3AVKA

Crystal structures of novel allosteric peptide inhibitors of hiv integrase in the ledgf binding site
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
153
structure length
149
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEDGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGYSAGERIVDIIATDIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Crystal structures of novel allosteric peptide inhibitors of HIV integrase identify new interactions at the LEDGF binding site.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Recombination/inhibitor
total genus 54
structure length 149
sequence length 153
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3avkA00
3VQ9A 1Z26A 1C1CA 1ITGA 1BIZA 1ASWA 4HTUA 5FDLA 4DF8A 1BQNA 3KKSA 1WAFA 4CFBA 3ZSYA 4BACA 2IS3A 1NK0A 1WSHA 1BI4B 4Y1CA 3VQPA 1NKCA 4DU3A 4CEZA 1RNHA 4LH5A 4FCYA 3NHGA 3OYDA 4FJJA 1TKTA 5E41A 4BDYA 1ASUA 1VSKA 4E19A 3SV3A 4RW8A 3AVJA 3VA0A 1NK7A 1VSJA 1HNIA 1RT6A 2WOMA 3HVTA 3KK1A 4KO0A 2QKBA 3LWMA 2VG5A 2OA8A 1BCOA 4K8ZA 3OS1A 3QNNA 2KZZA 5J2QA 1HRHA 4GVMA 3NFAA 2XY5A 1VSDA 1WNSA 2IC3A 1C6VA 2FBTA 3LP0A 1U49A 2PYLA 4OKJA 2DY4A 1S6QA 1ZBUA 1JL2A 1Z25A 1S6PA 3QINA 3M8RA 3L2VA 3K58A 3V9ZA 1U47A 4AHCA 4AHVA 4EZ6A 4NYFA 1RDBA 4DFJA 4B9UA 4FJNA 1BISA 2X74A 3LP1A 4BE1A 3CQ8A 3O3GA 3UIQA 1TAUA 4BE2A 3HK2A 3ZCMA 4CHOA 1QTMA 4MFBA 1IG9A 3KK2A 4DQPA 2HHSA 4O55A 2RN2A 4CE9A 3VQ8A 3TAFA 4HCBA 5I3UA 3JSMA 4AHSA 4FK4A 2W42A 2HB5A 1FKPA 2ZE2A 1JLBA 3DI6A 4FVMA 4PA1A 2O4GA 3G0ZA 3LP3A 4CIGA 3LDSA 2YNIA 4KB1A 3L3UA 5SWMA 4W5RA 3RMDA 4LSLA 2ZQBA 1RT4A 2NUBA 3CFRA 3AVKA 3MXIA 1SL1A 2YHAA 3HPOA 1VSMA 1VRTA 3KD5E 3DRRA 3C6TA 4M3YA 4Z4FA 1J54A 4FLZA 4FJKA 4CEEA 4CIEA 2Z1IA 3VQDA 3LZJA 1WLJA 4Y1DA 4C8NA 4FLYA 4DSFA 4KHYA 3AVNA 4DU4A 3ZSOA 1XI1A 2JGUA 1X9MA 1CZ9A 3LALA 4Q5VA 3KK3A 4DFPA 4JRPA 1XHZA 4CF0A 4F8RA 4CERA 1JXBA 3NCIA 1NK9A 4CGFA 3AA2A 3A2FA 4IDKA 4CEQA 4W5TA 2KFNA 3ULDA 3TR8A 3P5JA 1Q8IA 3QEPA 3T3FA 4KPYA 3QLHA 4EP4A 3ZSVA 3TABA 1X9SA 3SUPA 1Q9XA 3EY1A 4FM0A 1IH7A 4OPKA 2VWKA 1VRUA 4JLHA 3SNNA 4LSNA 5KRTA 4DSIA 3MEGA 4F3OA 4DQRA 1VSLA 1A5WA 3TAQA 4B9MA 4ELTA 2KFZA 3VQCA 1RT3A 4ID1A 1L3VA 3NGZA 1RT1A 3V1RA 4LY7A 5KI6A 1DLOA 5I42A 4Z4HA 4JS5A 1VSEA 4DTOA 3L3VA 4IFVA 3HL8A 4R5PA 4DFMA 3SCXA 1TK5A 4EZ9A 1KLNA 1S9GA 1L5UA 4K8XA 2D5RA 3PX0A 3OYAA 1DTTA 1VK0A 1NOZA 2D0AA 3FFIA 3KKRA 3AO2A 3RMBA 2PZSA 4NCAA 2YHBA 3OS0A 2Z1JA 2OPQA 2XY7A 2DTUA 4M41A 5K14A 4O44A 3OYBA 4C8MA 3OJUA 4FJ9A 5FRMA 1GOCA 2YV0X 4NCGA 1TVRA 4CECA 2OZSA 3OYCA 4J2DA 1IKYA 3LWLA 3SUQA 3BDPA 3KTQA 2OPPA 2RF2A 3SJJA 1A5VA 1D5AA 2B5JA 4CHZA 4E7HA 4M3WA 1RTHA 2QKKA 2RPIA 1RTIA 3QEWA 1O1WA 3CG7A 4FM1A 3V4IA 3KD1E 4AHRA 4F4KA 3KLFA 1RBTA 3V81A 1YTUA 1JL1A 1XWLA 4LD0A 1Y97A 4N56A 1HPZA 2I5JA 5T7BA 4DLEA 1X9WA 3L8BA 1GOAA 4DG1A 1RCHA 3OYNA 3QEVA 2F96A 2HMIA 4CEBA 3VQ6A 2KW4A 3CM5A 3NF9A 1SKWA 3DLHA 3SQ4A 4CFCA 4IFYA 3HYFA 3TAGA 3NDKA 4E1NA 4CEFA 4RW7A 3AVHA 4W5NA 4B08A 5J2MA 4HCCA 3DLRA 3HPGA 5C42A 3RR7A 3L2WA 1TKDA 1KVBA 3T1AA 1CLQA 1LAWA 1I39A 4CHQA 4M3RA 4I9QA 4PY5A 3TANA 4OGEA 3QO9A 2HHXA 4O5BA 1C1AA 3KIOA 4CFAA 1J9AA 4QAGA 2PYJA 1JXEA 4DSLA 1D9FA 2F8TA 1RT5A 3WNHA 3LAMA 3C6UA 4CHNA 4CIFA 3TAMA 3RTVA 1UA0A 1WSJA 5CZ2A 3HSTB 3L2QA 4CCHA 4G1QA 3U3GA 2IAJA 3NH1A 4CK3A 4FM2A 1BIUA 2E4LA 4YNQA 3M8PA 2HHVA 1B9DA 1SL2A 3ZSZA 1S1XA 4FZYA 3QIOA 1TK0A 4CF8A 4DTMA 1D8YA 4E7JA 4KKOA 3OYJA 4OGCA 3AVGA 4L8RB 3HM9A 2GV9A 4OKEA 4M42A 1NJZA 3M8SA 4Z4GA 3U6FA 3WNEA 4CJQA 1S1TA 3DLKA 4I2QA 4IBNA 1TKZA 2GUIA 2XRIA 3AVLA 3VQ7A 5KGWA 2IDOA 3K5LA 3VQ5A 4DTNA 4DTJA 1S1UA 1RDCA 3V9WA 3IS9A 4DTUA 4H4MA 5DMRA 5HRRA 1FK9A 3V9XA 2FBVA 3LPTA 1SUQA 1UWBA 1RBRA 3KJVA 1U4BA 5KTQA 1J5OA 1KFDA 3ZT4A 3HPHA 3OYIA 5KGXA 1U04A 3PY8A 4FJ5A 4CFDA 4FJ7A 1QSYA 5JS2A 3THVA 4FJXA 3OYGA 2R7YA 4NCBA 3NH2A 4Z4IA 1JLFA 2HVIA 1IKVA 3MXJA 2X78A 3ZSWA 4AILC 1S1WA 3OYKA 1T8EA 4O4GA 3NBPA 4FW1A 3LANA 1MU2A 2IGIA 3JYTA 4CESA 2BGGA 1K6YA 4DU1A 1HQUA 2OPSA 2P5GA 2HHUA 4CEAA 3HVRA 1S1VA 3DLGA 2Y1IA 4M3UA 3OY9A 3V1QA 3VA3A 4F3TA 1TV6A 1YTAA 1J53A 3SPZA 1CZBA 2XO7A 3DYAA 4RW6A 1C0UA 1DTQA 3ZSQA 4GMJB 3AO4A 2YNGA 3S3MA 3ZSRA 3ZSXA 3PO4A 1VSIA 1T7PA 4DQSA 4PWDA 1GOBA 1REVA 1HYVA 1D9DA 4DQIA 2G8IA 1TGOA 2X6SA 2D0BA 4CEDA 4DS4A 4KHWA 1C0MA 3LZIA 3MECA 1EXQA 3K5MA 4FJGA 3EZ5A 1S9EA 3O3HA 3PX6A 3B6PA 2WONA 2G8UA 1IKXA 3AVMA 2HNZA 3SUNA 3AO3A 4CJUA 3HXMA 3S9HA 4Z4CA 4H8KA 5DK5A 5SZTA 5HROA 4E7LA 3K5OA 4FK0A 4HUEA 4FLVA 1ZBLA 4KHQA 1YT3A 3DMJA 1UAXA 3WNGA 1LV5A 1KFSA 2KTQA 2Z1HA 3TI0A 1RT2A 2A1SA 1CXQA 4W5OA 3ZT2A 2D0CA 4F2SA 1KRPA 4FLXA 4E89A 3HJFA 3QEXA 3C95A 3O4QA 3KLEA 4E1MA 3L2UA 2LSNA 3AVBA 1NK4A 1L3UA 1JLQA 4FW2A 3KLGA 1WSGA 1WN7A 3T19A 1BI4A 3ITHA 3BGRA 5HP1A 4KHUA 4CGGA 3CM6A 3SQ1A 1HYZA 4DTSA 2YNFA 1FKOA 3HP6A 3OVNA 1BHLA 4E0DA 1B92A 5FROA 4QOZB 3M8QA 5CYMA 4OLAA 2EHGA 4ELUA 2G8WA 3SUOA 3EYZA 3OYHA 1TL3A 3QERA 1EKEA 3LPUA 4CK1A 1LW0A 5CZ1A 3V1OA 2F8SA 3P83D 4I2PA 4CGJA 3DOLA 3SPYA 3NF8A 1IO2A 2G8KA 4N76A 2ITGA 3HP9A 3PUFA 4CF2A 4JS4A 3F9KA 4E7IA 4N5SA 1JLGA 1QSSA 4KHNA 1SKRA 3L2RA 4KV8A 4CJFA 2HNYA 5HBMA 1U48A 3VQ4A 1HQEA 4CJVA 5HRPA 1HNVA 4UQGA 4DWIA 4AHUA 4ZTJA 3PO5A 3O4NA 5J1EA 4CJRA 4E7KA 5CY4A 1R0AA 2BDPA 4WE1A 2KZMA 4DSEA 3TAEA 3AA3A 3E01A 3VQEA 3P1GA 2A1RA 3AA5X 3NGIA 1TKXA 4FJMA 3K57A 3G10A 2KQ2A 3TAPA 4KAZA 2QK9A 4PQUA 3ASMA 4H4OA 3H08A 3KLHA 4B8CA 2P5OA 2XY6A 4AHTA 4M3TA 4HUFA 1W0HA 2RKIA 3K59A 3RRHA 4KB0A 4CJ5A 5J2PA 5KRSA 4NYNA 3MXMA 4DTPA 1BQMA 3C94A 3NE6A 4B9VA 4Z0UA 2G8HA 1EX4A 5FRNA 1JLEA 2YNHA 3NAEA 3D45A 1C0TA 1SL0A 4FJHA 1ASVA 1XHXA 4HUGA 1LWEA 4DMNA 1SKSA 2FBYA 1Q9YA 2P1JA 5D3GA 2B6AA 4ID5A 4BWMA 3DRSA 3RMCA 4N41A 1KVAA 4FZZA 1NK6A 2BANA 2Q3SA 3PX4A 4IG3A 4CHYA 4O0IA 1T05A 4CJEA 1ZBIA 1ZBHA 1B9FA 4C8LA 4J2BA 4ZHRA 1NK8A 4OLBA 4C8OA 1RDAA 4GW6A 2AJQA 1BL3A 4KFBA 4RW9A 1NJWA 4CGIA 1L3TA 4FLWA 3QETA 1ZBFA 5HLFA 4RG8A 5C25A 2OYQA 4O0JA 3NF7A 4BWJA 4CJWA 4FLTA 1F21A 3MEDA 1YVUA 1A5XA 2G8FA 2P51A 1LWFA 2ATQA 4KTZA 5EU7A 3OJSA 3SV4A 3SYZA 3U3YA 4M45A 1KSPA 1WSEA 4CF9A 1WSIA 4FXDA 4QCLA 4FJ8A 4ELVA 3SQ0A 1KTQA 3TARA 1NK5A 4PUOA 2E6LA 3SZ2A 1L3SA 2QXFA 3VQQA 4BDZA 3O3FA 1JLAA 1RILA 3K5NA 3PV8A 1WSFA 3DLEA 4BDPA 1RBVA 4J2EA 1RTDA 1QQCA 4AH9A 3K2PA 1FXXA 5J2NA 3QEIA 3S3OA 1HYSA 4FLUA 3NH0A 1TK8A 3LP2A 1TL1A 3OS2A 1C1BA 4IKFA 4CJPA 2G8VA 1KVCA 4CF1A 3CYMA 4OKKA 1QE1A 1EP4A 3OYFA 1RT7A 1TAQA 1VSFA 4I9LA 4CJTA 3V9UA 4Q0BA 1KCFA 1BGXT 2OPRA 4M3XA 2YKNA 1HMVA 4J2AA 3I0SA 3OYMA 3QNOA 4IG0A 1SV5A 5HRSA 4KI4A 3B6OA 1RTJA 3RR8A 4DTRA 4N47A 3ZT3A 2HHWA 3ALYA 1U45A 4DSKA 2HVHA 1LWCA 1UA1A 1X1PA 4E3SA 4BE0A 2DFFA 2E6MA 3KLIA 3LAKA 4RW4A 4CGHA 4DS5A 1HJRA 2O4IA 1I3AA 3VQBA 2YKMA 4KHSA 2XY8A 3I0RA 1ZYQA 3F73A 3V9SA 3MAQA 3CFOA 3AA4A 3D0PA 1JKHA 4CJKA 5CYQA 2OZMA 1EETA 1QS4A 4C8KA 2DFEA 4W5QA 2Z1GA 4I7FA 4FYDA 3RRGA 3SQ2A 1JLCA 2B4JA 4KRFA 2VWJA 4DFKA 3AVFA 3V6DA 3AO5A 3IRXA 4DQQA 2Y1JA 3WNFA 2HHTA 4CEOA 4CHPA 1CXUA 3I8DA 1UOCA 2VG7A 4KTQA 4CJSA 2EX3A 1WAJA 2IOCA 3AVIA 1N5YA 4B9SA 5JS1A 4DF4A 1S5JA 3TWHA 3RWUA 1KLMA 4FJLA 4OPJA 4CJ3A 4JRQA 4CGDA 3HO1A 4B3OA 4B9LA 4HVJA 5C24A 4OVLA 3ZT0A 3S3NA 1NOYA 4FK2A 1RBSA 2HHQA 3QIPA 1RDDA 3DLBA 1QHTA 1RBUA 2GBZA 4B8AB 3AV9A 3NF6A 4Z4EA 3SI6A 1IKWA 3AO1A 1LAVA 2JLEA 4OJRA 4XIUA 1XC9A 1NKBA 4DTXA 4HHTA 4FZXC 4TSXA 3AVCA 1NKEA 3NGYA 1VSHA 1BCMA 4KI6A 2FBXA 4KTWA 3AVAA 3DM2A 4MQ3A 2ZD1A 2HNDA 1G15A 3IAYA 3CFPA 4B9NA 3ZT1A 3DRPA 3OYLA 1NJXA 4M3ZA 3ISNC 3VQAA 4ICLA 2X6NA 4YFUA 3QESA 4DLGA 1W9HA 1QSLA 2PY5A 4FJIA 4CJLA 4KREA 4EP5A 2BE2A 5HRNA 3DOKA 4DSJA 3HT3A 3RMAA 3VN5A 3MEEA 3IG1A 3OYEA 4F2RA 4CK2A 2ETJA 2XHBA 1T03A 1NJYA 1LW2A 2DFHA 4B9TA 4LH4A 2HW3A 4CJ4A 4ZTFA 2FC0A 1N6QA 2VG6A
chains in the Genus database with same CATH superfamily
1FW6A 4IXCA 4BRIA 1Z26A 3PSIA 2A5XA 5GAGP 1OH8A 1ASWA 3IMXA 3C6AA 2NRHA 1NK0A 2QWPA 1BI4B 4Y1CA 3VQPA 4ILJA 4DU3A 1RNHA 3OYDA 1X9JA 4BDYA 4E19A 4RW8A 2WOMA 3ID6A 4KO0A 3QNNA 3P38A 1VQON 5J2QA 4LF4K 4JHDA 1VSDA 3F9MA 4DUYK 4OKJA 3M8RA 2A3ZA 1Z25A 1S6PA 3K58A 1HPMA 3O3GA 4A5BA 3ZCMA 3VETA 4PL8A 1QTMA 4IO9L 2EWSA 3TAFA 3H45C 3SMPA 4NLCA 1WB9A 3DI6A 4PA1A 4DQ8A 3IFRA 1RT4A 3CFRA 4WFBL 3WEEA 4XEIA 4Z4FA 4FJKA 4H5VA 4CIEA 3VQDA 4Y1DA 1Q18A 3O80A 5M1QA 4FLYA 4DU4A 3ZSOA 2P9IB 2JGUA 4Q5VA 1NM1A 1SZ2A 5AQZA 3WUHA 3NCIA 1NK9A 4W5TA 3TR8A 3QLHA 5F2RA 1T3VA 3VESA 4L3QA 4FM0A 3E1YA 2VWKA 1VRUA 3H6EA 4JLHA 4JHDB 4LSNA 5KRTA 4IEIA 5C12A 4ID1A 2PBDA 3NGZA 5KI6A 1DLOA 4NB4A 5LY3A 1VSEA 3HBTA 4LFCK 3ENOA 3LDOA 1Q81O 4JK7A 1VK0A 1NOZA 1P8ZA 2D0AA 3AO2A 3CC7N 2YHBA 3OS0A 4DCHA 4JKCA 4B1XB 1TVRA 4CECA 3OYCA 4J2DA 1IKYA 1NGFA 5M1KA 3SUQA 1A5VA 1D5AA 2E2OA 4FOIA 3WQUA 4E7HA 5AQSA 1NWKA 1RTIA 3V4IA 1NGGA 3UKUA 4AHRA 2YHYA 3VEXA 1YTUA 4LD0A 1Y97A 4BRQA 1HPZA 3L8BA 4DG1A 3CC2N 1KAXA 1OKJA 1OVQA 3CM5A 3DLHA 3O8MA 1M1KO 3MCAB 5AZJB 3TAGA 4PHTX 5J2MA 2O8CA 3TSUA 4BR2A 2WFBA 3J7ZO 2PFUA 1CLQA 1KD1O 1QQNA 3RSEA 1YVNA 3CC4N 4O5BA 3KIOA 4QAGA 3GG4A 4CHNA 1BWFO 3TAMA 1UA0A 3L2QA 3HSTB 1E4FT 1BA1A 3U3GA 4G1QA 3VEWA 2HHVA 2E4LA 4YHHK 1B9DA 1TK0A 2IVNA 1D8YA 4KKOA 5GIPA 4OGCA 1TUUA 3AVGA 1KAZA 4IOXA 4WYBA 4L8RB 1NJZA 4Z4GA 2PAVA 4B3TK 2GUIA 2J4RA 5B8HA 2P9UA 4CI6A 4DTJA 3D6RA 3D2EA 3IS9A 1LCUA 5LMNK 3V9XA 4DUZK 2O8DB 1U4BA 5KTQA 3OYIA 2ZWHA 3THVA 4NCBA 2HVIA 2R7YA 1JLFA 2X78A 4AILC 4AQYK 1MU2A 2BGGA 1K6YA 2Y1IA 3V1QA 1TV6A 4DV3K 3LDQA 4RW6A 1C0UA 4IOCL 2YNGA 3LM2A 1KQSM 4DQSA 1HYVA 4DQIA 1C0MA 1YF5L 1EXQA 3MECA 4PKGA 3K5MA 2G8UA 4B3RK 1IKXA 4KH6A 3CCVN 4BRMA 4CJUA 4Z4CA 1JJ2M 3Q7BA 2FLOA 5F0XA 2NZTA 4HUEA 3DMJA 1LV5A 4M63C 3UKRA 3TI0A 1P90A 1RT2A 1VQ8N 3O08A 1N33K 2F9WA 1KRPA 2O8BB 5BPLA 2D0PA 4PKIA 4A59A 3QEXA 3O4QA 5ADXA 3HJFA 4E1MA 4JD2B 1GLCG 3AVBA 1NK4A 3PLAA 1WSGA 1VQ6N 3BGRA 3R6MA 1HYZA 4H5WA 4DTSA 2YNFA 1FKOA 3HP6A 1K8KA 4E0DA 3HOSA 3WQTA 4QOZB 3CPEA 4IO8A 4OLAA 2G8WA 3SUOA 3QERA 1BO5O 1TL3A 3VTHA 4DHYA 5GIOA 5AQTA 4CK1A 5CZ1A 1GLDG 3C7NA 3V1OA 3ULEB 1BU6O 4YY3K 4JS4A 2FXUA 4E7IA 1MWKA 4JKHA 3L2RA 4KV8A 2HNYA 1HQEA 3ZYYX 1HNVA 5J1EA 4E7KA 5CY4A 4WE1A 4K25A 3R3LA 3VQEA 4BC5A 3AA5X 3DXKA 3G10A 2QK9A 3ASMA 4H4OA 3KLHA 4B8CA 1W0HA 2RKIA 3OBWA 4JKGA 3MXMA 4DTPA 1RDWX 4B9VA 3O6WA 4Z0UA 3QFPA 1JLEA 4JEPA 1YXQA 4HUGA 4K42A 2B6AA 4ID5A 5JVGL 4BWMA 4B1VA 2VQEK 1VQKN 4FZZA 2BANA 4IG3A 4A2AA 1ZBHA 2VCPA 4OLBA 4GW6A 2UUCK 4RW9A 1DT9A 3NF7A 3G71N 2P51A 3SYZA 1KSPA 3SV4A 3ZX0A 4BR4A 4M45A 4CF9A 3W0LA 1NK5A 1HX1A 4PUOA 2E6LA 3SZ2A 2E88A 4C1NK 4BDZA 4WFNL 1KC8O 1U6ZA 3O9RA 4BDPA 5J2NA 3S3OA 4BRPA 4FLUA 4IKFA 3VPZA 4WQ5C 4JKAA 4QS7A 4FPBA 3CYMA 3SBGA 2W6LA 4OKKA 1QE1A 3CD6N 1RT7A 4Q0BA 3QNOA 5HRSA 3ZETB 1RTJA 5FPMA 3RR8A 4N47A 3ALYA 4EAHD 1U45A 3P39A 1LWCA 4BY9C 1YUWA 1NG9A 4IEEA 3LAKA 3DJCA 4CGHA 2O4IA 1I3AA 2YKMA 4KHSA 3I0RA 3GDQA 4DR4K 3MAQA 1NGAA 2QWRA 3D0PA 4NLBA 3MWPA 3H1VX 1QS4A 3FGUA 1VQMN 5AFUA 4NXMK 2Z1GA 1YI2N 2E1ZA 3MN9A 3AVFA 4CZFA 3AO5A 4IFEA 2Y1JA 2HHTA 4YDUA 1Y64A 2VG7A 4KTQA 1WAJA 1NGEA 1S5JA 4B3OA 5CE3A 4CJ3A 4B9LA 4HVJA 4GV6A 4DR5K 1NOYA 4PKHA 3TSPA 1RBUA 1ZXOA 4Z4EA 3AO1A 4OJRA 1XC9A 4BR0A 1SAZA 4FZXC 1QZ5A 1NKEA 3O1WA 1DKGD 4GY2B 3CIPA 3ZT1A 3DRPA 2X6NA 1E3MA 3ATUA 4EHUA 5LMUK 2PY5A 4FJIA 4IJNA 4U67L 2W6KA 3CCJN 5GAHP 4F2RA 2HSTA 4CK2A 2HW3A 1LW2A 2DFHA 5EOYA 3CCLN 4HWIA 3D2FA 4JI1K 3CQXA 4FO0A 1EWRA 3HM8A 3BF1A 3CERA 5FDLA 1BQNA 3KKSA 5I9EB 4KH5A 1MWMA 5AZIA 4JYAK 5CHIA 3A5MC 4CJ7A 1W2BM 1C0GA 3NHGA 4I6MA 4FJJA 1NGBA 1TKTA 3FLCO 5E41A 1TUYA 4BGBA 3AVJA 4JI8K 5JMVA 3KK1A 3BUZB 2E2NA 5GAEP 3CCUN 4KHPK 3CHWA 3OS1A 2KZZA 1ATSA 3R9PA 1SS6A 3TTFA 3JAMO 3NFAA 3A5NC 3VEYA 2IC3A 2FBTA 3LP0A 2HHHK 1S6QA 3V9ZA 3QINA 5BR8K 2CH5A 4C23A 1BISA 3LP1A 4CZKA 2UXDK 4E1JA 2CH6A 3MWTA 3CPWM 2YHXA 2KHOA 3KK2A 4O55A 2RN2A 4AHSA 1ATRA 2HB5A 1FKPA 1JLBA 4CIGA 4FVMA 1ILYA 2YNIA 4KB1A 2ZQBA 1IBLK 1IV0A 2YHAA 1VSMA 3KD5E 3C6TA 3C6HA 4DR1K 1OH6A 4A62A 3WXMB 2O8EA 3LZJA 4DSFA 4KHYA 2UUBK 3KK3A 3ZEUA 1N32K 3MCPA 5GINA 1JXBA 3AA2A 3A2FA 3EZWA 4CEQA 1Q8IA 3QEPA 1U2VA 5LJWA 4KPYA 3TABA 1X9SA 1NMNA 1IH7A 3H3NO 5JVHL 3WXKA 4BVOA 4F3OA 3MEGA 4B9MA 2A41A 2ZGYA 3VQCA 1RT3A 3O4WA 5I42A 4JI3K 5TKWA 4M3XA 4IFVA 4DFMA 4JKBA 1KLNA 1S9GA 4K8XA 4CBUA 5AQOA 2DTUA 4M41A 3OYBA 4O44A 4FJ9A 2VGNA 5FRMA 2OZSA 3QFUA 5LJVA 3LWLA 3BDPA 2OPPA 3SJJA 2B5JA 1RDUA 4M3WA 2QKKA 4WQ4A 4OO1J 5BREA 4FM1A 1K8AO 3C65A 3SMSA 4F4KA 3V81A 1XWLA 4B1YB 1GOAA 1RCHA 4FWSA 2F96A 2KW4A 1SKWA 3SQ4A 1XMQK 3HYFA 3U4LA 1QVGM 2P9KB 3AVHA 4A57A 1H1VA 3LL3A 5M1OA 1TKDA 4BG9A 4JN4A 3ENHA 4CHQA 1I39A 3KWIA 1XNRK 4OPAA 4CFAA 1TYQB 2PYJA 3LAMA 4BC4A 4CIFA 1ZC6A 1WSJA 5CZ2A 4CCHA 3EKSA 2IAJA 4KBOA 1BIUA 4YNQA 3CCEN 2ZJPL 3ZSZA 4CF8A 1VQ4N 4DV4K 3CJCA 3HM9A 4OKEA 2JWKA 4GKJK 1S1TA 3DLKA 3VQ7A 1BA0A 3VQ5A 4DTNA 1RDCA 2UYTA 1VQLN 4DTUA 1NGCA 1FK9A 2FBVA 3LPTA 1SUQA 3KJVA 1J5OA 1KFDA 3HPHA 4DKWA 5KGXA 1DEJA 3PY8A 4FJ5A 2QEXN 1QSYA 3OW2M 3OYGA 1IKVA 4MLEA 1S1WA 1T8EA 4FW1A 5FPDA 4CESA 3AAQA 4LFBK 1JCEA 2HHUA 1S1VA 4M3UA 3EEQA 4F3TA 4XH4A 1J53A 3DYAA 1DTQA 4EFHA 4DV0K 3ZSXA 1VSIA 3LDPA 3IUCA 4MDBA 4KHWA 3HTVA 4XH1A 1NGHA 3EZ5A 5A2QO 2WONA 3AO3A 3OTOK 3TPQA 3S9HA 5DK5A 3MX2A 4E7LA 4FLVA 1XC3A 5AQXA 2Z1HA 2V52B 3MX5A 2A1SA 4W5OA 3ZT2A 4F2SA 2QWLA 4FLXA 4H0OA 3J8AA 3ZX3A 3KLGA 3ITHA 1N34K 4CGGA 1S22A 1BHLA 3MMVA 3M8QA 5CYMA 5FPEA 2EHGA 4ELUA 4FWQA 1HNXK 4G9ZA 3CMAN 1VAZA 2RE2A 1EKEA 3LPUA 3WEEB 1LW0A 3P83D 4I2PA 3SPYA 3NF8A 1IO2A 3SAGA 4CF2A 3CCRN 1JLGA 3CF5L 1S72N 4CJFA 5MLCQ 1U48A 4DWIA 3AGKA 1KXPA 3ENBA 5C0YA 1HNWK 4AHUA 4RCHA 3A5LC 4IWVA 4DV6K 3GBTA 2H3GX 4AF1A 3P1GA 3NVKA 1OH7A 4PQUA 3J80O 5EVZA 3U9ZA 3H08A 2D4WA 4XH5A 4M3TA 4HUFA 5EY4A 4CJ5A 3C94A 1EX4A 3D45A 1C0TA 4FJHA 1XHXA 4DMNA 5D3GA 1Q9YA 2FBYA 3O1BA 2P1JA 4LFAK 1NK8A 5BN9A 1BL3A 4KFBA 1L3TA 4FLWA 3QETA 4CJWA 1IBMK 1F21A 1A5XA 3U3YA 3JS6A 5EU7A 3UKUB 1WSEA 4QCLA 1KTQA 4YOUA 5JLFA 2QXFA 3O3FA 3I8BA 3VEZA 4YORA 1WSFA 5M1NA 2O8CB 4AH9A 1FXXA 1HYSA 3NH0A 1C1BA 1HR0K 4UY8O 4YOXA 2G8VA 3RSEB 4BGAA 4CF1A 1N8RO 2WBNA 2QW9A 1TAQA 1VSFA 3THXA 2HF3A 5AQFA 1HMVA 4IG0A 1YHQN 1SV5A 4KI4A 3ZT3A 4DSKA 4E3SA 1BDGA 3EE9A 3KLIA 2HHQA 3F73A 2IIRA 1GLFO 2P9UB 3D2EB 5CYQA 3PIPL 4B1WB 2DFEA 3IKMA 4I7FA 4MDAA 1JLCA 3SQ2A 2P9SA 4CVNE 3GE1A 3FE1A 2P9LA 5AQJA 4CHPA 2QI2A 3AVIA 2UUAK 3DWLA 4B9SA 5JS1A 4FJLA 4MLHA 4CGDA 1WUAA 4X64K 4JKFA 4FK2A 3QIPA 1RDDA 3O5BA 3AV9A 3SI6A 1IKWA 1IBKK 1WOQA 2O8FA 3AVCA 3L6QA 4KI6A 2FBXA 3AVAA 1G15A 3IDHA 4B9NA 3CQYA 4ILGB 4O5FA 4CJLA 4H5RA 2BE2A 3DOKA 4CW7B 3RMAA 3MEEA 3THWA 1T03A 4CZLA 1NJYA 2ITMA 2OTLN 1N6QA 4H5NA 3UKRB 4YDUC 3VQ9A 2VG6A 4NXNK 3DLLL 3TSQA 1BIZA 4DF8A 3I55N 4CFBA 3E66A 4CBXA 3ZSYA 4BACA 2IS3A 4ISGA 4CEZA 1ASUA 1VSKA 5C10A 3SV3A 1K8KB 4QS9A 2NRXA 1RT6A 2QKBA 3LWMA 2VG5A 2OA8A 1BCOA 4CZJA 3CJ1A 4YOVA 3C7NB 4GVMA 1T6CA 5CR4A 2HBLA 2XY5A 2P9NA 2E2PA 2PYLA 3O9UA 2DY4A 1O13A 1ZBUA 3B8AX 1JL2A 3AAPA 1U47A 1K73O 4CZMA 4AHVA 1C0FA 4EZ6A 1RDBA 4DFJA 4FJNA 1S3XA 2X74A 4BE1A 4U7BA 3UIQA 3MN5A 3VF4A 4CHOA 4BR9A 3QDKA 4MFBA 1IG9A 3DXKB 4CE9A 3VQ8A 4HCBA 5I3UA 3JSMA 4FK4A 3UE5A 2W42A 2ZE2A 3EO3A 3LDSA 3LP3A 1HUXA 3G0ZA 3R8EA 3L3UA 3RMDA 4LSLA 3TTDA 4BR5A 2NUBA 4JKGB 1SL1A 3MXIA 1VRTA 4JK8A 1YAGA 4JI4K 4M3YA 4JV5K 1J54A 4CEEA 2Z1IA 2E20A 4DB3A 2FSNA 4C8NA 3AVNA 4YOYA 1X9MA 3LALA 2ASMA 2WC9A 4AM7A 3VF6A 4DFPA 4CF0A 3A8YA 4BVPA 2QXLA 4LF7K 2QWMA 5BR9A 2KFNA 3ULDA 5C2DA 3T3FA 4EP4A 3ZSVA 4BREA 3SUPA 1Q9XA 1VQ5N 2RHKA 4B3MK 2YJEA 4OPKA 3DXMA 3SNNA 4DSIA 1ESVA 3K9JA 3K0SA 5AQLA 3WXLA 4DQRA 4ELTA 5ELZA 3J81O 1L3VA 1RT1A 3M5RA 4Z4HA 1TK5A 4EZ9A 3G25A 3WT0A 2D5RA 1DTTA 3KKRA 3W3DA 2PZSA 4NCAA 2Z1JA 2XY7A 3OJUA 3QICA 4NCGA 3T1YK 3T69A 3KTQA 2RF2A 4CHZA 1RTHA 2RPIA 3TTCA 4C1NI 3CG7A 3KLFA 3UB5A 1JL1A 2WUSA 4N56A 3KWGA 3VERA 5T7BA 3SJHA 1XMOK 4FVUA 2HMIA 3NF9A 3E9PA 4IFYA 5JLHA 4M7XA 4CEFA 4RW7A 4W5NA 2F7TA 3VENA 5ADXH 1WBDA 3HPGA 4HTLA 2A40A 3L2WA 3L0QA 1KVBA 4I9QA 4F9OA 4IZ9A 3TANA 3EL2A 4B1ZA 3DXMB 1J9AA 5F1XA 1JXEA 1NGDA 2BUPA 4FL9A 3RTVA 4MO4A 3WNHA 3C6UA 2F8TA 3L4QA 4Z94A 3K9KA 3M8PA 5AQVA 2V7YA 1SL2A 1S1XA 4BQZA 4FZYA 4DTMA 3OYJA 1Z05A 4A5AA 3R1XA 3M1FA 4WQ4C 4M42A 1GLBG 1VQ7N 3SLCA 3M8SA 3U6FA 3WNEA 4CJQA 4JI5K 4I2QA 1TKZA 4H0VB 5KGWA 2IDOA 2VGMA 2FSJA 1S1UA 3V9WA 4H0XB 4DV1K 3T1HK 2F4VK 1GLEG 4GNIA 3C0BA 5AJ3K 2OANA 1RBRA 2P9PA 2A42A 5TKYA 2YCHA 4B3SK 1U04A 4FJ7A 4CFDA 3NH2A 3ZSWA 3D2FB 3NBPA 5AQPA 1GLLO 1VHXA 3WXJA 3LANA 4K41A 3JYTA 1YITN 2V7ZA 3KK7A 1HQUA 2OPSA 5KPTA 4CEAA 3LM9A 3P4IA 3HVRA 3OY9A 3VA3A 4CBWA 4IDHA 2I7NA 3SPZA 2XO7A 5AZIB 2Q97A 3S3MA 1BOTO 4I6MB 1T7PA 1GOBA 1REVA 2G8IA 1TGOA 2X6SA 4CEDA 4DS4A 4FJGA 1S9EA 4LC9B 3O3HA 4BR7A 2HNZA 3HXMA 4H8KA 3S41A 5SZTA 4FK0A 4KHQA 2HF4A 3CCQN 3WNGA 1KFSA 1VQ9N 4JAXA 1NNEA 1CXQA 5IWAK 5LL6Z 3BZKA 4E89A 3C95A 1OH5A 3ATVA 2LSNA 4ISEA 1L3UA 4FW2A 1WN7A 1BI4A 5HP1A 3JXUA 1HJOA 4LF6K 5E26A 5C2FA 1B92A 3MK6A 5AQYA 3OYHA 4H0PA 1XQSC 2NRTA 4BRHA 2FSKA 3AARA 4J8FA 3ID8A 2O8EB 1R59O 2G8KA 2ITGA 3PUFA 3F9KA 1SKRA 2ZJQL 2OCEA 3VQ4A 4UQGA 3ZEUB 4X65K 3DAWA 3O4NA 4ZTJA 3PO5A 4BRFA 4CJRA 2BDPA 5AFUH 1YJ9N 2KZMA 2I7PA 4DSEA 3AA3A 3TAEA 1U2VB 3E01A 4FWMA 1VQNN 3H3OB 1TKXA 2KKZA 4QS8A 2FF6A 3WXIA 4PL7A 4RWTA 3NGIA 3K57A 4FJMA 2KQ2A 3TAPA 4KAZA 4DR6K 4YOTA 3EE8A 3M6GA 4AHTA 3K59A 1EO1A 2DPNA 3VGLA 5J2PA 3U9DA 4NYNA 5KRSA 1BQMA 4DR3K 2G8HA 5KQ8A 3J7YP 5FRNA 3NAEA 1SL0A 1ASVA 2GEMA 3G4SN 3GL1A 3NVMA 3DRSA 4N41A 5HOOA 4O0IA 4CHYA 1T05A 2P9IA 4M7YA 1B9FA 3PIOL 4J2BA 4ZHRA 4C8OA 1RDAA 3F5TA 2YHWA 2HBJA 3QB0A 4YOWA 1QQOA 3CJBA 5AQNA 1NJWA 4CGIA 1MA9B 4RG8A 4O0JA 5FPNA 3KVGA 2AP1A 4OX9K 2G8FA 1BUPA 1WSIA 4FXDA 1Z6RA 4ELVA 3SQ0A 4FPAA 3P31A 2OTJN 3A0IX 1NU0A 2AA4A 1JLAA 3LDLA 2ZF5O 3PV8A 1RBVA 1T44A 5AQRA 1QQCA 3QEIA 3HZ6A 1TK8A 1QVFM 1J6ZA 3F2KA 4FWKA 4B9QA 1M90O 1KVCA 4LF5K 1NGIA 5HL7L 3OYFA 4I9LA 4CJTA 3V9UA 1KCFA 1BGXT 2OPRA 2YKNA 4J2AA 2E2QA 5DM6L 4LF8K 4R79A 1HNZK 1SQKA 1X1PA 4BE0A 2DFFA 4RW4A 1HJRA 4JNEA 3VQBA 2GUPA 3V9SA 3CFOA 3AA4A 5AZJA 1JKHA 4CJKA 2YI1A 2OZMA 1EETA 1LOTB 4JI6K 4C8KA 4W5QA 4DV2K 4WCEL 2CGLA 3FZHA 5DM7L 4FYDA 2B4JA 4KRFA 2HMPA 2VWJA 5C15A 4DFKA 3WNFA 2KLAA 4CEOA 1GLAG 4CJSA 3RWUA 1KLMA 3HO1A 1V4TA 5C24A 4OVLA 3S3NA 1RBSA 3DLBA 4B8AB 1YJWN 5EX5A 2JLEA 4XIUA 1NKBA 1BG3A 2NRZA 3NGYA 4GVEA 1BCMA 2HBMA 4KTWA 2W41A 3CFPA 3OYLA 1NJXA 3VQAA 4YFUA 4DR2K 3CJ7A 5BPNA 3CETA 2O8DA 4BRAA 3ZX2A 1W9HA 1NGJA 4BG8A 2QWOA 2QWQA 4EP5A 5HRNA 3HOTA 4DSJA 5BRFA 1HKBA 1NMDA 1N36K 3VN5A 3OYEA 3IG1A 2ETJA 3OHRA 4OPHA 3L4IA 3U8XA 1WBBA 3BY5A 1RFQA 1XNQK 1C1CA 1ITGA 4HTUA 1WAFA 2ZGZA 1YIJN 1WSHA 1QHAA 1KAYA 1NKCA 4LH5A 4FCYA 5AR0A 4CD3A 3VA0A 3FFKB 1NK7A 1VSJA 1HNIA 3BP8A 3HVTA 2Q2RA 4K8ZA 1ATNA 5AQHA 1HRHA 3FR0A 1IG8A 4JK9A 1WNSA 1C6VA 2NLXA 1U49A 3L2VA 3BF3A 1G99A 4AHCA 3D7EO 5IT9O 4NYFA 4B9UA 2ASOA 3CQ8A 2O8BA 1TAUA 2WTUA 4BE2A 3HK2A 3CI5A 4JD2A 2VQFK 4O8KA 4DQPA 2HHSA 1ZBSA 2O4GA 5SWMA 5BN8A 4FWOA 4W5RA 3AVKA 3HPOA 3DRRA 5BPMA 2D0OA 5BRHA 1XUPO 4FLZA 1K9MO 3ULEA 2GWJA 5M1PA 1WLJA 4LF9K 3HRGA 2ZJRL 2CGKA 4JI2K 3TU5A 1XI1A 1CZ9A 1XHZA 4JRPA 1HKCA 4F8RA 4AM6A 4CERA 1GLJO 5KPZA 3PSFA 4CGFA 4IDKA 1D4XA 3P5JA 3EY1A 1HKGA 1VSLA 2ZM6K 1A5WA 3TAQA 2KFZA 3V1RA 4LY7A 4GV3A 3AGRA 1CZAN 4JS5A 2HOEA 4DTOA 3L3VA 4R5PA 3HL8A 3SCXA 4JI0K 3SAHA 1L5UA 3PX0A 3OYAA 3FFIA 4GKKK 3RMBA 4H0TB 2OPQA 5K14A 4C8MA 1GOCA 2QM1A 2YV0X 3VF2A 4ILHA 3VEOA 3GOIA 5GADP 3THXB 1X3MA 2ASPA 3QEWA 1O1WA 3VGKA 3KD1E 3QBWA 1RBTA 4A61A 2FF3B 2I5JA 4DLEA 4H5TA 1X9WA 3QEVA 3OYNA 3MN7A 1VQPN 1I94K 4CEBA 3VQ6A 3RVCA 4CFCA 3THYA 3NDKA 4E1NA 1DGKN 4B08A 4HCCA 3DLRA 1QZ6A 5EXWA 5C42A 3RR7A 3T1AA 2P9SB 1LAWA 4Y0WA 4M3RA 4PY5A 4OGEA 2CGJA 3QO9A 2HHXA 1C1AA 5AQMA 3I56N 2P9LB 4DSLA 1D9FA 1RT5A 1Q86O 1J5EK 3MDQA 4FM2A 3QBXA 4CK3A 1RGIA 4FWLA 3NH1A 3QIOA 4BRKA 1YJNN 4E7JA 4CZEA 3ZETA 2D1KA 4CZGA 2GV9A 5AQKA 3H46O 5FLXO 4IBNA 2XRIA 4K0KK 3AVLA 2O8FB 2UXBK 3K5LA 4BRNA 2BTFA 3SBTA 3CCMN 4H4MA 5DMRA 5HRRA 1UWBA 3N4PA 3SAFA 3ZT4A 3QMLA 4ISFA 5JS2A 4FJXA 4KH4A 4Z4IA 3THWB 3KHYA 4IOAL 2Q36A 2GELA 3BZCA 3M3ZA 3MXJA 3OYKA 3THYB 4O4GA 4DR7K 3VTIA 2JWLA 2IGIA 3J7AP 3CCSN 3KZBA 4DU1A 2P5GA 3CJAA 1W7AA 3DLGA 4IJAA 4BRDA 4DV7K 1YTAA 3A5OC 3CMEN 1CZBA 5H1SQ 3ZSQA 4GMJB 1IJJA 3AO4A 3O9QA 3ZSRA 3PO4A 1JCGA 4PWDA 1D9DA 2D0BA 3LZIA 1MDUB 2BH1A 4X62K 3PX6A 3B6PA 2Q0RA 3AVMA 3SUNA 5AQIA 5HROA 2P9NB 3K5OA 1ZBLA 2IVPA 1YT3A 1UAXA 3AY9A 2KTQA 3HSCA 2Q0UA 3O9TA 5M1FA 2D0CA 4EIAA 2HBKA 1FJGK 3KLEA 3L2UA 1JLQA 3FZLA 3T19A 4KHUA 3CM6A 3SQ1A 3ZLJA 1T6DA 2YX6A 2F9TA 3H1QA 3OVNA 3E9OA 5FROA 3EYZA 4B1UB 4A2BA 4FSVA 4FWRA 4BC3A 2F8SA 4EHTA 4CGJA 2GTDA 4RTFD 2QTDA 3DOLA 3Q7CA 4N76A 3HP9A 3NMUA 4N5SA 4KHNA 4O8UA 2NRRA 5HBMA 2E8AA 4CJVA 5HRPA 4JI7K 2VWBA 4DV5K 1R0AA 3EKUA 4BRCA 1NJIO 2A1RA 2QWNA 3HI0A 3I33A 4FWPA 2P5OA 2XY6A 5AQQA 3RRHA 4KB0A 3BEXA 1NLVA 3NE6A 2IVOA 3SK3A 5BRDA 2YNHA 1JCFA 2QA4N 1LWEA 1SKSA 4WQ5A 3CJ9A 5KQDA 3RMCA 1KVAA 2E1YA 1EQYA 2Q3SA 3PX4A 1NK6A 1ZBIA 3VEVA 1EWQA 4CJEA 4C8LA 2AJQA 4WF9L 5AQGA 4JKDA 4K43A 1ZBFA 5HLFA 5C25A 2OYQA 4BWJA 4FLTA 1V4SA 3MEDA 1YVUA 4FWNA 1LWFA 2ATQA 4KTZA 3OJSA 1Q7YO 2E5LK 4FJ8A 3OA9A 3TARA 4WFAL 1L3SA 1HLUA 3VQQA 1RILA 3K5NA 1W97L 2NRWA 3DLEA 4J2EA 5AQWA 1RTDA 3T7ZA 3K2PA 3VGMA 3EN9A 4BROA 2UU9K 2Q31A 3LP2A 1TL1A 3OS2A 4CJPA 4NO7A 3VMFB 1EP4A 3G6EN 4CZHA 2GX9A 4JKEA 3CXCM 2UXCK 3I0SA 3OYMA 3B6OA 4DTRA 1QQMA 2HHWA 4H0YB 2HVHA 4CZIA 1UA1A 4FOEA 2E6MA 2YJFA 3E9LA 4DS5A 3LDNA 2V51B 4MO5A 2XY8A 1ZYQA 3FZMA 2Q1NA 2P9KA 3N4QA 5KPRA 4GV9A 3OBYA 3O9SA 3RRGA 2P9PB 3V6DA 3IRXA 4DQQA 1TYQA 3FZKA 1CXUA 3I8DA 1UOCA 4BRLA 2NRVA 2EX3A 2IOCA 1N5YA 4CD1A 4DF4A 3TWHA 4OPJA 4JRQA 1Q82O 3ZT0A 2W40A 4BQLA 1QHTA 2GBZA 3VOVA 3NF6A 5JICA 1NBWA 1LAVA 4V19S 4DTXA 4HHTA 1E4GT 4TSXA 3MN6A 1VSHA 4BRGA 3DM2A 4MQ3A 2ZD1A 2HNDA 3IAYA 4M3ZA 3ISNC 4ICLA 4H03B 3QESA 4DLGA 3FZFA 1QSLA 2VYPA 2NNWA 4KREA 2A6AA 4X66K 1X3NA 2GWKA 3HT3A 4BC2A 2XHBA 5E84A 4B9TA 4LH4A 5AQUA 4CJ4A 4ZTFA 2FC0A 1OVYA 1QSSA
chains in the Genus database with same CATH topology
3VQ9A 1Z26A 1C1CA 1ITGA 1BIZA 1ASWA 4HTUA 5FDLA 4DF8A 1BQNA 3KKSA 1WAFA 4CFBA 3ZSYA 4BACA 2IS3A 1NK0A 1WSHA 1BI4B 4Y1CA 3VQPA 1NKCA 4DU3A 4CEZA 1RNHA 4LH5A 4FCYA 3NHGA 3OYDA 4FJJA 1TKTA 5E41A 4BDYA 1ASUA 1VSKA 4E19A 3SV3A 4RW8A 3AVJA 3VA0A 1NK7A 1VSJA 1HNIA 1RT6A 2WOMA 3HVTA 3KK1A 4KO0A 2QKBA 3LWMA 2VG5A 2OA8A 1BCOA 4K8ZA 3OS1A 3QNNA 2KZZA 5J2QA 1HRHA 4GVMA 3NFAA 2XY5A 1VSDA 1WNSA 2IC3A 1C6VA 2FBTA 3LP0A 1U49A 2PYLA 4OKJA 2DY4A 1S6QA 1ZBUA 1JL2A 1Z25A 1S6PA 3QINA 3M8RA 3L2VA 3K58A 3V9ZA 1U47A 4AHCA 4AHVA 4EZ6A 4NYFA 1RDBA 4DFJA 4B9UA 4FJNA 1BISA 2X74A 3LP1A 4BE1A 3CQ8A 3O3GA 3UIQA 1TAUA 4BE2A 3HK2A 3ZCMA 4CHOA 1QTMA 4MFBA 1IG9A 3KK2A 4DQPA 2HHSA 4O55A 2RN2A 4CE9A 3VQ8A 3TAFA 4HCBA 5I3UA 3JSMA 4AHSA 4FK4A 2W42A 2HB5A 1FKPA 2ZE2A 1JLBA 3DI6A 4FVMA 4PA1A 2O4GA 3G0ZA 3LP3A 4CIGA 3LDSA 2YNIA 4KB1A 3L3UA 5SWMA 4W5RA 3RMDA 4LSLA 2ZQBA 1RT4A 2NUBA 3CFRA 3AVKA 3MXIA 1SL1A 2YHAA 3HPOA 1VSMA 1VRTA 3KD5E 3DRRA 3C6TA 4M3YA 4Z4FA 1J54A 4FLZA 4FJKA 4CEEA 4CIEA 2Z1IA 3VQDA 3LZJA 1WLJA 4Y1DA 4C8NA 4FLYA 4DSFA 4KHYA 3AVNA 4DU4A 3ZSOA 1XI1A 2JGUA 1X9MA 1CZ9A 3LALA 4Q5VA 3KK3A 4DFPA 4JRPA 1XHZA 4CF0A 4F8RA 4CERA 1JXBA 3NCIA 1NK9A 4CGFA 3AA2A 3A2FA 4IDKA 4CEQA 4W5TA 2KFNA 3ULDA 3TR8A 3P5JA 1Q8IA 3QEPA 3T3FA 4KPYA 3QLHA 4EP4A 3ZSVA 3TABA 1X9SA 3SUPA 1Q9XA 3EY1A 4FM0A 1IH7A 4OPKA 2VWKA 1VRUA 4JLHA 3SNNA 4LSNA 5KRTA 4DSIA 3MEGA 4F3OA 4DQRA 1VSLA 1A5WA 3TAQA 4B9MA 4ELTA 2KFZA 3VQCA 1RT3A 4ID1A 1L3VA 3NGZA 1RT1A 3V1RA 4LY7A 5KI6A 1DLOA 5I42A 4Z4HA 4JS5A 1VSEA 4DTOA 3L3VA 4IFVA 3HL8A 4R5PA 4DFMA 3SCXA 1TK5A 4EZ9A 1KLNA 1S9GA 1L5UA 4K8XA 2D5RA 3PX0A 3OYAA 1DTTA 1VK0A 1NOZA 2D0AA 3FFIA 3KKRA 3AO2A 3RMBA 2PZSA 4NCAA 2YHBA 3OS0A 2Z1JA 2OPQA 2XY7A 2DTUA 4M41A 5K14A 4O44A 3OYBA 4C8MA 3OJUA 4FJ9A 5FRMA 1GOCA 2YV0X 4NCGA 1TVRA 4CECA 2OZSA 3OYCA 4J2DA 1IKYA 3LWLA 3SUQA 3BDPA 3KTQA 2OPPA 2RF2A 3SJJA 1A5VA 1D5AA 2B5JA 4CHZA 4E7HA 4M3WA 1RTHA 2QKKA 2RPIA 1RTIA 3QEWA 1O1WA 3CG7A 4FM1A 3V4IA 3KD1E 4AHRA 4F4KA 3KLFA 1RBTA 3V81A 1YTUA 1JL1A 1XWLA 4LD0A 1Y97A 4N56A 1HPZA 2I5JA 5T7BA 4DLEA 1X9WA 3L8BA 1GOAA 4DG1A 1RCHA 3OYNA 3QEVA 2F96A 2HMIA 4CEBA 3VQ6A 2KW4A 3CM5A 3NF9A 1SKWA 3DLHA 3SQ4A 4CFCA 4IFYA 3HYFA 3TAGA 3NDKA 4E1NA 4CEFA 4RW7A 3AVHA 4W5NA 4B08A 5J2MA 4HCCA 3DLRA 3HPGA 5C42A 3RR7A 3L2WA 1TKDA 1KVBA 3T1AA 1CLQA 1LAWA 1I39A 4CHQA 4M3RA 4I9QA 4PY5A 3TANA 4OGEA 3QO9A 2HHXA 4O5BA 1C1AA 3KIOA 4CFAA 1J9AA 4QAGA 2PYJA 1JXEA 4DSLA 1D9FA 2F8TA 1RT5A 3WNHA 3LAMA 3C6UA 4CHNA 4CIFA 3TAMA 3RTVA 1UA0A 1WSJA 5CZ2A 3HSTB 3L2QA 4CCHA 4G1QA 3U3GA 2IAJA 3NH1A 4CK3A 4FM2A 1BIUA 2E4LA 4YNQA 3M8PA 2HHVA 1B9DA 1SL2A 3ZSZA 1S1XA 4FZYA 3QIOA 1TK0A 4CF8A 4DTMA 1D8YA 4E7JA 4KKOA 3OYJA 4OGCA 3AVGA 4L8RB 3HM9A 2GV9A 4OKEA 4M42A 1NJZA 3M8SA 4Z4GA 3U6FA 3WNEA 4CJQA 1S1TA 3DLKA 4I2QA 4IBNA 1TKZA 2GUIA 2XRIA 3AVLA 3VQ7A 5KGWA 2IDOA 3K5LA 3VQ5A 4DTNA 4DTJA 1S1UA 1RDCA 3V9WA 3IS9A 4DTUA 4H4MA 5DMRA 5HRRA 1FK9A 3V9XA 2FBVA 3LPTA 1SUQA 1UWBA 1RBRA 3KJVA 1U4BA 5KTQA 1J5OA 1KFDA 3ZT4A 3HPHA 3OYIA 5KGXA 1U04A 3PY8A 4FJ5A 4CFDA 4FJ7A 1QSYA 5JS2A 3THVA 4FJXA 3OYGA 2R7YA 4NCBA 3NH2A 4Z4IA 1JLFA 2HVIA 1IKVA 3MXJA 2X78A 3ZSWA 4AILC 1S1WA 3OYKA 1T8EA 4O4GA 3NBPA 4FW1A 3LANA 1MU2A 2IGIA 3JYTA 4CESA 2BGGA 1K6YA 4DU1A 1HQUA 2OPSA 2P5GA 2HHUA 4CEAA 3HVRA 1S1VA 3DLGA 2Y1IA 4M3UA 3OY9A 3V1QA 3VA3A 4F3TA 1TV6A 1YTAA 1J53A 3SPZA 1CZBA 2XO7A 3DYAA 4RW6A 1C0UA 1DTQA 3ZSQA 4GMJB 3AO4A 2YNGA 3S3MA 3ZSRA 3ZSXA 3PO4A 1VSIA 1T7PA 4DQSA 4PWDA 1GOBA 1REVA 1HYVA 1D9DA 4DQIA 2G8IA 1TGOA 2X6SA 2D0BA 4CEDA 4DS4A 4KHWA 1C0MA 3LZIA 3MECA 1EXQA 3K5MA 4FJGA 3EZ5A 1S9EA 3O3HA 3PX6A 3B6PA 2WONA 2G8UA 1IKXA 3AVMA 2HNZA 3SUNA 3AO3A 4CJUA 3HXMA 3S9HA 4Z4CA 4H8KA 5DK5A 5SZTA 5HROA 4E7LA 3K5OA 4FK0A 4HUEA 4FLVA 1ZBLA 4KHQA 1YT3A 3DMJA 1UAXA 3WNGA 1LV5A 1KFSA 2KTQA 2Z1HA 3TI0A 1RT2A 2A1SA 1CXQA 4W5OA 3ZT2A 2D0CA 4F2SA 1KRPA 4FLXA 4E89A 3HJFA 3QEXA 3C95A 3O4QA 3KLEA 4E1MA 3L2UA 2LSNA 3AVBA 1NK4A 1L3UA 1JLQA 4FW2A 3KLGA 1WSGA 1WN7A 3T19A 1BI4A 3ITHA 3BGRA 5HP1A 4KHUA 4CGGA 3CM6A 3SQ1A 1HYZA 4DTSA 2YNFA 1FKOA 3HP6A 3OVNA 1BHLA 4E0DA 1B92A 5FROA 4QOZB 3M8QA 5CYMA 4OLAA 2EHGA 4ELUA 2G8WA 3SUOA 3EYZA 3OYHA 1TL3A 3QERA 1EKEA 3LPUA 4CK1A 1LW0A 5CZ1A 3V1OA 2F8SA 3P83D 4I2PA 4CGJA 3DOLA 3SPYA 3NF8A 1IO2A 2G8KA 4N76A 2ITGA 3HP9A 3PUFA 4CF2A 4JS4A 3F9KA 4E7IA 4N5SA 1JLGA 1QSSA 4KHNA 1SKRA 3L2RA 4KV8A 4CJFA 2HNYA 5HBMA 1U48A 3VQ4A 1HQEA 4CJVA 5HRPA 1HNVA 4UQGA 4DWIA 4AHUA 4ZTJA 3PO5A 3O4NA 5J1EA 4CJRA 4E7KA 5CY4A 1R0AA 2BDPA 4WE1A 2KZMA 4DSEA 3TAEA 3AA3A 3E01A 3VQEA 3P1GA 2A1RA 3AA5X 3NGIA 1TKXA 4FJMA 3K57A 3G10A 2KQ2A 3TAPA 4KAZA 2QK9A 4PQUA 3ASMA 4H4OA 3H08A 3KLHA 4B8CA 2P5OA 2XY6A 4AHTA 4M3TA 4HUFA 1W0HA 2RKIA 3K59A 3RRHA 4KB0A 4CJ5A 5J2PA 5KRSA 4NYNA 3MXMA 4DTPA 1BQMA 3C94A 3NE6A 4B9VA 4Z0UA 2G8HA 1EX4A 5FRNA 1JLEA 2YNHA 3NAEA 3D45A 1C0TA 1SL0A 4FJHA 1ASVA 1XHXA 4HUGA 1LWEA 4DMNA 1SKSA 2FBYA 1Q9YA 2P1JA 5D3GA 2B6AA 4ID5A 4BWMA 3DRSA 3RMCA 4N41A 1KVAA 4FZZA 1NK6A 2BANA 2Q3SA 3PX4A 4IG3A 4CHYA 4O0IA 1T05A 4CJEA 1ZBIA 1ZBHA 1B9FA 4C8LA 4J2BA 4ZHRA 1NK8A 4OLBA 4C8OA 1RDAA 4GW6A 2AJQA 1BL3A 4KFBA 4RW9A 1NJWA 4CGIA 1L3TA 4FLWA 3QETA 1ZBFA 5HLFA 4RG8A 5C25A 2OYQA 4O0JA 3NF7A 4BWJA 4CJWA 4FLTA 1F21A 3MEDA 1YVUA 1A5XA 2G8FA 2P51A 1LWFA 2ATQA 4KTZA 5EU7A 3OJSA 3SV4A 3SYZA 3U3YA 4M45A 1KSPA 1WSEA 4CF9A 1WSIA 4FXDA 4QCLA 4FJ8A 4ELVA 3SQ0A 1KTQA 3TARA 1NK5A 4PUOA 2E6LA 3SZ2A 1L3SA 2QXFA 3VQQA 4BDZA 3O3FA 1JLAA 1RILA 3K5NA 3PV8A 1WSFA 3DLEA 4BDPA 1RBVA 4J2EA 1RTDA 1QQCA 4AH9A 3K2PA 1FXXA 5J2NA 3QEIA 3S3OA 1HYSA 4FLUA 3NH0A 1TK8A 3LP2A 1TL1A 3OS2A 1C1BA 4IKFA 4CJPA 2G8VA 1KVCA 4CF1A 3CYMA 4OKKA 1QE1A 1EP4A 3OYFA 1RT7A 1TAQA 1VSFA 4I9LA 4CJTA 3V9UA 4Q0BA 1KCFA 1BGXT 2OPRA 4M3XA 2YKNA 1HMVA 4J2AA 3I0SA 3OYMA 3QNOA 4IG0A 1SV5A 5HRSA 4KI4A 3B6OA 1RTJA 3RR8A 4DTRA 4N47A 3ZT3A 2HHWA 3ALYA 1U45A 4DSKA 2HVHA 1LWCA 1UA1A 1X1PA 4E3SA 4BE0A 2DFFA 2E6MA 3KLIA 3LAKA 4RW4A 4CGHA 4DS5A 1HJRA 2O4IA 1I3AA 3VQBA 2YKMA 4KHSA 2XY8A 3I0RA 1ZYQA 3F73A 3V9SA 3MAQA 3CFOA 3AA4A 3D0PA 1JKHA 4CJKA 5CYQA 2OZMA 1EETA 1QS4A 4C8KA 2DFEA 4W5QA 2Z1GA 4I7FA 4FYDA 3RRGA 3SQ2A 1JLCA 2B4JA 4KRFA 2VWJA 4DFKA 3AVFA 3V6DA 3AO5A 3IRXA 4DQQA 2Y1JA 3WNFA 2HHTA 4CEOA 4CHPA 1CXUA 3I8DA 1UOCA 2VG7A 4KTQA 4CJSA 2EX3A 1WAJA 2IOCA 3AVIA 1N5YA 4B9SA 5JS1A 4DF4A 1S5JA 3TWHA 3RWUA 1KLMA 4FJLA 4OPJA 4CJ3A 4JRQA 4CGDA 3HO1A 4B3OA 4B9LA 4HVJA 5C24A 4OVLA 3ZT0A 3S3NA 1NOYA 4FK2A 1RBSA 2HHQA 3QIPA 1RDDA 3DLBA 1QHTA 1RBUA 2GBZA 4B8AB 3AV9A 3NF6A 4Z4EA 3SI6A 1IKWA 3AO1A 1LAVA 2JLEA 4OJRA 4XIUA 1XC9A 1NKBA 4DTXA 4HHTA 4FZXC 4TSXA 3AVCA 1NKEA 3NGYA 1VSHA 1BCMA 4KI6A 2FBXA 4KTWA 3AVAA 3DM2A 4MQ3A 2ZD1A 2HNDA 1G15A 3IAYA 3CFPA 4B9NA 3ZT1A 3DRPA 3OYLA 1NJXA 4M3ZA 3ISNC 3VQAA 4ICLA 2X6NA 4YFUA 3QESA 4DLGA 1W9HA 1QSLA 2PY5A 4FJIA 4CJLA 4KREA 4EP5A 2BE2A 5HRNA 3DOKA 4DSJA 3HT3A 3RMAA 3VN5A 3MEEA 3IG1A 3OYEA 4F2RA 4CK2A 2ETJA 2XHBA 1T03A 1NJYA 1LW2A 2DFHA 4B9TA 4LH4A 2HW3A 4CJ4A 4ZTFA 2FC0A 1N6QA 2VG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VQ9 A;  1Z26 A;  1C1C A;  1ITG A;  1BIZ A;  1ASW A;  4HTU A;  5FDL A;  4DF8 A;  1BQN A;  3KKS A;  1WAF A;  4CFB A;  3ZSY A;  4BAC A;  2IS3 A;  1NK0 A;  1WSH A;  1BI4 B;  4Y1C A;  3VQP A;  1NKC A;  4DU3 A;  4CEZ A;  1RNH A;  4LH5 A;  4FCY A;  3NHG A;  3OYD A;  4FJJ A;  1TKT A;  5E41 A;  4BDY A;  1ASU A;  1VSK A;  4E19 A;  3SV3 A;  4RW8 A;  3AVJ A;  3VA0 A;  1NK7 A;  1VSJ A;  1HNI A;  1RT6 A;  2WOM A;  3HVT A;  3KK1 A;  4KO0 A;  2QKB A;  3LWM A;  2VG5 A;  2OA8 A;  1BCO A;  4K8Z A;  3OS1 A;  3QNN A;  2KZZ A;  5J2Q A;  1HRH A;  4GVM A;  3NFA A;  2XY5 A;  1VSD A;  1WNS A;  2IC3 A;  1C6V A;  2FBT A;  3LP0 A;  1U49 A;  2PYL A;  4OKJ A;  2DY4 A;  1S6Q A;  1ZBU A;  1JL2 A;  1Z25 A;  1S6P A;  3QIN A;  3M8R A;  3L2V A;  3K58 A;  3V9Z A;  1U47 A;  4AHC A;  4AHV A;  4EZ6 A;  4NYF A;  1RDB A;  4DFJ A;  4B9U A;  4FJN A;  1BIS A;  2X74 A;  3LP1 A;  4BE1 A;  3CQ8 A;  3O3G A;  3UIQ A;  1TAU A;  4BE2 A;  3HK2 A;  3ZCM A;  4CHO A;  1QTM A;  4MFB A;  1IG9 A;  3KK2 A;  4DQP A;  2HHS A;  4O55 A;  2RN2 A;  4CE9 A;  3VQ8 A;  3TAF A;  4HCB A;  5I3U A;  3JSM A;  4AHS A;  4FK4 A;  2W42 A;  2HB5 A;  1FKP A;  2ZE2 A;  1JLB A;  3DI6 A;  4FVM A;  4PA1 A;  2O4G A;  3G0Z A;  3LP3 A;  4CIG A;  3LDS A;  2YNI A;  4KB1 A;  3L3U A;  5SWM A;  4W5R A;  3RMD A;  4LSL A;  2ZQB A;  1RT4 A;  2NUB A;  3CFR A;  3AVK A;  3MXI A;  1SL1 A;  2YHA A;  3HPO A;  1VSM A;  1VRT A;  3KD5 E;  3DRR A;  3C6T A;  4M3Y A;  4Z4F A;  1J54 A;  4FLZ A;  4FJK A;  4CEE A;  4CIE A;  2Z1I A;  3VQD A;  3LZJ A;  1WLJ A;  4Y1D A;  4C8N A;  4FLY A;  4DSF A;  4KHY A;  3AVN A;  4DU4 A;  3ZSO A;  1XI1 A;  2JGU A;  1X9M A;  1CZ9 A;  3LAL A;  4Q5V A;  3KK3 A;  4DFP A;  4JRP A;  1XHZ A;  4CF0 A;  4F8R A;  4CER A;  1JXB A;  3NCI A;  1NK9 A;  4CGF A;  3AA2 A;  3A2F A;  4IDK A;  4CEQ A;  4W5T A;  2KFN A;  3ULD A;  3TR8 A;  3P5J A;  1Q8I A;  3QEP A;  3T3F A;  4KPY A;  3QLH A;  4EP4 A;  3ZSV A;  3TAB A;  1X9S A;  3SUP A;  1Q9X A;  3EY1 A;  4FM0 A;  1IH7 A;  4OPK A;  2VWK A;  1VRU A;  4JLH A;  3SNN A;  4LSN A;  5KRT A;  4DSI A;  3MEG A;  4F3O A;  4DQR A;  1VSL A;  1A5W A;  3TAQ A;  4B9M A;  4ELT A;  2KFZ A;  3VQC A;  1RT3 A;  4ID1 A;  1L3V A;  3NGZ A;  1RT1 A;  3V1R A;  4LY7 A;  5KI6 A;  1DLO A;  5I42 A;  4Z4H A;  4JS5 A;  1VSE A;  4DTO A;  3L3V A;  4IFV A;  3HL8 A;  4R5P A;  4DFM A;  3SCX A;  1TK5 A;  4EZ9 A;  1KLN A;  1S9G A;  1L5U A;  4K8X A;  2D5R A;  3PX0 A;  3OYA A;  1DTT A;  1VK0 A;  1NOZ A;  2D0A A;  3FFI A;  3KKR A;  3AO2 A;  3RMB A;  2PZS A;  4NCA A;  2YHB A;  3OS0 A;  2Z1J A;  2OPQ A;  2XY7 A;  2DTU A;  4M41 A;  5K14 A;  4O44 A;  3OYB A;  4C8M A;  3OJU A;  4FJ9 A;  5FRM A;  1GOC A;  2YV0 X;  4NCG A;  1TVR A;  4CEC A;  2OZS A;  3OYC A;  4J2D A;  1IKY A;  3LWL A;  3SUQ A;  3BDP A;  3KTQ A;  2OPP A;  2RF2 A;  3SJJ A;  1A5V A;  1D5A A;  2B5J A;  4CHZ A;  4E7H A;  4M3W A;  1RTH A;  2QKK A;  2RPI A;  1RTI A;  3QEW A;  1O1W A;  3CG7 A;  4FM1 A;  3V4I A;  3KD1 E;  4AHR A;  4F4K A;  3KLF A;  1RBT A;  3V81 A;  1YTU A;  1JL1 A;  1XWL A;  4LD0 A;  1Y97 A;  4N56 A;  1HPZ A;  2I5J A;  5T7B A;  4DLE A;  1X9W A;  3L8B A;  1GOA A;  4DG1 A;  1RCH A;  3OYN A;  3QEV A;  2F96 A;  2HMI A;  4CEB A;  3VQ6 A;  2KW4 A;  3CM5 A;  3NF9 A;  1SKW A;  3DLH A;  3SQ4 A;  4CFC A;  4IFY A;  3HYF A;  3TAG A;  3NDK A;  4E1N A;  4CEF A;  4RW7 A;  3AVH A;  4W5N A;  4B08 A;  5J2M A;  4HCC A;  3DLR A;  3HPG A;  5C42 A;  3RR7 A;  3L2W A;  1TKD A;  1KVB A;  3T1A A;  1CLQ A;  1LAW A;  1I39 A;  4CHQ A;  4M3R A;  4I9Q A;  4PY5 A;  3TAN A;  4OGE A;  3QO9 A;  2HHX A;  4O5B A;  1C1A A;  3KIO A;  4CFA A;  1J9A A;  4QAG A;  2PYJ A;  1JXE A;  4DSL A;  1D9F A;  2F8T A;  1RT5 A;  3WNH A;  3LAM A;  3C6U A;  4CHN A;  4CIF A;  3TAM A;  3RTV A;  1UA0 A;  1WSJ A;  5CZ2 A;  3HST B;  3L2Q A;  4CCH A;  4G1Q A;  3U3G A;  2IAJ A;  3NH1 A;  4CK3 A;  4FM2 A;  1BIU A;  2E4L A;  4YNQ A;  3M8P A;  2HHV A;  1B9D A;  1SL2 A;  3ZSZ A;  1S1X A;  4FZY A;  3QIO A;  1TK0 A;  4CF8 A;  4DTM A;  1D8Y A;  4E7J A;  4KKO A;  3OYJ A;  4OGC A;  3AVG A;  4L8R B;  3HM9 A;  2GV9 A;  4OKE A;  4M42 A;  1NJZ A;  3M8S A;  4Z4G A;  3U6F A;  3WNE A;  4CJQ A;  1S1T A;  3DLK A;  4I2Q A;  4IBN A;  1TKZ A;  2GUI A;  2XRI A;  3AVL A;  3VQ7 A;  5KGW A;  2IDO A;  3K5L A;  3VQ5 A;  4DTN A;  4DTJ A;  1S1U A;  1RDC A;  3V9W A;  3IS9 A;  4DTU A;  4H4M A;  5DMR A;  5HRR A;  1FK9 A;  3V9X A;  2FBV A;  3LPT A;  1SUQ A;  1UWB A;  1RBR A;  3KJV A;  1U4B A;  5KTQ A;  1J5O A;  1KFD A;  3ZT4 A;  3HPH A;  3OYI A;  5KGX A;  1U04 A;  3PY8 A;  4FJ5 A;  4CFD A;  4FJ7 A;  1QSY A;  5JS2 A;  3THV A;  4FJX A;  3OYG A;  2R7Y A;  4NCB A;  3NH2 A;  4Z4I A;  1JLF A;  2HVI A;  1IKV A;  3MXJ A;  2X78 A;  3ZSW A;  4AIL C;  1S1W A;  3OYK A;  1T8E A;  4O4G A;  3NBP A;  4FW1 A;  3LAN A;  1MU2 A;  2IGI A;  3JYT A;  4CES A;  2BGG A;  1K6Y A;  4DU1 A;  1HQU A;  2OPS A;  2P5G A;  2HHU A;  4CEA A;  3HVR A;  1S1V A;  3DLG A;  2Y1I A;  4M3U A;  3OY9 A;  3V1Q A;  3VA3 A;  4F3T A;  1TV6 A;  1YTA A;  1J53 A;  3SPZ A;  1CZB A;  2XO7 A;  3DYA A;  4RW6 A;  1C0U A;  1DTQ A;  3ZSQ A;  4GMJ B;  3AO4 A;  2YNG A;  3S3M A;  3ZSR A;  3ZSX A;  3PO4 A;  1VSI A;  1T7P A;  4DQS A;  4PWD A;  1GOB A;  1REV A;  1HYV A;  1D9D A;  4DQI A;  2G8I A;  1TGO A;  2X6S A;  2D0B A;  4CED A;  4DS4 A;  4KHW A;  1C0M A;  3LZI A;  3MEC A;  1EXQ A;  3K5M A;  4FJG A;  3EZ5 A;  1S9E A;  3O3H A;  3PX6 A;  3B6P A;  2WON A;  2G8U A;  1IKX A;  3AVM A;  2HNZ A;  3SUN A;  3AO3 A;  4CJU A;  3HXM A;  3S9H A;  4Z4C A;  4H8K A;  5DK5 A;  5SZT A;  5HRO A;  4E7L A;  3K5O A;  4FK0 A;  4HUE A;  4FLV A;  1ZBL A;  4KHQ A;  1YT3 A;  3DMJ A;  1UAX A;  3WNG A;  1LV5 A;  1KFS A;  2KTQ A;  2Z1H A;  3TI0 A;  1RT2 A;  2A1S A;  1CXQ A;  4W5O A;  3ZT2 A;  2D0C A;  4F2S A;  1KRP A;  4FLX A;  4E89 A;  3HJF A;  3QEX A;  3C95 A;  3O4Q A;  3KLE A;  4E1M A;  3L2U A;  2LSN A;  3AVB A;  1NK4 A;  1L3U A;  1JLQ A;  4FW2 A;  3KLG A;  1WSG A;  1WN7 A;  3T19 A;  1BI4 A;  3ITH A;  3BGR A;  5HP1 A;  4KHU A;  4CGG A;  3CM6 A;  3SQ1 A;  1HYZ A;  4DTS A;  2YNF A;  1FKO A;  3HP6 A;  3OVN A;  1BHL A;  4E0D A;  1B92 A;  5FRO A;  4QOZ B;  3M8Q A;  5CYM A;  4OLA A;  2EHG A;  4ELU A;  2G8W A;  3SUO A;  3EYZ A;  3OYH A;  1TL3 A;  3QER A;  1EKE A;  3LPU A;  4CK1 A;  1LW0 A;  5CZ1 A;  3V1O A;  2F8S A;  3P83 D;  4I2P A;  4CGJ A;  3DOL A;  3SPY A;  3NF8 A;  1IO2 A;  2G8K A;  4N76 A;  2ITG A;  3HP9 A;  3PUF A;  4CF2 A;  4JS4 A;  3F9K A;  4E7I A;  4N5S A;  1JLG A;  1QSS A;  4KHN A;  1SKR A;  3L2R A;  4KV8 A;  4CJF A;  2HNY A;  5HBM A;  1U48 A;  3VQ4 A;  1HQE A;  4CJV A;  5HRP A;  1HNV A;  4UQG A;  4DWI A;  4AHU A;  4ZTJ A;  3PO5 A;  3O4N A;  5J1E A;  4CJR A;  4E7K A;  5CY4 A;  1R0A A;  2BDP A;  4WE1 A;  2KZM A;  4DSE A;  3TAE A;  3AA3 A;  3E01 A;  3VQE A;  3P1G A;  2A1R A;  3AA5 X;  3NGI A;  1TKX A;  4FJM A;  3K57 A;  3G10 A;  2KQ2 A;  3TAP A;  4KAZ A;  2QK9 A;  4PQU A;  3ASM A;  4H4O A;  3H08 A;  3KLH A;  4B8C A;  2P5O A;  2XY6 A;  4AHT A;  4M3T A;  4HUF A;  1W0H A;  2RKI A;  3K59 A;  3RRH A;  4KB0 A;  4CJ5 A;  5J2P A;  5KRS A;  4NYN A;  3MXM A;  4DTP A;  1BQM A;  3C94 A;  3NE6 A;  4B9V A;  4Z0U A;  2G8H A;  1EX4 A;  5FRN A;  1JLE A;  2YNH A;  3NAE A;  3D45 A;  1C0T A;  1SL0 A;  4FJH A;  1ASV A;  1XHX A;  4HUG A;  1LWE A;  4DMN A;  1SKS A;  2FBY A;  1Q9Y A;  2P1J A;  5D3G A;  2B6A A;  4ID5 A;  4BWM A;  3DRS A;  3RMC A;  4N41 A;  1KVA A;  4FZZ A;  1NK6 A;  2BAN A;  2Q3S A;  3PX4 A;  4IG3 A;  4CHY A;  4O0I A;  1T05 A;  4CJE A;  1ZBI A;  1ZBH A;  1B9F A;  4C8L A;  4J2B A;  4ZHR A;  1NK8 A;  4OLB A;  4C8O A;  1RDA A;  4GW6 A;  2AJQ A;  1BL3 A;  4KFB A;  4RW9 A;  1NJW A;  4CGI A;  1L3T A;  4FLW A;  3QET A;  1ZBF A;  5HLF A;  4RG8 A;  5C25 A;  2OYQ A;  4O0J A;  3NF7 A;  4BWJ A;  4CJW A;  4FLT A;  1F21 A;  3MED A;  1YVU A;  1A5X A;  2G8F A;  2P51 A;  1LWF A;  2ATQ A;  4KTZ A;  5EU7 A;  3OJS A;  3SV4 A;  3SYZ A;  3U3Y A;  4M45 A;  1KSP A;  1WSE A;  4CF9 A;  1WSI A;  4FXD A;  4QCL A;  4FJ8 A;  4ELV A;  3SQ0 A;  1KTQ A;  3TAR A;  1NK5 A;  4PUO A;  2E6L A;  3SZ2 A;  1L3S A;  2QXF A;  3VQQ A;  4BDZ A;  3O3F A;  1JLA A;  1RIL A;  3K5N A;  3PV8 A;  1WSF A;  3DLE A;  4BDP A;  1RBV A;  4J2E A;  1RTD A;  1QQC A;  4AH9 A;  3K2P A;  1FXX A;  5J2N A;  3QEI A;  3S3O A;  1HYS A;  4FLU A;  3NH0 A;  1TK8 A;  3LP2 A;  1TL1 A;  3OS2 A;  1C1B A;  4IKF A;  4CJP A;  2G8V A;  1KVC A;  4CF1 A;  3CYM A;  4OKK A;  1QE1 A;  1EP4 A;  3OYF A;  1RT7 A;  1TAQ A;  1VSF A;  4I9L A;  4CJT A;  3V9U A;  4Q0B A;  1KCF A;  1BGX T;  2OPR A;  4M3X A;  2YKN A;  1HMV A;  4J2A A;  3I0S A;  3OYM A;  3QNO A;  4IG0 A;  1SV5 A;  5HRS A;  4KI4 A;  3B6O A;  1RTJ A;  3RR8 A;  4DTR A;  4N47 A;  3ZT3 A;  2HHW A;  3ALY A;  1U45 A;  4DSK A;  2HVH A;  1LWC A;  1UA1 A;  1X1P A;  4E3S A;  4BE0 A;  2DFF A;  2E6M A;  3KLI A;  3LAK A;  4RW4 A;  4CGH A;  4DS5 A;  1HJR A;  2O4I A;  1I3A A;  3VQB A;  2YKM A;  4KHS A;  2XY8 A;  3I0R A;  1ZYQ A;  3F73 A;  3V9S A;  3MAQ A;  3CFO A;  3AA4 A;  3D0P A;  1JKH A;  4CJK A;  5CYQ A;  2OZM A;  1EET A;  1QS4 A;  4C8K A;  2DFE A;  4W5Q A;  2Z1G A;  4I7F A;  4FYD A;  3RRG A;  3SQ2 A;  1JLC A;  2B4J A;  4KRF A;  2VWJ A;  4DFK A;  3AVF A;  3V6D A;  3AO5 A;  3IRX A;  4DQQ A;  2Y1J A;  3WNF A;  2HHT A;  4CEO A;  4CHP A;  1CXU A;  3I8D A;  1UOC A;  2VG7 A;  4KTQ A;  4CJS A;  2EX3 A;  1WAJ A;  2IOC A;  3AVI A;  1N5Y A;  4B9S A;  5JS1 A;  4DF4 A;  1S5J A;  3TWH A;  3RWU A;  1KLM A;  4FJL A;  4OPJ A;  4CJ3 A;  4JRQ A;  4CGD A;  3HO1 A;  4B3O A;  4B9L A;  4HVJ A;  5C24 A;  4OVL A;  3ZT0 A;  3S3N A;  1NOY A;  4FK2 A;  1RBS A;  2HHQ A;  3QIP A;  1RDD A;  3DLB A;  1QHT A;  1RBU A;  2GBZ A;  4B8A B;  3AV9 A;  3NF6 A;  4Z4E A;  3SI6 A;  1IKW A;  3AO1 A;  1LAV A;  2JLE A;  4OJR A;  4XIU A;  1XC9 A;  1NKB A;  4DTX A;  4HHT A;  4FZX C;  4TSX A;  3AVC A;  1NKE A;  3NGY A;  1VSH A;  1BCM A;  4KI6 A;  2FBX A;  4KTW A;  3AVA A;  3DM2 A;  4MQ3 A;  2ZD1 A;  2HND A;  1G15 A;  3IAY A;  3CFP A;  4B9N A;  3ZT1 A;  3DRP A;  3OYL A;  1NJX A;  4M3Z A;  3ISN C;  3VQA A;  4ICL A;  2X6N A;  4YFU A;  3QES A;  4DLG A;  1W9H A;  1QSL A;  2PY5 A;  4FJI A;  4CJL A;  4KRE A;  4EP5 A;  2BE2 A;  5HRN A;  3DOK A;  4DSJ A;  3HT3 A;  3RMA A;  3VN5 A;  3MEE A;  3IG1 A;  3OYE A;  4F2R A;  4CK2 A;  2ETJ A;  2XHB A;  1T03 A;  1NJY A;  1LW2 A;  2DFH A;  4B9T A;  4LH4 A;  2HW3 A;  4CJ4 A;  4ZTF A;  2FC0 A;  1N6Q A;  2VG6 A; 
#chains in the Genus database with same CATH topology
 1FW6 A;  4IXC A;  4BRI A;  1Z26 A;  3PSI A;  2A5X A;  5GAG P;  1OH8 A;  1ASW A;  3IMX A;  3C6A A;  2NRH A;  1NK0 A;  2QWP A;  1BI4 B;  4Y1C A;  3VQP A;  4ILJ A;  4DU3 A;  1RNH A;  3OYD A;  1X9J A;  4BDY A;  4E19 A;  4RW8 A;  2WOM A;  3ID6 A;  4KO0 A;  3QNN A;  3P38 A;  1VQO N;  5J2Q A;  4LF4 K;  4JHD A;  1VSD A;  3F9M A;  4DUY K;  4OKJ A;  3M8R A;  2A3Z A;  1Z25 A;  1S6P A;  3K58 A;  1HPM A;  3O3G A;  4A5B A;  3ZCM A;  3VET A;  4PL8 A;  1QTM A;  4IO9 L;  2EWS A;  3TAF A;  3H45 C;  3SMP A;  4NLC A;  1WB9 A;  3DI6 A;  4PA1 A;  4DQ8 A;  3IFR A;  1RT4 A;  3CFR A;  4WFB L;  3WEE A;  4XEI A;  4Z4F A;  4FJK A;  4H5V A;  4CIE A;  3VQD A;  4Y1D A;  1Q18 A;  3O80 A;  5M1Q A;  4FLY A;  4DU4 A;  3ZSO A;  2P9I B;  2JGU A;  4Q5V A;  1NM1 A;  1SZ2 A;  5AQZ A;  3WUH A;  3NCI A;  1NK9 A;  4W5T A;  3TR8 A;  3QLH A;  5F2R A;  1T3V A;  3VES A;  4L3Q A;  4FM0 A;  3E1Y A;  2VWK A;  1VRU A;  3H6E A;  4JLH A;  4JHD B;  4LSN A;  5KRT A;  4IEI A;  5C12 A;  4ID1 A;  2PBD A;  3NGZ A;  5KI6 A;  1DLO A;  4NB4 A;  5LY3 A;  1VSE A;  3HBT A;  4LFC K;  3ENO A;  3LDO A;  1Q81 O;  4JK7 A;  1VK0 A;  1NOZ A;  1P8Z A;  2D0A A;  3AO2 A;  3CC7 N;  2YHB A;  3OS0 A;  4DCH A;  4JKC A;  4B1X B;  1TVR A;  4CEC A;  3OYC A;  4J2D A;  1IKY A;  1NGF A;  5M1K A;  3SUQ A;  1A5V A;  1D5A A;  2E2O A;  4FOI A;  3WQU A;  4E7H A;  5AQS A;  1NWK A;  1RTI A;  3V4I A;  1NGG A;  3UKU A;  4AHR A;  2YHY A;  3VEX A;  1YTU A;  4LD0 A;  1Y97 A;  4BRQ A;  1HPZ A;  3L8B A;  4DG1 A;  3CC2 N;  1KAX A;  1OKJ A;  1OVQ A;  3CM5 A;  3DLH A;  3O8M A;  1M1K O;  3MCA B;  5AZJ B;  3TAG A;  4PHT X;  5J2M A;  2O8C A;  3TSU A;  4BR2 A;  2WFB A;  3J7Z O;  2PFU A;  1CLQ A;  1KD1 O;  1QQN A;  3RSE A;  1YVN A;  3CC4 N;  4O5B A;  3KIO A;  4QAG A;  3GG4 A;  4CHN A;  1BWF O;  3TAM A;  1UA0 A;  3L2Q A;  3HST B;  1E4F T;  1BA1 A;  3U3G A;  4G1Q A;  3VEW A;  2HHV A;  2E4L A;  4YHH K;  1B9D A;  1TK0 A;  2IVN A;  1D8Y A;  4KKO A;  5GIP A;  4OGC A;  1TUU A;  3AVG A;  1KAZ A;  4IOX A;  4WYB A;  4L8R B;  1NJZ A;  4Z4G A;  2PAV A;  4B3T K;  2GUI A;  2J4R A;  5B8H A;  2P9U A;  4CI6 A;  4DTJ A;  3D6R A;  3D2E A;  3IS9 A;  1LCU A;  5LMN K;  3V9X A;  4DUZ K;  2O8D B;  1U4B A;  5KTQ A;  3OYI A;  2ZWH A;  3THV A;  4NCB A;  2HVI A;  2R7Y A;  1JLF A;  2X78 A;  4AIL C;  4AQY K;  1MU2 A;  2BGG A;  1K6Y A;  2Y1I A;  3V1Q A;  1TV6 A;  4DV3 K;  3LDQ A;  4RW6 A;  1C0U A;  4IOC L;  2YNG A;  3LM2 A;  1KQS M;  4DQS A;  1HYV A;  4DQI A;  1C0M A;  1YF5 L;  1EXQ A;  3MEC A;  4PKG A;  3K5M A;  2G8U A;  4B3R K;  1IKX A;  4KH6 A;  3CCV N;  4BRM A;  4CJU A;  4Z4C A;  1JJ2 M;  3Q7B A;  2FLO A;  5F0X A;  2NZT A;  4HUE A;  3DMJ A;  1LV5 A;  4M63 C;  3UKR A;  3TI0 A;  1P90 A;  1RT2 A;  1VQ8 N;  3O08 A;  1N33 K;  2F9W A;  1KRP A;  2O8B B;  5BPL A;  2D0P A;  4PKI A;  4A59 A;  3QEX A;  3O4Q A;  5ADX A;  3HJF A;  4E1M A;  4JD2 B;  1GLC G;  3AVB A;  1NK4 A;  3PLA A;  1WSG A;  1VQ6 N;  3BGR A;  3R6M A;  1HYZ A;  4H5W A;  4DTS A;  2YNF A;  1FKO A;  3HP6 A;  1K8K A;  4E0D A;  3HOS A;  3WQT A;  4QOZ B;  3CPE A;  4IO8 A;  4OLA A;  2G8W A;  3SUO A;  3QER A;  1BO5 O;  1TL3 A;  3VTH A;  4DHY A;  5GIO A;  5AQT A;  4CK1 A;  5CZ1 A;  1GLD G;  3C7N A;  3V1O A;  3ULE B;  1BU6 O;  4YY3 K;  4JS4 A;  2FXU A;  4E7I A;  1MWK A;  4JKH A;  3L2R A;  4KV8 A;  2HNY A;  1HQE A;  3ZYY X;  1HNV A;  5J1E A;  4E7K A;  5CY4 A;  4WE1 A;  4K25 A;  3R3L A;  3VQE A;  4BC5 A;  3AA5 X;  3DXK A;  3G10 A;  2QK9 A;  3ASM A;  4H4O A;  3KLH A;  4B8C A;  1W0H A;  2RKI A;  3OBW A;  4JKG A;  3MXM A;  4DTP A;  1RDW X;  4B9V A;  3O6W A;  4Z0U A;  3QFP A;  1JLE A;  4JEP A;  1YXQ A;  4HUG A;  4K42 A;  2B6A A;  4ID5 A;  5JVG L;  4BWM A;  4B1V A;  2VQE K;  1VQK N;  4FZZ A;  2BAN A;  4IG3 A;  4A2A A;  1ZBH A;  2VCP A;  4OLB A;  4GW6 A;  2UUC K;  4RW9 A;  1DT9 A;  3NF7 A;  3G71 N;  2P51 A;  3SYZ A;  1KSP A;  3SV4 A;  3ZX0 A;  4BR4 A;  4M45 A;  4CF9 A;  3W0L A;  1NK5 A;  1HX1 A;  4PUO A;  2E6L A;  3SZ2 A;  2E88 A;  4C1N K;  4BDZ A;  4WFN L;  1KC8 O;  1U6Z A;  3O9R A;  4BDP A;  5J2N A;  3S3O A;  4BRP A;  4FLU A;  4IKF A;  3VPZ A;  4WQ5 C;  4JKA A;  4QS7 A;  4FPB A;  3CYM A;  3SBG A;  2W6L A;  4OKK A;  1QE1 A;  3CD6 N;  1RT7 A;  4Q0B A;  3QNO A;  5HRS A;  3ZET B;  1RTJ A;  5FPM A;  3RR8 A;  4N47 A;  3ALY A;  4EAH D;  1U45 A;  3P39 A;  1LWC A;  4BY9 C;  1YUW A;  1NG9 A;  4IEE A;  3LAK A;  3DJC A;  4CGH A;  2O4I A;  1I3A A;  2YKM A;  4KHS A;  3I0R A;  3GDQ A;  4DR4 K;  3MAQ A;  1NGA A;  2QWR A;  3D0P A;  4NLB A;  3MWP A;  3H1V X;  1QS4 A;  3FGU A;  1VQM N;  5AFU A;  4NXM K;  2Z1G A;  1YI2 N;  2E1Z A;  3MN9 A;  3AVF A;  4CZF A;  3AO5 A;  4IFE A;  2Y1J A;  2HHT A;  4YDU A;  1Y64 A;  2VG7 A;  4KTQ A;  1WAJ A;  1NGE A;  1S5J A;  4B3O A;  5CE3 A;  4CJ3 A;  4B9L A;  4HVJ A;  4GV6 A;  4DR5 K;  1NOY A;  4PKH A;  3TSP A;  1RBU A;  1ZXO A;  4Z4E A;  3AO1 A;  4OJR A;  1XC9 A;  4BR0 A;  1SAZ A;  4FZX C;  1QZ5 A;  1NKE A;  3O1W A;  1DKG D;  4GY2 B;  3CIP A;  3ZT1 A;  3DRP A;  2X6N A;  1E3M A;  3ATU A;  4EHU A;  5LMU K;  2PY5 A;  4FJI A;  4IJN A;  4U67 L;  2W6K A;  3CCJ N;  5GAH P;  4F2R A;  2HST A;  4CK2 A;  2HW3 A;  1LW2 A;  2DFH A;  5EOY A;  3CCL N;  4HWI A;  3D2F A;  4JI1 K;  3CQX A;  4FO0 A;  1EWR A;  3HM8 A;  3BF1 A;  3CER A;  5FDL A;  1BQN A;  3KKS A;  5I9E B;  4KH5 A;  1MWM A;  5AZI A;  4JYA K;  5CHI A;  3A5M C;  4CJ7 A;  1W2B M;  1C0G A;  3NHG A;  4I6M A;  4FJJ A;  1NGB A;  1TKT A;  3FLC O;  5E41 A;  1TUY A;  4BGB A;  3AVJ A;  4JI8 K;  5JMV A;  3KK1 A;  3BUZ B;  2E2N A;  5GAE P;  3CCU N;  4KHP K;  3CHW A;  3OS1 A;  2KZZ A;  1ATS A;  3R9P A;  1SS6 A;  3TTF A;  3JAM O;  3NFA A;  3A5N C;  3VEY A;  2IC3 A;  2FBT A;  3LP0 A;  2HHH K;  1S6Q A;  3V9Z A;  3QIN A;  5BR8 K;  2CH5 A;  4C23 A;  1BIS A;  3LP1 A;  4CZK A;  2UXD K;  4E1J A;  2CH6 A;  3MWT A;  3CPW M;  2YHX A;  2KHO A;  3KK2 A;  4O55 A;  2RN2 A;  4AHS A;  1ATR A;  2HB5 A;  1FKP A;  1JLB A;  4CIG A;  4FVM A;  1ILY A;  2YNI A;  4KB1 A;  2ZQB A;  1IBL K;  1IV0 A;  2YHA A;  1VSM A;  3KD5 E;  3C6T A;  3C6H A;  4DR1 K;  1OH6 A;  4A62 A;  3WXM B;  2O8E A;  3LZJ A;  4DSF A;  4KHY A;  2UUB K;  3KK3 A;  3ZEU A;  1N32 K;  3MCP A;  5GIN A;  1JXB A;  3AA2 A;  3A2F A;  3EZW A;  4CEQ A;  1Q8I A;  3QEP A;  1U2V A;  5LJW A;  4KPY A;  3TAB A;  1X9S A;  1NMN A;  1IH7 A;  3H3N O;  5JVH L;  3WXK A;  4BVO A;  4F3O A;  3MEG A;  4B9M A;  2A41 A;  2ZGY A;  3VQC A;  1RT3 A;  3O4W A;  5I42 A;  4JI3 K;  5TKW A;  4M3X A;  4IFV A;  4DFM A;  4JKB A;  1KLN A;  1S9G A;  4K8X A;  4CBU A;  5AQO A;  2DTU A;  4M41 A;  3OYB A;  4O44 A;  4FJ9 A;  2VGN A;  5FRM A;  2OZS A;  3QFU A;  5LJV A;  3LWL A;  3BDP A;  2OPP A;  3SJJ A;  2B5J A;  1RDU A;  4M3W A;  2QKK A;  4WQ4 A;  4OO1 J;  5BRE A;  4FM1 A;  1K8A O;  3C65 A;  3SMS A;  4F4K A;  3V81 A;  1XWL A;  4B1Y B;  1GOA A;  1RCH A;  4FWS A;  2F96 A;  2KW4 A;  1SKW A;  3SQ4 A;  1XMQ K;  3HYF A;  3U4L A;  1QVG M;  2P9K B;  3AVH A;  4A57 A;  1H1V A;  3LL3 A;  5M1O A;  1TKD A;  4BG9 A;  4JN4 A;  3ENH A;  4CHQ A;  1I39 A;  3KWI A;  1XNR K;  4OPA A;  4CFA A;  1TYQ B;  2PYJ A;  3LAM A;  4BC4 A;  4CIF A;  1ZC6 A;  1WSJ A;  5CZ2 A;  4CCH A;  3EKS A;  2IAJ A;  4KBO A;  1BIU A;  4YNQ A;  3CCE N;  2ZJP L;  3ZSZ A;  4CF8 A;  1VQ4 N;  4DV4 K;  3CJC A;  3HM9 A;  4OKE A;  2JWK A;  4GKJ K;  1S1T A;  3DLK A;  3VQ7 A;  1BA0 A;  3VQ5 A;  4DTN A;  1RDC A;  2UYT A;  1VQL N;  4DTU A;  1NGC A;  1FK9 A;  2FBV A;  3LPT A;  1SUQ A;  3KJV A;  1J5O A;  1KFD A;  3HPH A;  4DKW A;  5KGX A;  1DEJ A;  3PY8 A;  4FJ5 A;  2QEX N;  1QSY A;  3OW2 M;  3OYG A;  1IKV A;  4MLE A;  1S1W A;  1T8E A;  4FW1 A;  5FPD A;  4CES A;  3AAQ A;  4LFB K;  1JCE A;  2HHU A;  1S1V A;  4M3U A;  3EEQ A;  4F3T A;  4XH4 A;  1J53 A;  3DYA A;  1DTQ A;  4EFH A;  4DV0 K;  3ZSX A;  1VSI A;  3LDP A;  3IUC A;  4MDB A;  4KHW A;  3HTV A;  4XH1 A;  1NGH A;  3EZ5 A;  5A2Q O;  2WON A;  3AO3 A;  3OTO K;  3TPQ A;  3S9H A;  5DK5 A;  3MX2 A;  4E7L A;  4FLV A;  1XC3 A;  5AQX A;  2Z1H A;  2V52 B;  3MX5 A;  2A1S A;  4W5O A;  3ZT2 A;  4F2S A;  2QWL A;  4FLX A;  4H0O A;  3J8A A;  3ZX3 A;  3KLG A;  3ITH A;  1N34 K;  4CGG A;  1S22 A;  1BHL A;  3MMV A;  3M8Q A;  5CYM A;  5FPE A;  2EHG A;  4ELU A;  4FWQ A;  1HNX K;  4G9Z A;  3CMA N;  1VAZ A;  2RE2 A;  1EKE A;  3LPU A;  3WEE B;  1LW0 A;  3P83 D;  4I2P A;  3SPY A;  3NF8 A;  1IO2 A;  3SAG A;  4CF2 A;  3CCR N;  1JLG A;  3CF5 L;  1S72 N;  4CJF A;  5MLC Q;  1U48 A;  4DWI A;  3AGK A;  1KXP A;  3ENB A;  5C0Y A;  1HNW K;  4AHU A;  4RCH A;  3A5L C;  4IWV A;  4DV6 K;  3GBT A;  2H3G X;  4AF1 A;  3P1G A;  3NVK A;  1OH7 A;  4PQU A;  3J80 O;  5EVZ A;  3U9Z A;  3H08 A;  2D4W A;  4XH5 A;  4M3T A;  4HUF A;  5EY4 A;  4CJ5 A;  3C94 A;  1EX4 A;  3D45 A;  1C0T A;  4FJH A;  1XHX A;  4DMN A;  5D3G A;  1Q9Y A;  2FBY A;  3O1B A;  2P1J A;  4LFA K;  1NK8 A;  5BN9 A;  1BL3 A;  4KFB A;  1L3T A;  4FLW A;  3QET A;  4CJW A;  1IBM K;  1F21 A;  1A5X A;  3U3Y A;  3JS6 A;  5EU7 A;  3UKU B;  1WSE A;  4QCL A;  1KTQ A;  4YOU A;  5JLF A;  2QXF A;  3O3F A;  3I8B A;  3VEZ A;  4YOR A;  1WSF A;  5M1N A;  2O8C B;  4AH9 A;  1FXX A;  1HYS A;  3NH0 A;  1C1B A;  1HR0 K;  4UY8 O;  4YOX A;  2G8V A;  3RSE B;  4BGA A;  4CF1 A;  1N8R O;  2WBN A;  2QW9 A;  1TAQ A;  1VSF A;  3THX A;  2HF3 A;  5AQF A;  1HMV A;  4IG0 A;  1YHQ N;  1SV5 A;  4KI4 A;  3ZT3 A;  4DSK A;  4E3S A;  1BDG A;  3EE9 A;  3KLI A;  2HHQ A;  3F73 A;  2IIR A;  1GLF O;  2P9U B;  3D2E B;  5CYQ A;  3PIP L;  4B1W B;  2DFE A;  3IKM A;  4I7F A;  4MDA A;  1JLC A;  3SQ2 A;  2P9S A;  4CVN E;  3GE1 A;  3FE1 A;  2P9L A;  5AQJ A;  4CHP A;  2QI2 A;  3AVI A;  2UUA K;  3DWL A;  4B9S A;  5JS1 A;  4FJL A;  4MLH A;  4CGD A;  1WUA A;  4X64 K;  4JKF A;  4FK2 A;  3QIP A;  1RDD A;  3O5B A;  3AV9 A;  3SI6 A;  1IKW A;  1IBK K;  1WOQ A;  2O8F A;  3AVC A;  3L6Q A;  4KI6 A;  2FBX A;  3AVA A;  1G15 A;  3IDH A;  4B9N A;  3CQY A;  4ILG B;  4O5F A;  4CJL A;  4H5R A;  2BE2 A;  3DOK A;  4CW7 B;  3RMA A;  3MEE A;  3THW A;  1T03 A;  4CZL A;  1NJY A;  2ITM A;  2OTL N;  1N6Q A;  4H5N A;  3UKR B;  4YDU C;  3VQ9 A;  2VG6 A;  4NXN K;  3DLL L;  3TSQ A;  1BIZ A;  4DF8 A;  3I55 N;  4CFB A;  3E66 A;  4CBX A;  3ZSY A;  4BAC A;  2IS3 A;  4ISG A;  4CEZ A;  1ASU A;  1VSK A;  5C10 A;  3SV3 A;  1K8K B;  4QS9 A;  2NRX A;  1RT6 A;  2QKB A;  3LWM A;  2VG5 A;  2OA8 A;  1BCO A;  4CZJ A;  3CJ1 A;  4YOV A;  3C7N B;  4GVM A;  1T6C A;  5CR4 A;  2HBL A;  2XY5 A;  2P9N A;  2E2P A;  2PYL A;  3O9U A;  2DY4 A;  1O13 A;  1ZBU A;  3B8A X;  1JL2 A;  3AAP A;  1U47 A;  1K73 O;  4CZM A;  4AHV A;  1C0F A;  4EZ6 A;  1RDB A;  4DFJ A;  4FJN A;  1S3X A;  2X74 A;  4BE1 A;  4U7B A;  3UIQ A;  3MN5 A;  3VF4 A;  4CHO A;  4BR9 A;  3QDK A;  4MFB A;  1IG9 A;  3DXK B;  4CE9 A;  3VQ8 A;  4HCB A;  5I3U A;  3JSM A;  4FK4 A;  3UE5 A;  2W42 A;  2ZE2 A;  3EO3 A;  3LDS A;  3LP3 A;  1HUX A;  3G0Z A;  3R8E A;  3L3U A;  3RMD A;  4LSL A;  3TTD A;  4BR5 A;  2NUB A;  4JKG B;  1SL1 A;  3MXI A;  1VRT A;  4JK8 A;  1YAG A;  4JI4 K;  4M3Y A;  4JV5 K;  1J54 A;  4CEE A;  2Z1I A;  2E20 A;  4DB3 A;  2FSN A;  4C8N A;  3AVN A;  4YOY A;  1X9M A;  3LAL A;  2ASM A;  2WC9 A;  4AM7 A;  3VF6 A;  4DFP A;  4CF0 A;  3A8Y A;  4BVP A;  2QXL A;  4LF7 K;  2QWM A;  5BR9 A;  2KFN A;  3ULD A;  5C2D A;  3T3F A;  4EP4 A;  3ZSV A;  4BRE A;  3SUP A;  1Q9X A;  1VQ5 N;  2RHK A;  4B3M K;  2YJE A;  4OPK A;  3DXM A;  3SNN A;  4DSI A;  1ESV A;  3K9J A;  3K0S A;  5AQL A;  3WXL A;  4DQR A;  4ELT A;  5ELZ A;  3J81 O;  1L3V A;  1RT1 A;  3M5R A;  4Z4H A;  1TK5 A;  4EZ9 A;  3G25 A;  3WT0 A;  2D5R A;  1DTT A;  3KKR A;  3W3D A;  2PZS A;  4NCA A;  2Z1J A;  2XY7 A;  3OJU A;  3QIC A;  4NCG A;  3T1Y K;  3T69 A;  3KTQ A;  2RF2 A;  4CHZ A;  1RTH A;  2RPI A;  3TTC A;  4C1N I;  3CG7 A;  3KLF A;  3UB5 A;  1JL1 A;  2WUS A;  4N56 A;  3KWG A;  3VER A;  5T7B A;  3SJH A;  1XMO K;  4FVU A;  2HMI A;  3NF9 A;  3E9P A;  4IFY A;  5JLH A;  4M7X A;  4CEF A;  4RW7 A;  4W5N A;  2F7T A;  3VEN A;  5ADX H;  1WBD A;  3HPG A;  4HTL A;  2A40 A;  3L2W A;  3L0Q A;  1KVB A;  4I9Q A;  4F9O A;  4IZ9 A;  3TAN A;  3EL2 A;  4B1Z A;  3DXM B;  1J9A A;  5F1X A;  1JXE A;  1NGD A;  2BUP A;  4FL9 A;  3RTV A;  4MO4 A;  3WNH A;  3C6U A;  2F8T A;  3L4Q A;  4Z94 A;  3K9K A;  3M8P A;  5AQV A;  2V7Y A;  1SL2 A;  1S1X A;  4BQZ A;  4FZY A;  4DTM A;  3OYJ A;  1Z05 A;  4A5A A;  3R1X A;  3M1F A;  4WQ4 C;  4M42 A;  1GLB G;  1VQ7 N;  3SLC A;  3M8S A;  3U6F A;  3WNE A;  4CJQ A;  4JI5 K;  4I2Q A;  1TKZ A;  4H0V B;  5KGW A;  2IDO A;  2VGM A;  2FSJ A;  1S1U A;  3V9W A;  4H0X B;  4DV1 K;  3T1H K;  2F4V K;  1GLE G;  4GNI A;  3C0B A;  5AJ3 K;  2OAN A;  1RBR A;  2P9P A;  2A42 A;  5TKY A;  2YCH A;  4B3S K;  1U04 A;  4FJ7 A;  4CFD A;  3NH2 A;  3ZSW A;  3D2F B;  3NBP A;  5AQP A;  1GLL O;  1VHX A;  3WXJ A;  3LAN A;  4K41 A;  3JYT A;  1YIT N;  2V7Z A;  3KK7 A;  1HQU A;  2OPS A;  5KPT A;  4CEA A;  3LM9 A;  3P4I A;  3HVR A;  3OY9 A;  3VA3 A;  4CBW A;  4IDH A;  2I7N A;  3SPZ A;  2XO7 A;  5AZI B;  2Q97 A;  3S3M A;  1BOT O;  4I6M B;  1T7P A;  1GOB A;  1REV A;  2G8I A;  1TGO A;  2X6S A;  4CED A;  4DS4 A;  4FJG A;  1S9E A;  4LC9 B;  3O3H A;  4BR7 A;  2HNZ A;  3HXM A;  4H8K A;  3S41 A;  5SZT A;  4FK0 A;  4KHQ A;  2HF4 A;  3CCQ N;  3WNG A;  1KFS A;  1VQ9 N;  4JAX A;  1NNE A;  1CXQ A;  5IWA K;  5LL6 Z;  3BZK A;  4E89 A;  3C95 A;  1OH5 A;  3ATV A;  2LSN A;  4ISE A;  1L3U A;  4FW2 A;  1WN7 A;  1BI4 A;  5HP1 A;  3JXU A;  1HJO A;  4LF6 K;  5E26 A;  5C2F A;  1B92 A;  3MK6 A;  5AQY A;  3OYH A;  4H0P A;  1XQS C;  2NRT A;  4BRH A;  2FSK A;  3AAR A;  4J8F A;  3ID8 A;  2O8E B;  1R59 O;  2G8K A;  2ITG A;  3PUF A;  3F9K A;  1SKR A;  2ZJQ L;  2OCE A;  3VQ4 A;  4UQG A;  3ZEU B;  4X65 K;  3DAW A;  3O4N A;  4ZTJ A;  3PO5 A;  4BRF A;  4CJR A;  2BDP A;  5AFU H;  1YJ9 N;  2KZM A;  2I7P A;  4DSE A;  3AA3 A;  3TAE A;  1U2V B;  3E01 A;  4FWM A;  1VQN N;  3H3O B;  1TKX A;  2KKZ A;  4QS8 A;  2FF6 A;  3WXI A;  4PL7 A;  4RWT A;  3NGI A;  3K57 A;  4FJM A;  2KQ2 A;  3TAP A;  4KAZ A;  4DR6 K;  4YOT A;  3EE8 A;  3M6G A;  4AHT A;  3K59 A;  1EO1 A;  2DPN A;  3VGL A;  5J2P A;  3U9D A;  4NYN A;  5KRS A;  1BQM A;  4DR3 K;  2G8H A;  5KQ8 A;  3J7Y P;  5FRN A;  3NAE A;  1SL0 A;  1ASV A;  2GEM A;  3G4S N;  3GL1 A;  3NVM A;  3DRS A;  4N41 A;  5HOO A;  4O0I A;  4CHY A;  1T05 A;  2P9I A;  4M7Y A;  1B9F A;  3PIO L;  4J2B A;  4ZHR A;  4C8O A;  1RDA A;  3F5T A;  2YHW A;  2HBJ A;  3QB0 A;  4YOW A;  1QQO A;  3CJB A;  5AQN A;  1NJW A;  4CGI A;  1MA9 B;  4RG8 A;  4O0J A;  5FPN A;  3KVG A;  2AP1 A;  4OX9 K;  2G8F A;  1BUP A;  1WSI A;  4FXD A;  1Z6R A;  4ELV A;  3SQ0 A;  4FPA A;  3P31 A;  2OTJ N;  3A0I X;  1NU0 A;  2AA4 A;  1JLA A;  3LDL A;  2ZF5 O;  3PV8 A;  1RBV A;  1T44 A;  5AQR A;  1QQC A;  3QEI A;  3HZ6 A;  1TK8 A;  1QVF M;  1J6Z A;  3F2K A;  4FWK A;  4B9Q A;  1M90 O;  1KVC A;  4LF5 K;  1NGI A;  5HL7 L;  3OYF A;  4I9L A;  4CJT A;  3V9U A;  1KCF A;  1BGX T;  2OPR A;  2YKN A;  4J2A A;  2E2Q A;  5DM6 L;  4LF8 K;  4R79 A;  1HNZ K;  1SQK A;  1X1P A;  4BE0 A;  2DFF A;  4RW4 A;  1HJR A;  4JNE A;  3VQB A;  2GUP A;  3V9S A;  3CFO A;  3AA4 A;  5AZJ A;  1JKH A;  4CJK A;  2YI1 A;  2OZM A;  1EET A;  1LOT B;  4JI6 K;  4C8K A;  4W5Q A;  4DV2 K;  4WCE L;  2CGL A;  3FZH A;  5DM7 L;  4FYD A;  2B4J A;  4KRF A;  2HMP A;  2VWJ A;  5C15 A;  4DFK A;  3WNF A;  2KLA A;  4CEO A;  1GLA G;  4CJS A;  3RWU A;  1KLM A;  3HO1 A;  1V4T A;  5C24 A;  4OVL A;  3S3N A;  1RBS A;  3DLB A;  4B8A B;  1YJW N;  5EX5 A;  2JLE A;  4XIU A;  1NKB A;  1BG3 A;  2NRZ A;  3NGY A;  4GVE A;  1BCM A;  2HBM A;  4KTW A;  2W41 A;  3CFP A;  3OYL A;  1NJX A;  3VQA A;  4YFU A;  4DR2 K;  3CJ7 A;  5BPN A;  3CET A;  2O8D A;  4BRA A;  3ZX2 A;  1W9H A;  1NGJ A;  4BG8 A;  2QWO A;  2QWQ A;  4EP5 A;  5HRN A;  3HOT A;  4DSJ A;  5BRF A;  1HKB A;  1NMD A;  1N36 K;  3VN5 A;  3OYE A;  3IG1 A;  2ETJ A;  3OHR A;  4OPH A;  3L4I A;  3U8X A;  1WBB A;  3BY5 A;  1RFQ A;  1XNQ K;  1C1C A;  1ITG A;  4HTU A;  1WAF A;  2ZGZ A;  1YIJ N;  1WSH A;  1QHA A;  1KAY A;  1NKC A;  4LH5 A;  4FCY A;  5AR0 A;  4CD3 A;  3VA0 A;  3FFK B;  1NK7 A;  1VSJ A;  1HNI A;  3BP8 A;  3HVT A;  2Q2R A;  4K8Z A;  1ATN A;  5AQH A;  1HRH A;  3FR0 A;  1IG8 A;  4JK9 A;  1WNS A;  1C6V A;  2NLX A;  1U49 A;  3L2V A;  3BF3 A;  1G99 A;  4AHC A;  3D7E O;  5IT9 O;  4NYF A;  4B9U A;  2ASO A;  3CQ8 A;  2O8B A;  1TAU A;  2WTU A;  4BE2 A;  3HK2 A;  3CI5 A;  4JD2 A;  2VQF K;  4O8K A;  4DQP A;  2HHS A;  1ZBS A;  2O4G A;  5SWM A;  5BN8 A;  4FWO A;  4W5R A;  3AVK A;  3HPO A;  3DRR A;  5BPM A;  2D0O A;  5BRH A;  1XUP O;  4FLZ A;  1K9M O;  3ULE A;  2GWJ A;  5M1P A;  1WLJ A;  4LF9 K;  3HRG A;  2ZJR L;  2CGK A;  4JI2 K;  3TU5 A;  1XI1 A;  1CZ9 A;  1XHZ A;  4JRP A;  1HKC A;  4F8R A;  4AM6 A;  4CER A;  1GLJ O;  5KPZ A;  3PSF A;  4CGF A;  4IDK A;  1D4X A;  3P5J A;  3EY1 A;  1HKG A;  1VSL A;  2ZM6 K;  1A5W A;  3TAQ A;  2KFZ A;  3V1R A;  4LY7 A;  4GV3 A;  3AGR A;  1CZA N;  4JS5 A;  2HOE A;  4DTO A;  3L3V A;  4R5P A;  3HL8 A;  3SCX A;  4JI0 K;  3SAH A;  1L5U A;  3PX0 A;  3OYA A;  3FFI A;  4GKK K;  3RMB A;  4H0T B;  2OPQ A;  5K14 A;  4C8M A;  1GOC A;  2QM1 A;  2YV0 X;  3VF2 A;  4ILH A;  3VEO A;  3GOI A;  5GAD P;  3THX B;  1X3M A;  2ASP A;  3QEW A;  1O1W A;  3VGK A;  3KD1 E;  3QBW A;  1RBT A;  4A61 A;  2FF3 B;  2I5J A;  4DLE A;  4H5T A;  1X9W A;  3QEV A;  3OYN A;  3MN7 A;  1VQP N;  1I94 K;  4CEB A;  3VQ6 A;  3RVC A;  4CFC A;  3THY A;  3NDK A;  4E1N A;  1DGK N;  4B08 A;  4HCC A;  3DLR A;  1QZ6 A;  5EXW A;  5C42 A;  3RR7 A;  3T1A A;  2P9S B;  1LAW A;  4Y0W A;  4M3R A;  4PY5 A;  4OGE A;  2CGJ A;  3QO9 A;  2HHX A;  1C1A A;  5AQM A;  3I56 N;  2P9L B;  4DSL A;  1D9F A;  1RT5 A;  1Q86 O;  1J5E K;  3MDQ A;  4FM2 A;  3QBX A;  4CK3 A;  1RGI A;  4FWL A;  3NH1 A;  3QIO A;  4BRK A;  1YJN N;  4E7J A;  4CZE A;  3ZET A;  2D1K A;  4CZG A;  2GV9 A;  5AQK A;  3H46 O;  5FLX O;  4IBN A;  2XRI A;  4K0K K;  3AVL A;  2O8F B;  2UXB K;  3K5L A;  4BRN A;  2BTF A;  3SBT A;  3CCM N;  4H4M A;  5DMR A;  5HRR A;  1UWB A;  3N4P A;  3SAF A;  3ZT4 A;  3QML A;  4ISF A;  5JS2 A;  4FJX A;  4KH4 A;  4Z4I A;  3THW B;  3KHY A;  4IOA L;  2Q36 A;  2GEL A;  3BZC A;  3M3Z A;  3MXJ A;  3OYK A;  3THY B;  4O4G A;  4DR7 K;  3VTI A;  2JWL A;  2IGI A;  3J7A P;  3CCS N;  3KZB A;  4DU1 A;  2P5G A;  3CJA A;  1W7A A;  3DLG A;  4IJA A;  4BRD A;  4DV7 K;  1YTA A;  3A5O C;  3CME N;  1CZB A;  5H1S Q;  3ZSQ A;  4GMJ B;  1IJJ A;  3AO4 A;  3O9Q A;  3ZSR A;  3PO4 A;  1JCG A;  4PWD A;  1D9D A;  2D0B A;  3LZI A;  1MDU B;  2BH1 A;  4X62 K;  3PX6 A;  3B6P A;  2Q0R A;  3AVM A;  3SUN A;  5AQI A;  5HRO A;  2P9N B;  3K5O A;  1ZBL A;  2IVP A;  1YT3 A;  1UAX A;  3AY9 A;  2KTQ A;  3HSC A;  2Q0U A;  3O9T A;  5M1F A;  2D0C A;  4EIA A;  2HBK A;  1FJG K;  3KLE A;  3L2U A;  1JLQ A;  3FZL A;  3T19 A;  4KHU A;  3CM6 A;  3SQ1 A;  3ZLJ A;  1T6D A;  2YX6 A;  2F9T A;  3H1Q A;  3OVN A;  3E9O A;  5FRO A;  3EYZ A;  4B1U B;  4A2B A;  4FSV A;  4FWR A;  4BC3 A;  2F8S A;  4EHT A;  4CGJ A;  2GTD A;  4RTF D;  2QTD A;  3DOL A;  3Q7C A;  4N76 A;  3HP9 A;  3NMU A;  4N5S A;  4KHN A;  4O8U A;  2NRR A;  5HBM A;  2E8A A;  4CJV A;  5HRP A;  4JI7 K;  2VWB A;  4DV5 K;  1R0A A;  3EKU A;  4BRC A;  1NJI O;  2A1R A;  2QWN A;  3HI0 A;  3I33 A;  4FWP A;  2P5O A;  2XY6 A;  5AQQ A;  3RRH A;  4KB0 A;  3BEX A;  1NLV A;  3NE6 A;  2IVO A;  3SK3 A;  5BRD A;  2YNH A;  1JCF A;  2QA4 N;  1LWE A;  1SKS A;  4WQ5 A;  3CJ9 A;  5KQD A;  3RMC A;  1KVA A;  2E1Y A;  1EQY A;  2Q3S A;  3PX4 A;  1NK6 A;  1ZBI A;  3VEV A;  1EWQ A;  4CJE A;  4C8L A;  2AJQ A;  4WF9 L;  5AQG A;  4JKD A;  4K43 A;  1ZBF A;  5HLF A;  5C25 A;  2OYQ A;  4BWJ A;  4FLT A;  1V4S A;  3MED A;  1YVU A;  4FWN A;  1LWF A;  2ATQ A;  4KTZ A;  3OJS A;  1Q7Y O;  2E5L K;  4FJ8 A;  3OA9 A;  3TAR A;  4WFA L;  1L3S A;  1HLU A;  3VQQ A;  1RIL A;  3K5N A;  1W97 L;  2NRW A;  3DLE A;  4J2E A;  5AQW A;  1RTD A;  3T7Z A;  3K2P A;  3VGM A;  3EN9 A;  4BRO A;  2UU9 K;  2Q31 A;  3LP2 A;  1TL1 A;  3OS2 A;  4CJP A;  4NO7 A;  3VMF B;  1EP4 A;  3G6E N;  4CZH A;  2GX9 A;  4JKE A;  3CXC M;  2UXC K;  3I0S A;  3OYM A;  3B6O A;  4DTR A;  1QQM A;  2HHW A;  4H0Y B;  2HVH A;  4CZI A;  1UA1 A;  4FOE A;  2E6M A;  2YJF A;  3E9L A;  4DS5 A;  3LDN A;  2V51 B;  4MO5 A;  2XY8 A;  1ZYQ A;  3FZM A;  2Q1N A;  2P9K A;  3N4Q A;  5KPR A;  4GV9 A;  3OBY A;  3O9S A;  3RRG A;  2P9P B;  3V6D A;  3IRX A;  4DQQ A;  1TYQ A;  3FZK A;  1CXU A;  3I8D A;  1UOC A;  4BRL A;  2NRV A;  2EX3 A;  2IOC A;  1N5Y A;  4CD1 A;  4DF4 A;  3TWH A;  4OPJ A;  4JRQ A;  1Q82 O;  3ZT0 A;  2W40 A;  4BQL A;  1QHT A;  2GBZ A;  3VOV A;  3NF6 A;  5JIC A;  1NBW A;  1LAV A;  4V19 S;  4DTX A;  4HHT A;  1E4G T;  4TSX A;  3MN6 A;  1VSH A;  4BRG A;  3DM2 A;  4MQ3 A;  2ZD1 A;  2HND A;  3IAY A;  4M3Z A;  3ISN C;  4ICL A;  4H03 B;  3QES A;  4DLG A;  3FZF A;  1QSL A;  2VYP A;  2NNW A;  4KRE A;  2A6A A;  4X66 K;  1X3N A;  2GWK A;  3HT3 A;  4BC2 A;  2XHB A;  5E84 A;  4B9T A;  4LH4 A;  5AQU A;  4CJ4 A;  4ZTF A;  2FC0 A;  1OVY A;  1QSS A; 
#chains in the Genus database with same CATH homology
 3VQ9 A;  1Z26 A;  1C1C A;  1ITG A;  1BIZ A;  1ASW A;  4HTU A;  5FDL A;  4DF8 A;  1BQN A;  3KKS A;  1WAF A;  4CFB A;  3ZSY A;  4BAC A;  2IS3 A;  1NK0 A;  1WSH A;  1BI4 B;  4Y1C A;  3VQP A;  1NKC A;  4DU3 A;  4CEZ A;  1RNH A;  4LH5 A;  4FCY A;  3NHG A;  3OYD A;  4FJJ A;  1TKT A;  5E41 A;  4BDY A;  1ASU A;  1VSK A;  4E19 A;  3SV3 A;  4RW8 A;  3AVJ A;  3VA0 A;  1NK7 A;  1VSJ A;  1HNI A;  1RT6 A;  2WOM A;  3HVT A;  3KK1 A;  4KO0 A;  2QKB A;  3LWM A;  2VG5 A;  2OA8 A;  1BCO A;  4K8Z A;  3OS1 A;  3QNN A;  2KZZ A;  5J2Q A;  1HRH A;  4GVM A;  3NFA A;  2XY5 A;  1VSD A;  1WNS A;  2IC3 A;  1C6V A;  2FBT A;  3LP0 A;  1U49 A;  2PYL A;  4OKJ A;  2DY4 A;  1S6Q A;  1ZBU A;  1JL2 A;  1Z25 A;  1S6P A;  3QIN A;  3M8R A;  3L2V A;  3K58 A;  3V9Z A;  1U47 A;  4AHC A;  4AHV A;  4EZ6 A;  4NYF A;  1RDB A;  4DFJ A;  4B9U A;  4FJN A;  1BIS A;  2X74 A;  3LP1 A;  4BE1 A;  3CQ8 A;  3O3G A;  3UIQ A;  1TAU A;  4BE2 A;  3HK2 A;  3ZCM A;  4CHO A;  1QTM A;  4MFB A;  1IG9 A;  3KK2 A;  4DQP A;  2HHS A;  4O55 A;  2RN2 A;  4CE9 A;  3VQ8 A;  3TAF A;  4HCB A;  5I3U A;  3JSM A;  4AHS A;  4FK4 A;  2W42 A;  2HB5 A;  1FKP A;  2ZE2 A;  1JLB A;  3DI6 A;  4FVM A;  4PA1 A;  2O4G A;  3G0Z A;  3LP3 A;  4CIG A;  3LDS A;  2YNI A;  4KB1 A;  3L3U A;  5SWM A;  4W5R A;  3RMD A;  4LSL A;  2ZQB A;  1RT4 A;  2NUB A;  3CFR A;  3AVK A;  3MXI A;  1SL1 A;  2YHA A;  3HPO A;  1VSM A;  1VRT A;  3KD5 E;  3DRR A;  3C6T A;  4M3Y A;  4Z4F A;  1J54 A;  4FLZ A;  4FJK A;  4CEE A;  4CIE A;  2Z1I A;  3VQD A;  3LZJ A;  1WLJ A;  4Y1D A;  4C8N A;  4FLY A;  4DSF A;  4KHY A;  3AVN A;  4DU4 A;  3ZSO A;  1XI1 A;  2JGU A;  1X9M A;  1CZ9 A;  3LAL A;  4Q5V A;  3KK3 A;  4DFP A;  4JRP A;  1XHZ A;  4CF0 A;  4F8R A;  4CER A;  1JXB A;  3NCI A;  1NK9 A;  4CGF A;  3AA2 A;  3A2F A;  4IDK A;  4CEQ A;  4W5T A;  2KFN A;  3ULD A;  3TR8 A;  3P5J A;  1Q8I A;  3QEP A;  3T3F A;  4KPY A;  3QLH A;  4EP4 A;  3ZSV A;  3TAB A;  1X9S A;  3SUP A;  1Q9X A;  3EY1 A;  4FM0 A;  1IH7 A;  4OPK A;  2VWK A;  1VRU A;  4JLH A;  3SNN A;  4LSN A;  5KRT A;  4DSI A;  3MEG A;  4F3O A;  4DQR A;  1VSL A;  1A5W A;  3TAQ A;  4B9M A;  4ELT A;  2KFZ A;  3VQC A;  1RT3 A;  4ID1 A;  1L3V A;  3NGZ A;  1RT1 A;  3V1R A;  4LY7 A;  5KI6 A;  1DLO A;  5I42 A;  4Z4H A;  4JS5 A;  1VSE A;  4DTO A;  3L3V A;  4IFV A;  3HL8 A;  4R5P A;  4DFM A;  3SCX A;  1TK5 A;  4EZ9 A;  1KLN A;  1S9G A;  1L5U A;  4K8X A;  2D5R A;  3PX0 A;  3OYA A;  1DTT A;  1VK0 A;  1NOZ A;  2D0A A;  3FFI A;  3KKR A;  3AO2 A;  3RMB A;  2PZS A;  4NCA A;  2YHB A;  3OS0 A;  2Z1J A;  2OPQ A;  2XY7 A;  2DTU A;  4M41 A;  5K14 A;  4O44 A;  3OYB A;  4C8M A;  3OJU A;  4FJ9 A;  5FRM A;  1GOC A;  2YV0 X;  4NCG A;  1TVR A;  4CEC A;  2OZS A;  3OYC A;  4J2D A;  1IKY A;  3LWL A;  3SUQ A;  3BDP A;  3KTQ A;  2OPP A;  2RF2 A;  3SJJ A;  1A5V A;  1D5A A;  2B5J A;  4CHZ A;  4E7H A;  4M3W A;  1RTH A;  2QKK A;  2RPI A;  1RTI A;  3QEW A;  1O1W A;  3CG7 A;  4FM1 A;  3V4I A;  3KD1 E;  4AHR A;  4F4K A;  3KLF A;  1RBT A;  3V81 A;  1YTU A;  1JL1 A;  1XWL A;  4LD0 A;  1Y97 A;  4N56 A;  1HPZ A;  2I5J A;  5T7B A;  4DLE A;  1X9W A;  3L8B A;  1GOA A;  4DG1 A;  1RCH A;  3OYN A;  3QEV A;  2F96 A;  2HMI A;  4CEB A;  3VQ6 A;  2KW4 A;  3CM5 A;  3NF9 A;  1SKW A;  3DLH A;  3SQ4 A;  4CFC A;  4IFY A;  3HYF A;  3TAG A;  3NDK A;  4E1N A;  4CEF A;  4RW7 A;  3AVH A;  4W5N A;  4B08 A;  5J2M A;  4HCC A;  3DLR A;  3HPG A;  5C42 A;  3RR7 A;  3L2W A;  1TKD A;  1KVB A;  3T1A A;  1CLQ A;  1LAW A;  1I39 A;  4CHQ A;  4M3R A;  4I9Q A;  4PY5 A;  3TAN A;  4OGE A;  3QO9 A;  2HHX A;  4O5B A;  1C1A A;  3KIO A;  4CFA A;  1J9A A;  4QAG A;  2PYJ A;  1JXE A;  4DSL A;  1D9F A;  2F8T A;  1RT5 A;  3WNH A;  3LAM A;  3C6U A;  4CHN A;  4CIF A;  3TAM A;  3RTV A;  1UA0 A;  1WSJ A;  5CZ2 A;  3HST B;  3L2Q A;  4CCH A;  4G1Q A;  3U3G A;  2IAJ A;  3NH1 A;  4CK3 A;  4FM2 A;  1BIU A;  2E4L A;  4YNQ A;  3M8P A;  2HHV A;  1B9D A;  1SL2 A;  3ZSZ A;  1S1X A;  4FZY A;  3QIO A;  1TK0 A;  4CF8 A;  4DTM A;  1D8Y A;  4E7J A;  4KKO A;  3OYJ A;  4OGC A;  3AVG A;  4L8R B;  3HM9 A;  2GV9 A;  4OKE A;  4M42 A;  1NJZ A;  3M8S A;  4Z4G A;  3U6F A;  3WNE A;  4CJQ A;  1S1T A;  3DLK A;  4I2Q A;  4IBN A;  1TKZ A;  2GUI A;  2XRI A;  3AVL A;  3VQ7 A;  5KGW A;  2IDO A;  3K5L A;  3VQ5 A;  4DTN A;  4DTJ A;  1S1U A;  1RDC A;  3V9W A;  3IS9 A;  4DTU A;  4H4M A;  5DMR A;  5HRR A;  1FK9 A;  3V9X A;  2FBV A;  3LPT A;  1SUQ A;  1UWB A;  1RBR A;  3KJV A;  1U4B A;  5KTQ A;  1J5O A;  1KFD A;  3ZT4 A;  3HPH A;  3OYI A;  5KGX A;  1U04 A;  3PY8 A;  4FJ5 A;  4CFD A;  4FJ7 A;  1QSY A;  5JS2 A;  3THV A;  4FJX A;  3OYG A;  2R7Y A;  4NCB A;  3NH2 A;  4Z4I A;  1JLF A;  2HVI A;  1IKV A;  3MXJ A;  2X78 A;  3ZSW A;  4AIL C;  1S1W A;  3OYK A;  1T8E A;  4O4G A;  3NBP A;  4FW1 A;  3LAN A;  1MU2 A;  2IGI A;  3JYT A;  4CES A;  2BGG A;  1K6Y A;  4DU1 A;  1HQU A;  2OPS A;  2P5G A;  2HHU A;  4CEA A;  3HVR A;  1S1V A;  3DLG A;  2Y1I A;  4M3U A;  3OY9 A;  3V1Q A;  3VA3 A;  4F3T A;  1TV6 A;  1YTA A;  1J53 A;  3SPZ A;  1CZB A;  2XO7 A;  3DYA A;  4RW6 A;  1C0U A;  1DTQ A;  3ZSQ A;  4GMJ B;  3AO4 A;  2YNG A;  3S3M A;  3ZSR A;  3ZSX A;  3PO4 A;  1VSI A;  1T7P A;  4DQS A;  4PWD A;  1GOB A;  1REV A;  1HYV A;  1D9D A;  4DQI A;  2G8I A;  1TGO A;  2X6S A;  2D0B A;  4CED A;  4DS4 A;  4KHW A;  1C0M A;  3LZI A;  3MEC A;  1EXQ A;  3K5M A;  4FJG A;  3EZ5 A;  1S9E A;  3O3H A;  3PX6 A;  3B6P A;  2WON A;  2G8U A;  1IKX A;  3AVM A;  2HNZ A;  3SUN A;  3AO3 A;  4CJU A;  3HXM A;  3S9H A;  4Z4C A;  4H8K A;  5DK5 A;  5SZT A;  5HRO A;  4E7L A;  3K5O A;  4FK0 A;  4HUE A;  4FLV A;  1ZBL A;  4KHQ A;  1YT3 A;  3DMJ A;  1UAX A;  3WNG A;  1LV5 A;  1KFS A;  2KTQ A;  2Z1H A;  3TI0 A;  1RT2 A;  2A1S A;  1CXQ A;  4W5O A;  3ZT2 A;  2D0C A;  4F2S A;  1KRP A;  4FLX A;  4E89 A;  3HJF A;  3QEX A;  3C95 A;  3O4Q A;  3KLE A;  4E1M A;  3L2U A;  2LSN A;  3AVB A;  1NK4 A;  1L3U A;  1JLQ A;  4FW2 A;  3KLG A;  1WSG A;  1WN7 A;  3T19 A;  1BI4 A;  3ITH A;  3BGR A;  5HP1 A;  4KHU A;  4CGG A;  3CM6 A;  3SQ1 A;  1HYZ A;  4DTS A;  2YNF A;  1FKO A;  3HP6 A;  3OVN A;  1BHL A;  4E0D A;  1B92 A;  5FRO A;  4QOZ B;  3M8Q A;  5CYM A;  4OLA A;  2EHG A;  4ELU A;  2G8W A;  3SUO A;  3EYZ A;  3OYH A;  1TL3 A;  3QER A;  1EKE A;  3LPU A;  4CK1 A;  1LW0 A;  5CZ1 A;  3V1O A;  2F8S A;  3P83 D;  4I2P A;  4CGJ A;  3DOL A;  3SPY A;  3NF8 A;  1IO2 A;  2G8K A;  4N76 A;  2ITG A;  3HP9 A;  3PUF A;  4CF2 A;  4JS4 A;  3F9K A;  4E7I A;  4N5S A;  1JLG A;  1QSS A;  4KHN A;  1SKR A;  3L2R A;  4KV8 A;  4CJF A;  2HNY A;  5HBM A;  1U48 A;  3VQ4 A;  1HQE A;  4CJV A;  5HRP A;  1HNV A;  4UQG A;  4DWI A;  4AHU A;  4ZTJ A;  3PO5 A;  3O4N A;  5J1E A;  4CJR A;  4E7K A;  5CY4 A;  1R0A A;  2BDP A;  4WE1 A;  2KZM A;  4DSE A;  3TAE A;  3AA3 A;  3E01 A;  3VQE A;  3P1G A;  2A1R A;  3AA5 X;  3NGI A;  1TKX A;  4FJM A;  3K57 A;  3G10 A;  2KQ2 A;  3TAP A;  4KAZ A;  2QK9 A;  4PQU A;  3ASM A;  4H4O A;  3H08 A;  3KLH A;  4B8C A;  2P5O A;  2XY6 A;  4AHT A;  4M3T A;  4HUF A;  1W0H A;  2RKI A;  3K59 A;  3RRH A;  4KB0 A;  4CJ5 A;  5J2P A;  5KRS A;  4NYN A;  3MXM A;  4DTP A;  1BQM A;  3C94 A;  3NE6 A;  4B9V A;  4Z0U A;  2G8H A;  1EX4 A;  5FRN A;  1JLE A;  2YNH A;  3NAE A;  3D45 A;  1C0T A;  1SL0 A;  4FJH A;  1ASV A;  1XHX A;  4HUG A;  1LWE A;  4DMN A;  1SKS A;  2FBY A;  1Q9Y A;  2P1J A;  5D3G A;  2B6A A;  4ID5 A;  4BWM A;  3DRS A;  3RMC A;  4N41 A;  1KVA A;  4FZZ A;  1NK6 A;  2BAN A;  2Q3S A;  3PX4 A;  4IG3 A;  4CHY A;  4O0I A;  1T05 A;  4CJE A;  1ZBI A;  1ZBH A;  1B9F A;  4C8L A;  4J2B A;  4ZHR A;  1NK8 A;  4OLB A;  4C8O A;  1RDA A;  4GW6 A;  2AJQ A;  1BL3 A;  4KFB A;  4RW9 A;  1NJW A;  4CGI A;  1L3T A;  4FLW A;  3QET A;  1ZBF A;  5HLF A;  4RG8 A;  5C25 A;  2OYQ A;  4O0J A;  3NF7 A;  4BWJ A;  4CJW A;  4FLT A;  1F21 A;  3MED A;  1YVU A;  1A5X A;  2G8F A;  2P51 A;  1LWF A;  2ATQ A;  4KTZ A;  5EU7 A;  3OJS A;  3SV4 A;  3SYZ A;  3U3Y A;  4M45 A;  1KSP A;  1WSE A;  4CF9 A;  1WSI A;  4FXD A;  4QCL A;  4FJ8 A;  4ELV A;  3SQ0 A;  1KTQ A;  3TAR A;  1NK5 A;  4PUO A;  2E6L A;  3SZ2 A;  1L3S A;  2QXF A;  3VQQ A;  4BDZ A;  3O3F A;  1JLA A;  1RIL A;  3K5N A;  3PV8 A;  1WSF A;  3DLE A;  4BDP A;  1RBV A;  4J2E A;  1RTD A;  1QQC A;  4AH9 A;  3K2P A;  1FXX A;  5J2N A;  3QEI A;  3S3O A;  1HYS A;  4FLU A;  3NH0 A;  1TK8 A;  3LP2 A;  1TL1 A;  3OS2 A;  1C1B A;  4IKF A;  4CJP A;  2G8V A;  1KVC A;  4CF1 A;  3CYM A;  4OKK A;  1QE1 A;  1EP4 A;  3OYF A;  1RT7 A;  1TAQ A;  1VSF A;  4I9L A;  4CJT A;  3V9U A;  4Q0B A;  1KCF A;  1BGX T;  2OPR A;  4M3X A;  2YKN A;  1HMV A;  4J2A A;  3I0S A;  3OYM A;  3QNO A;  4IG0 A;  1SV5 A;  5HRS A;  4KI4 A;  3B6O A;  1RTJ A;  3RR8 A;  4DTR A;  4N47 A;  3ZT3 A;  2HHW A;  3ALY A;  1U45 A;  4DSK A;  2HVH A;  1LWC A;  1UA1 A;  1X1P A;  4E3S A;  4BE0 A;  2DFF A;  2E6M A;  3KLI A;  3LAK A;  4RW4 A;  4CGH A;  4DS5 A;  1HJR A;  2O4I A;  1I3A A;  3VQB A;  2YKM A;  4KHS A;  2XY8 A;  3I0R A;  1ZYQ A;  3F73 A;  3V9S A;  3MAQ A;  3CFO A;  3AA4 A;  3D0P A;  1JKH A;  4CJK A;  5CYQ A;  2OZM A;  1EET A;  1QS4 A;  4C8K A;  2DFE A;  4W5Q A;  2Z1G A;  4I7F A;  4FYD A;  3RRG A;  3SQ2 A;  1JLC A;  2B4J A;  4KRF A;  2VWJ A;  4DFK A;  3AVF A;  3V6D A;  3AO5 A;  3IRX A;  4DQQ A;  2Y1J A;  3WNF A;  2HHT A;  4CEO A;  4CHP A;  1CXU A;  3I8D A;  1UOC A;  2VG7 A;  4KTQ A;  4CJS A;  2EX3 A;  1WAJ A;  2IOC A;  3AVI A;  1N5Y A;  4B9S A;  5JS1 A;  4DF4 A;  1S5J A;  3TWH A;  3RWU A;  1KLM A;  4FJL A;  4OPJ A;  4CJ3 A;  4JRQ A;  4CGD A;  3HO1 A;  4B3O A;  4B9L A;  4HVJ A;  5C24 A;  4OVL A;  3ZT0 A;  3S3N A;  1NOY A;  4FK2 A;  1RBS A;  2HHQ A;  3QIP A;  1RDD A;  3DLB A;  1QHT A;  1RBU A;  2GBZ A;  4B8A B;  3AV9 A;  3NF6 A;  4Z4E A;  3SI6 A;  1IKW A;  3AO1 A;  1LAV A;  2JLE A;  4OJR A;  4XIU A;  1XC9 A;  1NKB A;  4DTX A;  4HHT A;  4FZX C;  4TSX A;  3AVC A;  1NKE A;  3NGY A;  1VSH A;  1BCM A;  4KI6 A;  2FBX A;  4KTW A;  3AVA A;  3DM2 A;  4MQ3 A;  2ZD1 A;  2HND A;  1G15 A;  3IAY A;  3CFP A;  4B9N A;  3ZT1 A;  3DRP A;  3OYL A;  1NJX A;  4M3Z A;  3ISN C;  3VQA A;  4ICL A;  2X6N A;  4YFU A;  3QES A;  4DLG A;  1W9H A;  1QSL A;  2PY5 A;  4FJI A;  4CJL A;  4KRE A;  4EP5 A;  2BE2 A;  5HRN A;  3DOK A;  4DSJ A;  3HT3 A;  3RMA A;  3VN5 A;  3MEE A;  3IG1 A;  3OYE A;  4F2R A;  4CK2 A;  2ETJ A;  2XHB A;  1T03 A;  1NJY A;  1LW2 A;  2DFH A;  4B9T A;  4LH4 A;  2HW3 A;  4CJ4 A;  4ZTF A;  2FC0 A;  1N6Q A;  2VG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...