3AVKA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Recombination/inhibitor
molecule keywords Integrase
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avkA00
2FBVA 5HBMA 4FM1A 2DTUA 3SQ4A 4AH9A 4GVMA 1S1WA 4CK1A 3F9KA 1BIZA 4FCYA 2VG5A 4CHOA 1MU2A 4ICLA 1KVBA 4DSEA 1BL3A 3L2WA 2ETJA 3NE6A 4FLYA 4M3WA 1J53A 4JRQA 2FBXA 4HCBA 1YTUA 1JXBA 3LPTA 4FZXC 2WOMA 3NF7A 4J2DA 1JKHA 1C1CA 1VRUA 4LH5A 3O3FA 3AVHA 2OPRA 2G8HA 1KRPA 4KHQA 3HYFA 1U45A 3QIPA 2QK9A 4O4GA 1HPZA 5FDLA 4M45A 4CIEA 3THVA 4C8LA 3OS0A 4FJGA 4CERA 1JLAA 1JL1A 3LWLA 4RW9A 4FK0A 1EXQA 5HROA 5HLFA 2G8WA 5EU7A 2BANA 3TAFA 4CK3A 3AVFA 4LD0A 1NJZA 3L2VA 1NKEA 4AHSA 1NK6A 4C8OA 3OYAA 3L3VA 1S1XA 4H4MA 3ZT4A 3DYAA 5CYQA 1RT6A 1ZBUA 4HUFA 1UA1A 1NOYA 3MECA 4W5OA 3KD5E 2XHBA 1UWBA 3IG1A 4B9UA 3ZCMA 2HHVA 4Z0UA 4FK2A 3M8RA 3KJVA 3K5MA 1CXQA 3AVGA 3T19A 4OKKA 2BDPA 2B6AA 4DF8A 3AA2A 3KLEA 4OVLA 2E6MA 3TAMA 1XHXA 1N6QA 4CGIA 4Z4CA 2OPQA 1WSJA 3G10A 1X9WA 1C0UA 4RW8A 1RT3A 3ITHA 1NK4A 1QSSA 2HHTA 2IOCA 1RT4A 4FJ5A 2GUIA 3C94A 4H4OA 4KO0A 3VQ4A 2D0BA 5KTQA 3ZT2A 1IKXA 4ID1A 3C6UA 1ITGA 1ASUA 1A5XA 1C0TA 1WNSA 4CGHA 2X78A 3DLRA 2HNDA 2Z1GA 1REVA 1RCHA 2BE2A 4BE2A 3HP6A 3ZSYA 3KLFA 2HVHA 4CGGA 1XI1A 4JS4A 4HUGA 4RW4A 2E6LA 1LWEA 4HCCA 1FXXA 4F2RA 1HQEA 3TAPA 2KW4A 5J2MA 1R0AA 2D0CA 4FJXA 5FRMA 4CK2A 4CJ4A 3ZSZA 2RN2A 2YKMA 4FLZA 3O4QA 3NF6A 3BGRA 4NCGA 5KI6A 4CJKA 3V81A 2G8UA 2A1SA 2D0AA 4EZ9A 3NH2A 1JXEA 3ZT3A 4FM0A 3KK3A 4DQSA 1VK0A 1L3UA 4Z4EA 2JLEA 3OYKA 4E7HA 4E3SA 1RT2A 3KK2A 4CF1A 3M8SA 3WNGA 3DLEA 4FJ7A 1UOCA 1SV5A 3DMJA 2YNHA 4N76A 4J2BA 3TI0A 1BGXT 4FM2A 3HO1A 4CJLA 1NJWA 2P5GA 1S1TA 3RRGA 1Q9YA 2G8VA 4CJFA 4DFKA 1FKOA 1BCOA 1Q8IA 1ZYQA 3NBPA 1SUQA 3OJSA 3RWUA 2ZD1A 3TAQA 2F8SA 2PY5A 3ZT0A 4W5TA 3DRRA 2G8IA 4IFVA 3HJFA 4KI6A 3AO5A 4ZTJA 3ZSOA 4CHNA 3LANA 1XC9A 1NK0A 1D9DA 3HK2A 1D5AA 3VQDA 4M3XA 5FRNA 4FW1A 1JLFA 3IRXA 5J2NA 1QTMA 4DTXA 3TAGA 3LDSA 2EX3A 4O44A 1FKPA 4IG0A 4DF4A 1XWLA 4YNQA 3I8DA 1S5JA 3JYTA 3IS9A 3KLGA 3DLHA 3L2UA 3U3YA 1TKZA 4C8KA 3DRPA 5C24A 3HM9A 4Z4FA 1TK0A 1NK7A 1KVCA 3P1GA 4Z4HA 2NUBA 3DLBA 5HP1A 4MQ3A 2YHBA 3O3HA 1TVRA 4LSLA 4E7JA 1NK5A 1S6PA 3QLHA 4JS5A 4GW6A 4PUOA 1RBRA 2W42A 1NKCA 4B9VA 4KHUA 1VSEA 3P5JA 2HW3A 3VQ9A 4DS4A 4DQPA 4C8NA 4CF9A 2QKBA 1SL0A 4ELUA 3KLHA 4BWMA 3EZ5A 4FJMA 3QERA 4W5QA 4E7KA 1IKWA 1Y97A 4KHWA 3HP9A 4B3OA 1ZBIA 3SUOA 1C1BA 1RTJA 1YT3A 3OYMA 2B5JA 1BQNA 4CJ5A 1TL3A 3TWHA 3NHGA 2G8KA 2QKKA 4DQIA 4DSIA 3DI6A 3CYMA 3SYZA 5JS1A 5C25A 4B9NA 3NGIA 4CJRA 3C6TA 5DK5A 4AHUA 2X74A 2P51A 3HT3A 4DLGA 2JGUA 4F3TA 4Q0BA 3RTVA 2P5OA 3NF8A 1SKRA 2OZMA 4Z4GA 4M3RA 3SV4A 1KFSA 4FJIA 4RW7A 4CJ3A 3K58A 1KTQA 5DMRA 2OPPA 4EP5A 1TGOA 2HNZA 1CZ9A 4HTUA 4CFCA 3QESA 1T8EA 1QSLA 4CEAA 3ULDA 1LAVA 3DLGA 3PX0A 1D8YA 4DSFA 1IG9A 1RDBA 2FC0A 3FFIA 3P83D 5HRPA 2BGGA 1UA0A 3V1QA 3NFAA 1KVAA 1QQCA 3C95A 2VG7A 1VSDA 4DTNA 3QNOA 4GMJB 4AHCA 3IAYA 3SV3A 1IH7A 1NJYA 3L2QA 3PX4A 2XRIA 1JLEA 1RT5A 3MXMA 4PWDA 3KLIA 3QNNA 4BE0A 3AO1A 3ZT1A 5KRTA 4FJHA 1CZBA 3AO2A 4AHRA 4KHSA 4RW6A 1JLCA 4DFPA 3I0RA 4CEQA 2XY6A 4O0JA 2Z1IA 4DU4A 4K8ZA 3WNFA 4CJVA 1TKXA 4Z4IA 5CZ2A 2OA8A 4DTMA 1J54A 4EP4A 2OZSA 4DTUA 3SUNA 3M8PA 5FROA 3G0ZA 4KAZA 3CG7A 3MEDA 4DG1A 3OYCA 3HXMA 4DTJA 4ELVA 2KFNA 3SPYA 1TAQA 5HRRA 4AILC 4CGDA 4Y1DA 3RMAA 3SQ0A 1RT1A 2OPSA 4MFBA 3CFPA 3MXIA 4Q5VA 3LP1A 1B92A 1C0MA 1GOAA 1CLQA 1ZBHA 3SCXA 3RR8A 1A5VA 4CIGA 5KRSA 2E4LA 4DU3A 1UAXA 1WAFA 2XY8A 1QSYA 1HQUA 2RKIA 4CECA 4O0IA 3CQ8A 4CHPA 1TK5A 3K57A 3MEGA 1VSHA 2DY4A 1S6QA 4RG8A 3TR8A 3U6FA 3MAQA 1GOBA 1T7PA 4DMNA 1B9DA 3OYHA 1LAWA 1RBSA 1Z25A 4CFBA 3OS1A 4E0DA 4J2EA 4CJEA 2IDOA 4QAGA 3AA4A 1TAUA 4FJKA 3KTQA 4KTWA 1W0HA 1KLMA 3NH0A 2ATQA 2KTQA 4I2PA 3NH1A 1SKSA 1ZBLA 3KIOA 3NAEA 1X1PA 1K6YA 2KZMA 1HRHA 3PUFA 1X9MA 4LSNA 4OKEA 3SUQA 4K8XA 2KQ2A 4OLBA 1LW0A 3A2FA 3O3GA 3RR7A 4FYDA 2YKNA 2X6NA 4N47A 3VQ5A 3I0SA 3S9HA 4FLTA 4M3YA 3LZJA 2Q3SA 4Y1CA 1RBTA 4KB1A 2HHWA 3VQ6A 1BHLA 1Z26A 3VA3A 4DSJA 1JLBA 3ZSXA 3T1AA 4CIFA 3EYZA 4JRPA 4E7LA 3S3MA 1Q9XA 4B9TA 1C6VA 1DLOA 4JLHA 5K14A 4BWJA 5SWMA 1RILA 1TKTA 4B9LA 4FJLA 4KHYA 4NCAA 1EKEA 3LAKA 3ZSQA 4KRFA 1EETA 3WNHA 3E01A 4F2SA 3LWMA 3K5NA 1BIUA 2Z1HA 3V4IA 4CF0A 3OY9A 4YFUA 3SQ1A 3DRSA 1HJRA 1HYZA 4OGCA 4FLXA 1CXUA 3CFOA 4IG3A 2FBYA 1VSFA 4N5SA 3AVJA 1VSJA 4XIUA 3TANA 1BI4A 1WSGA 2ITGA 2VWJA 1QE1A 4KTQA 3AVBA 2RF2A 3SPZA 4CJSA 2DFHA 2VG6A 3NF9A 3OYGA 3SJJA 1JLQA 3QO9A 4AHTA 4OPJA 4F3OA 1DTTA 1EX4A 3LPUA 4CEEA 1BCMA 5CZ1A 4CE9A 4UQGA 3VQPA 3CFRA 4DS5A 1QS4A 1VSMA 3KKSA 2XY5A 3AVNA 3SI6A 3V9SA 2AJQA 1I3AA 3VQEA 4CHQA 1VSKA 4IKFA 4QCLA 2HNYA 3S3OA 3BDPA 1IO2A 4FJNA 4DWIA 3VQQA 2YNIA 4CGJA 3MXJA 4CJQA 4WE1A 3OYEA 1VRTA 1W9HA 1RBVA 1F21A 1WLJA 4FLVA 3K59A 3L3UA 1EP4A 4BACA 1HMVA 1N5YA 4NYNA 2Y1JA 5D3GA 4OPKA 3TAEA 3RMDA 4QOZB 3DM2A 2IAJA 3AVMA 4M41A 4B08A 4IFYA 4OKJA 4KHNA 2GV9A 4O55A 1KSPA 4N56A 1LWCA 1WSIA 2IS3A 2KZZA 3QEPA 4E19A 3T3FA 4CEBA 4DQQA 4FJ9A 2HVIA 4DFJA 5J1EA 1J5OA 3QEVA 4M42A 2HHXA 3RMBA 1ASVA 1HYVA 3LAMA 1JL2A 1WSHA 2OYQA 2YHAA 1RDAA 5CY4A 1FK9A 3KKRA 4B8AB 3V1RA 3QIOA 4CHZA 1WN7A 2DFFA 3JSMA 3ALYA 3NCIA 1SL1A 2HHUA 1NOZA 4I9QA 4FLUA 4CCHA 1RT7A 3H08A 3B6PA 3OVNA 3OJUA 4CFAA 1JLGA 4E1NA 4W5RA 4B8CA 4CGFA 3NGYA 5HRSA 4BE1A 3V9WA 2A1RA 1HNIA 1L3SA 3VN5A 2X6SA 3ZSWA 5CYMA 4FZYA 4HVJA 2YNFA 4FK4A 3QEXA 3HPHA 2EHGA 3AO4A 4HUEA 1NKBA 2XY7A 3K2PA 3HVRA 1L3VA 3PV8A 3AVCA 1I39A 4J2AA 4CEOA 1KLNA 3DLKA 3NGZA 2I5JA 4DTSA 3HPOA 1TKDA 4ELTA 1WAJA 3SUPA 2FBTA 3AA3A 4CJPA 3V9UA 4KREA 1TK8A 3S3NA 4CJTA 2F96A 1WSFA 4E89A 2HB5A 3NDKA 2G8FA 3L2RA 1HNVA 4BDZA 4BDPA 4DTRA 3DOLA 2LSNA 3LP2A 1HYSA 4B9SA 4LH4A 3OS2A 4IDKA 1L5UA 4O5BA 2XO7A 2ZQBA 2O4GA 4CESA 3QEWA 4DQRA 4CEFA 1G15A 4H8KA 3QEIA 2F8TA 4TSXA 4M3UA 3LP0A 1L3TA 4CJUA 4E7IA 4F8RA 2HHSA 1D9FA 2WONA 4PA1A 3PY8A 3AVAA 3VQCA 4R5PA 1KCFA 3OYLA 4FLWA 3PO5A 1TV6A 2PYJA 4EZ6A 3K5LA 3RMCA 4CEZA 3AVIA 3ISNC 1LWFA 3B6OA 4FJ8A 3AO3A 1SKWA 5I42A 1RTHA 5J2QA 3TARA 1U49A 2VWKA 4KPYA 2B4JA 3WNEA 3SZ2A 4OGEA 2IC3A 3AVLA 3VA0A 1A5WA 3SQ2A 3TABA 1WSEA 4OJRA 3OYIA 3KD1E 4BDYA 1KFDA 3M8QA 3V1OA 4DSKA 1ZBFA 1GOCA 2ZE2A 2P1JA 5J2PA 1DTQA 1LW2A 3AA5X 1B9FA 4I7FA 3V9ZA 4DSLA 5SZTA 3V9XA 1XHZA 3ZSVA 4LY7A 4L8RB 2YV0X 3OYDA 3VQBA 2QXFA 4DTPA 1S9EA 3VQ8A 4DU1A 3AV9A 3ZSRA 4OLAA 4FJJA 3K5OA 1RTDA 4G1QA 3DOKA 1O1WA 1TL1A 3EY1A 3OYBA 3LZIA 1U4BA 1ASWA 1X9SA 3RRHA 2HMIA 4FZZA 3MEEA 1BQMA 1IKVA 3KK1A 2D5RA 4DLEA 3OYFA 1NJXA 3PO4A 2RPIA 4CF8A 4CHYA 4AHVA 4CF2A 4PY5A 4I9LA 5I3UA 4DFMA 2HHQA 3LP3A 3F73A 3QINA 1BISA 1RDCA 1YTAA 4FVMA 1RDDA 3VQAA 1YVUA 4FW2A 4KV8A 4C8MA 3D45A 4KTZA 5HRNA 1J9AA 2GBZA 3OYJA 1QHTA 2YNGA 3CM5A 2Y1IA 1S9GA 4KFBA 5E41A 4N41A 3D0PA 1C1AA 2IGIA 4PQUA 2DFEA 4E1MA 4ZTFA 3O4NA 1SL2A 3ASMA 3SNNA 5T7BA 4DTOA 3CM6A 1VSLA 5C42A 1S1VA 4HHTA 5JS2A 4M3TA 1VSIA 3HSTB 4CJWA 1S1UA 4M3ZA 1T05A 2PYLA 4B9MA 2O4IA 4NCBA 1LV5A 3UIQA 1NK8A 4KB0A 4W5NA 4F4KA 3QETA 3HVTA 4IBNA 3AVKA 5KGXA 4KI4A 1RBUA 3U3GA 4FXDA 1U47A 2R7YA 4ID5A 5KGWA 3L8BA 1BI4B 1RTIA 3HPGA 3LALA 4I2QA 3VQ7A 4CFDA 3V6DA 1T03A 1U04A 4NYFA 4CEDA 1IKYA 3OYNA 1RNHA 1U48A 2KFZA 4ZHRA 3PX6A 1NK9A 4KKOA 2Z1JA 2PZSA 3HL8A
chains in the Genus database with same CATH superfamily
2VGNA 4AH9A 4GVMA 3DXKA 1OH6A 2O8CB 4FCYA 3VEXA 2BH1A 3IUCA 3M3ZA 2VG5A 1MU2A 5JLFA 1KVBA 4DSEA 2ETJA 3CPEA 3NE6A 3CXCM 3MK6A 4BRGA 5E26A 4B3MK 2OPRA 4KHQA 2V7YA 4M45A 3EEQA 3MMVA 4CERA 1JL1A 2P9UA 4RW9A 4M7YA 3TAFA 4B1ZA 3AVFA 4CK3A 1NKEA 4AHSA 1IBLK 4JK7A 3OYAA 3D2EB 1NOYA 1YJNN 4W5OA 3IG1A 3ZCMA 2V7ZA 4CZHA 3M8RA 3M5RA 3K5MA 3VF6A 3UKUB 2B6AA 2E6MA 1WSJA 3G10A 4IOCL 2RE2A 4RW8A 1FW6A 2HHTA 5AQZA 3C94A 3D6RA 5KTQA 3ZT2A 2O8FA 1ASUA 2F9TA 1C0TA 1WNSA 3BY5A 3DLRA 1BOTO 1DEJA 3HRGA 4BE2A 3ZSYA 4DV0K 4JAXA 2E6LA 4H0OA 5BR8K 4GKKK 4KH4A 1R0AA 4CK2A 4CJ4A 3ZSZA 1X3MA 3IDHA 1N36K 4BR0A 2D0AA 1NGEA 3ZEUA 3NH2A 3O9UA 1VK0A 5M1PA 3OYKA 4E7HA 3CI5A 4FJ7A 1SV5A 3TI0A 1BGXT 3C0BA 5CR4A 1Q9YA 2G8VA 1ZYQA 3RWUA 3TAQA 1MDUB 5AR0A 2G8IA 4JI0K 1VAZA 1D9DA 3VQDA 3KWIA 3WXJA 1QTMA 2E88A 5BPNA 3LDSA 4O44A 3THYB 5KPRA 3CMEN 3IS9A 2Q97A 2AP1A 3L2UA 3U3YA 3DRPA 3HM9A 2F4VK 2FXUA 1TK0A 3SAGA 1KVCA 4DV7K 4YOWA 1NK5A 4NO7A 1KQSM 1HX1A 1XMQK 1VSEA 3P5JA 4DS4A 3F9MA 3KLHA 3EZ5A 5TKWA 3RSEA 1WBDA 4E7KA 1Y97A 3SUOA 1YT3A 3OYMA 4DQIA 1YJWN 5JS1A 3CERA 3C6TA 3HT3A 1K8AO 2P51A 3FZLA 3RTVA 4IJNA 3VTIA 1M90O 1KTQA 1TGOA 4HTUA 2GWKA 4CFCA 3LDQA 2QA4N 3QESA 1T8EA 4GKJK 5ADXA 2HBMA 1D8YA 3K0SA 5JMVA 2KHOA 3NFAA 1NGIA 1QQCA 3D2FB 5MLCQ 2VG7A 1VSDA 3LM9A 2OTLN 3EZWA 4JI8K 3IAYA 3SV3A 3PX4A 4IEEA 1NGFA 3WT0A 2NZTA 4CZGA 5KRTA 4FJHA 4AHRA 4LF4K 4KHSA 4LFAK 3IFRA 5DM7L 3R8EA 1NGHA 1S22A 2YJFA 1EWRA 1K8KB 4DTMA 2OZSA 4DTUA 4IOAL 3M8PA 5FROA 3HOTA 1N32K 5LY3A 4ELVA 3SPYA 1TAQA 3VOVA 4C1NI 3TTFA 4AILC 4CGDA 5GAHP 3R3LA 4RTFD 5ADXH 2OPSA 3MXIA 4Q5VA 3AAPA 3O08A 1SZ2A 4NB4A 3OW2M 4OX9K 4DU3A 2YHXA 4O0IA 4CHPA 3K57A 3G4SN 1VQ5N 4DMNA 1B9DA 3OYHA 1RBSA 4CFBA 1KC8O 3F5TA 4J2EA 4CZKA 4JI3K 1GLCG 4BRDA 3VF4A 2J4RA 4JKCA 1QZ5A 1SKSA 5BR9A 1X1PA 1HRHA 4H5WA 4V19S 1TYQA 4OKEA 4K8XA 3O3GA 2YKNA 5BREA 4YOVA 4JKAA 4FLTA 4BVOA 4Y1CA 1RBTA 4KB1A 5GADP 3ZSXA 1K73O 3E9PA 4B9LA 1DLOA 4FJLA 1VQPN 3LAKA 3CMAN 4F2SA 3WNHA 3K5NA 3ENHA 4CF0A 3SQ1A 3DRSA 4MO5A 3ULEB 4O8UA 3OYGA 3SJJA 1JLQA 1XNRK 1XC3A 4DS5A 4CE9A 4CW7B 4UQGA 3CFRA 3V9SA 2AJQA 1I3AA 4GVEA 4QCLA 1TUUA 2HNYA 3U9ZA 4CBUA 1KAZA 4FJNA 4DWIA 4WQ5C 4EFHA 2YNIA 5EX5A 3O5BA 3OYEA 4YDUC 3CD6N 1F21A 4PHTX 3EO3A 3L3UA 4BACA 4IFYA 4N56A 3T69A 4CEBA 4DQQA 3CQYA 3H1QA 5J1EA 1J5OA 1NLVA 1JL2A 3G71N 1VQLN 4M7XA 4JKDA 4BRFA 3KKRA 4B8AB 3QIOA 1QQMA 3ALYA 4CCHA 4J8FA 3J8AA 3OVNA 5KQDA 2HF3A 4PWDA 5HRSA 3RVCA 3L4QA 2CH6A 1JCFA 2X6SA 4PKHA 4AM7A 4HVJA 1K9MO 4C23A 3QEXA 1VHXA 3AO4A 4HUEA 1L3VA 3AVCA 2IVOA 2GUPA 3DLKA 4PKIA 4CJPA 3AA3A 3W3DA 4DR6K 4BDZA 2FSJA 4LH4A 3T1HK 4O5BA 2ZQBA 5KPTA 4DQRA 3MN5A 1YXQA 3LP0A 4E7IA 4JI4K 5GIOA 3CJAA 1Q18A 3AVAA 3S41A 4R5PA 1KCFA 3E66A 2QM1A 3LDPA 4YOXA 4FLWA 3PO5A 3TU5A 3O9TA 3L4IA 4EZ6A 4BRLA 3RMCA 4CEZA 3AO3A 1SKWA 5I42A 1RTHA 3VPZA 5J2QA 3TARA 4XH4A 1U49A 2WBNA 4KPYA 4CD3A 4BR7A 1IBMK 1KFDA 2CGLA 5I9EB 5AQLA 4DSLA 1BUPA 1JJ2M 4DTPA 1S9EA 2O8BA 4DU1A 3AV9A 3K5OA 1RTDA 3DOKA 2ZGZA 3FLCO 1TL1A 4OPAA 3EY1A 3LDNA 3LZIA 4FZZA 1IKVA 3KK1A 4DV6K 4CF8A 3H3NO 4BRNA 5I3UA 3E9LA 2ZM6K 3LP3A 1YTAA 1RDDA 2P9SB 4KV8A 2W42A 1D9FA 3T7ZA 2GBZA 4KFBA 5JLHA 4N41A 4PQUA 4GNIA 3VEYA 4BC2A 3GE1A 3R1XA 4CJWA 3HSTB 4CZIA 1S1UA 4M3TA 1T05A 2PYLA 4B9MA 4B1WB 4W5NA 5BN8A 1Q7YO 2GEMA 1U47A 4HWIA 1IV0A 3HPGA 4H0TB 1NGDA 3KVGA 1J5EK 2KFZA 5IT9O 4IXCA 1NK9A 2WUSA 5C12A 3V9UA 2PZSA 3DXKB 2DTUA 5HBMA 3O1WA 4EIAA 1VQ4N 1S1WA 4CK1A 1BIZA 3VERA 4JKBA 3ATVA 1BL3A 3L2WA 1J53A 4HCBA 1YTUA 4ISGA 1H1VA 1LOTB 5AQUA 3NF7A 1VRUA 3AVHA 1ESVA 4B1UB 1HPZA 3THVA 4R79A 3LWLA 2GWJA 4FK0A 1EXQA 5HLFA 2G8WA 1NK6A 4LD0A 3L2VA 1N33K 4C8OA 1Q82O 2NRTA 3L3VA 3ZT4A 4H4MA 3DYAA 5CYQA 1ZBUA 1UA1A 4WFNL 2XHBA 5M1FA 4NLBA 3JS6A 3THWA 4Z0UA 4FK2A 3KJVA 4XH1A 2V51B 4PKGA 3KLEA 3TAMA 1N6QA 1XHXA 5AZIA 4Z4CA 2OPQA 1X9WA 3SJHA 3WXKA 3ITHA 1NK4A 1GLBG 3I33A 3C6UA 1A5XA 3LM2A 4CGHA 1VQON 3CCMN 2QWNA 2Z1GA 1REVA 4IFEA 4GV6A 1RCHA 2ASPA 1XI1A 4JS4A 4HUGA 4RW4A 3THXA 1LWEA 4HCCA 3N4QA 3CCQN 3TAPA 2KW4A 5JVHL 5J2MA 5AQYA 2Q2RA 3E9OA 4CJKA 2P9UB 2YHWA 1JXEA 4DQSA 3GG4A 3JXUA 3D2EA 2QXLA 1HKGA 3M8SA 5AQHA 3WNGA 3DLEA 5A2QO 1UOCA 4J2BA 3C6HA 3EKUA 4CI6A 1Q8IA 1BCOA 3AGKA 3NBPA 1SUQA 3OJSA 2ZD1A 4BR2A 3DRRA 4A2AA 4IFVA 3UKRB 3HJFA 3TTCA 5KQ8A 1D5AA 4FWNA 2HF4A 1FKPA 3CJ1A 4DF4A 3FZHA 3ZETB 2IVPA 2NRWA 4C8KA 4Z4FA 1NK7A 3DLBA 2NUBA 5HP1A 4MQ3A 2D0OA 1E3MA 3O3HA 1NMNA 1TVRA 1S6PA 4H5VA 4PUOA 4BG9A 4B9VA 3FR0A 2ZJRL 1WOQA 4DQPA 3CJ9A 4CF9A 2QKBA 1K8KA 2OANA 1OH5A 4ELUA 4FJMA 3SK3A 1ZBIA 2HBKA 1RTJA 1RGIA 3M6GA 2B5JA 1BQNA 5BRHA 1TL3A 3DI6A 1NGCA 3CYMA 1VQ9N 4WYBA 3NGIA 4AHUA 5DK5A 2JGUA 4F3TA 4Q0BA 2VYPA 3SV4A 5M1NA 2OPPA 2HNZA 2UUAK 2PAVA 1QSLA 1LAVA 3PX0A 4FL9A 5AQIA 3VESA 4DSFA 1IG9A 1RDBA 2FC0A 2BGGA 1UA0A 3CCUN 1BWFO 1KVAA 4BRKA 4FVUA 3MN7A 4H0YB 2E2NA 3QNOA 4AHCA 3QMLA 2W40A 1JLEA 5AQTA 4G9ZA 3AO1A 3ENOA 3MN9A 4DV1K 3U8XA 4O0JA 3WNFA 4CJVA 4Z4IA 4CZLA 4EP4A 4KAZA 4DR3K 2KFNA 4DTJA 2HHHK 5AQJA 4Y1DA 3RMAA 1B92A 1C0MA 1ZBHA 3SCXA 1A5VA 3CCEN 2E4LA 3I55N 4CVNE 1BA1A 1HQUA 4ISFA 4CECA 2F9WA 1SAZA 1T7PA 1Z25A 2QW9A 5FPNA 3TTDA 2IDOA 4IDHA 4FJKA 3O8MA 2HBJA 4KTWA 5AQQA 1KLMA 3CC4N 4DR7K 3KIOA 1N34K 3PUFA 1JCEA 4LSNA 1ZC6A 2NRRA 1LW0A 3A2FA 3H3OB 2FSNA 4FPBA 4N47A 3I0SA 4DSJA 4BRHA 2W6LA 3T1AA 3P39A 3U4LA 1C6VA 4BWJA 4MDBA 4DR5K 4KHYA 1EETA 3V4IA 2UYTA 3OY9A 1W97L 1HJRA 3DWLA 3ZX2A 3CCLN 1VSFA 4N5SA 3AVJA 3I8BA 3TANA 1WSGA 2VWJA 1QE1A 4KTQA 3AVBA 4CJSA 1D4XA 3WEEA 1X9JA 2Q1NA 1WB9A 1EX4A 4U67L 3S9HA 1VSMA 3SI6A 4KBOA 1YJ9N 1VSKA 3LDLA 1IO2A 2UXBK 4CJQA 3MXJA 4WE1A 4H0PA 1DKGD 3ZX3A 4Y0WA 2Q31A 4WQ4C 2QWQA 3K59A 5D3GA 2Q36A 4NYNA 2Y1JA 3ZETA 4JD2B 3TAEA 4QOZB 3DM2A 2IAJA 3HOSA 2E2PA 4C1NK 1HLUA 4OKJA 4KHNA 2IS3A 1WUAA 2CH5A 3MN6A 3QEVA 2HHXA 3RMBA 1ASVA 2YHAA 5CY4A 1FK9A 4A59A 4JI5K 3V1RA 3JSMA 4BVPA 1QVFM 3TSUA 4I9QA 5C0YA 1HJOA 3B6PA 4BC3A 4AF1A 1NGBA 4WQ5A 1JLGA 4E1NA 4B8CA 3NGYA 4DUYK 1HNIA 4FWKA 3ZSWA 5CYMA 1IG8A 1Z6RA 1QQOA 2QWPA 4FZYA 2YNFA 5KPZA 4FK4A 1NKBA 2XY7A 3K2PA 5ELZA 3PV8A 1GLLO 4J2AA 4K0KK 4CEOA 4H5RA 3GDQA 1TKDA 3HPOA 4K41A 4LF8K 2OTJN 3P4IA 3WUHA 4GV3A 1NMDA 3NDKA 5C15A 3DOLA 5F2RA 3OS2A 4EHTA 4BGAA 5HOOA 4H8KA 2F8TA 4M3UA 1L3TA 4CJUA 1YF5L 5GAEP 2E8AA 5F1XA 1MWKA 1TV6A 4FWPA 1VQKN 3K5LA 1QZ6A 3U9DA 1LWFA 3B6OA 2QEXN 3SZ2A 2IC3A 3AVLA 2E2OA 5EOYA 3VA0A 3FZMA 1WSEA 2JWLA 3OYIA 4DR2K 2A42A 4BDYA 1ZBFA 1GOCA 4BQZA 2ZE2A 4JHDA 4EHUA 2P1JA 1KD1O 4BROA 3OHRA 3VENA 4L8RB 2EWSA 2YV0X 4O5FA 4B9QA 3A0IX 4LFCK 4BGBA 3ZSRA 3ZX0A 4X66K 4FJJA 3UE5A 2IIRA 4G1QA 4IZ9A 3OYBA 2GELA 3CIPA 3WXIA 2D5RA 3OYFA 3VEWA 1NJXA 2RPIA 3AGRA 4AHVA 4PY5A 3VEZA 4I9LA 2HHQA 3PSFA 3QINA 1BISA 4JKEA 2WC9A 3VQAA 4FW2A 3NVKA 3D45A 4JKHA 5H1SQ 2P9NB 1NM1A 1S9GA 4BQLA 3D0PA 1C1AA 1SL2A 5T7BA 1VSLA 5C42A 1S1VA 1VSIA 2O4IA 4F4KA 3FZKA 4FXDA 4BC5A 2R7YA 3FZFA 4BRPA 3L8BA 3LALA 4I2QA 3VQ7A 1LCUA 4CEDA 1IKYA 3MCPA 1RNHA 3OYNA 4ZHRA 4C8MA 2FF6A 3VEVA 1BO5O 2P9LB 4QS9A 3SQ4A 3MX5A 3R9PA 3F9KA 5AQRA 4JRQA 1JXBA 3LPTA 4FSVA 2WOMA 1JKHA 1KRPA 2G8HA 4BRAA 1HR0K 3HYFA 3CJ7A 1U45A 2QK9A 4H5NA 3AY9A 2AA4A 4CIEA 4FJGA 3OTOK 1JLAA 4K43A 1XNQK 3CC2N 1S1XA 4B1YB 3MECA 4B9UA 3QBXA 4FOEA 3ULEA 4L3QA 1WBBA 4YY3K 1CXQA 3AVGA 3T19A 4DF8A 4OVLA 4H0VB 4GV9A 4MDAA 1C0UA 1RT3A 1QSSA 3CHWA 3D7EO 2YJEA 2GUIA 4H4OA 4KO0A 3VQ4A 1ITGA 4X64K 2HNDA 3HSCA 4AM6A 2HVHA 3HP6A 1N8RO 4CGGA 4B1VA 1HQEA 3O9RA 2ZWHA 2O8BB 1BA0A 5EVZA 1SS6A 2RN2A 2YKMA 3NF6A 3BGRA 4NCGA 3V81A 4XH5A 1BG3A 4X62K 3BZCA 1L3UA 3SAHA 4JI2K 1HNXK 1ATNA 3KK2A 4CF1A 4N76A 3DMJA 4CJLA 1NJWA 2P5GA 1J6ZA 1S1TA 3Q7BA 4JI1K 4DKWA 4DFKA 1FKOA 3WQTA 2KLAA 4ISEA 2UUBK 3CCSN 2H3GX 3AO5A 3ZSOA 4CHNA 3LANA 4I6MB 1XC9A 1NK0A 1RDWX 1JLFA 3UB5A 4ILJA 4BRMA 2GX9A 5J2NA 3TAGA 4JKGA 2EX3A 3J81O 2KKZA 1XWLA 3I8DA 5BPMA 1E4FT 2DPNA 3JYTA 2UXDK 1DT9A 3KLGA 3DLHA 3THXB 5C24A 5AQKA 4BG8A 1VQ7N 3VGKA 1P90A 3CCVN 3P1GA 2YHBA 2ZF5O 3DXMB 4JS5A 4DUZK 4IO8A 2P9KA 3EE9A 1KAXA 3CQXA 4KH5A 5CHIA 3BUZB 1ATSA 1ZXOA 4NXNK 2QWOA 4NLCA 4BWMA 4W5QA 4DV4K 2ITMA 4B3OA 4IEIA 2HOEA 3O80A 4KHUA 4CJ5A 3TWHA 2QKKA 3NHGA 2RHKA 1NJIO 3A5NC 4DV2K 4DLGA 2P5OA 3NF8A 3CETA 1SKRA 2O8DB 1KFSA 4RW7A 4EP5A 5C2DA 1U2VB 1NGJA 4CZFA 3ULDA 1EWQA 3P83D 5HRPA 1YIJN 4K42A 3V1QA 4DTNA 1BDGA 2I7NA 2P9KB 2XRIA 2QTDA 3C7NA 2A5XA 4BE0A 1YITN 1OH8A 3AO2A 1JLCA 3I0RA 3RSEB 1RFQA 3GL1A 4K8ZA 1TKXA 2OA8A 1J54A 1W7AA 3SUNA 3CC7N 1E4GT 1NWKA 3G0ZA 4PL7A 3NVMA 3R6MA 4DG1A 1YUWA 1T6CA 3SQ0A 1RT1A 5LJWA 3CFPA 1Q86O 4JKGB 1CLQA 2ZGYA 4DR1K 3DLLL 1UAXA 1WAFA 2XY8A 2RKIA 3SBGA 3MEGA 1VSHA 4JKFA 4RG8A 4H5TA 3U6FA 1GOBA 1LAWA 3OS1A 3K9KA 4QAGA 3QBWA 3KTQA 2BTFA 2QWLA 1QHAA 4RCHA 4JV5K 2O8FB 2ATQA 2KTQA 4I2PA 3J7ZO 1ZBLA 4BY9C 4BREA 1K6YA 2KZMA 3SUQA 2KQ2A 4OLBA 3RR7A 3VQ5A 2E20A 2X6NA 4M3YA 1MA9B 5AQWA 3LZJA 2Q3SA 3FFKB 2QI2A 2HHWA 3VA3A 1Z26A 5LMUK 4E7LA 3S3MA 1Q9XA 4JLHA 5K14A 5SWMA 1NGAA 1RILA 3ZEUB 1NBWA 4IJAA 2NRVA 3E01A 3LWMA 1BIUA 2Z1HA 4GY2B 4YFUA 1C0GA 4OGCA 4FLXA 4IG3A 2FBYA 3A8YA 5AJ3K 1BI4A 2NRZA 2DFHA 3D2FA 3QO9A 4I6MA 4AHTA 4F3OA 1DTTA 5HL7L 3K9JA 3LPUA 4CEEA 1BCMA 1XMOK 2HHUA 1QS4A 4MO4A 3AVNA 1VQ8N 4CHQA 2P9PB 1QQNA 5AQOA 4CBXA 4CGJA 1R59O 1VRTA 1W9HA 2D1KA 3THYA 4FLVA 1EP4A 1HMVA 4OPKA 3BF3A 4B08A 3DXMA 2GV9A 1LWCA 3QEPA 4E19A 2P9IA 3THWB 1ILYA 3H46O 1HYVA 3LAMA 2OYQA 1RDAA 4LF6K 2UU9K 4CHZA 2WTUA 1WN7A 1SL1A 4OPHA 3SMPA 1NOZA 2P9LA 3H08A 3OJUA 4CFAA 1T3VA 2A1RA 3RR8A 4BE1A 2Q0UA 1VQNN 3OA9A 5F0XA 1DGKN 2P9PA 2EHGA 1EO1A 1I39A 1KLNA 4DTSA 4WCEL 2O8DA 2FBTA 4KREA 2F96A 1WSFA 2YHYA 3LP2A 4CZJA 4LF9K 1NNEA 4B9SA 4IDKA 3KHYA 2NNWA 5GINA 2O4GA 4CESA 4A61A 3QEIA 3C7NB 4LC9B 4TSXA 1MWMA 4F8RA 2WONA 4PA1A 4YOTA 3TSPA 3PY8A 4KHPK 3VQCA 3OYLA 1TUYA 5AZJB 2PYJA 1OVYA 1QVGM 5FPDA 3AVIA 3ISNC 3SLCA 3MWPA 4BRQA 3Q7CA 3KK7A 3WNEA 2VGMA 4OGEA 3O9QA 4BR5A 3V1OA 5LJVA 4DSKA 4YHHK 3DAWA 1DTQA 1LW2A 3P38A 5J2PA 5M1QA 3VEOA 2E5LK 3OYDA 4CJ7A 3VQBA 5C2FA 1Q81O 4JNEA 3A5OC 2BUPA 4UY8O 1O13A 4OLAA 4F9OA 4M63C 1FJGK 3J80O 2NRHA 1X9SA 4JK9A 3ZLJA 4WFAL 3KWGA 1BQMA 4DHYA 4DLEA 3PO4A 4YORA 1TYQB 4DV3K 4DFMA 3F73A 3TSQA 2P9NA 1RDCA 5HRNA 1YVUA 3B8AX 2OZMA 2OCEA 1J9AA 4IWVA 3KZBA 4CZMA 3P31A 3G25A 4ZTFA 3ASMA 3SNNA 1CZAN 4DTOA 3CM6A 5JS2A 1T6DA 1X3NA 4M3ZA 2FF3B 4NCBA 1LV5A 1NK8A 3QETA 4IBNA 5KGXA 3AVKA 4MLEA 3SAFA 4ID5A 4BC4A 4MLHA 1BI4B 1RTIA 4CFDA 3V6DA 1T03A 3ID6A 3PIPL 1U48A 3PX6A 2VQEK 4KKOA 3HP9A 2Z1JA 5AQNA 2FBVA 3ENBA 3DJCA 4FM1A 5AQFA 5AQPA 4FWSA 4CHOA 4ICLA 4PL8A 4M3WA 3GBTA 4A5AA 4FLYA 2Q0RA 2O8CA 2FBXA 4H03B 3J7AP 4FZXC 4J2DA 1C1CA 3O3FA 4LH5A 4FWRA 3QIPA 4JYAK 1IJJA 4O4GA 5FDLA 4C8LA 3O6WA 1NGGA 3OS0A 1RDUA 1HPMA 3G6EN 3HI0A 4B3SK 4E1JA 5HROA 5EU7A 2BANA 1NJZA 1BU6O 1GLJO 5BPLA 4B1XB 4HUFA 1RT6A 4JK8A 3KD5E 1UWBA 3GOIA 2HHVA 5GIPA 1U2VA 3QICA 3W0LA 4OKKA 2BDPA 1JCGA 3AA2A 3WEEB 4CGIA 1HNWK 2IOCA 1RT4A 4FWOA 3HZ6A 4JI7K 4FJ5A 2D0BA 1IKXA 4ID1A 1GLDG 2X78A 4FO0A 2BE2A 3KLFA 1SQKA 4A57A 3N4PA 1FXXA 4JD2A 4F2RA 2A40A 1OH7A 3BP8A 2D0CA 4FJXA 5EY4A 5FRMA 4FWMA 4FLZA 4RWTA 3O4QA 5KI6A 2G8UA 2A1SA 5C10A 5FPEA 4EZ9A 3ZT3A 4FM0A 3KK3A 4Z4EA 2JLEA 2VQFK 4E3SA 1RT2A 4YDUA 3HO1A 2YNHA 4A62A 4FM2A 3BF1A 2ZJPL 3RRGA 4CJFA 2A3ZA 3UKUA 3AAQA 2FSKA 2F8SA 2PY5A 3ZT0A 4ILGB 4W5TA 2UUCK 4DR4K 3J7YP 4KI6A 4ZTJA 4EAHD 3HK2A 4HTLA 1W2BM 4M3XA 5FRNA 4FW1A 3IRXA 3EN9A 4DTXA 3QFPA 5AFUH 3CJBA 4IG0A 4AQYK 3TPQA 1S5JA 3FGUA 4JN4A 1TKZA 3LL3A 4H0XB 3CF5L 3O4WA 5AQVA 4Z4HA 2A6AA 4LSLA 4E7JA 3QLHA 3SBTA 4GW6A 1YHQN 1RBRA 4LF5K 1NKCA 2HW3A 4BR4A 3VQ9A 4C8NA 1SL0A 2HBLA 4JEPA 3QERA 4A5BA 2YCHA 2VCPA 1IKWA 4KHWA 5M1OA 1C1BA 2G8KA 5AFUA 4DSIA 3SYZA 2I7PA 2GTDA 5C25A 4B9NA 4CJRA 3VGMA 2X74A 3L6QA 4YOYA 4Z4GA 2VWBA 4M3RA 4FJIA 4NXMK 3MCAB 3K58A 4CJ3A 5JVGL 5DMRA 1VQMN 1CZ9A 3EE8A 4CEAA 3DLGA 2F7TA 3FFIA 1NG9A 1OKJA 2UXCK 2ASMA 3BEXA 4A2BA 4WF9L 3C95A 2QWMA 4GMJB 3CCJN 1IH7A 1NJYA 2PBDA 3L2QA 4Z94A 3E1YA 1RT5A 3MXMA 3KLIA 3QNNA 4ILHA 3ZT1A 1CZBA 4RW6A 4WQ4A 4DFPA 4CEQA 2XY6A 4DU4A 2Z1IA 5CZ2A 2O8EB 3VF2A 3CG7A 3MEDA 1S72N 3HXMA 2D4WA 3OYCA 5HRRA 2W41A 4MFBA 3QB0A 3QFUA 3LP1A 1KAYA 1GOAA 3ZYYX 4CIGA 5KRSA 4FWLA 4FPAA 1YI2N 1QSYA 3CQ8A 3MDQA 3VTHA 1TK5A 2DY4A 1S6QA 3TR8A 3H6EA 3VETA 3MAQA 4U7BA 5BN9A 4E0DA 4CJEA 4WFBL 3AA4A 3IMXA 1TAUA 5CE3A 3C65A 5LMNK 1W0HA 3NH0A 3NH1A 3CCRN 3NAEA 5GAGP 1NU0A 5AQMA 1Z05A 2W6KA 3F2KA 2QWRA 1X9MA 2WFBA 3LDOA 3PSIA 1XUPO 3ATUA 4BRCA 4FYDA 4FWQA 2HSTA 5TKYA 1I94K 3O9SA 1T44A 3VQ6A 1BHLA 4K25A 1JLBA 3EYZA 4CIFA 4JRPA 4B9TA 3ID8A 5FLXO 2E1ZA 1TKTA 1IBKK 4NCAA 1EKEA 5EXWA 3ZSQA 4KRFA 4YOUA 1ATRA 3CPWM 1G99A 1HYZA 1CXUA 3CFOA 1HUXA 4XEIA 1VSJA 4XIUA 1GLEG 3NMUA 2ITGA 3SPZA 2RF2A 3OBYA 5DM6L 2VG6A 3NF9A 5AZIB 4OPJA 5CZ1A 3VQPA 4O8KA 3KKSA 2XY5A 3UKRA 1ZBSA 3VQEA 4JHDB 4IKFA 1P8ZA 2E1YA 3S3OA 2PFUA 3BDPA 5BRFA 3VQQA 5AQGA 2YX6A 5E84A 1RBVA 1WLJA 1Y64A 1N5YA 3RMDA 1KXPA 4IOXA 2JWKA 3H1VX 5LL6Z 4LFBK 3AVMA 4M41A 3OBWA 1HNZK 4O55A 1KSPA 1WSIA 2KZZA 3T3FA 3QDKA 1YAGA 4QS8A 4FJ9A 2HVIA 4DFJA 4M42A 2P9IB 5M1KA 1WSHA 4DQ8A 2DFFA 3NCIA 4LF7K 1XQSC 4FLUA 1RT7A 4BRIA 4DV5K 3I56N 4W5RA 4CGFA 3V9WA 1L3SA 3VN5A 3JAMO 1GLFO 3H45C 3HPHA 2E2QA 2A41A 3HVRA 4B3RK 1HKCA 3NGZA 2I5JA 4ELTA 1WAJA 3SUPA 5AQXA 3HM8A 1TK8A 3S3NA 4CJTA 3FE1A 3L0QA 2HB5A 4E89A 1OVQA 2G8FA 3L2RA 1HNVA 3HBTA 3PLAA 2ASOA 4DTRA 4BDPA 2LSNA 1HYSA 3T1YK 4OO1J 1L5UA 5JICA 2XO7A 3IKMA 1HKBA 4X65K 3QEWA 2NLXA 4CEFA 1G15A 3HTVA 1V4SA 4DCHA 2HHSA 1V4TA 5AZJA 3BZKA 3C6AA 3A5LC 5AQSA 1YVNA 3A5MC 3SMSA 3EL2A 4FJ8A 2VWKA 2B4JA 4KH6A 2HMPA 5B8HA 1A5WA 2V52B 3SQ2A 3TABA 3VGLA 4OJRA 3KD1E 1EQYA 3M8QA 3M1FA 1M1KO 3WQUA 3AA5X 1B9FA 2FLOA 4I7FA 4B3TK 3V9ZA 3AARA 5SZTA 3V9XA 1XHZA 3ZSVA 4LY7A 2QXFA 4FOIA 4IO9L 1VQ6N 3VQ8A 3WXMB 2D0PA 3EKSA 1C0FA 1O1WA 3MWTA 1U4BA 1ASWA 3VMFB 2NRXA 3RRHA 3MEEA 2HMIA 4CBWA 4CHYA 2ZJQL 4CF2A 4JI6K 4CD1A 4FVMA 4YNQA 2Y1IA 4KTZA 3OYJA 1QHTA 2YNGA 3CM5A 2CGKA 3PIOL 2P9SA 5E41A 4CZEA 5IWAK 5BRDA 2IGIA 3MX2A 2DFEA 4E1MA 3O4NA 2IVNA 4BR9A 4QS7A 2O8EA 4HHTA 3CJCA 1S3XA 5FPMA 4DB3A 2YI1A 3UIQA 4KB0A 3HVTA 4KI4A 1RBUA 3U3GA 1GLAG 3WXLA 1U6ZA 5KGWA 2CGJA 3O1BA 1U04A 4NYFA 3HL8A
chains in the Genus database with same CATH topology
2FBVA 5HBMA 4FM1A 2DTUA 3SQ4A 4AH9A 4GVMA 1S1WA 4CK1A 3F9KA 1BIZA 4FCYA 2VG5A 4CHOA 1MU2A 4ICLA 1KVBA 4DSEA 1BL3A 3L2WA 2ETJA 3NE6A 4FLYA 4M3WA 1J53A 4JRQA 2FBXA 4HCBA 1YTUA 1JXBA 3LPTA 4FZXC 2WOMA 3NF7A 4J2DA 1JKHA 1C1CA 1VRUA 4LH5A 3O3FA 3AVHA 2OPRA 2G8HA 1KRPA 4KHQA 3HYFA 1U45A 3QIPA 2QK9A 4O4GA 1HPZA 5FDLA 4M45A 4CIEA 3THVA 4C8LA 3OS0A 4FJGA 4CERA 1JLAA 1JL1A 3LWLA 4RW9A 4FK0A 1EXQA 5HROA 5HLFA 2G8WA 5EU7A 2BANA 3TAFA 4CK3A 3AVFA 4LD0A 1NJZA 3L2VA 1NKEA 4AHSA 1NK6A 4C8OA 3OYAA 3L3VA 1S1XA 4H4MA 3ZT4A 3DYAA 5CYQA 1RT6A 1ZBUA 4HUFA 1UA1A 1NOYA 3MECA 4W5OA 3KD5E 2XHBA 1UWBA 3IG1A 4B9UA 3ZCMA 2HHVA 4Z0UA 4FK2A 3M8RA 3KJVA 3K5MA 1CXQA 3AVGA 3T19A 4OKKA 2BDPA 2B6AA 4DF8A 3AA2A 3KLEA 4OVLA 2E6MA 3TAMA 1XHXA 1N6QA 4CGIA 4Z4CA 2OPQA 1WSJA 3G10A 1X9WA 1C0UA 4RW8A 1RT3A 3ITHA 1NK4A 1QSSA 2HHTA 2IOCA 1RT4A 4FJ5A 2GUIA 3C94A 4H4OA 4KO0A 3VQ4A 2D0BA 5KTQA 3ZT2A 1IKXA 4ID1A 3C6UA 1ITGA 1ASUA 1A5XA 1C0TA 1WNSA 4CGHA 2X78A 3DLRA 2HNDA 2Z1GA 1REVA 1RCHA 2BE2A 4BE2A 3HP6A 3ZSYA 3KLFA 2HVHA 4CGGA 1XI1A 4JS4A 4HUGA 4RW4A 2E6LA 1LWEA 4HCCA 1FXXA 4F2RA 1HQEA 3TAPA 2KW4A 5J2MA 1R0AA 2D0CA 4FJXA 5FRMA 4CK2A 4CJ4A 3ZSZA 2RN2A 2YKMA 4FLZA 3O4QA 3NF6A 3BGRA 4NCGA 5KI6A 4CJKA 3V81A 2G8UA 2A1SA 2D0AA 4EZ9A 3NH2A 1JXEA 3ZT3A 4FM0A 3KK3A 4DQSA 1VK0A 1L3UA 4Z4EA 2JLEA 3OYKA 4E7HA 4E3SA 1RT2A 3KK2A 4CF1A 3M8SA 3WNGA 3DLEA 4FJ7A 1UOCA 1SV5A 3DMJA 2YNHA 4N76A 4J2BA 3TI0A 1BGXT 4FM2A 3HO1A 4CJLA 1NJWA 2P5GA 1S1TA 3RRGA 1Q9YA 2G8VA 4CJFA 4DFKA 1FKOA 1BCOA 1Q8IA 1ZYQA 3NBPA 1SUQA 3OJSA 3RWUA 2ZD1A 3TAQA 2F8SA 2PY5A 3ZT0A 4W5TA 3DRRA 2G8IA 4IFVA 3HJFA 4KI6A 3AO5A 4ZTJA 3ZSOA 4CHNA 3LANA 1XC9A 1NK0A 1D9DA 3HK2A 1D5AA 3VQDA 4M3XA 5FRNA 4FW1A 1JLFA 3IRXA 5J2NA 1QTMA 4DTXA 3TAGA 3LDSA 2EX3A 4O44A 1FKPA 4IG0A 4DF4A 1XWLA 4YNQA 3I8DA 1S5JA 3JYTA 3IS9A 3KLGA 3DLHA 3L2UA 3U3YA 1TKZA 4C8KA 3DRPA 5C24A 3HM9A 4Z4FA 1TK0A 1NK7A 1KVCA 3P1GA 4Z4HA 2NUBA 3DLBA 5HP1A 4MQ3A 2YHBA 3O3HA 1TVRA 4LSLA 4E7JA 1NK5A 1S6PA 3QLHA 4JS5A 4GW6A 4PUOA 1RBRA 2W42A 1NKCA 4B9VA 4KHUA 1VSEA 3P5JA 2HW3A 3VQ9A 4DS4A 4DQPA 4C8NA 4CF9A 2QKBA 1SL0A 4ELUA 3KLHA 4BWMA 3EZ5A 4FJMA 3QERA 4W5QA 4E7KA 1IKWA 1Y97A 4KHWA 3HP9A 4B3OA 1ZBIA 3SUOA 1C1BA 1RTJA 1YT3A 3OYMA 2B5JA 1BQNA 4CJ5A 1TL3A 3TWHA 3NHGA 2G8KA 2QKKA 4DQIA 4DSIA 3DI6A 3CYMA 3SYZA 5JS1A 5C25A 4B9NA 3NGIA 4CJRA 3C6TA 5DK5A 4AHUA 2X74A 2P51A 3HT3A 4DLGA 2JGUA 4F3TA 4Q0BA 3RTVA 2P5OA 3NF8A 1SKRA 2OZMA 4Z4GA 4M3RA 3SV4A 1KFSA 4FJIA 4RW7A 4CJ3A 3K58A 1KTQA 5DMRA 2OPPA 4EP5A 1TGOA 2HNZA 1CZ9A 4HTUA 4CFCA 3QESA 1T8EA 1QSLA 4CEAA 3ULDA 1LAVA 3DLGA 3PX0A 1D8YA 4DSFA 1IG9A 1RDBA 2FC0A 3FFIA 3P83D 5HRPA 2BGGA 1UA0A 3V1QA 3NFAA 1KVAA 1QQCA 3C95A 2VG7A 1VSDA 4DTNA 3QNOA 4GMJB 4AHCA 3IAYA 3SV3A 1IH7A 1NJYA 3L2QA 3PX4A 2XRIA 1JLEA 1RT5A 3MXMA 4PWDA 3KLIA 3QNNA 4BE0A 3AO1A 3ZT1A 5KRTA 4FJHA 1CZBA 3AO2A 4AHRA 4KHSA 4RW6A 1JLCA 4DFPA 3I0RA 4CEQA 2XY6A 4O0JA 2Z1IA 4DU4A 4K8ZA 3WNFA 4CJVA 1TKXA 4Z4IA 5CZ2A 2OA8A 4DTMA 1J54A 4EP4A 2OZSA 4DTUA 3SUNA 3M8PA 5FROA 3G0ZA 4KAZA 3CG7A 3MEDA 4DG1A 3OYCA 3HXMA 4DTJA 4ELVA 2KFNA 3SPYA 1TAQA 5HRRA 4AILC 4CGDA 4Y1DA 3RMAA 3SQ0A 1RT1A 2OPSA 4MFBA 3CFPA 3MXIA 4Q5VA 3LP1A 1B92A 1C0MA 1GOAA 1CLQA 1ZBHA 3SCXA 3RR8A 1A5VA 4CIGA 5KRSA 2E4LA 4DU3A 1UAXA 1WAFA 2XY8A 1QSYA 1HQUA 2RKIA 4CECA 4O0IA 3CQ8A 4CHPA 1TK5A 3K57A 3MEGA 1VSHA 2DY4A 1S6QA 4RG8A 3TR8A 3U6FA 3MAQA 1GOBA 1T7PA 4DMNA 1B9DA 3OYHA 1LAWA 1RBSA 1Z25A 4CFBA 3OS1A 4E0DA 4J2EA 4CJEA 2IDOA 4QAGA 3AA4A 1TAUA 4FJKA 3KTQA 4KTWA 1W0HA 1KLMA 3NH0A 2ATQA 2KTQA 4I2PA 3NH1A 1SKSA 1ZBLA 3KIOA 3NAEA 1X1PA 1K6YA 2KZMA 1HRHA 3PUFA 1X9MA 4LSNA 4OKEA 3SUQA 4K8XA 2KQ2A 4OLBA 1LW0A 3A2FA 3O3GA 3RR7A 4FYDA 2YKNA 2X6NA 4N47A 3VQ5A 3I0SA 3S9HA 4FLTA 4M3YA 3LZJA 2Q3SA 4Y1CA 1RBTA 4KB1A 2HHWA 3VQ6A 1BHLA 1Z26A 3VA3A 4DSJA 1JLBA 3ZSXA 3T1AA 4CIFA 3EYZA 4JRPA 4E7LA 3S3MA 1Q9XA 4B9TA 1C6VA 1DLOA 4JLHA 5K14A 4BWJA 5SWMA 1RILA 1TKTA 4B9LA 4FJLA 4KHYA 4NCAA 1EKEA 3LAKA 3ZSQA 4KRFA 1EETA 3WNHA 3E01A 4F2SA 3LWMA 3K5NA 1BIUA 2Z1HA 3V4IA 4CF0A 3OY9A 4YFUA 3SQ1A 3DRSA 1HJRA 1HYZA 4OGCA 4FLXA 1CXUA 3CFOA 4IG3A 2FBYA 1VSFA 4N5SA 3AVJA 1VSJA 4XIUA 3TANA 1BI4A 1WSGA 2ITGA 2VWJA 1QE1A 4KTQA 3AVBA 2RF2A 3SPZA 4CJSA 2DFHA 2VG6A 3NF9A 3OYGA 3SJJA 1JLQA 3QO9A 4AHTA 4OPJA 4F3OA 1DTTA 1EX4A 3LPUA 4CEEA 1BCMA 5CZ1A 4CE9A 4UQGA 3VQPA 3CFRA 4DS5A 1QS4A 1VSMA 3KKSA 2XY5A 3AVNA 3SI6A 3V9SA 2AJQA 1I3AA 3VQEA 4CHQA 1VSKA 4IKFA 4QCLA 2HNYA 3S3OA 3BDPA 1IO2A 4FJNA 4DWIA 3VQQA 2YNIA 4CGJA 3MXJA 4CJQA 4WE1A 3OYEA 1VRTA 1W9HA 1RBVA 1F21A 1WLJA 4FLVA 3K59A 3L3UA 1EP4A 4BACA 1HMVA 1N5YA 4NYNA 2Y1JA 5D3GA 4OPKA 3TAEA 3RMDA 4QOZB 3DM2A 2IAJA 3AVMA 4M41A 4B08A 4IFYA 4OKJA 4KHNA 2GV9A 4O55A 1KSPA 4N56A 1LWCA 1WSIA 2IS3A 2KZZA 3QEPA 4E19A 3T3FA 4CEBA 4DQQA 4FJ9A 2HVIA 4DFJA 5J1EA 1J5OA 3QEVA 4M42A 2HHXA 3RMBA 1ASVA 1HYVA 3LAMA 1JL2A 1WSHA 2OYQA 2YHAA 1RDAA 5CY4A 1FK9A 3KKRA 4B8AB 3V1RA 3QIOA 4CHZA 1WN7A 2DFFA 3JSMA 3ALYA 3NCIA 1SL1A 2HHUA 1NOZA 4I9QA 4FLUA 4CCHA 1RT7A 3H08A 3B6PA 3OVNA 3OJUA 4CFAA 1JLGA 4E1NA 4W5RA 4B8CA 4CGFA 3NGYA 5HRSA 4BE1A 3V9WA 2A1RA 1HNIA 1L3SA 3VN5A 2X6SA 3ZSWA 5CYMA 4FZYA 4HVJA 2YNFA 4FK4A 3QEXA 3HPHA 2EHGA 3AO4A 4HUEA 1NKBA 2XY7A 3K2PA 3HVRA 1L3VA 3PV8A 3AVCA 1I39A 4J2AA 4CEOA 1KLNA 3DLKA 3NGZA 2I5JA 4DTSA 3HPOA 1TKDA 4ELTA 1WAJA 3SUPA 2FBTA 3AA3A 4CJPA 3V9UA 4KREA 1TK8A 3S3NA 4CJTA 2F96A 1WSFA 4E89A 2HB5A 3NDKA 2G8FA 3L2RA 1HNVA 4BDZA 4BDPA 4DTRA 3DOLA 2LSNA 3LP2A 1HYSA 4B9SA 4LH4A 3OS2A 4IDKA 1L5UA 4O5BA 2XO7A 2ZQBA 2O4GA 4CESA 3QEWA 4DQRA 4CEFA 1G15A 4H8KA 3QEIA 2F8TA 4TSXA 4M3UA 3LP0A 1L3TA 4CJUA 4E7IA 4F8RA 2HHSA 1D9FA 2WONA 4PA1A 3PY8A 3AVAA 3VQCA 4R5PA 1KCFA 3OYLA 4FLWA 3PO5A 1TV6A 2PYJA 4EZ6A 3K5LA 3RMCA 4CEZA 3AVIA 3ISNC 1LWFA 3B6OA 4FJ8A 3AO3A 1SKWA 5I42A 1RTHA 5J2QA 3TARA 1U49A 2VWKA 4KPYA 2B4JA 3WNEA 3SZ2A 4OGEA 2IC3A 3AVLA 3VA0A 1A5WA 3SQ2A 3TABA 1WSEA 4OJRA 3OYIA 3KD1E 4BDYA 1KFDA 3M8QA 3V1OA 4DSKA 1ZBFA 1GOCA 2ZE2A 2P1JA 5J2PA 1DTQA 1LW2A 3AA5X 1B9FA 4I7FA 3V9ZA 4DSLA 5SZTA 3V9XA 1XHZA 3ZSVA 4LY7A 4L8RB 2YV0X 3OYDA 3VQBA 2QXFA 4DTPA 1S9EA 3VQ8A 4DU1A 3AV9A 3ZSRA 4OLAA 4FJJA 3K5OA 1RTDA 4G1QA 3DOKA 1O1WA 1TL1A 3EY1A 3OYBA 3LZIA 1U4BA 1ASWA 1X9SA 3RRHA 2HMIA 4FZZA 3MEEA 1BQMA 1IKVA 3KK1A 2D5RA 4DLEA 3OYFA 1NJXA 3PO4A 2RPIA 4CF8A 4CHYA 4AHVA 4CF2A 4PY5A 4I9LA 5I3UA 4DFMA 2HHQA 3LP3A 3F73A 3QINA 1BISA 1RDCA 1YTAA 4FVMA 1RDDA 3VQAA 1YVUA 4FW2A 4KV8A 4C8MA 3D45A 4KTZA 5HRNA 1J9AA 2GBZA 3OYJA 1QHTA 2YNGA 3CM5A 2Y1IA 1S9GA 4KFBA 5E41A 4N41A 3D0PA 1C1AA 2IGIA 4PQUA 2DFEA 4E1MA 4ZTFA 3O4NA 1SL2A 3ASMA 3SNNA 5T7BA 4DTOA 3CM6A 1VSLA 5C42A 1S1VA 4HHTA 5JS2A 4M3TA 1VSIA 3HSTB 4CJWA 1S1UA 4M3ZA 1T05A 2PYLA 4B9MA 2O4IA 4NCBA 1LV5A 3UIQA 1NK8A 4KB0A 4W5NA 4F4KA 3QETA 3HVTA 4IBNA 3AVKA 5KGXA 4KI4A 1RBUA 3U3GA 4FXDA 1U47A 2R7YA 4ID5A 5KGWA 3L8BA 1BI4B 1RTIA 3HPGA 3LALA 4I2QA 3VQ7A 4CFDA 3V6DA 1T03A 1U04A 4NYFA 4CEDA 1IKYA 3OYNA 1RNHA 1U48A 2KFZA 4ZHRA 3PX6A 1NK9A 4KKOA 2Z1JA 2PZSA 3HL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FBV A;  5HBM A;  4FM1 A;  2DTU A;  3SQ4 A;  4AH9 A;  4GVM A;  1S1W A;  4CK1 A;  3F9K A;  1BIZ A;  4FCY A;  2VG5 A;  4CHO A;  1MU2 A;  4ICL A;  1KVB A;  4DSE A;  1BL3 A;  3L2W A;  2ETJ A;  3NE6 A;  4FLY A;  4M3W A;  1J53 A;  4JRQ A;  2FBX A;  4HCB A;  1YTU A;  1JXB A;  3LPT A;  4FZX C;  2WOM A;  3NF7 A;  4J2D A;  1JKH A;  1C1C A;  1VRU A;  4LH5 A;  3O3F A;  3AVH A;  2OPR A;  2G8H A;  1KRP A;  4KHQ A;  3HYF A;  1U45 A;  3QIP A;  2QK9 A;  4O4G A;  1HPZ A;  5FDL A;  4M45 A;  4CIE A;  3THV A;  4C8L A;  3OS0 A;  4FJG A;  4CER A;  1JLA A;  1JL1 A;  3LWL A;  4RW9 A;  4FK0 A;  1EXQ A;  5HRO A;  5HLF A;  2G8W A;  5EU7 A;  2BAN A;  3TAF A;  4CK3 A;  3AVF A;  4LD0 A;  1NJZ A;  3L2V A;  1NKE A;  4AHS A;  1NK6 A;  4C8O A;  3OYA A;  3L3V A;  1S1X A;  4H4M A;  3ZT4 A;  3DYA A;  5CYQ A;  1RT6 A;  1ZBU A;  4HUF A;  1UA1 A;  1NOY A;  3MEC A;  4W5O A;  3KD5 E;  2XHB A;  1UWB A;  3IG1 A;  4B9U A;  3ZCM A;  2HHV A;  4Z0U A;  4FK2 A;  3M8R A;  3KJV A;  3K5M A;  1CXQ A;  3AVG A;  3T19 A;  4OKK A;  2BDP A;  2B6A A;  4DF8 A;  3AA2 A;  3KLE A;  4OVL A;  2E6M A;  3TAM A;  1XHX A;  1N6Q A;  4CGI A;  4Z4C A;  2OPQ A;  1WSJ A;  3G10 A;  1X9W A;  1C0U A;  4RW8 A;  1RT3 A;  3ITH A;  1NK4 A;  1QSS A;  2HHT A;  2IOC A;  1RT4 A;  4FJ5 A;  2GUI A;  3C94 A;  4H4O A;  4KO0 A;  3VQ4 A;  2D0B A;  5KTQ A;  3ZT2 A;  1IKX A;  4ID1 A;  3C6U A;  1ITG A;  1ASU A;  1A5X A;  1C0T A;  1WNS A;  4CGH A;  2X78 A;  3DLR A;  2HND A;  2Z1G A;  1REV A;  1RCH A;  2BE2 A;  4BE2 A;  3HP6 A;  3ZSY A;  3KLF A;  2HVH A;  4CGG A;  1XI1 A;  4JS4 A;  4HUG A;  4RW4 A;  2E6L A;  1LWE A;  4HCC A;  1FXX A;  4F2R A;  1HQE A;  3TAP A;  2KW4 A;  5J2M A;  1R0A A;  2D0C A;  4FJX A;  5FRM A;  4CK2 A;  4CJ4 A;  3ZSZ A;  2RN2 A;  2YKM A;  4FLZ A;  3O4Q A;  3NF6 A;  3BGR A;  4NCG A;  5KI6 A;  4CJK A;  3V81 A;  2G8U A;  2A1S A;  2D0A A;  4EZ9 A;  3NH2 A;  1JXE A;  3ZT3 A;  4FM0 A;  3KK3 A;  4DQS A;  1VK0 A;  1L3U A;  4Z4E A;  2JLE A;  3OYK A;  4E7H A;  4E3S A;  1RT2 A;  3KK2 A;  4CF1 A;  3M8S A;  3WNG A;  3DLE A;  4FJ7 A;  1UOC A;  1SV5 A;  3DMJ A;  2YNH A;  4N76 A;  4J2B A;  3TI0 A;  1BGX T;  4FM2 A;  3HO1 A;  4CJL A;  1NJW A;  2P5G A;  1S1T A;  3RRG A;  1Q9Y A;  2G8V A;  4CJF A;  4DFK A;  1FKO A;  1BCO A;  1Q8I A;  1ZYQ A;  3NBP A;  1SUQ A;  3OJS A;  3RWU A;  2ZD1 A;  3TAQ A;  2F8S A;  2PY5 A;  3ZT0 A;  4W5T A;  3DRR A;  2G8I A;  4IFV A;  3HJF A;  4KI6 A;  3AO5 A;  4ZTJ A;  3ZSO A;  4CHN A;  3LAN A;  1XC9 A;  1NK0 A;  1D9D A;  3HK2 A;  1D5A A;  3VQD A;  4M3X A;  5FRN A;  4FW1 A;  1JLF A;  3IRX A;  5J2N A;  1QTM A;  4DTX A;  3TAG A;  3LDS A;  2EX3 A;  4O44 A;  1FKP A;  4IG0 A;  4DF4 A;  1XWL A;  4YNQ A;  3I8D A;  1S5J A;  3JYT A;  3IS9 A;  3KLG A;  3DLH A;  3L2U A;  3U3Y A;  1TKZ A;  4C8K A;  3DRP A;  5C24 A;  3HM9 A;  4Z4F A;  1TK0 A;  1NK7 A;  1KVC A;  3P1G A;  4Z4H A;  2NUB A;  3DLB A;  5HP1 A;  4MQ3 A;  2YHB A;  3O3H A;  1TVR A;  4LSL A;  4E7J A;  1NK5 A;  1S6P A;  3QLH A;  4JS5 A;  4GW6 A;  4PUO A;  1RBR A;  2W42 A;  1NKC A;  4B9V A;  4KHU A;  1VSE A;  3P5J A;  2HW3 A;  3VQ9 A;  4DS4 A;  4DQP A;  4C8N A;  4CF9 A;  2QKB A;  1SL0 A;  4ELU A;  3KLH A;  4BWM A;  3EZ5 A;  4FJM A;  3QER A;  4W5Q A;  4E7K A;  1IKW A;  1Y97 A;  4KHW A;  3HP9 A;  4B3O A;  1ZBI A;  3SUO A;  1C1B A;  1RTJ A;  1YT3 A;  3OYM A;  2B5J A;  1BQN A;  4CJ5 A;  1TL3 A;  3TWH A;  3NHG A;  2G8K A;  2QKK A;  4DQI A;  4DSI A;  3DI6 A;  3CYM A;  3SYZ A;  5JS1 A;  5C25 A;  4B9N A;  3NGI A;  4CJR A;  3C6T A;  5DK5 A;  4AHU A;  2X74 A;  2P51 A;  3HT3 A;  4DLG A;  2JGU A;  4F3T A;  4Q0B A;  3RTV A;  2P5O A;  3NF8 A;  1SKR A;  2OZM A;  4Z4G A;  4M3R A;  3SV4 A;  1KFS A;  4FJI A;  4RW7 A;  4CJ3 A;  3K58 A;  1KTQ A;  5DMR A;  2OPP A;  4EP5 A;  1TGO A;  2HNZ A;  1CZ9 A;  4HTU A;  4CFC A;  3QES A;  1T8E A;  1QSL A;  4CEA A;  3ULD A;  1LAV A;  3DLG A;  3PX0 A;  1D8Y A;  4DSF A;  1IG9 A;  1RDB A;  2FC0 A;  3FFI A;  3P83 D;  5HRP A;  2BGG A;  1UA0 A;  3V1Q A;  3NFA A;  1KVA A;  1QQC A;  3C95 A;  2VG7 A;  1VSD A;  4DTN A;  3QNO A;  4GMJ B;  4AHC A;  3IAY A;  3SV3 A;  1IH7 A;  1NJY A;  3L2Q A;  3PX4 A;  2XRI A;  1JLE A;  1RT5 A;  3MXM A;  4PWD A;  3KLI A;  3QNN A;  4BE0 A;  3AO1 A;  3ZT1 A;  5KRT A;  4FJH A;  1CZB A;  3AO2 A;  4AHR A;  4KHS A;  4RW6 A;  1JLC A;  4DFP A;  3I0R A;  4CEQ A;  2XY6 A;  4O0J A;  2Z1I A;  4DU4 A;  4K8Z A;  3WNF A;  4CJV A;  1TKX A;  4Z4I A;  5CZ2 A;  2OA8 A;  4DTM A;  1J54 A;  4EP4 A;  2OZS A;  4DTU A;  3SUN A;  3M8P A;  5FRO A;  3G0Z A;  4KAZ A;  3CG7 A;  3MED A;  4DG1 A;  3OYC A;  3HXM A;  4DTJ A;  4ELV A;  2KFN A;  3SPY A;  1TAQ A;  5HRR A;  4AIL C;  4CGD A;  4Y1D A;  3RMA A;  3SQ0 A;  1RT1 A;  2OPS A;  4MFB A;  3CFP A;  3MXI A;  4Q5V A;  3LP1 A;  1B92 A;  1C0M A;  1GOA A;  1CLQ A;  1ZBH A;  3SCX A;  3RR8 A;  1A5V A;  4CIG A;  5KRS A;  2E4L A;  4DU3 A;  1UAX A;  1WAF A;  2XY8 A;  1QSY A;  1HQU A;  2RKI A;  4CEC A;  4O0I A;  3CQ8 A;  4CHP A;  1TK5 A;  3K57 A;  3MEG A;  1VSH A;  2DY4 A;  1S6Q A;  4RG8 A;  3TR8 A;  3U6F A;  3MAQ A;  1GOB A;  1T7P A;  4DMN A;  1B9D A;  3OYH A;  1LAW A;  1RBS A;  1Z25 A;  4CFB A;  3OS1 A;  4E0D A;  4J2E A;  4CJE A;  2IDO A;  4QAG A;  3AA4 A;  1TAU A;  4FJK A;  3KTQ A;  4KTW A;  1W0H A;  1KLM A;  3NH0 A;  2ATQ A;  2KTQ A;  4I2P A;  3NH1 A;  1SKS A;  1ZBL A;  3KIO A;  3NAE A;  1X1P A;  1K6Y A;  2KZM A;  1HRH A;  3PUF A;  1X9M A;  4LSN A;  4OKE A;  3SUQ A;  4K8X A;  2KQ2 A;  4OLB A;  1LW0 A;  3A2F A;  3O3G A;  3RR7 A;  4FYD A;  2YKN A;  2X6N A;  4N47 A;  3VQ5 A;  3I0S A;  3S9H A;  4FLT A;  4M3Y A;  3LZJ A;  2Q3S A;  4Y1C A;  1RBT A;  4KB1 A;  2HHW A;  3VQ6 A;  1BHL A;  1Z26 A;  3VA3 A;  4DSJ A;  1JLB A;  3ZSX A;  3T1A A;  4CIF A;  3EYZ A;  4JRP A;  4E7L A;  3S3M A;  1Q9X A;  4B9T A;  1C6V A;  1DLO A;  4JLH A;  5K14 A;  4BWJ A;  5SWM A;  1RIL A;  1TKT A;  4B9L A;  4FJL A;  4KHY A;  4NCA A;  1EKE A;  3LAK A;  3ZSQ A;  4KRF A;  1EET A;  3WNH A;  3E01 A;  4F2S A;  3LWM A;  3K5N A;  1BIU A;  2Z1H A;  3V4I A;  4CF0 A;  3OY9 A;  4YFU A;  3SQ1 A;  3DRS A;  1HJR A;  1HYZ A;  4OGC A;  4FLX A;  1CXU A;  3CFO A;  4IG3 A;  2FBY A;  1VSF A;  4N5S A;  3AVJ A;  1VSJ A;  4XIU A;  3TAN A;  1BI4 A;  1WSG A;  2ITG A;  2VWJ A;  1QE1 A;  4KTQ A;  3AVB A;  2RF2 A;  3SPZ A;  4CJS A;  2DFH A;  2VG6 A;  3NF9 A;  3OYG A;  3SJJ A;  1JLQ A;  3QO9 A;  4AHT A;  4OPJ A;  4F3O A;  1DTT A;  1EX4 A;  3LPU A;  4CEE A;  1BCM A;  5CZ1 A;  4CE9 A;  4UQG A;  3VQP A;  3CFR A;  4DS5 A;  1QS4 A;  1VSM A;  3KKS A;  2XY5 A;  3AVN A;  3SI6 A;  3V9S A;  2AJQ A;  1I3A A;  3VQE A;  4CHQ A;  1VSK A;  4IKF A;  4QCL A;  2HNY A;  3S3O A;  3BDP A;  1IO2 A;  4FJN A;  4DWI A;  3VQQ A;  2YNI A;  4CGJ A;  3MXJ A;  4CJQ A;  4WE1 A;  3OYE A;  1VRT A;  1W9H A;  1RBV A;  1F21 A;  1WLJ A;  4FLV A;  3K59 A;  3L3U A;  1EP4 A;  4BAC A;  1HMV A;  1N5Y A;  4NYN A;  2Y1J A;  5D3G A;  4OPK A;  3TAE A;  3RMD A;  4QOZ B;  3DM2 A;  2IAJ A;  3AVM A;  4M41 A;  4B08 A;  4IFY A;  4OKJ A;  4KHN A;  2GV9 A;  4O55 A;  1KSP A;  4N56 A;  1LWC A;  1WSI A;  2IS3 A;  2KZZ A;  3QEP A;  4E19 A;  3T3F A;  4CEB A;  4DQQ A;  4FJ9 A;  2HVI A;  4DFJ A;  5J1E A;  1J5O A;  3QEV A;  4M42 A;  2HHX A;  3RMB A;  1ASV A;  1HYV A;  3LAM A;  1JL2 A;  1WSH A;  2OYQ A;  2YHA A;  1RDA A;  5CY4 A;  1FK9 A;  3KKR A;  4B8A B;  3V1R A;  3QIO A;  4CHZ A;  1WN7 A;  2DFF A;  3JSM A;  3ALY A;  3NCI A;  1SL1 A;  2HHU A;  1NOZ A;  4I9Q A;  4FLU A;  4CCH A;  1RT7 A;  3H08 A;  3B6P A;  3OVN A;  3OJU A;  4CFA A;  1JLG A;  4E1N A;  4W5R A;  4B8C A;  4CGF A;  3NGY A;  5HRS A;  4BE1 A;  3V9W A;  2A1R A;  1HNI A;  1L3S A;  3VN5 A;  2X6S A;  3ZSW A;  5CYM A;  4FZY A;  4HVJ A;  2YNF A;  4FK4 A;  3QEX A;  3HPH A;  2EHG A;  3AO4 A;  4HUE A;  1NKB A;  2XY7 A;  3K2P A;  3HVR A;  1L3V A;  3PV8 A;  3AVC A;  1I39 A;  4J2A A;  4CEO A;  1KLN A;  3DLK A;  3NGZ A;  2I5J A;  4DTS A;  3HPO A;  1TKD A;  4ELT A;  1WAJ A;  3SUP A;  2FBT A;  3AA3 A;  4CJP A;  3V9U A;  4KRE A;  1TK8 A;  3S3N A;  4CJT A;  2F96 A;  1WSF A;  4E89 A;  2HB5 A;  3NDK A;  2G8F A;  3L2R A;  1HNV A;  4BDZ A;  4BDP A;  4DTR A;  3DOL A;  2LSN A;  3LP2 A;  1HYS A;  4B9S A;  4LH4 A;  3OS2 A;  4IDK A;  1L5U A;  4O5B A;  2XO7 A;  2ZQB A;  2O4G A;  4CES A;  3QEW A;  4DQR A;  4CEF A;  1G15 A;  4H8K A;  3QEI A;  2F8T A;  4TSX A;  4M3U A;  3LP0 A;  1L3T A;  4CJU A;  4E7I A;  4F8R A;  2HHS A;  1D9F A;  2WON A;  4PA1 A;  3PY8 A;  3AVA A;  3VQC A;  4R5P A;  1KCF A;  3OYL A;  4FLW A;  3PO5 A;  1TV6 A;  2PYJ A;  4EZ6 A;  3K5L A;  3RMC A;  4CEZ A;  3AVI A;  3ISN C;  1LWF A;  3B6O A;  4FJ8 A;  3AO3 A;  1SKW A;  5I42 A;  1RTH A;  5J2Q A;  3TAR A;  1U49 A;  2VWK A;  4KPY A;  2B4J A;  3WNE A;  3SZ2 A;  4OGE A;  2IC3 A;  3AVL A;  3VA0 A;  1A5W A;  3SQ2 A;  3TAB A;  1WSE A;  4OJR A;  3OYI A;  3KD1 E;  4BDY A;  1KFD A;  3M8Q A;  3V1O A;  4DSK A;  1ZBF A;  1GOC A;  2ZE2 A;  2P1J A;  5J2P A;  1DTQ A;  1LW2 A;  3AA5 X;  1B9F A;  4I7F A;  3V9Z A;  4DSL A;  5SZT A;  3V9X A;  1XHZ A;  3ZSV A;  4LY7 A;  4L8R B;  2YV0 X;  3OYD A;  3VQB A;  2QXF A;  4DTP A;  1S9E A;  3VQ8 A;  4DU1 A;  3AV9 A;  3ZSR A;  4OLA A;  4FJJ A;  3K5O A;  1RTD A;  4G1Q A;  3DOK A;  1O1W A;  1TL1 A;  3EY1 A;  3OYB A;  3LZI A;  1U4B A;  1ASW A;  1X9S A;  3RRH A;  2HMI A;  4FZZ A;  3MEE A;  1BQM A;  1IKV A;  3KK1 A;  2D5R A;  4DLE A;  3OYF A;  1NJX A;  3PO4 A;  2RPI A;  4CF8 A;  4CHY A;  4AHV A;  4CF2 A;  4PY5 A;  4I9L A;  5I3U A;  4DFM A;  2HHQ A;  3LP3 A;  3F73 A;  3QIN A;  1BIS A;  1RDC A;  1YTA A;  4FVM A;  1RDD A;  3VQA A;  1YVU A;  4FW2 A;  4KV8 A;  4C8M A;  3D45 A;  4KTZ A;  5HRN A;  1J9A A;  2GBZ A;  3OYJ A;  1QHT A;  2YNG A;  3CM5 A;  2Y1I A;  1S9G A;  4KFB A;  5E41 A;  4N41 A;  3D0P A;  1C1A A;  2IGI A;  4PQU A;  2DFE A;  4E1M A;  4ZTF A;  3O4N A;  1SL2 A;  3ASM A;  3SNN A;  5T7B A;  4DTO A;  3CM6 A;  1VSL A;  5C42 A;  1S1V A;  4HHT A;  5JS2 A;  4M3T A;  1VSI A;  3HST B;  4CJW A;  1S1U A;  4M3Z A;  1T05 A;  2PYL A;  4B9M A;  2O4I A;  4NCB A;  1LV5 A;  3UIQ A;  1NK8 A;  4KB0 A;  4W5N A;  4F4K A;  3QET A;  3HVT A;  4IBN A;  3AVK A;  5KGX A;  4KI4 A;  1RBU A;  3U3G A;  4FXD A;  1U47 A;  2R7Y A;  4ID5 A;  5KGW A;  3L8B A;  1BI4 B;  1RTI A;  3HPG A;  3LAL A;  4I2Q A;  3VQ7 A;  4CFD A;  3V6D A;  1T03 A;  1U04 A;  4NYF A;  4CED A;  1IKY A;  3OYN A;  1RNH A;  1U48 A;  2KFZ A;  4ZHR A;  3PX6 A;  1NK9 A;  4KKO A;  2Z1J A;  2PZS A;  3HL8 A; 
#chains in the Genus database with same CATH topology
 2VGN A;  4AH9 A;  4GVM A;  3DXK A;  1OH6 A;  2O8C B;  4FCY A;  3VEX A;  2BH1 A;  3IUC A;  3M3Z A;  2VG5 A;  1MU2 A;  5JLF A;  1KVB A;  4DSE A;  2ETJ A;  3CPE A;  3NE6 A;  3CXC M;  3MK6 A;  4BRG A;  5E26 A;  4B3M K;  2OPR A;  4KHQ A;  2V7Y A;  4M45 A;  3EEQ A;  3MMV A;  4CER A;  1JL1 A;  2P9U A;  4RW9 A;  4M7Y A;  3TAF A;  4B1Z A;  3AVF A;  4CK3 A;  1NKE A;  4AHS A;  1IBL K;  4JK7 A;  3OYA A;  3D2E B;  1NOY A;  1YJN N;  4W5O A;  3IG1 A;  3ZCM A;  2V7Z A;  4CZH A;  3M8R A;  3M5R A;  3K5M A;  3VF6 A;  3UKU B;  2B6A A;  2E6M A;  1WSJ A;  3G10 A;  4IOC L;  2RE2 A;  4RW8 A;  1FW6 A;  2HHT A;  5AQZ A;  3C94 A;  3D6R A;  5KTQ A;  3ZT2 A;  2O8F A;  1ASU A;  2F9T A;  1C0T A;  1WNS A;  3BY5 A;  3DLR A;  1BOT O;  1DEJ A;  3HRG A;  4BE2 A;  3ZSY A;  4DV0 K;  4JAX A;  2E6L A;  4H0O A;  5BR8 K;  4GKK K;  4KH4 A;  1R0A A;  4CK2 A;  4CJ4 A;  3ZSZ A;  1X3M A;  3IDH A;  1N36 K;  4BR0 A;  2D0A A;  1NGE A;  3ZEU A;  3NH2 A;  3O9U A;  1VK0 A;  5M1P A;  3OYK A;  4E7H A;  3CI5 A;  4FJ7 A;  1SV5 A;  3TI0 A;  1BGX T;  3C0B A;  5CR4 A;  1Q9Y A;  2G8V A;  1ZYQ A;  3RWU A;  3TAQ A;  1MDU B;  5AR0 A;  2G8I A;  4JI0 K;  1VAZ A;  1D9D A;  3VQD A;  3KWI A;  3WXJ A;  1QTM A;  2E88 A;  5BPN A;  3LDS A;  4O44 A;  3THY B;  5KPR A;  3CME N;  3IS9 A;  2Q97 A;  2AP1 A;  3L2U A;  3U3Y A;  3DRP A;  3HM9 A;  2F4V K;  2FXU A;  1TK0 A;  3SAG A;  1KVC A;  4DV7 K;  4YOW A;  1NK5 A;  4NO7 A;  1KQS M;  1HX1 A;  1XMQ K;  1VSE A;  3P5J A;  4DS4 A;  3F9M A;  3KLH A;  3EZ5 A;  5TKW A;  3RSE A;  1WBD A;  4E7K A;  1Y97 A;  3SUO A;  1YT3 A;  3OYM A;  4DQI A;  1YJW N;  5JS1 A;  3CER A;  3C6T A;  3HT3 A;  1K8A O;  2P51 A;  3FZL A;  3RTV A;  4IJN A;  3VTI A;  1M90 O;  1KTQ A;  1TGO A;  4HTU A;  2GWK A;  4CFC A;  3LDQ A;  2QA4 N;  3QES A;  1T8E A;  4GKJ K;  5ADX A;  2HBM A;  1D8Y A;  3K0S A;  5JMV A;  2KHO A;  3NFA A;  1NGI A;  1QQC A;  3D2F B;  5MLC Q;  2VG7 A;  1VSD A;  3LM9 A;  2OTL N;  3EZW A;  4JI8 K;  3IAY A;  3SV3 A;  3PX4 A;  4IEE A;  1NGF A;  3WT0 A;  2NZT A;  4CZG A;  5KRT A;  4FJH A;  4AHR A;  4LF4 K;  4KHS A;  4LFA K;  3IFR A;  5DM7 L;  3R8E A;  1NGH A;  1S22 A;  2YJF A;  1EWR A;  1K8K B;  4DTM A;  2OZS A;  4DTU A;  4IOA L;  3M8P A;  5FRO A;  3HOT A;  1N32 K;  5LY3 A;  4ELV A;  3SPY A;  1TAQ A;  3VOV A;  4C1N I;  3TTF A;  4AIL C;  4CGD A;  5GAH P;  3R3L A;  4RTF D;  5ADX H;  2OPS A;  3MXI A;  4Q5V A;  3AAP A;  3O08 A;  1SZ2 A;  4NB4 A;  3OW2 M;  4OX9 K;  4DU3 A;  2YHX A;  4O0I A;  4CHP A;  3K57 A;  3G4S N;  1VQ5 N;  4DMN A;  1B9D A;  3OYH A;  1RBS A;  4CFB A;  1KC8 O;  3F5T A;  4J2E A;  4CZK A;  4JI3 K;  1GLC G;  4BRD A;  3VF4 A;  2J4R A;  4JKC A;  1QZ5 A;  1SKS A;  5BR9 A;  1X1P A;  1HRH A;  4H5W A;  4V19 S;  1TYQ A;  4OKE A;  4K8X A;  3O3G A;  2YKN A;  5BRE A;  4YOV A;  4JKA A;  4FLT A;  4BVO A;  4Y1C A;  1RBT A;  4KB1 A;  5GAD P;  3ZSX A;  1K73 O;  3E9P A;  4B9L A;  1DLO A;  4FJL A;  1VQP N;  3LAK A;  3CMA N;  4F2S A;  3WNH A;  3K5N A;  3ENH A;  4CF0 A;  3SQ1 A;  3DRS A;  4MO5 A;  3ULE B;  4O8U A;  3OYG A;  3SJJ A;  1JLQ A;  1XNR K;  1XC3 A;  4DS5 A;  4CE9 A;  4CW7 B;  4UQG A;  3CFR A;  3V9S A;  2AJQ A;  1I3A A;  4GVE A;  4QCL A;  1TUU A;  2HNY A;  3U9Z A;  4CBU A;  1KAZ A;  4FJN A;  4DWI A;  4WQ5 C;  4EFH A;  2YNI A;  5EX5 A;  3O5B A;  3OYE A;  4YDU C;  3CD6 N;  1F21 A;  4PHT X;  3EO3 A;  3L3U A;  4BAC A;  4IFY A;  4N56 A;  3T69 A;  4CEB A;  4DQQ A;  3CQY A;  3H1Q A;  5J1E A;  1J5O A;  1NLV A;  1JL2 A;  3G71 N;  1VQL N;  4M7X A;  4JKD A;  4BRF A;  3KKR A;  4B8A B;  3QIO A;  1QQM A;  3ALY A;  4CCH A;  4J8F A;  3J8A A;  3OVN A;  5KQD A;  2HF3 A;  4PWD A;  5HRS A;  3RVC A;  3L4Q A;  2CH6 A;  1JCF A;  2X6S A;  4PKH A;  4AM7 A;  4HVJ A;  1K9M O;  4C23 A;  3QEX A;  1VHX A;  3AO4 A;  4HUE A;  1L3V A;  3AVC A;  2IVO A;  2GUP A;  3DLK A;  4PKI A;  4CJP A;  3AA3 A;  3W3D A;  4DR6 K;  4BDZ A;  2FSJ A;  4LH4 A;  3T1H K;  4O5B A;  2ZQB A;  5KPT A;  4DQR A;  3MN5 A;  1YXQ A;  3LP0 A;  4E7I A;  4JI4 K;  5GIO A;  3CJA A;  1Q18 A;  3AVA A;  3S41 A;  4R5P A;  1KCF A;  3E66 A;  2QM1 A;  3LDP A;  4YOX A;  4FLW A;  3PO5 A;  3TU5 A;  3O9T A;  3L4I A;  4EZ6 A;  4BRL A;  3RMC A;  4CEZ A;  3AO3 A;  1SKW A;  5I42 A;  1RTH A;  3VPZ A;  5J2Q A;  3TAR A;  4XH4 A;  1U49 A;  2WBN A;  4KPY A;  4CD3 A;  4BR7 A;  1IBM K;  1KFD A;  2CGL A;  5I9E B;  5AQL A;  4DSL A;  1BUP A;  1JJ2 M;  4DTP A;  1S9E A;  2O8B A;  4DU1 A;  3AV9 A;  3K5O A;  1RTD A;  3DOK A;  2ZGZ A;  3FLC O;  1TL1 A;  4OPA A;  3EY1 A;  3LDN A;  3LZI A;  4FZZ A;  1IKV A;  3KK1 A;  4DV6 K;  4CF8 A;  3H3N O;  4BRN A;  5I3U A;  3E9L A;  2ZM6 K;  3LP3 A;  1YTA A;  1RDD A;  2P9S B;  4KV8 A;  2W42 A;  1D9F A;  3T7Z A;  2GBZ A;  4KFB A;  5JLH A;  4N41 A;  4PQU A;  4GNI A;  3VEY A;  4BC2 A;  3GE1 A;  3R1X A;  4CJW A;  3HST B;  4CZI A;  1S1U A;  4M3T A;  1T05 A;  2PYL A;  4B9M A;  4B1W B;  4W5N A;  5BN8 A;  1Q7Y O;  2GEM A;  1U47 A;  4HWI A;  1IV0 A;  3HPG A;  4H0T B;  1NGD A;  3KVG A;  1J5E K;  2KFZ A;  5IT9 O;  4IXC A;  1NK9 A;  2WUS A;  5C12 A;  3V9U A;  2PZS A;  3DXK B;  2DTU A;  5HBM A;  3O1W A;  4EIA A;  1VQ4 N;  1S1W A;  4CK1 A;  1BIZ A;  3VER A;  4JKB A;  3ATV A;  1BL3 A;  3L2W A;  1J53 A;  4HCB A;  1YTU A;  4ISG A;  1H1V A;  1LOT B;  5AQU A;  3NF7 A;  1VRU A;  3AVH A;  1ESV A;  4B1U B;  1HPZ A;  3THV A;  4R79 A;  3LWL A;  2GWJ A;  4FK0 A;  1EXQ A;  5HLF A;  2G8W A;  1NK6 A;  4LD0 A;  3L2V A;  1N33 K;  4C8O A;  1Q82 O;  2NRT A;  3L3V A;  3ZT4 A;  4H4M A;  3DYA A;  5CYQ A;  1ZBU A;  1UA1 A;  4WFN L;  2XHB A;  5M1F A;  4NLB A;  3JS6 A;  3THW A;  4Z0U A;  4FK2 A;  3KJV A;  4XH1 A;  2V51 B;  4PKG A;  3KLE A;  3TAM A;  1N6Q A;  1XHX A;  5AZI A;  4Z4C A;  2OPQ A;  1X9W A;  3SJH A;  3WXK A;  3ITH A;  1NK4 A;  1GLB G;  3I33 A;  3C6U A;  1A5X A;  3LM2 A;  4CGH A;  1VQO N;  3CCM N;  2QWN A;  2Z1G A;  1REV A;  4IFE A;  4GV6 A;  1RCH A;  2ASP A;  1XI1 A;  4JS4 A;  4HUG A;  4RW4 A;  3THX A;  1LWE A;  4HCC A;  3N4Q A;  3CCQ N;  3TAP A;  2KW4 A;  5JVH L;  5J2M A;  5AQY A;  2Q2R A;  3E9O A;  4CJK A;  2P9U B;  2YHW A;  1JXE A;  4DQS A;  3GG4 A;  3JXU A;  3D2E A;  2QXL A;  1HKG A;  3M8S A;  5AQH A;  3WNG A;  3DLE A;  5A2Q O;  1UOC A;  4J2B A;  3C6H A;  3EKU A;  4CI6 A;  1Q8I A;  1BCO A;  3AGK A;  3NBP A;  1SUQ A;  3OJS A;  2ZD1 A;  4BR2 A;  3DRR A;  4A2A A;  4IFV A;  3UKR B;  3HJF A;  3TTC A;  5KQ8 A;  1D5A A;  4FWN A;  2HF4 A;  1FKP A;  3CJ1 A;  4DF4 A;  3FZH A;  3ZET B;  2IVP A;  2NRW A;  4C8K A;  4Z4F A;  1NK7 A;  3DLB A;  2NUB A;  5HP1 A;  4MQ3 A;  2D0O A;  1E3M A;  3O3H A;  1NMN A;  1TVR A;  1S6P A;  4H5V A;  4PUO A;  4BG9 A;  4B9V A;  3FR0 A;  2ZJR L;  1WOQ A;  4DQP A;  3CJ9 A;  4CF9 A;  2QKB A;  1K8K A;  2OAN A;  1OH5 A;  4ELU A;  4FJM A;  3SK3 A;  1ZBI A;  2HBK A;  1RTJ A;  1RGI A;  3M6G A;  2B5J A;  1BQN A;  5BRH A;  1TL3 A;  3DI6 A;  1NGC A;  3CYM A;  1VQ9 N;  4WYB A;  3NGI A;  4AHU A;  5DK5 A;  2JGU A;  4F3T A;  4Q0B A;  2VYP A;  3SV4 A;  5M1N A;  2OPP A;  2HNZ A;  2UUA K;  2PAV A;  1QSL A;  1LAV A;  3PX0 A;  4FL9 A;  5AQI A;  3VES A;  4DSF A;  1IG9 A;  1RDB A;  2FC0 A;  2BGG A;  1UA0 A;  3CCU N;  1BWF O;  1KVA A;  4BRK A;  4FVU A;  3MN7 A;  4H0Y B;  2E2N A;  3QNO A;  4AHC A;  3QML A;  2W40 A;  1JLE A;  5AQT A;  4G9Z A;  3AO1 A;  3ENO A;  3MN9 A;  4DV1 K;  3U8X A;  4O0J A;  3WNF A;  4CJV A;  4Z4I A;  4CZL A;  4EP4 A;  4KAZ A;  4DR3 K;  2KFN A;  4DTJ A;  2HHH K;  5AQJ A;  4Y1D A;  3RMA A;  1B92 A;  1C0M A;  1ZBH A;  3SCX A;  1A5V A;  3CCE N;  2E4L A;  3I55 N;  4CVN E;  1BA1 A;  1HQU A;  4ISF A;  4CEC A;  2F9W A;  1SAZ A;  1T7P A;  1Z25 A;  2QW9 A;  5FPN A;  3TTD A;  2IDO A;  4IDH A;  4FJK A;  3O8M A;  2HBJ A;  4KTW A;  5AQQ A;  1KLM A;  3CC4 N;  4DR7 K;  3KIO A;  1N34 K;  3PUF A;  1JCE A;  4LSN A;  1ZC6 A;  2NRR A;  1LW0 A;  3A2F A;  3H3O B;  2FSN A;  4FPB A;  4N47 A;  3I0S A;  4DSJ A;  4BRH A;  2W6L A;  3T1A A;  3P39 A;  3U4L A;  1C6V A;  4BWJ A;  4MDB A;  4DR5 K;  4KHY A;  1EET A;  3V4I A;  2UYT A;  3OY9 A;  1W97 L;  1HJR A;  3DWL A;  3ZX2 A;  3CCL N;  1VSF A;  4N5S A;  3AVJ A;  3I8B A;  3TAN A;  1WSG A;  2VWJ A;  1QE1 A;  4KTQ A;  3AVB A;  4CJS A;  1D4X A;  3WEE A;  1X9J A;  2Q1N A;  1WB9 A;  1EX4 A;  4U67 L;  3S9H A;  1VSM A;  3SI6 A;  4KBO A;  1YJ9 N;  1VSK A;  3LDL A;  1IO2 A;  2UXB K;  4CJQ A;  3MXJ A;  4WE1 A;  4H0P A;  1DKG D;  3ZX3 A;  4Y0W A;  2Q31 A;  4WQ4 C;  2QWQ A;  3K59 A;  5D3G A;  2Q36 A;  4NYN A;  2Y1J A;  3ZET A;  4JD2 B;  3TAE A;  4QOZ B;  3DM2 A;  2IAJ A;  3HOS A;  2E2P A;  4C1N K;  1HLU A;  4OKJ A;  4KHN A;  2IS3 A;  1WUA A;  2CH5 A;  3MN6 A;  3QEV A;  2HHX A;  3RMB A;  1ASV A;  2YHA A;  5CY4 A;  1FK9 A;  4A59 A;  4JI5 K;  3V1R A;  3JSM A;  4BVP A;  1QVF M;  3TSU A;  4I9Q A;  5C0Y A;  1HJO A;  3B6P A;  4BC3 A;  4AF1 A;  1NGB A;  4WQ5 A;  1JLG A;  4E1N A;  4B8C A;  3NGY A;  4DUY K;  1HNI A;  4FWK A;  3ZSW A;  5CYM A;  1IG8 A;  1Z6R A;  1QQO A;  2QWP A;  4FZY A;  2YNF A;  5KPZ A;  4FK4 A;  1NKB A;  2XY7 A;  3K2P A;  5ELZ A;  3PV8 A;  1GLL O;  4J2A A;  4K0K K;  4CEO A;  4H5R A;  3GDQ A;  1TKD A;  3HPO A;  4K41 A;  4LF8 K;  2OTJ N;  3P4I A;  3WUH A;  4GV3 A;  1NMD A;  3NDK A;  5C15 A;  3DOL A;  5F2R A;  3OS2 A;  4EHT A;  4BGA A;  5HOO A;  4H8K A;  2F8T A;  4M3U A;  1L3T A;  4CJU A;  1YF5 L;  5GAE P;  2E8A A;  5F1X A;  1MWK A;  1TV6 A;  4FWP A;  1VQK N;  3K5L A;  1QZ6 A;  3U9D A;  1LWF A;  3B6O A;  2QEX N;  3SZ2 A;  2IC3 A;  3AVL A;  2E2O A;  5EOY A;  3VA0 A;  3FZM A;  1WSE A;  2JWL A;  3OYI A;  4DR2 K;  2A42 A;  4BDY A;  1ZBF A;  1GOC A;  4BQZ A;  2ZE2 A;  4JHD A;  4EHU A;  2P1J A;  1KD1 O;  4BRO A;  3OHR A;  3VEN A;  4L8R B;  2EWS A;  2YV0 X;  4O5F A;  4B9Q A;  3A0I X;  4LFC K;  4BGB A;  3ZSR A;  3ZX0 A;  4X66 K;  4FJJ A;  3UE5 A;  2IIR A;  4G1Q A;  4IZ9 A;  3OYB A;  2GEL A;  3CIP A;  3WXI A;  2D5R A;  3OYF A;  3VEW A;  1NJX A;  2RPI A;  3AGR A;  4AHV A;  4PY5 A;  3VEZ A;  4I9L A;  2HHQ A;  3PSF A;  3QIN A;  1BIS A;  4JKE A;  2WC9 A;  3VQA A;  4FW2 A;  3NVK A;  3D45 A;  4JKH A;  5H1S Q;  2P9N B;  1NM1 A;  1S9G A;  4BQL A;  3D0P A;  1C1A A;  1SL2 A;  5T7B A;  1VSL A;  5C42 A;  1S1V A;  1VSI A;  2O4I A;  4F4K A;  3FZK A;  4FXD A;  4BC5 A;  2R7Y A;  3FZF A;  4BRP A;  3L8B A;  3LAL A;  4I2Q A;  3VQ7 A;  1LCU A;  4CED A;  1IKY A;  3MCP A;  1RNH A;  3OYN A;  4ZHR A;  4C8M A;  2FF6 A;  3VEV A;  1BO5 O;  2P9L B;  4QS9 A;  3SQ4 A;  3MX5 A;  3R9P A;  3F9K A;  5AQR A;  4JRQ A;  1JXB A;  3LPT A;  4FSV A;  2WOM A;  1JKH A;  1KRP A;  2G8H A;  4BRA A;  1HR0 K;  3HYF A;  3CJ7 A;  1U45 A;  2QK9 A;  4H5N A;  3AY9 A;  2AA4 A;  4CIE A;  4FJG A;  3OTO K;  1JLA A;  4K43 A;  1XNQ K;  3CC2 N;  1S1X A;  4B1Y B;  3MEC A;  4B9U A;  3QBX A;  4FOE A;  3ULE A;  4L3Q A;  1WBB A;  4YY3 K;  1CXQ A;  3AVG A;  3T19 A;  4DF8 A;  4OVL A;  4H0V B;  4GV9 A;  4MDA A;  1C0U A;  1RT3 A;  1QSS A;  3CHW A;  3D7E O;  2YJE A;  2GUI A;  4H4O A;  4KO0 A;  3VQ4 A;  1ITG A;  4X64 K;  2HND A;  3HSC A;  4AM6 A;  2HVH A;  3HP6 A;  1N8R O;  4CGG A;  4B1V A;  1HQE A;  3O9R A;  2ZWH A;  2O8B B;  1BA0 A;  5EVZ A;  1SS6 A;  2RN2 A;  2YKM A;  3NF6 A;  3BGR A;  4NCG A;  3V81 A;  4XH5 A;  1BG3 A;  4X62 K;  3BZC A;  1L3U A;  3SAH A;  4JI2 K;  1HNX K;  1ATN A;  3KK2 A;  4CF1 A;  4N76 A;  3DMJ A;  4CJL A;  1NJW A;  2P5G A;  1J6Z A;  1S1T A;  3Q7B A;  4JI1 K;  4DKW A;  4DFK A;  1FKO A;  3WQT A;  2KLA A;  4ISE A;  2UUB K;  3CCS N;  2H3G X;  3AO5 A;  3ZSO A;  4CHN A;  3LAN A;  4I6M B;  1XC9 A;  1NK0 A;  1RDW X;  1JLF A;  3UB5 A;  4ILJ A;  4BRM A;  2GX9 A;  5J2N A;  3TAG A;  4JKG A;  2EX3 A;  3J81 O;  2KKZ A;  1XWL A;  3I8D A;  5BPM A;  1E4F T;  2DPN A;  3JYT A;  2UXD K;  1DT9 A;  3KLG A;  3DLH A;  3THX B;  5C24 A;  5AQK A;  4BG8 A;  1VQ7 N;  3VGK A;  1P90 A;  3CCV N;  3P1G A;  2YHB A;  2ZF5 O;  3DXM B;  4JS5 A;  4DUZ K;  4IO8 A;  2P9K A;  3EE9 A;  1KAX A;  3CQX A;  4KH5 A;  5CHI A;  3BUZ B;  1ATS A;  1ZXO A;  4NXN K;  2QWO A;  4NLC A;  4BWM A;  4W5Q A;  4DV4 K;  2ITM A;  4B3O A;  4IEI A;  2HOE A;  3O80 A;  4KHU A;  4CJ5 A;  3TWH A;  2QKK A;  3NHG A;  2RHK A;  1NJI O;  3A5N C;  4DV2 K;  4DLG A;  2P5O A;  3NF8 A;  3CET A;  1SKR A;  2O8D B;  1KFS A;  4RW7 A;  4EP5 A;  5C2D A;  1U2V B;  1NGJ A;  4CZF A;  3ULD A;  1EWQ A;  3P83 D;  5HRP A;  1YIJ N;  4K42 A;  3V1Q A;  4DTN A;  1BDG A;  2I7N A;  2P9K B;  2XRI A;  2QTD A;  3C7N A;  2A5X A;  4BE0 A;  1YIT N;  1OH8 A;  3AO2 A;  1JLC A;  3I0R A;  3RSE B;  1RFQ A;  3GL1 A;  4K8Z A;  1TKX A;  2OA8 A;  1J54 A;  1W7A A;  3SUN A;  3CC7 N;  1E4G T;  1NWK A;  3G0Z A;  4PL7 A;  3NVM A;  3R6M A;  4DG1 A;  1YUW A;  1T6C A;  3SQ0 A;  1RT1 A;  5LJW A;  3CFP A;  1Q86 O;  4JKG B;  1CLQ A;  2ZGY A;  4DR1 K;  3DLL L;  1UAX A;  1WAF A;  2XY8 A;  2RKI A;  3SBG A;  3MEG A;  1VSH A;  4JKF A;  4RG8 A;  4H5T A;  3U6F A;  1GOB A;  1LAW A;  3OS1 A;  3K9K A;  4QAG A;  3QBW A;  3KTQ A;  2BTF A;  2QWL A;  1QHA A;  4RCH A;  4JV5 K;  2O8F B;  2ATQ A;  2KTQ A;  4I2P A;  3J7Z O;  1ZBL A;  4BY9 C;  4BRE A;  1K6Y A;  2KZM A;  3SUQ A;  2KQ2 A;  4OLB A;  3RR7 A;  3VQ5 A;  2E20 A;  2X6N A;  4M3Y A;  1MA9 B;  5AQW A;  3LZJ A;  2Q3S A;  3FFK B;  2QI2 A;  2HHW A;  3VA3 A;  1Z26 A;  5LMU K;  4E7L A;  3S3M A;  1Q9X A;  4JLH A;  5K14 A;  5SWM A;  1NGA A;  1RIL A;  3ZEU B;  1NBW A;  4IJA A;  2NRV A;  3E01 A;  3LWM A;  1BIU A;  2Z1H A;  4GY2 B;  4YFU A;  1C0G A;  4OGC A;  4FLX A;  4IG3 A;  2FBY A;  3A8Y A;  5AJ3 K;  1BI4 A;  2NRZ A;  2DFH A;  3D2F A;  3QO9 A;  4I6M A;  4AHT A;  4F3O A;  1DTT A;  5HL7 L;  3K9J A;  3LPU A;  4CEE A;  1BCM A;  1XMO K;  2HHU A;  1QS4 A;  4MO4 A;  3AVN A;  1VQ8 N;  4CHQ A;  2P9P B;  1QQN A;  5AQO A;  4CBX A;  4CGJ A;  1R59 O;  1VRT A;  1W9H A;  2D1K A;  3THY A;  4FLV A;  1EP4 A;  1HMV A;  4OPK A;  3BF3 A;  4B08 A;  3DXM A;  2GV9 A;  1LWC A;  3QEP A;  4E19 A;  2P9I A;  3THW B;  1ILY A;  3H46 O;  1HYV A;  3LAM A;  2OYQ A;  1RDA A;  4LF6 K;  2UU9 K;  4CHZ A;  2WTU A;  1WN7 A;  1SL1 A;  4OPH A;  3SMP A;  1NOZ A;  2P9L A;  3H08 A;  3OJU A;  4CFA A;  1T3V A;  2A1R A;  3RR8 A;  4BE1 A;  2Q0U A;  1VQN N;  3OA9 A;  5F0X A;  1DGK N;  2P9P A;  2EHG A;  1EO1 A;  1I39 A;  1KLN A;  4DTS A;  4WCE L;  2O8D A;  2FBT A;  4KRE A;  2F96 A;  1WSF A;  2YHY A;  3LP2 A;  4CZJ A;  4LF9 K;  1NNE A;  4B9S A;  4IDK A;  3KHY A;  2NNW A;  5GIN A;  2O4G A;  4CES A;  4A61 A;  3QEI A;  3C7N B;  4LC9 B;  4TSX A;  1MWM A;  4F8R A;  2WON A;  4PA1 A;  4YOT A;  3TSP A;  3PY8 A;  4KHP K;  3VQC A;  3OYL A;  1TUY A;  5AZJ B;  2PYJ A;  1OVY A;  1QVG M;  5FPD A;  3AVI A;  3ISN C;  3SLC A;  3MWP A;  4BRQ A;  3Q7C A;  3KK7 A;  3WNE A;  2VGM A;  4OGE A;  3O9Q A;  4BR5 A;  3V1O A;  5LJV A;  4DSK A;  4YHH K;  3DAW A;  1DTQ A;  1LW2 A;  3P38 A;  5J2P A;  5M1Q A;  3VEO A;  2E5L K;  3OYD A;  4CJ7 A;  3VQB A;  5C2F A;  1Q81 O;  4JNE A;  3A5O C;  2BUP A;  4UY8 O;  1O13 A;  4OLA A;  4F9O A;  4M63 C;  1FJG K;  3J80 O;  2NRH A;  1X9S A;  4JK9 A;  3ZLJ A;  4WFA L;  3KWG A;  1BQM A;  4DHY A;  4DLE A;  3PO4 A;  4YOR A;  1TYQ B;  4DV3 K;  4DFM A;  3F73 A;  3TSQ A;  2P9N A;  1RDC A;  5HRN A;  1YVU A;  3B8A X;  2OZM A;  2OCE A;  1J9A A;  4IWV A;  3KZB A;  4CZM A;  3P31 A;  3G25 A;  4ZTF A;  3ASM A;  3SNN A;  1CZA N;  4DTO A;  3CM6 A;  5JS2 A;  1T6D A;  1X3N A;  4M3Z A;  2FF3 B;  4NCB A;  1LV5 A;  1NK8 A;  3QET A;  4IBN A;  5KGX A;  3AVK A;  4MLE A;  3SAF A;  4ID5 A;  4BC4 A;  4MLH A;  1BI4 B;  1RTI A;  4CFD A;  3V6D A;  1T03 A;  3ID6 A;  3PIP L;  1U48 A;  3PX6 A;  2VQE K;  4KKO A;  3HP9 A;  2Z1J A;  5AQN A;  2FBV A;  3ENB A;  3DJC A;  4FM1 A;  5AQF A;  5AQP A;  4FWS A;  4CHO A;  4ICL A;  4PL8 A;  4M3W A;  3GBT A;  4A5A A;  4FLY A;  2Q0R A;  2O8C A;  2FBX A;  4H03 B;  3J7A P;  4FZX C;  4J2D A;  1C1C A;  3O3F A;  4LH5 A;  4FWR A;  3QIP A;  4JYA K;  1IJJ A;  4O4G A;  5FDL A;  4C8L A;  3O6W A;  1NGG A;  3OS0 A;  1RDU A;  1HPM A;  3G6E N;  3HI0 A;  4B3S K;  4E1J A;  5HRO A;  5EU7 A;  2BAN A;  1NJZ A;  1BU6 O;  1GLJ O;  5BPL A;  4B1X B;  4HUF A;  1RT6 A;  4JK8 A;  3KD5 E;  1UWB A;  3GOI A;  2HHV A;  5GIP A;  1U2V A;  3QIC A;  3W0L A;  4OKK A;  2BDP A;  1JCG A;  3AA2 A;  3WEE B;  4CGI A;  1HNW K;  2IOC A;  1RT4 A;  4FWO A;  3HZ6 A;  4JI7 K;  4FJ5 A;  2D0B A;  1IKX A;  4ID1 A;  1GLD G;  2X78 A;  4FO0 A;  2BE2 A;  3KLF A;  1SQK A;  4A57 A;  3N4P A;  1FXX A;  4JD2 A;  4F2R A;  2A40 A;  1OH7 A;  3BP8 A;  2D0C A;  4FJX A;  5EY4 A;  5FRM A;  4FWM A;  4FLZ A;  4RWT A;  3O4Q A;  5KI6 A;  2G8U A;  2A1S A;  5C10 A;  5FPE A;  4EZ9 A;  3ZT3 A;  4FM0 A;  3KK3 A;  4Z4E A;  2JLE A;  2VQF K;  4E3S A;  1RT2 A;  4YDU A;  3HO1 A;  2YNH A;  4A62 A;  4FM2 A;  3BF1 A;  2ZJP L;  3RRG A;  4CJF A;  2A3Z A;  3UKU A;  3AAQ A;  2FSK A;  2F8S A;  2PY5 A;  3ZT0 A;  4ILG B;  4W5T A;  2UUC K;  4DR4 K;  3J7Y P;  4KI6 A;  4ZTJ A;  4EAH D;  3HK2 A;  4HTL A;  1W2B M;  4M3X A;  5FRN A;  4FW1 A;  3IRX A;  3EN9 A;  4DTX A;  3QFP A;  5AFU H;  3CJB A;  4IG0 A;  4AQY K;  3TPQ A;  1S5J A;  3FGU A;  4JN4 A;  1TKZ A;  3LL3 A;  4H0X B;  3CF5 L;  3O4W A;  5AQV A;  4Z4H A;  2A6A A;  4LSL A;  4E7J A;  3QLH A;  3SBT A;  4GW6 A;  1YHQ N;  1RBR A;  4LF5 K;  1NKC A;  2HW3 A;  4BR4 A;  3VQ9 A;  4C8N A;  1SL0 A;  2HBL A;  4JEP A;  3QER A;  4A5B A;  2YCH A;  2VCP A;  1IKW A;  4KHW A;  5M1O A;  1C1B A;  2G8K A;  5AFU A;  4DSI A;  3SYZ A;  2I7P A;  2GTD A;  5C25 A;  4B9N A;  4CJR A;  3VGM A;  2X74 A;  3L6Q A;  4YOY A;  4Z4G A;  2VWB A;  4M3R A;  4FJI A;  4NXM K;  3MCA B;  3K58 A;  4CJ3 A;  5JVG L;  5DMR A;  1VQM N;  1CZ9 A;  3EE8 A;  4CEA A;  3DLG A;  2F7T A;  3FFI A;  1NG9 A;  1OKJ A;  2UXC K;  2ASM A;  3BEX A;  4A2B A;  4WF9 L;  3C95 A;  2QWM A;  4GMJ B;  3CCJ N;  1IH7 A;  1NJY A;  2PBD A;  3L2Q A;  4Z94 A;  3E1Y A;  1RT5 A;  3MXM A;  3KLI A;  3QNN A;  4ILH A;  3ZT1 A;  1CZB A;  4RW6 A;  4WQ4 A;  4DFP A;  4CEQ A;  2XY6 A;  4DU4 A;  2Z1I A;  5CZ2 A;  2O8E B;  3VF2 A;  3CG7 A;  3MED A;  1S72 N;  3HXM A;  2D4W A;  3OYC A;  5HRR A;  2W41 A;  4MFB A;  3QB0 A;  3QFU A;  3LP1 A;  1KAY A;  1GOA A;  3ZYY X;  4CIG A;  5KRS A;  4FWL A;  4FPA A;  1YI2 N;  1QSY A;  3CQ8 A;  3MDQ A;  3VTH A;  1TK5 A;  2DY4 A;  1S6Q A;  3TR8 A;  3H6E A;  3VET A;  3MAQ A;  4U7B A;  5BN9 A;  4E0D A;  4CJE A;  4WFB L;  3AA4 A;  3IMX A;  1TAU A;  5CE3 A;  3C65 A;  5LMN K;  1W0H A;  3NH0 A;  3NH1 A;  3CCR N;  3NAE A;  5GAG P;  1NU0 A;  5AQM A;  1Z05 A;  2W6K A;  3F2K A;  2QWR A;  1X9M A;  2WFB A;  3LDO A;  3PSI A;  1XUP O;  3ATU A;  4BRC A;  4FYD A;  4FWQ A;  2HST A;  5TKY A;  1I94 K;  3O9S A;  1T44 A;  3VQ6 A;  1BHL A;  4K25 A;  1JLB A;  3EYZ A;  4CIF A;  4JRP A;  4B9T A;  3ID8 A;  5FLX O;  2E1Z A;  1TKT A;  1IBK K;  4NCA A;  1EKE A;  5EXW A;  3ZSQ A;  4KRF A;  4YOU A;  1ATR A;  3CPW M;  1G99 A;  1HYZ A;  1CXU A;  3CFO A;  1HUX A;  4XEI A;  1VSJ A;  4XIU A;  1GLE G;  3NMU A;  2ITG A;  3SPZ A;  2RF2 A;  3OBY A;  5DM6 L;  2VG6 A;  3NF9 A;  5AZI B;  4OPJ A;  5CZ1 A;  3VQP A;  4O8K A;  3KKS A;  2XY5 A;  3UKR A;  1ZBS A;  3VQE A;  4JHD B;  4IKF A;  1P8Z A;  2E1Y A;  3S3O A;  2PFU A;  3BDP A;  5BRF A;  3VQQ A;  5AQG A;  2YX6 A;  5E84 A;  1RBV A;  1WLJ A;  1Y64 A;  1N5Y A;  3RMD A;  1KXP A;  4IOX A;  2JWK A;  3H1V X;  5LL6 Z;  4LFB K;  3AVM A;  4M41 A;  3OBW A;  1HNZ K;  4O55 A;  1KSP A;  1WSI A;  2KZZ A;  3T3F A;  3QDK A;  1YAG A;  4QS8 A;  4FJ9 A;  2HVI A;  4DFJ A;  4M42 A;  2P9I B;  5M1K A;  1WSH A;  4DQ8 A;  2DFF A;  3NCI A;  4LF7 K;  1XQS C;  4FLU A;  1RT7 A;  4BRI A;  4DV5 K;  3I56 N;  4W5R A;  4CGF A;  3V9W A;  1L3S A;  3VN5 A;  3JAM O;  1GLF O;  3H45 C;  3HPH A;  2E2Q A;  2A41 A;  3HVR A;  4B3R K;  1HKC A;  3NGZ A;  2I5J A;  4ELT A;  1WAJ A;  3SUP A;  5AQX A;  3HM8 A;  1TK8 A;  3S3N A;  4CJT A;  3FE1 A;  3L0Q A;  2HB5 A;  4E89 A;  1OVQ A;  2G8F A;  3L2R A;  1HNV A;  3HBT A;  3PLA A;  2ASO A;  4DTR A;  4BDP A;  2LSN A;  1HYS A;  3T1Y K;  4OO1 J;  1L5U A;  5JIC A;  2XO7 A;  3IKM A;  1HKB A;  4X65 K;  3QEW A;  2NLX A;  4CEF A;  1G15 A;  3HTV A;  1V4S A;  4DCH A;  2HHS A;  1V4T A;  5AZJ A;  3BZK A;  3C6A A;  3A5L C;  5AQS A;  1YVN A;  3A5M C;  3SMS A;  3EL2 A;  4FJ8 A;  2VWK A;  2B4J A;  4KH6 A;  2HMP A;  5B8H A;  1A5W A;  2V52 B;  3SQ2 A;  3TAB A;  3VGL A;  4OJR A;  3KD1 E;  1EQY A;  3M8Q A;  3M1F A;  1M1K O;  3WQU A;  3AA5 X;  1B9F A;  2FLO A;  4I7F A;  4B3T K;  3V9Z A;  3AAR A;  5SZT A;  3V9X A;  1XHZ A;  3ZSV A;  4LY7 A;  2QXF A;  4FOI A;  4IO9 L;  1VQ6 N;  3VQ8 A;  3WXM B;  2D0P A;  3EKS A;  1C0F A;  1O1W A;  3MWT A;  1U4B A;  1ASW A;  3VMF B;  2NRX A;  3RRH A;  3MEE A;  2HMI A;  4CBW A;  4CHY A;  2ZJQ L;  4CF2 A;  4JI6 K;  4CD1 A;  4FVM A;  4YNQ A;  2Y1I A;  4KTZ A;  3OYJ A;  1QHT A;  2YNG A;  3CM5 A;  2CGK A;  3PIO L;  2P9S A;  5E41 A;  4CZE A;  5IWA K;  5BRD A;  2IGI A;  3MX2 A;  2DFE A;  4E1M A;  3O4N A;  2IVN A;  4BR9 A;  4QS7 A;  2O8E A;  4HHT A;  3CJC A;  1S3X A;  5FPM A;  4DB3 A;  2YI1 A;  3UIQ A;  4KB0 A;  3HVT A;  4KI4 A;  1RBU A;  3U3G A;  1GLA G;  3WXL A;  1U6Z A;  5KGW A;  2CGJ A;  3O1B A;  1U04 A;  4NYF A;  3HL8 A; 
#chains in the Genus database with same CATH homology
 2FBV A;  5HBM A;  4FM1 A;  2DTU A;  3SQ4 A;  4AH9 A;  4GVM A;  1S1W A;  4CK1 A;  3F9K A;  1BIZ A;  4FCY A;  2VG5 A;  4CHO A;  1MU2 A;  4ICL A;  1KVB A;  4DSE A;  1BL3 A;  3L2W A;  2ETJ A;  3NE6 A;  4FLY A;  4M3W A;  1J53 A;  4JRQ A;  2FBX A;  4HCB A;  1YTU A;  1JXB A;  3LPT A;  4FZX C;  2WOM A;  3NF7 A;  4J2D A;  1JKH A;  1C1C A;  1VRU A;  4LH5 A;  3O3F A;  3AVH A;  2OPR A;  2G8H A;  1KRP A;  4KHQ A;  3HYF A;  1U45 A;  3QIP A;  2QK9 A;  4O4G A;  1HPZ A;  5FDL A;  4M45 A;  4CIE A;  3THV A;  4C8L A;  3OS0 A;  4FJG A;  4CER A;  1JLA A;  1JL1 A;  3LWL A;  4RW9 A;  4FK0 A;  1EXQ A;  5HRO A;  5HLF A;  2G8W A;  5EU7 A;  2BAN A;  3TAF A;  4CK3 A;  3AVF A;  4LD0 A;  1NJZ A;  3L2V A;  1NKE A;  4AHS A;  1NK6 A;  4C8O A;  3OYA A;  3L3V A;  1S1X A;  4H4M A;  3ZT4 A;  3DYA A;  5CYQ A;  1RT6 A;  1ZBU A;  4HUF A;  1UA1 A;  1NOY A;  3MEC A;  4W5O A;  3KD5 E;  2XHB A;  1UWB A;  3IG1 A;  4B9U A;  3ZCM A;  2HHV A;  4Z0U A;  4FK2 A;  3M8R A;  3KJV A;  3K5M A;  1CXQ A;  3AVG A;  3T19 A;  4OKK A;  2BDP A;  2B6A A;  4DF8 A;  3AA2 A;  3KLE A;  4OVL A;  2E6M A;  3TAM A;  1XHX A;  1N6Q A;  4CGI A;  4Z4C A;  2OPQ A;  1WSJ A;  3G10 A;  1X9W A;  1C0U A;  4RW8 A;  1RT3 A;  3ITH A;  1NK4 A;  1QSS A;  2HHT A;  2IOC A;  1RT4 A;  4FJ5 A;  2GUI A;  3C94 A;  4H4O A;  4KO0 A;  3VQ4 A;  2D0B A;  5KTQ A;  3ZT2 A;  1IKX A;  4ID1 A;  3C6U A;  1ITG A;  1ASU A;  1A5X A;  1C0T A;  1WNS A;  4CGH A;  2X78 A;  3DLR A;  2HND A;  2Z1G A;  1REV A;  1RCH A;  2BE2 A;  4BE2 A;  3HP6 A;  3ZSY A;  3KLF A;  2HVH A;  4CGG A;  1XI1 A;  4JS4 A;  4HUG A;  4RW4 A;  2E6L A;  1LWE A;  4HCC A;  1FXX A;  4F2R A;  1HQE A;  3TAP A;  2KW4 A;  5J2M A;  1R0A A;  2D0C A;  4FJX A;  5FRM A;  4CK2 A;  4CJ4 A;  3ZSZ A;  2RN2 A;  2YKM A;  4FLZ A;  3O4Q A;  3NF6 A;  3BGR A;  4NCG A;  5KI6 A;  4CJK A;  3V81 A;  2G8U A;  2A1S A;  2D0A A;  4EZ9 A;  3NH2 A;  1JXE A;  3ZT3 A;  4FM0 A;  3KK3 A;  4DQS A;  1VK0 A;  1L3U A;  4Z4E A;  2JLE A;  3OYK A;  4E7H A;  4E3S A;  1RT2 A;  3KK2 A;  4CF1 A;  3M8S A;  3WNG A;  3DLE A;  4FJ7 A;  1UOC A;  1SV5 A;  3DMJ A;  2YNH A;  4N76 A;  4J2B A;  3TI0 A;  1BGX T;  4FM2 A;  3HO1 A;  4CJL A;  1NJW A;  2P5G A;  1S1T A;  3RRG A;  1Q9Y A;  2G8V A;  4CJF A;  4DFK A;  1FKO A;  1BCO A;  1Q8I A;  1ZYQ A;  3NBP A;  1SUQ A;  3OJS A;  3RWU A;  2ZD1 A;  3TAQ A;  2F8S A;  2PY5 A;  3ZT0 A;  4W5T A;  3DRR A;  2G8I A;  4IFV A;  3HJF A;  4KI6 A;  3AO5 A;  4ZTJ A;  3ZSO A;  4CHN A;  3LAN A;  1XC9 A;  1NK0 A;  1D9D A;  3HK2 A;  1D5A A;  3VQD A;  4M3X A;  5FRN A;  4FW1 A;  1JLF A;  3IRX A;  5J2N A;  1QTM A;  4DTX A;  3TAG A;  3LDS A;  2EX3 A;  4O44 A;  1FKP A;  4IG0 A;  4DF4 A;  1XWL A;  4YNQ A;  3I8D A;  1S5J A;  3JYT A;  3IS9 A;  3KLG A;  3DLH A;  3L2U A;  3U3Y A;  1TKZ A;  4C8K A;  3DRP A;  5C24 A;  3HM9 A;  4Z4F A;  1TK0 A;  1NK7 A;  1KVC A;  3P1G A;  4Z4H A;  2NUB A;  3DLB A;  5HP1 A;  4MQ3 A;  2YHB A;  3O3H A;  1TVR A;  4LSL A;  4E7J A;  1NK5 A;  1S6P A;  3QLH A;  4JS5 A;  4GW6 A;  4PUO A;  1RBR A;  2W42 A;  1NKC A;  4B9V A;  4KHU A;  1VSE A;  3P5J A;  2HW3 A;  3VQ9 A;  4DS4 A;  4DQP A;  4C8N A;  4CF9 A;  2QKB A;  1SL0 A;  4ELU A;  3KLH A;  4BWM A;  3EZ5 A;  4FJM A;  3QER A;  4W5Q A;  4E7K A;  1IKW A;  1Y97 A;  4KHW A;  3HP9 A;  4B3O A;  1ZBI A;  3SUO A;  1C1B A;  1RTJ A;  1YT3 A;  3OYM A;  2B5J A;  1BQN A;  4CJ5 A;  1TL3 A;  3TWH A;  3NHG A;  2G8K A;  2QKK A;  4DQI A;  4DSI A;  3DI6 A;  3CYM A;  3SYZ A;  5JS1 A;  5C25 A;  4B9N A;  3NGI A;  4CJR A;  3C6T A;  5DK5 A;  4AHU A;  2X74 A;  2P51 A;  3HT3 A;  4DLG A;  2JGU A;  4F3T A;  4Q0B A;  3RTV A;  2P5O A;  3NF8 A;  1SKR A;  2OZM A;  4Z4G A;  4M3R A;  3SV4 A;  1KFS A;  4FJI A;  4RW7 A;  4CJ3 A;  3K58 A;  1KTQ A;  5DMR A;  2OPP A;  4EP5 A;  1TGO A;  2HNZ A;  1CZ9 A;  4HTU A;  4CFC A;  3QES A;  1T8E A;  1QSL A;  4CEA A;  3ULD A;  1LAV A;  3DLG A;  3PX0 A;  1D8Y A;  4DSF A;  1IG9 A;  1RDB A;  2FC0 A;  3FFI A;  3P83 D;  5HRP A;  2BGG A;  1UA0 A;  3V1Q A;  3NFA A;  1KVA A;  1QQC A;  3C95 A;  2VG7 A;  1VSD A;  4DTN A;  3QNO A;  4GMJ B;  4AHC A;  3IAY A;  3SV3 A;  1IH7 A;  1NJY A;  3L2Q A;  3PX4 A;  2XRI A;  1JLE A;  1RT5 A;  3MXM A;  4PWD A;  3KLI A;  3QNN A;  4BE0 A;  3AO1 A;  3ZT1 A;  5KRT A;  4FJH A;  1CZB A;  3AO2 A;  4AHR A;  4KHS A;  4RW6 A;  1JLC A;  4DFP A;  3I0R A;  4CEQ A;  2XY6 A;  4O0J A;  2Z1I A;  4DU4 A;  4K8Z A;  3WNF A;  4CJV A;  1TKX A;  4Z4I A;  5CZ2 A;  2OA8 A;  4DTM A;  1J54 A;  4EP4 A;  2OZS A;  4DTU A;  3SUN A;  3M8P A;  5FRO A;  3G0Z A;  4KAZ A;  3CG7 A;  3MED A;  4DG1 A;  3OYC A;  3HXM A;  4DTJ A;  4ELV A;  2KFN A;  3SPY A;  1TAQ A;  5HRR A;  4AIL C;  4CGD A;  4Y1D A;  3RMA A;  3SQ0 A;  1RT1 A;  2OPS A;  4MFB A;  3CFP A;  3MXI A;  4Q5V A;  3LP1 A;  1B92 A;  1C0M A;  1GOA A;  1CLQ A;  1ZBH A;  3SCX A;  3RR8 A;  1A5V A;  4CIG A;  5KRS A;  2E4L A;  4DU3 A;  1UAX A;  1WAF A;  2XY8 A;  1QSY A;  1HQU A;  2RKI A;  4CEC A;  4O0I A;  3CQ8 A;  4CHP A;  1TK5 A;  3K57 A;  3MEG A;  1VSH A;  2DY4 A;  1S6Q A;  4RG8 A;  3TR8 A;  3U6F A;  3MAQ A;  1GOB A;  1T7P A;  4DMN A;  1B9D A;  3OYH A;  1LAW A;  1RBS A;  1Z25 A;  4CFB A;  3OS1 A;  4E0D A;  4J2E A;  4CJE A;  2IDO A;  4QAG A;  3AA4 A;  1TAU A;  4FJK A;  3KTQ A;  4KTW A;  1W0H A;  1KLM A;  3NH0 A;  2ATQ A;  2KTQ A;  4I2P A;  3NH1 A;  1SKS A;  1ZBL A;  3KIO A;  3NAE A;  1X1P A;  1K6Y A;  2KZM A;  1HRH A;  3PUF A;  1X9M A;  4LSN A;  4OKE A;  3SUQ A;  4K8X A;  2KQ2 A;  4OLB A;  1LW0 A;  3A2F A;  3O3G A;  3RR7 A;  4FYD A;  2YKN A;  2X6N A;  4N47 A;  3VQ5 A;  3I0S A;  3S9H A;  4FLT A;  4M3Y A;  3LZJ A;  2Q3S A;  4Y1C A;  1RBT A;  4KB1 A;  2HHW A;  3VQ6 A;  1BHL A;  1Z26 A;  3VA3 A;  4DSJ A;  1JLB A;  3ZSX A;  3T1A A;  4CIF A;  3EYZ A;  4JRP A;  4E7L A;  3S3M A;  1Q9X A;  4B9T A;  1C6V A;  1DLO A;  4JLH A;  5K14 A;  4BWJ A;  5SWM A;  1RIL A;  1TKT A;  4B9L A;  4FJL A;  4KHY A;  4NCA A;  1EKE A;  3LAK A;  3ZSQ A;  4KRF A;  1EET A;  3WNH A;  3E01 A;  4F2S A;  3LWM A;  3K5N A;  1BIU A;  2Z1H A;  3V4I A;  4CF0 A;  3OY9 A;  4YFU A;  3SQ1 A;  3DRS A;  1HJR A;  1HYZ A;  4OGC A;  4FLX A;  1CXU A;  3CFO A;  4IG3 A;  2FBY A;  1VSF A;  4N5S A;  3AVJ A;  1VSJ A;  4XIU A;  3TAN A;  1BI4 A;  1WSG A;  2ITG A;  2VWJ A;  1QE1 A;  4KTQ A;  3AVB A;  2RF2 A;  3SPZ A;  4CJS A;  2DFH A;  2VG6 A;  3NF9 A;  3OYG A;  3SJJ A;  1JLQ A;  3QO9 A;  4AHT A;  4OPJ A;  4F3O A;  1DTT A;  1EX4 A;  3LPU A;  4CEE A;  1BCM A;  5CZ1 A;  4CE9 A;  4UQG A;  3VQP A;  3CFR A;  4DS5 A;  1QS4 A;  1VSM A;  3KKS A;  2XY5 A;  3AVN A;  3SI6 A;  3V9S A;  2AJQ A;  1I3A A;  3VQE A;  4CHQ A;  1VSK A;  4IKF A;  4QCL A;  2HNY A;  3S3O A;  3BDP A;  1IO2 A;  4FJN A;  4DWI A;  3VQQ A;  2YNI A;  4CGJ A;  3MXJ A;  4CJQ A;  4WE1 A;  3OYE A;  1VRT A;  1W9H A;  1RBV A;  1F21 A;  1WLJ A;  4FLV A;  3K59 A;  3L3U A;  1EP4 A;  4BAC A;  1HMV A;  1N5Y A;  4NYN A;  2Y1J A;  5D3G A;  4OPK A;  3TAE A;  3RMD A;  4QOZ B;  3DM2 A;  2IAJ A;  3AVM A;  4M41 A;  4B08 A;  4IFY A;  4OKJ A;  4KHN A;  2GV9 A;  4O55 A;  1KSP A;  4N56 A;  1LWC A;  1WSI A;  2IS3 A;  2KZZ A;  3QEP A;  4E19 A;  3T3F A;  4CEB A;  4DQQ A;  4FJ9 A;  2HVI A;  4DFJ A;  5J1E A;  1J5O A;  3QEV A;  4M42 A;  2HHX A;  3RMB A;  1ASV A;  1HYV A;  3LAM A;  1JL2 A;  1WSH A;  2OYQ A;  2YHA A;  1RDA A;  5CY4 A;  1FK9 A;  3KKR A;  4B8A B;  3V1R A;  3QIO A;  4CHZ A;  1WN7 A;  2DFF A;  3JSM A;  3ALY A;  3NCI A;  1SL1 A;  2HHU A;  1NOZ A;  4I9Q A;  4FLU A;  4CCH A;  1RT7 A;  3H08 A;  3B6P A;  3OVN A;  3OJU A;  4CFA A;  1JLG A;  4E1N A;  4W5R A;  4B8C A;  4CGF A;  3NGY A;  5HRS A;  4BE1 A;  3V9W A;  2A1R A;  1HNI A;  1L3S A;  3VN5 A;  2X6S A;  3ZSW A;  5CYM A;  4FZY A;  4HVJ A;  2YNF A;  4FK4 A;  3QEX A;  3HPH A;  2EHG A;  3AO4 A;  4HUE A;  1NKB A;  2XY7 A;  3K2P A;  3HVR A;  1L3V A;  3PV8 A;  3AVC A;  1I39 A;  4J2A A;  4CEO A;  1KLN A;  3DLK A;  3NGZ A;  2I5J A;  4DTS A;  3HPO A;  1TKD A;  4ELT A;  1WAJ A;  3SUP A;  2FBT A;  3AA3 A;  4CJP A;  3V9U A;  4KRE A;  1TK8 A;  3S3N A;  4CJT A;  2F96 A;  1WSF A;  4E89 A;  2HB5 A;  3NDK A;  2G8F A;  3L2R A;  1HNV A;  4BDZ A;  4BDP A;  4DTR A;  3DOL A;  2LSN A;  3LP2 A;  1HYS A;  4B9S A;  4LH4 A;  3OS2 A;  4IDK A;  1L5U A;  4O5B A;  2XO7 A;  2ZQB A;  2O4G A;  4CES A;  3QEW A;  4DQR A;  4CEF A;  1G15 A;  4H8K A;  3QEI A;  2F8T A;  4TSX A;  4M3U A;  3LP0 A;  1L3T A;  4CJU A;  4E7I A;  4F8R A;  2HHS A;  1D9F A;  2WON A;  4PA1 A;  3PY8 A;  3AVA A;  3VQC A;  4R5P A;  1KCF A;  3OYL A;  4FLW A;  3PO5 A;  1TV6 A;  2PYJ A;  4EZ6 A;  3K5L A;  3RMC A;  4CEZ A;  3AVI A;  3ISN C;  1LWF A;  3B6O A;  4FJ8 A;  3AO3 A;  1SKW A;  5I42 A;  1RTH A;  5J2Q A;  3TAR A;  1U49 A;  2VWK A;  4KPY A;  2B4J A;  3WNE A;  3SZ2 A;  4OGE A;  2IC3 A;  3AVL A;  3VA0 A;  1A5W A;  3SQ2 A;  3TAB A;  1WSE A;  4OJR A;  3OYI A;  3KD1 E;  4BDY A;  1KFD A;  3M8Q A;  3V1O A;  4DSK A;  1ZBF A;  1GOC A;  2ZE2 A;  2P1J A;  5J2P A;  1DTQ A;  1LW2 A;  3AA5 X;  1B9F A;  4I7F A;  3V9Z A;  4DSL A;  5SZT A;  3V9X A;  1XHZ A;  3ZSV A;  4LY7 A;  4L8R B;  2YV0 X;  3OYD A;  3VQB A;  2QXF A;  4DTP A;  1S9E A;  3VQ8 A;  4DU1 A;  3AV9 A;  3ZSR A;  4OLA A;  4FJJ A;  3K5O A;  1RTD A;  4G1Q A;  3DOK A;  1O1W A;  1TL1 A;  3EY1 A;  3OYB A;  3LZI A;  1U4B A;  1ASW A;  1X9S A;  3RRH A;  2HMI A;  4FZZ A;  3MEE A;  1BQM A;  1IKV A;  3KK1 A;  2D5R A;  4DLE A;  3OYF A;  1NJX A;  3PO4 A;  2RPI A;  4CF8 A;  4CHY A;  4AHV A;  4CF2 A;  4PY5 A;  4I9L A;  5I3U A;  4DFM A;  2HHQ A;  3LP3 A;  3F73 A;  3QIN A;  1BIS A;  1RDC A;  1YTA A;  4FVM A;  1RDD A;  3VQA A;  1YVU A;  4FW2 A;  4KV8 A;  4C8M A;  3D45 A;  4KTZ A;  5HRN A;  1J9A A;  2GBZ A;  3OYJ A;  1QHT A;  2YNG A;  3CM5 A;  2Y1I A;  1S9G A;  4KFB A;  5E41 A;  4N41 A;  3D0P A;  1C1A A;  2IGI A;  4PQU A;  2DFE A;  4E1M A;  4ZTF A;  3O4N A;  1SL2 A;  3ASM A;  3SNN A;  5T7B A;  4DTO A;  3CM6 A;  1VSL A;  5C42 A;  1S1V A;  4HHT A;  5JS2 A;  4M3T A;  1VSI A;  3HST B;  4CJW A;  1S1U A;  4M3Z A;  1T05 A;  2PYL A;  4B9M A;  2O4I A;  4NCB A;  1LV5 A;  3UIQ A;  1NK8 A;  4KB0 A;  4W5N A;  4F4K A;  3QET A;  3HVT A;  4IBN A;  3AVK A;  5KGX A;  4KI4 A;  1RBU A;  3U3G A;  4FXD A;  1U47 A;  2R7Y A;  4ID5 A;  5KGW A;  3L8B A;  1BI4 B;  1RTI A;  3HPG A;  3LAL A;  4I2Q A;  3VQ7 A;  4CFD A;  3V6D A;  1T03 A;  1U04 A;  4NYF A;  4CED A;  1IKY A;  3OYN A;  1RNH A;  1U48 A;  2KFZ A;  4ZHR A;  3PX6 A;  1NK9 A;  4KKO A;  2Z1J A;  2PZS A;  3HL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...