3AVEA

Crystal structure of the fucosylated fc fragment from human immunoglobulin g1
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
211
structure length
211
Chain Sequence
LLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Corrigendum to "Structural Comparison of Fucosylated and Nonfucosylated Fc Fragments of Human Immunoglobulin G1" [J. Mol. Biol. 386/3 (2007) 767-779]
doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
total genus 38
structure length 211
sequence length 211
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3aveA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3aveA01
3JWOC 1K2DB 1J8HD 4G5ZL 4MVBD 4EI5C 1EGJH 3L3DA 3U46B 3MCKB 3QFDA 3C8HA 4HDIB 5FDYA 1TZHB 4YC2C 4RX4A 4H0GA 2G5RA 4D0CA 3GHBL 2AQ1A 3U0WL 1ZT7B 4X4YB 5HHOA 1TTUA 4URTB 4XB8A 1Z3GH 2PO6D 3QCTH 1T1ZA 5DK0B 1XGPB 4NCDA 4M1CC 1E6OL 5FXCH 4ODXA 4YHLH 1DBAL 4HXBH 4H1LG 5I8KH 3ROLB 3RY6A 4QTHB 3NIFE 3TLRA 5HDQH 2BVPB 5DA4A 1HWGB 1WV7T 3TNMB 1R3HB 3JWDL 2KQNA 2PXYB 3P9LB 1JWSA 4HIHA 1ZHBA 5FV2A 4KI5E 2HLFC 4XT1C 3HI5L 2PO6A 3RY6C 3KWWA 5C0BB 5EU6E 2R9HD 1GZQB 4XZUB 1C5CH 1QA9A 4IRSD 2DJUA 2V7NA 1HOCB 1WUNT 1M71A 3NFPA 1A1OB 1S7TA 3IDMA 4PIRF 4PJCA 2WQ8A 4NRYA 1I1CA 3ARFB 1WCBB 4M7ZB 4GXVL 3QFJB 1G84A 3EDFA 2KKQA 2MJWA 1A1MB 5KVEL 3QULA 4H25A 1U3JA 1JTPA 3MCG1 1R3KB 2A6JB 3IJHB 4TPRH 3V0WH 5IOPB 1RZJH 3V6FA 2H1PH 1DFBH 3AS1A 3OB0K 5J1TC 1TZHA 3RGVC 5DMKB 1XF4B 1R3LB 3GIVB 5DT1H 5DLML 4KY1H 5ABDE 3QUXD 1ZK9A 2YWYA 4PJHA 4WI4A 1BF8A 4Y2DD 2HTKC 3PDOB 1TETL 3ZL4L 3MRJA 5L9DH 3FRUA 3MBEC 4GW4B 4S1QH 1YMME 5JW5A 4H0HB 4FFWD 4M02A 1YEHH 3BI9X 1DQTA 1T4KB 2Y07H 2APBA 5KZCD 3CDCA 1U3HB 1EEZB 5E8OA 2YHGA 3F12B 2F8XC 1T20A 2HYMA 4OCRL 2NY4B 2XN9A 4BZYA 1NBQA 1JHLL 4RWHA 5DWUL 1JGUL 1F11B 3RQ3A 4O58L 1GYAA 4JR9H 4BM7A 3LN5A 2GTZA 3RWDB 4X6FB 2BY1A 4FMFA 2GKIA 3LEYH 4XI5D 4HUWB 2NLJA 5EUOA 4J1UA 5M94B 4UNVA 1RUKH 3ZT7A 1BQLL 1NGQL 3LKSA 2OTWB 3W39A 2C1OB 3QHTC 4H26A 4P2QD 4QRPA 5A16A 2XWTA 4BSWA 5I1LB 5BV7C 4YHLL 4NZDA 2HFFB 1SJXA 3SKJL 4NUGH 5SX5H 4OUUB 2VE6B 1NDMB 1WFTA 3AU1A 3KPSA 3F12A 3HZKA 3VWKB 4NOBA 5F44A 4AM0A 2YD8A 1DVFA 3BKYH 2AEIT 4K71C 3ROOA 1WCQA 4EQ2A 3S3SA 5IEKB 6CGTA 1G7QB 4Q6YA 5TDOA 4OFYD 4RAVA 4ENED 1RSFA 4PJ7B 5CJOH 1ORQB 4G6FD 4XP6L 5EZLB 1YNTA 3U7YL 1D5BB 4LLUB 2PTTA 5FYKE 4RMQA 5DQJA 4R9HA 4N0CC 4HF5H 2D31B 2Z35A 4GAGH 1WT5C 5B38B 2QBWA 4XBEH 2PNDA 1MSPA 2EDQA 1SY6L 1EBAA 4I3SH 4D8PB 1U58B 2H6PB 4JKPH 2Y6SC 3Q6FA 1BD2E 2AGJL 1WICA 5IVZB 4YXKH 4MLSA 3U9UB 1NLDH 3TO4D 3C9NA 4ZFOA 4Y5VA 1CG9B 4BZ1H 2X89A 4N1CA 4H5SB 4JLRA 2OR7A 4TVPE 5GSRB 4K3JL 2Z31C 1D9KC 5E2VL 2R8SH 5GGRA 3RVXD 2IBGA 3IRPX 3GM8A 1HH6B 5H37G 3ZDXF 5J56B 3WL9B 2FGWH 4KROB 3RKPA 3ULVF 1MIEH 4N0UA 1U8NA 3LV3A 3KPNB 4JQVC 4AQOA 3SCMB 3MCLH 3QQ9D 4WHYG 3QJHB 1EDQA 5D1ZD 1FNSH 3T1FA 1M6OB 1CT8A 1JRHI 5ICZA 4JFOB 3UJJH 5TF1H 3HS0B 4OZIB 5C09B 2CIKB 3SJVD 4RFEB 4U6XB 2QSTA 5HI5C 2E7LA 2X89D 2HJKA 3QXUA 4RGMC 4KMTH 5IW1B 2AXGB 1TPXC 1XF2A 5I30L 1VEPA 2PW2A 4LCUA 3RNQB 1S7VB 3ARFA 2YSSA 3LQZB 3KYKH 1L0QA 4X4ZA 1K8IA 2W0FA 4XVSL 1VFBB 2Z35B 4ORGB 5FCUL 4FQLH 4K7PL 2OP4L 4I18A 1HIMH 3MV8A 1I7RA 2EYTB 4LAQH 3IAPA 1PY4A 3TM6A 5L2KB 5DD3H 2PYFB 3OB8A 4QRRD 4U0QB 5T1DL 2F58L 2XKSA 5E6ZA 2F5BL 4OGAD 3GJEA 3QDJA 3Q6GH 3I6LD 2W9EL 4I4WA 5F7EH 1CG9A 3OKEA 1OTTD 4P3CH 5K59E 2A6DB 3ULVC 4ZFOB 1Y6NR 1KJ2H 1AY1L 2ATPA 1WAAA 4KTEH 2DTML 2W59A 3ARGD 5A2FA 2ZSWB 4JQVA 1WZ1L 1IM9A 1NH6A 2FSEA 5E6IC 1H8OA 3BGMB 3C09B 2NY7L 3L5XH 1FNEB 4EDXB 2D7TL 1E4XH 2C4FU 1G6RL 4WWKB 3CX2A 2AK4A 1BIIA 5T1DH 1K6QH 1VFAA 3NZHL 4MQTB 5E4EB 3VXQB 4G6JL 4QF1B 2VDLL 4JO1H 1KFAH 4MXVE 4LHUG 2UZIH 1CQYA 1HIML 1MF2L 1UACH 1RD6A 1OW0A 4KHXH 2BCKA 3KYKL 3C5ZC 5C92A 1M05A 4NJAH 1T66D 3HAEA 3KYNA 2A6IB 3BRFA 2EE9A 2HFGH 5SV4A 3FCTB 1I8MA 2Q8AL 2DJSA 4GKZB 1SJVA 4YWGL 5BMFL 3L6FB 4ZUSA 4POYA 2JB5L 3NN8B 3QEUA 5DDHB 3ES6A 1T04B 5D7IF 5I1AB 2EDDA 2WBJA 1GC1H 3P77A 2AEPH 3I9GL 4TSBH 1V7NH 4OF3A 1QFHA 4LCIL 3ZKND 2XZAH 2VC2L 3C8DA 3HI1A 4E41D 5JXEA 3FZUD 2GJ6A 1MI5A 5FYJD 3O6ML 4ONHA 2G2RA 1ZS8B 2VH5H 1G7JB 5CIPA 3BP6B 5C2BH 2J3SA 1J0KA 1UH4A 1T6WA 2BMKB 3OMZA 3QDGE 2DKUA 4MAYD 4NNYA 5F1NB 3VXPA 2NXZB 2Q8BL 5IKCA 1RU9L 1Y6KR 3MTRA 4OFVA 4XBEL 4OBRA 3D69B 5TFSH 4H88L 1ACZA 2F54A 3QUMA 1P7QD 4JRXB 3LD8B 4PBVC 5C0FB 5JXED 4P2OA 4I3RL 1AGDB 1JN6A 4Q6IB 3STZB 3WS6A 4QRQA 3DMMC 3LDBC 3IDYC 3C08L 2FBJL 4PJ5A 3ETBF 3QUZD 1NMBH 5IB2B 4GKZA 4DGYL 5FYJH 2ILLA 2EDJA 4MJIB 4P9ML 4PRPA 3GB7A 5JXAL 3ARVA 2B4CH 2LQRA 1N0XH 1QSEB 1XCQB 2V17L 4HS8H 2X4QA 1U95B 4MX7A 1RUKL 2XA8L 2WNGA 1A6AB 3HG1E 4P2OD 4PUBH 3MBED 4RGND 1MLCB 3FFCA 2IANA 3QIUB 3NACH 1FDLL 3GI9L 2O5ZL 4YE4L 4EI6A 2VITA 1N59B 2CR3A 3QIBA 4UQ2A 3VXTB 2P8LA 3DETC 3INUH 5ESVB 2YUVA 5HHNA 4ELKB 3RRQA 3MJ8A 1ADQH 1N5YH 4O4YH 2QADD 1OD7A 4OCRH 2CKBL 4G9DA 1ODAA 3TFKD 2VTFA 2YBRA 2BSTA 4NC1E 1OGTB 1QLEL 1ZAGA 1FLRL 3V5DB 4NNPL 4KZDL 3KYOA 4XGZB 1H3PL 3HKFA 3LKNA 1H3XA 3ZKXB 5FUCE 3GFUA 4FFZL 3X3FL 4N5ED 3LRSA 4NQVA 4MCZA 3O4LD 4I2XB 5GS0H 1TJGL 4D94A 3T3PF 1CD1A 2EKSA 3BE1L 1HI6A 3IFLH 1FSKB 3ZL4H 2ZJSL 1CDHA 1QSEA 3QIBB 1JK8A 1N7MH 1RZJL 3U6RB 1I1AB 3HG1A 4XP5L 4ODHL 1UB6B 1CFQA 1ROWA 3HNTL 5KVEH 1A6AA 1BVLB 1M7DA 1U93B 5BXFA 4HH9B 4K3EH 4M5ZH 4PJ5B 3UYOD 1XF5B 1OAYL 4DVBA 5GZNC 5IHBA 5MI0B 4MQ7A 1IQDB 3NA9H 1B6DA 1TNNA 1FV1B 3B3IB 3MRQA 3QCUL 1AD9B 3PNWB 3OHXA 5L6YL 2VLRD 1KPVA 4WTXA 4HXAL 1MJJA 3B5HA 1WISA 2Y06L 4NN5B 4WUUE 4PD4J 4OLYL 1QBAA 4FA8A 3RVTD 4KKAD 4TUOA 3ZKMD 3TO2B 5FECB 1JYVA 4OV5B 1C5CL 1MCIA 4HPYL 4Z7WA 1CF8H 2DWDB 3MO1B 2FEEI 2BRRH 3DSNA 4F57H 4OD3L 5EUOB 5TGBB 2ZUXA 3HI5H 2OQJA 3VCLB 3R1GH 4PLJC 3D9AL 3VWJA 4ETQB 3LIZL 4X8JA 3K4ZA 3RGHA 2XTJD 1OY3B 2VKXA 4MCYA 5J11B 2A1WH 2R1YB 3BUYA 5D8JH 1WBXB 2A73A 4HJJL 1A6UL 1KENH 4NKMB 4NQCB 1RUAH 1G6RH 2KZWA 4Q6IC 1N2RA 1KOAA 2XOTA 5IVXA 3LQAC 4PY7A 1D5MB 3O45B 3TT1H 1AD9A 3CC5B 4I0PC 3N85L 5K59F 3RDTB 1ONQB 1CFNA 2VDML 3MLVH 5I8CB 5J6HA 5HI3C 1P84J 4TUJA 1K4DB 3QZWA 2XFXA 2HKHH 1XF5A 3QDAA 4OLYH 5FGBA 2YUZA 4JHBA 5CEZH 3RP1A 5D5MA 5E95B 4JE4B 2DQJL 1WJ3A 5JW3L 4LKXA 5FB8B 4RFNB 2X1WL 2DN7A 2LE9A 3KLAB 4U7KA 1BJMA 1DDHA 1J5OH 1OP5K 4GRWH 1CE1L 2DYPA 2WIIB 4M9OA 5DJZA 2OJEB 4GMSH 4K94H 1FBIL 1OD9A 2NY2B 3FKUS 4L4VD 1W0YT 3AB0C 3TESA 5ICXB 4U1IA 4OZHA 4Z7QE 4U1KB 1DEDA 5CS7A 3GSUB 5ITBL 3UJIL 1YEFL 4PREB 5E4EC 4DKFL 4FXGA 2HTKD 1ZANL 2XZQL 1KELL 2BC4B 5CEYB 3E3QE 2N7AA 5E99H 5B39G 3AGVA 5ID0B 2O5XH 1F4HA 5GRUH 1EEYB 2G9HA 2OXHA 5M7QA 3EO0A 5I76B 1NFDA 4UT7L 4WCYH 5C0AB 1JZ4A 1YYLL 4ELKA 4BQ8A 3P4OB 3QDMD 4U1HA 2F5AH 3GMLB 4GG8B 1AKJB 4L9LC 1C1EH 5FYJU 3RWIB 4N1HB 1U3HA 4LLMA 2FIRT 5JOEA 1SBSH 1H8SA 1CI5A 1MUJA 1TCMA 5MEOB 2R0WH 1XIWD 1C08A 2J8UB 3EZ8A 4HV8B 1TNMA 2EYTA 5HHXH 3ULUD 4JO2H 1F90H 3FO0L 5GRYA 4Z8FH 4GKSB 3HE6C 3RZCA 2YEZB 2CLRA 5FGSA 4Z18A 15C8H 3WIIL 3T77A 2PR4L 1F13A 4P57B 1YYML 4WWKD 4P4KC 2GAZA 1T0NA 3QA3B 1G7LB 1Z9SA 1ZXQA 1CD1B 1S5HA 1WZLA 3BIAX 3WUWA 4ELMB 1ZLSL 1EMTL 2GCYA 2Z31A 4ERSL 4LLQB 1NFDB 4J3XA 4KKCD 1XGTB 1V3MA 3MYJB 3OQ3B 4HLJA 4J4PC 3O3AA 5BCAA 1L6ZA 3TCXA 1IAII 2EE2A 4JCLA 2CK0L 4AYFA 4Y4HA 1F58H 3VMOA 4FHBD 1XT5A 3CFCL 5T3XL 3LSOA 4FFYL 4HC1L 4PGEA 4MQ7B 4FZEH 3AREB 3KPQA 4AENA 2QTEA 4PY8I 4LLWB 4W4NA 3HRPA 3T4AA 3ARGA 3O81A 5DMJB 3RIAK 2R0ZL 5ICXA 2P1YA 3R0MA 2P49B 3MLWL 1ZA3A 3FOMA 4P2RE 3S5LG 3UTPE 5BS0E 1N59A 2W65B 2O5YL 3U0PB 4OKVA 4Y7MA 4XHJC 4PB9H 3X11B 5BS0B 1O7VA 1JUFA 5D96B 3TGXA 4O51A 3HB3D 4NKIH 2CJUH 1U58A 4O9HH 4MZ3A 1YNTB 4JM4H 4WEUD 5EO9B 2JJTC 3ESUF 5F1OB 4YDVA 5DHYA 5E1AA 4IRJA 4PJDF 4XAWL 4IS6A 1AC0A 4ONHB 2X4SA 3CUPA 4IIQA 2HH0H 3KNBA 3S37X 3E3QC 3HNVL 1MJ8H 4YNYB 1YC8A 2NXZD 3INUL 1JV5A 1KB5A 2ZOKA 1Q0XH 4AEHH 4OLWL 1PZ5A 3TBWA 4GSDH 3ARYA 1G6VK 1KCSH 4UAOB 5E2TH 2CRMA 4XCCH 4YWGH 4L4VA 4YUEH 4NO2A 3MLWH 1UKQA 3SQBA 1PG7L 35C8H 5DDHA 3CXHJ 1MCCA 7FABH 3OJDA 5FK9A 2NY2C 3SDDA 1OM3L 3TN0A 2ZNWA 3T3PE 1CGWA 4JANB 1YZZA 1YY8A 2XN9E 3OKLB 4WFFE 5T3XH 1ZLWK 3WN5C 3LQMA 3MRPB 4XNUL 1T83C 3GMNA 4PJCF 4JN2A 4KQ3H 3IJSB 5DFTA 1NMBL 2AXFA 4YDVB 2W65A 3U0PA 3HMXL 4F15B 4Z0BH 5SWSB 3BRGC 3KJ4C 1OB1B 3A6CH 5CJQL 4OLXL 5C71A 3HUJE 2A6KB 4MA8H 1HHJA 3FB6B 5CMAA 5BO1L 4HKZB 5IG7A 1FO0A 1CL7I 1KN2H 1TTGA 1QKZH 4LARL 2VR9A 2BHZA 3DV6B 3H7BA 3WSQH 2EIZB 1E28A 5I71B 3IKCB 3WIIH 1MCRA 1ZHNB 1FYTB 3SE4C 5FM5O 3MRCA 1YPZF 5IR1A 4HWEL 4KKBD 1A02N 3FTGA 4WI5A 3WHXB 4HHAB 4YDJB 3SDXF 4QEGA 5A3IC 1ZT4B 2QADB 1XZ0A 1CK0H 4R96A 4LPXA 4OB5L 4ZUWB 4YXHH 3IETB 3G6JA 5EC1A 5JIKA 1WAAE 1NC4D 4OFPA 4UZGA 2Z8SA 2FECI 4TSCH 3MRLA 1MCLA 4LAQL 4HXBL 2DWEA 3VFGL 3GBNH 2ADGA 4TSBL 4KJPC 4NNXB 4MS8D 2Z92A 2GQHA 4NN7B 3M07A 4G9FB 4MD5B 2VL5B 1J18A 3VGEA 3QUMH 4M43L 3P2TA 2V5TA 3VFSB 3D2UB 4HV8A 4YBLB 5EU4A 1KJ2B 2DIJA 3DI3B 4K55A 4QF1A 3CXHK 3UDWC 2RB8A 4M7KL 4MXQC 3CU7A 2LV4A 2H2PC 3KVQA 1FHGA 1Z2KA 1T0NB 3BQUB 2VWEC 1KEMH 1F3DJ 4MZ2A 4Z76A 2D03L 3WLWC 4PJ5D 5DHXB 5SX5K 3PWNA 3RVUD 4LSVL 3TNMA 5HYQA 4G8EA 3RY4A 3L95A 3V0AC 4Z7VB 5JW4M 3OKNA 3VMPA 3DECA 3CSGA 3GMMB 4PGDB 2FL5A 2Q6WA 4XRCA 3EHBD 5EZJB 1F5WA 1IKNC 1PSKH 2ADIA 4HS6B 4XWOD 2WWKO 1OPGL 4H20H 5E7FA 4JKPL 2BVPA 3FOLB 3MBEA 5MEND 2J5LC 1RVFH 2VL5A 4ZAKC 3L7FA 5HY9B 5JDSA 1J0IA 3VFNB 1W72A 1A14H 4MD0A 1UKSA 4YGAB 2UVFA 4PGJA 3EO0B 4JY5H 4YHIA 2EDRA 5IJKA 3KLSA 2ADGB 4ZUVA 4GQ9H 3IGAA 1MCPL 1X5JA 2ICWA 2EDBA 3MA9L 3VFOB 1WC7A 2CR6A 5CJQH 4P59H 1MFDL 4HS3B 3MJ9A 1G7QA 5BRZA 2I07B 3LVEA 1MRDL 3C87A 5F96H 4F9LA 2GJ6E 3LRHA 3WN5B 1MFEL 1B4JH 3P0VL 4H5SA 4JLRB 1SJHA 4FTVD 4WEBL 2BRRL 3RBGA 3G5YB 4TTDC 2FX7L 4XBGB 4YQXH 3QAZB 1CF8L 3SKJH 1KCVL 2XWBA 4FQJL 1LP9B 4KDVA 1HQ4B 3ECBA 4F37F 2RCSH 1I3RB 2CIIA 4D8PA 1F4XL 4OZ4A 1ZGLA 3WFHA 5DJAB 4Y8DC 4P3WA 3V79C 3H42H 2QHRH 4NQEB 1DLFL 2ZG1A 5TE6H 2FEEL 1EERB 4GT7A 5DUPL 4NT6A 1A7NL 4KRMB 4XH2A 1X6LA 3KR3L 3GBNL 4JZJB 2X4QB 4K9EL 4GW1B 3QZWB 4XMPH 1L0YA 3WV0A 2IANB 4JGMA 1CLYL 3U7AA 1JE6A 5HTSA 4PJ8D 2ZSVB 4YHZH 1J8HB 4NN6C 1QEWA 2GSIA 4J3WA 3D39B 5GQBA 3JTSA 4LVNB 1RUPH 1AFVL 1CFNB 5D7LA 3PWPB 4Z5RB 3TT3H 3FB5B 2XKUA 4YAQB 3QDGB 1KPRB 5JUEL 4JJ5A 3FFCE 4MA3B 1F4WL 1R3JA 3RNQA 2I25N 3L6FA 2PTVA 4ZUSB 1NDMA 3AU1B 4AK1A 1FVEB 2VDOH 4DW2H 3U6RA 4J8RA 3U7YH 5JNYA 4PJBE 4YR6B 1AIFA 4EVNB 2DM3A 4R97B 3RL2A 1UXSA 3F7YA 1KGCE 2P45B 3BDYH 3CDFA 4Y5VC 4BFBD 4MJIE 4N68A 2YPLA 3RGVD 4J4PD 1YUHA 3P0GB 3EJZD 1AGBB 5HBBA 3FQRB 3DXAB 4KH2A 4NT6B 4U0RB 1NKOA 3BP4B 4FQQA 1NCNA 4JFHE 4R4FH 3OAZH 2R2HA 5CEZD 3OXSA 3NCFB 2R4RL 2L7JA 4KVNL 1DJSA 2E5EA 4PV8B 1FGNL 1WBYB 2F54E 1WFNA 3TCLA 2PXYA 1NEZA 1A3LH 4XPBH 3TYGL 4D0DA 1NGQH 4KGLA 5TGBA 1A1OA 1UEYA 4BA8A 2VE6A 4HS8L 1BQLH 4YFLI 4S2SA 1RUML 1X9QA 2FGZA 4KV5F 4ELMA 5DMGC 2CDEA 1L4IA 4D0BA 4OCXL 5CHNA 4OT1H 2X1OA 2WP3O 4W4OC 3ZSSA 6FABL 4O2EA 4LCWD 3QUXB 4J3VA 5DD5L 1PW3A 4ODTH 4WW2C 4XMLL 1XF4A 1G0YR 5F1KC 4CGTA 3JTTB 5D1ZB 3HUJF 1CIDA 3FCTA 5E6IB 5BRZD 2A6JA 4PRPB 5ICZB 2X5PA 2UUDK 1N3NB 2ADIB 5E08H 4XP1H 3C60D 3RZCB 1N8ZB 5AUMB 3I75A 4LSUL 1HHIB 3UMTA 1WBXA 4M03A 3B9DA 1J1XH 1YPZE 2AXGA 3AMLA 5T5FH 1XF2B 4UDUA 2MFNA 3QSKB 4KJQC 4MXWH 4S1QL 3S9DB 1GGUA 2BK8A 5IROA 2DM7A 4I2XE 1K8IB 2W0FB 1P5VA 4U33A 2VAAB 2CMRL 5HI3D 3BO8A 5HVGB 3S98A 4P9HC 4JGUA 1FNHA 4Z95L 2X42A 3SGKA 3REVB 1KCRL 3B5TA 4PP1D 5HVFB 4G8GD 4IHOB 4OZGF 2ZUSA 5CP3A 4CBPA 4Y4FD 4IMLB 3H9HB 4XXCA 5DS8B 4K8RD 4RMWA 4L3CB 1DANT 1J9CT 3RX5A 2YN5A 1UG9A 4W6XB 1WWCA 4MJ5B 5CILH 4RMTA 3KPSD 2UWEE 3EFFB 3B2VH 3MXWH 1ACYL 3GBLA 3GRWH 4F8QA 2D0FA 4TUKH 3AS3A 5C07B 3IDNA 5HHXL 3STLB 1URLA 2GTWB 1YY9D 4WFED 1CE6B 3C6LA 1HQRA 1FIGH 4TTGA 4Q6IA 1VB9A 2ARWA 3G9VA 4QHNB 2RAMA 3JWOH 1FAIH 2MKLC 4CU7A 4HX1B 1RIHH 1RUAL 2PO6C 3FB7B 4FFVC 3I02A 1AKJA 4R2GD 1VADA 5DJCB 2UZIL 1M7IA 4EZMA 4QHLA 2ED8A 1CGVA 1I9EA 3DBXB 4G6JH 5CP3H 2F5AL 4ZOBA 3W81A 4JN1H 5C2UB 3RVXC 4G9FE 5T1LD 3U82B 1IAKA 3JV4A 2B5IC 3GZKA 4LIQE 2VL4A 4UTAL 5DO2C 1HWHB 1C16B 1QFPA 3S34H 1Q0YH 1KELH 3Q48A 4GAYB 5DS8A 1YEFH 4PYGA 4Z7UF 4POZD 4P46A 3VI3E 3ALPA 5D70H 1NBVL 4LNRB 4NZUL 1EGJL 3G08A 3NBNA 1LK2B 3KXFB 3MODL 2D31A 5LQBH 2C3GA 2OQJB 3GMRA 5ADOH 4M7LT 4EVNA 5DQDH 4LLYB 5HYIA 3OKOB 2Q76B 2P5WA 4UV4H 4NWUL 2YD9A 4KJYA 3H0TA 3THMH 4FQLL 1SBBA 4K7PH 3IB4A 2JJSA 2MHAB 4ORZC 2A6IA 5TDNA 1ADQA 2ZUQB 3QEGH 4Z7UA 4CMHC 1HSBA 2GT9A 3RAJH 5JQ6L 3LS5L 4LQFH 3GHEH 4FOMA 4GW5B 1N0LA 4HEPG 5IESL 4JPKH 5I15L 4FXKB 5IJKC 4LPVA 4WW2B 4QHLB 1EFXA 3O6FD 4V2CB 2FWOA 3VXSA 2F53A 3IU3B 3ZT6A 3PGFH 4PJDA 5I1AA 3VJ6A 4ZAKD 3RWCB 3KHQA 4LNRA 2F8OA 4QHNA 4LVHB 5KN5B 3JXAA 1A9BA 5ISZE 3PGCB 5J1SC 3MV8B 1FC1A 3BW9B 4OFKA 1U93A 4U6VL 5BXFB 1F02I 4OTXL 4U6XA 5DD5H 1A7OL 3BEWB 5L0QC 2DQFB 1CLZH 1IEBA 2NYYD 3E2HC 1KJVA 3MLZL 1JNJA 4RBPH 7CGTA 1FZOA 1NGXA 4U7MA 3BPLB 4O4YL 1MHPH 5J1AB 4LSRH 5DMKA 1RZ8A 1EO8L 1T89C 3EOYG 1MHCA 4AEIH 4NKQB 1WT5A 2DB8A 4HGWA 3FN3A 5EN2B 3OWEA 2X4TA 2G5BB 1NC2A 4UIKL 1R0AH 4V1DB 4NQXB 5IUSA 4DFHA 4OZFH 1J88A 4FP8H 4PTTB 1AP2A 1AQKL 2V17H 4MXVF 1HINH 4ZTOL 5JXAH 1CICC 4S1RH 1ZLVH 3A6CL 2NXYC 4E0RA 3QUYB 3MBXL 2VIRB 1YECH 1U8MB 5ILTH 3BMVA 4NPYB 5HPOA 3T4YB 2DQUL 3PWLA 4U1SB 43CAB 3TPUB 4OLUL 5E8EA 2F53B 3IU3A 4ODHH 4XBPB 1P1ZB 4DK3A 4X6DB 1L9NA 1KEGH 3TA3C 4L8SA 4JZOA 3U83A 2VDOL 3HAEB 4LSDA 1MLCA 3FFCB 4QXGH 1P7KA 5EZOL 5E2TL 4FFZH 4HZLB 2VMFA 5M95B 2A0LC 3I2CH 3BFOA 4X9IA 3LKPA 3QDME 3TBVB 1MCWM 1YJDC 3CFKB 1OT2A 4L8BA 3T65B 5GGUB 2EC8A 4LP4A 1AC6A 2BSED 1RJLB 5MERB 4DZBA 3LN4A 4YDJA 4HK3J 3L3GB 2BOBA 2JIXD 5JXEC 3E8UL 1A3RL 4OQTH 1ZHNA 3MC0A 3UTQB 3VDAA 4XVTL 2F9BT 1OCWH 5A3ID 2P43B 4OM0L 4G7YH 5GPRA 2HVJA 5ECJE 4XCYA 43C9B 3KWWB 3T0ED 1D9KD 3ZLQC 1OAXL 4U1KA 3KPMA 4PPTA 3IDGB 4MD5A 3A0OA 5IEKA 3P4MB 4NP4H 1FNGB 1BOGA 4WTZA 3I50H 1FDLH 3NACL 5CEYA 5C0CB 1QSFA 1F2XK 5F8QC 1MI5B 5E8DL 1D5BA 4KJPD 4MS8C 5F3BB 3HFMH 3QHZL 1OSPL 1GGCL 1KEGL 4YR6A 5DJXB 1G7HA 3L3KA 1C5DB 2YC1A 3HE7A 1Q9KA 4X6DF 5EB9A 4L8DB 4LSQL 3B6SA 1CFSA 4HUUA 4JJ5B 3HC4H 1JGLH 4JG0L 1DFBL 4JRYA 3RVWD 5FA4A 1LE9A 5IW6A 5FA3A 1BZ7B 1ZGLP 1BM3H 4Z7NE 2Q1EA 5IB1A 5DUML 3PQYA 4LSUH 4Q9RH 1QSED 4N8CH 1IMHC 4CRPA 3MRJB 3RVUC 4P2RA 3KNBB 1XF3A 3OAZK 4NUJB 3GNMH 3MRDB 4AIZA 1ZTXH 4DEPB 4WFGD 1U3HC 4H88H 1R3LA 5C07A 5DMYA 3R8BB 5TE7L 2BVTA 3OKNB 1GCFA 5I18L 1RVFL 3CVHH 2BJML 5HHOD 3L9RB 4PJ9B 1MIML 3GMPB 1OARH 4G6KL 1RZ7H 4FQXA 1FORH 1OQXA 2BNRB 3KS0H 4NHCH 3QFJD 4N90E 4EDXA 3KPMB 5EU5A 1C8PA 3P4LA 2R2CA 5TDPB 3GO1H 4JDZA 3GSNA 5J13B 4X6BA 1T03L 1KTDB 1QBLH 3C2SA 3ILQD 1UQSB 2CGRL 2VXSH 4PGEB 3I3BA 5B8CB 4PRPD 2M26A 3RX7A 1CICB 3G04A 4LSSL 5GZND 3MRNB 4K2UL 5DVKA 5E0QA 2WUBL 4PJFA 4UB0H 1C5DA 4OZIE 1JZ6A 1XF3B 1Z3GL 3FRPG 1EEUA 5KSUA 2D7MA 2HJLB 1IL1B 2F74B 2A83A 2DICA 4OCMC 3AM8A 3WJJA 5F9OH 3H3KA 3SPVA 2P42B 3W0WE 3W9EB 2A74A 4KXZH 4YBQD 3RVTC 4G5ZH 5KSAC 5TE4L 3DURB 5CCKH 3NGBB 4GMSL 3S35X 3VFMA 4ODXB 2QHLA 3CSYB 2P5WB 5IV2A 3QXWA 1JL8A 2HA1A 2VXQL 3PWUA 4MNGE 4QCIA 4NYLA 2FATH 3VFVB 1V05A 1LO2L 2JIXA 1UJ3B 2CRIA 4IDJH 1CWVA 5HPMB 1TJIH 2XTJC 3KPPA 3IFPB 4JQIL 4QRPD 4CADA 2IF7A 4B41A 1OOAA 3MLTA 2AVGA 5DJYB 1DQDL 4R90H 4CW1B 3VXRA 4E42A 1QA9B 1JNNH 2VDRL 3OTTA 4C56B 5ID1B 3FB6A 3KYMB 5I18H 2FHCA 3K2MC 4YHZL 5IIEA 1WFUA 3HPJB 3PABA 2X44D 4UTAH 1CICA 5I1GH 3HZMB 5GJSL 2F5BH 3GMNB 1IC1A 1CLCA 3LY6A 2DQTL 4YH6A 4XP6H 3EYUH 4ZDHA 1FH5L 4IHOA 4HGKC 2ICES 4JFDA 3S4SA 4DFIA 3BWUC 4BQ6A 4IOIB 4Z0BL 4QNPE 1FG2B 5IB5B 3WO3B 3RWEB 1W8OA 2RCSL 3PF2A 1RZKL 5CFHA 1YEDB 2DQHH 1W8NA 5FDWB 4OD3H 3FRUB 5J12C 4PJAB 2CSPA 3TIDB 2NZ9C 4R26H 4CN6A 1A4JA 3EAKA 3HNSL 3BDXA 1CD0A 4RA0C 4CN4A 5CD5C 1NCWH 3WIFA 3WIHA 4R8WH 4X6CF 4JRWA 2FX8H 4HKBA 4XC1H 2P8PB 4JFDD 1WITA 4I48B 3O6FC 1QVOA 5GHWL 1JZ5A 3QCUH 2MWCA 3KAAA 4U1GB 3MSPA 3QPQC 5JHDE 5J57B 3ZO0A 5L88H 3EO1A 5GGRB 4M5ZL 4G8GA 3VG0H 3MLRH 4NPYA 5I1GL 1RIUL 4Q0XH 1BOYA 3MNVB 3DETD 5EOTA 5JHDB 4M6AA 4JG1L 2W9LA 5CEXB 5GRWA 3WO4B 1X4ZA 3N1MC 4JM4L 4LMQE 5DC0A 1TTFA 1D5IL 5GS1A 1UB5A 2WUCH 5FO7A 5C9JA 3D39E 5ACMA 2X1XR 1FCCA 1YN6A 4UDTB 5E00A 2EZ0D 3AVEA 5IJVB 2O61B 3MRKA 3KYMA 3QI9C 1LO2H 1U8LB 5LWYH 5AYQA 2Y25A 3ABZA 1M4KA 2BZDA 1BQUA 4NZTH 1HHHB 3QDMB 1A9BB 1TZGL 4ESKA 2Y36L 5BZDA 5F1IB 3V7MA 1HEZA 3N50A 4A6YA 1F00I 4G3YH 3T0VA 1WEJL 3ALXA 1F6AA 3BGFB 3TBTB 2ESVE 4F7MA 2EDFA 4ZUTA 4MXWL 5JO5B 4UI2A 3V0WL 4TPRL 3TJEH 1QBML 2C3VB 1YMMB 5D7LD 4PP1C 4H1LA 2J12B 2J8UA 2ZCLL 3TV3L 4D9RE 4YFLF 4XPBL 3TYGH 3WN5A 4LOUD 3BHBB 4PD4K 4PUBL 3PWPA 1IJ9A 4MA1C 3LDBB 1FVDB 2GTWA 5IBTL 5BZWA 2A83B 1DQLL 5BQ7B 3FMGH 3MUZ1 5IBLD 3X12A 2VLJD 2ZCHL 4ZD3H 5T1KA 1VFUA 4LEOB 5DURB 2UY6A 2JLLA 5GJTL 1CK0L 1QLRB 4EI5A 4GH7B 4RDQG 3EYOA 4MNGA 1ZHKB 2K7PA 1R5VB 2AV1B 4LHJB 5EA0L 4A6YL 3O3EA 1C1EL 1T0MB 5LBSH 1ED3B 3PGDA 1U8KA 1S3KH 3BUTA 3H8NA 3LCYA 1CFVH 3ZYOA 3V52L 3CFBB 1S7QB 4E0RB 2CIIB 2X9YA 1GH7A 4QHKJ 4GBXD 5E99L 4HGMA 4NKOA 3VGDA 1DVFD 1ERNA 3D5OF 1RU9H 1UCBL 2QQKL 2DL2A 2HMIC 2DWEB 3C5JA 5CUSH 1LDSA 5I1HH 5FM4A 4JG0H 1MAKA 5JIIA 4FQ1H 3T0XA 1IC5L 9CGTA 1VERA 2QQLL 4ORGA 1RK0B 4APQA 2AI0L 3OGOE 2J6EH 3LQZA 3NH7H 3TVMD 4P5TB 1F6FB 1H9VA 1K5NB 4ZTPL 2DOCA 4M1DH 1HZHH 1IZJA 4YPGA 1XR8A 5K9JH 2HJKB 3MOBL 1JBJA 3I3DA 1NJ9B 3RNKB 5KSBA 4P0DA 4M62L 3BJ91 1T1WA 4ZUUA 1T89A 2YSSB 2F54D 5LQBL 4PJ9C 4G9FA 5TJWK 4Q2ZB 1WBZB 4NP4L 1ITBB 3C5ZA 2IPKB 4UIMB 1HKLH 1DLFH 5IB2A 2AJ3A 5CZXD 1IQWL 2P7TA 3MJ7B 1PYWA 2VYRE 3QIUC 4WW2A 4WHYH 3HNVH 4G8EB 4GAJH 3W5MA 2CK2A 3BP4A 5ESQB 1WWAX 1XR9B 4F58L 1T3FB 4HCRL 2V5RA 2H9GA 4KKBC 3TT1L 3QWOA 2BNUB 4WRLA 1RULH 4KU1A 5L88L 4KDTC 4OZGE 3BZ4B 3L5IA 3SE9L 3BW9A 4UV7L 1U8HA 2P5WE 5I66B 4KK6C 3VRIA 2QHRL 4R4BA 3B9EA 4LLVB 3U36B 1YPZA 3O2DL 1FVCA 2AABL 1X44A 1FFOB 2UWEF 2ARJA 4PG9B 1CVRA 4JY4B 4LLUA 3ECBB 2FX7H 4N0FB 2P46B 5MEOA 1NGZA 5F7KC 5HYJD 1QSZA 3SGEH 4L3ED 3GRWL 5ETUB 4F3FB 1ZEAH 3NCJH 1SJHB 3REWB 1BFOB 4G8GE 3ULUC 4TULL 3FFDB 4JZNA 1UWGL 1EMTH 2VDQH 4WDIB 4YBQC 2JCCB 4U0RC 1OVZA 4U4BA 4P4KD 3QUXA 4I0PB 3FN0H 5FA3B 1VCAA 3CNKA 3AFLA 5DJ0A 1IILE 3FONB 1EEYA 2G9HB 2ZSVA 2B1AH 4LSTL 4M8QB 3N06B 5F89B 1JI1A 4HJGA 2MOVA 4IJ3C 5A43C 1E27B 2VQ1A 2PYEE 4JFYA 5EWIH 4ODUA 2ZJSH 3MROA 1HQ4A 1Z6JT 2DIAA 2LFGA 4LLWA 3T4AB 3SDCB 3U1SL 1B3JA 2HP4A 3K8LA 4PG9A 3O9WC 4JDTH 4UT9L 5F71A 5SWZB 5TF1L 4X6EB 3QR2A 1KC5H 4MNQE 3GSXB 4JKWA 4ZMAT 2KL6A 2HN7A 5GGVY 5H35A 2BHYA 3WD5H 4CVXA 1MPAL 1ZVSB 2WINB 1WWBX 3RZCC 3OF6A 3Q1SH 3FONA 2CKBH 2R0LL 5ETUA 5IVXB 1KLGB 3SGJA 5FF6A 4OT1L 1FGVL 1JPSL 4U1LB 3UZQA 2L7UA 1IC7H 4Y5YA 3PL6C 5EUKB 3MBEB 5IMLB 2VR5A 4X4ME 4K2UH 3U4EA 1UVQA 3U9PH 5E1HB 4M62H 1OTSC 2ORBH 1P9MA 3ILPB 4YDIH 5D93B 5CD5D 4PGDA 1MQKL 2Y4SA 1T5XB 5FYLE 4ELME 2JELH 1G9NL 1N0XL 4OI8A 3PWVB 4Y2DC 2AI0H 2MMXA 2P48B 3OKDA 1NAMB 5CBAA 3ZDZF 3H9SB 2E9JA 1FORL 3VU2A 1W72H 1CBVH 2OZ4L 3MFFB 1CGSL 1UCBH 2QQKH 3LKOA 1AO7E 2VDMH 3MLVL 4Y2OA 1J11A 4W81A 3DRQB 2ITDB 3D25B 3VW3L 1NC2D 4FQCH 4OAWB 4NO0A 3WSQL 3MLSH 2EH7H 4RNRB 3TCLB 2APFA 4OZ4B 3HPJA 2EIZA 1AXSB 3GI8H 1JZ7A 4XNYL 4X5LA 1JV5B 5HJ3A 4Q9RL 2WIIA 3BGFC 3JSSA 4QOKE 3SKNA 3V5DA 4D9QE 3SBWC 2AEQH 1BGXH 5FOJA 2HTLD 1GOHA 3VG9B 4AT6A 5FUZH 5FB8A 2AQ3A 1KB9J 4LSQH 4EUPG 5E2WH 4Z78B 4F2MA 3B9KA 4ZUWA 5J9PB 3JTTA 5D1ZA 2R2EA 4EUPH 1BWMA 3PWLB 3KR3H 3GK8L 3DUUA 3IU4H 1KTKE 1TENA 2FYYA 3GBML 1PEWA 4LMQI 8CGTA 3H9SA 4I0KA 2VSDA 4GKSA 1CGUA 3DGCR 2XICA 3LRGA 1ITCA 1T1XB 1MUJB 1KTDA 4JFZH 4ZPTA 3LKOB 4PRDB 1ZLUK 4HC1H 5T3ZH 2Z91B 4V1DA 1FPTL 1ZGLM 3CD4A 3FB5A 3P0VH 4A6YB 4MXQD 3LEVH 1A6ZB 3STBA 4NCC1 4HUXB 3BUYB 3TWCL 1MY5A 1ULVA 4KZEL 1S5HB 3EIFA 1UCTA 1YMMD 3CX5K 4CVZB 3H3PH 3ARED 4J8RB 2GJZA 1D5ZB 2IALB 2DYPD 2PYEA 5DEGA 3VCLA 4WVRA 1E4XL 1CFTA 4PRIB 2Z4QA 4BZ2H 5CINL 2PR4H 3QEQA 1JZ3A 3FOMB 3KPOA 4MX7B 1WZ1H 4X80L 3P4NA 2QL1A 5INCB 5ESQA 5BQ7A 5FO9B 3UYRL 4X5WA 3KPQB 5LBSL 4HZAA 4LCWA 4AENB 4ZXBA 5FGBC 2N1KA 2OL3B 1EFQA 3DUHA 25C8L 4XPTH 3WYRA 4HUMB 3PL6B 4ZPTB 1N5YL 1ADQL 1MCQA 3MRIA 1NCBH 1RFDL 1EAJA 4R4ND 4S1RL 3EW3B 4RISL 4OLEA 5BOPA 1FNFA 4E41E 2ZCKH 3BMWA 4OZHF 1IGTB 1HXYA 4HT1H 2CLVA 4O2EB 3PQYE 1PD6A 3SKMA 3VI4F 3R8QA 5KSVA 1DBAH 1JCKA 3KJ6L 4IRJB 4Y5XB 2WLYA 1N26A 3B9AA 2IH1B 8FABA 5LJYH 2P8MA 5C09E 3QO0B 2IPUK 1H3TA 2DQIL 3JWNC 32C2B 4K3DL 5C07E 4P9MH 2VLJA 3U0WH 1NFDF 1Z5LA 3Q5OA 5DGRA 1A22B 1I7ZB 3IT8D 4YO0A 1OGAE 2LAAA 3V0VA 1FNGA 3BDYL 1IEAA 1QYGH 4P5MB 4WWKA 2Y5TB 3SGDI 5J06A 4YHMH 4G8GB 2P5ED 3QEQB 4PS4H 3BH9A 3L3HA 5B21A 1E4KA 3O3UN 5DJ2B 3RY5A 1FJ1B 1F8TL 1QRNA 4L1HA 3RA7H 4OM1H 4X4MA 3BO8B 1T0PB 1VESA 5J89A 4M5YL 3MRMA 5EU6A 5E5MA 4EXPX 2LTQC 5ERWB 5KJRL 1I9RL 3C60A 3QIWB 5I71C 1UZ6F 4E5XB 1G7IA 3UZEA 1F3DH 3RAJL 5JQ6H 1X5LA 3UTTA 4DN4H 1JFQH 1M05B 2V5SA 4C56E 3D18A 2VOTA 4TVPD 2B1AL 4LSTH 2XZAL 1I7UB 1CDYA 1CXEA 4UTBL 1KTLB 4Z77B 4YHML 4PTUA 3C5SB 3NFSH 4F7CA 4N0UE 2OYPA 4QRSA 2F53D 3SDCC 3EUUA 1NBYB 4TULH 4HK3N 4PTTA 2FX8L 4OFDA 4M7JL 3NCJL 4PJGB 2H9GB 4PG2A 4PY8J 3K2UH 1ZT4A 12E8H 2R2EB 4GMTL 3VXRD 2R1WA 2V2WA 3HNSH 3EO9L 4GRLC 4HAFA 3WUWB 3FFCD 4RA3A 2DQIH 3RTQA 3WDIA 4FTVA 2IEPA 4NUGL 5EU4B 3SY0B 2JB6B 3AY4C 2YD3A 3QUMB 3LOWA 5JPNB 1J0YA 3OHXB 3RHWF 4P46C 4PRHD 4LDEB 5F7UA 3TN0D 3MV8E 4KRPC 2XPGB 2VDNH 5IW1A 1JF1A 3DARA 3CSBA 1F6LL 5I1DA 2OK0L 2D0HA 3TIEA 3JV5A 2XY1A 2R0KH 2MPAL 4OCLC 4PJGF 3L5XL 5IBLC 4MAYC 1S9XA 3F58L 2LABA 3WS6C 4ACPA 3QDJE 3WNOA 4UU9A 1NUGA 3K7UA 3BZFA 2E7CA 2VZUA 4Y16B 2VLLB 1BWWA 1T0MA 5JA9A 3BEVA 1I9RH 2V7HB 2J5LB 5HSFA 1DQQA 1PSKL 3ARUA 1IQWH 1HILB 4WUUD 4NKOB 4D3CL 5LXGL 1I75A 1IVLA 1IBGH 1S9KC 1J1OH 4PJHB 2F58H 4P49A 5DD0H 1RZIA 5HHQB 1BZ9A 3RWGA 3PWPE 3WIFB 1OAYH 4HKJB 5GGTH 5C7XH 3GB7B 3OR7B 1ONQA 5I8CA 4QWWD 4ZSOE 2VLME 4DKAA 1UADC 2H45A 4AL8H 1WBYA 4FZEL 5GGSB 2B0SH 2EO9A 3ARRA 1TCRA 4OGXL 4LCCA 5F9WB 3AAZA 3CFCH 4AEFA 1KXVC 4YK4B 3B9KC 1BIIB 2E9BA 5SX4H 2J88L 1ZSDA 4ZOAA 4AM0B 5I6XB 1PQZA 2XTJE 1NDGB 1Y0LB 4PGBA 4X4XB 4MSWB 3O11A 1LWRA 1PZUB 3ZKXC 2VB5A 1Q72L 2NX5B 3RWJA 4Z7OE 3QNZB 2DDQL 4EN3D 3BP7B 4MB3A 3CJJA 3LQAH 3W11C 1MIEL 15C8L 3TZVD 3U2SA 1Z5LB 2Q3AA 4TSCL 1UJ3C 3QIUD 2BNUA 1FSKC 2FJGB 3C2AH 1S9WA 4J7RA 3AMKA 2RIKA 2P7TB 5FYJE 4FQXD 5KSAA 3HMWL 5K9OA 1UA6L 3UXFA 3DIFA 1YY9C 2I5YL 4XAKE 3L5HA 1HILA 5JMRA 3D3VD 3F62A 1X7QB 2CKBA 4JKLA 3OAUH 4I5BA 3A6OA 5FF6B 3RWGB 2EKSB 3KLHD 5D2LB 3SE8H 4R2GC 1KJ3L 4BQBA 4C57C 2VXTH 4R96B 5JHDA 3LKQA 3DX8A 5C6PB 1J87A 3EOBB 1BBJB 2EXYC 1D7FA 3Q5YA 4KK6D 2Q7YB 3T0EC 3TV3H 3RL1A 1OAQL 4NN5C 3UTTE 2APWA 2QLVB 5EIIB 1A9EA 1S7SA 5DVLA 4ZXBB 3SKOB 2QSVA 1I9IL 1QFWH 3FQXA 3K4DA 5I75C 1ZVHA 1S8DA 4JQXC 4XBPA 4HJ0C 2OR9L 2KZ1B 1B6UA 4M7ZC 4KQ3L 1HHGA 1SYVA 1E4XI 2XZCL 4KI5F 4PRNB 5DJDB 1B2WH 1LILA 3MMEA 4ZO6A 2B0SL 1JHKH 1P6FA 2VDKH 1T7YA 4JM2F 4YHNA 3CVHA 4FQHA 4L8BB 3U48A 5E8DH 3V95A 5I8EB 3UO1L 3O8XD 1OP3H 2BOBB 4GJTB 1J1OL 4OLWH 1MCOL 1T1YA 3TT3L 4L8CB 5JR1H 1K9TA 2WUCL 3AY4A 5BMFH 4HFUL 1C7SA 2AK1H 1YN7A 5F6HJ 2C4FT 3S3PA 1T1XA 4UBDC 1AI1H 2VITB 1MAJA 4NQDD 1A9EB 1S7SB 2AJXH 5EUOE 2GUOB 3SKOA 4FNLL 5H35B 4YHIB 3OJVC 5C08B 5DSCB 3QH3B 2EYRA 5D6CB 1W72B 1JGUH 3EOAB 3VXNA 5C08E 3S8WA 2VC2H 3S96B 2VN7A 1KIUA 2ED7A 2MPAH 4M6MH 1QTYT 2R0KL 3SDCA 3FOLA 3PG2A 3CFDA 1YEKH 3T09A 4NKIL 3ARBC 3ZMRA 5D8JL 4LKCA 5JO5A 2ADJA 4NQCE 4LSPL 4UNTA 4GG6E 1CLOL 2OJEA 3H2WA 5E2UL 1MHHA 1Q94A 2GK0B 3GKWH 1G0XA 5CKGA 2HT2C 1MCEA 1YMHB 1NJ9A 1YNKH 4MA7H 5CJXA 2CDEB 1IKNA 4NQDA 4Y5YB 3MJ8B 3C60B 3RZCD 1U92A 3OXSB 4OGZA 1ED3A 4XGZA 1CZ8H 2R69H 3VFTB 2HFGL 5AAMA 3H6JA 4PB0L 4DAGH 4NQVB 4NIKB 4V2BA 2FX9L 5D1QB 5IVXF 4DVRL 4HIHB 4P3CL 3PL6D 4G6ML 3DX7A 1YEIL 4LU5H 5C0AD 4ZFGH 3GKZA 3B8SA 3P40A 5GRXG 2YD2A 3WO4C 4PJ8B 1HH9A 5D6DA 4K3EL 3PXJA 2VLRA 3ARDB 1UVQB 1PLGL 2AK4B 5J6GA 1NCCL 1A1NB 4QRRE 1CICD 1G1CA 5JOFA 4YHYB 4AIXA 1K3IA 3BOVA 3VRIB 5GS1B 4WUKL 5E9DB 4JO2L 5D7SH 1EAPA 4JY6B 3ZTNH 3FQWA 4I0CC 2R0WL 2QKIB 5E9DE 5TDOB 4X7EC 3T77B 5CIPH 1PGRB 4QT5A 4X7DC 5DGQA 5FOBB 3RA7L 3KYNB 3F7VB 1FFQA 5CGTA 3QBTB 2H32H 3IRZA 3TA3D 1NLBH 4Y19A 4LSPH 1QR1B 2EDYA 5EZLA 3S37H 1V3JA 1MRFH 4OSUH 5TQ2L 2XN9D 2C5DC 2XNAB 4GRWE 1YYLH 5IR1B 3OJMB 1I7TA 1OHQA 3FFDA 3NPSC 4Y4KD 1RZFL 5DFVC 1X5XA 3PHOB 4X98B 4KDTA 1QG3A 4KROC 4PJGE 2R9HC 5CEXA 4IRSC 1PDKA 4K3JH 5IVZA 3HE6D 4NKMA 4ZUUB 4P4RA 2R1YA 2QQNH 3RHWK 3QDMA 5C3LD 4LCYA 2J8UE 2VJXA 5AZEH 4J6RL 4L4TA 4LVOB 5F8RC 1E27A 1H0DA 1BMGA 1DTUA 4OZIA 1X5GA 3BP6A 2VLRB 3ARDA 4OKVB 1XGQB 4BQ9A 1BEYL 4QLRA 3VXMD 3QJHA 2FO4B 3VFGH 1SM3H 1L0XA 3MOBH 4NNYB 3MJ9L 1HZHL 3FN0L 1RURH 3BPLC 1QR1A 3H9SE 4HFWB 2ZUTA 2DQCH 4HZLA 5E94A 5DJCA 3GGWB 3IJYB 1XH3B 4YXHL 2F15A 4KRPD 2X05A 1QHPA 3BP5A 3ZYIA 1X4YA 4L8DA 3HR5A 1SEBB 3VFRA 1S7VA 2KBGA 1EHXA 5CUSL 1UM5L 2IGFH 4I3SL 1QFWL 5IW6B 4DUXA 1T20B 3T2NH 3G5VB 1AHWA 3BVNA 3VE0B 1KIQA 3HB3C 3WHE1 1CXLA 1X5FA 2YPKB 3V7AE 1CDGA 1UWXK 4NRXA 3RU8L 3FT3A 3HAEG 1OP3K 5D4QA 3BWAB 4IIQC 3BSZH 4PRHB 4XRCB 2EC9U 1G7MB 3QUYC 1N6VA 1R3HA 5CWSB 4ZSOB 1QZ1A 3Q3GA 3HZVA 1YQVL 1IGFH 1ND0A 5AYUH 3VWKD 3OPZL 3DHJA 3V6BR 1U3HD 4GW5A 3TO4A 2EKJA 1CDJA 2EYRB 5D6CA 5MP6L 3DVNA 3QG7L 3BH8A 4WY7H 3DX6B 5L0QB 2I26N 1U3ZA 5MHSE 3BGMA 5CGMA 3HHRB 1S7TB 3DRTA 3GMLA 4Y0GA 1DQLH 1VFAB 3E6HB 1HKFA 1OSZB 3PWJB 1HXMA 3C5ZB 3MACL 5I76A 2HT4D 4HCRA 1RHFA 2DQFA 5HHOE 3G6AA 3SY0A 2IADA 1OT1A 4S0SD 4KI5C 3D25A 1MI5E 3ILQC 4E41A 3GGWA 1BD2D 1Q72H 4FZ8H 3NCYP 3QUKB 1B0RB 4NO5A 1LO5B 3DROA 2ZUWA 3ULVH 4G42B 4PJ7A 3VFWB 5CWSA 2DIBA 3PP3H 5EU3A 4JR9L 1RK0A 3PHQA 8FABB 2IPKA 4UIMA 1MCFA 3FT3B 4LF3A 3MGOA 4EKXA 3CX5J 1U8OB 1QQDA 4RX4D 5DF0A 4X99B 4JKMA 1NANH 1TJGH 2H1PL 3K81A 1G7MA 5E8EB 1NPUA 3D48R 1G7JA 1AKJD 1BD2A 4ZPVA 3G6JB 5EC1B 3WFEH 4OCWL 2WBJB 3GRWA 4OCWH 4B0MM 5JOFB 3MV9E 4XP1L 4HX1A 3C9NB 1FO0L 4LFHD 4DGIL 5IMLA 1KG0B 1AHWB 3BVNB 3P73B 4YBLC 3VE0A 3WS3B 1T7ZA 1MCHA 5BW7C 5JLZA 5E5MB 1FL5B 1MFCL 4MJ2A 3FQNB 4IOSD 3T0AA 5JW5B 5KSBF 1Q9OB 1P2CB 4KTEL 2V9RA 1QLEH 1QRNB 4PV8A 4V1DD 3LD8C 5DXWA 3NOIA 1S9WB 4U2YA 1BLNB 1MJUL 4WFHE 1JGDA 1WLHA 4OIIL 2QEJA 3OKKA 2Y5EA 1LNUB 3FQUA 2VDNL 2BNRE 3QUKA 5LGHH 3QEHA 1AQKH 1D5XB 4HUXA 1BZQK 5EBLB 3OZ9L 3G08B 5FCUH 2NX5A 4EN3A 5IB5A 1FNEA 3M45A 3X3GH 1HYRC 3CDGB 4LEOA 4NYLB 2EO1A 3PWJA 3VFTA 3MRBA 2R2BB 3KPRD 4R26L 1NUDA 2ZCLH 4MYWB 4FXKA 1KB5B 3WJLC 2H32B 4XVUC 1KJMA 2ATPB 3MUGB 5DQ9A 4XNZB 2FB4L 3QIUA 4MWFA 5FUOH 1JPSH 3ARBB 2A9NH 3BT2L 3CMOL 3DX7B 4O2FB 1MELA 3OKYA 2FWOB 2IQ9H 1FCGA 3L3KB 1P7QB 1S5IH 4RIRB 2UYLB 1SJEB 4YX2L 1XCQA 3BKMH 5D1XA 5EU3B 4F37K 1HNFA 2L0DA 3WD5L 4I3RH 4LK4A 5F9JB 5FA4B 1QUNA 4Z7VE 4YIQA 4DQOL 3O4LA 5L8JB 1NBZB 1QO3B 1RPQA 3BAEL 1DANU 1ZV5A 1I9JL 1KC5L 5JUEH 3CLFH 3QWRA 4X6CA 5CAYB 4DEPC 4QRRB 3V5HA 1LE9B 1DP0A 4HUUB 4DCQA 5GZOD 3P9WB 3SDXE 3M17A 3EFFA 4FMKA 2EH8L 4HIIB 4Y8AA 2DQCL 5HDBF 1KIPA 4DOHB 2HKFH 3QEHB 3GMPA 3NA4A 5DJXA 3GSNH 2E27L 2VN4A 1MCWW 5E56A 1ZOXA 3BPNB 1CQKA 1XR9A 4NHUB 1JPGA 2X4OA 4K9EH 2M8XA 5L7XL 4NC2B 4HPOH 4HWZB 4EIGB 5TH2A 5JPMB 2DQEL 3RGVA 4JZJC 4XNMB 3BAEH 1GAFH 2GJ6B 1MFAH 1A7QL 2VABA 2GK0A 1CGTA 5F9OL 1CIUA 1T7WA 2L4OA 1AO7A 2BRQA 2A9NL 1P6AB 3BT2H 1W0WA 5B8CC 4X6DA 2QQNL 2VXUL 1DQML 2OL3H 3DNKA 4BKLA 1IGML 2GITA 4YX2H 1I8LA 4JAMB 1UZ6E 4M61A 3CZJA 1A6VH 5D2LF 3CXDH 3QNXA 2OX5A 2DKMA 3ILPA 4O5LL 2ADJB 4MA3A 4NQEE 4NRYB 5DMIL 4DCQB 1ES0A 1ZHLB 4JFFB 4PJEB 5DSCA 4MJ5A 2FB4H 2P5EE 2A74B 5DQJB 2NNAB 3UC0L 3S88H 4X9HA 3LKPB 3GO1L 5C0BA 3VFUB 3DIFB 2A9MH 4F2MB 5KSUB 1RZGB 3LEYL 2V2TA 1TLKA 3GUTA 1JMZA 1RJZB 1RZ7L 1XGRA 3RGVB 1VACA 2H2SD 3QRGL 1MIMH 1OGAA 4PR5A 5J11C 1FIGL 3U9UA 4D9RD 5D2LA 2AJSH 4XP4H 5IOPA 5IMKB 2YRZA 4KJYB 4F58H 5D7SL 5B3JE 3U2SB 4NHUA 4OCSL 4OIIH 3PGDB 5IWLA 4RGNE 2YPLD 1CL7H 3A67H 1JNNL 2CDGA 1JWUB 1OPGH 4H20L 4NO3A 3QUZA 1RY7B 3ZE0E 25C8H 5DD6A 3Q6GL 3ULUE 4PGCB 4RZCB 1I8KB 4O02L 5C0BD 4X6EA 5FGCE 4YO0B 2NY3C 4K7FA 2G75A 4IDJL 3ULVE 1I1FA 4F7PA 1ZLWH 3QUZC 1VGEH 5AD0A 2VLKE 1I3VA 3HC4L 1T6VN 4KTYA 2ZWLT 2PKDA 5FIEA 1IGYA 5B4MC 4X98A 1ORSB 1T5WA 3AXLB 1S9YA 2WAHA 3EZJB 4PB0H 4DAGL 4FTVE 1UT9A 1N7ML 1VDGA 4EDWH 5CZVL 2BVOA 3QQ9C 5FM5M 5DK0A 2CUHA 4WIQA 1JWMA 4M48H 2NX5E 5C0DB 1C7TA 2I9LA 4NC1C 4ZFOL 3MRGA 4AJ0A 1CLOH 2FH8A 4O00A 1CD9B 1FNSL 4P9HH 4P2RB 1TZIB 4L29A 3PIQB 4Y19D 2V7HA 4C54A 2VUOA 3RJQB 2EIDA 2H26A 4D9LL 1DZBA 5ADPL 4LHUD 4N8VG 4L3AA 3ME0A 3SGEI 5KOMC 4ODTL 2R8SL 1J8KA 3MPCA 3S96A 2BNRA 5CP7A 4LF3B 4BZ1L 3QDJD 1NFIA 2DI7A 1HN1A 3IJYA 2Z4QB 3IF1B 1EFXB 2W92A 1A3QA 4OF6A 1MVUA 5E2WL 3HR6A 4N1EA 2X4RB 3V6ZA 2VKWA 3CPLA 2IBZY 4DKEH 5CD3B 5AG9A 1IGFL 1YY8B 4CVZA 4JFEB 1D6VH 4XB7A 3P30H 4BH8B 4RMVA 2R1WB 2V2WB 1FZKA 4O2CB 1Y0LA 1A1MA 5JOPE 3P73A 4GAGL 5JLZB 4JM2B 5C86A 1BQSA 4Z7OF 5FO7B 5IFHL 3VH8G 5J0BA 1U8IA 1JWUA 1KPRA 4KRLB 1HOCA 4U6HB 1P5UA 1LD9A 2CH8A 1BX2B 2X4UA 5DRXA 4OLXH 1EHNA 1KJ2A 1WCBA 5DJ6A 1MFBH 1CBVL 3ZE1E 4P23A 2BFVL 3MOAL 3VW3H 4WFFD 2WBJC 3QEQD 1A7BA 4DZBB 2BY3A 3TC9A 3V4PH 3GSQA 3HTLX 3MV9B 5HGAA 3TF7C 4P23C 1LEIB 1IAIM 1KJ3H 3NAAH 1U8MA 5DJ8A 4NBXB 1CDCA 3QCVL 4JY6A 2J4WL 3HLAB 3O11B 2W91A 1M7IB 2GITB 3EFDL 3HAEH 4NOFA 4PLJD 4KV5E 5EOCJ 3VXMA 2BDNL 1I4FA 5ANMB 2VH5L 5C2BL 1QSFB 1MRCL 1HXMB 4CU6A 2EEBA 5GGSA 2YZ1A 4J3TA 4XMPL 3ARFD 2DKSA 4XXDA 3SOBH 2MNUA 2NW2A 5C8JA 2NY3B 4JFXB 1MY7A 3HRZB 3LN5B 1WZMA 5C0NC 1BQHB 5BRZE 5DRNA 5KS9A 1KBGL 3UX9B 1AH1A 3OV6A 1RZJC 2JB5H 5DK3A 2XZQH 5BRZB 1FFNB 2EIBA 3V7AG 4JVPA 3RTQB 3UJIH 4KROD 1NCWL 4MNQD 4FQJH 4LLYA 1MCKA 3GHEL 3TYFB 5FUCC 4FFYH 4H1LH 2J88H 1DL7L 1IT9H 4ODVL 2ATKA 3K1DA 3EGSB 4IBLT 1F4YL 4I18C 1NKRA 4U31A 1L6XA 3DUSA 3KXFE 3T2PA 4AMKL 4J2XA 1IGIH 3C09C 4OZHE 2ZOKB 2VDLH 2X6MA 3MZTA 2EXWC 1DBML 2GY5A 1LDPH 4P5TA 1JPFA 3HA0A 5EOQH 3WBDA 3I6GB 2IAMD 1TPXB 4QXTB 4P48A 2NY7H 5AWNL 1NCUA 2VISA 5AWNH 4GG6A 5GGQH 4JY5L 5C0EB 4HUVA 4OGYL 2GEEA 3LPFA 4R0LB 1JIBA 1NEUA 1UQSA 2ZUUA 2J6EA 2XRAL 3KPSB 4WUUB 3SBWA 1R3KA 3N85H 1EJOH 2OMNA 1EZVY 1T2QH 4LPWA 5C9KA 3K46A 1LMKA 1FZOB 1NGXB 5FYLD 1NUFA 2LU3A 4UOW1 2OK0H 3PE9A 4PJHF 3QWRD 2YD1A 4XNQA 3MRFA 4NQCA 3SGJC 1FO0B 1YEGH 3IDNB 4KMQA 3STLA 1EH9A 4N0YL 4YK4C 3NCMA 5DJDA 1X5IA 4R2GB 4I3GA 3IFOA 3QUYD 4KC3B 4WEMB 5F7HA 3GKWL 3IVKA 4KK8D 1D5XA 5DA0B 5KTEH 5D7KE 1T04A 2HLAB 5BVJA 3QEUB 4HCRH 1SYSB 3O3BB 3OR7A 2IFFH 3Q3GB 4QTHA 3CFEA 3BEVB 1Q1JL 3RPIA 1KIRA 4B5EA 4WWKC 4IMKA 4M7JH 3B2VL 4F15C 4OIBA 5E9DA 1M7XA 3I02B 2AV7B 4U1JB 1GAFL 2MCG1 1JGVL 1X5AA 3ULUF 2D9QB 2NXYD 4KKCC 4QXTA 1T21A 1K4DA 1GZPA 3CVIH 4XPAH 2AKRB 4M7LL 3WNLA 3SEPA 4YEFA 3F6LA 3ZDYE 4K23L 1HCFX 5HJ3B 1S9YB 5HGGS 2WWMD 3TBWB 3NTCH 2YXFA 2B7DT 4N8VB 2HFTA 2JJUA 1J8HE 4QXUL 3TH4T 1H5BA 2DM2A 4PJIB 1GVIA 2CKNA 4OM1L 4WI6A 2OI9C 3AROA 3TH3T 1SVCP 1CU4H 3QNZA 1RIVH 3UAJD 1JNHA 5JW4N 4ZAKA 1MLBA 3SCMD 5SWZD 5I1HL 5DJ0B 1Q9OA 4LARH 5E4IA 1V5JA 4M6NL 5I9QC 5LKNA 3J8F7 1KENL 1FL5A 2VLKB 5CJOL 5FK9B 1BP3B 4PREA 3U0TA 3GIZL 5FCSH 3BKML 3W0WD 4OCYL 3N1QC 5GIRA 1FZMB 3OGCA 1M1SA 3NCCB 4NWTH 2V2TB 5EULV 3VFNA 3SDAC 1A7PH 1EPFA 3B43A 1LGVA 3MREB 2D9CA 4HWBL 3B9KD 3DXAE 4BJLA 1FC2D 3P0YH 3A6BL 5AG8A 4Q2ZA 3O0RL 1EHLH 3IGAB 1T1YB 3VXME 3P11L 1L9MA 3VH8B 1IKFL 1T1ZB 3QQ3B 3EJYC 1T7XA 4MB4A 5HHOB 3CZFA 4TOYL 1A21A 4I2XA 1KT2B 3HUJA 2Z8WC 3IDUA 1BQHG 2XYCA 2DTSA 5EZIH 3QWOB 3TZVC 4XVUD 3MV7B 3RUGA 1CVSC 4WI2A 1C12A 1A3RH 4OQTL 3DYOA 5I2IB 4YGVA 3C6SA 3DGGA 3S36L 4MQXD 2Q3ZA 5CBEA 3SO3B 1NGYA 2E3VA 1UENA 3FO1A 3UBXG 2FRGP 4G3YL 1KLGA 1QEWB 5C0JB 5TFSL 5SWSD 4LGSB 4JPWL 3QJFB 4JPIB 1EA9C 4D3CH 1A0QL 5I1EL 1U91B 2XI9A 4CDGC 1AGFB 1BJ1H 4W6WB 4QY8A 2AJZA 4NNPH 4KZDH 3VH8A 3BXNB 3BP7A 4PGBB 3MREA 4G6AC 4KTDL 5HHME 4ODWA 5B3NA 2O26U 4NNXA 3PWVA 5KSAB 1QRNE 3RL2B 3OX8A 2BOCB 1U95A 1FZMA 1I7ZA 4HJ0D 1GXEA 5IV2B 4Z5RA 1U8PA 1N6QL 4LVOC 3UPRA 1X7QA 2CKBB 2PTUA 4JVWA 2AJSL 4YDLC 4UUJB 5TE6L 4JG1H 3QRGH 3WNMA 1J05B 5EZIL 3GBMH 4NDMA 2FJGA 4YHOH 4M8QA 3QIBC 1HEZB 4GXUN 3P0YL 2UWEB 4C56D 1IKFH 3K4AA 1P9MC 4BFEA 3D39D 4YQXL 1IARB 3BPOC 4OBSA 3EKCA 5I0ZA 1A6TA 3V6OE 4EUPA 1Q9WA 1D5MA 1S7UA 3O45A 4LHQB 3UTOA 3ZTJH 5IQ7H 3MA7B 4UBDD 3QDHA 5C0JA 1YQVH 2JJWA 1R6VA 3GSRB 2K9UA 3FQWB 3IDGA 1S78C 5MENA 3SHSA 3IDIB 5HGDB 1DQMH 2J2ZA 3MFGB 3NZHH 2FDBP 4XXCC 1WTGT 2XWBB 4Z7NF 1TVHA 5BS0A 3QUXC 4QTIL 5LCVH 1WQVT 1IRAY 4DN3H 3O6LL 3RU8H 3R06A 2Z91A 2DYPB 3S3JA 3DVGA 1NANI 3MNZB 3U7WL 3HPLA 3JV6B 1BFSA 2DQDL 2ITCA 5FO8B 4UTBH 1RHHA 1XFPA 3GHBH 2OZ4H 4Q74A 1F2QA 4LKXB 2HT2D 1GIGH 2BOCA 1RUPL 3TNNA 3VGFA 3LH2H 4G80B 5I0DA 1AR1D 3O9WA 2OZ4A 2B4CC 3WLBB 5E6YA 5K9KA 3NFNA 1FBIH 5JIHA 1XGRB 1JFQL 2LVEA 2GSGA 4YJZL 3X17A 3PDDA 2BNQB 3FB8A 3WHE0 3S36X 2UWEA 4DOHE 3DTXB 3BKCH 4Y4HC 3DWTA 1U8OA 4R7NB 3UCRA 4EEEA 3KPOB 2LU4A 2D3VA 3I9GH 4Z7VF 1W0VB 3MOQA 5LVEA 1BVLA 1IGYB 2P24B 5DJAA 4LPCA 5IVOA 3HC3H 4PRBA 5I1DB 2VIRA 3O6LH 2IALA 2PYEB 5E24E 1JNLH 3WEXB 1Q1JH 2DLFH 3PWPD 3UJJL 1KCVH 1Q0YL 5C0AA 4PJCE 1UB6A 4WHCA 4WJ5A 3RIAF 1BAFL 5I1IL 3MNVA 4NO0B 5SWQB 3IDMB 4PJCB 4P99A 1IC4L 4G80A 1JWSB 3HC0B 5I74B 4KHTH 1QBLL 5F7DB 5DZLA 3S37L 3VFPA 3SKNB 1MREL 3OB0H 2PO6B 3VXUB 3LIZH 4XHQA 1J86A 4UT9H 4ENEC 1RIHL 3L3GA 2FR4A 1I1AD 4HWNA 4MD4A 3KPLB 2AGJH 1W0VA 3L7FB 4Y4KC 1YC7A 5DFVD 5LGHL 2IBZX 2BJMH 4G43A 1YMMA 1IGCL 4ONOA 1NCBL 1RFDH 1T22B 3MRMB 5EU6B 3OG4B 5BW7A 2FO1A 3IFPA 5ACLA 4HXAH 3ALWA 1X4XA 4JPVL 4NKDA 1DDHB 3BD3A 2C3VA 4N8CL 3H3PL 3N9GH 4O51B 4S2SB 4U3HA 2F19H 2EXYD 2MSPA 4ZFGL 4JFOA 3GSVB 2FIKA 2KH2B 4G6MH 3EJZC 3MLPA 4DGVH 4U1IB 3BPOB 3JWDC 2QSCL 4WJ5B 5IHLB 4JPWH 3ZYJA 4KKLD 1DN0B 4XX1G 5T5NG 2CMRH 4D2NA 3O3DA 2WWMC 5BVPH 2KQMA 1TQCC 4AMKH 1G9MC 4JFZL 1U8KB 4GLRH 2NW3A 3KPLA 3UTSE 1P4BH 3HC0A 4HIXL 1I85A 1ZHKA 2IJ0C 1FPTH 3VI3F 5EFIA 5IGXH 3G6DH 4QRPB 1N5AB 2W60B 1AGCB 1QFUL 4JFDE 1MHEB 2IG2L 1Q9LB 4NO3B 4XVJH 2FSEB 2DM4A 1F42A 1NFKA 3SCMC 1A5FL 4KAQH 1JYXA 4L3EE 1TQBB 3MQIA 3TN0B 5HYFA 5EOCL 3ET9F 3WFDL 4LDLB 4XC3L 1DSFH 4LASH 3C5SA 5SWZA 3ZHKA 3TO4C 1NLDL 4K3HA 3EBAA 1EHLL 1U9KA 4ODSL 1GJIA 5K93A 3SDDB 3L3OA 5EO1A 3IXTB 4RAVB 4OGAC 1MJ7L 4X5WB 5IK3B 2AP2A 3V5KA 1BGXL 2AEQL 3BN9C 3PUCA 3ZHLA 5EG6C 1NL0H 1OTTC 3VJ6B 3I2CL 2NY1D 1QPXA 1KSRA 3H7BB 1S7XB 3CDGA 4JFEE 5EZOH 5FYKH 3T1WA 2NY5L 5MP6H 3KG5A 3HI1B 1OLZA 4OUOA 3VWKA 2FIKB 4C4KT 3EFDH 3MRGB 5F1IA 1CCZA 1JTTA 1QKZL 3RNKA 2HT4C 3RVVD 4FXLA 4HHAA 5GS2H 1BZ9B 4YPGB 3MLYH 4BELD 1O0VA 4L29B 4ZUTB 4F7EA 1NUNB 4CMHB 3K80A 3PDGA 1VA9A 1OP5H 1TFHA 1AR2A 3GJFH 2OR9H 4UAOC 4ZOCA 1NCDL 2ICCA 3BKYL 1GGTA 2AERT 4ERSH 1LNUA 3FQUB 3BZ4A 5EORL 4ZFZB 4OLUH 1V7MH 3ZYZA 1G9NH 5DK2B 1OM3H 4PP2A 5I74C 1YECL 5F72S 5ILTL 3V0VB 3MBXH 4P2QA 5E7BA 2P44B 4U05A 1AE6L 4OLVL 5ALBH 1QSEE 4WTWA 1S3KL 3SKUD 3BZEA 5HPMA 5FYKD 5GISH 5I66A 1ZA6A 1VFMA 2E6QA 1YEEL 1MAML 1MJ7H 3CZFB 5HHMB 1Q38A 4LSRL 1YMHA 2Z0BA 3X14B 5KG9A 4PJIF 4KI1A 4QGYA 5SWQA 1QLFB 2ERJC 1LVEA 3O6MH 4Z7QF 1NL0L 1DSFL 1R24B 3DO7A 5D1XC 3DVFA 3KLDA 3JVGC 1INQA 5C6WH 4OZGB 4ALAL 5IBTH 5BV7H 2BVOB 3GSUA 2VO5A 3REWA 3IS0X 1GC1L 2DDQH 3IVKB 1TVBA 1A7OH 1QFUH 2FR4B 5IGXL 3ELAT 3H42L 4AEEA 5IMOA 4LGRB 4PRPE 2AQ2A 1JTOA 5FV1L 1AXTH 1FE8L 3DGGB 4KDWA 4DZ8A 1AGFA 5IESH 3BESR 3L7EA 4ZXBC 3NIDE 3D85B 2BX5A 3CFBA 4UQ2B 4EDWL 1H5BC 3LMJL 4PJAF 2Q6WB 3UBXI 1K2DA 4S1SH 1KTRL 1A4KA 5DHVB 5T3XE 2CUIA 5HHNB 3F7RA 3VFUA 2XFXB 5EC2A 3EYQD 5DQDL 3WIHH 2UZXB 2BNQE 5DUBA 4HMCA 4EI6B 5C6TL 1EJ6A 3AC0A 5HYEA 2YBRB 4JFFA 4PJEA 4PRDA 4JPVH 5F7NC 2CLRB 1HDMA 5LXGH 1KJVB 2HWZH 4N0RA 4XMKL 1EV2E 3KYOB 1T1WB 4MLIA 2LVCA 4MNQA 1BBDH 2WBWB 4CL7A 4MQSB 5E8NB 5E70A 3VDBA 5KN5A 3WJJC 4B53A 1YEIH 1NBVH 3F58H 3AS0A 3TBSA 2AABH 4DVRH 3BEWA 2UZYB 3VD3A 2EEAA 3TYFA 4DTGL 4PJ9A 4BUHA 2VLKA 4GRWB 4KVCL 4U1LA 3LV3B 1P69B 3NIGF 2DS4A 1G9EA 1PJ9A 3LRSB 4NFDA 1MLBB 2UYLA 2E7HA 3SE3C 1FYTA 2P8PA 2YA0A 3FHAA 3BYTA 3ZHDA 2G2RB 4FG6D 5T3ZE 2V9QA 5I30H 3FTGB 3B3IA 5IT2L 2OL3L 2ZG3A 3C60C 2BSSB 2AJUL 3P4OA 4RIRA 4M7KH 1AGDA 1JN6B 4GRMB 5TDPA 4XH2B 2YD4A 5CSZB 2VAJA 5EH1A 3DSFH 3CXDL 2XZZA 3ARQA 4KJQD 5GGVH 1UH3A 4CNIB 2WV3A 1KCUL 2DLFL 3LN9A 4NZRH 3UJTH 1FYTD 1PG7X 3FN9A 1J5OL 4KRNA 2AK1L 4X5XA 4XMKH 2YRLA 3QAZC 4X6CB 5FHBH 4ZQKA 4XZUA 3VWJB 4ETQA 5B38A 4FABH 1MVUB 2EDWA 1DN0A 3MRKB 3DPBA 3OKEB 2R56L 3MLUL 5IVNA 4BSJA 1I3GL 3SPVB 5IKCB 1H15B 2Y7QB 3OKMB 3H3BC 4XCFL 1L7TH 4PJXE 4JFEA 5D1QA 5F9DC 2AXHA 2J8OA 4YHYC 2IQAB 3VA2C 1S7RA 3BPCA 2DQGH 4EBQL 3PQYD 4ZODA 1J1XL 2EE6A 5BVJB 3QQ4B 4NJ9H 3LAFA 1VADB 4RQQB 2ZOLA 4PY7B 1C12B 3RUGB 3GMOB 1QBBA 5L8KB 1GGIL 5KW9H 3FQTB 2X4UB 5T5FL 3VFVA 2W0PA 2NZIA 4JRXE 3ZDXE 4PGZA 5IFAL 2AJZB 3DYMA 2NNAA 4KQ4H 2AJYH 3NPZB 4B7IA 5J8OA 1OGAD 1TQCB 2A1WL 2P8LB 3D2UD 1ZHLA 2NTFA 1Z9OA 5TQ0L 1RMFH 1QYGL 3QJFA 2FYYB 3OF6D 4KK9D 5IFHH 6FABH 1KPUA 3VA6A 5IQ7L 3L3DB 4M61B 5LCVL 4UMGA 4G6AD 1XGUA 5CJBA 5EBWB 4QY8B 3VFWA 4TQEH 3UTSB 3MV9D 1RUMH 4MCZB 4WGVB 2I24N 4YXLL 2R4SH 4I0PD 3ZE0F 4DKEL 1YEDA 4LGPB 4WNQA 5DYOA 3LPWA 4I9WE 4I18B 1KV3A 1F11A 2DLTA 1DBJH 4HT1L 3PP4L 4U6YB 4LNVA 3VXMB 3ULSB 1UFUA 3L7EB 1QFWM 4JRYB 3TJHC 1PYWB 4LCYB 1IM3B 3ZKMC 2SEBA 4OLVH 4NHCL 1IE5A 2EYSA 4PYHA 4U1GC 4R4FL 1N8ZA 4O58H 1I1AA 2NTFB 1U42A 2ZUVA 3QH3A 5GGRY 2YEZA 3VXSB 1BFVL 1GGBL 4P5KA 5D9SB 4LPTA 4L4TE 5IB4A 1CXFA 4I48A 3K8KA 3S35H 3VXSE 3BE1H 3IFLL 2F53E 1TJHH 1T5WB 3AXLA 1DE4B 5GS0L 4IRJD 1ZHBB 4WW2F 1BJ8A 1EX0A 4J3SA 4PRAB 1G6RB 4WGWB 4UINL 2Q20A 3QFJA 4HEME 4F33A 1WVZA 1YDPA 5IM7B 5BS0D 2QR0B 3QQ4A 1TZGH 3H9HA 3WL9A 2V7NB 1GHFL 2ZPKH 1T21B 2HRPH 5J7CC 2IH3A 3O4LE 2IMNA 2YA1A 3QI9B 5DLMH 2FH6A 1QR4A 5T3ZL 4ZG1A 3DVGB 2SEBB 3IKCA 3G5VA 4ZYKB 3EYVA 5GZOC 5E94B 2DD8L 1OF2B 3S35L 3SDDD 3A67L 5GGUA 5D7JD 1BIHA 1IL1A 2F74A 1AP2B 1BFVH 1GGBH 1F6AB 4FZ8L 1A2YB 2JCCF 3GMQA 4XP4L 5KVDL 1N64H 1GC1C 4QOKA 1AQDA 3KPPB 3WFBL 3VG0L 1U6AL 4ZS7L 4HLZG 2WZPD 1P53A 5I16B 4E42B 4P23D 5IB4B 4EI5D 2XA8H 4XCYB 1C16A 2R15A 1FL3A 3RIFF 5FEBA 4PRHA 3QIWC 4XC1L 1KLFA 2C3HA 2PW2B 4LCUB 1SBSL 3QG7H 2YN3A 3L3IB 4O5LH 2XKNB 1S7XA 5A40E 5GGSY 5E03A 5BJTB 4H8WC 4OZFA 3WKNA 4GAYA 4IRZL 4GBXA 4OF5A 3MA9H 2DQHL 5H37H 3N1GC 5F6HI 5ITFB 4KK5C 3RDTA 5D1XD 3TBVA 1MCPH 3HE6B 1Q9KB 3B83A 5TDNB 2P5WD 1RMFL 3GM0A 5I19L 2OL3A 3HN3A 4XTRC 3OBAA 4GRLB 3I6KB 5C0ND 2ICEB 4H0IA 4HIEB 2NLJB 3NIFF 3T2NL 5D71L 2Q76A 1KJ2L 3UPCA 2QSQA 2H2SC 1UM5H 2IGFL 3MGOB 2VDRH 5L2KA 1AHWC 4RAUA 1GGIH 2XG4A 5EU5B 5I73C 5H2BB 5CKAA 2E8YA 3CIQA 2XWTB 1H0DB 4ZOEA 3OJ2C 5HYJE 2ID5A 1FG2A 3O4OC 4G42A 5IG7B 4JFPB 4HG4K 1G1YA 3RDTD 1RJCA 1SMOA 5T33L 2DQGL 1YEJL 2FATL 5TF0A 3OAYK 4P2CG 3EYFB 4P5TC 4ZYKA 2AXFB 3CFJB 3O2VL 3MV01 4JQIH 4WHTA 4RBPK 4UIKH 4Z7WE 4JQXA 4RGMB 5I17B 4LCWE 3GMQB 4KMTL 2BSSA 3WXWL 4M93C 4Z7WB 1FAKT 2FHBA 3I85A 4XPAL 3T0WA 4KKLC 1U36A 2DBJA 4Y16C 3C6LC 3FRPA 1B90A 5F70A 2Q8AH 1LEGA 3BPNC 3MJ7A 4TYUA 5GRJL 3REVA 3DX9B 5IWLC 1P2CA 4LLDB 3CMOH 3QB7C 3W0WB 1KCKA 1JNLL 1EO7A 2H26B 4Q9QH 2R2BA 1J12A 5IT2H 1PKOA 2YD5A 4JO1L 5EBMA 5DVNA 3PDOA 4NSKA 3SDAB 5C09A 1KF9B 3PGFL 1JYWA 4NBZB 5I6XC 5HGHA 2YUXA 3O2VH 4TNVF 4AG4L 1G9ML 1NBZA 3VXUE 4KXZI 5D7LE 1N4XL 4L3EA 1I1RA 1BF2A 3OAYH 4PLNC 1GZQA 2A77L 3FT4B 1J7VR 2H8PA 4OI7A 4CKVX 1ORSA 1G9NC 3MRRA 2W0KA 3KPTA 4PRAA 4QKXB 3T1FB 4LVHC 3IDXL 3BH8B 1HK6A 3BD4A 4PJHE 3OR6B 3P9LA 3GNML 5KAQG 3QUYA 1I1YB 1MCDA 3M17B 5B8CA 5F7MC 3B4NA 5DJ2A 3UZVB 3LN4B 1INEL 1U92B 4MA8L 1KCLA 3MV7D 1UWGH 2VDQL 4WFEE 2DL9A 2PUQT 3UBXA 1VFBA 1VSCA 2X09A 3UPAA 2VR4A 5CINH 3KXFA 5E8PB 3RI5F 4I77L 1QLRA 1H8NA 5EBMB 5JDSB 1S7WA 2OSLB 1KXTB 2FX9H 2CUMA 1LDPL 3L5JA 5JOPD 5IBUG 3VXRE 1BM3L 4ZFZA 4KZEH 3SGKC 4NQSB 5JMOC 4LLDA 1AO7B 3W0WA 2WBJD 1A47A 2YKLL 4LP5A 3CDYA 5EZJA 4UNUA 2GT9B 4YEEA 5HGAB 3K74B 5T1KB 3QG6A 1P4LA 1J1PL 2OBGA 4PRHE 3O9WB 3L95B 1DVFB 4UQ3A 3S5LA 4FQ2L 4DK6A 1AXTL 1NMCB 2OTPA 2R23B 3X13A 1KN4H 4MJIA 7FABL 3ZDYF 5I1CL 3DX8B 2CO7B 1UYWH 2GI7A 1U8IB 5E2UH 5KG9B 2E9IA 4WU7B 5E2VH 5C0AE 1MEXL 4Y1AE 1N64L 4BFIA 2PETA 3TVMB 1H3VA 4NN7C 1ZT7A 4WI3A 3QPXH 4YDLB 4CJ0A 5DC4B 3KDMA 5EN2A 4OJFL 4OJFH 1E4JA 3MR9A 2A6KA 4OM0H 3HZMA 2E6PA 4Q58C 4XWOC 1KB5H 5D2LE 3WFDH 1SY6H 1U8LA 4JDVA 4KUCF 4OLZH 1J0HA 1TVBB 4RQQA 4KTDH 2RJMA 4QRTA 3DMMB 4WY7L 3ULUL 4NUJA 5DRWB 4RWYH 1PY9A 1FN4A 3AUVA 2I07A 1INQB 5D2NB 1K85A 4N8VA 5AAWA 2P8MB 2VLMD 1U41A 3MNWA 2MCPH 2B4CL 4Z95H 1Q9LA 1G0DA 1TMCB 5CSBA 3P77B 5C0CD 2NY0D 4DGYH 3ARBA 2YZ8A 1ZT1B 2NY6B 1WF5A 1KGCD 4MDIA 2CDGB 1DCLA 2H2PD 2BHUA 1HSAB 1I3RA 3FHQA 1R5IB 4CDHA 4JKKA 2I60H 1UJTA 2R23A 4UDUB 1SQ2N 1R3JB 2IQAA 1CGSH 5I1KH 5DTFA 4HMDA 4RRPA 3VDCA 4DGVL 3SGDH 1DEEB 1J8HA 1MCBA 2NZ9D 4NGHL 4WV1B 4F3FA 5J13C 3BDBA 3WUZA 3HZYB 2VDPL 5F97E 3W2DL 2IAMC 3MXVL 1INEH 4ZTOH 3WFZA 4JZOB 3LHPH 5DUBB 1VHPA 4U49A 4X0KA 5C70A 2J8HA 2YK1L 4JY4A 1KNOB 3O8XB 4FQIH 3VD5A 5EA0H 1P4LB 4A6YH 1DBJL 1EGJA 4K7FB 1HDMB 3HI6H 3L3IA 4YDIL 3O0RH 4JDVB 1BEYH 3ARGC 4LLVA 3U36A 2ESVA 3JWDH 4HWBA 4ZD3L 43C9A 4C4KO 2EECA 1AIFB 4NM4L 5JHLH 3FMGL 3MRFB 3PWNB 4OTXH 4J6RH 5DVOA 4PJ8C 1LEKB 3ARSA 3E6FB 4WCYL 1G9MH 4AG4H 4JFED 2E8ZA 4D9LH 3C6SB 2V2XB 1MREH 2K3TA 3DVNB 5EOCH 1Y18B 2ADFH 3V9FA 3DUUB 1VENA 5EO1B 2H8PB 4ZO8A 5GS1C 4HWZA 3IKKA 4AH2B 4P4KA 4YGVB 3LEXA 4TTDD 2ICWB 3QIBD 4XI5C 3EJJX 1TETH 1WEJH 3LS5H 4LQFL 1XF1A 1EEZA 2CQVA 5E8OB 1ES0B 5IEHA 1DE4A 4AY0A 1IEBB 3QNXB 4OGXH 4CAGA 4MD0B 1CE1H 4U3XA 3DTXA 4XWGH