3AVKA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Recombination/inhibitor
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avkA00
1EP4A 4KTQA 4HCCA 2RPIA 1GOBA 3K5OA 1A5XA 3MECA 3QIOA 1TV6A 3S3MA 1DTQA 4CK2A 3RMAA 3CM6A 3PUFA 5HRPA 2KTQA 4E19A 1SKSA 4DSKA 1I39A 1QHTA 4CJSA 4E7HA 5HLFA 2VG7A 1O1WA 3B6PA 3O4NA 3AVFA 2F96A 1IH7A 2ZE2A 4RW6A 4RW9A 3OYDA 2PYLA 2XY8A 3DOLA 1IG9A 1J53A 1F21A 4FLWA 3THVA 2A1SA 1RDAA 4R5PA 4LD0A 4PA1A 1VSKA 1ZBHA 4CEOA 3QEXA 3RMBA 1LW2A 2EX3A 1UAXA 2DFEA 4I7FA 4B9LA 3ZCMA 3VQBA 1TAUA 2DFHA 4CHZA 2AJQA 2Y1JA 4J2AA 3VQCA 3VQ7A 4AHTA 1TL3A 4F2SA 1SV5A 4ZHRA 3V6DA 3K5NA 3SV3A 4J2DA 4MFBA 3O3FA 4DSJA 4CF1A 4F3TA 3U3GA 2OA8A 1W0HA 1N6QA 4FJ7A 2RKIA 4FJLA 1KLNA 1TVRA 3SQ2A 4M3TA 3HP6A 4OGEA 3AA5X 1NJYA 3K58A 2YNIA 4IG3A 4DTOA 2JLEA 4HUEA 3DM2A 4DSIA 4EP4A 3QNNA 2XY7A 1U4BA 1BQNA 4UQGA 1Q8IA 3QO9A 3LAMA 5C24A 4NCGA 2YHBA 4CEDA 1RT6A 3L3UA 1NOZA 4DQQA 2FBXA 2JGUA 5J2PA 1LWCA 4DTJA 3AA2A 2RN2A 1KVAA 3HM9A 4QCLA 2GUIA 2F8TA 3ZSVA 1VSEA 4DTPA 2A1RA 4FLYA 3LP1A 4OKJA 4AHRA 2Z1HA 4Z4GA 3RR7A 3TI0A 3IS9A 4RW8A 4Y1CA 3JYTA 4MQ3A 2B5JA 1VSHA 2Z1JA 1B9DA 3AO5A 3KLIA 4M45A 4CJKA 1RNHA 3LZJA 1NK8A 1S1UA 1NK0A 1VRTA 1WSJA 3CQ8A 2HNZA 4IG0A 1BCMA 4CF8A 3AA3A 4DS5A 3QESA 5HROA 4NCBA 4KI6A 4DWIA 1CLQA 1JLEA 2B6AA 3KKSA 1ZBLA 4KHQA 2OPSA 4QOZB 3QIPA 3OYAA 2VG5A 2YNFA 3VQDA 2PZSA 5DMRA 3RRHA 3LDSA 3LP3A 2VWJA 1TK8A 3T1AA 1RTHA 2D5RA 4KHSA 3K57A 4BE2A 2LSNA 3V9ZA 1JXEA 4ZTFA 1EX4A 4RG8A 1VK0A 4CGGA 4JRQA 3MXJA 2IDOA 4JS4A 4E7IA 3IAYA 2KFNA 4CEEA 2HB5A 1HYSA 4FJNA 3NAEA 3U6FA 3NF7A 2O4IA 3OY9A 4FLZA 3F9KA 4FXDA 4KREA 4N47A 3OS1A 1WNSA 4GVMA 4CJ3A 4N76A 3ZSZA 1WSEA 1N5YA 1GOCA 3L2VA 1S1VA 3WNEA 3C6TA 1BIZA 5CY4A 2WOMA 1UA1A 3PO4A 4AHUA 2HHUA 4FJ9A 4FJXA 4IFVA 4B9NA 4E7JA 4NYNA 1RBRA 3DRSA 4CHQA 1NK7A 1BQMA 2I5JA 3VQ9A 3SZ2A 3RRGA 1JLGA 4WE1A 3MXIA 3HSTB 2G8HA 4B9TA 3SNNA 2HHWA 4DTMA 3V81A 3V9XA 1RDCA 3SQ1A 3OYBA 3SUNA 2IC3A 3ZT2A 1D9DA 4ELVA 1L3SA 2GBZA 4IKFA 3TAPA 4CFDA 2X6SA 3TAEA 3ZT1A 4FJGA 2FC0A 4Y1DA 1JL1A 1VRUA 1JL2A 4OLAA 1X9WA 1YTAA 1DTTA 2ZQBA 4HHTA 1KFSA 4O0JA 3SUQA 4E0DA 3WNHA 4B9SA 2HHQA 4F8RA 1TK5A 3NBPA 3OYJA 3AVLA 3BGRA 3RMDA 4FM2A 3SPZA 2IOCA 3AVJA 3FFIA 4B9MA 2HNDA 1BI4A 3ZT4A 1U47A 2X74A 3OYKA 2HVIA 4NCAA 3C95A 4M3UA 4ID1A 4I2PA 3QETA 4O5BA 4FZYA 4CECA 4DFPA 2Q3SA 3D45A 3SQ4A 3MEEA 1KLMA 3NGYA 3NGIA 4I2QA 4BWJA 3HPOA 4FK2A 4OPKA 5D3GA 1IKWA 4KFBA 4Z4CA 4YNQA 1BHLA 4CJUA 2G8KA 3E01A 4CE9A 4LSLA 4F3OA 1TL1A 4O0IA 4PY5A 3CM5A 4CHNA 4DSLA 4HTUA 2BGGA 3S9HA 1WSHA 3KIOA 3QEIA 1B92A 1NJXA 3TARA 4CEFA 3PV8A 1X9MA 4IDKA 1UA0A 4FVMA 3VQQA 1HJRA 2BE2A 2QXFA 1C0TA 3V9UA 1RBSA 1XWLA 1TK0A 5FRMA 2PYJA 3A2FA 4ELTA 2YKMA 4CK1A 3F73A 4DFJA 1J54A 1T7PA 3I8DA 1VSJA 2ITGA 4M3XA 1RTDA 3OYMA 1JKHA 3L3VA 1BIUA 2F8SA 3DI6A 3T19A 3SJJA 1SUQA 1ZBUA 4E1NA 4B9VA 1C0MA 4IBNA 5SWMA 4CHOA 1RT1A 4CJ4A 2BDPA 1RT4A 3MEGA 3VQ4A 1BCOA 1WN7A 2IAJA 4LY7A 5KGXA 3K5MA 3LP0A 4DTUA 1S1XA 3NF9A 4FZZA 4FZXC 3O3HA 4F2RA 1IKVA 4M3YA 3LPTA 4CIGA 3EYZA 5I42A 1NJWA 2WONA 3JSMA 3KLHA 1RBUA 3NF8A 1B9FA 2G8VA 1KVCA 2PY5A 2X78A 1TAQA 1RDDA 3SI6A 3HK2A 2VWKA 1C6VA 2YNHA 3AVHA 4O4GA 3O3GA 1S9GA 3HPHA 4CFAA 3QLHA 3TR8A 3TWHA 3DLKA 1U04A 2YV0X 3OJSA 4AHVA 3KLFA 3ZT3A 4OPJA 1BISA 2HNYA 5J1EA 3V1OA 4CJEA 2GV9A 4OKEA 1RCHA 1RILA 2DFFA 4XIUA 4DTSA 4KTWA 2G8WA 1Y97A 3QEVA 1NK4A 4CEAA 4QAGA 3NH2A 3I0SA 2W42A 4E3SA 3NFAA 4CF9A 3OYLA 2KZMA 3LAKA 1C1CA 4CGFA 3DRPA 4FM1A 1T05A 1QTMA 4K8ZA 4M3RA 4DSEA 1YT3A 4OGCA 3MXMA 3HVRA 2DY4A 2D0BA 3TABA 4BE0A 5CYMA 3K2PA 4ELUA 4CGJA 3VQ8A 4B08A 4DFMA 4PWDA 3V4IA 4HVJA 3AVCA 2QK9A 4CGDA 4CF0A 2P51A 3AVMA 5KRSA 3AO1A 5HRSA 1D8YA 4H4OA 3VQ6A 3ISNC 4DS4A 1FK9A 4DF8A 1FXXA 3DYAA 5JS2A 4CIEA 4KB1A 3DLBA 3OJUA 1XHXA 2BANA 5CZ2A 1VSFA 4BWMA 3L2UA 4KO0A 3RMCA 1A5VA 1EKEA 4FJJA 4CJVA 1RT2A 4O44A 4YFUA 3C6UA 4JLHA 1IO2A 3CFOA 4IFYA 4AHCA 4Z0UA 3U3YA 1R0AA 4DQPA 4FJHA 4FW2A 3OS0A 4OLBA 2G8IA 2OPPA 3HVTA 1RBTA 3LANA 3HJFA 3V1QA 1KFDA 1TKXA 3HP9A 4DLGA 3SUOA 5KTQA 3TANA 4C8MA 2XO7A 3OVNA 3K59A 1L3UA 3DMJA 4KI4A 1S9EA 4FJKA 1G15A 5KRTA 4HUGA 1LWFA 3AO2A 4CEQA 5CZ1A 1C1BA 3CYMA 3AVIA 1J5OA 1RDBA 1J9AA 1KCFA 3CG7A 2HMIA 4C8KA 1HQUA 2YKNA 1NK5A 5J2QA 4LSNA 1NOYA 4W5TA 4C8OA 5HP1A 4H8KA 4Q5VA 4N5SA 4I9QA 4FJ5A 4TSXA 1LAWA 4M42A 3RR8A 3K5LA 1NKBA 2HVHA 1SL0A 1SL1A 4N56A 1RT3A 2X6NA 3NE6A 2QKBA 3VA0A 1L5UA 3LZIA 3PX6A 1LAVA 1JLAA 4KV8A 2OYQA 1SKRA 3CFPA 1ITGA 4L8RB 3P83D 2HHXA 3UIQA 3TAMA 1UWBA 2KZZA 3CFRA 1ASVA 1XC9A 3LPUA 5I3UA 4KHUA 1UOCA 3OYCA 2YHAA 1KSPA 4W5NA 3ALYA 4KHNA 1RBVA 1S6PA 2EHGA 4B8AB 4CESA 2G8FA 3ZSYA 2P5GA 3M8PA 2XRIA 3NH1A 2OZMA 4E1MA 3DLEA 1TGOA 4KHWA 4DMNA 1LV5A 1TKTA 1Z25A 1JLCA 3P5JA 1DLOA 4BACA 2IGIA 3LWLA 3ITHA 4FCYA 3TAGA 5C42A 3IG1A 3VQAA 1KVBA 3ZSQA 4DFKA 1YTUA 2IS3A 4EZ6A 5J2NA 1RT7A 4CHYA 3AA4A 4CK3A 1EETA 1FKPA 4JRPA 3ULDA 4DTXA 3V9WA 2KQ2A 4HUFA 4FJMA 4DQSA 4C8LA 4PUOA 3I0RA 3WNGA 5FRNA 1NK6A 1HPZA 3SCXA 4I9LA 3MAQA 3L2WA 4C8NA 1JLBA 4W5OA 3HXMA 4F4KA 2KFZA 3C94A 1ZBIA 1K6YA 1IKYA 1RTJA 2E6MA 4H4MA 4W5RA 2FBYA 3KJVA 4FM0A 3DLHA 4KRFA 2P1JA 4DSFA 3DLRA 1X9SA 2FBTA 5EU7A 1Q9XA 3ZSOA 4E7LA 3LALA 1QE1A 4CIFA 3OYFA 1MU2A 3M8SA 3L2RA 3ZT0A 1QSLA 2XHBA 2QKKA 1HNIA 2DTUA 4W5QA 1BL3A 4FLTA 5DK5A 1WSFA 1Q9YA 1ASUA 3AV9A 4CERA 1T8EA 3DLGA 3PY8A 1I3AA 3RWUA 4CHPA 4GMJB 3HYFA 4B3OA 3V1RA 4RW7A 4PQUA 3KKRA 1NK9A 3SYZA 1KRPA 1FKOA 1HNVA 3KLGA 4CFCA 1YVUA 3NGZA 4CEBA 2OZSA 1HYZA 5C25A 3TAQA 3SQ0A 3QEPA 4CJ5A 3WNFA 3AVBA 2HHSA 4FK0A 1HQEA 1WAFA 3V9SA 3G0ZA 4DF4A 5HRNA 2HHTA 1WSIA 1QSYA 3SPYA 4LH5A 4KAZA 1VSLA 1A5WA 2YNGA 4LH4A 4Z4IA 1ZBFA 5E41A 3OYNA 3L2QA 5KGWA 4E89A 1NKCA 3AO4A 4EZ9A 4FLUA 2O4GA 1S5JA 2ETJA 1U49A 1QQCA 4OVLA 1WSGA 3ZSXA 4CGIA 4Z4HA 4J2BA 1GOAA 3QINA 5SZTA 3AVGA 4BDYA 1S6QA 1XI1A 1VSMA 4CGHA 1C1AA 4J2EA 1NKEA 1KTQA 4DU3A 4NYFA 2D0CA 1SKWA 4HCBA 2HW3A 2OPRA 4CJFA 2XY5A 4M3ZA 5CYQA 5K14A 4AH9A 3B6OA 1WAJA 3MEDA 3KK1A 3NCIA 3VQPA 1VSIA 3HPGA 5T7BA 3SUPA 1TKZA 2NUBA 1CZ9A 1JLFA 4EP5A 3VA3A 4DTRA 4CF2A 3HT3A 3PX0A 4ZTJA 1JLQA 4Q0BA 2OPQA 3OYHA 4OJRA 3VQ5A 4CJTA 1TKDA 1NJZA 1SL2A 1LW0A 1S1TA 3SV4A 3QERA 1CZBA 2Y1IA 4CCHA 1RTIA 4ICLA 4DU4A 5J2MA 4DLEA 1HRHA 1ZYQA 1QS4A 3PO5A 4B9UA 4AILC 3M8QA 2E4LA 3KLEA 2XY6A 3HL8A 3D0PA 2G8UA 4G1QA 4M41A 4CJQA 4CJLA 3RTVA 1JXBA 2ATQA 1HYVA 1ASWA 1REVA 4KTZA 4DTNA 3BDPA 2P5OA 3VQEA 1WLJA 3T3FA 4BDZA 4KB0A 3KTQA 1D5AA 3AO3A 1IKXA 3NF6A 4M3WA 1L3TA 4FW1A 3VN5A 3ZSRA 3AVNA 4AHSA 4K8XA 2FBVA 4B8CA 4CJWA 4N41A 3H08A 3HO1A 1C0UA 3IRXA 2R7YA 4DU1A 3NDKA 1L3VA 4E7KA 4FJ8A 4KHYA 3M8RA 4JS5A 4GW6A 3DRRA 4CEZA 3EZ5A 3EY1A 2Z1GA 3OYEA 3LWMA 3KK3A 2RF2A 1CXQA 2D0AA 4FK4A 3QNOA 3AVAA 4FJIA 2B4JA 3G10A 5HBMA 4CFBA 4DQRA 4DQIA 5KI6A 3KD5E 3KD1E 4BDPA 4RW4A 3L8BA 1CXUA 3ASMA 3P1GA 3OYGA 4CJRA 3S3OA 2HHVA 2Z1IA 1XHZA 4O55A 3O4QA 1LWEA 5FROA 3OS2A 2E6LA 4FLVA 3TAFA 3S3NA 2VG6A 4ID5A 4FLXA 1RT5A 4KKOA 1QSSA 3QEWA 3AVKA 4Z4FA 1T03A 1EXQA 1X1PA 5FDLA 5HRRA 4DG1A 1W9HA 1VSDA 4CJPA 1D9FA 4FYDA 1HMVA 3DOKA 4OKKA 3NHGA 1Z26A 1U48A 3KK2A 3ZSWA 3OYIA 4Z4EA 2ZD1A 1BGXT 1BI4B 3NH0A 4KPYA 5JS1A 3LP2A 1U45A 1S1WA 4BE1A 3PX4A 2KW4A
chains in the Genus database with same CATH superfamily
4KTQA 1A5XA 3MECA 3IUCA 3S3MA 1DTQA 2UU9K 3RMAA 4BC5A 2KTQA 5HRPA 4DSKA 3TPQA 3O4NA 3EE8A 2F96A 1IH7A 4RW6A 3DOLA 2P9PB 1VQ9N 1F21A 4FWRA 3VESA 4R5PA 4LD0A 5GAEP 1EWQA 1ZBHA 3QEXA 3RMBA 5BREA 3ZETB 3R9PA 2HOEA 3HZ6A 3CXCM 4AHTA 1TL3A 3LDNA 4ZHRA 3K5NA 1K9MO 3SV3A 4F3TA 4CF1A 4JKDA 1N6QA 2RKIA 3SQ2A 3M5RA 4JD2A 2YNIA 4DSIA 1U4BA 3O5BA 3LAMA 5C24A 4NCGA 1RT6A 3VF4A 4JI2K 4DTJA 2IVOA 2P9LA 4QCLA 2F8TA 4DTPA 4Z4GA 4OX9K 3SAFA 2B5JA 3AO5A 3CJAA 3KLIA 1WUAA 2HW3A 1RNHA 1NK0A 1KD1O 4IG0A 1BCMA 4DWIA 1CLQA 1JLEA 1OH7A 2AP1A 2PZSA 4ISGA 4M7XA 1TK8A 3T1AA 1RTHA 4KHSA 3MCPA 4LF7K 3MK6A 3K57A 2HF4A 3SMSA 2F4VK 3JXUA 4CGGA 4JS4A 4CEEA 3EL2A 4PKGA 4LFAK 4CJ3A 1MA9B 2CGKA 4N76A 1ATRA 3C65A 5CY4A 3HOTA 3PO4A 4B9NA 3CJ9A 4BR7A 1RBRA 4ILHA 4HTLA 2P9IB 2P9NA 4B9TA 2G8HA 2HHWA 4DTMA 1VQ6N 3ID6A 4WQ4A 3SQ1A 5HL7L 2E1ZA 2GBZA 4H0OA 3TAEA 1JL1A 3THXA 1X9WA 2ZQBA 4O0JA 5GINA 4A62A 1NGBA 1Q18A 3WNHA 2HHQA 4F8RA 1KQSM 3BGRA 3RMDA 4FM2A 3SPZA 2YHWA 2HNDA 1BI4A 1KC8O 2HVIA 4NCAA 4M3UA 5AZJB 4O5BA 4FZYA 4DQ8A 4B1XB 3D45A 5AQGA 1E3MA 1ESVA 2QWOA 4CJ7A 4BR0A 4YNQA 1BHLA 2F9WA 3UB5A 4F3OA 1VQMN 4JI3K 4B1UB 3OHRA 5C0YA 4I6MB 5M1PA 4BC2A 4DSLA 4HTUA 4FWNA 1WSHA 1NJXA 4BQLA 4IDKA 4FVMA 1C0TA 2PYJA 4ELTA 4NO7A 5LMUK 4ISFA 2ITGA 1HKGA 3L3VA 2F8SA 3SJJA 4NXNK 3CIPA 3EE9A 3K9KA 4CJ4A 2Q0UA 2IAJA 4BG8A 3HOSA 5GAHP 3CJ1A 3JSMA 2PY5A 1TUUA 1TAQA 3SI6A 2UUBK 1C6VA 5F0XA 1YJNN 1S9GA 4CFAA 4DB3A 4IFEA 1U04A 3OJSA 5E84A 4AHVA 3BF1A 4OPJA 4OKEA 3O1BA 4YDUA 1HNZK 4QAGA 5C12A 3I0SA 4DV1K 4CF9A 1X3NA 1E4GT 1QTMA 4K8ZA 4JK7A 3N4PA 1R59O 2VCPA 2P9LB 2HBLA 2DY4A 4E1JA 3TABA 3K2PA 4BRFA 4ELUA 4B08A 4FSVA 4BVOA 4CZMA 2VWBA 5HRSA 1N32K 2QWLA 3ISNC 5AZIA 3VEOA 3OJUA 3VTIA 1O13A 4BGAA 3O80A 3VENA 3BUZB 3C6UA 4JLHA 1IO2A 4IFYA 3T7ZA 3U3YA 5E26A 4FJHA 4OLBA 5AQUA 1XQSC 2OPPA 3HVTA 2JWKA 1RBTA 3HJFA 3T1HK 1TKXA 3EO3A 2V7YA 5KTQA 4B3SK 3TANA 1V4SA 4EAHD 3L4IA 5AQYA 2IIRA 1L3UA 4FJKA 1G15A 4HUGA 3CC7N 4IZ9A 2O8FA 4X64K 5CZ1A 1C1BA 3CYMA 3AVIA 3VEVA 1J5OA 3PIPL 2PAVA 4JV5K 1IBMK 4YHHK 5J2QA 4JK9A 3CCMN 4H8KA 5BRHA 4WFBL 4FJ5A 1LAWA 4M42A 3RR8A 1SL0A 1HKBA 3LL3A 3PSFA 4WF9L 3PX6A 1OH5A 1ITGA 3UIQA 3RSEA 3ULEA 1U6ZA 1KAYA 1UWBA 1ASVA 5I3UA 5AQVA 2KKZA 1UOCA 3THXB 4MO5A 2OCEA 1RBVA 4CD1A 4YOYA 3O08A 4BC3A 1M90O 4KHWA 3P5JA 2IGIA 4K42A 3ITHA 3IG1A 1KVBA 4OO1J 4CBUA 1IBKK 1NGAA 4IDHA 2NRTA 3MN6A 1EETA 3ULDA 3V9WA 5ADXA 4DQSA 4PUOA 5M1FA 3I0RA 1N33K 1Q82O 1SQKA 2ZF5O 4WYBA 3MAQA 4C8NA 1VQNN 1K6YA 2E6MA 5HOOA 1RDWX 4JKFA 4KRFA 2H3GX 4FWQA 4IOXA 4H0TB 3ZSOA 4E7LA 3LALA 1QE1A 4BRPA 3M8SA 1QSLA 3NVKA 2XHBA 3SAHA 1HNIA 2DTUA 1OH8A 4W5QA 1WSFA 1ASUA 3AV9A 4CERA 3RWUA 1HNXK 4GKJK 4CHPA 4GMJB 3HYFA 3V1RA 3R6MA 5AQIA 2A42A 3WXKA 4LF4K 1HNVA 3CF5L 4CFCA 3DLLL 1ZBSA 3E9LA 4DUYK 3SQ0A 3WNFA 2HHSA 3TSQA 5HRNA 1GLJO 3SPYA 4LH5A 1A5WA 4LH4A 1NKCA 3AO4A 2NZTA 4J2BA 4DUZK 3QINA 4CZKA 2V51B 3TSPA 1W97L 3MN9A 1H1VA 1NKEA 3I56N 4HCBA 2NRWA 1W7AA 4M3ZA 4AH9A 3O9SA 5KPTA 3HBTA 1WAJA 3KK1A 5MLCQ 5T7BA 1TKZA 2NUBA 2QWQA 3C0BA 3UKUA 1M1KO 1JLQA 4OJRA 1P8ZA 3S41A 4CJTA 3PIOL 4CCHA 3CERA 4JHDB 4AILC 3KLEA 2E4LA 2XY6A 3HL8A 3D0PA 4G1QA 2QTDA 4WQ5C 4BR9A 4CJQA 4KTZA 1ASWA 3CJBA 3EN9A 5DM7L 2EWSA 1J5EK 3O6WA 3AO3A 3VN5A 2UUAK 4K8XA 2FBVA 3O8MA 5JLHA 3G4SN 3H08A 3HO1A 4DU1A 3IRXA 3M8RA 1NG9A 4CEZA 3C7NB 3OYEA 1YJWN 2D0AA 2OTJN 1Y64A 3AVAA 4V19S 1KXPA 4MDBA 5B8HA 3KD1E 4BDPA 3DXKB 3ASMA 3L8BA 3OYGA 3IFRA 3TAFA 3S3NA 2VG6A 4ID5A 1RT5A 2QM1A 4QS8A 4IEIA 3ZLJA 1NLVA 1IJJA 1X1PA 1XUPO 2VQEK 1GLCG 4LF5K 5M1NA 1U48A 3OYIA 4H0YB 5AQJA 3NH0A 1S3XA 2P9KA 5JS1A 1S22A 5BRFA 4FPAA 3MMVA 3PX4A 2KW4A 5TKWA 2RPIA 3RSEB 3ULEB 3QIOA 1TV6A 4CK2A 3CM6A 3PUFA 4E19A 4E7HA 1VQON 2O8EB 2VG7A 5AQTA 3BF3A 1J53A 2A1SA 4PA1A 1VSKA 4JI1K 5GADP 2DFEA 4I7FA 4JI8K 3ZCMA 4JI0K 4J2AA 3VQCA 4F2SA 1SV5A 1Q7YO 5EX5A 4DSJA 4JKGA 3U3GA 2OA8A 4BROA 4FJLA 4IJAA 3HP6A 3AA5X 3BEXA 4IG3A 4DR2K 2O8CB 2W41A 2XY7A 1Q8IA 1NOZA 4DQQA 3HRGA 3P38A 1T44A 4LFBK 4H5RA 2Q2RA 4FLYA 2A1RA 4OKJA 2Z1HA 4CZHA 2GEMA 3UKRA 1VSHA 3FZKA 1NK8A 1W2BM 3A8YA 3CQ8A 2V7ZA 4RTFD 3QESA 1Q86O 3THYA 2B6AA 2VG5A 5DMRA 3LDSA 3CC4N 2VWJA 2D5RA 1WB9A 4JKBA 1VQ4N 1BG3A 3QICA 1JXEA 5AQPA 3IAYA 2KFNA 5ADXH 3NAEA 4FJNA 3BZKA 3DJCA 3F9KA 4KREA 4N47A 2D0PA 4GVMA 2BUPA 1WSEA 2O8DA 2OANA 5A2QO 5BR9A 2E5LK 1GOCA 3L2VA 3WNEA 4KH6A 4JYAK 4FJXA 4IFVA 4NYNA 3DRSA 1U2VA 4CHQA 4BRHA 3ATVA 3VQ9A 1IG8A 3MXIA 3HSTB 3V81A 3WEEA 3OYBA 1YXQA 3TAPA 4CFDA 2X6SA 2FC0A 3H46O 4Y1DA 1VRUA 4JI6K 5CR4A 4OLAA 3HSCA 4GY2B 4NB4A 3SUQA 4E0DA 4FL9A 5KQDA 1TK5A 3AVLA 3AVJA 4NLCA 1YIJN 4B9MA 3H6EA 4JAXA 4U67L 3A5LC 4JN4A 3VTHA 5EVZA 3SQ4A 3NGIA 4BWJA 3L6QA 3HPOA 4Z94A 4OPKA 3E01A 4CE9A 4DKWA 1Q81O 4AQYK 4PY5A 4CHNA 3S9HA 3R8EA 5AQFA 2YI1A 4YOTA 1IV0A 3VMFB 3PV8A 1HJRA 5FRMA 1RBSA 3A2FA 2YKMA 4H5NA 4DFJA 1J54A 5GAGP 1JKHA 3CMEN 3VEWA 3DI6A 3T19A 1ZBUA 5JMVA 3MX2A 4E1NA 4CZGA 1C0MA 4IBNA 4B9VA 1RT1A 3MEGA 1BCOA 1WN7A 3DXMA 4FZXC 4F2RA 3LPTA 4FO0A 2I7PA 3EYZA 1B9FA 3HK2A 3SBTA 2D4WA 5AQSA 4O4GA 3O3GA 3QLHA 2PFUA 4EFHA 3OA9A 2FF3B 4CD3A 2QEXN 1XNRK 5AR0A 1BISA 3CCLN 4CJEA 1DT9A 2G8WA 5AFUA 4KTWA 5DM6L 1Y97A 3AARA 3QEVA 1NK4A 3ZX2A 4CEAA 1FW6A 4E3SA 2UUCK 3NFAA 3OYLA 4XH4A 2KZMA 4YOVA 4CGFA 3DRPA 1OKJA 2NRVA 4FWOA 3DAWA 3MXMA 1LOTB 2Q0RA 3O9RA 5CYMA 2VGNA 3TTFA 4HVJA 3AVCA 4MLEA 4CGDA 2ZM6K 2P51A 3BY5A 4FWSA 5EY4A 3AVMA 4IJNA 5KRSA 3AO1A 3QBWA 4DS4A 3HTVA 2NNWA 1XHXA 2BANA 4FJJA 4O44A 4YFUA 4DQPA 4FW2A 3OS0A 3FZLA 4DLGA 1N8RO 2HBMA 3MN5A 2BH1A 1P90A 3AGRA 3K59A 4KI4A 5KRTA 4U7BA 5AQQA 1RDBA 1KCFA 3CG7A 4IO9L 5BRDA 1HQUA 2HMIA 3BP8A 1YJ9N 1U2VB 4N5SA 4TSXA 4BRGA 1SL1A 4N56A 1RT3A 3NE6A 2QKBA 3QDKA 3H1VX 1L5UA 3KHYA 3LZIA 1GLEG 1JLAA 2OYQA 1NGEA 2FSNA 3CFRA 1C0FA 4KHUA 3OYCA 4IXCA 4BREA 3ALYA 2EHGA 4ILJA 3M8PA 4A2BA 3T1YK 3CJ7A 3VETA 1HNWK 3NH1A 4E1MA 5AQNA 1TKTA 1DLOA 3Q7CA 4HWIA 1QVFM 4BGBA 3PSIA 3ZSQA 4FVUA 5LMNK 4CK3A 4DTXA 1V4TA 2QWRA 1HUXA 3D2FA 4DR3K 3SCXA 4I9LA 3H3OB 4F4KA 4UY8O 1QZ6A 4JI5K 3TSUA 4H03B 3KJVA 2FBYA 1NGIA 4K25A 3EZWA 4DSFA 3DLRA 2FBTA 3CQXA 2WTUA 3OYFA 3ZT0A 4L3QA 5FPDA 4CZEA 3WXIA 4B3OA 3LDLA 1FKOA 2F9TA 3NGZA 4CEBA 4BG9A 1HYZA 4OPAA 3DXMB 4JD2B 4CJ5A 3AVBA 3KZBA 4FK0A 1OH6A 3ZYYX 1HQEA 1WAFA 3G0ZA 4GV3A 4JNEA 2HSTA 4KAZA 1VSLA 4Z4IA 1Z05A 1ZBFA 3OYNA 3L2QA 4E89A 3O9UA 3VGLA 4FLUA 2FF6A 3KWIA 4JKHA 2ETJA 3A5MC 4K43A 1XI1A 4H0VB 4J2EA 2YHYA 2YJFA 4DU3A 4NYFA 2D0CA 1SKWA 3M1FA 4CJFA 5CYQA 3B6OA 1HLUA 3MEDA 3VQPA 3HPGA 3SUPA 4O5FA 1CZ9A 1JLFA 3CHWA 3OYHA 3VQ5A 1XC3A 4DU4A 2NRXA 1BWFO 1HRHA 4JKEA 1TYQA 1ZYQA 3PO5A 3U9DA 4DR7K 3HI0A 4PKHA 4JEPA 3BDPA 4DTNA 2W6KA 1JCEA 3O4WA 2PBDA 1IKXA 3NF6A 4M3WA 3AVNA 4GVEA 1IBLK 2IVPA 2R7YA 5LL6Z 3D2EA 3AGKA 4E7KA 1BA0A 4KHYA 1K8KA 3VPZA 4GW6A 4H5VA 5FPEA 2P9NB 2Z1GA 4FK4A 5KPZA 3QNOA 2B4JA 3G10A 4PKIA 3KD5E 3PLAA 4RW4A 3JAMO 1BOTO 1XHZA 5FROA 1LWEA 5AFUH 2E6LA 4CW7B 3QEWA 3AVKA 1T03A 2IVNA 1EXQA 1KAXA 1CZAN 3K0SA 4A5AA 5FDLA 4CJPA 3VOVA 3U9ZA 1D9FA 4FYDA 4BRLA 2NRZA 4OKKA 3P4IA 3SMPA 1SZ2A 1Z6RA 3KK2A 3ZSWA 4Z4EA 2ZD1A 1BGXT 3FR0A 1BI4B 4KPYA 4YOXA 1U45A 3FZHA 3D6RA 1EP4A 4FPBA 4HCCA 3K5OA 1SKSA 5HLFA 3VERA 2ZE2A 2PYLA 2J4RA 2XY8A 3QMLA 4FLWA 5ELZA 3QFUA 1KAZA 4DV0K 1EO1A 2EX3A 3VEXA 3VQBA 4CHZA 2AJQA 2Y1JA 3VQ7A 3NMUA 1MDUB 4J2DA 4MFBA 4DCHA 4CI6A 4DR5K 5BPMA 1NJYA 3VEYA 2QI2A 4DTOA 2JLEA 2O8BA 4EP4A 3FLCO 3QNNA 1BQNA 4UQGA 3MWPA 4CEDA 2YHBA 3L3UA 2JGUA 4YY3K 5J2PA 2FSKA 1WOQA 2RN2A 3HM9A 1GLBG 2GUIA 1OVQA 3ZSVA 1VSEA 4A61A 4BRAA 2GELA 4AHRA 3IS9A 4RW8A 4Y1CA 5C15A 2ZJPL 5KQ8A 4YOWA 1HJOA 1S1UA 1VRTA 3VF2A 1WSJA 3CCRN 3O9TA 4DS5A 3AA3A 4BRQA 4KI6A 1K8AO 3IMXA 3CCVN 4QOZB 1ZBLA 1NGDA 3QIPA 3OYAA 2YNFA 3VQDA 3RRHA 4DHYA 3J7ZO 3GBTA 4BE2A 2LSNA 3V9ZA 4ZTFA 1EX4A 4RG8A 1VK0A 2IDOA 4BY9C 4E7IA 2HB5A 2P9SA 3OY9A 3ATUA 4FXDA 2E8AA 3H45C 3OS1A 3CC2N 3ZSZA 3D7EO 5AJ3K 1MWKA 5AZIB 1S1VA 1ZC6A 3C6TA 1BIZA 2GWKA 2WOMA 1UA1A 4AHUA 4WFNL 4C1NI 3WQUA 1NK7A 1ILYA 1BQMA 3G71N 2I5JA 3SZ2A 3RRGA 4WE1A 2E2NA 3SNNA 4K0KK 1RDCA 1YAGA 5C10A 3SUNA 2IC3A 1D9DA 4ELVA 2UYTA 2O8FB 2Q31A 3ZT1A 3OBWA 1YTAA 3A5OC 4DV6K 3ZEUA 4JKCA 4GV9A 3THWA 5KPRA 1NMDA 3OYKA 3C95A 5LJVA 1VQ5N 4ID1A 4CECA 4DFPA 3CCUN 3MCAB 3NGYA 5AQOA 1IKWA 2DPNA 4CJUA 3F2KA 4LSLA 3EKSA 2AA4A 2P9PA 3QEIA 4DV3K 5CE3A 3G6EN 4CEFA 1X9MA 2QXFA 3V9UA 1TK0A 3ZETA 2ZWHA 4RCHA 3GDQA 4LFCK 4CK1A 1HR0K 1VSJA 4M3XA 1RTDA 3OYMA 2KHOA 4B1ZA 1SUQA 5GIOA 4FWMA 3CI5A 5JVGL 5SWMA 2BDPA 4H5WA 4F9OA 3LP0A 3N4QA 1S1XA 4DTUA 4FZZA 3ENHA 1C0GA 5I42A 2WONA 3L0QA 3CCQN 3NF8A 1KVCA 2X78A 1RDDA 4XH5A 3EKUA 2VWKA 3AVHA 3CPEA 3TWHA 3DLKA 5LJWA 2YV0X 3I33A 3ZT3A 2HNYA 3V1OA 3FZFA 5BN9A 3DWLA 1RCHA 1RILA 2DFFA 2FLOA 1VQLN 1QZ5A 2D1KA 5AQKA 2O8BB 3C6HA 4CBWA 2W42A 2FXUA 3SBGA 3LAKA 4DSEA 1YT3A 2D0BA 4BE0A 4WCEL 4PWDA 3V4IA 1E4FT 4X66K 5AQLA 3LM2A 4KBOA 1D8YA 3VQ6A 4X62K 1QQOA 1FK9A 4DF8A 4KB1A 3DYAA 3W3DA 5IT9O 5CZ2A 4BWMA 1S72N 3UKUB 4CJVA 1RT2A 1FJGK 3CFOA 1BU6O 1R0AA 4Z0UA 3WXLA 3V1QA 3HP9A 1YUWA 3SUOA 2XO7A 2CGJA 2RE2A 3JS6A 4MLHA 4CVNE 4WQ4C 1NGHA 3DMJA 4C1NK 4DR1K 1LWFA 3AO2A 4CEQA 2YCHA 4RWTA 3UE5A 2YKNA 1NK5A 4C8OA 2D0OA 2ZJQL 3CD6N 4I9QA 2WBNA 1SS6A 1NKBA 2HVHA 3CETA 4CZJA 3R1XA 1HKCA 1SKRA 3CFPA 3P83D 3WUHA 2HHXA 1GLAG 4CZIA 3TAMA 1WBBA 3FZMA 3J8AA 2NLXA 2VGMA 3A0IX 2YHAA 1KSPA 4W5NA 2G8FA 4B8AB 1GLLO 3THWB 1TGOA 3CCEN 3CCJN 4DMNA 1LV5A 1Z25A 2P9KB 1JLCA 2E88A 2HMPA 4ILGB 4IOCL 4FOEA 2UXCK 3TAGA 2ZGYA 4B3TK 3VQAA 4DFKA 1YTUA 2QW9A 4EZ6A 1RT7A 5AQHA 1FKPA 5M1KA 4JRPA 4C8LA 4LF8K 2P9UA 1VQPN 1HPZA 1NK6A 5BPNA 3L2WA 1JLBA 4W5OA 2KFZA 3C94A 1ZBIA 4H4MA 3FFKB 2YHXA 4AM6A 3WXMB 1MU2A 3L2RA 1VQKN 1NM1A 3GOIA 4FLTA 1Q9YA 3E9OA 3PY8A 1I3AA 4JKGB 4PQUA 3OW2M 4FWPA 3SYZA 1KRPA 3LDQA 2OZSA 4MO4A 3QB0A 5M1OA 4YDUC 4B3MK 2HBJA 3IDHA 1BUPA 1NWKA 4DF4A 3U4LA 1WSIA 1QSYA 1YF5L 5KGWA 2O4GA 3VGKA 2JWLA 4OVLA 2HF3A 3ZSXA 3UKRB 1GOAA 3TTCA 3CCSN 4JI4K 4KHPK 4BDYA 4YORA 1VSMA 4CGHA 1C1AA 1WBDA 3SAGA 3THYB 1N34K 2ASPA 2OPRA 5K14A 3NCIA 3KVGA 2Q36A 4EP5A 3VA3A 4DTRA 3HT3A 4Q0BA 3A5NC 2OPQA 1TKDA 1NJZA 1SL2A 1LW0A 1S1TA 4A57A 3SV4A 1XMQK 4LF9K 4C23A 3M8QA 2G8UA 1RGIA 4CJLA 1JXBA 1HYVA 1REVA 2P5OA 3VQEA 4BDZA 2O8DB 4KB0A 3KTQA 1D5AA 4AHSA 4JKAA 2UXDK 4FJ8A 3NVMA 3DRRA 3LWMA 3KK3A 1CXQA 2ASMA 2QWNA 4FJIA 1VAZA 2E2QA 4DQRA 3WEEB 3OTOK 2BTFA 1CXUA 3P1GA 3S3OA 2Z1IA 5H1SQ 4FLVA 3OS2A 1T6DA 4Z4FA 4KKOA 2I7NA 2VQFK 5AQMA 1VSDA 1HMVA 3NHGA 1Z26A 4R79A 2A6AA 4BE1A 1U49A 3G25A 2V52B 1GOBA 1BO5O 1JCFA 4CZLA 2WFBA 1I39A 1QHTA 4O8UA 4CJSA 4AF1A 3MDQA 1O1WA 3B6PA 3AVFA 4RW9A 3OYDA 3AAQA 1IG9A 3THVA 1NGFA 1RDAA 3Q7BA 4CEOA 2OTLN 1JCGA 1LW2A 1UAXA 4B9LA 1TAUA 2DFHA 4H0XB 1QQNA 4B1WB 3MX5A 3V6DA 3EEQA 3O3FA 2P9UB 1W0HA 1QVGM 4FJ7A 5FPMA 1I94K 1KLNA 1TVRA 4XEIA 4M3TA 4OGEA 3K58A 4HUEA 3DM2A 4M7YA 4K41A 3J7AP 1TUYA 5JLFA 3QO9A 2FBXA 3CQYA 2CGLA 4BRMA 1LWCA 2NRHA 2WC9A 3AA2A 1KVAA 4AM7A 3IKMA 2ZJRL 3LP1A 3RR7A 3TI0A 5C2DA 4A5BA 3ZX3A 3JYTA 4MQ3A 2Z1JA 4M45A 4CJKA 1B9DA 3KWGA 3LZJA 2HHHK 2HNZA 3J80O 4CF8A 5HROA 1XNQK 4NCBA 3KK7A 3KKSA 4KHQA 4ISEA 2OPSA 3SLCA 3I55N 3LP3A 1G99A 1QQMA 3CJCA 2A5XA 2E2PA 4JRQA 5JICA 3MXJA 3FE1A 4A59A 4JHDA 1HYSA 3U6FA 3NF7A 2O4IA 4FLZA 4X65K 1WNSA 3ENOA 1T6CA 2ITMA 1N5YA 2QXLA 2FSJA 3VEZA 1YI2N 2HHUA 4FJ9A 4QS9A 4E7JA 4DR4K 3L4QA 3CPWM 3H3NO 3C7NA 1JLGA 4YOUA 1N36K 3LDOA 3V9XA 4BRKA 3R3LA 3DXKA 4DV2K 3ZT2A 4IKFA 1L3SA 3FGUA 1EWRA 4FJGA 3VF6A 1YHQN 2UXBK 1JL2A 2RHKA 4DR6K 2QWMA 4HHTA 1DTTA 3M6GA 1KFSA 4B9SA 3NBPA 1ZXOA 5AQZA 3OYJA 2IOCA 4B1VA 3FFIA 3ZT4A 1U47A 2X74A 4O8KA 5GIPA 3QETA 4I2PA 1NBWA 2Q3SA 3WQTA 3MEEA 1KLMA 1HPMA 3GG4A 4I2QA 4BR5A 4FK2A 5D3GA 4Z4CA 4KFBA 3AAPA 2G8KA 2O8EA 2QA4N 1TL1A 4O0IA 3CM5A 4G9ZA 1X3MA 1NGGA 2BGGA 3KIOA 1B92A 2A41A 3O9QA 1D4XA 5EOYA 3TARA 4BVPA 1NU0A 2E1YA 1UA0A 4DV5K 3VQQA 2BE2A 5IWAK 1XWLA 4IO8A 5FPNA 1YITN 3LDPA 2GUPA 3F73A 1T7PA 3I8DA 5F1XA 3BZCA 4M63C 1ATSA 4MDAA 3SK3A 1X9JA 1BIUA 4PHTX 5I9EB 1NNEA 2GWJA 3D2FB 4CHOA 1GLFO 3QBXA 5LY3A 1RT4A 4Y0WA 3VQ4A 4LY7A 5KGXA 3K5MA 2O8CA 3NF9A 3O3HA 1IKVA 3WT0A 4M3YA 4CIGA 1NJWA 1QHAA 5M1QA 3KLHA 1RBUA 2G8VA 2YNHA 3B8AX 3HPHA 3TR8A 1BDGA 3KLFA 2GTDA 5J1EA 2GV9A 2W6LA 4CZFA 1BA1A 4XIUA 4DTSA 4LC9B 3NH2A 3E9PA 1VHXA 1HX1A 3ID8A 1C1CA 4FM1A 1T05A 1OVYA 4M3RA 3LM9A 4OGCA 1RDUA 3MWTA 3HVRA 2CH5A 3F9MA 4OPHA 4CGJA 3VQ8A 4DFMA 3P31A 2QK9A 4CF0A 1NGCA 4IOAL 5AQWA 4EIAA 4H4OA 3P39A 4GNIA 4J8FA 1FXXA 5JS2A 4CIEA 3DLBA 1VSFA 3L2UA 4KO0A 3RMCA 1A5VA 1EKEA 4AHCA 1T3VA 3K9JA 2G8IA 3ENBA 5CHIA 3LANA 1ATNA 1TYQB 1KFDA 4C8MA 4BRDA 3OVNA 1S9EA 2KLAA 5FLXO 2GX9A 3J81O 1EQYA 2E2OA 1J9AA 4DV7K 4C8KA 4LSNA 3D2EB 4W5TA 1NOYA 5HP1A 1K8KB 4Q5VA 3K5LA 2X6NA 3VA0A 3M3ZA 4B1YB 1LAVA 4KV8A 4IEEA 3AY9A 3QFPA 4L8RB 4WFAL 4EHTA 2KZZA 1XC9A 3LPUA 3CMAN 2YX6A 4BQZA 3TTDA 2ASOA 4KHNA 1S6PA 3GL1A 4CESA 2P5GA 3ZSYA 2XRIA 2OZMA 3DLEA 4EHUA 4JI7K 4BACA 3LWLA 4XH1A 4FCYA 3TU5A 3RVCA 5C42A 2IS3A 4QS7A 5J2NA 4CHYA 3AA4A 2Q97A 4H5TA 2KQ2A 4HUFA 4FJMA 4BC4A 3WNGA 5FRNA 3O1WA 1JJ2M 5C2FA 3HXMA 3DLHA 1IKYA 1RTJA 4W5RA 4FM0A 1NMNA 2P1JA 2WUSA 2YJEA 3OBYA 1X9SA 5EU7A 1Q9XA 1VQ8N 4CIFA 5BPLA 2QKKA 4H0PA 4BR2A 4NLBA 1BL3A 5DK5A 3ZX0A 1T8EA 1MWMA 2ZGZA 3DLGA 5F2RA 4RW7A 3KKRA 3C6AA 2QWPA 1NK9A 2VYPA 3KLGA 1YVUA 4KH4A 3MN7A 4BRNA 5C25A 3TAQA 2HBKA 4NXMK 4BRCA 3QEPA 4GV6A 4A2AA 2F7TA 3V9SA 2HHTA 1DKGD 4FWLA 1K73O 3J7YP 1DGKN 5EXWA 2YNGA 5E41A 4CBXA 4EZ9A 3WXJA 1S5JA 1QQCA 3I8BA 1WSGA 4CGIA 4Z4HA 2W40A 5SZTA 3AVGA 1NJIO 1S6QA 4PL8A 3SJHA 1KTQA 2XY5A 4BR4A 1VSIA 2A40A 3PX0A 4CF2A 4ZTJA 1RFQA 4KH5A 3QERA 2Y1IA 1CZBA 2A3ZA 1XMOK 1RTIA 4ICLA 5J2MA 3VGMA 2NRRA 1J6ZA 3H1QA 4DLEA 4FWKA 1QS4A 2P9IA 4BRIA 4B9UA 2P9SB 1LCUA 4WQ5A 4M41A 3RTVA 2ATQA 3HM8A 2E20A 1DEJA 1WLJA 3T3FA 2CH6A 5AQRA 1YVNA 4FOIA 4JK8A 1L3TA 4FW1A 3ZSRA 4B8CA 4CJWA 4N41A 3E1YA 3GE1A 3F5TA 1GLDG 1C0UA 1L3VA 4B3RK 3NDKA 4GKKK 4JS5A 5JVHL 3EZ5A 3EY1A 4IWVA 3W0LA 2RF2A 1NGJA 3E66A 4CFBA 5HBMA 5AZJA 4DQIA 5KI6A 4CJRA 4O55A 3O4QA 5TKYA 5AQXA 2HHVA 1QSSA 4FLXA 1SAZA 4DV4K 5HRRA 4DG1A 1W9HA 5BR8K 3ZEUB 4B9QA 3DOKA 4I6MA 3U8XA 3T69A 2Q1NA 3LP2A 1VQ7N 4PL7A 1S1WA 4LF6K 5BN8A
chains in the Genus database with same CATH topology
1EP4A 4KTQA 4HCCA 2RPIA 1GOBA 3K5OA 1A5XA 3MECA 3QIOA 1TV6A 3S3MA 1DTQA 4CK2A 3RMAA 3CM6A 3PUFA 5HRPA 2KTQA 4E19A 1SKSA 4DSKA 1I39A 1QHTA 4CJSA 4E7HA 5HLFA 2VG7A 1O1WA 3B6PA 3O4NA 3AVFA 2F96A 1IH7A 2ZE2A 4RW6A 4RW9A 3OYDA 2PYLA 2XY8A 3DOLA 1IG9A 1J53A 1F21A 4FLWA 3THVA 2A1SA 1RDAA 4R5PA 4LD0A 4PA1A 1VSKA 1ZBHA 4CEOA 3QEXA 3RMBA 1LW2A 2EX3A 1UAXA 2DFEA 4I7FA 4B9LA 3ZCMA 3VQBA 1TAUA 2DFHA 4CHZA 2AJQA 2Y1JA 4J2AA 3VQCA 3VQ7A 4AHTA 1TL3A 4F2SA 1SV5A 4ZHRA 3V6DA 3K5NA 3SV3A 4J2DA 4MFBA 3O3FA 4DSJA 4CF1A 4F3TA 3U3GA 2OA8A 1W0HA 1N6QA 4FJ7A 2RKIA 4FJLA 1KLNA 1TVRA 3SQ2A 4M3TA 3HP6A 4OGEA 3AA5X 1NJYA 3K58A 2YNIA 4IG3A 4DTOA 2JLEA 4HUEA 3DM2A 4DSIA 4EP4A 3QNNA 2XY7A 1U4BA 1BQNA 4UQGA 1Q8IA 3QO9A 3LAMA 5C24A 4NCGA 2YHBA 4CEDA 1RT6A 3L3UA 1NOZA 4DQQA 2FBXA 2JGUA 5J2PA 1LWCA 4DTJA 3AA2A 2RN2A 1KVAA 3HM9A 4QCLA 2GUIA 2F8TA 3ZSVA 1VSEA 4DTPA 2A1RA 4FLYA 3LP1A 4OKJA 4AHRA 2Z1HA 4Z4GA 3RR7A 3TI0A 3IS9A 4RW8A 4Y1CA 3JYTA 4MQ3A 2B5JA 1VSHA 2Z1JA 1B9DA 3AO5A 3KLIA 4M45A 4CJKA 1RNHA 3LZJA 1NK8A 1S1UA 1NK0A 1VRTA 1WSJA 3CQ8A 2HNZA 4IG0A 1BCMA 4CF8A 3AA3A 4DS5A 3QESA 5HROA 4NCBA 4KI6A 4DWIA 1CLQA 1JLEA 2B6AA 3KKSA 1ZBLA 4KHQA 2OPSA 4QOZB 3QIPA 3OYAA 2VG5A 2YNFA 3VQDA 2PZSA 5DMRA 3RRHA 3LDSA 3LP3A 2VWJA 1TK8A 3T1AA 1RTHA 2D5RA 4KHSA 3K57A 4BE2A 2LSNA 3V9ZA 1JXEA 4ZTFA 1EX4A 4RG8A 1VK0A 4CGGA 4JRQA 3MXJA 2IDOA 4JS4A 4E7IA 3IAYA 2KFNA 4CEEA 2HB5A 1HYSA 4FJNA 3NAEA 3U6FA 3NF7A 2O4IA 3OY9A 4FLZA 3F9KA 4FXDA 4KREA 4N47A 3OS1A 1WNSA 4GVMA 4CJ3A 4N76A 3ZSZA 1WSEA 1N5YA 1GOCA 3L2VA 1S1VA 3WNEA 3C6TA 1BIZA 5CY4A 2WOMA 1UA1A 3PO4A 4AHUA 2HHUA 4FJ9A 4FJXA 4IFVA 4B9NA 4E7JA 4NYNA 1RBRA 3DRSA 4CHQA 1NK7A 1BQMA 2I5JA 3VQ9A 3SZ2A 3RRGA 1JLGA 4WE1A 3MXIA 3HSTB 2G8HA 4B9TA 3SNNA 2HHWA 4DTMA 3V81A 3V9XA 1RDCA 3SQ1A 3OYBA 3SUNA 2IC3A 3ZT2A 1D9DA 4ELVA 1L3SA 2GBZA 4IKFA 3TAPA 4CFDA 2X6SA 3TAEA 3ZT1A 4FJGA 2FC0A 4Y1DA 1JL1A 1VRUA 1JL2A 4OLAA 1X9WA 1YTAA 1DTTA 2ZQBA 4HHTA 1KFSA 4O0JA 3SUQA 4E0DA 3WNHA 4B9SA 2HHQA 4F8RA 1TK5A 3NBPA 3OYJA 3AVLA 3BGRA 3RMDA 4FM2A 3SPZA 2IOCA 3AVJA 3FFIA 4B9MA 2HNDA 1BI4A 3ZT4A 1U47A 2X74A 3OYKA 2HVIA 4NCAA 3C95A 4M3UA 4ID1A 4I2PA 3QETA 4O5BA 4FZYA 4CECA 4DFPA 2Q3SA 3D45A 3SQ4A 3MEEA 1KLMA 3NGYA 3NGIA 4I2QA 4BWJA 3HPOA 4FK2A 4OPKA 5D3GA 1IKWA 4KFBA 4Z4CA 4YNQA 1BHLA 4CJUA 2G8KA 3E01A 4CE9A 4LSLA 4F3OA 1TL1A 4O0IA 4PY5A 3CM5A 4CHNA 4DSLA 4HTUA 2BGGA 3S9HA 1WSHA 3KIOA 3QEIA 1B92A 1NJXA 3TARA 4CEFA 3PV8A 1X9MA 4IDKA 1UA0A 4FVMA 3VQQA 1HJRA 2BE2A 2QXFA 1C0TA 3V9UA 1RBSA 1XWLA 1TK0A 5FRMA 2PYJA 3A2FA 4ELTA 2YKMA 4CK1A 3F73A 4DFJA 1J54A 1T7PA 3I8DA 1VSJA 2ITGA 4M3XA 1RTDA 3OYMA 1JKHA 3L3VA 1BIUA 2F8SA 3DI6A 3T19A 3SJJA 1SUQA 1ZBUA 4E1NA 4B9VA 1C0MA 4IBNA 5SWMA 4CHOA 1RT1A 4CJ4A 2BDPA 1RT4A 3MEGA 3VQ4A 1BCOA 1WN7A 2IAJA 4LY7A 5KGXA 3K5MA 3LP0A 4DTUA 1S1XA 3NF9A 4FZZA 4FZXC 3O3HA 4F2RA 1IKVA 4M3YA 3LPTA 4CIGA 3EYZA 5I42A 1NJWA 2WONA 3JSMA 3KLHA 1RBUA 3NF8A 1B9FA 2G8VA 1KVCA 2PY5A 2X78A 1TAQA 1RDDA 3SI6A 3HK2A 2VWKA 1C6VA 2YNHA 3AVHA 4O4GA 3O3GA 1S9GA 3HPHA 4CFAA 3QLHA 3TR8A 3TWHA 3DLKA 1U04A 2YV0X 3OJSA 4AHVA 3KLFA 3ZT3A 4OPJA 1BISA 2HNYA 5J1EA 3V1OA 4CJEA 2GV9A 4OKEA 1RCHA 1RILA 2DFFA 4XIUA 4DTSA 4KTWA 2G8WA 1Y97A 3QEVA 1NK4A 4CEAA 4QAGA 3NH2A 3I0SA 2W42A 4E3SA 3NFAA 4CF9A 3OYLA 2KZMA 3LAKA 1C1CA 4CGFA 3DRPA 4FM1A 1T05A 1QTMA 4K8ZA 4M3RA 4DSEA 1YT3A 4OGCA 3MXMA 3HVRA 2DY4A 2D0BA 3TABA 4BE0A 5CYMA 3K2PA 4ELUA 4CGJA 3VQ8A 4B08A 4DFMA 4PWDA 3V4IA 4HVJA 3AVCA 2QK9A 4CGDA 4CF0A 2P51A 3AVMA 5KRSA 3AO1A 5HRSA 1D8YA 4H4OA 3VQ6A 3ISNC 4DS4A 1FK9A 4DF8A 1FXXA 3DYAA 5JS2A 4CIEA 4KB1A 3DLBA 3OJUA 1XHXA 2BANA 5CZ2A 1VSFA 4BWMA 3L2UA 4KO0A 3RMCA 1A5VA 1EKEA 4FJJA 4CJVA 1RT2A 4O44A 4YFUA 3C6UA 4JLHA 1IO2A 3CFOA 4IFYA 4AHCA 4Z0UA 3U3YA 1R0AA 4DQPA 4FJHA 4FW2A 3OS0A 4OLBA 2G8IA 2OPPA 3HVTA 1RBTA 3LANA 3HJFA 3V1QA 1KFDA 1TKXA 3HP9A 4DLGA 3SUOA 5KTQA 3TANA 4C8MA 2XO7A 3OVNA 3K59A 1L3UA 3DMJA 4KI4A 1S9EA 4FJKA 1G15A 5KRTA 4HUGA 1LWFA 3AO2A 4CEQA 5CZ1A 1C1BA 3CYMA 3AVIA 1J5OA 1RDBA 1J9AA 1KCFA 3CG7A 2HMIA 4C8KA 1HQUA 2YKNA 1NK5A 5J2QA 4LSNA 1NOYA 4W5TA 4C8OA 5HP1A 4H8KA 4Q5VA 4N5SA 4I9QA 4FJ5A 4TSXA 1LAWA 4M42A 3RR8A 3K5LA 1NKBA 2HVHA 1SL0A 1SL1A 4N56A 1RT3A 2X6NA 3NE6A 2QKBA 3VA0A 1L5UA 3LZIA 3PX6A 1LAVA 1JLAA 4KV8A 2OYQA 1SKRA 3CFPA 1ITGA 4L8RB 3P83D 2HHXA 3UIQA 3TAMA 1UWBA 2KZZA 3CFRA 1ASVA 1XC9A 3LPUA 5I3UA 4KHUA 1UOCA 3OYCA 2YHAA 1KSPA 4W5NA 3ALYA 4KHNA 1RBVA 1S6PA 2EHGA 4B8AB 4CESA 2G8FA 3ZSYA 2P5GA 3M8PA 2XRIA 3NH1A 2OZMA 4E1MA 3DLEA 1TGOA 4KHWA 4DMNA 1LV5A 1TKTA 1Z25A 1JLCA 3P5JA 1DLOA 4BACA 2IGIA 3LWLA 3ITHA 4FCYA 3TAGA 5C42A 3IG1A 3VQAA 1KVBA 3ZSQA 4DFKA 1YTUA 2IS3A 4EZ6A 5J2NA 1RT7A 4CHYA 3AA4A 4CK3A 1EETA 1FKPA 4JRPA 3ULDA 4DTXA 3V9WA 2KQ2A 4HUFA 4FJMA 4DQSA 4C8LA 4PUOA 3I0RA 3WNGA 5FRNA 1NK6A 1HPZA 3SCXA 4I9LA 3MAQA 3L2WA 4C8NA 1JLBA 4W5OA 3HXMA 4F4KA 2KFZA 3C94A 1ZBIA 1K6YA 1IKYA 1RTJA 2E6MA 4H4MA 4W5RA 2FBYA 3KJVA 4FM0A 3DLHA 4KRFA 2P1JA 4DSFA 3DLRA 1X9SA 2FBTA 5EU7A 1Q9XA 3ZSOA 4E7LA 3LALA 1QE1A 4CIFA 3OYFA 1MU2A 3M8SA 3L2RA 3ZT0A 1QSLA 2XHBA 2QKKA 1HNIA 2DTUA 4W5QA 1BL3A 4FLTA 5DK5A 1WSFA 1Q9YA 1ASUA 3AV9A 4CERA 1T8EA 3DLGA 3PY8A 1I3AA 3RWUA 4CHPA 4GMJB 3HYFA 4B3OA 3V1RA 4RW7A 4PQUA 3KKRA 1NK9A 3SYZA 1KRPA 1FKOA 1HNVA 3KLGA 4CFCA 1YVUA 3NGZA 4CEBA 2OZSA 1HYZA 5C25A 3TAQA 3SQ0A 3QEPA 4CJ5A 3WNFA 3AVBA 2HHSA 4FK0A 1HQEA 1WAFA 3V9SA 3G0ZA 4DF4A 5HRNA 2HHTA 1WSIA 1QSYA 3SPYA 4LH5A 4KAZA 1VSLA 1A5WA 2YNGA 4LH4A 4Z4IA 1ZBFA 5E41A 3OYNA 3L2QA 5KGWA 4E89A 1NKCA 3AO4A 4EZ9A 4FLUA 2O4GA 1S5JA 2ETJA 1U49A 1QQCA 4OVLA 1WSGA 3ZSXA 4CGIA 4Z4HA 4J2BA 1GOAA 3QINA 5SZTA 3AVGA 4BDYA 1S6QA 1XI1A 1VSMA 4CGHA 1C1AA 4J2EA 1NKEA 1KTQA 4DU3A 4NYFA 2D0CA 1SKWA 4HCBA 2HW3A 2OPRA 4CJFA 2XY5A 4M3ZA 5CYQA 5K14A 4AH9A 3B6OA 1WAJA 3MEDA 3KK1A 3NCIA 3VQPA 1VSIA 3HPGA 5T7BA 3SUPA 1TKZA 2NUBA 1CZ9A 1JLFA 4EP5A 3VA3A 4DTRA 4CF2A 3HT3A 3PX0A 4ZTJA 1JLQA 4Q0BA 2OPQA 3OYHA 4OJRA 3VQ5A 4CJTA 1TKDA 1NJZA 1SL2A 1LW0A 1S1TA 3SV4A 3QERA 1CZBA 2Y1IA 4CCHA 1RTIA 4ICLA 4DU4A 5J2MA 4DLEA 1HRHA 1ZYQA 1QS4A 3PO5A 4B9UA 4AILC 3M8QA 2E4LA 3KLEA 2XY6A 3HL8A 3D0PA 2G8UA 4G1QA 4M41A 4CJQA 4CJLA 3RTVA 1JXBA 2ATQA 1HYVA 1ASWA 1REVA 4KTZA 4DTNA 3BDPA 2P5OA 3VQEA 1WLJA 3T3FA 4BDZA 4KB0A 3KTQA 1D5AA 3AO3A 1IKXA 3NF6A 4M3WA 1L3TA 4FW1A 3VN5A 3ZSRA 3AVNA 4AHSA 4K8XA 2FBVA 4B8CA 4CJWA 4N41A 3H08A 3HO1A 1C0UA 3IRXA 2R7YA 4DU1A 3NDKA 1L3VA 4E7KA 4FJ8A 4KHYA 3M8RA 4JS5A 4GW6A 3DRRA 4CEZA 3EZ5A 3EY1A 2Z1GA 3OYEA 3LWMA 3KK3A 2RF2A 1CXQA 2D0AA 4FK4A 3QNOA 3AVAA 4FJIA 2B4JA 3G10A 5HBMA 4CFBA 4DQRA 4DQIA 5KI6A 3KD5E 3KD1E 4BDPA 4RW4A 3L8BA 1CXUA 3ASMA 3P1GA 3OYGA 4CJRA 3S3OA 2HHVA 2Z1IA 1XHZA 4O55A 3O4QA 1LWEA 5FROA 3OS2A 2E6LA 4FLVA 3TAFA 3S3NA 2VG6A 4ID5A 4FLXA 1RT5A 4KKOA 1QSSA 3QEWA 3AVKA 4Z4FA 1T03A 1EXQA 1X1PA 5FDLA 5HRRA 4DG1A 1W9HA 1VSDA 4CJPA 1D9FA 4FYDA 1HMVA 3DOKA 4OKKA 3NHGA 1Z26A 1U48A 3KK2A 3ZSWA 3OYIA 4Z4EA 2ZD1A 1BGXT 1BI4B 3NH0A 4KPYA 5JS1A 3LP2A 1U45A 1S1WA 4BE1A 3PX4A 2KW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EP4 A;  4KTQ A;  4HCC A;  2RPI A;  1GOB A;  3K5O A;  1A5X A;  3MEC A;  3QIO A;  1TV6 A;  3S3M A;  1DTQ A;  4CK2 A;  3RMA A;  3CM6 A;  3PUF A;  5HRP A;  2KTQ A;  4E19 A;  1SKS A;  4DSK A;  1I39 A;  1QHT A;  4CJS A;  4E7H A;  5HLF A;  2VG7 A;  1O1W A;  3B6P A;  3O4N A;  3AVF A;  2F96 A;  1IH7 A;  2ZE2 A;  4RW6 A;  4RW9 A;  3OYD A;  2PYL A;  2XY8 A;  3DOL A;  1IG9 A;  1J53 A;  1F21 A;  4FLW A;  3THV A;  2A1S A;  1RDA A;  4R5P A;  4LD0 A;  4PA1 A;  1VSK A;  1ZBH A;  4CEO A;  3QEX A;  3RMB A;  1LW2 A;  2EX3 A;  1UAX A;  2DFE A;  4I7F A;  4B9L A;  3ZCM A;  3VQB A;  1TAU A;  2DFH A;  4CHZ A;  2AJQ A;  2Y1J A;  4J2A A;  3VQC A;  3VQ7 A;  4AHT A;  1TL3 A;  4F2S A;  1SV5 A;  4ZHR A;  3V6D A;  3K5N A;  3SV3 A;  4J2D A;  4MFB A;  3O3F A;  4DSJ A;  4CF1 A;  4F3T A;  3U3G A;  2OA8 A;  1W0H A;  1N6Q A;  4FJ7 A;  2RKI A;  4FJL A;  1KLN A;  1TVR A;  3SQ2 A;  4M3T A;  3HP6 A;  4OGE A;  3AA5 X;  1NJY A;  3K58 A;  2YNI A;  4IG3 A;  4DTO A;  2JLE A;  4HUE A;  3DM2 A;  4DSI A;  4EP4 A;  3QNN A;  2XY7 A;  1U4B A;  1BQN A;  4UQG A;  1Q8I A;  3QO9 A;  3LAM A;  5C24 A;  4NCG A;  2YHB A;  4CED A;  1RT6 A;  3L3U A;  1NOZ A;  4DQQ A;  2FBX A;  2JGU A;  5J2P A;  1LWC A;  4DTJ A;  3AA2 A;  2RN2 A;  1KVA A;  3HM9 A;  4QCL A;  2GUI A;  2F8T A;  3ZSV A;  1VSE A;  4DTP A;  2A1R A;  4FLY A;  3LP1 A;  4OKJ A;  4AHR A;  2Z1H A;  4Z4G A;  3RR7 A;  3TI0 A;  3IS9 A;  4RW8 A;  4Y1C A;  3JYT A;  4MQ3 A;  2B5J A;  1VSH A;  2Z1J A;  1B9D A;  3AO5 A;  3KLI A;  4M45 A;  4CJK A;  1RNH A;  3LZJ A;  1NK8 A;  1S1U A;  1NK0 A;  1VRT A;  1WSJ A;  3CQ8 A;  2HNZ A;  4IG0 A;  1BCM A;  4CF8 A;  3AA3 A;  4DS5 A;  3QES A;  5HRO A;  4NCB A;  4KI6 A;  4DWI A;  1CLQ A;  1JLE A;  2B6A A;  3KKS A;  1ZBL A;  4KHQ A;  2OPS A;  4QOZ B;  3QIP A;  3OYA A;  2VG5 A;  2YNF A;  3VQD A;  2PZS A;  5DMR A;  3RRH A;  3LDS A;  3LP3 A;  2VWJ A;  1TK8 A;  3T1A A;  1RTH A;  2D5R A;  4KHS A;  3K57 A;  4BE2 A;  2LSN A;  3V9Z A;  1JXE A;  4ZTF A;  1EX4 A;  4RG8 A;  1VK0 A;  4CGG A;  4JRQ A;  3MXJ A;  2IDO A;  4JS4 A;  4E7I A;  3IAY A;  2KFN A;  4CEE A;  2HB5 A;  1HYS A;  4FJN A;  3NAE A;  3U6F A;  3NF7 A;  2O4I A;  3OY9 A;  4FLZ A;  3F9K A;  4FXD A;  4KRE A;  4N47 A;  3OS1 A;  1WNS A;  4GVM A;  4CJ3 A;  4N76 A;  3ZSZ A;  1WSE A;  1N5Y A;  1GOC A;  3L2V A;  1S1V A;  3WNE A;  3C6T A;  1BIZ A;  5CY4 A;  2WOM A;  1UA1 A;  3PO4 A;  4AHU A;  2HHU A;  4FJ9 A;  4FJX A;  4IFV A;  4B9N A;  4E7J A;  4NYN A;  1RBR A;  3DRS A;  4CHQ A;  1NK7 A;  1BQM A;  2I5J A;  3VQ9 A;  3SZ2 A;  3RRG A;  1JLG A;  4WE1 A;  3MXI A;  3HST B;  2G8H A;  4B9T A;  3SNN A;  2HHW A;  4DTM A;  3V81 A;  3V9X A;  1RDC A;  3SQ1 A;  3OYB A;  3SUN A;  2IC3 A;  3ZT2 A;  1D9D A;  4ELV A;  1L3S A;  2GBZ A;  4IKF A;  3TAP A;  4CFD A;  2X6S A;  3TAE A;  3ZT1 A;  4FJG A;  2FC0 A;  4Y1D A;  1JL1 A;  1VRU A;  1JL2 A;  4OLA A;  1X9W A;  1YTA A;  1DTT A;  2ZQB A;  4HHT A;  1KFS A;  4O0J A;  3SUQ A;  4E0D A;  3WNH A;  4B9S A;  2HHQ A;  4F8R A;  1TK5 A;  3NBP A;  3OYJ A;  3AVL A;  3BGR A;  3RMD A;  4FM2 A;  3SPZ A;  2IOC A;  3AVJ A;  3FFI A;  4B9M A;  2HND A;  1BI4 A;  3ZT4 A;  1U47 A;  2X74 A;  3OYK A;  2HVI A;  4NCA A;  3C95 A;  4M3U A;  4ID1 A;  4I2P A;  3QET A;  4O5B A;  4FZY A;  4CEC A;  4DFP A;  2Q3S A;  3D45 A;  3SQ4 A;  3MEE A;  1KLM A;  3NGY A;  3NGI A;  4I2Q A;  4BWJ A;  3HPO A;  4FK2 A;  4OPK A;  5D3G A;  1IKW A;  4KFB A;  4Z4C A;  4YNQ A;  1BHL A;  4CJU A;  2G8K A;  3E01 A;  4CE9 A;  4LSL A;  4F3O A;  1TL1 A;  4O0I A;  4PY5 A;  3CM5 A;  4CHN A;  4DSL A;  4HTU A;  2BGG A;  3S9H A;  1WSH A;  3KIO A;  3QEI A;  1B92 A;  1NJX A;  3TAR A;  4CEF A;  3PV8 A;  1X9M A;  4IDK A;  1UA0 A;  4FVM A;  3VQQ A;  1HJR A;  2BE2 A;  2QXF A;  1C0T A;  3V9U A;  1RBS A;  1XWL A;  1TK0 A;  5FRM A;  2PYJ A;  3A2F A;  4ELT A;  2YKM A;  4CK1 A;  3F73 A;  4DFJ A;  1J54 A;  1T7P A;  3I8D A;  1VSJ A;  2ITG A;  4M3X A;  1RTD A;  3OYM A;  1JKH A;  3L3V A;  1BIU A;  2F8S A;  3DI6 A;  3T19 A;  3SJJ A;  1SUQ A;  1ZBU A;  4E1N A;  4B9V A;  1C0M A;  4IBN A;  5SWM A;  4CHO A;  1RT1 A;  4CJ4 A;  2BDP A;  1RT4 A;  3MEG A;  3VQ4 A;  1BCO A;  1WN7 A;  2IAJ A;  4LY7 A;  5KGX A;  3K5M A;  3LP0 A;  4DTU A;  1S1X A;  3NF9 A;  4FZZ A;  4FZX C;  3O3H A;  4F2R A;  1IKV A;  4M3Y A;  3LPT A;  4CIG A;  3EYZ A;  5I42 A;  1NJW A;  2WON A;  3JSM A;  3KLH A;  1RBU A;  3NF8 A;  1B9F A;  2G8V A;  1KVC A;  2PY5 A;  2X78 A;  1TAQ A;  1RDD A;  3SI6 A;  3HK2 A;  2VWK A;  1C6V A;  2YNH A;  3AVH A;  4O4G A;  3O3G A;  1S9G A;  3HPH A;  4CFA A;  3QLH A;  3TR8 A;  3TWH A;  3DLK A;  1U04 A;  2YV0 X;  3OJS A;  4AHV A;  3KLF A;  3ZT3 A;  4OPJ A;  1BIS A;  2HNY A;  5J1E A;  3V1O A;  4CJE A;  2GV9 A;  4OKE A;  1RCH A;  1RIL A;  2DFF A;  4XIU A;  4DTS A;  4KTW A;  2G8W A;  1Y97 A;  3QEV A;  1NK4 A;  4CEA A;  4QAG A;  3NH2 A;  3I0S A;  2W42 A;  4E3S A;  3NFA A;  4CF9 A;  3OYL A;  2KZM A;  3LAK A;  1C1C A;  4CGF A;  3DRP A;  4FM1 A;  1T05 A;  1QTM A;  4K8Z A;  4M3R A;  4DSE A;  1YT3 A;  4OGC A;  3MXM A;  3HVR A;  2DY4 A;  2D0B A;  3TAB A;  4BE0 A;  5CYM A;  3K2P A;  4ELU A;  4CGJ A;  3VQ8 A;  4B08 A;  4DFM A;  4PWD A;  3V4I A;  4HVJ A;  3AVC A;  2QK9 A;  4CGD A;  4CF0 A;  2P51 A;  3AVM A;  5KRS A;  3AO1 A;  5HRS A;  1D8Y A;  4H4O A;  3VQ6 A;  3ISN C;  4DS4 A;  1FK9 A;  4DF8 A;  1FXX A;  3DYA A;  5JS2 A;  4CIE A;  4KB1 A;  3DLB A;  3OJU A;  1XHX A;  2BAN A;  5CZ2 A;  1VSF A;  4BWM A;  3L2U A;  4KO0 A;  3RMC A;  1A5V A;  1EKE A;  4FJJ A;  4CJV A;  1RT2 A;  4O44 A;  4YFU A;  3C6U A;  4JLH A;  1IO2 A;  3CFO A;  4IFY A;  4AHC A;  4Z0U A;  3U3Y A;  1R0A A;  4DQP A;  4FJH A;  4FW2 A;  3OS0 A;  4OLB A;  2G8I A;  2OPP A;  3HVT A;  1RBT A;  3LAN A;  3HJF A;  3V1Q A;  1KFD A;  1TKX A;  3HP9 A;  4DLG A;  3SUO A;  5KTQ A;  3TAN A;  4C8M A;  2XO7 A;  3OVN A;  3K59 A;  1L3U A;  3DMJ A;  4KI4 A;  1S9E A;  4FJK A;  1G15 A;  5KRT A;  4HUG A;  1LWF A;  3AO2 A;  4CEQ A;  5CZ1 A;  1C1B A;  3CYM A;  3AVI A;  1J5O A;  1RDB A;  1J9A A;  1KCF A;  3CG7 A;  2HMI A;  4C8K A;  1HQU A;  2YKN A;  1NK5 A;  5J2Q A;  4LSN A;  1NOY A;  4W5T A;  4C8O A;  5HP1 A;  4H8K A;  4Q5V A;  4N5S A;  4I9Q A;  4FJ5 A;  4TSX A;  1LAW A;  4M42 A;  3RR8 A;  3K5L A;  1NKB A;  2HVH A;  1SL0 A;  1SL1 A;  4N56 A;  1RT3 A;  2X6N A;  3NE6 A;  2QKB A;  3VA0 A;  1L5U A;  3LZI A;  3PX6 A;  1LAV A;  1JLA A;  4KV8 A;  2OYQ A;  1SKR A;  3CFP A;  1ITG A;  4L8R B;  3P83 D;  2HHX A;  3UIQ A;  3TAM A;  1UWB A;  2KZZ A;  3CFR A;  1ASV A;  1XC9 A;  3LPU A;  5I3U A;  4KHU A;  1UOC A;  3OYC A;  2YHA A;  1KSP A;  4W5N A;  3ALY A;  4KHN A;  1RBV A;  1S6P A;  2EHG A;  4B8A B;  4CES A;  2G8F A;  3ZSY A;  2P5G A;  3M8P A;  2XRI A;  3NH1 A;  2OZM A;  4E1M A;  3DLE A;  1TGO A;  4KHW A;  4DMN A;  1LV5 A;  1TKT A;  1Z25 A;  1JLC A;  3P5J A;  1DLO A;  4BAC A;  2IGI A;  3LWL A;  3ITH A;  4FCY A;  3TAG A;  5C42 A;  3IG1 A;  3VQA A;  1KVB A;  3ZSQ A;  4DFK A;  1YTU A;  2IS3 A;  4EZ6 A;  5J2N A;  1RT7 A;  4CHY A;  3AA4 A;  4CK3 A;  1EET A;  1FKP A;  4JRP A;  3ULD A;  4DTX A;  3V9W A;  2KQ2 A;  4HUF A;  4FJM A;  4DQS A;  4C8L A;  4PUO A;  3I0R A;  3WNG A;  5FRN A;  1NK6 A;  1HPZ A;  3SCX A;  4I9L A;  3MAQ A;  3L2W A;  4C8N A;  1JLB A;  4W5O A;  3HXM A;  4F4K A;  2KFZ A;  3C94 A;  1ZBI A;  1K6Y A;  1IKY A;  1RTJ A;  2E6M A;  4H4M A;  4W5R A;  2FBY A;  3KJV A;  4FM0 A;  3DLH A;  4KRF A;  2P1J A;  4DSF A;  3DLR A;  1X9S A;  2FBT A;  5EU7 A;  1Q9X A;  3ZSO A;  4E7L A;  3LAL A;  1QE1 A;  4CIF A;  3OYF A;  1MU2 A;  3M8S A;  3L2R A;  3ZT0 A;  1QSL A;  2XHB A;  2QKK A;  1HNI A;  2DTU A;  4W5Q A;  1BL3 A;  4FLT A;  5DK5 A;  1WSF A;  1Q9Y A;  1ASU A;  3AV9 A;  4CER A;  1T8E A;  3DLG A;  3PY8 A;  1I3A A;  3RWU A;  4CHP A;  4GMJ B;  3HYF A;  4B3O A;  3V1R A;  4RW7 A;  4PQU A;  3KKR A;  1NK9 A;  3SYZ A;  1KRP A;  1FKO A;  1HNV A;  3KLG A;  4CFC A;  1YVU A;  3NGZ A;  4CEB A;  2OZS A;  1HYZ A;  5C25 A;  3TAQ A;  3SQ0 A;  3QEP A;  4CJ5 A;  3WNF A;  3AVB A;  2HHS A;  4FK0 A;  1HQE A;  1WAF A;  3V9S A;  3G0Z A;  4DF4 A;  5HRN A;  2HHT A;  1WSI A;  1QSY A;  3SPY A;  4LH5 A;  4KAZ A;  1VSL A;  1A5W A;  2YNG A;  4LH4 A;  4Z4I A;  1ZBF A;  5E41 A;  3OYN A;  3L2Q A;  5KGW A;  4E89 A;  1NKC A;  3AO4 A;  4EZ9 A;  4FLU A;  2O4G A;  1S5J A;  2ETJ A;  1U49 A;  1QQC A;  4OVL A;  1WSG A;  3ZSX A;  4CGI A;  4Z4H A;  4J2B A;  1GOA A;  3QIN A;  5SZT A;  3AVG A;  4BDY A;  1S6Q A;  1XI1 A;  1VSM A;  4CGH A;  1C1A A;  4J2E A;  1NKE A;  1KTQ A;  4DU3 A;  4NYF A;  2D0C A;  1SKW A;  4HCB A;  2HW3 A;  2OPR A;  4CJF A;  2XY5 A;  4M3Z A;  5CYQ A;  5K14 A;  4AH9 A;  3B6O A;  1WAJ A;  3MED A;  3KK1 A;  3NCI A;  3VQP A;  1VSI A;  3HPG A;  5T7B A;  3SUP A;  1TKZ A;  2NUB A;  1CZ9 A;  1JLF A;  4EP5 A;  3VA3 A;  4DTR A;  4CF2 A;  3HT3 A;  3PX0 A;  4ZTJ A;  1JLQ A;  4Q0B A;  2OPQ A;  3OYH A;  4OJR A;  3VQ5 A;  4CJT A;  1TKD A;  1NJZ A;  1SL2 A;  1LW0 A;  1S1T A;  3SV4 A;  3QER A;  1CZB A;  2Y1I A;  4CCH A;  1RTI A;  4ICL A;  4DU4 A;  5J2M A;  4DLE A;  1HRH A;  1ZYQ A;  1QS4 A;  3PO5 A;  4B9U A;  4AIL C;  3M8Q A;  2E4L A;  3KLE A;  2XY6 A;  3HL8 A;  3D0P A;  2G8U A;  4G1Q A;  4M41 A;  4CJQ A;  4CJL A;  3RTV A;  1JXB A;  2ATQ A;  1HYV A;  1ASW A;  1REV A;  4KTZ A;  4DTN A;  3BDP A;  2P5O A;  3VQE A;  1WLJ A;  3T3F A;  4BDZ A;  4KB0 A;  3KTQ A;  1D5A A;  3AO3 A;  1IKX A;  3NF6 A;  4M3W A;  1L3T A;  4FW1 A;  3VN5 A;  3ZSR A;  3AVN A;  4AHS A;  4K8X A;  2FBV A;  4B8C A;  4CJW A;  4N41 A;  3H08 A;  3HO1 A;  1C0U A;  3IRX A;  2R7Y A;  4DU1 A;  3NDK A;  1L3V A;  4E7K A;  4FJ8 A;  4KHY A;  3M8R A;  4JS5 A;  4GW6 A;  3DRR A;  4CEZ A;  3EZ5 A;  3EY1 A;  2Z1G A;  3OYE A;  3LWM A;  3KK3 A;  2RF2 A;  1CXQ A;  2D0A A;  4FK4 A;  3QNO A;  3AVA A;  4FJI A;  2B4J A;  3G10 A;  5HBM A;  4CFB A;  4DQR A;  4DQI A;  5KI6 A;  3KD5 E;  3KD1 E;  4BDP A;  4RW4 A;  3L8B A;  1CXU A;  3ASM A;  3P1G A;  3OYG A;  4CJR A;  3S3O A;  2HHV A;  2Z1I A;  1XHZ A;  4O55 A;  3O4Q A;  1LWE A;  5FRO A;  3OS2 A;  2E6L A;  4FLV A;  3TAF A;  3S3N A;  2VG6 A;  4ID5 A;  4FLX A;  1RT5 A;  4KKO A;  1QSS A;  3QEW A;  3AVK A;  4Z4F A;  1T03 A;  1EXQ A;  1X1P A;  5FDL A;  5HRR A;  4DG1 A;  1W9H A;  1VSD A;  4CJP A;  1D9F A;  4FYD A;  1HMV A;  3DOK A;  4OKK A;  3NHG A;  1Z26 A;  1U48 A;  3KK2 A;  3ZSW A;  3OYI A;  4Z4E A;  2ZD1 A;  1BGX T;  1BI4 B;  3NH0 A;  4KPY A;  5JS1 A;  3LP2 A;  1U45 A;  1S1W A;  4BE1 A;  3PX4 A;  2KW4 A; 
#chains in the Genus database with same CATH topology
 4KTQ A;  1A5X A;  3MEC A;  3IUC A;  3S3M A;  1DTQ A;  2UU9 K;  3RMA A;  4BC5 A;  2KTQ A;  5HRP A;  4DSK A;  3TPQ A;  3O4N A;  3EE8 A;  2F96 A;  1IH7 A;  4RW6 A;  3DOL A;  2P9P B;  1VQ9 N;  1F21 A;  4FWR A;  3VES A;  4R5P A;  4LD0 A;  5GAE P;  1EWQ A;  1ZBH A;  3QEX A;  3RMB A;  5BRE A;  3ZET B;  3R9P A;  2HOE A;  3HZ6 A;  3CXC M;  4AHT A;  1TL3 A;  3LDN A;  4ZHR A;  3K5N A;  1K9M O;  3SV3 A;  4F3T A;  4CF1 A;  4JKD A;  1N6Q A;  2RKI A;  3SQ2 A;  3M5R A;  4JD2 A;  2YNI A;  4DSI A;  1U4B A;  3O5B A;  3LAM A;  5C24 A;  4NCG A;  1RT6 A;  3VF4 A;  4JI2 K;  4DTJ A;  2IVO A;  2P9L A;  4QCL A;  2F8T A;  4DTP A;  4Z4G A;  4OX9 K;  3SAF A;  2B5J A;  3AO5 A;  3CJA A;  3KLI A;  1WUA A;  2HW3 A;  1RNH A;  1NK0 A;  1KD1 O;  4IG0 A;  1BCM A;  4DWI A;  1CLQ A;  1JLE A;  1OH7 A;  2AP1 A;  2PZS A;  4ISG A;  4M7X A;  1TK8 A;  3T1A A;  1RTH A;  4KHS A;  3MCP A;  4LF7 K;  3MK6 A;  3K57 A;  2HF4 A;  3SMS A;  2F4V K;  3JXU A;  4CGG A;  4JS4 A;  4CEE A;  3EL2 A;  4PKG A;  4LFA K;  4CJ3 A;  1MA9 B;  2CGK A;  4N76 A;  1ATR A;  3C65 A;  5CY4 A;  3HOT A;  3PO4 A;  4B9N A;  3CJ9 A;  4BR7 A;  1RBR A;  4ILH A;  4HTL A;  2P9I B;  2P9N A;  4B9T A;  2G8H A;  2HHW A;  4DTM A;  1VQ6 N;  3ID6 A;  4WQ4 A;  3SQ1 A;  5HL7 L;  2E1Z A;  2GBZ A;  4H0O A;  3TAE A;  1JL1 A;  3THX A;  1X9W A;  2ZQB A;  4O0J A;  5GIN A;  4A62 A;  1NGB A;  1Q18 A;  3WNH A;  2HHQ A;  4F8R A;  1KQS M;  3BGR A;  3RMD A;  4FM2 A;  3SPZ A;  2YHW A;  2HND A;  1BI4 A;  1KC8 O;  2HVI A;  4NCA A;  4M3U A;  5AZJ B;  4O5B A;  4FZY A;  4DQ8 A;  4B1X B;  3D45 A;  5AQG A;  1E3M A;  1ESV A;  2QWO A;  4CJ7 A;  4BR0 A;  4YNQ A;  1BHL A;  2F9W A;  3UB5 A;  4F3O A;  1VQM N;  4JI3 K;  4B1U B;  3OHR A;  5C0Y A;  4I6M B;  5M1P A;  4BC2 A;  4DSL A;  4HTU A;  4FWN A;  1WSH A;  1NJX A;  4BQL A;  4IDK A;  4FVM A;  1C0T A;  2PYJ A;  4ELT A;  4NO7 A;  5LMU K;  4ISF A;  2ITG A;  1HKG A;  3L3V A;  2F8S A;  3SJJ A;  4NXN K;  3CIP A;  3EE9 A;  3K9K A;  4CJ4 A;  2Q0U A;  2IAJ A;  4BG8 A;  3HOS A;  5GAH P;  3CJ1 A;  3JSM A;  2PY5 A;  1TUU A;  1TAQ A;  3SI6 A;  2UUB K;  1C6V A;  5F0X A;  1YJN N;  1S9G A;  4CFA A;  4DB3 A;  4IFE A;  1U04 A;  3OJS A;  5E84 A;  4AHV A;  3BF1 A;  4OPJ A;  4OKE A;  3O1B A;  4YDU A;  1HNZ K;  4QAG A;  5C12 A;  3I0S A;  4DV1 K;  4CF9 A;  1X3N A;  1E4G T;  1QTM A;  4K8Z A;  4JK7 A;  3N4P A;  1R59 O;  2VCP A;  2P9L B;  2HBL A;  2DY4 A;  4E1J A;  3TAB A;  3K2P A;  4BRF A;  4ELU A;  4B08 A;  4FSV A;  4BVO A;  4CZM A;  2VWB A;  5HRS A;  1N32 K;  2QWL A;  3ISN C;  5AZI A;  3VEO A;  3OJU A;  3VTI A;  1O13 A;  4BGA A;  3O80 A;  3VEN A;  3BUZ B;  3C6U A;  4JLH A;  1IO2 A;  4IFY A;  3T7Z A;  3U3Y A;  5E26 A;  4FJH A;  4OLB A;  5AQU A;  1XQS C;  2OPP A;  3HVT A;  2JWK A;  1RBT A;  3HJF A;  3T1H K;  1TKX A;  3EO3 A;  2V7Y A;  5KTQ A;  4B3S K;  3TAN A;  1V4S A;  4EAH D;  3L4I A;  5AQY A;  2IIR A;  1L3U A;  4FJK A;  1G15 A;  4HUG A;  3CC7 N;  4IZ9 A;  2O8F A;  4X64 K;  5CZ1 A;  1C1B A;  3CYM A;  3AVI A;  3VEV A;  1J5O A;  3PIP L;  2PAV A;  4JV5 K;  1IBM K;  4YHH K;  5J2Q A;  4JK9 A;  3CCM N;  4H8K A;  5BRH A;  4WFB L;  4FJ5 A;  1LAW A;  4M42 A;  3RR8 A;  1SL0 A;  1HKB A;  3LL3 A;  3PSF A;  4WF9 L;  3PX6 A;  1OH5 A;  1ITG A;  3UIQ A;  3RSE A;  3ULE A;  1U6Z A;  1KAY A;  1UWB A;  1ASV A;  5I3U A;  5AQV A;  2KKZ A;  1UOC A;  3THX B;  4MO5 A;  2OCE A;  1RBV A;  4CD1 A;  4YOY A;  3O08 A;  4BC3 A;  1M90 O;  4KHW A;  3P5J A;  2IGI A;  4K42 A;  3ITH A;  3IG1 A;  1KVB A;  4OO1 J;  4CBU A;  1IBK K;  1NGA A;  4IDH A;  2NRT A;  3MN6 A;  1EET A;  3ULD A;  3V9W A;  5ADX A;  4DQS A;  4PUO A;  5M1F A;  3I0R A;  1N33 K;  1Q82 O;  1SQK A;  2ZF5 O;  4WYB A;  3MAQ A;  4C8N A;  1VQN N;  1K6Y A;  2E6M A;  5HOO A;  1RDW X;  4JKF A;  4KRF A;  2H3G X;  4FWQ A;  4IOX A;  4H0T B;  3ZSO A;  4E7L A;  3LAL A;  1QE1 A;  4BRP A;  3M8S A;  1QSL A;  3NVK A;  2XHB A;  3SAH A;  1HNI A;  2DTU A;  1OH8 A;  4W5Q A;  1WSF A;  1ASU A;  3AV9 A;  4CER A;  3RWU A;  1HNX K;  4GKJ K;  4CHP A;  4GMJ B;  3HYF A;  3V1R A;  3R6M A;  5AQI A;  2A42 A;  3WXK A;  4LF4 K;  1HNV A;  3CF5 L;  4CFC A;  3DLL L;  1ZBS A;  3E9L A;  4DUY K;  3SQ0 A;  3WNF A;  2HHS A;  3TSQ A;  5HRN A;  1GLJ O;  3SPY A;  4LH5 A;  1A5W A;  4LH4 A;  1NKC A;  3AO4 A;  2NZT A;  4J2B A;  4DUZ K;  3QIN A;  4CZK A;  2V51 B;  3TSP A;  1W97 L;  3MN9 A;  1H1V A;  1NKE A;  3I56 N;  4HCB A;  2NRW A;  1W7A A;  4M3Z A;  4AH9 A;  3O9S A;  5KPT A;  3HBT A;  1WAJ A;  3KK1 A;  5MLC Q;  5T7B A;  1TKZ A;  2NUB A;  2QWQ A;  3C0B A;  3UKU A;  1M1K O;  1JLQ A;  4OJR A;  1P8Z A;  3S41 A;  4CJT A;  3PIO L;  4CCH A;  3CER A;  4JHD B;  4AIL C;  3KLE A;  2E4L A;  2XY6 A;  3HL8 A;  3D0P A;  4G1Q A;  2QTD A;  4WQ5 C;  4BR9 A;  4CJQ A;  4KTZ A;  1ASW A;  3CJB A;  3EN9 A;  5DM7 L;  2EWS A;  1J5E K;  3O6W A;  3AO3 A;  3VN5 A;  2UUA K;  4K8X A;  2FBV A;  3O8M A;  5JLH A;  3G4S N;  3H08 A;  3HO1 A;  4DU1 A;  3IRX A;  3M8R A;  1NG9 A;  4CEZ A;  3C7N B;  3OYE A;  1YJW N;  2D0A A;  2OTJ N;  1Y64 A;  3AVA A;  4V19 S;  1KXP A;  4MDB A;  5B8H A;  3KD1 E;  4BDP A;  3DXK B;  3ASM A;  3L8B A;  3OYG A;  3IFR A;  3TAF A;  3S3N A;  2VG6 A;  4ID5 A;  1RT5 A;  2QM1 A;  4QS8 A;  4IEI A;  3ZLJ A;  1NLV A;  1IJJ A;  1X1P A;  1XUP O;  2VQE K;  1GLC G;  4LF5 K;  5M1N A;  1U48 A;  3OYI A;  4H0Y B;  5AQJ A;  3NH0 A;  1S3X A;  2P9K A;  5JS1 A;  1S22 A;  5BRF A;  4FPA A;  3MMV A;  3PX4 A;  2KW4 A;  5TKW A;  2RPI A;  3RSE B;  3ULE B;  3QIO A;  1TV6 A;  4CK2 A;  3CM6 A;  3PUF A;  4E19 A;  4E7H A;  1VQO N;  2O8E B;  2VG7 A;  5AQT A;  3BF3 A;  1J53 A;  2A1S A;  4PA1 A;  1VSK A;  4JI1 K;  5GAD P;  2DFE A;  4I7F A;  4JI8 K;  3ZCM A;  4JI0 K;  4J2A A;  3VQC A;  4F2S A;  1SV5 A;  1Q7Y O;  5EX5 A;  4DSJ A;  4JKG A;  3U3G A;  2OA8 A;  4BRO A;  4FJL A;  4IJA A;  3HP6 A;  3AA5 X;  3BEX A;  4IG3 A;  4DR2 K;  2O8C B;  2W41 A;  2XY7 A;  1Q8I A;  1NOZ A;  4DQQ A;  3HRG A;  3P38 A;  1T44 A;  4LFB K;  4H5R A;  2Q2R A;  4FLY A;  2A1R A;  4OKJ A;  2Z1H A;  4CZH A;  2GEM A;  3UKR A;  1VSH A;  3FZK A;  1NK8 A;  1W2B M;  3A8Y A;  3CQ8 A;  2V7Z A;  4RTF D;  3QES A;  1Q86 O;  3THY A;  2B6A A;  2VG5 A;  5DMR A;  3LDS A;  3CC4 N;  2VWJ A;  2D5R A;  1WB9 A;  4JKB A;  1VQ4 N;  1BG3 A;  3QIC A;  1JXE A;  5AQP A;  3IAY A;  2KFN A;  5ADX H;  3NAE A;  4FJN A;  3BZK A;  3DJC A;  3F9K A;  4KRE A;  4N47 A;  2D0P A;  4GVM A;  2BUP A;  1WSE A;  2O8D A;  2OAN A;  5A2Q O;  5BR9 A;  2E5L K;  1GOC A;  3L2V A;  3WNE A;  4KH6 A;  4JYA K;  4FJX A;  4IFV A;  4NYN A;  3DRS A;  1U2V A;  4CHQ A;  4BRH A;  3ATV A;  3VQ9 A;  1IG8 A;  3MXI A;  3HST B;  3V81 A;  3WEE A;  3OYB A;  1YXQ A;  3TAP A;  4CFD A;  2X6S A;  2FC0 A;  3H46 O;  4Y1D A;  1VRU A;  4JI6 K;  5CR4 A;  4OLA A;  3HSC A;  4GY2 B;  4NB4 A;  3SUQ A;  4E0D A;  4FL9 A;  5KQD A;  1TK5 A;  3AVL A;  3AVJ A;  4NLC A;  1YIJ N;  4B9M A;  3H6E A;  4JAX A;  4U67 L;  3A5L C;  4JN4 A;  3VTH A;  5EVZ A;  3SQ4 A;  3NGI A;  4BWJ A;  3L6Q A;  3HPO A;  4Z94 A;  4OPK A;  3E01 A;  4CE9 A;  4DKW A;  1Q81 O;  4AQY K;  4PY5 A;  4CHN A;  3S9H A;  3R8E A;  5AQF A;  2YI1 A;  4YOT A;  1IV0 A;  3VMF B;  3PV8 A;  1HJR A;  5FRM A;  1RBS A;  3A2F A;  2YKM A;  4H5N A;  4DFJ A;  1J54 A;  5GAG P;  1JKH A;  3CME N;  3VEW A;  3DI6 A;  3T19 A;  1ZBU A;  5JMV A;  3MX2 A;  4E1N A;  4CZG A;  1C0M A;  4IBN A;  4B9V A;  1RT1 A;  3MEG A;  1BCO A;  1WN7 A;  3DXM A;  4FZX C;  4F2R A;  3LPT A;  4FO0 A;  2I7P A;  3EYZ A;  1B9F A;  3HK2 A;  3SBT A;  2D4W A;  5AQS A;  4O4G A;  3O3G A;  3QLH A;  2PFU A;  4EFH A;  3OA9 A;  2FF3 B;  4CD3 A;  2QEX N;  1XNR K;  5AR0 A;  1BIS A;  3CCL N;  4CJE A;  1DT9 A;  2G8W A;  5AFU A;  4KTW A;  5DM6 L;  1Y97 A;  3AAR A;  3QEV A;  1NK4 A;  3ZX2 A;  4CEA A;  1FW6 A;  4E3S A;  2UUC K;  3NFA A;  3OYL A;  4XH4 A;  2KZM A;  4YOV A;  4CGF A;  3DRP A;  1OKJ A;  2NRV A;  4FWO A;  3DAW A;  3MXM A;  1LOT B;  2Q0R A;  3O9R A;  5CYM A;  2VGN A;  3TTF A;  4HVJ A;  3AVC A;  4MLE A;  4CGD A;  2ZM6 K;  2P51 A;  3BY5 A;  4FWS A;  5EY4 A;  3AVM A;  4IJN A;  5KRS A;  3AO1 A;  3QBW A;  4DS4 A;  3HTV A;  2NNW A;  1XHX A;  2BAN A;  4FJJ A;  4O44 A;  4YFU A;  4DQP A;  4FW2 A;  3OS0 A;  3FZL A;  4DLG A;  1N8R O;  2HBM A;  3MN5 A;  2BH1 A;  1P90 A;  3AGR A;  3K59 A;  4KI4 A;  5KRT A;  4U7B A;  5AQQ A;  1RDB A;  1KCF A;  3CG7 A;  4IO9 L;  5BRD A;  1HQU A;  2HMI A;  3BP8 A;  1YJ9 N;  1U2V B;  4N5S A;  4TSX A;  4BRG A;  1SL1 A;  4N56 A;  1RT3 A;  3NE6 A;  2QKB A;  3QDK A;  3H1V X;  1L5U A;  3KHY A;  3LZI A;  1GLE G;  1JLA A;  2OYQ A;  1NGE A;  2FSN A;  3CFR A;  1C0F A;  4KHU A;  3OYC A;  4IXC A;  4BRE A;  3ALY A;  2EHG A;  4ILJ A;  3M8P A;  4A2B A;  3T1Y K;  3CJ7 A;  3VET A;  1HNW K;  3NH1 A;  4E1M A;  5AQN A;  1TKT A;  1DLO A;  3Q7C A;  4HWI A;  1QVF M;  4BGB A;  3PSI A;  3ZSQ A;  4FVU A;  5LMN K;  4CK3 A;  4DTX A;  1V4T A;  2QWR A;  1HUX A;  3D2F A;  4DR3 K;  3SCX A;  4I9L A;  3H3O B;  4F4K A;  4UY8 O;  1QZ6 A;  4JI5 K;  3TSU A;  4H03 B;  3KJV A;  2FBY A;  1NGI A;  4K25 A;  3EZW A;  4DSF A;  3DLR A;  2FBT A;  3CQX A;  2WTU A;  3OYF A;  3ZT0 A;  4L3Q A;  5FPD A;  4CZE A;  3WXI A;  4B3O A;  3LDL A;  1FKO A;  2F9T A;  3NGZ A;  4CEB A;  4BG9 A;  1HYZ A;  4OPA A;  3DXM B;  4JD2 B;  4CJ5 A;  3AVB A;  3KZB A;  4FK0 A;  1OH6 A;  3ZYY X;  1HQE A;  1WAF A;  3G0Z A;  4GV3 A;  4JNE A;  2HST A;  4KAZ A;  1VSL A;  4Z4I A;  1Z05 A;  1ZBF A;  3OYN A;  3L2Q A;  4E89 A;  3O9U A;  3VGL A;  4FLU A;  2FF6 A;  3KWI A;  4JKH A;  2ETJ A;  3A5M C;  4K43 A;  1XI1 A;  4H0V B;  4J2E A;  2YHY A;  2YJF A;  4DU3 A;  4NYF A;  2D0C A;  1SKW A;  3M1F A;  4CJF A;  5CYQ A;  3B6O A;  1HLU A;  3MED A;  3VQP A;  3HPG A;  3SUP A;  4O5F A;  1CZ9 A;  1JLF A;  3CHW A;  3OYH A;  3VQ5 A;  1XC3 A;  4DU4 A;  2NRX A;  1BWF O;  1HRH A;  4JKE A;  1TYQ A;  1ZYQ A;  3PO5 A;  3U9D A;  4DR7 K;  3HI0 A;  4PKH A;  4JEP A;  3BDP A;  4DTN A;  2W6K A;  1JCE A;  3O4W A;  2PBD A;  1IKX A;  3NF6 A;  4M3W A;  3AVN A;  4GVE A;  1IBL K;  2IVP A;  2R7Y A;  5LL6 Z;  3D2E A;  3AGK A;  4E7K A;  1BA0 A;  4KHY A;  1K8K A;  3VPZ A;  4GW6 A;  4H5V A;  5FPE A;  2P9N B;  2Z1G A;  4FK4 A;  5KPZ A;  3QNO A;  2B4J A;  3G10 A;  4PKI A;  3KD5 E;  3PLA A;  4RW4 A;  3JAM O;  1BOT O;  1XHZ A;  5FRO A;  1LWE A;  5AFU H;  2E6L A;  4CW7 B;  3QEW A;  3AVK A;  1T03 A;  2IVN A;  1EXQ A;  1KAX A;  1CZA N;  3K0S A;  4A5A A;  5FDL A;  4CJP A;  3VOV A;  3U9Z A;  1D9F A;  4FYD A;  4BRL A;  2NRZ A;  4OKK A;  3P4I A;  3SMP A;  1SZ2 A;  1Z6R A;  3KK2 A;  3ZSW A;  4Z4E A;  2ZD1 A;  1BGX T;  3FR0 A;  1BI4 B;  4KPY A;  4YOX A;  1U45 A;  3FZH A;  3D6R A;  1EP4 A;  4FPB A;  4HCC A;  3K5O A;  1SKS A;  5HLF A;  3VER A;  2ZE2 A;  2PYL A;  2J4R A;  2XY8 A;  3QML A;  4FLW A;  5ELZ A;  3QFU A;  1KAZ A;  4DV0 K;  1EO1 A;  2EX3 A;  3VEX A;  3VQB A;  4CHZ A;  2AJQ A;  2Y1J A;  3VQ7 A;  3NMU A;  1MDU B;  4J2D A;  4MFB A;  4DCH A;  4CI6 A;  4DR5 K;  5BPM A;  1NJY A;  3VEY A;  2QI2 A;  4DTO A;  2JLE A;  2O8B A;  4EP4 A;  3FLC O;  3QNN A;  1BQN A;  4UQG A;  3MWP A;  4CED A;  2YHB A;  3L3U A;  2JGU A;  4YY3 K;  5J2P A;  2FSK A;  1WOQ A;  2RN2 A;  3HM9 A;  1GLB G;  2GUI A;  1OVQ A;  3ZSV A;  1VSE A;  4A61 A;  4BRA A;  2GEL A;  4AHR A;  3IS9 A;  4RW8 A;  4Y1C A;  5C15 A;  2ZJP L;  5KQ8 A;  4YOW A;  1HJO A;  1S1U A;  1VRT A;  3VF2 A;  1WSJ A;  3CCR N;  3O9T A;  4DS5 A;  3AA3 A;  4BRQ A;  4KI6 A;  1K8A O;  3IMX A;  3CCV N;  4QOZ B;  1ZBL A;  1NGD A;  3QIP A;  3OYA A;  2YNF A;  3VQD A;  3RRH A;  4DHY A;  3J7Z O;  3GBT A;  4BE2 A;  2LSN A;  3V9Z A;  4ZTF A;  1EX4 A;  4RG8 A;  1VK0 A;  2IDO A;  4BY9 C;  4E7I A;  2HB5 A;  2P9S A;  3OY9 A;  3ATU A;  4FXD A;  2E8A A;  3H45 C;  3OS1 A;  3CC2 N;  3ZSZ A;  3D7E O;  5AJ3 K;  1MWK A;  5AZI B;  1S1V A;  1ZC6 A;  3C6T A;  1BIZ A;  2GWK A;  2WOM A;  1UA1 A;  4AHU A;  4WFN L;  4C1N I;  3WQU A;  1NK7 A;  1ILY A;  1BQM A;  3G71 N;  2I5J A;  3SZ2 A;  3RRG A;  4WE1 A;  2E2N A;  3SNN A;  4K0K K;  1RDC A;  1YAG A;  5C10 A;  3SUN A;  2IC3 A;  1D9D A;  4ELV A;  2UYT A;  2O8F B;  2Q31 A;  3ZT1 A;  3OBW A;  1YTA A;  3A5O C;  4DV6 K;  3ZEU A;  4JKC A;  4GV9 A;  3THW A;  5KPR A;  1NMD A;  3OYK A;  3C95 A;  5LJV A;  1VQ5 N;  4ID1 A;  4CEC A;  4DFP A;  3CCU N;  3MCA B;  3NGY A;  5AQO A;  1IKW A;  2DPN A;  4CJU A;  3F2K A;  4LSL A;  3EKS A;  2AA4 A;  2P9P A;  3QEI A;  4DV3 K;  5CE3 A;  3G6E N;  4CEF A;  1X9M A;  2QXF A;  3V9U A;  1TK0 A;  3ZET A;  2ZWH A;  4RCH A;  3GDQ A;  4LFC K;  4CK1 A;  1HR0 K;  1VSJ A;  4M3X A;  1RTD A;  3OYM A;  2KHO A;  4B1Z A;  1SUQ A;  5GIO A;  4FWM A;  3CI5 A;  5JVG L;  5SWM A;  2BDP A;  4H5W A;  4F9O A;  3LP0 A;  3N4Q A;  1S1X A;  4DTU A;  4FZZ A;  3ENH A;  1C0G A;  5I42 A;  2WON A;  3L0Q A;  3CCQ N;  3NF8 A;  1KVC A;  2X78 A;  1RDD A;  4XH5 A;  3EKU A;  2VWK A;  3AVH A;  3CPE A;  3TWH A;  3DLK A;  5LJW A;  2YV0 X;  3I33 A;  3ZT3 A;  2HNY A;  3V1O A;  3FZF A;  5BN9 A;  3DWL A;  1RCH A;  1RIL A;  2DFF A;  2FLO A;  1VQL N;  1QZ5 A;  2D1K A;  5AQK A;  2O8B B;  3C6H A;  4CBW A;  2W42 A;  2FXU A;  3SBG A;  3LAK A;  4DSE A;  1YT3 A;  2D0B A;  4BE0 A;  4WCE L;  4PWD A;  3V4I A;  1E4F T;  4X66 K;  5AQL A;  3LM2 A;  4KBO A;  1D8Y A;  3VQ6 A;  4X62 K;  1QQO A;  1FK9 A;  4DF8 A;  4KB1 A;  3DYA A;  3W3D A;  5IT9 O;  5CZ2 A;  4BWM A;  1S72 N;  3UKU B;  4CJV A;  1RT2 A;  1FJG K;  3CFO A;  1BU6 O;  1R0A A;  4Z0U A;  3WXL A;  3V1Q A;  3HP9 A;  1YUW A;  3SUO A;  2XO7 A;  2CGJ A;  2RE2 A;  3JS6 A;  4MLH A;  4CVN E;  4WQ4 C;  1NGH A;  3DMJ A;  4C1N K;  4DR1 K;  1LWF A;  3AO2 A;  4CEQ A;  2YCH A;  4RWT A;  3UE5 A;  2YKN A;  1NK5 A;  4C8O A;  2D0O A;  2ZJQ L;  3CD6 N;  4I9Q A;  2WBN A;  1SS6 A;  1NKB A;  2HVH A;  3CET A;  4CZJ A;  3R1X A;  1HKC A;  1SKR A;  3CFP A;  3P83 D;  3WUH A;  2HHX A;  1GLA G;  4CZI A;  3TAM A;  1WBB A;  3FZM A;  3J8A A;  2NLX A;  2VGM A;  3A0I X;  2YHA A;  1KSP A;  4W5N A;  2G8F A;  4B8A B;  1GLL O;  3THW B;  1TGO A;  3CCE N;  3CCJ N;  4DMN A;  1LV5 A;  1Z25 A;  2P9K B;  1JLC A;  2E88 A;  2HMP A;  4ILG B;  4IOC L;  4FOE A;  2UXC K;  3TAG A;  2ZGY A;  4B3T K;  3VQA A;  4DFK A;  1YTU A;  2QW9 A;  4EZ6 A;  1RT7 A;  5AQH A;  1FKP A;  5M1K A;  4JRP A;  4C8L A;  4LF8 K;  2P9U A;  1VQP N;  1HPZ A;  1NK6 A;  5BPN A;  3L2W A;  1JLB A;  4W5O A;  2KFZ A;  3C94 A;  1ZBI A;  4H4M A;  3FFK B;  2YHX A;  4AM6 A;  3WXM B;  1MU2 A;  3L2R A;  1VQK N;  1NM1 A;  3GOI A;  4FLT A;  1Q9Y A;  3E9O A;  3PY8 A;  1I3A A;  4JKG B;  4PQU A;  3OW2 M;  4FWP A;  3SYZ A;  1KRP A;  3LDQ A;  2OZS A;  4MO4 A;  3QB0 A;  5M1O A;  4YDU C;  4B3M K;  2HBJ A;  3IDH A;  1BUP A;  1NWK A;  4DF4 A;  3U4L A;  1WSI A;  1QSY A;  1YF5 L;  5KGW A;  2O4G A;  3VGK A;  2JWL A;  4OVL A;  2HF3 A;  3ZSX A;  3UKR B;  1GOA A;  3TTC A;  3CCS N;  4JI4 K;  4KHP K;  4BDY A;  4YOR A;  1VSM A;  4CGH A;  1C1A A;  1WBD A;  3SAG A;  3THY B;  1N34 K;  2ASP A;  2OPR A;  5K14 A;  3NCI A;  3KVG A;  2Q36 A;  4EP5 A;  3VA3 A;  4DTR A;  3HT3 A;  4Q0B A;  3A5N C;  2OPQ A;  1TKD A;  1NJZ A;  1SL2 A;  1LW0 A;  1S1T A;  4A57 A;  3SV4 A;  1XMQ K;  4LF9 K;  4C23 A;  3M8Q A;  2G8U A;  1RGI A;  4CJL A;  1JXB A;  1HYV A;  1REV A;  2P5O A;  3VQE A;  4BDZ A;  2O8D B;  4KB0 A;  3KTQ A;  1D5A A;  4AHS A;  4JKA A;  2UXD K;  4FJ8 A;  3NVM A;  3DRR A;  3LWM A;  3KK3 A;  1CXQ A;  2ASM A;  2QWN A;  4FJI A;  1VAZ A;  2E2Q A;  4DQR A;  3WEE B;  3OTO K;  2BTF A;  1CXU A;  3P1G A;  3S3O A;  2Z1I A;  5H1S Q;  4FLV A;  3OS2 A;  1T6D A;  4Z4F A;  4KKO A;  2I7N A;  2VQF K;  5AQM A;  1VSD A;  1HMV A;  3NHG A;  1Z26 A;  4R79 A;  2A6A A;  4BE1 A;  1U49 A;  3G25 A;  2V52 B;  1GOB A;  1BO5 O;  1JCF A;  4CZL A;  2WFB A;  1I39 A;  1QHT A;  4O8U A;  4CJS A;  4AF1 A;  3MDQ A;  1O1W A;  3B6P A;  3AVF A;  4RW9 A;  3OYD A;  3AAQ A;  1IG9 A;  3THV A;  1NGF A;  1RDA A;  3Q7B A;  4CEO A;  2OTL N;  1JCG A;  1LW2 A;  1UAX A;  4B9L A;  1TAU A;  2DFH A;  4H0X B;  1QQN A;  4B1W B;  3MX5 A;  3V6D A;  3EEQ A;  3O3F A;  2P9U B;  1W0H A;  1QVG M;  4FJ7 A;  5FPM A;  1I94 K;  1KLN A;  1TVR A;  4XEI A;  4M3T A;  4OGE A;  3K58 A;  4HUE A;  3DM2 A;  4M7Y A;  4K41 A;  3J7A P;  1TUY A;  5JLF A;  3QO9 A;  2FBX A;  3CQY A;  2CGL A;  4BRM A;  1LWC A;  2NRH A;  2WC9 A;  3AA2 A;  1KVA A;  4AM7 A;  3IKM A;  2ZJR L;  3LP1 A;  3RR7 A;  3TI0 A;  5C2D A;  4A5B A;  3ZX3 A;  3JYT A;  4MQ3 A;  2Z1J A;  4M45 A;  4CJK A;  1B9D A;  3KWG A;  3LZJ A;  2HHH K;  2HNZ A;  3J80 O;  4CF8 A;  5HRO A;  1XNQ K;  4NCB A;  3KK7 A;  3KKS A;  4KHQ A;  4ISE A;  2OPS A;  3SLC A;  3I55 N;  3LP3 A;  1G99 A;  1QQM A;  3CJC A;  2A5X A;  2E2P A;  4JRQ A;  5JIC A;  3MXJ A;  3FE1 A;  4A59 A;  4JHD A;  1HYS A;  3U6F A;  3NF7 A;  2O4I A;  4FLZ A;  4X65 K;  1WNS A;  3ENO A;  1T6C A;  2ITM A;  1N5Y A;  2QXL A;  2FSJ A;  3VEZ A;  1YI2 N;  2HHU A;  4FJ9 A;  4QS9 A;  4E7J A;  4DR4 K;  3L4Q A;  3CPW M;  3H3N O;  3C7N A;  1JLG A;  4YOU A;  1N36 K;  3LDO A;  3V9X A;  4BRK A;  3R3L A;  3DXK A;  4DV2 K;  3ZT2 A;  4IKF A;  1L3S A;  3FGU A;  1EWR A;  4FJG A;  3VF6 A;  1YHQ N;  2UXB K;  1JL2 A;  2RHK A;  4DR6 K;  2QWM A;  4HHT A;  1DTT A;  3M6G A;  1KFS A;  4B9S A;  3NBP A;  1ZXO A;  5AQZ A;  3OYJ A;  2IOC A;  4B1V A;  3FFI A;  3ZT4 A;  1U47 A;  2X74 A;  4O8K A;  5GIP A;  3QET A;  4I2P A;  1NBW A;  2Q3S A;  3WQT A;  3MEE A;  1KLM A;  1HPM A;  3GG4 A;  4I2Q A;  4BR5 A;  4FK2 A;  5D3G A;  4Z4C A;  4KFB A;  3AAP A;  2G8K A;  2O8E A;  2QA4 N;  1TL1 A;  4O0I A;  3CM5 A;  4G9Z A;  1X3M A;  1NGG A;  2BGG A;  3KIO A;  1B92 A;  2A41 A;  3O9Q A;  1D4X A;  5EOY A;  3TAR A;  4BVP A;  1NU0 A;  2E1Y A;  1UA0 A;  4DV5 K;  3VQQ A;  2BE2 A;  5IWA K;  1XWL A;  4IO8 A;  5FPN A;  1YIT N;  3LDP A;  2GUP A;  3F73 A;  1T7P A;  3I8D A;  5F1X A;  3BZC A;  4M63 C;  1ATS A;  4MDA A;  3SK3 A;  1X9J A;  1BIU A;  4PHT X;  5I9E B;  1NNE A;  2GWJ A;  3D2F B;  4CHO A;  1GLF O;  3QBX A;  5LY3 A;  1RT4 A;  4Y0W A;  3VQ4 A;  4LY7 A;  5KGX A;  3K5M A;  2O8C A;  3NF9 A;  3O3H A;  1IKV A;  3WT0 A;  4M3Y A;  4CIG A;  1NJW A;  1QHA A;  5M1Q A;  3KLH A;  1RBU A;  2G8V A;  2YNH A;  3B8A X;  3HPH A;  3TR8 A;  1BDG A;  3KLF A;  2GTD A;  5J1E A;  2GV9 A;  2W6L A;  4CZF A;  1BA1 A;  4XIU A;  4DTS A;  4LC9 B;  3NH2 A;  3E9P A;  1VHX A;  1HX1 A;  3ID8 A;  1C1C A;  4FM1 A;  1T05 A;  1OVY A;  4M3R A;  3LM9 A;  4OGC A;  1RDU A;  3MWT A;  3HVR A;  2CH5 A;  3F9M A;  4OPH A;  4CGJ A;  3VQ8 A;  4DFM A;  3P31 A;  2QK9 A;  4CF0 A;  1NGC A;  4IOA L;  5AQW A;  4EIA A;  4H4O A;  3P39 A;  4GNI A;  4J8F A;  1FXX A;  5JS2 A;  4CIE A;  3DLB A;  1VSF A;  3L2U A;  4KO0 A;  3RMC A;  1A5V A;  1EKE A;  4AHC A;  1T3V A;  3K9J A;  2G8I A;  3ENB A;  5CHI A;  3LAN A;  1ATN A;  1TYQ B;  1KFD A;  4C8M A;  4BRD A;  3OVN A;  1S9E A;  2KLA A;  5FLX O;  2GX9 A;  3J81 O;  1EQY A;  2E2O A;  1J9A A;  4DV7 K;  4C8K A;  4LSN A;  3D2E B;  4W5T A;  1NOY A;  5HP1 A;  1K8K B;  4Q5V A;  3K5L A;  2X6N A;  3VA0 A;  3M3Z A;  4B1Y B;  1LAV A;  4KV8 A;  4IEE A;  3AY9 A;  3QFP A;  4L8R B;  4WFA L;  4EHT A;  2KZZ A;  1XC9 A;  3LPU A;  3CMA N;  2YX6 A;  4BQZ A;  3TTD A;  2ASO A;  4KHN A;  1S6P A;  3GL1 A;  4CES A;  2P5G A;  3ZSY A;  2XRI A;  2OZM A;  3DLE A;  4EHU A;  4JI7 K;  4BAC A;  3LWL A;  4XH1 A;  4FCY A;  3TU5 A;  3RVC A;  5C42 A;  2IS3 A;  4QS7 A;  5J2N A;  4CHY A;  3AA4 A;  2Q97 A;  4H5T A;  2KQ2 A;  4HUF A;  4FJM A;  4BC4 A;  3WNG A;  5FRN A;  3O1W A;  1JJ2 M;  5C2F A;  3HXM A;  3DLH A;  1IKY A;  1RTJ A;  4W5R A;  4FM0 A;  1NMN A;  2P1J A;  2WUS A;  2YJE A;  3OBY A;  1X9S A;  5EU7 A;  1Q9X A;  1VQ8 N;  4CIF A;  5BPL A;  2QKK A;  4H0P A;  4BR2 A;  4NLB A;  1BL3 A;  5DK5 A;  3ZX0 A;  1T8E A;  1MWM A;  2ZGZ A;  3DLG A;  5F2R A;  4RW7 A;  3KKR A;  3C6A A;  2QWP A;  1NK9 A;  2VYP A;  3KLG A;  1YVU A;  4KH4 A;  3MN7 A;  4BRN A;  5C25 A;  3TAQ A;  2HBK A;  4NXM K;  4BRC A;  3QEP A;  4GV6 A;  4A2A A;  2F7T A;  3V9S A;  2HHT A;  1DKG D;  4FWL A;  1K73 O;  3J7Y P;  1DGK N;  5EXW A;  2YNG A;  5E41 A;  4CBX A;  4EZ9 A;  3WXJ A;  1S5J A;  1QQC A;  3I8B A;  1WSG A;  4CGI A;  4Z4H A;  2W40 A;  5SZT A;  3AVG A;  1NJI O;  1S6Q A;  4PL8 A;  3SJH A;  1KTQ A;  2XY5 A;  4BR4 A;  1VSI A;  2A40 A;  3PX0 A;  4CF2 A;  4ZTJ A;  1RFQ A;  4KH5 A;  3QER A;  2Y1I A;  1CZB A;  2A3Z A;  1XMO K;  1RTI A;  4ICL A;  5J2M A;  3VGM A;  2NRR A;  1J6Z A;  3H1Q A;  4DLE A;  4FWK A;  1QS4 A;  2P9I A;  4BRI A;  4B9U A;  2P9S B;  1LCU A;  4WQ5 A;  4M41 A;  3RTV A;  2ATQ A;  3HM8 A;  2E20 A;  1DEJ A;  1WLJ A;  3T3F A;  2CH6 A;  5AQR A;  1YVN A;  4FOI A;  4JK8 A;  1L3T A;  4FW1 A;  3ZSR A;  4B8C A;  4CJW A;  4N41 A;  3E1Y A;  3GE1 A;  3F5T A;  1GLD G;  1C0U A;  1L3V A;  4B3R K;  3NDK A;  4GKK K;  4JS5 A;  5JVH L;  3EZ5 A;  3EY1 A;  4IWV A;  3W0L A;  2RF2 A;  1NGJ A;  3E66 A;  4CFB A;  5HBM A;  5AZJ A;  4DQI A;  5KI6 A;  4CJR A;  4O55 A;  3O4Q A;  5TKY A;  5AQX A;  2HHV A;  1QSS A;  4FLX A;  1SAZ A;  4DV4 K;  5HRR A;  4DG1 A;  1W9H A;  5BR8 K;  3ZEU B;  4B9Q A;  3DOK A;  4I6M A;  3U8X A;  3T69 A;  2Q1N A;  3LP2 A;  1VQ7 N;  4PL7 A;  1S1W A;  4LF6 K;  5BN8 A; 
#chains in the Genus database with same CATH homology
 1EP4 A;  4KTQ A;  4HCC A;  2RPI A;  1GOB A;  3K5O A;  1A5X A;  3MEC A;  3QIO A;  1TV6 A;  3S3M A;  1DTQ A;  4CK2 A;  3RMA A;  3CM6 A;  3PUF A;  5HRP A;  2KTQ A;  4E19 A;  1SKS A;  4DSK A;  1I39 A;  1QHT A;  4CJS A;  4E7H A;  5HLF A;  2VG7 A;  1O1W A;  3B6P A;  3O4N A;  3AVF A;  2F96 A;  1IH7 A;  2ZE2 A;  4RW6 A;  4RW9 A;  3OYD A;  2PYL A;  2XY8 A;  3DOL A;  1IG9 A;  1J53 A;  1F21 A;  4FLW A;  3THV A;  2A1S A;  1RDA A;  4R5P A;  4LD0 A;  4PA1 A;  1VSK A;  1ZBH A;  4CEO A;  3QEX A;  3RMB A;  1LW2 A;  2EX3 A;  1UAX A;  2DFE A;  4I7F A;  4B9L A;  3ZCM A;  3VQB A;  1TAU A;  2DFH A;  4CHZ A;  2AJQ A;  2Y1J A;  4J2A A;  3VQC A;  3VQ7 A;  4AHT A;  1TL3 A;  4F2S A;  1SV5 A;  4ZHR A;  3V6D A;  3K5N A;  3SV3 A;  4J2D A;  4MFB A;  3O3F A;  4DSJ A;  4CF1 A;  4F3T A;  3U3G A;  2OA8 A;  1W0H A;  1N6Q A;  4FJ7 A;  2RKI A;  4FJL A;  1KLN A;  1TVR A;  3SQ2 A;  4M3T A;  3HP6 A;  4OGE A;  3AA5 X;  1NJY A;  3K58 A;  2YNI A;  4IG3 A;  4DTO A;  2JLE A;  4HUE A;  3DM2 A;  4DSI A;  4EP4 A;  3QNN A;  2XY7 A;  1U4B A;  1BQN A;  4UQG A;  1Q8I A;  3QO9 A;  3LAM A;  5C24 A;  4NCG A;  2YHB A;  4CED A;  1RT6 A;  3L3U A;  1NOZ A;  4DQQ A;  2FBX A;  2JGU A;  5J2P A;  1LWC A;  4DTJ A;  3AA2 A;  2RN2 A;  1KVA A;  3HM9 A;  4QCL A;  2GUI A;  2F8T A;  3ZSV A;  1VSE A;  4DTP A;  2A1R A;  4FLY A;  3LP1 A;  4OKJ A;  4AHR A;  2Z1H A;  4Z4G A;  3RR7 A;  3TI0 A;  3IS9 A;  4RW8 A;  4Y1C A;  3JYT A;  4MQ3 A;  2B5J A;  1VSH A;  2Z1J A;  1B9D A;  3AO5 A;  3KLI A;  4M45 A;  4CJK A;  1RNH A;  3LZJ A;  1NK8 A;  1S1U A;  1NK0 A;  1VRT A;  1WSJ A;  3CQ8 A;  2HNZ A;  4IG0 A;  1BCM A;  4CF8 A;  3AA3 A;  4DS5 A;  3QES A;  5HRO A;  4NCB A;  4KI6 A;  4DWI A;  1CLQ A;  1JLE A;  2B6A A;  3KKS A;  1ZBL A;  4KHQ A;  2OPS A;  4QOZ B;  3QIP A;  3OYA A;  2VG5 A;  2YNF A;  3VQD A;  2PZS A;  5DMR A;  3RRH A;  3LDS A;  3LP3 A;  2VWJ A;  1TK8 A;  3T1A A;  1RTH A;  2D5R A;  4KHS A;  3K57 A;  4BE2 A;  2LSN A;  3V9Z A;  1JXE A;  4ZTF A;  1EX4 A;  4RG8 A;  1VK0 A;  4CGG A;  4JRQ A;  3MXJ A;  2IDO A;  4JS4 A;  4E7I A;  3IAY A;  2KFN A;  4CEE A;  2HB5 A;  1HYS A;  4FJN A;  3NAE A;  3U6F A;  3NF7 A;  2O4I A;  3OY9 A;  4FLZ A;  3F9K A;  4FXD A;  4KRE A;  4N47 A;  3OS1 A;  1WNS A;  4GVM A;  4CJ3 A;  4N76 A;  3ZSZ A;  1WSE A;  1N5Y A;  1GOC A;  3L2V A;  1S1V A;  3WNE A;  3C6T A;  1BIZ A;  5CY4 A;  2WOM A;  1UA1 A;  3PO4 A;  4AHU A;  2HHU A;  4FJ9 A;  4FJX A;  4IFV A;  4B9N A;  4E7J A;  4NYN A;  1RBR A;  3DRS A;  4CHQ A;  1NK7 A;  1BQM A;  2I5J A;  3VQ9 A;  3SZ2 A;  3RRG A;  1JLG A;  4WE1 A;  3MXI A;  3HST B;  2G8H A;  4B9T A;  3SNN A;  2HHW A;  4DTM A;  3V81 A;  3V9X A;  1RDC A;  3SQ1 A;  3OYB A;  3SUN A;  2IC3 A;  3ZT2 A;  1D9D A;  4ELV A;  1L3S A;  2GBZ A;  4IKF A;  3TAP A;  4CFD A;  2X6S A;  3TAE A;  3ZT1 A;  4FJG A;  2FC0 A;  4Y1D A;  1JL1 A;  1VRU A;  1JL2 A;  4OLA A;  1X9W A;  1YTA A;  1DTT A;  2ZQB A;  4HHT A;  1KFS A;  4O0J A;  3SUQ A;  4E0D A;  3WNH A;  4B9S A;  2HHQ A;  4F8R A;  1TK5 A;  3NBP A;  3OYJ A;  3AVL A;  3BGR A;  3RMD A;  4FM2 A;  3SPZ A;  2IOC A;  3AVJ A;  3FFI A;  4B9M A;  2HND A;  1BI4 A;  3ZT4 A;  1U47 A;  2X74 A;  3OYK A;  2HVI A;  4NCA A;  3C95 A;  4M3U A;  4ID1 A;  4I2P A;  3QET A;  4O5B A;  4FZY A;  4CEC A;  4DFP A;  2Q3S A;  3D45 A;  3SQ4 A;  3MEE A;  1KLM A;  3NGY A;  3NGI A;  4I2Q A;  4BWJ A;  3HPO A;  4FK2 A;  4OPK A;  5D3G A;  1IKW A;  4KFB A;  4Z4C A;  4YNQ A;  1BHL A;  4CJU A;  2G8K A;  3E01 A;  4CE9 A;  4LSL A;  4F3O A;  1TL1 A;  4O0I A;  4PY5 A;  3CM5 A;  4CHN A;  4DSL A;  4HTU A;  2BGG A;  3S9H A;  1WSH A;  3KIO A;  3QEI A;  1B92 A;  1NJX A;  3TAR A;  4CEF A;  3PV8 A;  1X9M A;  4IDK A;  1UA0 A;  4FVM A;  3VQQ A;  1HJR A;  2BE2 A;  2QXF A;  1C0T A;  3V9U A;  1RBS A;  1XWL A;  1TK0 A;  5FRM A;  2PYJ A;  3A2F A;  4ELT A;  2YKM A;  4CK1 A;  3F73 A;  4DFJ A;  1J54 A;  1T7P A;  3I8D A;  1VSJ A;  2ITG A;  4M3X A;  1RTD A;  3OYM A;  1JKH A;  3L3V A;  1BIU A;  2F8S A;  3DI6 A;  3T19 A;  3SJJ A;  1SUQ A;  1ZBU A;  4E1N A;  4B9V A;  1C0M A;  4IBN A;  5SWM A;  4CHO A;  1RT1 A;  4CJ4 A;  2BDP A;  1RT4 A;  3MEG A;  3VQ4 A;  1BCO A;  1WN7 A;  2IAJ A;  4LY7 A;  5KGX A;  3K5M A;  3LP0 A;  4DTU A;  1S1X A;  3NF9 A;  4FZZ A;  4FZX C;  3O3H A;  4F2R A;  1IKV A;  4M3Y A;  3LPT A;  4CIG A;  3EYZ A;  5I42 A;  1NJW A;  2WON A;  3JSM A;  3KLH A;  1RBU A;  3NF8 A;  1B9F A;  2G8V A;  1KVC A;  2PY5 A;  2X78 A;  1TAQ A;  1RDD A;  3SI6 A;  3HK2 A;  2VWK A;  1C6V A;  2YNH A;  3AVH A;  4O4G A;  3O3G A;  1S9G A;  3HPH A;  4CFA A;  3QLH A;  3TR8 A;  3TWH A;  3DLK A;  1U04 A;  2YV0 X;  3OJS A;  4AHV A;  3KLF A;  3ZT3 A;  4OPJ A;  1BIS A;  2HNY A;  5J1E A;  3V1O A;  4CJE A;  2GV9 A;  4OKE A;  1RCH A;  1RIL A;  2DFF A;  4XIU A;  4DTS A;  4KTW A;  2G8W A;  1Y97 A;  3QEV A;  1NK4 A;  4CEA A;  4QAG A;  3NH2 A;  3I0S A;  2W42 A;  4E3S A;  3NFA A;  4CF9 A;  3OYL A;  2KZM A;  3LAK A;  1C1C A;  4CGF A;  3DRP A;  4FM1 A;  1T05 A;  1QTM A;  4K8Z A;  4M3R A;  4DSE A;  1YT3 A;  4OGC A;  3MXM A;  3HVR A;  2DY4 A;  2D0B A;  3TAB A;  4BE0 A;  5CYM A;  3K2P A;  4ELU A;  4CGJ A;  3VQ8 A;  4B08 A;  4DFM A;  4PWD A;  3V4I A;  4HVJ A;  3AVC A;  2QK9 A;  4CGD A;  4CF0 A;  2P51 A;  3AVM A;  5KRS A;  3AO1 A;  5HRS A;  1D8Y A;  4H4O A;  3VQ6 A;  3ISN C;  4DS4 A;  1FK9 A;  4DF8 A;  1FXX A;  3DYA A;  5JS2 A;  4CIE A;  4KB1 A;  3DLB A;  3OJU A;  1XHX A;  2BAN A;  5CZ2 A;  1VSF A;  4BWM A;  3L2U A;  4KO0 A;  3RMC A;  1A5V A;  1EKE A;  4FJJ A;  4CJV A;  1RT2 A;  4O44 A;  4YFU A;  3C6U A;  4JLH A;  1IO2 A;  3CFO A;  4IFY A;  4AHC A;  4Z0U A;  3U3Y A;  1R0A A;  4DQP A;  4FJH A;  4FW2 A;  3OS0 A;  4OLB A;  2G8I A;  2OPP A;  3HVT A;  1RBT A;  3LAN A;  3HJF A;  3V1Q A;  1KFD A;  1TKX A;  3HP9 A;  4DLG A;  3SUO A;  5KTQ A;  3TAN A;  4C8M A;  2XO7 A;  3OVN A;  3K59 A;  1L3U A;  3DMJ A;  4KI4 A;  1S9E A;  4FJK A;  1G15 A;  5KRT A;  4HUG A;  1LWF A;  3AO2 A;  4CEQ A;  5CZ1 A;  1C1B A;  3CYM A;  3AVI A;  1J5O A;  1RDB A;  1J9A A;  1KCF A;  3CG7 A;  2HMI A;  4C8K A;  1HQU A;  2YKN A;  1NK5 A;  5J2Q A;  4LSN A;  1NOY A;  4W5T A;  4C8O A;  5HP1 A;  4H8K A;  4Q5V A;  4N5S A;  4I9Q A;  4FJ5 A;  4TSX A;  1LAW A;  4M42 A;  3RR8 A;  3K5L A;  1NKB A;  2HVH A;  1SL0 A;  1SL1 A;  4N56 A;  1RT3 A;  2X6N A;  3NE6 A;  2QKB A;  3VA0 A;  1L5U A;  3LZI A;  3PX6 A;  1LAV A;  1JLA A;  4KV8 A;  2OYQ A;  1SKR A;  3CFP A;  1ITG A;  4L8R B;  3P83 D;  2HHX A;  3UIQ A;  3TAM A;  1UWB A;  2KZZ A;  3CFR A;  1ASV A;  1XC9 A;  3LPU A;  5I3U A;  4KHU A;  1UOC A;  3OYC A;  2YHA A;  1KSP A;  4W5N A;  3ALY A;  4KHN A;  1RBV A;  1S6P A;  2EHG A;  4B8A B;  4CES A;  2G8F A;  3ZSY A;  2P5G A;  3M8P A;  2XRI A;  3NH1 A;  2OZM A;  4E1M A;  3DLE A;  1TGO A;  4KHW A;  4DMN A;  1LV5 A;  1TKT A;  1Z25 A;  1JLC A;  3P5J A;  1DLO A;  4BAC A;  2IGI A;  3LWL A;  3ITH A;  4FCY A;  3TAG A;  5C42 A;  3IG1 A;  3VQA A;  1KVB A;  3ZSQ A;  4DFK A;  1YTU A;  2IS3 A;  4EZ6 A;  5J2N A;  1RT7 A;  4CHY A;  3AA4 A;  4CK3 A;  1EET A;  1FKP A;  4JRP A;  3ULD A;  4DTX A;  3V9W A;  2KQ2 A;  4HUF A;  4FJM A;  4DQS A;  4C8L A;  4PUO A;  3I0R A;  3WNG A;  5FRN A;  1NK6 A;  1HPZ A;  3SCX A;  4I9L A;  3MAQ A;  3L2W A;  4C8N A;  1JLB A;  4W5O A;  3HXM A;  4F4K A;  2KFZ A;  3C94 A;  1ZBI A;  1K6Y A;  1IKY A;  1RTJ A;  2E6M A;  4H4M A;  4W5R A;  2FBY A;  3KJV A;  4FM0 A;  3DLH A;  4KRF A;  2P1J A;  4DSF A;  3DLR A;  1X9S A;  2FBT A;  5EU7 A;  1Q9X A;  3ZSO A;  4E7L A;  3LAL A;  1QE1 A;  4CIF A;  3OYF A;  1MU2 A;  3M8S A;  3L2R A;  3ZT0 A;  1QSL A;  2XHB A;  2QKK A;  1HNI A;  2DTU A;  4W5Q A;  1BL3 A;  4FLT A;  5DK5 A;  1WSF A;  1Q9Y A;  1ASU A;  3AV9 A;  4CER A;  1T8E A;  3DLG A;  3PY8 A;  1I3A A;  3RWU A;  4CHP A;  4GMJ B;  3HYF A;  4B3O A;  3V1R A;  4RW7 A;  4PQU A;  3KKR A;  1NK9 A;  3SYZ A;  1KRP A;  1FKO A;  1HNV A;  3KLG A;  4CFC A;  1YVU A;  3NGZ A;  4CEB A;  2OZS A;  1HYZ A;  5C25 A;  3TAQ A;  3SQ0 A;  3QEP A;  4CJ5 A;  3WNF A;  3AVB A;  2HHS A;  4FK0 A;  1HQE A;  1WAF A;  3V9S A;  3G0Z A;  4DF4 A;  5HRN A;  2HHT A;  1WSI A;  1QSY A;  3SPY A;  4LH5 A;  4KAZ A;  1VSL A;  1A5W A;  2YNG A;  4LH4 A;  4Z4I A;  1ZBF A;  5E41 A;  3OYN A;  3L2Q A;  5KGW A;  4E89 A;  1NKC A;  3AO4 A;  4EZ9 A;  4FLU A;  2O4G A;  1S5J A;  2ETJ A;  1U49 A;  1QQC A;  4OVL A;  1WSG A;  3ZSX A;  4CGI A;  4Z4H A;  4J2B A;  1GOA A;  3QIN A;  5SZT A;  3AVG A;  4BDY A;  1S6Q A;  1XI1 A;  1VSM A;  4CGH A;  1C1A A;  4J2E A;  1NKE A;  1KTQ A;  4DU3 A;  4NYF A;  2D0C A;  1SKW A;  4HCB A;  2HW3 A;  2OPR A;  4CJF A;  2XY5 A;  4M3Z A;  5CYQ A;  5K14 A;  4AH9 A;  3B6O A;  1WAJ A;  3MED A;  3KK1 A;  3NCI A;  3VQP A;  1VSI A;  3HPG A;  5T7B A;  3SUP A;  1TKZ A;  2NUB A;  1CZ9 A;  1JLF A;  4EP5 A;  3VA3 A;  4DTR A;  4CF2 A;  3HT3 A;  3PX0 A;  4ZTJ A;  1JLQ A;  4Q0B A;  2OPQ A;  3OYH A;  4OJR A;  3VQ5 A;  4CJT A;  1TKD A;  1NJZ A;  1SL2 A;  1LW0 A;  1S1T A;  3SV4 A;  3QER A;  1CZB A;  2Y1I A;  4CCH A;  1RTI A;  4ICL A;  4DU4 A;  5J2M A;  4DLE A;  1HRH A;  1ZYQ A;  1QS4 A;  3PO5 A;  4B9U A;  4AIL C;  3M8Q A;  2E4L A;  3KLE A;  2XY6 A;  3HL8 A;  3D0P A;  2G8U A;  4G1Q A;  4M41 A;  4CJQ A;  4CJL A;  3RTV A;  1JXB A;  2ATQ A;  1HYV A;  1ASW A;  1REV A;  4KTZ A;  4DTN A;  3BDP A;  2P5O A;  3VQE A;  1WLJ A;  3T3F A;  4BDZ A;  4KB0 A;  3KTQ A;  1D5A A;  3AO3 A;  1IKX A;  3NF6 A;  4M3W A;  1L3T A;  4FW1 A;  3VN5 A;  3ZSR A;  3AVN A;  4AHS A;  4K8X A;  2FBV A;  4B8C A;  4CJW A;  4N41 A;  3H08 A;  3HO1 A;  1C0U A;  3IRX A;  2R7Y A;  4DU1 A;  3NDK A;  1L3V A;  4E7K A;  4FJ8 A;  4KHY A;  3M8R A;  4JS5 A;  4GW6 A;  3DRR A;  4CEZ A;  3EZ5 A;  3EY1 A;  2Z1G A;  3OYE A;  3LWM A;  3KK3 A;  2RF2 A;  1CXQ A;  2D0A A;  4FK4 A;  3QNO A;  3AVA A;  4FJI A;  2B4J A;  3G10 A;  5HBM A;  4CFB A;  4DQR A;  4DQI A;  5KI6 A;  3KD5 E;  3KD1 E;  4BDP A;  4RW4 A;  3L8B A;  1CXU A;  3ASM A;  3P1G A;  3OYG A;  4CJR A;  3S3O A;  2HHV A;  2Z1I A;  1XHZ A;  4O55 A;  3O4Q A;  1LWE A;  5FRO A;  3OS2 A;  2E6L A;  4FLV A;  3TAF A;  3S3N A;  2VG6 A;  4ID5 A;  4FLX A;  1RT5 A;  4KKO A;  1QSS A;  3QEW A;  3AVK A;  4Z4F A;  1T03 A;  1EXQ A;  1X1P A;  5FDL A;  5HRR A;  4DG1 A;  1W9H A;  1VSD A;  4CJP A;  1D9F A;  4FYD A;  1HMV A;  3DOK A;  4OKK A;  3NHG A;  1Z26 A;  1U48 A;  3KK2 A;  3ZSW A;  3OYI A;  4Z4E A;  2ZD1 A;  1BGX T;  1BI4 B;  3NH0 A;  4KPY A;  5JS1 A;  3LP2 A;  1U45 A;  1S1W A;  4BE1 A;  3PX4 A;  2KW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...