3AVZA

Structure of sars 3cl protease with peptidic aldehyde inhibitor containing cyclohexyl side chain
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
300
structure length
300
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDIQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGSTILEDEFTPFDVVRQC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-Like Proteinase
publication title Structure-Based Design, Synthesis, and Evaluation of Peptide-Mimetic SARS 3CL Protease Inhibitors.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Hydrolase/hydrolase inhibitor
total genus 79
structure length 300
sequence length 300
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-03-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3avzA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3avzA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3avzA02
1L0ZA 3VEQB 1O33A 1YLCA 2FOEA 1XUGA 1KY9A 3RXGA 4GAWA 4Q7XA 3LH1A 4UFDH 5BRRE 2CF8H 1RTFB 3FAOA 5EG4A 3RXMA 1HJAC 1KIGH 3K65B 1G36A 1XMNB 4MLFB 1CSOE 4JZ1A 2ZDMA 2JKHA 4RKOB 2ZP0H 3MU5A 4DIHH 1VITH 2FOGA 1ZHMA 3SV8A 4HZHA 2ZO3H 1SQTA 3TK6A 1VJ9U 1WU1A 2ALPA 1F2SE 1BOQA 1LKAA 4FVBA 1ETRH 5ETXA 2ZECA 3MO3A 1TX6A 2EI8A 4NSYA 1C1QA 1NT1A 3Q77A 1ZLRA 1D3DB 3CENA 4FUEA 1BDAA 4AB9A 3URCA 4BTTB 1ESTA 4CH2B 1RGQA 4ABJA 4KTUA 2RA0A 3OYPA 5LPFA 4X6OA 3OX7U 1NROH 2PKSB 1O3NA 3ZV8A 3TH4H 1YBWA 1MZAA 2A5KA 4FUIA 1EZUC 1NFWA 3ZZCA 3KNXA 3S7KB 1PJPA 4B76A 2ALVA 2JH5D 5JPMH 1P01A 2PFEA 1K1IA 9ESTA 1O2XA 2XRCA 1ZMLA 4I7YH 1QQ4A 4WJG2 1MAYA 1C2FA 2BDCA 4OS7A 2CV3A 3TGKE 1C2DA 3LGVA 2OD3B 3LGWA 2HNTF 1Z8RA 1A5GH 1TQ7B 2CHAB 1P3EA 2PKSC 3T62A 1QJ1B 5DP8A 2AYWA 4ISIH 4F49A 1O5AB 2SGPE 1OX1A 1WAYB 2HOBA 3H5CB 3DHKH 1YPEH 1J14A 1UTPA 5JYIA 1L2EA 3BTHE 3MTYA 1ELEE 1BBRH 3A8DA 3C1KA 1ACBE 2FOHA 1UCYE 2PW8H 2FX6A 2OC1A 2J34A 4ABBA 1T8MA 1TIOA 1AU8A 3PM3A 1HJ9A 7GCHG 3PTNA 4LOYH 4R0IA 3RXLA 2NU3E 3G01A 4AOQA 1GBBA 4NA8A 2H2ZA 1PPEE 2R2WU 1ZYOA 2XW9A 2QF3A 1DOJA 1GBEA 4CH8B 1NPMA 1VJAU 1LTOA 4U01A 3CS0A 3LGYA 4B2AA 1C5LH 2CHAC 3B8JA 1O2SA 3T2NA 2ZGXH 4DGJA 3Q3XA 2I6QA 1L1GA 3RMNH 2FPZA 1NRRH 4OS1A 1A5IA 2BD3A 4YT6H 4H6TA 2A4OA 1OKXA 1SLWB 2KAIA 2W7UA 4OGYA 5G4BA 1O2RA 1ZZZA 2FMJA 5A0BA 1KXFA 1HAPH 2ULLA 5FBIA 1IOEA 1K22H 2FZZA 4X8UH 1EKBB 1T4UH 5CHAB 1DICA 1RTLA 4UD9H 1W11U 3SU5A 4K60A 3SNAA 3OSYA 1LHGH 1TLDA 1KLJH 1UVPA 1UO6A 3UQVA 1UVSH 1BRUP 1V2KT 2UUYA 1T32A 1ETSH 1XX9A 1YF4A 1AVGH 1GHVH 1BMAA 1XVOA 4TY7A 1C9PA 1D3TB 2A31A 2QCYA 3BTEE 2ZZUH 2NU0E 1ESBA 3T29A 2AERH 4XOJA 1C2KA 1AY6H 1E0FD 4H4FA 3RXHA 1AIXH 2M5TA 5JBCS 3SQHE 1O3CA 2GDEH 3N7OA 2EI7A 5CHAC 1TRNA 4NFFA 2F9BH 3K9XB 4IS5A 3GDVA 1S0RA 4MTBA 2G4TA 3ZZ8A 3RXBA 2ZCKP 1ANEA 2Y5FA 5FBEA 3ITIA 4AYYB 1GMHF 1IHTH 4CBNA 1TNGA 2ANYA 2BQ6B 1HUTH 1P0SH 1JRTA 1B5GH 3D49H 4FUFA 1DXWA 3BTDE 4KP0A 1SGDE 2FODA 1O2YA 2XC0A 5AF9H 2VWNA 4DW2U 2Z9KA 1ELBA 1FAXA 1CA8B 4IMQA 4CR5A 4KELA 5GJ4B 2PKAA 4IGDA 1TGCA 1GHZA 4Y11E 3SI4H 4ISNA 4ABEA 1H8DH 3GDUA 3L33A 2PTNA 1V6DA 1IHSH 3TJOA 5C5OA 2A4GA 3BIUH 1C4V2 2F91A 1FY1A 1V2LT 2JH6D 1O5GH 3PYHA 4X1QU 3E3TA 1ELDE 1LCYA 1ZRKA 1C1WH 1O2OA 4KGAA 1SOTA 3E0NB 1Z8JB 1NRPH 1N6XA 4Y7AA 1SGEE 5IYTA 1C9TA 5EQSA 1BRAA 1A3BH 1DSTA 3GDSA 3RXCA 3V13A 4PROA 1KXCA 2HPPH 3SGAE 2ANKH 4D8NA 1MCTA 1S0QA 3H7OA 2ZDLA 1Z7KA 1BTUA 1Y5AT 1RJXB 4NWLA 1JIMA 2W3KA 1PQ5A 2R3UA 5HGGA 1P8VC 1ETTH 3M35A 2OBOA 3TIUA 1ZPBA 1GMHG 2WPJS 1VGCC 1SPJA 1GI8B 2XCFA 2ZC9H 4ZAEA 4X1NU 3TNTA 1WUNH 2W26A 2V35A 1K1PA 1TYNA 2ZKSA 4FUBA 1W3CA 1H8IH 2BX3A 4Y8YA 2R3YA 3WY8A 4MNWA 4RSPA 1OWKA 3ATWA 1L1NA 4XSKU 3ZVBA 2BD8A 3L3TA 4GHTA 3SUDA 1UHBA 1IQMA 2P93A 3DA9B 3CP7A 4YOIA 1YCPH 1O2PA 3QK1A 1BMLA 5FPSA 1TNIA 1KDQB 2BZ6H 2BY9X 1SFQB 2ESTE 2ANMH 4UFEH 4SGBE 2BB4A 2FX4A 2UWPA 5DP3A 3P6ZB 3KQCA 3RLWH 3QTOH 1HBTH 5C5NA 4K8BA 1QNJA 3U8TH 2J95A 2GZ8A 1HJ8A 1SVPA 2A4RA 3A80A 1TA2A 1DE7H 1DY8A 1JBUH 1MQ6A 3LOXA 3KEEA 3B23B 2YNAA 2O8TA 1TPAE 4B75A 3VFEA 1QL8A 2VJ1A 3MH6A 2Y82A 2PSXA 3I29A 1Y3UA 4IBLH 2BM2A 2ZU5A 1W7XH 2CGAA 4I32A 1V2NT 3P8NA 4X0WU 2BD9A 4R8TB 4WY3A 1HAVB 1F5RA 1H1BA 1HAXB 1XXDA 3BG4C 1G2MA 5FCKA 1HIAA 4BAMB 1SLVB 2P59A 5PTPA 3RUOA 2GDDA 2A4QA 5LGOA 2G51A 1AUJA 3RXFA 1AVXA 3SU4A 2P3TB 3P92A 2ZDNA 1SFIA 5L2YH 1ZHPA 1T8NA 2VU8E 1AKSA 2P16A 3SZNA 2HWLB 3GOVB 2G00A 3BF6H 1ELGA 1J17T 2CMYA 1TOCB 2YNBA 2GZ7A 4WXVA 1ZTLA 2F9OA 3MWIU 1O3KA 3STJA 3HK3B 1F0UA 1NFYA 4HI3A 3U9AH 1LMWB 1Y5BT 1ANDA 4X1RU 1DWEH 1DX5M 1UVOA 1WBGB 3L6PA 3MNCA 3T25A 4WMFA 2PSYA 3KQBA 1P2OA 2O8WA 4K3JA 3MHWU 1PQ7A 2HALA 2AIPA 1GMDF 1IAUA 1QBVH 2ZTZA 2WPKS 3F9GA 1A0LA 1QRWA 1A3EH 2Y6TA 2H5DA 2SGDE 1SB1H 1YKTA 4INKA 4ABAA 2Y81A 1BB0B 1HRTH 1TWXB 2BLOA 1TNJA 5FPYA 4I33A 2VB0A 1GJ5H 5A09A 1O2MA 1O30A 3A7WA 1V2PT 3M5LA 4CRDA 1SOZA 1D6RA 2F3CE 5JB8S 1ZOMA 4DIIH 5DP7A 1G2LA 1AE5A 2XTTB 4UE7H 4ZXXH 2QA9E 2GP9B 4B1TA 1C5UA 3UY9A 8ESTE 1OWJA 1HPGA 1ARCA 5AVDA 1MUEB 4NFEA 1W14U 1ZGIA 4ISLA 4UFFH 1Y3YA 1IQKA 3RDZA 1CO7E 2STBE 2R9PA 1FDPA 1C1NA 1HYLA 5EXNA 4AORA 7LPRA 3E90B 1GMCF 3PLBA 3SI3H 2CN0H 2Z9GA 1GJBB 3SU2A 1EB1H 3O8DA 1OWHA 1GHYH 1MU8B 1KXDA 3TVJB 1TPSA 2FOMB 1O39A 2Q6FA 4A92A 6ESTA 2ZU4A 3OY5U 3MH5A 2RG3A 2VGCB 1C1UH 2Z6BD 4FU7A 1BHXF 1O3PB 1OOKB 1TBZH 4IN1A 4ZHLU 5CMXH 3Q76A 2G5VA 1GMDG 1UCYH 2C8YB 1MD8A 1PYTD 1TFXA 3AAVA 1BJVA 1DFPA 1AGJA 3OY6U 3ZVGA 1C1OA 2Z3EA 4A1TA 3M7UA 2ANWA 1SGRE 1IQFA 3RLYH 4JK5A 2FS9A 5EPNA 1P2JA 1C1VH 2VVCA 3PWCA 1TABE 4VGCB 1TMTH 1YPKH 1K2I1 1TBQH 3FANA 1CBWB 3SO3A 3EQ0H 4Y8XA 4CR9A 5C1YA 1N8OB 3PB1E 3PMBB 5JBAS 4DG4A 2D26C 2YOLA 2B9LA 4J1YA 4CRFA 2VGCC 4Y0ZE 1O38A 2ZEBA 2C90B 2FOAA 4HGCA 2EC9H 3RXSA 3P95A 3UNRA 1ELVA 1Q3XA 2RCEA 2J38A 4JZFH 2BDIA 3ODFA 3SGQE 1GHXH 1TPPA 1AFQB 3JZ1B 3TLOA 1GMCG 1O2ZA 1QBOA 5T6FA 1FPCH 4VGCC 3PWBA 1CBWC 2FESH 1C1PA 1N8OC 1JWTA 1LQDB 3O8RA 1AD8H 1C5QA 1W0ZU 1O36A 2BVSH 3M5OA 3LT3A 1PFXC 2ZG0H 3DD2H 1SHHB 1V2MT 3MU8A 3M5NA 3UOPA 1Y3XA 1CQQA 3KHVA 1NTPA 1HAGE 1GGDC 3U98H 4M7GA 3PV4A 2BLWA 3VB4A 5K0HA 1EAWA 1C1RA 4X2XA 2PUXB 2PHBA 1GHBG 4ASHA 1S5SA 1W7GH 3M3SA 4X6MA 3ZVFA 3M3TA 2H9EH 2VIOA 2A7CA 1AFQC 2A45B 1MBMA 2ASUB 2OP9A 3BTWE 3S9CA 3ZZ5A 1UTOA 1WSSH 1AB9B 3TJUA 3GY2A 2SGQE 3KF2A 2J4IA 1GDQA 1GBHA 3C27B 3RC4A 5ESBA 1ELTA 1BTZA 3RM2H 3ATIA 1DXPA 1OYTH 1FY4A 1O3OA 4X8SH 1EUFA 1QA7A 5C20A 2G4UA 2Z3CA 1IQLA 2H6MA 3GYMA 1VR1H 1SBWA 3EYDA 2ZGCA 7GCHF 5EGMA 2PV9B 1ZPZA 3EBNA 1HNEE 1C2MA 1BITA 2VVVA 2C8XB 2FI3E 2PLXA 1ABJH 3KQDA 4AFUA 2B7DH 2A7HA 2W5EA 5E2OA 2PR3A 2BOKA 2Y5HA 3UOUA 1AB9C 2ZCLP 1C2HA 3ZZDA 3GICB 3BV9B 3HKIB 1O31A 3F6UH 2TIOA 1O2TA 2GT7A 1GBKA 8LPRA 3A7VA 3MNBA 5T3HA 2FO9A 4K1EA 1E35B 1CGJE 1O5DH 4K1TA 1XUJA 2G5NA 1HAYB 4ABFA 1JRSA 4JZEH 1VCQA 1MKWK 1DVAH 1QQUA 3KIDU 2QGRA 2ZDKA 1XKBC 4FUCA 4Q7ZA 2Y80A 3OTJE 3E91A 1IQEA 1O2UA 1G32B 4Y0YE 4HFPB 3D62A 2ZU1A 1TMUH 2FYRA 2WV5A 2UUKB 1A0HB 5DG6A 1K1OA 4K8YA 5EU8A 2XBYA 1QJ7B 3QDZB 2EA3A 1O3MA 1GVLA 1MTWA 1PPCE 1KSNA 2GTBA 1QL9A 1SC8U 4DOQA 3IWMA 3ZZBA 4AG1A 1XUFA 2Z9IA 2F9NA 1BTYA 3ATLA 2F9VA 4I8KA 3LGIA 1Y3WA 1Q31A 1YPLH 2PGQB 4KKDA 4WMDA 2QXJA 1MTUA 1TX8A 5BPEA 3SGBE 1GJDB 4BANB 5DP5A 2O9QA 3M3VA 4BXWA 1GDNA 3RXKA 5FAHA 4MNXA 1ANCA 1QRZA 3AW1A 1O2IA 1EZSC 1GBLA 1UTKA 2ZDAH 2P3UB 1LVMA 2FOBA 5ESTE 3RC6A 1DWDH 1GJ8B 3SU0A 1S84A 4NZQA 4BAOB 1LPKB 2TRMA 4GCHG 1O5FH 2AMDA 1EPTB 3TITA 2ZPRA 5DKMA 4D7FA 1GJ4H 3DUXH 1NS3A 4O9VA 1C1MA 3V12A 4XBBA 2AGGX 2AGEX 3RXRA 1T31A 1GL0E 1BZXE 5HXFA 1FJSA 2AS9A 3ENSB 1Y8TA 4ZMAH 1O3DA 4FUDA 5A8XA 4AFZA 3SBKA 2BDAA 1CGIE 1SQOA 1O2WA 3HK6B 1NESE 1FV9A 1UTLM 5B6OA 1GJ9B 2A32A 3QUMP 2NU1E 1EZXC 1CT2E 1GHWH 1S82A 4D7GA 3S9BA 4U30A 3A8CA 1C2JA 3M7TA 3F9EA 1SQAA 4INLA 3RXQA 1BTWA 1P2IA 1WV7H 3A88A 1EPTC 2AEIH 1O0DH 5I25A 1J15A 2XNIA 1S85A 1C5MD 3OU0A 4A6LA 3BTFE 2ZNKH 2HGTH 1Z6EA 1AUTC 4X8VH 4Y79A 1O5BB 1SGQE 2AGIX 1MCVA 1KDQA 1GI6A 3BTTE 4OS6A 2BD5A 2FTLE 4TWYA 2GD4B 3M5MA 3VB7A 2ZPQA 1ORFA 1P11E 2J9NA 2NU4E 1O3HA 5EW2H 2WINI 3PLKA 5DJ7A 4BNRA 1A61H 4B74A 3QN7A 1DSUA 1KXBA 5T6GA 5JBBS 3HPTB 1BTXA 1E37B 5T6DA 1JIRA 1BMMH 3NWUA 2ODQA 1PYTC 4B73A 3M61U 3S7HB 1H4WA 4JZIA 1OSSA 1YM0A 1MD7A 1G3EA 3NUMA 3EA8A 4CRGA 4DVAU 1CVWH 1A5HA 4A1VA 2WV4A 1VCWA 1TPOA 1OWEA 3RXAA 2JETB 2ZFPH 2BY6X 1GCTB 3M37A 3U8OH 4MG3A 2FS8A 1WTHD 3A7ZA 4DURA 3GY6A 1TQ0B 4WF8A 4ZH8A 2QN5T 4WMEA 3K6ZA 1EQ9A 3ESTA 2G52A 4KTCA 1FNIA 3EDXB 1BJUA 5C1UA 5E8EH 1FPHH 4SGAE 3MNXA 2Z9JA 1K9OE 3RMMH 1HAVA 4ZROA 2F9PA 1SR5C 1MAXA 1SHYA 1BTHH 1WYKA 1P2NA 1SSXA 3MMGA 4XE4A 5DP4A 3IG6B 4X2YA 2JETC 3LONA 3UNQA 1AVWA 4HTCH 1GCTC 4MNYA 5EXLA 2H5CA 1KLTA 1C2LA 3T5FH 1ZTKA 2QXGA 4OS5A 1EAUA 2FM2A 1JOUB 3DFLA 3SV2H 3W95A 4TPYA 1EP5A 1NFXA 2TGTA 4AFSA 3SNEA 1A0JA 3TPIZ 1QHRB 4NZLA 1THRH 1OP8A 1HGTH 2PGBB 2XCNA 1MH0A 3FVFB 4AN7A 1SLUB 2ZHDA 4E06H 1K28D 4FU8A 4YZUA 1XUHA 1QB9A 5TJXA 5L2ZH 1O3AA 4ZHAA 4Q80A 1P9UA 2B8OH 4LXBH 1CT0E 1GI5A 3V3MA 3ZVAA 3EA9A 1DLEA 2W3IA 1NO9H 1QFKH 2OC0A 4Y10E 2GCTB 1P03A 1C5NH 1O2LA 1Z71A 3SHAH 1G37A 2XC4A 4MPWA 3W94A 3BN9A 2Y7ZA 1C5OH 4AGJA 1ZHRA 1KXAA 2P94A 3F1SB 3KL6A 5A0CA 1DM4B 2F83A 1AHTH 2V0BA 1GJAB 1NU7B 4NIXA 1NRQH 3P8OA 3A81A 2UWLA 3A8BA 2TGDA 2RDLA 3VB5A 1GI9B 4UEHH 3T27A 5EQRA 4E05H 1MTSA 2TGAA 4FUJA 4NA7A 1XKAC 3SV6A 3RC5A 1MZDA 2CF9H 4JCNA 9LPRA 2UUJB 3KQEA 4ABGA 1GDUA 1UTMA 4MPVA 1QIXB 1DDJA 1IQJA 3VPKA 2ZFQH 3BTGE 1HFDA 3SN8A 3MU0A 1VCPA 4ZKRU 2GCTC 3FZDA 5HM9A 2J2UA 1FY8E 1TBRH 2SGFE 1Z1JA 1ZPCA 4NIYA 3AASA 1P2MA 5F6MA 5F8ZA 4TY6A 1G3CA 3E8LA 4Z6AH 1DUAA 2C8WB 5A2MH 2XWAA 1UK2A 1GBFA 1YCPM 1GI4A 3P70B 1HV7A 3TU7H 3MO6A 2VWLA 5EPYA 5GPIB 4H6SB 5LPRA 2ZGHA 4O3TA 1XVMA 3SNCA 4YLUA 2HNTC 1SGFA 3SJKA 1YPJH 2NU2E 1FIZA 2GX4A 2WUCA 2OINA 1LVOA 2FXRA 2TBSA 2DUCA 3QZQA 1UVTH 2A0QB 3H7TA 1QRXA 1ID5H 6GCHF 5L30H 2IJOB 2PUQH 5F8TA 3BTQE 5E2PA 2Z9LA 2AMQA 2CXVA 3ZZ7A 2BY5X 3HKJB 4MNVA 1K1NA 4XDEA 4KTSA 1PQAA 5A0AE 3GYLB 2BLVA 2ZCHP 4CHAB 4X1PU 3ATKA 4AYVB 1F0TA 1GBTA 3RXJA 2WPMS 1E34B 4AFQA 4YOGA 1AZZA 1GWAA 5E0HA 1FY5A 2R0KA 2GKVE 4GPGA 3P8GA 2BDGA 2VNTA 3FZZA 1ZSJA 2WPIS 1O3GA 1GVKB 1E36B 5J4SA 5DK1A 1HXFH 2OTVA 1GBIA 1P09A 1XM1A 1LDTT 2RA3A 3KCGH 4ZKSU 2BYAX 1DLKB 4CRAA 1HB0B 5GDSH 3FP7E 3RU4E 4D9QA 1W8BH 1GBAA 3RM0H 3GCNA 2ZTYA 2A2QH 2DE9A 3RXTA 1YPHC 1EASA 1V2RT 1YPMH 4IMZA 1P02A 1O34A 1ELFA 4WWYA 4FUHA 3SUGA 4CHAC 3ZZ6A 1O2HA 2Y7XA 5H4IB 1DWCH 2BD7A 4RKJB 1X7AC 4FU9A 4THNH 3UFAA 1O3EA 2O8LA 3TNSA 3MO9A 3A8AA 3Q00A 2F9UA 4DT7B 4Y71A 4B71A 2XC5A 4IW4E 3LDXH 2Z7FE 3VB6A 1C5RA 5C67A 1UK4A 3SJIA 1OPHB 6GCHG 8KME2 4ISHH 2A1DB 1P2QA 3SUEA 1O2NA 1U6QA 4YESB 4ABIA 3ODDA 1LHEH 3AVZA 5LPEA 1L4DA 2AMPA 1PPHE 1INCA 1SG8B 2A2XH 4ABHA 1UJ1A 4DJZB 2ZGJA 1W13U 2VWOA 2O8UA 1W2KH 1V2UT 3AAUA 2C93B 4X1SU 1GBJA 1GHBF 4NCYA 3HGPA 4INHA 3RMLH 3SORA 2XBWA 1OP2A 1SGYE 1PPFE 1TNLA 4BAKB 3SOSA 2WPHS 2BMGB 1GJ7B 3ZZAA 3P17H 1V2JT 1EAIA 3IITA 1OWIA 1V2VT 3LPRA 1TGTA 3NK8A 1ZRBA 2ZF0H 1P10A 3JZ2B 3PMHB 4DY7B 2VIPA 1FIWA 4JYUH 4GLYA 3SJ9A 1QJ6B 1DS2E 3GCTF 1OS8A 2BHGA 2A7JA 2FOFA 1JXPA 4CRBA 1EJAA 1GL1A 4I8GA 5SGAE 2XXLA 1CE5A 1FONA 3EGKH 1HDTH 3QLPH 4K5ZA 1D4PB 2THFB 4MVNA 4GHQA 3SU1A 4MPXA 3E0PB 1HXEH 1QB6A 2LIZA 2BQWB 5JDUB 2IN2A 1O2JA 4U2WA 1O3JA 1DWBH 5C2ZA 3BEUA 2FP7B 1C5WB 3TGIE 1UK3A 1BRBE 1G3BA 1GJCB 1Q2WA 3DFJA 1ARBA 5I46H 3TH2H 5EW1H 1LPGB 1BBRK 4H42U 3GY5A 2HPQH 1DPOA 2QV1A 3LJOA 1C5TA 4IC6A 2OQUA 5JBTA 1LQEA 2BY7X 3VXEH 1H9IE 2Z94A 3RP2A 1C2GA 1UVUH 3RU4T 2FIRH 4YLQH 1CHGA 1TNHA 4CRCA 2ZHQH 1Z1IA 4OGXA 3EA7A 4JYTA 3S9AA 1MTVA 3A82A 5GCHF 1V2WT 2Q1JA 4ZHMU 1GCDA 2PTCE 3TJVA 5GWZA 1FY3A 4A7IB 4YT7H 1E38B 3QTVH 4TWWA 2Q6GA 1CT4E 1EXFA 3FFGA 3GCTG 1ELAA 3VB3A 4I8JA 1B0FA 1EP6A 4NIWA 3ZZ4A 1F0RA 2BX4A 3A86A 4GUXA 2VIQA 3ATMA 2BXTH 1C5YB 2ZFFH 2ZFTA 1EATA 1GG6B 3PTBA 1Y5UT 3Q3KA 1SLXB 2D1JA 4A1XA 3UREA 1YGCH 2P3FH 1P9SA 1UTQA 1CHOF 2SFAA 3A7XA 4XFQA 5L6NH 4MPUA 4ZKNU 4Y7BA 2D2DA 2XBXA 1EPTA 1MMJN 1FN6A 4NA9H 1QL7A 1KTSB 2ZHWH 1EZQA 5F03A 1AFEH 3LC3A 3RXIA 1O2KA 1FLEE 3EE0B 5E0JA 1Y3VA 4K1SA 3RXOA 3SHCH 3TJNA 3UQOA 1TMBH 2GMTB 1P3CA 2LNCA 1FUJA 3MYWA 4GCHF 1PPBH 1AO5A 3M7QA 1GG6C 2BDBA 3ZVCA 2QXIA 3E6PH 2FI4E 1F5LA 2VIWA 5GCHG 1D3PB 5HM2A 1G3DA 2R2MB 1F0SA 3ZYEA 2HNTE 5E0GA 1WQSA 1W12U 2C3SA 3NKKA 1FXYA 4YTAA 2IPHA 1UMAH 5GIBA 2C8ZB 2GMTC 1L1JA 2Z3DA 1O32A 2H9HA 2TPIZ 4D9RA 3Q3YA 1S81A 2FLRH 4X6NA 1WTGH 3LGTA 1F7ZA 2XBVA 4U32A 4NIVA 4ZXYH 1P06A 1NZQH 1BRCE 3MH7A 2OBQA 3UUZA 3V7TA 1P04A 2O8MA 1UTNA 1YC0A 3ZZ9A 1CHOG 2UWOA 7ESTE 1NC6A 2GV6A 2EI6A 2P8OB 2TGPZ 2FEQH 3GY3A 1RIWB 4JYVH 4O03A 1TX7A 2V6NA 2V3OH 1O37A 1S6HA 3HATH 3U1IB 4NG9H 5AFZH 1K1MA 2GGVB 3RXUA 2FTMA 1IQIA 4ISOA 2OCVB 1V2QT 2VINA 1O2VA 1L4ZA 1P57B 1BA8B 1V2ST 3D23A 2AFQB 3ZYDA 1O3IA 2ZTXA 1BUIA 1TAWA 1C5SA 1HAHH 2ZHEH 1YPHE 1NM6A 3BSQA 3GY7A 4I8HA 3RXPA 1ZR0A 1GI3A 1AI8H 4Z0KA 2FWWA 2BXUH 1BCUH 1M9UA 2P8OC 2ODPA 2STAE 3D65E 1RIWC 3RXEA 1IQHA 2B5TB 3UR6A 3A7YA 4AX9H 2BLQA 1A2CH 3SNBA 1A4WH 4CBOA 2ZFSA 1Y59T 1K21H 5J4QA 3R0FA 4ZKOU 3SV7A 1XUIA 3UR9A 3MFJA 1A1RA 1GJ6A 4XBCA 1BHXB 1YCPK 1TB6H 4Q7YA 1KXEA 2OC8A 3KN2A 1SGTA 1SL3A 1QTFA 2BZAA 3KGPA 1SI5H 2CJIA 1TONA 3T26A 1EAXA 5FX6A 3FP8E 1ABIH 3UNSA 1BIOA 2VIDA 1NFUA 1G30B 2NWNA 3U8RH 1ANBA 1K1JA 1DUEA 5C1XA 2K1QA 3FP6E 1MKWH 2FYQA 1ZSKA 3O8CA 2PWXA 3TH3H 3UWJH 1C4Y2 2P95A 5K7RA 2OLGA 2BD4A 2ZQ1A 1DANH 3O8BA 4J2YB 4JK6A 1FMGA 4K2YA 3GISB 2QIQA 3VXFH 1VITF 2FDAA 2WYJA 3HGNA 4NSVA 3TGJE 2WPLS 3LJJA 3MNSA 1Z6JH 1BT7A 3RMOH 2D8WA 5AHGH 1T7CA 1BMNH 1NY22 1H9LB 1THSH 4MQAA 3SJOA 1RS0A 2Y5GA 2VH0A 2BOHB 1QY6A 1RD3B 1C2EA 3AW0A 3GCOA 4FVDA 5EXMA 1HAOH 1UTJA 3LKWA 3MU1A 1VGCB 4D76A 3QGNB 3BEFB 1PPZA 1FQ3A 1TGNA 5F8XA 3QO6A 2KAIB 2QF0A 1EJMA 4JMYA 2B0FA 3SU6A 1ELCA 1YPGH 2ZFRH 4RN6A 1T4VH 1DT2A 4Y76A 1EOLA 1ZSLA 5DP6A 4AZ2B 1C1SA 4BAQB 1OXGA 4ABDA 2BD2A 1B7XB 1YP9A 3I77A 1J8AA 2H1UA 5JB9S 3BIVH 1J16A 3U1JB 2GCHF 3S0NA 2BQ7B 4BXSA 2ZA5A 3A85A 4ZUHA 4LZ4B 2EEKA 5DPAA 3GCHB 4NWKA 5DGJA 4UDWH 1O3FA 2ZU2A 1D6WA 3MOCA 1BBRE 4YOJA 3PO1B 2BVXH 3B9FH 5A8ZA 1VITG 5FPTA 1V3XA 1HAIH 4UFGH 1GBDA 1SGNE 3E16B 6CHAB 1FAKH 1P12E 1WCZA 3F9FA 2AH4X 2SGEE 4O97A 5GXPA 2V3HH 3ELAH 1SGFG 5FHTA 1GI0A 1TRYA 1QURH 1W10U 4OS2A 4IN2A 3PLPA 4E7RG 2XWBI 1O5EH 1CA0B 2WYGA 1MTNB 1A46H 1QGFA 3GCHC 2OUAA 4B2BA 4BOHA 5C3NA 1LVBA 2PKAB 3VGCB 3PO1C 4XBDA 4I31A 3NCLA 1G9IE 4Y6DA 4LK4A 2ODYB 1MQ5A 2ZI2H 4GSOA 1ZMNA 2VVUA 1GBMA 6CHAC 3RXDA 1K1LA 4YM9A 3K2UA 1AWFH 1C2IA 1O3BA 2ZQ2A 1JMOH 1O35A 1TRMA 4FXGH 1SMFE 3K6YA 3UTUH 3BG4B 3NZIA 1TOMH 1PPGE 2GCHG 3TK9A 3ZV9A 1LHCH 1EB2A 1CA0C 5FCRA 1MTNC 3BTME 2BTCE 1ESAA 1AWHB 3VGCC 1LPZB 1LHFH 3ZVDA 5EOKA 1C5XB 5LH8A 3SJ8A 3EAJA 4X2VA 1F92A 3T28A 3F68H 2OQ5A 2ZHFH 2ZIQH 1OWDA 4OS4A 1LKBA 4DCDA 2QC2A 2J92A 5ABWA 2FOCA 2ILNA 2QYIA 1ZJKA 4AGKA 1WQVH 3A87A 2A5IA 1AMHA 1TGBA 2G8TA 1UCYK 1B0EA 3PMAB 1SGCA 1OP0A 3I78A 3MI4A 1FZZA 1TE0A 1D3QB 1FN8A 3MU4A 1HLTH 1V2OT 1S6FA 4YO9A 5A8YA 4QT8C 4UONA 1ZTJA 1P2KA 1GVZA 1FI8A 3SW2B 1DY9A 2GZ9A 3QX5H 1RFNA 5DP9A 1C4U2 1W0YH 1RTKA 1MKXK 2R0LA 1MBQA 1NRNH 1UHBB 1HCGA 3MH4A 4WXIA 2ZWLH 3QGJA 1GPZA 4ESTE 2I6SA 1SGPE 1O2QA 5FXLA 1KYNA 4TPIZ 2SNVA 2K7XA 5TCAA 2W7SA 5IDKA 2AIQA 3SV9A 3P8FA 1NN6A 3LC5A 1N1LA 3ZZ3A 3STIA 1VZQH 3CS7A 1C5VA 1CGHA 3A83A 5HMAA 1LVYA 1NRSH 3NPSA 1GHAF 2ZGBH 2H9TH 2SGAA 3RU4D 3GY4A 1YYY1 2BDYA 2GT8A 2ZPSA 4BAHB 4I8LA 1IQGA 1XXFA 3LH3A 3R3GB 2WUBA 5CE1A 1RRKA 2J94A 3LU9B 3BEIB 4MDSA 4AG2A 4F4OC 4X2WA 3URDA 4CREA 3UPEA 3M36A 2VWMA 2UUFB 4Y8ZA 8GCHF 3DT0H 2ZU3A 3V0XA 1T8LA 3PMJA 1DITH 3U69H 1QB1A 2HRVA 1TALA 1EX3A 1EOJA 2GV7A 1C5PA 3RXVA 1S83A 2QAAA 2DE8A 4X8TH 4GVUA 1QA0A 2IOTA 1CU1A 1HIAB 1V2TT 3S69A 3A7TA 2OC7A 1O5CB 4WH6A 1T8OA 5EODA 1LHDH 2Q6DA 2G81E 3PROA 1C1TA 3TK5A 1C5ZB 1BTPA 3E1XB 3NXPA 2C4FH 5TCCA 1P05A 1RXPA 3SUFA 2JH0D 3BG8A 2VH6A 3A84A 2FI5E 1Z8IB 2OXSA 7KMEH 1AKSB 1GI1A 1KTTB 4BTIB 3UIRA 4A5TS 4FUGA 1BQYA 3QWCH 1J9CH 1H9HE 4O3UA 4X6PA 2A5AA 5FX5A 2BVRH 3LGUA 3BTKE 5EQQA 4BTUB 1GHAG 1F5KU 1D9IA 1IQNA 4B2CA 4TYDA 1O2GH 1QBNA 2ZDVH 1GI7B 1TA6A 1TNKA 1AZ8A 1KLIH 3A89A 1A7SA 4IC5A 5AFYH 4AB8A 1HAZB 1AQ7A 4LZ1H 2G55A 3GY8A 4WH8A 3UWIA 1YLDA 3ZVEA 1GBCA 1TGSZ 5HYOA 1MKXH 4JZDH 1ZJDA 2VIVA 8GCHG 1MU6B 2BY8X 1LO6A 1PQ8A 5DO4H 1QCPA 1GGDB 2LPRA 1NU9A 2SNWA 3SQEE 1ZGVA 2XYAA 1Z8GA 1QR3E 2BDHA 3LIWA 1THPB 1GI2A 1HJAB 4WVPE 4E7NA 4Q2KA 1OYQA 3F9HA 2FLBH 3SNDA 1XUKA 3SU3A 1WOFA 1AN1E 1ZMJA 2QXHA 2HLCA 2GVFA 1EJNA 1O3LA 2HVXA 4K69A 4NGAH 2QY0B 3QZRA 6LPRA 1SGIB 1N6YA 1AE8H
chains in the Genus database with same CATH superfamily
1L0ZA 3VEQB 1O33A 1YLCA 2FOEA 1XUGA 1KY9A 3RXGA 4GAWA 4Q7XA 3LH1A 4UFDH 5BRRE 2CF8H 1RTFB 3FAOA 5EG4A 3RXMA 4M9FA 1HJAC 1KIGH 3K65B 1G36A 1XMNB 4MLFB 1CSOE 4JZ1A 2ZDMA 2JKHA 4RKOB 2ZP0H 3MU5A 4DIHH 1E1QD 1VITH 2FOGA 1ZHMA 3SV8A 4HZHA 2ZO3H 1SQTA 3TK6A 1VJ9U 1WU1A 2ALPA 1F2SE 3DSGA 1BOQA 1LKAA 4FVBA 1ETRH 5ETXA 2ZECA 3MO3A 1TX6A 2EI8A 4NSYA 1C1QA 1NT1A 3Q77A 1ZLRA 1D3DB 3CENA 4FUEA 1BDAA 4AB9A 3URCA 4BTTB 1ESTA 4CH2B 1RGQA 4ABJA 4KTUA 2RA0A 3DSPA 3OYPA 5LPFA 4X6OA 3OX7U 1NROH 2PKSB 1O3NA 3ZV8A 1YY3A 3TH4H 1YBWA 1MZAA 2A5KA 4FUIA 1EZUC 1NFWA 3ZZCA 3KNXA 3S7KB 1PJPA 4B76A 2ALVA 2JH5D 5JPMH 3F0OA 1P01A 2PFEA 4XRNA 1K1IA 9ESTA 1O2XA 2XRCA 2QF4A 1ZMLA 4I7YH 1QQ4A 4WJG2 1MAYA 1C2FA 2BDCA 4OS7A 2CV3A 3TGKE 1C2DA 3LGVA 2OD3B 3LGWA 2HNTF 1Z8RA 1A5GH 1W0JD 1TQ7B 2KX4A 2CHAB 2K0QA 1P3EA 2PKSC 3T62A 1QJ1B 5DP8A 2AYWA 4ISIH 4F49A 1O5AB 2SGPE 1OX1A 1WAYB 2HOBA 3H5CB 3DHKH 1YPEH 1J14A 1UTPA 5JYIA 1L2EA 3BTHE 3MTYA 1ELEE 1BBRH 3A8DA 3C1KA 1ACBE 2FOHA 1UCYE 2PW8H 2FX6A 2OC1A 2J34A 4ABBA 1T8MA 1TIOA 1AU8A 3PM3A 1HJ9A 3N99A 7GCHG 3PTNA 4LOYH 4R0IA 3RXLA 2NU3E 3G01A 4AOQA 1GBBA 4NA8A 2H2ZA 1PPEE 2R2WU 1ZYOA 2XW9A 2QF3A 2JJ2D 1DOJA 1GBEA 4CH8B 1NPMA 1VJAU 1LTOA 4U01A 3CS0A 3LGYA 4B2AA 1C5LH 2CHAC 3B8JA 1O2SA 3T2NA 5C17A 2ZGXH 4DGJA 3Q3XA 2I6QA 1L1GA 3RMNH 2FPZA 3OTPA 1NRRH 4OS1A 1A5IA 2BD3A 4YT6H 4H6TA 2A4OA 1OKXA 1SLWB 2KAIA 2W7UA 4OGYA 5G4BA 1O2RA 1ZZZA 2FMJA 5A0BA 1KXFA 1HAPH 2ULLA 5FBIA 1IOEA 1K22H 2FZZA 4X8UH 1EKBB 1T4UH 5CHAB 1DICA 1RTLA 4UD9H 1W11U 3SU5A 4K60A 3SNAA 3OSYA 1LHGH 1TLDA 1KLJH 1UVPA 1UO6A 3UQVA 1UVSH 1BRUP 1V2KT 2UUYA 1T32A 1ETSH 1XX9A 1YF4A 1AVGH 1GHVH 1BMAA 1XVOA 4TY7A 1C9PA 1D3TB 1KMHB 2A31A 2QCYA 3BTEE 2ZZUH 2NU0E 1ESBA 3T29A 2AERH 4XOJA 1C2KA 1AY6H 1E0FD 4H4FA 3RXHA 4B6EA 1AIXH 2M5TA 5JBCS 3SQHE 1O3CA 2GDEH 3N7OA 2EI7A 5CHAC 2WV9A 1TRNA 4NFFA 2F9BH 3K9XB 4IS5A 3GDVA 1S0RA 4MTBA 2G4TA 3ZZ8A 3RXBA 2ZCKP 1ANEA 2Y5FA 5FBEA 3ITIA 4AYYB 1GMHF 1IHTH 4CBNA 1TNGA 2ANYA 2BQ6B 1HUTH 1P0SH 1JRTA 1B5GH 3D49H 4FUFA 1DXWA 3BTDE 4KP0A 1SGDE 2FODA 1O2YA 2XC0A 5AF9H 2VWNA 4DW2U 2Z9KA 1ELBA 1FAXA 1CA8B 4IMQA 4CR5A 4KELA 5GJ4B 2PKAA 4IGDA 1TGCA 1GHZA 4Y11E 3SI4H 4ISNA 4ABEA 1H8DH 3GDUA 3L33A 2PTNA 1V6DA 1IHSH 3TJOA 5C5OA 3F2HA 2A4GA 3BIUH 1C4V2 2F91A 1FY1A 1V2LT 2JH6D 1O5GH 3PYHA 4X1QU 3E3TA 1ELDE 1LCYA 1ZRKA 1C1WH 1O2OA 4KGAA 1SOTA 3E0NB 1Z8JB 1NRPH 1N6XA 4Y7AA 1SGEE 5IYTA 1C9TA 5EQSA 1BRAA 1A3BH 1DSTA 3GDSA 3RXCA 3V13A 4PROA 1KXCA 2HPPH 3SGAE 2ANKH 4D8NA 1MCTA 1S0QA 3H7OA 2ZDLA 1Z7KA 1BTUA 1FX0B 1Y5AT 1RJXB 4NWLA 1JIMA 2W3KA 1PQ5A 2R3UA 5HGGA 1P8VC 1ETTH 3M35A 2OBOA 3TIUA 5HKKD 1ZPBA 1GMHG 2WPJS 1VGCC 1SPJA 1GI8B 2XCFA 2ZC9H 4ZAEA 4X1NU 3TNTA 1WUNH 2W26A 2V35A 1K1PA 1TYNA 2ZKSA 4FUBA 1W3CA 1H8IH 2BX3A 4Y8YA 2R3YA 3WY8A 4MNWA 4RSPA 1OWKA 3ATWA 1L1NA 2AHME 4XSKU 3ZVBA 2BD8A 3L3TA 4GHTA 3SUDA 1UHBA 2JJ1D 1IQMA 2P93A 3DA9B 3CP7A 4YOIA 1YCPH 1O2PA 3QK1A 1BMLA 5FPSA 1TNIA 4Q63A 1KDQB 2BZ6H 2BY9X 1SFQB 2ESTE 2ANMH 5C0UA 3EE7A 4UFEH 4SGBE 1NBMD 2BB4A 2FX4A 2UWPA 5DP3A 3P6ZB 3KQCA 3RLWH 3F3BA 3QTOH 1HBTH 2PP6A 5C5NA 4K8BA 1QNJA 3U8TH 3VG8A 2J95A 2GZ8A 1HJ8A 1SVPA 2A4RA 3A80A 1TA2A 1DE7H 1DY8A 1JBUH 1MQ6A 4ZCNA 3LOXA 3KEEA 3B23B 2YNAA 2O8TA 1TPAE 4B75A 3VFEA 1QL8A 2VJ1A 3MH6A 2Y82A 2PSXA 3I29A 1Y3UA 4IBLH 2BM2A 2ZU5A 1W7XH 2CGAA 4I32A 1V2NT 3P8NA 4X0WU 2L74A 2BD9A 4R8TB 4WY3A 1HAVB 1F5RA 1H1BA 1HAXB 1XXDA 3BG4C 1G2MA 5FCKA 1HIAA 4BAMB 1SLVB 2P59A 5PTPA 3RUOA 2GDDA 2A4QA 5LGOA 2G51A 1AUJA 3RXFA 3SZEA 1AVXA 3SU4A 2P3TB 3P92A 2ZDNA 1SFIA 5L2YH 4ASUD 1ZHPA 1T8NA 2VU8E 3F0PA 1AKSA 2P16A 3SZNA 2HWLB 3GOVB 2G00A 3BF6H 1ELGA 1J17T 2CMYA 1TOCB 2YNBA 2GZ7A 4WXVA 1ZTLA 2F9OA 3MWIU 1O3KA 3STJA 3HK3B 1E1RD 1F0UA 1NFYA 4HI3A 3U9AH 1LMWB 1Y5BT 1ANDA 4X1RU 1DWEH 1DX5M 1UVOA 1WBGB 3L6PA 4F55A 3MNCA 3T25A 4WMFA 2PSYA 3KQBA 1P2OA 2O8WA 4K3JA 3MHWU 1PQ7A 2HALA 2AIPA 1GMDF 1IAUA 1QBVH 2ZTZA 2WPKS 3F9GA 2WSSD 1A0LA 1QRWA 1A3EH 2Y6TA 1OHHD 2H5DA 2SGDE 1SB1H 1YKTA 4INKA 2YMSD 4FETA 2Y81A 1BB0B 4ABAA 1HRTH 1TWXB 2BLOA 1TNJA 5FPYA 4I33A 2VB0A 1GJ5H 2QE7D 1O2MA 5A09A 1O30A 3A7WA 1V2PT 3M5LA 4CRDA 1SOZA 1D6RA 2F3CE 5JB8S 1ZOMA 4DIIH 5DP7A 3FO8D 1G2LA 1AE5A 2XTTB 4UE7H 4ZXXH 2QA9E 2GP9B 4B1TA 1C5UA 3UY9A 8ESTE 1OWJA 1HPGA 1ARCA 5AVDA 1MUEB 4NFEA 1W14U 1ZGIA 4ISLA 4UFFH 1Y3YA 1IQKA 3RDZA 1CO7E 2STBE 2R9PA 1FDPA 1C1NA 1HYLA 5EXNA 4AORA 7LPRA 3E90B 3W1EA 1GMCF 3PLBA 3SI3H 2CN0H 2Z9GA 1GJBB 3SU2A 1EB1H 3O8DA 4RI0A 1OWHA 3FOAA 1GHYH 1MU8B 5C94A 1KXDA 3TVJB 1TPSA 2FOMB 1O39A 2Q6FA 4A92A 6ESTA 2ZU4A 3OY5U 3MH5A 2RG3A 2VGCB 1C1UH 2Z6BD 4FU7A 3CNRA 1BHXF 1O3PB 1OOKB 1TBZH 4IN1A 1H8ED 4ZHLU 5CMXH 3Q76A 2G5VA 1GMDG 1UCYH 2C8YB 1MD8A 1PYTD 1TFXA 3AAVA 4XD7D 1BJVA 1DFPA 2XOKD 1AGJA 3OY6U 3ZVGA 3MQKC 1C1OA 2Z3EA 4A1TA 3M7UA 2ANWA 1SGRE 1IQFA 3RLYH 4JK5A 2FS9A 5EPNA 1P2JA 1C1VH 2VVCA 3PWCA 1TABE 4VGCB 1TMTH 1YPKH 1K2I1 1TBQH 3FANA 1CBWB 3SO3A 3EQ0H 4Y8XA 4CR9A 5C1YA 1N8OB 3PB1E 3PMBB 5JBAS 4DG4A 2D26C 2YOLA 2B9LA 4J1YA 4CRFA 2VGCC 4Y0ZE 1O38A 2ZEBA 2W6JD 2C90B 2FOAA 5T1VA 4HGCA 2EC9H 3RXSA 3P95A 3UNRA 1ELVA 1Q3XA 2RCEA 2J38A 4JZFH 2BDIA 3ODFA 3SGQE 1GHXH 1TPPA 1AFQB 3JZ1B 3TLOA 1GMCG 1O2ZA 1QBOA 5T6FA 1FPCH 4VGCC 3PWBA 1CBWC 2FESH 3OE7D 1C1PA 1N8OC 1JWTA 1LQDB 3O8RA 1AD8H 1C5QA 1W0ZU 1O36A 2BVSH 3M5OA 3LT3A 1PFXC 2ZG0H 2J98B 3DD2H 1SHHB 1V2MT 3MU8A 2KCYA 3M5NA 3UOPA 1Y3XA 1CQQA 3KHVA 1NTPA 1HAGE 1GGDC 3U98H 4M7GA 3PV4A 2BLWA 3VB4A 5K0HA 1EAWA 1C1RA 4X2XA 2PUXB 2PHBA 1GHBG 4ASHA 1S5SA 1W7GH 3M3SA 4X6MA 3ZVFA 3M3TA 2H9EH 2KFWA 2VIOA 2A7CA 1AFQC 1YLNA 1MBMA 2A45B 2ASUB 2OP9A 2WPDD 3BTWE 3S9CA 3ZZ5A 1UTOA 1WSSH 3PV5A 1AB9B 2LELA 3TJUA 3GY2A 2SGQE 3KF2A 2J4IA 1GDQA 1GBHA 3C27B 3RC4A 5ESBA 1ELTA 1BTZA 3RM2H 3ATIA 1DXPA 1OYTH 1FY4A 1O3OA 4X8SH 1EUFA 1QA7A 5C20A 2G4UA 2Z3CA 1IQLA 2VBCA 2H6MA 3GYMA 1VR1H 1SBWA 3EYDA 2ZGCA 7GCHF 5EGMA 2PV9B 1ZPZA 3EBNA 1HNEE 1C2MA 1BITA 2VVVA 2C8XB 2FI3E 2PLXA 1ABJH 3KQDA 4AFUA 2B7DH 2A7HA 2W5EA 5E2OA 2PR3A 2BOKA 2Y5HA 3UOUA 1AB9C 2ZCLP 1C2HA 3ZZDA 3GICB 3BV9B 3HKIB 1O31A 3F6UH 2TIOA 1O2TA 2GT7A 1GBKA 8LPRA 3A7VA 3MNBA 5T3HA 2FO9A 4K1EA 1E35B 1CGJE 1O5DH 4K1TA 1XUJA 2G5NA 1HAYB 3WWBA 4ABFA 1JRSA 3N7DA 4JZEH 1VCQA 1MKWK 1DVAH 1QQUA 3KIDU 2QGRA 2ZDKA 1XKBC 4FUCA 4Q7ZA 2Y80A 3OTJE 3E91A 1IQEA 1O2UA 1G32B 3OAAD 4HFPB 3D62A 4Y0YE 2ZU1A 1TMUH 2FYRA 2WV5A 2UUKB 1A0HB 5DG6A 1K1OA 4K8YA 5EU8A 2XBYA 1QJ7B 3QDZB 2EA3A 1O3MA 1GVLA 1MTWA 1PPCE 1KSNA 2GTBA 1QL9A 1SC8U 4DOQA 3IWMA 3ZZBA 4AG1A 1XUFA 2Z9IA 2F9NA 1YWUA 1BTYA 3ATLA 2F9VA 4I8KA 3LGIA 4I86A 1Y3WA 2L6OA 1Q31A 1YPLH 2PGQB 4KKDA 4WMDA 2QXJA 4P00A 1MTUA 1TX8A 5BPEA 3SGBE 1GJDB 4BANB 5KECA 5DP5A 2O9QA 3M3VA 4BXWA 1GDNA 3RXKA 5FAHA 4MNXA 1ANCA 2YMSB 1QRZA 3AW1A 1O2IA 1EZSC 1GBLA 1UTKA 5EJZA 2ZDAH 2P3UB 1LVMA 2FOBA 5ESTE 3RC6A 1DWDH 1GJ8B 3SU0A 1S84A 4NZQA 4BAOB 1LPKB 2TRMA 4GCHG 1O5FH 2AMDA 1EPTB 3TITA 2ZPRA 5DKMA 4D7FA 1GJ4H 3DUXH 1NS3A 4O9VA 1C1MA 3V12A 4XBBA 3FN8A 2AGGX 2AGEX 3RXRA 1T31A 1GL0E 1BZXE 5HXFA 1FJSA 2AS9A 3ENSB 1Y8TA 2EY4C 4ZMAH 1O3DA 4FUDA 5A8XA 3PRDA 4AFZA 2YMSC 3SBKA 2BDAA 1CGIE 1SQOA 1O2WA 3HK6B 1NESE 1FV9A 1UTLM 5B6OA 1GJ9B 2A32A 3QUMP 2NU1E 1EZXC 1CT2E 1GHWH 1S82A 4D7GA 3S9BA 4U30A 3A8CA 1C2JA 3M7TA 3F9EA 1SQAA 4INLA 3RXQA 1BTWA 1P2IA 1WV7H 3A88A 1EPTC 2F4LA 4RT1A 2AEIH 1O0DH 5I25A 1J15A 2XNIA 1S85A 1C5MD 3OU0A 4A6LA 3BTFE 2ZNKH 2HGTH 1Z6EA 1AUTC 4X8VH 4Y79A 1O5BB 1SGQE 2AGIX 1MCVA 1KDQA 1SKYE 1GI6A 3BTTE 2J5UA 4OS6A 2BD5A 4ACAA 2FTLE 4TWYA 2GD4B 3M5MA 3VB7A 2ZPQA 1ORFA 1P11E 2J9NA 2NU4E 1O3HA 5EW2H 2WINI 3PLKA 5DJ7A 4BNRA 1A61H 4B74A 3QN7A 1DSUA 1KXBA 5T6GA 5JBBS 3HPTB 1BTXA 1E37B 5T6DA 1JIRA 1BMMH 3NWUA 2ODQA 1PYTC 4B73A 2IPQX 3M61U 2RFKC 3S7HB 1H4WA 4JZIA 1OSSA 1YM0A 1MD7A 1G3EA 3NUMA 3EA8A 4CRGA 4DVAU 1CVWH 1A5HA 4A1VA 2WV4A 1VCWA 1TPOA 1OWEA 3RXAA 2JETB 2ZFPH 2BY6X 1GCTB 3M37A 3U8OH 4MG3A 2FS8A 1WTHD 3A7ZA 4DURA 3GY6A 1TQ0B 4WF8A 4ZH8A 2QN5T 4WMEA 2WZQA 3K6ZA 1EQ9A 3ESTA 2G52A 4KTCA 1FNIA 3EDXB 1BJUA 5C1UA 5E8EH 1FPHH 4SGAE 3MNXA 2Z9JA 1K9OE 3RMMH 1HAVA 4ZROA 2F9PA 1SR5C 1MAXA 1SHYA 1BTHH 1WYKA 1P2NA 1SSXA 3MMGA 4XE4A 5DP4A 3IG6B 3F2FA 4X2YA 2JETC 3LONA 3UNQA 1AVWA 4HTCH 1GCTC 4MNYA 5EXLA 2H5CA 1KLTA 1C2LA 3T5FH 1ZTKA 5DSFA 2QXGA 4OS5A 3N7EA 1EAUA 2FM2A 1JOUB 3DFLA 3SV2H 3W95A 4HG6A 4TPYA 1EP5A 1NFXA 2TGTA 4AFSA 3SNEA 1A0JA 3TPIZ 1QHRB 4NZLA 1THRH 4TT3D 1OP8A 1HGTH 2PGBB 2XCNA 1MH0A 3FVFB 4AN7A 1SLUB 2ZHDA 4E06H 1K28D 4FU8A 4YZUA 1XUHA 1QB9A 5TJXA 5L2ZH 1O3AA 4ZHAA 4Q80A 1P9UA 2B8OH 4LXBH 1CT0E 1GI5A 3V3MA 3ZVAA 3EA9A 1DLEA 2W3IA 1NO9H 1QFKH 2OC0A 4Y10E 2GCTB 1P03A 1C5NH 1O2LA 1Z71A 3SHAH 1G37A 2XC4A 4MPWA 3WWFA 3W94A 3BN9A 2Y7ZA 5EJ1A 1C5OH 4AGJA 1ZHRA 1KXAA 2P94A 3F1SB 3KL6A 5A0CA 5B6LA 1DM4B 2F83A 1AHTH 2V0BA 1GJAB 1NU7B 4NIXA 1NRQH 3P8OA 3A81A 2UWLA 3A8BA 2TGDA 2RDLA 3VB5A 1GI9B 4UEHH 3T27A 5EQRA 4E05H 1MTSA 2TGAA 4FUJA 4NA7A 1XKAC 3SV6A 3RC5A 1MZDA 2CF9H 4JCNA 9LPRA 2UUJB 3KQEA 4ABGA 1GDUA 1UTMA 4MPVA 1QIXB 1DDJA 1IQJA 3F2GA 2ZFQH 3BTGE 1HFDA 3SN8A 3VPKA 2HVYB 3MU0A 1VCPA 4ZKRU 2GCTC 3FZDA 5HM9A 2J2UA 1FY8E 1TBRH 2SGFE 1Z1JA 1ZPCA 4NIYA 3AASA 2JDID 5HIZA 1P2MA 5F6MA 5F8ZA 4TY6A 1G3CA 3E8LA 4Z6AH 1DUAA 2V7QD 2C8WB 5A2MH 2XWAA 1UK2A 1GBFA 1YCPM 1GI4A 3P70B 1HV7A 3TU7H 3MO6A 2VWLA 5EPYA 5GPIB 4H6SB 5LPRA 2ZGHA 4O3TA 1XVMA 3SNCA 4YLUA 2HNTC 1SGFA 4Z1MD 3SJKA 1YPJH 2NU2E 1FIZA 2GX4A 2WUCA 2OINA 1LVOA 2FXRA 2TBSA 2DUCA 3QZQA 1UVTH 2A0QB 3H7TA 1QRXA 1ID5H 6GCHF 5IK2D 5L30H 2IJOB 2PUQH 5F8TA 3BTQE 5E2PA 5KGOA 2Z9LA 2AMQA 2CXVA 3ZZ7A 2BY5X 3HKJB 4MNVA 1K1NA 4XDEA 4KTSA 1PQAA 5A0AE 3GYLB 2BLVA 2ZCHP 4CHAB 4ACBA 4X1PU 3ATKA 4AYVB 1F0TA 1GBTA 3RXJA 2WPMS 1E34B 4AFQA 4YOGA 1AZZA 1GWAA 5E0HA 1FY5A 2R0KA 2GKVE 4GPGA 2KR7A 3P8GA 2BDGA 2VNTA 3FZZA 1ZSJA 2WPIS 1O3GA 1GVKB 1E36B 5J4SA 5DK1A 1HXFH 2OTVA 1GBIA 1P09A 1XM1A 1LDTT 2KCOA 2EQNA 2RA3A 3KCGH 4ZKSU 2BYAX 1DLKB 4CRAA 1HB0B 5GDSH 3FP7E 3RU4E 4D9QA 1W8BH 1GBAA 3RM0H 3GCNA 4YXWD 2ZTYA 2A2QH 2DE9A 3RXTA 1YPHC 1EASA 1V2RT 1YPMH 4IMZA 1P02A 3U28C 1O34A 1ELFA 4WWYA 4FUHA 3SUGA 4CHAC 5F53A 3ZZ6A 1O2HA 2Y7XA 5H4IB 1DWCH 2BD7A 4RKJB 1X7AC 4FU9A 4THNH 3UFAA 1O3EA 2O8LA 3TNSA 3MO9A 3A8AA 3Q00A 2V3MA 2F9UA 4DT7B 4Y71A 1BMFD 4B71A 2XC5A 2J98A 4IW4E 3LDXH 2Z7FE 3VB6A 1C5RA 3PRBA 5C67A 1UK4A 3SJIA 1OPHB 6GCHG 8KME2 4ISHH 2A1DB 1P2QA 3SUEA 1O2NA 1U6QA 4YESB 4ABIA 3ODDA 1LHEH 3AVZA 5LPEA 1L4DA 2AMPA 1PPHE 1INCA 1SG8B 2A2XH 4ABHA 1UJ1A 4DJZB 2ZGJA 1W13U 2VWOA 2O8UA 1W2KH 1V2UT 3AAUA 2C93B 4X1SU 1GBJA 1GHBF 2M2AA 4NCYA 3HGPA 4INHA 3RMLH 3SORA 2XBWA 3WW7A 1OP2A 1SGYE 1PPFE 1TNLA 4BAKB 3SOSA 2WPHS 2BMGB 1GJ7B 3ZZAA 3P17H 1V2JT 1EAIA 3IITA 1OWIA 1V2VT 3LPRA 1TGTA 3NK8A 1ZRBA 2ZF0H 1P10A 3JZ2B 3PMHB 4DY7B 2VIPA 1FIWA 4JYUH 4GLYA 3SJ9A 1QJ6B 1DS2E 3GCTF 1OS8A 2BHGA 5KEDA 2A7JA 2FOFA 1JXPA 4CRBA 1EJAA 1GL1A 4I8GA 5SGAE 2XXLA 1CE5A 1FONA 1S6LA 3EGKH 1HDTH 5EIYA 3QLPH 4K5ZA 1D4PB 2THFB 4MVNA 4GHQA 3SU1A 4MPXA 3E0PB 1HXEH 1QB6A 5DN6D 2LIZA 2BQWB 5JDUB 2IN2A 1O2JA 4U2WA 1O3JA 1DWBH 5C2ZA 3BEUA 2FP7B 1C5WB 3DSOA 1MABB 3TGIE 5EJLA 1UK3A 1BRBE 1G3BA 1GJCB 1Q2WA 3DFJA 1ARBA 2QF5A 5I46H 3TH2H 5EW1H 1LPGB 1BBRK 4H42U 3GY5A 2HPQH 1DPOA 2QV1A 3LJOA 1C5TA 4IC6A 2OQUA 5JBTA 1LQEA 2BY7X 3VXEH 1H9IE 2Z94A 3RP2A 1C2GA 1UVUH 3RU4T 2FIRH 4YLQH 1CHGA 1TNHA 4CRCA 2ZHQH 3DCLA 1Z1IA 4OGXA 3EA7A 4JYTA 3S9AA 1MTVA 3A82A 1COWD 5GCHF 1V2WT 2Q1JA 4ZHMU 1GCDA 2PTCE 3TJVA 5GWZA 1FY3A 4A7IB 4YT7H 1E38B 3QTVH 4TWWA 2Q6GA 1CT4E 3KYFA 5FL7D 1EXFA 3FFGA 3GCTG 1ELAA 3VB3A 4I8JA 1B0FA 1EP6A 4NIWA 3ZZ4A 1F0RA 2BX4A 3A86A 4GUXA 2VIQA 3ATMA 2BXTH 1C5YB 2ZFFH 2ZFTA 1EATA 1GG6B 3PTBA 1Y5UT 3Q3KA 1SLXB 2OK5A 2D1JA 4A1XA 3UREA 1YGCH 2P3FH 1P9SA 1UTQA 1CHOF 2SFAA 3A7XA 4XFQA 5L6NH 4MPUA 4ZKNU 4Y7BA 2D2DA 2XBXA 1EPTA 1MMJN 1FN6A 4NA9H 1QL7A 1KTSB 2ZHWH 1EZQA 5F03A 1AFEH 3LC3A 3RXIA 1O2KA 1FLEE 3EE0B 5E0JA 1Y3VA 4AC9A 4K1SA 3RXOA 3SHCH 3TJNA 3UQOA 1TMBH 3SYJA 2GMTB 1P3CA 2LNCA 1FUJA 3MYWA 4GCHF 1PPBH 1AO5A 3M7QA 1WXRA 1GG6C 2BDBA 3ZVCA 2QXIA 3E6PH 2FI4E 1F5LA 2VIWA 5GCHG 1D3PB 5HM2A 1G3DA 2R2MB 1F0SA 3ZYEA 2HNTE 5E0GA 1WQSA 1W12U 2C3SA 3NKKA 1FXYA 4YTAA 2IPHA 1UMAH 5GIBA 2C8ZB 2GMTC 1L1JA 3OFND 2Z3DA 1O32A 2H9HA 2TPIZ 4D9RA 3Q3YA 1S81A 2FLRH 4X6NA 1WTGH 3LGTA 1F7ZA 2XBVA 4U32A 4NIVA 4ZXYH 1P06A 1NZQH 1BRCE 3MH7A 2OBQA 3UUZA 3V7TA 1P04A 2O8MA 1UTNA 1YC0A 3ZZ9A 1CHOG 2UWOA 7ESTE 1NC6A 2GV6A 2EI6A 2P8OB 2TGPZ 2FEQH 3GY3A 1RIWB 4JYVH 4O03A 1TX7A 2V6NA 2V3OH 1O37A 1S6HA 3HATH 3U1IB 4NG9H 5AFZH 1K1MA 2GGVB 3RXUA 2FTMA 4FOUC 1IQIA 4ISOA 2OCVB 1V2QT 2VINA 1O2VA 1L4ZA 1P57B 1BA8B 1V2ST 3D23A 2AFQB 3ZYDA 1O3IA 2ZTXA 1BUIA 3H09A 1TAWA 1C5SA 1HAHH 2ZHEH 1YPHE 1NM6A 3BSQA 3GY7A 4I8HA 3RXPA 1ZR0A 1GI3A 1AI8H 4Z0KA 2FWWA 2BXUH 1BCUH 1M9UA 2P8OC 2ODPA 2STAE 3D65E 1RIWC 3RXEA 1IQHA 2B5TB 3UR6A 3A7YA 4AX9H 2BLQA 1A2CH 3SNBA 1A4WH 4CBOA 2ZFSA 1Y59T 1K21H 5J4QA 3R0FA 4ZKOU 3SV7A 1XUIA 3UR9A 3MFJA 1A1RA 1GJ6A 4XBCA 1BHXB 1YCPK 1TB6H 4Q7YA 1KXEA 2OC8A 3KN2A 1SGTA 1SL3A 1QTFA 2BZAA 3KGPA 1SI5H 2CJIA 1TONA 3T26A 1EAXA 5FX6A 4Q4LA 3FP8E 1ABIH 3UNSA 1BIOA 2VIDA 1NFUA 1G30B 2RDEA 5CDFE 2NWNA 3U8RH 1ANBA 1K1JA 1DUEA 5C1XA 2K1QA 3FP6E 1MKWH 2FYQA 1ZSKA 3O8CA 2PWXA 3TH3H 3UWJH 1C4Y2 2P95A 5K7RA 2OLGA 2BD4A 2ZQ1A 1DANH 2CK3D 3FKSD 3O8BA 4J2YB 4JK6A 1FMGA 4K2YA 3GISB 2QIQA 3VXFH 4RT0A 1VITF 2FDAA 2WYJA 3HGNA 4NSVA 3TGJE 2WPLS 3LJJA 3MNSA 1Z6JH 1BT7A 3RMOH 2D8WA 5AHGH 1T7CA 1BMNH 1NY22 1H9LB 1THSH 4MQAA 3SJOA 1RS0A 2Y5GA 2VH0A 2BOHB 1QY6A 1RD3B 2W6ID 1C2EA 3AW0A 3GCOA 4FVDA 5EXMA 1HAOH 1UTJA 3LKWA 3MU1A 1VGCB 2J97A 2WHXA 4B6FA 4D76A 3QGNB 3BEFB 1PPZA 1FQ3A 1TGNA 5F8XA 3QO6A 2KAIB 4F48B 2QF0A 1QZ8A 1EJMA 4JMYA 2B0FA 3SU6A 1ELCA 5CHBA 3KYGA 1YPGH 2ZFRH 4RN6A 1T4VH 1DT2A 4Y76A 1K0HA 1EOLA 1ZSLA 1SQRA 5DP6A 4AZ2B 1C1SA 4BAQB 1OXGA 4ABDA 2BD2A 1B7XB 1YP9A 3I77A 1J8AA 2H1UA 5JB9S 3BIVH 1J16A 3U1JB 2GCHF 3S0NA 2BQ7B 4BXSA 2ZA5A 3A85A 4ZUHA 4LZ4B 2EEKA 5DPAA 3GCHB 4NWKA 5DGJA 4UDWH 1O3FA 2ZU2A 1D6WA 3MOCA 1BBRE 4YOJA 3PO1B 2BVXH 3B9FH 5A8ZA 1VITG 5FPTA 1V3XA 1HAIH 4UFGH 2JIZD 1GBDA 1SGNE 3E16B 6CHAB 1FAKH 1P12E 1WCZA 3F9FA 2AH4X 2SGEE 4O97A 3NRLA 5GXPA 2V3HH 3ELAH 1SGFG 5FHTA 1GI0A 1TRYA 1QURH 1NBME 1W10U 4OS2A 4IN2A 3PLPA 4E7RG 4DT4A 1WDIA 2XWBI 1O5EH 1CA0B 2WYGA 1MTNB 1A46H 1QGFA 3GCHC 2OUAA 4B2BA 4BOHA 5C3NA 1LVBA 2PKAB 3VGCB 3PO1C 4XBDA 4I31A 3NCLA 1G9IE 4Y6DA 5GNDA 4LK4A 2ODYB 1MQ5A 2ZI2H 4GSOA 1ZMNA 1W0KD 2VVUA 1GBMA 2HLDD 6CHAC 3RXDA 1K1LA 4YM9A 3K2UA 1AWFH 1C2IA 1O3BA 2ZQ2A 1JMOH 1O35A 1TRMA 4FXGH 1SMFE 4OM9A 3K6YA 1EFRD 3UTUH 3BG4B 3NZIA 1TOMH 1PPGE 2GCHG 3TK9A 3ZV9A 1LHCH 1EB2A 1CA0C 5FCRA 1MTNC 2KCPA 3BTME 2BTCE 1ESAA 1AWHB 3VGCC 1LPZB 1LHFH 3UAIC 3ZVDA 5EOKA 2XNDD 1C5XB 5LH8A 3SJ8A 3EAJA 4X2VA 1F92A 3T28A 3F68H 2OQ5A 2ZHFH 2ZIQH 1OWDA 4OS4A 1LKBA 4DCDA 2QC2A 2LP6A 2J92A 5ABWA 2FOCA 2ILNA 2KM0A 1ZJKA 2QYIA 1WQVH 3A87A 4AGKA 2A5IA 1AMHA 1TGBA 2G8TA 1UCYK 1B0EA 3PMAB 1SGCA 1OP0A 3I78A 3MI4A 1FZZA 1TE0A 1D3QB 1FN8A 2GJGA 3MU4A 3OEHD 1HLTH 3KQ5A 1V2OT 1S6FA 4YO9A 5A8YA 4QT8C 4UONA 1ZTJA 1P2KA 1GVZA 1FI8A 3SW2B 1DY9A 2GZ9A 3QX5H 1RFNA 5DP9A 2KZ4A 1C4U2 1W0YH 1RTKA 1MKXK 2R0LA 1VKYA 1MBQA 1NRNH 1UHBB 1HCGA 3MH4A 4WXIA 2ZWLH 3QGJA 1GPZA 3PV2A 4ESTE 2KCAA 2I6SA 1SGPE 1O2QA 5FXLA 1KYNA 4TPIZ 2SNVA 2K7XA 5TCAA 2W7SA 5IDKA 2AIQA 3SV9A 3P8FA 1NN6A 3LC5A 1N1LA 3ZZ3A 3STIA 1VZQH 3CS7A 1C5VA 1CGHA 3A83A 5HMAA 1LVYA 1NRSH 3NPSA 1GHAF 2ZGBH 2H9TH 2SGAA 3RU4D 3GY4A 1YYY1 2BDYA 2GT8A 3GS9A 2ZPSA 4BAHB 3UB0A 1UW7A 1H8HD 4I8LA 1IQGA 1XXFA 3LH3A 3R3GB 2WUBA 5CE1A 1RRKA 2J94A 3LU9B 3BEIB 4MDSA 4AG2A 4F4OC 4X2WA 3URDA 4CREA 3UPEA 3M36A 2VWMA 2UUFB 4Y8ZA 8GCHF 3DT0H 2ZU3A 3V0XA 1T8LA 3PMJA 1DITH 3U69H 1QB1A 2HRVA 1TALA 2K8IA 1EX3A 1EOJA 2GV7A 1C5PA 3RXVA 1S83A 2QAAA 2DE8A 4X8TH 4GVUA 1QA0A 2IOTA 1CU1A 1HIAB 1V2TT 3OEED 3S69A 1E79D 3A7TA 2OC7A 1O5CB 4WH6A 1T8OA 5EODA 1LHDH 2Q6DA 2G81E 3PROA 3ZIAD 4P02A 1C1TA 3TK5A 1C5ZB 1BTPA 3E1XB 3NXPA 2C4FH 5TCCA 1P05A 1RXPA 3SUFA 2JH0D 3BG8A 2VH6A 3A84A 2FI5E 1Z8IB 2OXSA 7KMEH 1AKSB 1GI1A 1KTTB 4BTIB 3UIRA 4A5TS 4FUGA 1BQYA 3QWCH 1J9CH 1H9HE 4O3UA 4X6PA 2A5AA 5FX5A 2BVRH 3LGUA 3BTKE 5EQQA 4BTUB 1GHAG 1F5KU 1D9IA 1IQNA 4B2CA 4TYDA 1O2GH 1QBNA 2ZDVH 1GI7B 1TA6A 1TNKA 5HIYA 1AZ8A 1KLIH 3A89A 1A7SA 4IC5A 5AFYH 4AB8A 1HAZB 1AQ7A 2IJD1 4LZ1H 2G55A 3GY8A 4WH8A 5C0TA 3UWIA 1YLDA 3ZVEA 1GBCA 1TGSZ 5HYOA 1MKXH 2F43B 4JZDH 1ZJDA 2VIVA 8GCHG 1MU6B 2BY8X 1LO6A 1PQ8A 5DO4H 1QCPA 1GGDB 2LPRA 4TSFD 1NU9A 2SNWA 3SQEE 1ZGVA 2XYAA 1Z8GA 1QR3E 2BDHA 3LIWA 1THPB 1GI2A 1HJAB 4WVPE 4E7NA 4Q2KA 1OYQA 3F9HA 2FLBH 3SNDA 1XUKA 3SU3A 1WOFA 1AN1E 1ZMJA 2QXHA 2HLCA 2GVFA 1EJNA 1O3LA 2HVXA 4K69A 4NGAH 2QY0B 3QZRA 6LPRA 1SGIB 3AK5A 1N6YA 1AE8H
chains in the Genus database with same CATH topology
1L0ZA 3VEQB 1O33A 1YLCA 2FOEA 1XUGA 1KY9A 3RXGA 4GAWA 4Q7XA 3LH1A 4UFDH 5BRRE 2CF8H 1RTFB 3FAOA 5EG4A 3RXMA 1HJAC 1KIGH 3K65B 1G36A 1XMNB 4MLFB 1CSOE 4JZ1A 2ZDMA 2JKHA 4RKOB 2ZP0H 3MU5A 4DIHH 1VITH 2FOGA 1ZHMA 3SV8A 4HZHA 2ZO3H 1SQTA 3TK6A 1VJ9U 1WU1A 2ALPA 1F2SE 1BOQA 1LKAA 4FVBA 1ETRH 5ETXA 2ZECA 3MO3A 1TX6A 2EI8A 4NSYA 1C1QA 1NT1A 3Q77A 1ZLRA 1D3DB 3CENA 4FUEA 1BDAA 4AB9A 3URCA 4BTTB 1ESTA 4CH2B 1RGQA 4ABJA 4KTUA 2RA0A 3OYPA 5LPFA 4X6OA 3OX7U 1NROH 2PKSB 1O3NA 3ZV8A 3TH4H 1YBWA 1MZAA 2A5KA 4FUIA 1EZUC 1NFWA 3ZZCA 3KNXA 3S7KB 1PJPA 4B76A 2ALVA 2JH5D 5JPMH 1P01A 2PFEA 1K1IA 9ESTA 1O2XA 2XRCA 1ZMLA 4I7YH 1QQ4A 4WJG2 1MAYA 1C2FA 2BDCA 4OS7A 2CV3A 3TGKE 1C2DA 3LGVA 2OD3B 3LGWA 2HNTF 1Z8RA 1A5GH 1TQ7B 2CHAB 1P3EA 2PKSC 3T62A 1QJ1B 5DP8A 2AYWA 4ISIH 4F49A 1O5AB 2SGPE 1OX1A 1WAYB 2HOBA 3H5CB 3DHKH 1YPEH 1J14A 1UTPA 5JYIA 1L2EA 3BTHE 3MTYA 1ELEE 1BBRH 3A8DA 3C1KA 1ACBE 2FOHA 1UCYE 2PW8H 2FX6A 2OC1A 2J34A 4ABBA 1T8MA 1TIOA 1AU8A 3PM3A 1HJ9A 7GCHG 3PTNA 4LOYH 4R0IA 3RXLA 2NU3E 3G01A 4AOQA 1GBBA 4NA8A 2H2ZA 1PPEE 2R2WU 1ZYOA 2XW9A 2QF3A 1DOJA 1GBEA 4CH8B 1NPMA 1VJAU 1LTOA 4U01A 3CS0A 3LGYA 4B2AA 1C5LH 2CHAC 3B8JA 1O2SA 3T2NA 2ZGXH 4DGJA 3Q3XA 2I6QA 1L1GA 3RMNH 2FPZA 1NRRH 4OS1A 1A5IA 2BD3A 4YT6H 4H6TA 2A4OA 1OKXA 1SLWB 2KAIA 2W7UA 4OGYA 5G4BA 1O2RA 1ZZZA 2FMJA 5A0BA 1KXFA 1HAPH 2ULLA 5FBIA 1IOEA 1K22H 2FZZA 4X8UH 1EKBB 1T4UH 5CHAB 1DICA 1RTLA 4UD9H 1W11U 3SU5A 4K60A 3SNAA 3OSYA 1LHGH 1TLDA 1KLJH 1UVPA 1UO6A 3UQVA 1UVSH 1BRUP 1V2KT 2UUYA 1T32A 1ETSH 1XX9A 1YF4A 1AVGH 1GHVH 1BMAA 1XVOA 4TY7A 1C9PA 1D3TB 2A31A 2QCYA 3BTEE 2ZZUH 2NU0E 1ESBA 3T29A 2AERH 4XOJA 1C2KA 1AY6H 1E0FD 4H4FA 3RXHA 1AIXH 2M5TA 5JBCS 3SQHE 1O3CA 2GDEH 3N7OA 2EI7A 5CHAC 1TRNA 4NFFA 2F9BH 3K9XB 4IS5A 3GDVA 1S0RA 4MTBA 2G4TA 3ZZ8A 3RXBA 2ZCKP 1ANEA 2Y5FA 5FBEA 3ITIA 4AYYB 1GMHF 1IHTH 4CBNA 1TNGA 2ANYA 2BQ6B 1HUTH 1P0SH 1JRTA 1B5GH 3D49H 4FUFA 1DXWA 3BTDE 4KP0A 1SGDE 2FODA 1O2YA 2XC0A 5AF9H 2VWNA 4DW2U 2Z9KA 1ELBA 1FAXA 1CA8B 4IMQA 4CR5A 4KELA 5GJ4B 2PKAA 4IGDA 1TGCA 1GHZA 4Y11E 3SI4H 4ISNA 4ABEA 1H8DH 3GDUA 3L33A 2PTNA 1V6DA 1IHSH 3TJOA 5C5OA 2A4GA 3BIUH 1C4V2 2F91A 1FY1A 1V2LT 2JH6D 1O5GH 3PYHA 4X1QU 3E3TA 1ELDE 1LCYA 1ZRKA 1C1WH 1O2OA 4KGAA 1SOTA 3E0NB 1Z8JB 1NRPH 1N6XA 4Y7AA 1SGEE 5IYTA 1C9TA 5EQSA 1BRAA 1A3BH 1DSTA 3GDSA 3RXCA 3V13A 4PROA 1KXCA 2HPPH 3SGAE 2ANKH 4D8NA 1MCTA 1S0QA 3H7OA 2ZDLA 1Z7KA 1BTUA 1Y5AT 1RJXB 4NWLA 1JIMA 2W3KA 1PQ5A 2R3UA 5HGGA 1P8VC 1ETTH 3M35A 2OBOA 3TIUA 1ZPBA 1GMHG 2WPJS 1VGCC 1SPJA 1GI8B 2XCFA 2ZC9H 4ZAEA 4X1NU 3TNTA 1WUNH 2W26A 2V35A 1K1PA 1TYNA 2ZKSA 4FUBA 1W3CA 1H8IH 2BX3A 4Y8YA 2R3YA 3WY8A 4MNWA 4RSPA 1OWKA 3ATWA 1L1NA 4XSKU 3ZVBA 2BD8A 3L3TA 4GHTA 3SUDA 1UHBA 1IQMA 2P93A 3DA9B 3CP7A 4YOIA 1YCPH 1O2PA 3QK1A 1BMLA 5FPSA 1TNIA 1KDQB 2BZ6H 2BY9X 1SFQB 2ESTE 2ANMH 4UFEH 4SGBE 2BB4A 2FX4A 2UWPA 5DP3A 3P6ZB 3KQCA 3RLWH 3QTOH 1HBTH 5C5NA 4K8BA 1QNJA 3U8TH 2J95A 2GZ8A 1HJ8A 1SVPA 2A4RA 3A80A 1TA2A 1DE7H 1DY8A 1JBUH 1MQ6A 3LOXA 3KEEA 3B23B 2YNAA 2O8TA 1TPAE 4B75A 3VFEA 1QL8A 2VJ1A 3MH6A 2Y82A 2PSXA 3I29A 1Y3UA 4IBLH 2BM2A 2ZU5A 1W7XH 2CGAA 4I32A 1V2NT 3P8NA 4X0WU 2BD9A 4R8TB 4WY3A 1HAVB 1F5RA 1H1BA 1HAXB 1XXDA 3BG4C 1G2MA 5FCKA 1HIAA 4BAMB 1SLVB 2P59A 5PTPA 3RUOA 2GDDA 2A4QA 5LGOA 2G51A 1AUJA 3RXFA 1AVXA 3SU4A 2P3TB 3P92A 2ZDNA 1SFIA 5L2YH 1ZHPA 1T8NA 2VU8E 1AKSA 2P16A 3SZNA 2HWLB 3GOVB 2G00A 3BF6H 1ELGA 1J17T 2CMYA 1TOCB 2YNBA 2GZ7A 4WXVA 1ZTLA 2F9OA 3MWIU 1O3KA 3STJA 3HK3B 1F0UA 1NFYA 4HI3A 3U9AH 1LMWB 1Y5BT 1ANDA 4X1RU 1DWEH 1DX5M 1UVOA 1WBGB 3L6PA 3MNCA 3T25A 4WMFA 2PSYA 3KQBA 1P2OA 2O8WA 4K3JA 3MHWU 1PQ7A 2HALA 2AIPA 1GMDF 1IAUA 1QBVH 2ZTZA 2WPKS 3F9GA 1A0LA 1QRWA 1A3EH 2Y6TA 2H5DA 2SGDE 1SB1H 1YKTA 4INKA 4ABAA 2Y81A 1BB0B 1HRTH 1TWXB 2BLOA 1TNJA 5FPYA 4I33A 2VB0A 1GJ5H 5A09A 1O2MA 1O30A 3A7WA 1V2PT 3M5LA 4CRDA 1SOZA 1D6RA 2F3CE 5JB8S 1ZOMA 4DIIH 5DP7A 1G2LA 1AE5A 2XTTB 4UE7H 4ZXXH 2QA9E 2GP9B 4B1TA 1C5UA 3UY9A 8ESTE 1OWJA 1HPGA 1ARCA 5AVDA 1MUEB 4NFEA 1W14U 1ZGIA 4ISLA 4UFFH 1Y3YA 1IQKA 3RDZA 1CO7E 2STBE 2R9PA 1FDPA 1C1NA 1HYLA 5EXNA 4AORA 7LPRA 3E90B 1GMCF 3PLBA 3SI3H 2CN0H 2Z9GA 1GJBB 3SU2A 1EB1H 3O8DA 1OWHA 1GHYH 1MU8B 1KXDA 3TVJB 1TPSA 2FOMB 1O39A 2Q6FA 4A92A 6ESTA 2ZU4A 3OY5U 3MH5A 2RG3A 2VGCB 1C1UH 2Z6BD 4FU7A 1BHXF 1O3PB 1OOKB 1TBZH 4IN1A 4ZHLU 5CMXH 3Q76A 2G5VA 1GMDG 1UCYH 2C8YB 1MD8A 1PYTD 1TFXA 3AAVA 1BJVA 1DFPA 1AGJA 3OY6U 3ZVGA 1C1OA 2Z3EA 4A1TA 3M7UA 2ANWA 1SGRE 1IQFA 3RLYH 4JK5A 2FS9A 5EPNA 1P2JA 1C1VH 2VVCA 3PWCA 1TABE 4VGCB 1TMTH 1YPKH 1K2I1 1TBQH 3FANA 1CBWB 3SO3A 3EQ0H 4Y8XA 4CR9A 5C1YA 1N8OB 3PB1E 3PMBB 5JBAS 4DG4A 2D26C 2YOLA 2B9LA 4J1YA 4CRFA 2VGCC 4Y0ZE 1O38A 2ZEBA 2C90B 2FOAA 4HGCA 2EC9H 3RXSA 3P95A 3UNRA 1ELVA 1Q3XA 2RCEA 2J38A 4JZFH 2BDIA 3ODFA 3SGQE 1GHXH 1TPPA 1AFQB 3JZ1B 3TLOA 1GMCG 1O2ZA 1QBOA 5T6FA 1FPCH 4VGCC 3PWBA 1CBWC 2FESH 1C1PA 1N8OC 1JWTA 1LQDB 3O8RA 1AD8H 1C5QA 1W0ZU 1O36A 2BVSH 3M5OA 3LT3A 1PFXC 2ZG0H 3DD2H 1SHHB 1V2MT 3MU8A 3M5NA 3UOPA 1Y3XA 1CQQA 3KHVA 1NTPA 1HAGE 1GGDC 3U98H 4M7GA 3PV4A 2BLWA 3VB4A 5K0HA 1EAWA 1C1RA 4X2XA 2PUXB 2PHBA 1GHBG 4ASHA 1S5SA 1W7GH 3M3SA 4X6MA 3ZVFA 3M3TA 2H9EH 2VIOA 2A7CA 1AFQC 2A45B 1MBMA 2ASUB 2OP9A 3BTWE 3S9CA 3ZZ5A 1UTOA 1WSSH 1AB9B 3TJUA 3GY2A 2SGQE 3KF2A 2J4IA 1GDQA 1GBHA 3C27B 3RC4A 5ESBA 1ELTA 1BTZA 3RM2H 3ATIA 1DXPA 1OYTH 1FY4A 1O3OA 4X8SH 1EUFA 1QA7A 5C20A 2G4UA 2Z3CA 1IQLA 2H6MA 3GYMA 1VR1H 1SBWA 3EYDA 2ZGCA 7GCHF 5EGMA 2PV9B 1ZPZA 3EBNA 1HNEE 1C2MA 1BITA 2VVVA 2C8XB 2FI3E 2PLXA 1ABJH 3KQDA 4AFUA 2B7DH 2A7HA 2W5EA 5E2OA 2PR3A 2BOKA 2Y5HA 3UOUA 1AB9C 2ZCLP 1C2HA 3ZZDA 3GICB 3BV9B 3HKIB 1O31A 3F6UH 2TIOA 1O2TA 2GT7A 1GBKA 8LPRA 3A7VA 3MNBA 5T3HA 2FO9A 4K1EA 1E35B 1CGJE 1O5DH 4K1TA 1XUJA 2G5NA 1HAYB 4ABFA 1JRSA 4JZEH 1VCQA 1MKWK 1DVAH 1QQUA 3KIDU 2QGRA 2ZDKA 1XKBC 4FUCA 4Q7ZA 2Y80A 3OTJE 3E91A 1IQEA 1O2UA 1G32B 4Y0YE 4HFPB 3D62A 2ZU1A 1TMUH 2FYRA 2WV5A 2UUKB 1A0HB 5DG6A 1K1OA 4K8YA 5EU8A 2XBYA 1QJ7B 3QDZB 2EA3A 1O3MA 1GVLA 1MTWA 1PPCE 1KSNA 2GTBA 1QL9A 1SC8U 4DOQA 3IWMA 3ZZBA 4AG1A 1XUFA 2Z9IA 2F9NA 1BTYA 3ATLA 2F9VA 4I8KA 3LGIA 1Y3WA 1Q31A 1YPLH 2PGQB 4KKDA 4WMDA 2QXJA 1MTUA 1TX8A 5BPEA 3SGBE 1GJDB 4BANB 5DP5A 2O9QA 3M3VA 4BXWA 1GDNA 3RXKA 5FAHA 4MNXA 1ANCA 1QRZA 3AW1A 1O2IA 1EZSC 1GBLA 1UTKA 2ZDAH 2P3UB 1LVMA 2FOBA 5ESTE 3RC6A 1DWDH 1GJ8B 3SU0A 1S84A 4NZQA 4BAOB 1LPKB 2TRMA 4GCHG 1O5FH 2AMDA 1EPTB 3TITA 2ZPRA 5DKMA 4D7FA 1GJ4H 3DUXH 1NS3A 4O9VA 1C1MA 3V12A 4XBBA 2AGGX 2AGEX 3RXRA 1T31A 1GL0E 1BZXE 5HXFA 1FJSA 2AS9A 3ENSB 1Y8TA 4ZMAH 1O3DA 4FUDA 5A8XA 4AFZA 3SBKA 2BDAA 1CGIE 1SQOA 1O2WA 3HK6B 1NESE 1FV9A 1UTLM 5B6OA 1GJ9B 2A32A 3QUMP 2NU1E 1EZXC 1CT2E 1GHWH 1S82A 4D7GA 3S9BA 4U30A 3A8CA 1C2JA 3M7TA 3F9EA 1SQAA 4INLA 3RXQA 1BTWA 1P2IA 1WV7H 3A88A 1EPTC 2AEIH 1O0DH 5I25A 1J15A 2XNIA 1S85A 1C5MD 3OU0A 4A6LA 3BTFE 2ZNKH 2HGTH 1Z6EA 1AUTC 4X8VH 4Y79A 1O5BB 1SGQE 2AGIX 1MCVA 1KDQA 1GI6A 3BTTE 4OS6A 2BD5A 2FTLE 4TWYA 2GD4B 3M5MA 3VB7A 2ZPQA 1ORFA 1P11E 2J9NA 2NU4E 1O3HA 5EW2H 2WINI 3PLKA 5DJ7A 4BNRA 1A61H 4B74A 3QN7A 1DSUA 1KXBA 5T6GA 5JBBS 3HPTB 1BTXA 1E37B 5T6DA 1JIRA 1BMMH 3NWUA 2ODQA 1PYTC 4B73A 3M61U 3S7HB 1H4WA 4JZIA 1OSSA 1YM0A 1MD7A 1G3EA 3NUMA 3EA8A 4CRGA 4DVAU 1CVWH 1A5HA 4A1VA 2WV4A 1VCWA 1TPOA 1OWEA 3RXAA 2JETB 2ZFPH 2BY6X 1GCTB 3M37A 3U8OH 4MG3A 2FS8A 1WTHD 3A7ZA 4DURA 3GY6A 1TQ0B 4WF8A 4ZH8A 2QN5T 4WMEA 3K6ZA 1EQ9A 3ESTA 2G52A 4KTCA 1FNIA 3EDXB 1BJUA 5C1UA 5E8EH 1FPHH 4SGAE 3MNXA 2Z9JA 1K9OE 3RMMH 1HAVA 4ZROA 2F9PA 1SR5C 1MAXA 1SHYA 1BTHH 1WYKA 1P2NA 1SSXA 3MMGA 4XE4A 5DP4A 3IG6B 4X2YA 2JETC 3LONA 3UNQA 1AVWA 4HTCH 1GCTC 4MNYA 5EXLA 2H5CA 1KLTA 1C2LA 3T5FH 1ZTKA 2QXGA 4OS5A 1EAUA 2FM2A 1JOUB 3DFLA 3SV2H 3W95A 4TPYA 1EP5A 1NFXA 2TGTA 4AFSA 3SNEA 1A0JA 3TPIZ 1QHRB 4NZLA 1THRH 1OP8A 1HGTH 2PGBB 2XCNA 1MH0A 3FVFB 4AN7A 1SLUB 2ZHDA 4E06H 1K28D 4FU8A