR A;  2FBV A;  1D9F A;  3LWM A;  3V9X A;  4N56 A;  1T05 A;  4RW9 A;  3VQ8 A;  5CYM A;  3TAF A;  1X9W A;  2DTU A;  4ID5 A;  2WOM A;  4W5R A;  4F2R A;  4IKF A;  2A1R A;  3K5N A;  4Z4E A;  2YHB A;  3TAE A;  1UA0 A;  1C1B A;  3SUQ A;  4N41 A;  1LWC A;  4M45 A;  4FLT A;  4OKJ A;  5KRT A;  3B6P A;  1FKO A;  1S1X A;  4CES A;  4LSN A;  1BIZ A;  3V9U A;  4CEF A;  1UAX A;  4N5S A;  3O4N A;  4I2Q A;  5EU7 A;  4LD0 A;  3T3F A;  4BWJ A;  3RRG A;  2KFN A;  4CJP A;  3VQ4 A;  4FLU A;  1JXB A;  1F21 A;  1VSJ A;  3ALY A;  3T19 A;  4IDK A;  4CHP A;  1KVB A;  4BDP A;  3TAB A;  4KHQ A;  4CCH A;  2P5O A;  1D5A A;  1WSF A;  1Z25 A;  2IGI A;  3E01 A;  1CZ9 A;  2IOC A;  4M41 A;  3VQP A;  3ZT2 A;  3CFR A;  1ZBL A;  1D9D A;  3AVG A;  2YNG A;  3DI6 A;  1HYV A;  4CJS A;  3ZCM A;  1EP4 A;  1KCF A;  4IFY A;  3WNE A;  3NH0 A;  3KD5 E;  3K5M A;  1W9H A;  3TI0 A;  3RMA A;  3AVF A;  1CLQ A;  1RBS A;  2F8T A;  4CJL A;  1A5V A;  4HTU A;  4FCY A;  3MXM A;  4DTU A;  5KTQ A;  2EX3 A;  1VSH A;  1KTQ A;  1RBT A;  1TL3 A;  3HP9 A;  3AO4 A;  4NCG A;  3T1A A;  4CED A;  1JXE A;  3KK1 A;  4CFA A;  4QAG A;  4E1M A;  4FLY A;  1RTJ A;  3UIQ A;  4KAZ A;  1QE1 A;  4B9L A;  4FJX A;  1LAV A;  1S6Q A;  3DYA A;  2XY6 A;  2G8K A;  2KZM A;  3RR8 A;  1DLO A;  2DFE A;  4IG0 A;  3OYI A;  4CFC A;  5T7B A;  2G8U A;  2HMI A;  1B9F A;  1RT1 A;  3KLG A;  3NDK A;  1Y97 A;  1LV5 A;  1EET A;  3AO3 A;  1HNV A;  4E3S A;  4DLE A;  3HJF A;  3D0P A;  1S1U A;  1SKS A;  1ASV A;  3I0S A;  3QO9 A;  2OPQ A;  2B6A A;  3DMJ A;  1S5J A;  4OVL A;  4AHS A;  1RTI A;  4CHN A;  4DSI A;  1S6P A;  3P5J A;  3DLR A;  3DOK A;  3OS2 A;  1RT4 A;  4DFK A;  1ZYQ A;  2VWJ A;  1VK0 A;  5DMR A;  2Y1J A;  2HHT A;  1ASU A;  3SPZ A;  3OYM A;  3ZSQ A;  3SJJ A;  3V9W A;  4B8A B;  1JLB A;  4ICL A;  4KTW A;  4DQQ A;  3WNH A;  3AVH A;  3O4Q A;  3S3M A;  2G8F A;  3QLH A;  2KTQ A;  3CQ8 A;  1JL1 A;  3OJU A;  1J53 A;  4DWI A;  3B6O A;  4FYD A;  4CEO A;  3WNG A;  1TKT A;  4OKE A;  1CZB A;  4M42 A;  2FC0 A;  3M8P A;  4HUF A;  4FZZ A;  1TAU A;  4W5Q A;  1BL3 A;  2X6S A;  1RNH A;  2F96 A;  3O3F A;  3TAM A;  4Z4C A;  3K5L A;  4B9N A;  4QCL A;  2HHW A;  2HNZ A;  4HHT A;  4ELU A;  3A2F A;  3NF9 A;  1WSE A;  2B5J A;  2HNY A;  4ELT A;  1ZBH A;  4E7J A;  1C0T A;  5CYQ A;  4FJL A;  3AVC A;  3TWH A;  3LPU A;  4O55 A;  4FJ5 A;  1XWL A;  4RW7 A;  1HPZ A;  1XC9 A;  4FZY A;  1WSJ A;  1J54 A;  1RDC A;  3NGI A;  3EY1 A;  4JLH A;  5J2Q A;  2F8S A;  4KV8 A;  1SL0 A;  4M3Z A;  3DLH A;  3AA4 A;  4BAC A;  3THV A;  4KTQ A;  3DRP A;  1NKB A;  3S3N A;  1SKR A;  1B9D A;  1RBV A;  2D0B A;  4RW4 A;  3OYN A;  3M8R A;  3V9Z A;  2ITG A;  4C8N A;  2B4J A;  1Q9Y A;  4JS5 A;  1YVU A;  2FBT A;  2QK9 A;  2PYJ A;  2XY8 A;  4DFJ A;  4YFU A;  4DS4 A;  4FJI A;  1TKX A;  5CZ2 A;  4EZ9 A;  4CJK A;  3NCI A;  3SUO A;  1KLN A;  2G8V A;  2IDO A;  4B8C A;  4E7L A;  3I0R A;  1A5W A;  3VA3 A;  4DTO A;  5KGW A;  4ZTJ A;  3V1Q A;  1SL1 A;  1JLQ A;  3VN5 A;  3MXI A;  4CGG A;  2X74 A;  4DFM A;  4F2S A;  1VRU A;  4J2B A;  1RTD A;  4PUO A;  3K59 A;  1IH7 A;  4B3O A;  3K2P A;  1TVR A;  1NK7 A;  1L3T A;  3V9S A;  1NK8 A;  2BDP A;  4PY5 A;  2HW3 A;  1JLA A;  1RDA A;  1Z26 A;  4ZTF A;  1NKC A;  3DM2 A;  4AHV A;  5FRO A;  1T8E A;  3KD1 E;  3EZ5 A;  3IAY A;  3V1O A;  5HP1 A;  1TGO A;  3DOL A;  2XHB A;  4FLV A;  3SQ2 A;  3SV4 A;  1TL1 A;  1EKE A;  2O4I A;  2P1J A;  4Y1C A;  3DLG A;  3SQ4 A;  2OPR A;  1GOA A;  4CF8 A;  3U3Y A;  1WNS A;  1L3V A;  4OPK A;  1QSY A;  4O4G A;  4DLG A;  4CGI A;  3QEX A;  4CJU A;  2Z1J A;  4HVJ A;  3QET A;  4CJT A;  4FW2 A;  4AH9 A;  4FJJ A;  1NJY A;  3BGR A;  3OYB A;  3SUP A;  1QQC A;  4RW6 A;  3LP3 A;  3NGY A;  4EP5 A;  3HP6 A;  3DRR A;  3VQ5 A;  5KGX A;  3RR7 A;  1JLC A;  1U48 A;  4KI4 A;  5C25 A;  4K8Z A;  4DTX A;  4M3T A;  3NHG A;  4DS5 A;  3LAN A;  4B08 A;  3QEW A;  2R7Y A;  1VRT A;  4CGJ A;  1UA1 A;  3AVN A;  5HRP A;  1X9S A;  4CJ5 A;  1U47 A;  3RMB A;  1B92 A;  3NF6 A;  3ZT3 A;  3KLH A;  3AVK A;  1CXU A;  4O44 A;  2ZD1 A;  3KLI A;  4GVM A;  1EX4 A;  3VQA A;  4F3O A;  3IG1 A;  4CFB A;  5FRN A;  2DY4 A;  3OYL A;  1QSL A;  1BQM A;  4CGH A;  1NK5 A;  1JLE A;  1FKP A;  4AHR A;  4DTP A;  4FLZ A;  4O0J A;  3CM5 A;  2QKB A;  4W5T A;  4C8O A;  2G8H A;  1BI4 A;  3RMC A;  1ASW A;  3IRX A;  4FXD A;  3AO1 A;  1MU2 A;  1L3U A;  2HVI A;  4J2D A;  3AA2 A;  1N6Q A;  2XRI A;  3CFP A;  4JRP A;  4FK4 A;  3L2Q A;  3PO5 A;  1EXQ A;  4CK2 A;  1K6Y A;  1J5O A;  3VQ9 A;  2VWK A;  1UOC A;  4OGC A;  2RKI A;  4JRQ A;  1SV5 A;  1KLM A;  2BAN A;  4DTM A;  3HK2 A;  3OYH A;  3M8Q A;  4CK3 A;  5I3U A;  3AVJ A;  4DSL A;  3SPY A;  2QKK A;  1C0M A;  3NE6 A;  4ELV A;  4CJ4 A;  1HYZ A;  4FJG A;  2FBY A;  4EP4 A;  3C6U A;  1HJR A;  4DU3 A;  1VSD A;  3RTV A;  2JGU A;  5I42 A;  1U4B A;  4O5B A;  2OZM A;  1YTA A;  1BCM A;  1FK9 A;  4F3T A;  3RMD A;  3DLE A;  1GOB A;  2E6L A;  4CF2 A;  4DTN A;  2Z1H A;  4LH4 A;  5DK5 A;  2YHA A;  1LWF A;  3NBP A;  3WNF A;  1BGX T;  3NFA A;  4CJ3 A;  1R0A A;  3HM9 A;  4NYF A;  4JS4 A;  4FLX A;  4M3W A;  3NF7 A;  4FW1 A;  4E7H A;  3PX6 A;  5HRO A;  1BHL A;  1C6V A;  3HPG A;  5CZ1 A;  4CER A;  1D8Y A;  4CGF A;  4M3X A;  3LZI A;  4M3Y A;  4OLA A;  1WSG A;  3ZSY A;  1CXQ A;  1QHT A;  4HCB A;  1IG9 A;  4CEA A;  3ZT4 A;  3KLF A;  3BDP A;  1LW2 A;  1LWE A;  2XY5 A;  3AVA A;  3M8S A;  4K8X A;  4CEC A;  3HL8 A;  1TAQ A;  1KVA A;  3AA3 A;  3MXJ A;  1RT2 A;  3C95 A;  3SCX A;  4C8K A;  4EZ6 A;  2D0A A;  5CY4 A;  5C24 A;  3VQ7 A;  3ISN C;  4BDY A;  2O4G A;  1NKE A;  1IKX A;  1HRH A;  4FLW A;  4AIL C;  1XHZ A;  4L8R B;  3KTQ A;  3OVN A;  3OYG A;  1QTM A;  4CF1 A;  1T03 A;  4NCB A;  2ETJ A;  4KI6 A;  2KZZ A;  4E1N A;  3HPH A;  3AVI A;  2DFH A;  4DU1 A;  3ZT1 A;  4KHY A;  1VSK A;  3DLK A;  2D0C A;  3AO2 A;  3QEV A;  3PX4 A;  3K58 A;  2EHG A;  3ZSO A;  4CHY A;  4I9Q A;  4FJ9 A;  1KSP A;  1S9G A;  3ZSX A;  2PY5 A;  4CHZ A;  3KJV A;  3LAK A;  1DTQ A;  3AO5 A;  4PA1 A;  3V81 A;  1XI1 A;  1YT3 A;  1SL2 A;  1YTU A;  5J2P A;  4B9U A;  4IG3 A;  3L2W A;  4DF8 A;  2W42 A;  4AHT A;  4FJ7 A;  3KK3 A;  3IS9 A;  1S1W A;  3AA5 X;  3AVM A;  1U04 A;  4AHC A;  4CJF A;  4CK1 A;  4CGD A;  4ZHR A;  3AVL A;  3F73 A;  4CFD A;  3RRH A;  2D5R A;  4FJ8 A;  4CF9 A;  3VA0 A;  3LP0 A;  4H4O A;  3HPO A;  2YV0 X;  1JKH A;  3LZJ A;  1IKW A;  1W0H A;  3F9K A;  1UWB A;  1RT6 A;  4KHS A;  1WAF A;  5K14 A;  3D45 A;  5KI6 A;  3OYA A;  1VSL A;  3P83 D;  2QXF A;  2KFZ A;  1J9A A;  4CJR A;  1NJW A;  4FJN A;  1KFD A;  1NK4 A;  4GMJ B;  3MEC A;  1HNI A;  4FVM A;  4KO0 A;  3ZSV A;  4DSK A;  1ITG A;  2HHV A;  3LPT A;  2VG6 A;  3VQQ A;  4KRF A;  4DQR A;  4WE1 A;  3DRS A;  1U45 A;  2FBX A;  3SQ1 A;  1FXX A;  4B9T A;  3SZ2 A;  4M3U A;  4B9S A;  2DFF A;  4NYN A;  4CJW A;  4H8K A;  1RIL A;  2GV9 A;  1WLJ A;  1SKW A;  2I5J A;  4FZX C;  4J2E A;  1RDB A;  1RCH A;  3U3G A;  4CHO A;  4E19 A;  3QNO A;  1NOZ A;  1VSM A;  2KW4 A;  2X6N A;  3LAM A;  4MFB A;  4BWM A;  4W5O A;  4CJE A;  4DF4 A;  3TAN A;  3S9H A;  3V4I A;  2XY7 A;  2HVH A;  3QEI A;  1RTH A;  4DTR A;  2GBZ A;  2IC3 A;  2ZQB A;  4MQ3 A;  3ASM A;  3L3V A;  2G8I A;  1L3S A;  5HLF A;  1GOC A;  4UQG A;  4CHQ A;  3ITH A;  2YNF A;  2OZS A;  5SWM A;  3L3U A;  1QS4 A;  3HT3 A;  5HBM A;  1ZBU A;  3ZSZ A;  3OYJ A;  3L2U A;  4Z4I A;  4CIE A;  3KK2 A;  1TV6 A;  4N76 A;  4KTZ A;  1ZBI A;  2RF2 A;  3VQC A;  5J2M A;  1NK9 A;  4RG8 A;  1JL2 A;  3VQD A;  2IS3 A;  1U49 A;  2NUB A;  3CFO A;  4CEQ A;  4FM1 A;  1TKD A;  3C6T A;  3G0Z A;  4HCC A;  4KHN A;  3KLE A;  2HHS A;  1LAW A;  1N5Y A;  1WSI A;  3NH1 A;  1KFS A;  4DSJ A;  4TSX A;  1JLF A;  1VSI A;  2VG5 A;  4YNQ A;  4DTS A;  1S9E A;  5FRM A;  4E89 A;  3V1R A;  1C1A A;  2VG7 A;  3CM6 A;  2XO7 A;  4OLB A;  2JLE A;  3KKS A;  4H4M A;  4AHU A;  3OS0 A;  3O3H A;  3PX0 A;  3PO4 A;  4CEZ A;  3NH2 A;  4QOZ B;  5JS2 A;  4O0I A;  3QIN A;  4XIU A;  4FJK A;  5HRS A;  3PV8 A;  3OYE A;  1VSE A;  3S3O A;  4ID1 A;  4I7F A;  1VSF A;  5J1E A;  1X9M A;  3SNN A;  1Q9X A;  1RT5 A;  3LP2 A;  3CG7 A;  4C8L A;  4CJQ A;  3PY8 A;  4OKK A;  4OPJ A;  4LY7 A;  1RT7 A;  3KKR A;  2AJQ A;  3G10 A;  4BDZ A;  1HQE A;  1I3A A;  3PUF A;  4FM2 A;  4DQI A;  3OYD A;  5D3G A;  1NK0 A;  1IO2 A;  2YKN A;  1RBU A;  3ZT0 A;  4BE1 A;  3SV3 A;  3V6D A;  3TAP A;  4KPY A;  2HHU A;  2GUI A;  4OJR A;  4KHU A;  1A5X A;  3P1G A;  3TAG A;  1KRP A;  3QIP A;  1C0U A;  4E7I A;  3QNN A;  2OA8 A;  1BCO A;  5KRS A;  3DLB A;  4KB1 A;  2LSN A;  1IKY A;  4Q5V A;  3AV9 A;  3VQE A;  4BE2 A;  2HHQ A;  4F4K A;  4W5N A;  4LH5 A;  4FJH A;  1DTT A;  3NGZ A;  4KRE A;  1C1C A;  5J2N A;  1BQN A;  2OPP A;  1WSH A;  3ZSW A;  2Y1I A;  4G1Q A;  4Z0U A;  2P51 A;  3CYM A;  3FFI A;  1G15 A;  4CIG A;  1NJZ A;  1RDD A;  3K57 A;  4DSF A;  3K5O A;  3JSM A;  3OYF A;  3OS1 A;  2PYL A;  1TK5 A;  5FDL A;  2E4L A;  3SUN A;  2A1S A;  2KQ2 A;  2OPS A;  1REV A;  2HHX A;  2ZE2 A;  3H08 A;  3QES A;  4F8R A;  4CIF A;  4Q0B A;  2HB5 A;  3RWU A;  1S1T A;  3LAL A;  3SQ0 A;  3HST B;  2IAJ A;  4Z4H A;  4CEB A;  3LWL A;  4KHW A;  3L2R A;  4DG1 A;  1XHX A;  3QIO A;  5E41 A;  3HYF A;  2RPI A;  4LSL A;  4DU4 A;  4FJM A;  3TAR A;  1X1P A;  3MEE A;  1JLG A;  1Q8I A; 
#chains in the Genus database with same CATH topology
 1NBW A;  3WXI A;  4GNI A;  3VQB A;  2RN2 A;  5HRN A;  4IBN A;  2OYQ A;  4NLB A;  1LW0 A;  1I39 A;  1NMD A;  3I56 N;  3A5O C;  3KIO A;  5CR4 A;  3ULD A;  3A5N C;  4DKW A;  3CC4 N;  3U8X A;  2IIR A;  1KVC A;  3OBY A;  4M7X A;  1M90 O;  4BE0 A;  2E6M A;  3OYK A;  3HVT A;  1BA1 A;  3OJS A;  5C42 A;  5EVZ A;  4Y1D A;  3CCJ N;  1YJ9 N;  4B9M A;  3HTV A;  2F9T A;  2UUA K;  2GEL A;  4N47 A;  5AQK A;  5IWA K;  4J2A A;  5HRR A;  1HQU A;  4CVN E;  3L2V A;  1VAZ A;  3M6G A;  1BIU A;  2WON A;  2YNI A;  2VWB A;  1T05 A;  2DTU A;  4N56 A;  3C7N A;  3VQ8 A;  5CYM A;  1X9W A;  2RE2 A;  4JKA A;  4W5R A;  4F2R A;  4IKF A;  2A1R A;  3ENB A;  2YHB A;  1UA0 A;  1VQ6 N;  1C1B A;  1LWC A;  2IVP A;  4FLT A;  4CES A;  3V9U A;  3SLC A;  1UAX A;  3O4N A;  4JHD A;  1E4F T;  4BR5 A;  4ILH A;  1HKB A;  1WB9 A;  3VQ4 A;  4LF8 K;  4LC9 B;  2P9P A;  1VSJ A;  3EE9 A;  2QWL A;  3HOS A;  4BDP A;  2NRR A;  1D5A A;  3CFR A;  2IGI A;  1ZBL A;  1CZ9 A;  4L3Q A;  4HWI A;  3UB5 A;  1S72 N;  4FWQ A;  3NH0 A;  3WEE B;  1U2V B;  4ILJ A;  3PLA A;  1CLQ A;  4JKB A;  4CZK A;  4HTU A;  4FCY A;  4DV2 K;  2HHH K;  1RBT A;  1TL3 A;  3AO4 A;  3HI0 A;  4CED A;  3KK1 A;  3AAQ A;  4QAG A;  4CFA A;  4E1M A;  2E5L K;  4B9L A;  2O8D B;  1O13 A;  3D2E B;  3QML A;  2DFE A;  4IG0 A;  3UKR B;  2G8U A;  3SAH A;  4B1V A;  3KLG A;  5AQW A;  4KH5 A;  3PIP L;  3HJF A;  3D0P A;  1S1U A;  1SKS A;  3I0S A;  3K9J A;  1ZBS A;  2I7P A;  3H46 O;  4AQY K;  4DSI A;  3P5J A;  2JWL A;  3DLR A;  3DOK A;  3OS2 A;  3FZL A;  2HHT A;  3SPZ A;  4DQQ A;  4KTW A;  3AVH A;  3O4Q A;  3HZ6 A;  5BPN A;  1ATS A;  3OJU A;  3VET A;  4DWI A;  4IDH A;  3DXK A;  4FYD A;  1TKT A;  4H0Y B;  4M42 A;  2HF3 A;  3M8P A;  4W5Q A;  1BL3 A;  4Z4C A;  4HHT A;  4JI0 K;  1RDU A;  4ELT A;  1ZBH A;  1I94 K;  3CJ7 A;  3DJC A;  4FJL A;  3TWH A;  4DV3 K;  4FJ5 A;  1XWL A;  1WSJ A;  1RDC A;  4KHP K;  4JLH A;  5J2Q A;  5ADX A;  5LJW A;  4BAC A;  3SBT A;  4C1N I;  3O8M A;  1BUP A;  3OYN A;  3M8R A;  2ITG A;  3EN9 A;  1N36 K;  4EZ9 A;  4XEI A;  1GLJ O;  3K0S A;  5AZI A;  4FWS A;  4MDB A;  2P9I B;  3Q7B A;  4DTO A;  4H5N A;  3O9U A;  2CGK A;  1JLQ A;  1SL1 A;  2E2P A;  2UXC K;  4F2S A;  4J2B A;  1TVR A;  3FLC O;  1L3T A;  2BDP A;  3AAR A;  4FOI A;  4ZTF A;  3DM2 A;  1NGC A;  5FRO A;  3KD1 E;  4H03 B;  5HP1 A;  2XHB A;  1HNX K;  4IWV A;  2P1J A;  3SQ4 A;  1GOA A;  2Q36 A;  2UUC K;  1QSY A;  1VQ9 N;  4DLG A;  3QEX A;  2Z1J A;  2F4V K;  1X3M A;  4FJJ A;  4FW2 A;  1NJY A;  3OYB A;  1QQC A;  4RW6 A;  4FWP A;  5HOO A;  2ZGZ A;  4H5W A;  5LJV A;  1VRT A;  1N32 K;  1E4G T;  3NF6 A;  3QFU A;  3AVK A;  1CXU A;  3FZH A;  3CPW M;  3TTD A;  1KAY A;  2Q0R A;  5FRN A;  2DY4 A;  1QSL A;  3KZB A;  4GVE A;  1FKP A;  4FLZ A;  3U4L A;  2QKB A;  4W5T A;  3O6W A;  1BI4 A;  3IRX A;  5H1S Q;  3CCQ N;  2J4R A;  1VQ4 N;  2ITM A;  4DQ8 A;  4I6M A;  3L2Q A;  1EXQ A;  4BR2 A;  1E3M A;  3H45 C;  4IJA A;  3SPY A;  1C0M A;  3NE6 A;  4ELV A;  3G4S N;  1T6D A;  1HJR A;  3L6Q A;  4DU3 A;  5BR8 K;  5BPL A;  1YTA A;  4CZE A;  3QFP A;  4F3T A;  4DTN A;  2Q2R A;  4BRG A;  5DK5 A;  1LWF A;  3NFA A;  4M3W A;  4JS4 A;  4NYF A;  3DXM A;  1C6V A;  2EWS A;  4CER A;  4M3X A;  3LZI A;  4M3Y A;  4M63 C;  4OLA A;  3VGL A;  4HCB A;  4CEA A;  3ZT4 A;  5C12 A;  1LWE A;  2XY5 A;  4K8X A;  4GKK K;  3N4Q A;  1NNE A;  3MXJ A;  1RT2 A;  2ZM6 K;  1G99 A;  2P9I A;  5CY4 A;  1SS6 A;  1RFQ A;  4BDY A;  2O4G A;  2QTD A;  1WOQ A;  1YIT N;  3BEX A;  2NRX A;  3FZF A;  2WBN A;  4KI6 A;  4DUY K;  5LY3 A;  4KHY A;  1VSK A;  1IG8 A;  3QEV A;  2EHG A;  4I9Q A;  1KSP A;  1S9G A;  3ZSX A;  2E8A A;  3LAK A;  3GL1 A;  1NG9 A;  4IG3 A;  3VF2 A;  4FJ7 A;  1S1W A;  2NNW A;  4ZHR A;  2P9N B;  5FPM A;  4BC5 A;  3L0Q A;  3LP0 A;  1NGB A;  2VQE K;  3F9K A;  1BU6 O;  3OYA A;  2FF6 A;  3D45 A;  4GKJ K;  4K43 A;  3ATV A;  1CZA N;  3VEO A;  4CJR A;  4FJN A;  3MN6 A;  1NK4 A;  5JIC A;  4CBW A;  4DSK A;  2HHV A;  5BR9 A;  4DQR A;  5AQF A;  3ID8 A;  4B9T A;  5AQX A;  1WLJ A;  4BG8 A;  1RCH A;  4E19 A;  1NOZ A;  2KW4 A;  3O1W A;  5KQD A;  4DV5 K;  4CJE A;  4BR4 A;  4DTR A;  1NGJ A;  1BO5 O;  4MQ3 A;  3ASM A;  2G8I A;  1L3S A;  3OTO K;  3T7Z A;  4CHQ A;  1YI2 N;  1EWR A;  4X64 K;  1D4X A;  2D0P A;  2FF3 B;  4CIE A;  2AP1 A;  3EKU A;  3VQC A;  5J2M A;  1JL2 A;  3H1V X;  3H1Q A;  2IS3 A;  1U49 A;  3SMS A;  3CFO A;  1TKD A;  4UY8 O;  3VPZ A;  4KHN A;  3VF4 A;  1WSI A;  4DSJ A;  1K9M O;  4YNQ A;  3U9D A;  2QWM A;  3CM6 A;  2JLE A;  4AHU A;  3J8A A;  3O3H A;  4A2B A;  2A41 A;  2NRV A;  3OYE A;  4CJ7 A;  3MCP A;  5J1E A;  1X9M A;  5AQU A;  3FZM A;  3GG4 A;  5C15 A;  3PY8 A;  4OPJ A;  2O8E B;  2QXL A;  3A8Y A;  3E66 A;  2AJQ A;  3G10 A;  3T1H K;  4DQI A;  5D3G A;  4EAH D;  1RBU A;  4BE1 A;  5F1X A;  3SV3 A;  2GUI A;  4BRI A;  3P1G A;  1S3X A;  4E7I A;  4KB1 A;  4Q5V A;  3HSC A;  2D4W A;  4LH5 A;  5C10 A;  4KRE A;  3JXU A;  1DT9 A;  5BRF A;  4A57 A;  5E26 A;  3ZSW A;  2ASP A;  2P51 A;  3CYM A;  4CIG A;  1RDD A;  1KAX A;  3OYF A;  4K0K K;  1JCE A;  2A1S A;  1REV A;  3THY B;  1QVG M;  2HHX A;  3IDH A;  4CIF A;  4IOC L;  2HB5 A;  2NZT A;  3RWU A;  3LAL A;  2CGJ A;  3WUH A;  4DU4 A;  2NRT A;  3TAR A;  3MEE A;  2CGL A;  1QSS A;  4NB4 A;  5SZT A;  3EYZ A;  2E1Z A;  1R59 O;  1TKZ A;  1NK6 A;  3C0B A;  1V4T A;  3QBW A;  1T7P A;  1XC3 A;  3LP1 A;  1JCF A;  3CQY A;  4E7K A;  2UUB K;  4CEE A;  3MAQ A;  3JYT A;  5M1F A;  1NGA A;  4HUE A;  3J7Y P;  1YHQ N;  2QWP A;  4CZI A;  3VQ6 A;  4KFB A;  2A3Z A;  4OGE A;  4B9V A;  4Z4F A;  4E0D A;  4FM0 A;  2HOE A;  1EQY A;  3MED A;  4CE9 A;  4C8M A;  2PAV A;  4DTJ A;  2A5X A;  3G71 N;  1HJO A;  2D1K A;  3HXM A;  2V7Z A;  1W2B M;  3LDS A;  4BRO A;  1RT3 A;  3ZSR A;  2FBV A;  3LWM A;  1W7A A;  3TSP A;  4ID5 A;  5C2F A;  2WOM A;  4Z4E A;  4N41 A;  3SUQ A;  4JKH A;  4LSN A;  4I2Q A;  4LD0 A;  3RRG A;  3CF5 L;  4JKE A;  1F21 A;  1DGK N;  5GIP A;  3ALY A;  5MLC Q;  1WSF A;  3VQP A;  3VEN A;  3ZT2 A;  2IOC A;  3WXL A;  2WFB A;  3EKS A;  2YNG A;  3BZC A;  2P9L A;  4LFC K;  3KK7 A;  3EO3 A;  4CJS A;  1EP4 A;  3RMA A;  1RDW X;  1XMO K;  2F8T A;  1A5V A;  5JVH L;  3F9M A;  4WFA L;  4B3R K;  5KTQ A;  2EX3 A;  1VSH A;  3HP9 A;  5FLX O;  4NCG A;  4PL7 A;  3GE1 A;  3UIQ A;  1RTJ A;  4FJX A;  1QE1 A;  4JD2 B;  1LAV A;  3DYA A;  4DV6 K;  1T6C A;  2HST A;  1DLO A;  4C1N K;  3RR8 A;  4CFC A;  4JKC A;  5T7B A;  4IJN A;  1B9F A;  5M1Q A;  2YJE A;  5M1K A;  2QA4 N;  4E3S A;  3AGK A;  3QO9 A;  2B6A A;  3DMJ A;  1S5J A;  4AHS A;  3LM2 A;  1S6P A;  3SJH A;  4MDA A;  1RT4 A;  4DFK A;  1HPM A;  2VWJ A;  5DMR A;  3ZSQ A;  3SJJ A;  1JLB A;  4ICL A;  3S3M A;  1XQS C;  2G8F A;  3QLH A;  1DEJ A;  2KTQ A;  3CQ8 A;  1GLL O;  4OKE A;  5AQM A;  1GLD G;  1TAU A;  4HUF A;  2O8F A;  4NO7 A;  4QCL A;  3RVC A;  4CZM A;  4ELU A;  1YF5 L;  3A2F A;  4E7J A;  4A62 A;  1C0T A;  1IBK K;  3CC7 N;  3NGI A;  3EY1 A;  2FSN A;  4YOR A;  1SL0 A;  4GV3 A;  4M3Z A;  4PKG A;  3DLH A;  3AA4 A;  3G6E N;  1JCG A;  4KTQ A;  2KKZ A;  4FVU A;  3DRP A;  1NKB A;  3S3N A;  4ISG A;  3THX A;  5BRD A;  1Q9Y A;  4RW4 A;  3EEQ A;  4JK8 A;  1XUP O;  2B4J A;  1W97 L;  4JS5 A;  4PHT X;  2QK9 A;  5AQO A;  2PYJ A;  2XY8 A;  4JKG B;  3DWL A;  2QWQ A;  4DS4 A;  1T44 A;  5CZ2 A;  4WCE L;  2YHY A;  4IEE A;  3SUO A;  3CPE A;  4LFB K;  2G8V A;  3O08 A;  2P9U B;  4E7L A;  3I0R A;  1A5W A;  5KGW A;  4IO8 A;  3D2E A;  3MXI A;  3UKR A;  1XMQ K;  4PUO A;  2Q97 A;  1IH7 A;  1TUY A;  5CHI A;  1NK8 A;  3VEW A;  1KAZ A;  1RDA A;  2P9K B;  2YX6 A;  1NKC A;  4AHV A;  3EZ5 A;  3IAY A;  3V1O A;  1TGO A;  5I9E B;  5AZJ A;  3SV4 A;  3SQ2 A;  4BRE A;  2OTL N;  3DLG A;  2OPR A;  4CF8 A;  1WNS A;  2RHK A;  4O4G A;  4CGI A;  1OKJ A;  3ZLJ A;  4BRH A;  3NGY A;  3HP6 A;  3DRR A;  3VQ5 A;  4WQ5 A;  5KGX A;  3RR7 A;  3LDL A;  4FO0 A;  4K8Z A;  3BZK A;  4DTX A;  4LF7 K;  3WXM B;  1IJJ A;  5C0Y A;  4JNE A;  3ZYY X;  4NXN K;  1ESV A;  1UA1 A;  3WXK A;  3AVN A;  3TSU A;  5HRP A;  1X9S A;  4CJ5 A;  4OO1 J;  1GLA G;  3KLH A;  3ZT3 A;  2ZD1 A;  4GVM A;  4OPA A;  5BN9 A;  3VTH A;  3IG1 A;  4CFB A;  2PBD A;  1BQM A;  3MX5 A;  4CGH A;  4DTP A;  1NK5 A;  3CM5 A;  4C8O A;  2G8H A;  2UU9 K;  3KWI A;  2HVI A;  4J2D A;  3AA2 A;  3C65 A;  2XRI A;  3CFP A;  4JRP A;  3VEX A;  1K6Y A;  2E2O A;  1J5O A;  2OTJ N;  4CD1 A;  2VWK A;  3CER A;  1UOC A;  4RCH A;  4BGB A;  2RKI A;  3O9R A;  1SZ2 A;  4C23 A;  3AVJ A;  4BRD A;  2QKK A;  3VGK A;  1HYZ A;  2FBY A;  3E9O A;  5B8H A;  1VSD A;  2NRW A;  2JGU A;  3RTV A;  5I42 A;  2HBM A;  2OZM A;  3RMD A;  3DLE A;  4PKI A;  4H0T B;  4Z94 A;  4LH4 A;  3NBP A;  4DR7 K;  4JN4 A;  1BGX T;  3HM9 A;  1TUU A;  3NF7 A;  4FW1 A;  4E7H A;  3HPG A;  4IXC A;  5CZ1 A;  1HNW K;  1D8Y A;  2D0O A;  1WSG A;  2ZJR L;  3A5M C;  3J81 O;  1IG9 A;  3BDP A;  3KLF A;  3EL2 A;  2FXU A;  1TAQ A;  1KVA A;  3M1F A;  3SCX A;  3UKU A;  5AQT A;  5C24 A;  3HK2 A;  3G25 A;  1HRH A;  1XHZ A;  3OVN A;  3NVK A;  5GAD P;  4NCB A;  1Z05 A;  4E1N A;  4CZF A;  2DFH A;  1SQK A;  3ZT1 A;  1VQL N;  3DLK A;  5C2D A;  3K58 A;  3PX4 A;  5JVG L;  1HNZ K;  4FJ9 A;  4M7Y A;  5AZJ B;  1DTQ A;  3O9T A;  3WQT A;  3CMA N;  1XI1 A;  4BRQ A;  5J2P A;  2O8C B;  3MX2 A;  4B9U A;  4DF8 A;  4AHT A;  4I6M B;  3CCU N;  1QQN A;  4DCH A;  1U04 A;  4AHC A;  4F8R A;  3AVL A;  2D5R A;  3R8E A;  1VQO N;  2YV0 X;  1IKW A;  1LOT B;  3BF1 A;  1UWB A;  1RT6 A;  4JK7 A;  1WAF A;  5K14 A;  4CBX A;  2QWR A;  1U2V A;  1GLE G;  3MEC A;  1HNI A;  4YOU A;  3BUZ B;  4WQ5 C;  4WQ4 C;  3VQQ A;  1C0G A;  2FBX A;  1FXX A;  2VCP A;  3KWG A;  3LM9 A;  3DXM B;  2GV9 A;  3SK3 A;  2I5J A;  1SKW A;  3U3G A;  5ADX H;  2O8B A;  2X6N A;  4H0P A;  3LAM A;  4W5O A;  2Q1N A;  1RTH A;  4JI5 K;  3L3V A;  5AQJ A;  5HLF A;  3ITH A;  4KH6 A;  5SWM A;  3L3U A;  5HBM A;  3ZSZ A;  3KK2 A;  2RF2 A;  3OBW A;  1NK9 A;  4A2A A;  2H3G X;  5AQP A;  4HCC A;  3IMX A;  3DLL L;  4DR6 K;  1FJG K;  1S9E A;  3PSI A;  3WT0 A;  5FRM A;  1M1K O;  3OS0 A;  3PO4 A;  4B1X B;  4YOV A;  4O0I A;  3CI5 A;  4XIU A;  4FJK A;  5HRS A;  2P9N A;  3TTF A;  4ID1 A;  4I7F A;  1RT5 A;  3LP2 A;  4C8L A;  4LY7 A;  3KKR A;  4BDZ A;  3PUF A;  2WTU A;  3OYD A;  1S22 A;  1NK0 A;  1X3N A;  4IO9 L;  3QIP A;  4B9Q A;  3QNN A;  2OA8 A;  2LSN A;  1IKY A;  3VQE A;  1WUA A;  1DTT A;  4JI1 K;  3R6M A;  4MO4 A;  1C1C A;  1LCU A;  1Z6R A;  2W40 A;  1BQN A;  3PIO L;  1WSH A;  2O8F B;  3B8A X;  3D2F B;  3QBX A;  3JAM O;  3OS1 A;  4A5A A;  1TK5 A;  3CCL N;  2E4L A;  3GBT A;  3H08 A;  1S1T A;  4Z4H A;  4H5T A;  3L2R A;  4KHW A;  5E41 A;  4YY3 K;  4LSL A;  2RPI A;  3J7Z O;  1IBM K;  1NGD A;  3WNE A;  2HBJ A;  4M3R A;  1S1V A;  3A0I X;  3SYZ A;  2E2Q A;  1OH5 A;  3MEG A;  3O3G A;  1VQ8 N;  4FK0 A;  3OY9 A;  4IFV A;  5JMV A;  1HYS A;  1NGE A;  1BG3 A;  1ZBF A;  5KPR A;  5BRE A;  3SI6 A;  2P5G A;  3BP8 A;  2QW9 A;  3I8D A;  2IVO A;  4I2P A;  2YNH A;  5JS1 A;  3MDQ A;  3ULE B;  3TTC A;  2Q3S A;  2BGG A;  4Z4G A;  2BE2 A;  4PQU A;  2P9K A;  4DFP A;  1K8K A;  3GOI A;  2WC9 A;  4BRP A;  3CJ9 A;  3M3Z A;  1BI4 B;  1VQ5 N;  3L8B A;  2G8W A;  3HVR A;  3QEP A;  5CE3 A;  4R5P A;  1SUQ A;  4FK2 A;  4GW6 A;  1VHX A;  4CF0 A;  3WXJ A;  2YKM A;  2Z1I A;  4PWD A;  1J5E K;  3OYC A;  2Z1G A;  4KKO A;  4DSE A;  4ISE A;  3OA9 A;  3V9X A;  4EHT A;  3TAF A;  3K5N A;  4LFA K;  1KQS M;  2YCH A;  4BVO A;  4M45 A;  1QHA A;  5KRT A;  1FKO A;  1QZ6 A;  1S1X A;  4J8F A;  3K9K A;  4CEF A;  5EU7 A;  3T3F A;  4CJP A;  2V51 B;  1JXB A;  3D7E O;  4IDK A;  4CHP A;  1KVB A;  5DM7 L;  4KHQ A;  4CCH A;  1Z25 A;  3E01 A;  2HBK A;  3RSE B;  4M41 A;  1D9D A;  3AVG A;  3VTI A;  1Y64 A;  3KD5 E;  4YOW A;  3K5M A;  1W9H A;  1RBS A;  3THW B;  3HBT A;  2VYP A;  4DTU A;  4GV9 A;  4XH5 A;  5EX5 A;  3T1A A;  2AA4 A;  5FPN A;  4KAZ A;  2XY6 A;  1S6Q A;  4FOE A;  4IEI A;  2G8K A;  1YJW N;  3NDK A;  3AO3 A;  2ZWH A;  3W3D A;  1ASV A;  5GIO A;  3Q7C A;  1QZ5 A;  1MWK A;  1ZYQ A;  5LMN K;  2Y1J A;  4AF1 A;  1ASU A;  2GWJ A;  4CZG A;  3V9W A;  3WNH A;  2FSJ A;  1P8Z A;  1J53 A;  3B6O A;  3OW2 M;  3WNG A;  1CZB A;  4FZZ A;  4B9N A;  3K5L A;  2E88 A;  2Q31 A;  4K25 A;  2HNY A;  2B5J A;  2CH5 A;  2ASM A;  5CYQ A;  5TKW A;  4O55 A;  4FZY A;  1HPZ A;  5AQY A;  1J54 A;  5M1O A;  1OVY A;  4EIA A;  4DR4 K;  2F8S A;  3CJA A;  2W6K A;  2BTF A;  3CC2 N;  2GEM A;  4HTL A;  5IT9 O;  2P9L B;  1SKR A;  1B9D A;  1RBV A;  2D0B A;  3P38 A;  1VQN N;  4C8N A;  2F9W A;  3BY5 A;  1YVU A;  2FBT A;  2A42 A;  2HMP A;  4DFJ A;  3A5L C;  5A2Q O;  3VES A;  1TKX A;  1FW6 A;  1C0F A;  1MWM A;  2O8D A;  2IDO A;  4B8C A;  4IZ9 A;  3VA3 A;  3VN5 A;  4YDU A;  2X74 A;  4DUZ K;  5JLF A;  1VRU A;  4B3O A;  3K2P A;  2HW3 A;  4PY5 A;  3ZET A;  2BH1 A;  3LL3 A;  4BRA A;  1JLA A;  1T8E A;  3CCM N;  3ZEU A;  3DOL A;  4FLV A;  1BA0 A;  3LDO A;  1TL1 A;  1EKE A;  1TYQ B;  2NRH A;  4Y1C A;  1GLB G;  2HF4 A;  4CJU A;  4HVJ A;  3MCA B;  1NGI A;  4AH9 A;  4CJT A;  4BR9 A;  3LP3 A;  1J6Z A;  4EP5 A;  1ATN A;  1JLC A;  2NRZ A;  4JI4 K;  1U48 A;  5C25 A;  4M3T A;  3CD6 N;  4FWR A;  4DS5 A;  4DV0 K;  3LAN A;  4B08 A;  1Q7Y O;  4B3T K;  4CGJ A;  2ASO A;  3VER A;  3RMB A;  1B92 A;  4F3O A;  3KLI A;  3VQA A;  4MLH A;  3W0L A;  4AHR A;  3J7A P;  4O0J A;  1VQM N;  3LDQ A;  3RMC A;  1ASW A;  1ATR A;  4FXD A;  3AO1 A;  1MU2 A;  1L3U A;  1ZC6 A;  4FK4 A;  4CK2 A;  3VQ9 A;  1HKC A;  3CET A;  3R1X A;  3THW A;  4OGC A;  3QIC A;  4YHH K;  1SV5 A;  1KLM A;  2BAN A;  3C7N B;  5I3U A;  2E2N A;  4DSL A;  2V7Y A;  3P4I A;  1H1V A;  4CJ4 A;  1OH7 A;  3R3L A;  3M5R A;  3MWP A;  4DV4 K;  1U4B A;  1NU0 A;  2E6L A;  2Z1H A;  3VF6 A;  2YHA A;  3WNF A;  3ULE A;  4CJ3 A;  4FLX A;  4AM6 A;  5AQG A;  1K8K B;  4CGF A;  3CCS N;  4IFE A;  1N33 K;  4BG9 A;  1CXQ A;  4XH1 A;  1LW2 A;  2QI2 A;  3AVA A;  5AQS A;  4XH4 A;  3C95 A;  2D0A A;  5LMU K;  5AQV A;  4L8R B;  1IKX A;  4FWL A;  4AIL C;  3VOV A;  3KTQ A;  3OYG A;  1QTM A;  4CF1 A;  3ENO A;  4H0X B;  2ETJ A;  3ZET B;  3HPH A;  5F0X A;  3AVI A;  4DU1 A;  1MA9 B;  4JAX A;  1P90 A;  4O8U A;  2QM1 A;  4CHY A;  3VEZ A;  3VMF B;  2PY5 A;  4CHZ A;  1VQP N;  1NGH A;  4PA1 A;  4B1U B;  3V81 A;  1NMN A;  1SL2 A;  1YTU A;  3L2W A;  2A6A A;  3AVM A;  4CJF A;  4JEP A;  3SQ1 A;  4JI7 K;  3KHY A;  4H4O A;  3U9Z A;  5FPD A;  4KHS A;  3P83 D;  1GLF O;  5AR0 A;  2YI1 A;  3DAW A;  3PSF A;  1NJW A;  1KFD A;  2WUS A;  4BR7 A;  3ZSV A;  4YDU C;  4U67 L;  1ITG A;  3LPT A;  4KRF A;  2YHW A;  3VEY A;  4WE1 A;  5AQR A;  3SZ2 A;  4CJW A;  4H8K A;  4J2E A;  4Y0W A;  2IVN A;  1RDB A;  4BWM A;  1VSM A;  4MFB A;  3ENH A;  1HUX A;  3I33 A;  3V4I A;  2XY7 A;  4JV5 K;  1GLC G;  4IOX A;  2GBZ A;  2IC3 A;  2NLX A;  1GOC A;  3O9Q A;  2YNF A;  2OZS A;  3KVG A;  3CJC A;  1QS4 A;  3L2U A;  4A59 A;  4N76 A;  4RG8 A;  2UXB K;  2NUB A;  3QDK A;  3C6T A;  3G0Z A;  2E1Y A;  3KLE A;  2HHS A;  3ID6 A;  4JI2 K;  4JI8 K;  3TU5 A;  2VG5 A;  4DTS A;  3I55 N;  3AY9 A;  4BRK A;  3V1R A;  2VG7 A;  1DKG D;  2XO7 A;  3KKS A;  4H4M A;  2O8C A;  3F5T A;  3ZX0 A;  4CEZ A;  5JS2 A;  3QIN A;  4JHD B;  3CME N;  3SNN A;  1Q9X A;  3FFK B;  4CJQ A;  4OKK A;  3H6E A;  1RT7 A;  3THX B;  4FM2 A;  4H5R A;  1IO2 A;  3ZT0 A;  5BN8 A;  3V6D A;  4KPY A;  5GIN A;  2HHU A;  4JKG A;  4OJR A;  2A40 A;  1A5X A;  2UXD K;  1KRP A;  1C0U A;  4JKD A;  3ATU A;  3SMP A;  2HHQ A;  4W5N A;  3TSQ A;  3NGZ A;  4JK9 A;  2P9U A;  5J2N A;  2Q0U A;  3E9L A;  2W41 A;  5DM6 L;  3IUC A;  4G1Q A;  1ZXO A;  2OCE A;  2FLO A;  4LF9 K;  3K5O A;  3JSM A;  3CCE N;  2PYL A;  4EHU A;  3JS6 A;  3O80 A;  1NLV A;  4V19 S;  2KQ2 A;  2OPS A;  2JWK A;  2ZE2 A;  4H0V B;  3SQ0 A;  4NXM K;  1BOT O;  2P9P B;  3LDN A;  4DG1 A;  1XHX A;  3HYF A;  1HX1 A;  1X1P A;  1JLG A;  1Q8I A;  4KB0 A;  4DQS A;  1WN7 A;  4NCA A;  1NJX A;  2QEX N;  5M1P A;  3AVB A;  3FGU A;  4QS8 A;  3NAE A;  1TK8 A;  3L4Q A;  2PZS A;  3H3O B;  1TK0 A;  3P39 A;  4WFB L;  3TAQ A;  3C94 A;  4BQZ A;  3NF8 A;  4GY2 B;  3U6F A;  4BVP A;  2ZJQ L;  3HO1 A;  4FSV A;  3CCR N;  4CJV A;  1XNR K;  1IKV A;  3TR8 A;  2X78 A;  4DQP A;  4JD2 A;  4K42 A;  4BQL A;  4DMN A;  4O8K A;  1QQM A;  4BR0 A;  2UYT A;  4FWN A;  1NOY A;  1WAJ A;  2PFU A;  4FPA A;  4HUG A;  1K73 O;  4CI6 A;  1RBR A;  4PKH A;  2E20 A;  3C6A A;  3L4I A;  4B1W B;  1BIS A;  3NMU A;  1RGI A;  1HMV A;  2YHX A;  4DB3 A;  4DR3 K;  4EFH A;  3QER A;  2HND A;  1O1W A;  3UE5 A;  2ATQ A;  1L5U A;  3VGM A;  4WYB A;  4I9L A;  4BRN A;  3MN5 A;  4RW8 A;  1D9F A;  4G9Z A;  4RW9 A;  5GAH P;  5E84 A;  5AZI B;  5AFU A;  4X66 K;  1HLU A;  3TAE A;  3DXK B;  5ELZ A;  4OKJ A;  3B6P A;  4GV6 A;  3CQX A;  4BRL A;  3IFR A;  1BIZ A;  4BGA A;  2CH6 A;  4DR5 K;  1NWK A;  4N5S A;  2ZGY A;  3CIP A;  2BUP A;  4BWJ A;  2KFN A;  3I8B A;  5BRH A;  3FE1 A;  4FLU A;  3N4P A;  3T19 A;  4DR1 K;  1HR0 K;  1Q82 O;  3TAB A;  2P5O A;  4B1Y B;  4FWK A;  3DI6 A;  1HYV A;  5KQ8 A;  4F9O A;  4RTF D;  4JI3 K;  3ZCM A;  1KCF A;  4IFY A;  3TI0 A;  1N8R O;  3AVF A;  4CJL A;  4OX9 K;  3MXM A;  3J80 O;  1YUW A;  2I7N A;  3D2F A;  1KTQ A;  1JXE A;  4FLY A;  5GAG P;  4R79 A;  4B3M K;  2KZM A;  3OYI A;  2HMI A;  1RT1 A;  1LV5 A;  1Y97 A;  1EET A;  1HNV A;  4AM7 A;  4DLE A;  3HM8 A;  2OPQ A;  3HOT A;  4O5F A;  5AQH A;  4OVL A;  1RTI A;  2W6L A;  4CHN A;  2VQF K;  5AQN A;  1VK0 A;  4BRM A;  2F7T A;  3OYM A;  4B8A B;  2KHO A;  1OH6 A;  1JL1 A;  2GTD A;  4B1Z A;  3E9P A;  3FR0 A;  4CEO A;  4DV1 K;  2FC0 A;  2X6S A;  1T3V A;  1RNH A;  2GX9 A;  2F96 A;  3O3F A;  3TAM A;  1VQ7 N;  2HHW A;  2HNZ A;  3CHW A;  3NF9 A;  1WSE A;  4JI6 K;  1QQO A;  4NLC A;  3AVC A;  3LPU A;  4RW7 A;  1XC9 A;  2P9S B;  4LF5 K;  1NGG A;  2QWO A;  4KV8 A;  1WBB A;  3THV A;  4PL8 A;  3V9Z A;  1BDG A;  1NGF A;  2VGM A;  4BRC A;  4YFU A;  2VGN A;  4FJI A;  4CJK A;  3EE8 A;  3NCI A;  1OVQ A;  1KLN A;  3CJB A;  4CBU A;  2FSK A;  1IV0 A;  4ZTJ A;  3V1Q A;  1WBD A;  3MWT A;  4CGG A;  4DFM A;  3ZX3 A;  4JKF A;  4MO5 A;  1RTD A;  1HKG A;  1XNQ K;  3K59 A;  1YIJ N;  1NK7 A;  3V9S A;  1Z26 A;  2YJF A;  4FL9 A;  5AJ3 K;  3RSE A;  4IOA L;  2O4I A;  4CZJ A;  5FPE A;  1OH8 A;  3U3Y A;  3AGR A;  1L3V A;  4OPK A;  2HBL A;  5KPZ A;  3QET A;  3T1Y K;  2QWN A;  3BGR A;  3SUP A;  5KPT A;  4YOY A;  3CXC M;  4KH4 A;  4KI4 A;  2KLA A;  3NHG A;  1BWF O;  3MK6 A;  3QEW A;  3O5B A;  3FZK A;  2R7Y A;  1YXQ A;  1U47 A;  4O44 A;  1EX4 A;  4WFN L;  1VQK N;  4A5B A;  3OYL A;  1JLE A;  4OPH A;  4CD3 A;  3C6H A;  1N34 K;  3IKM A;  1N6Q A;  3PO5 A;  1YAG A;  5EXW A;  4JRQ A;  3SAG A;  4DTM A;  3OYH A;  3M8Q A;  4CK3 A;  3EZW A;  4ILG B;  3MMV A;  3SAF A;  4FJG A;  4EP4 A;  3C6U A;  5EOY A;  4A61 A;  1KC8 O;  4O5B A;  1BCM A;  1FK9 A;  1GOB A;  4CF2 A;  1R0A A;  1Q18 A;  2DPN A;  1JJ2 M;  3PX6 A;  5HRO A;  1BHL A;  3ZSY A;  1QHT A;  4BC4 A;  5AQI A;  3M8S A;  4CEC A;  3WEE A;  3HL8 A;  3O1B A;  3AA3 A;  4K41 A;  4C8K A;  1MDU B;  4EZ6 A;  3R9P A;  4H5V A;  3VQ7 A;  3ISN C;  1NKE A;  1EWQ A;  4FLW A;  4CZH A;  1T03 A;  2KZZ A;  5LL6 Z;  3H3N O;  2P9S A;  1QVF M;  2D0C A;  3AO2 A;  3ZEU B;  3ZSO A;  3OHR A;  4JYA K;  3KJV A;  1TYQ A;  3AO5 A;  4BC2 A;  1YT3 A;  2W42 A;  3KK3 A;  3HRG A;  3IS9 A;  3AA5 X;  3F73 A;  4CK1 A;  3AAP A;  4FJ8 A;  4CGD A;  3S41 A;  4CFD A;  3RRH A;  3VEV A;  3THY A;  4CF9 A;  3VA0 A;  3HPO A;  1X9J A;  4LF4 K;  3LZJ A;  1JKH A;  4YOT A;  1W0H A;  2O8E A;  5TKY A;  2OAN A;  5KI6 A;  1VSL A;  2KFZ A;  2QXF A;  3E1Y A;  1YJN N;  1J9A A;  3WQU A;  4GMJ B;  5AQQ A;  3GDQ A;  4FVM A;  4KO0 A;  4BY9 C;  2VG6 A;  1U45 A;  3DRS A;  5AQL A;  4M3U A;  4B9S A;  2DFF A;  4NYN A;  3O9S A;  1RIL A;  4Q0B A;  4FZX C;  4CHO A;  3QNO A;  4KBO A;  4DF4 A;  2GWK A;  4DR2 K;  3TAN A;  5HL7 L;  2HVH A;  3CJ1 A;  3S9H A;  5AFU H;  3CCV N;  3QEI A;  4X62 K;  2ZQB A;  3F2K A;  4QS7 A;  4BC3 A;  4UQG A;  1EO1 A;  3HT3 A;  3P31 A;  1ZBU A;  3UKU B;  3OYJ A;  4Z4I A;  2V52 B;  3LDP A;  1TV6 A;  4KTZ A;  1ZBI A;  3VQD A;  4CEQ A;  4FPB A;  4FM1 A;  5M1N A;  4DHY A;  2ZJP L;  1LAW A;  1N5Y A;  3NH1 A;  3NVM A;  1KFS A;  1SAZ A;  4TSX A;  3ZX2 A;  1JLF A;  5EY4 A;  1VSI A;  1KXP A;  5F2R A;  4E89 A;  4U7B A;  1C1A A;  5BPM A;  3BF3 A;  4LF6 K;  4OLB A;  4BRF A;  3PX0 A;  3NH2 A;  4QOZ B;  3O4W A;  1K8A O;  2ZF5 O;  4WF9 L;  3PV8 A;  1VSE A;  4E1J A;  3S3O A;  1VSF A;  4MLE A;  1Q86 O;  3CG7 A;  4RWT A;  4X65 K;  3T69 A;  1HQE A;  1I3A A;  4QS9 A;  2YKN A;  3TAP A;  4KHU A;  3TAG A;  3DLB A;  1BCO A;  5KRS A;  3AV9 A;  3TPQ A;  4BE2 A;  1KD1 O;  4F4K A;  4FWO A;  2GUP A;  4FJH A;  5GAE P;  2OPP A;  2O8B B;  4CW7 B;  4Z0U A;  4DV7 K;  2Y1I A;  4CZL A;  3FFI A;  1G15 A;  1NM1 A;  1NJZ A;  1Q81 O;  3K57 A;  4DSF A;  4WQ4 A;  3MN9 A;  1V4S A;  4H0O A;  5FDL A;  3SUN A;  1ILY A;  1U6Z A;  3SBG A;  1YVN A;  3D6R A;  5AQZ A;  5JLH A;  3QES A;  1IBL K;  3QB0 A;  4ISF A;  4FWM A;  1NJI O;  4YOX A;  3HST B;  2IAJ A;  3LWL A;  4CEB A;  3QIO A;  4FJM A;  3MN7 A;  4B3S K; 
#chains in the Genus database with same CATH homology
 4KB0 A;  4DQS A;  1WN7 A;  4NCA A;  4M3R A;  3VQB A;  1QSS A;  2RN2 A;  1S1V A;  3SYZ A;  1NJX A;  5HRN A;  4IBN A;  5SZT A;  3EYZ A;  3AVB A;  3MEG A;  3O3G A;  4FK0 A;  3NAE A;  3OY9 A;  1TK8 A;  2PZS A;  1TKZ A;  2OYQ A;  1NK6 A;  4IFV A;  1HYS A;  1TK0 A;  3TAQ A;  3C94 A;  1LW0 A;  1ZBF A;  1T7P A;  1I39 A;  3NF8 A;  3LP1 A;  3SI6 A;  3U6F A;  2P5G A;  3I8D A;  3HO1 A;  4E7K A;  3KIO A;  4CEE A;  4CJV A;  4I2P A;  3MAQ A;  1IKV A;  2YNH A;  3TR8 A;  3JYT A;  3ULD A;  5JS1 A;  4HUE A;  2X78 A;  4DQP A;  2Q3S A;  2BGG A;  4Z4G A;  1KVC A;  2BE2 A;  4DMN A;  4PQU A;  4DFP A;  4BE0 A;  3VQ6 A;  2E6M A;  4KFB A;  3OYK A;  1NOY A;  1WAJ A;  4OGE A;  4HUG A;  4B9V A;  4Z4F A;  4E0D A;  1RBR A;  1BI4 B;  3HVT A;  3OJS A;  4FM0 A;  2G8W A;  3L8B A;  5C42 A;  1BIS A;  4Y1D A;  4B9M A;  3HVR A;  3QEP A;  3MED A;  4CE9 A;  4C8M A;  4N47 A;  1HMV A;  4R5P A;  1SUQ A;  4FK2 A;  4GW6 A;  4CF0 A;  3QER A;  4DTJ A;  4J2A A;  2HND A;  1O1W A;  1HQU A;  2ATQ A;  2YKM A;  2Z1I A;  5HRR A;  3L2V A;  3HXM A;  1L5U A;  4PWD A;  3OYC A;  4I9L A;  1BIU A;  2WON A;  2YNI A;  2Z1G A;  3LDS A;  4KKO A;  4RW8 A;  4DSE A;  1RT3 A;  3ZSR A;  2FBV A;  1D9F A;  3LWM A;  3V9X A;  4N56 A;  1T05 A;  4RW9 A;  3VQ8 A;  5CYM A;  3TAF A;  1X9W A;  2DTU A;  4ID5 A;  2WOM A;  4W5R A;  4F2R A;  4IKF A;  2A1R A;  3K5N A;  4Z4E A;  2YHB A;  3TAE A;  1UA0 A;  1C1B A;  3SUQ A;  4N41 A;  1LWC A;  4M45 A;  4FLT A;  4OKJ A;  5KRT A;  3B6P A;  1FKO A;  1S1X A;  4CES A;  4LSN A;  1BIZ A;  3V9U A;  4CEF A;  1UAX A;  4N5S A;  3O4N A;  4I2Q A;  5EU7 A;  4LD0 A;  3T3F A;  4BWJ A;  3RRG A;  2KFN A;  4CJP A;  3VQ4 A;  4FLU A;  1JXB A;  1F21 A;  1VSJ A;  3ALY A;  3T19 A;  4IDK A;  4CHP A;  1KVB A;  4BDP A;  3TAB A;  4KHQ A;  4CCH A;  2P5O A;  1D5A A;  1WSF A;  1Z25 A;  2IGI A;  3E01 A;  1CZ9 A;  2IOC A;  4M41 A;  3VQP A;  3ZT2 A;  3CFR A;  1ZBL A;  1D9D A;  3AVG A;  2YNG A;  3DI6 A;  1HYV A;  4CJS A;  3ZCM A;  1EP4 A;  1KCF A;  4IFY A;  3WNE A;  3NH0 A;  3KD5 E;  3K5M A;  1W9H A;  3TI0 A;  3RMA A;  3AVF A;  1CLQ A;  1RBS A;  2F8T A;  4CJL A;  1A5V A;  4HTU A;  4FCY A;  3MXM A;  4DTU A;  5KTQ A;  2EX3 A;  1VSH A;  1KTQ A;  1RBT A;  1TL3 A;  3HP9 A;  3AO4 A;  4NCG A;  3T1A A;  4CED A;  1JXE A;  3KK1 A;  4CFA A;  4QAG A;  4E1M A;  4FLY A;  1RTJ A;  3UIQ A;  4KAZ A;  1QE1 A;  4B9L A;  4FJX A;  1LAV A;  1S6Q A;  3DYA A;  2XY6 A;  2G8K A;  2KZM A;  3RR8 A;  1DLO A;  2DFE A;  4IG0 A;  3OYI A;  4CFC A;  5T7B A;  2G8U A;  2HMI A;  1B9F A;  1RT1 A;  3KLG A;  3NDK A;  1Y97 A;  1LV5 A;  1EET A;  3AO3 A;  1HNV A;  4E3S A;  4DLE A;  3HJF A;  3D0P A;  1S1U A;  1SKS A;  1ASV A;  3I0S A;  3QO9 A;  2OPQ A;  2B6A A;  3DMJ A;  1S5J A;  4OVL A;  4AHS A;  1RTI A;  4CHN A;  4DSI A;  1S6P A;  3P5J A;  3DLR A;  3DOK A;  3OS2 A;  1RT4 A;  4DFK A;  1ZYQ A;  2VWJ A;  1VK0 A;  5DMR A;  2Y1J A;  2HHT A;  1ASU A;  3SPZ A;  3OYM A;  3ZSQ A;  3SJJ A;  3V9W A;  4B8A B;  1JLB A;  4ICL A;  4KTW A;  4DQQ A;  3WNH A;  3AVH A;  3O4Q A;  3S3M A;  2G8F A;  3QLH A;  2KTQ A;  3CQ8 A;  1JL1 A;  3OJU A;  1J53 A;  4DWI A;  3B6O A;  4FYD A;  4CEO A;  3WNG A;  1TKT A;  4OKE A;  1CZB A;  4M42 A;  2FC0 A;  3M8P A;  4HUF A;  4FZZ A;  1TAU A;  4W5Q A;  1BL3 A;  2X6S A;  1RNH A;  2F96 A;  3O3F A;  3TAM A;  4Z4C A;  3K5L A;  4B9N A;  4QCL A;  2HHW A;  2HNZ A;  4HHT A;  4ELU A;  3A2F A;  3NF9 A;  1WSE A;  2B5J A;  2HNY A;  4ELT A;  1ZBH A;  4E7J A;  1C0T A;  5CYQ A;  4FJL A;  3AVC A;  3TWH A;  3LPU A;  4O55 A;  4FJ5 A;  1XWL A;  4RW7 A;  1HPZ A;  1XC9 A;  4FZY A;  1WSJ A;  1J54 A;  1RDC A;  3NGI A;  3EY1 A;  4JLH A;  5J2Q A;  2F8S A;  4KV8 A;  1SL0 A;  4M3Z A;  3DLH A;  3AA4 A;  4BAC A;  3THV A;  4KTQ A;  3DRP A;  1NKB A;  3S3N A;  1SKR A;  1B9D A;  1RBV A;  2D0B A;  4RW4 A;  3OYN A;  3M8R A;  3V9Z A;  2ITG A;  4C8N A;  2B4J A;  1Q9Y A;  4JS5 A;  1YVU A;  2FBT A;  2QK9 A;  2PYJ A;  2XY8 A;  4DFJ A;  4YFU A;  4DS4 A;  4FJI A;  1TKX A;  5CZ2 A;  4EZ9 A;  4CJK A;  3NCI A;  3SUO A;  1KLN A;  2G8V A;  2IDO A;  4B8C A;  4E7L A;  3I0R A;  1A5W A;  3VA3 A;  4DTO A;  5KGW A;  4ZTJ A;  3V1Q A;  1SL1 A;  1JLQ A;  3VN5 A;  3MXI A;  4CGG A;  2X74 A;  4DFM A;  4F2S A;  1VRU A;  4J2B A;  1RTD A;  4PUO A;  3K59 A;  1IH7 A;  4B3O A;  3K2P A;  1TVR A;  1NK7 A;  1L3T A;  3V9S A;  1NK8 A;  2BDP A;  4PY5 A;  2HW3 A;  1JLA A;  1RDA A;  1Z26 A;  4ZTF A;  1NKC A;  3DM2 A;  4AHV A;  5FRO A;  1T8E A;  3KD1 E;  3EZ5 A;  3IAY A;  3V1O A;  5HP1 A;  1TGO A;  3DOL A;  2XHB A;  4FLV A;  3SQ2 A;  3SV4 A;  1TL1 A;  1EKE A;  2O4I A;  2P1J A;  4Y1C A;  3DLG A;  3SQ4 A;  2OPR A;  1GOA A;  4CF8 A;  3U3Y A;  1WNS A;  1L3V A;  4OPK A;  1QSY A;  4O4G A;  4DLG A;  4CGI A;  3QEX A;  4CJU A;  2Z1J A;  4HVJ A;  3QET A;  4CJT A;  4FW2 A;  4AH9 A;  4FJJ A;  1NJY A;  3BGR A;  3OYB A;  3SUP A;  1QQC A;  4RW6 A;  3LP3 A;  3NGY A;  4EP5 A;  3HP6 A;  3DRR A;  3VQ5 A;  5KGX A;  3RR7 A;  1JLC A;  1U48 A;  4KI4 A;  5C25 A;  4K8Z A;  4DTX A;  4M3T A;  3NHG A;  4DS5 A;  3LAN A;  4B08 A;  3QEW A;  2R7Y A;  1VRT A;  4CGJ A;  1UA1 A;  3AVN A;  5HRP A;  1X9S A;  4CJ5 A;  1U47 A;  3RMB A;  1B92 A;  3NF6 A;  3ZT3 A;  3KLH A;  3AVK A;  1CXU A;  4O44 A;  2ZD1 A;  3KLI A;  4GVM A;  1EX4 A;  3VQA A;  4F3O A;  3IG1 A;  4CFB A;  5FRN A;  2DY4 A;  3OYL A;  1QSL A;  1BQM A;  4CGH A;  1NK5 A;  1JLE A;  1FKP A;  4AHR A;  4DTP A;  4FLZ A;  4O0J A;  3CM5 A;  2QKB A;  4W5T A;  4C8O A;  2G8H A;  1BI4 A;  3RMC A;  1ASW A;  3IRX A;  4FXD A;  3AO1 A;  1MU2 A;  1L3U A;  2HVI A;  4J2D A;  3AA2 A;  1N6Q A;  2XRI A;  3CFP A;  4JRP A;  4FK4 A;  3L2Q A;  3PO5 A;  1EXQ A;  4CK2 A;  1K6Y A;  1J5O A;  3VQ9 A;  2VWK A;  1UOC A;  4OGC A;  2RKI A;  4JRQ A;  1SV5 A;  1KLM A;  2BAN A;  4DTM A;  3HK2 A;  3OYH A;  3M8Q A;  4CK3 A;  5I3U A;  3AVJ A;  4DSL A;  3SPY A;  2QKK A;  1C0M A;  3NE6 A;  4ELV A;  4CJ4 A;  1HYZ A;  4FJG A;  2FBY A;  4EP4 A;  3C6U A;  1HJR A;  4DU3 A;  1VSD A;  3RTV A;  2JGU A;  5I42 A;  1U4B A;  4O5B A;  2OZM A;  1YTA A;  1BCM A;  1FK9 A;  4F3T A;  3RMD A;  3DLE A;  1GOB A;  2E6L A;  4CF2 A;  4DTN A;  2Z1H A;  4LH4 A;  5DK5 A;  2YHA A;  1LWF A;  3NBP A;  3WNF A;  1BGX T;  3NFA A;  4CJ3 A;  1R0A A;  3HM9 A;  4NYF A;  4JS4 A;  4FLX A;  4M3W A;  3NF7 A;  4FW1 A;  4E7H A;  3PX6 A;  5HRO A;  1BHL A;  1C6V A;  3HPG A;  5CZ1 A;  4CER A;  1D8Y A;  4CGF A;  4M3X A;  3LZI A;  4M3Y A;  4OLA A;  1WSG A;  3ZSY A;  1CXQ A;  1QHT A;  4HCB A;  1IG9 A;  4CEA A;  3ZT4 A;  3KLF A;  3BDP A;  1LW2 A;  1LWE A;  2XY5 A;  3AVA A;  3M8S A;  4K8X A;  4CEC A;  3HL8 A;  1TAQ A;  1KVA A;  3AA3 A;  3MXJ A;  1RT2 A;  3C95 A;  3SCX A;  4C8K A;  4EZ6 A;  2D0A A;  5CY4 A;  5C24 A;  3VQ7 A;  3ISN C;  4BDY A;  2O4G A;  1NKE A;  1IKX A;  1HRH A;  4FLW A;  4AIL C;  1XHZ A;  4L8R B;  3KTQ A;  3OVN A;  3OYG A;  1QTM A;  4CF1 A;  1T03 A;  4NCB A;  2ETJ A;  4KI6 A;  2KZZ A;  4E1N A;  3HPH A;  3AVI A;  2DFH A;  4DU1 A;  3ZT1 A;  4KHY A;  1VSK A;  3DLK A;  2D0C A;  3AO2 A;  3QEV A;  3PX4 A;  3K58 A;  2EHG A;  3ZSO A;  4CHY A;  4I9Q A;  4FJ9 A;  1KSP A;  1S9G A;  3ZSX A;  2PY5 A;  4CHZ A;  3KJV A;  3LAK A;  1DTQ A;  3AO5 A;  4PA1 A;  3V81 A;  1XI1 A;  1YT3 A;  1SL2 A;  1YTU A;  5J2P A;  4B9U A;  4IG3 A;  3L2W A;  4DF8 A;  2W42 A;  4AHT A;  4FJ7 A;  3KK3 A;  3IS9 A;  1S1W A;  3AA5 X;  3AVM A;  1U04 A;  4AHC A;  4CJF A;  4CK1 A;  4CGD A;  4ZHR A;  3AVL A;  3F73 A;  4CFD A;  3RRH A;  2D5R A;  4FJ8 A;  4CF9 A;  3VA0 A;  3LP0 A;  4H4O A;  3HPO A;  2YV0 X;  1JKH A;  3LZJ A;  1IKW A;  1W0H A;  3F9K A;  1UWB A;  1RT6 A;  4KHS A;  1WAF A;  5K14 A;  3D45 A;  5KI6 A;  3OYA A;  1VSL A;  3P83 D;  2QXF A;  2KFZ A;  1J9A A;  4CJR A;  1NJW A;  4FJN A;  1KFD A;  1NK4 A;  4GMJ B;  3MEC A;  1HNI A;  4FVM A;  4KO0 A;  3ZSV A;  4DSK A;  1ITG A;  2HHV A;  3LPT A;  2VG6 A;  3VQQ A;  4KRF A;  4DQR A;  4WE1 A;  3DRS A;  1U45 A;  2FBX A;  3SQ1 A;  1FXX A;  4B9T A;  3SZ2 A;  4M3U A;  4B9S A;  2DFF A;  4NYN A;  4CJW A;  4H8K A;  1RIL A;  2GV9 A;  1WLJ A;  1SKW A;  2I5J A;  4FZX C;  4J2E A;  1RDB A;  1RCH A;  3U3G A;  4CHO A;  4E19 A;  3QNO A;  1NOZ A;  1VSM A;  2KW4 A;  2X6N A;  3LAM A;  4MFB A;  4BWM A;  4W5O A;  4CJE A;  4DF4 A;  3TAN A;  3S9H A;  3V4I A;  2XY7 A;  2HVH A;  3QEI A;  1RTH A;  4DTR A;  2GBZ A;  2IC3 A;  2ZQB A;  4MQ3 A;  3ASM A;  3L3V A;  2G8I A;  1L3S A;  5HLF A;  1GOC A;  4UQG A;  4CHQ A;  3ITH A;  2YNF A;  2OZS A;  5SWM A;  3L3U A;  1QS4 A;  3HT3 A;  5HBM A;  1ZBU A;  3ZSZ A;  3OYJ A;  3L2U A;  4Z4I A;  4CIE A;  3KK2 A;  1TV6 A;  4N76 A;  4KTZ A;  1ZBI A;  2RF2 A;  3VQC A;  5J2M A;  1NK9 A;  4RG8 A;  1JL2 A;  3VQD A;  2IS3 A;  1U49 A;  2NUB A;  3CFO A;  4CEQ A;  4FM1 A;  1TKD A;  3C6T A;  3G0Z A;  4HCC A;  4KHN A;  3KLE A;  2HHS A;  1LAW A;  1N5Y A;  1WSI A;  3NH1 A;  1KFS A;  4DSJ A;  4TSX A;  1JLF A;  1VSI A;  2VG5 A;  4YNQ A;  4DTS A;  1S9E A;  5FRM A;  4E89 A;  3V1R A;  1C1A A;  2VG7 A;  3CM6 A;  2XO7 A;  4OLB A;  2JLE A;  3KKS A;  4H4M A;  4AHU A;  3OS0 A;  3O3H A;  3PX0 A;  3PO4 A;  4CEZ A;  3NH2 A;  4QOZ B;  5JS2 A;  4O0I A;  3QIN A;  4XIU A;  4FJK A;  5HRS A;  3PV8 A;  3OYE A;  1VSE A;  3S3O A;  4ID1 A;  4I7F A;  1VSF A;  5J1E A;  1X9M A;  3SNN A;  1Q9X A;  1RT5 A;  3LP2 A;  3CG7 A;  4C8L A;  4CJQ A;  3PY8 A;  4OKK A;  4OPJ A;  4LY7 A;  1RT7 A;  3KKR A;  2AJQ A;  3G10 A;  4BDZ A;  1HQE A;  1I3A A;  3PUF A;  4FM2 A;  4DQI A;  3OYD A;  5D3G A;  1NK0 A;  1IO2 A;  2YKN A;  1RBU A;  3ZT0 A;  4BE1 A;  3SV3 A;  3V6D A;  3TAP A;  4KPY A;  2HHU A;  2GUI A;  4OJR A;  4KHU A;  1A5X A;  3P1G A;  3TAG A;  1KRP A;  3QIP A;  1C0U A;  4E7I A;  3QNN A;  2OA8 A;  1BCO A;  5KRS A;  3DLB A;  4KB1 A;  2LSN A;  1IKY A;  4Q5V A;  3AV9 A;  3VQE A;  4BE2 A;  2HHQ A;  4F4K A;  4W5N A;  4LH5 A;  4FJH A;  1DTT A;  3NGZ A;  4KRE A;  1C1C A;  5J2N A;  1BQN A;  2OPP A;  1WSH A;  3ZSW A;  2Y1I A;  4G1Q A;  4Z0U A;  2P51 A;  3CYM A;  3FFI A;  1G15 A;  4CIG A;  1NJZ A;  1RDD A;  3K57 A;  4DSF A;  3K5O A;  3JSM A;  3OYF A;  3OS1 A;  2PYL A;  1TK5 A;  5FDL A;  2E4L A;  3SUN A;  2A1S A;  2KQ2 A;  2OPS A;  1REV A;  2HHX A;  2ZE2 A;  3H08 A;  3QES A;  4F8R A;  4CIF A;  4Q0B A;  2HB5 A;  3RWU A;  1S1T A;  3LAL A;  3SQ0 A;  3HST B;  2IAJ A;  4Z4H A;  4CEB A;  3LWL A;  4KHW A;  3L2R A;  4DG1 A;  1XHX A;  3QIO A;  5E41 A;  3HYF A;  2RPI A;  4LSL A;  4DU4 A;  4FJM A;  3TAR A;  1X1P A;  3MEE A;  1JLG A;  1Q8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...