3AWDA

Crystal structure of gox2181
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
257
structure length
257
Chain Sequence
MYMEKLRLDNRVAIVTGGAQNIGLACVTALAEAGARVIIADLDEAMATKAVEDLRMEGHDVSSVVMDVTNTESVQNAVRSVHEQEGRVDILVACAGICISEVKAEDMTDGQWLKQVDINLNGMFRSCQAVGRIMLEQKQGVIVAIGSMSGLIVNRPQQQAAYNASKAGVHQYIRSLAAEWAPHGIRANAVAPTYIETTLTRFGMEKPELYDAWIAGTPMGRVGQPDEVASVVQFLASDAASLMTGAIVNVDAGFTVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and structural analysis of Gox2181, a new member of the SDR superfamily from Gluconobacter oxydans.
pubmed doi rcsb
source organism Gluconobacter oxydans
molecule tags Oxidoreductase
molecule keywords Putative polyol dehydrogenase
total genus 99
structure length 257
sequence length 257
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3awdA00
3RAJA 4CQLA 3K2BA 4NNJA 4UUNA 5KVCA 3WSWA 4OMUA 5TIIA 5JS6A 1VKNA 5G0TA 3ZN2A 3DR3A 1SEVA 4TRNA 3VPHA 1GZ4A 3F4LA 1KS9A 3HN7A 5T64A 4LRTB 5JO0A 1T2FA 2UVDA 2P9GA 3LT1A 3MJTA 2YW9A 1C1DB 3LYLA 3MWEB 4TWRA 3WMXA 3KYBA 3LT4A 3GVXA 3NYWA 3D5QA 3CEAA 2JCXA 3QWFA 3ADPA 1YVEI 3FD8A 4E21A 2JJYA 2D59A 2VWPA 2EKQA 3G79A 4NR0A 3IP3A 1NX6A 1DJQA 4AJNA 1E7YA 4R16A 4WOJA 2DBZA 4XWYA 2YJZA 2O3JA 1PGOA 4IZIA 1E3EA 3PJDA 4FJ1A 2GSDA 2I65A 4ZRMA 4PN3A 2WE8A 3F4BA 4CM6A 2J5KA 5KJ1A 1R4NA 4C4OA 4XDYA 4NMHA 2POQX 4WLOA 1QYVA 3KYCA 1HE5A 4CLOA 1P44A 3L0DA 1I01A 1P1FA 1ZMTA 4XYMA 3WWYA 3PK0A 1XG5A 1QYWA 4DL9A 4RVSA 3JQEA 2PZKA 3LLVA 2R2GA 4PIVA 3JQ9A 5MDHA 3RJ9A 4GX2A 2V7PA 1NM5A 1HE2A 2BI7A 4KUEA 4XIJA 1YB1A 4BQPA 4PLYA 1TT5A 4D3DA 5THKA 2RCYA 1KC1A 3JTMA 5F1KA 4O1MA 2FRDA 3KOUA 4EUFA 3QE3A 3GVHA 5G0SA 4M1QA 3E18A 4TVBA 4Y6PA 1I24A 5IXSA 3X2EA 2Q4BA 4NBRA 2V65A 3FN4A 1P0FA 2X23A 3ZNOA 2NVWA 1VRWA 3HQ4O 3I4FA 3RUFA 1WDKA 4D0RA 2PH3A 4ZQFA 2YFHA 4JCOA 1VL8A 1T2DA 2Q1TA 3PXXA 1NQTA 3TZ6A 2E82A 3HFGA 1U8XX 2CF5A 3PLNA 2P5YA 1HYEA 3EK2A 5CDGA 4UUOA 3PQFA 3BA1A 1JWBB 2W2KA 3DEYX 3LC2O 1ZSYA 3HNPA 1EMDA 1OZAA 4GQAA 2O3SA 1C0LA 1OMOA 1PQWA 5G2OA 2Q50A 4YXFA 5EINA 3UKOA 5JC1A 1CWUA 1IPEA 1CIVA 4XGNA 1TXGA 2G5CA 3VTZA 3NGLA 5JDIA 4ZVVA 2VWQA 3PHJA 4BNHA 1GYPA 4HFMA 4MP8A 1ZKMA 4MVJF 2DPGA 2IEBA 4II3A 5KJ6A 4CL3A 4BNNA 3F5QA 4LSMA 4UVDA 2OUIA 1BMDA 1UP4A 1ZZEA 3A9WA 1RYDA 3GGGA 3DZFA 4FFNA 1Y9AA 2VHWA 1HSZA 2YQ4A 3IOYA 3UICA 4CLEA 4EJ6A 3GDFA 3UCEA 2BGKA 3VTFA 2UYYA 2P4QA 1SOVA 3I9LA 3PDUA 4J7UA 1VL0A 1HDRA 2Y66A 1NPYA 4WCDA 4MVJI 3ICPA 2O3TA 4GMFA 5TX7A 5JW6A 2XXBA 3FR8A 1LRKA 1PJ4A 1T26A 2NVUB 1ZK4A 1GR0A 3WTBA 2EG9A 2GF2A 1LSJA 3BHIA 4OH1A 1PL7A 2C5AA 3JQAB 4JBIA 4LMRA 2D1YA 3ANNA 4GAEA 2BFAA 4NPCA 4PG5A 4BO4A 1Z82A 3LVFO 4XYLA 2CDCA 4K1LA 4DTIA 4QECA 4JX8A 3B1KA 1I3LA 1V8BA 3GZNA 4BNKA 4G2NA 4DC1A 2OP1A 3PI7A 1EUCA 1NAIA 3JQ6A 4I8XA 5JYEA 2PGJA 3D4NA 1HF3A 3EVTA 4K28A 1R16A 5ENDA 5C37A 2GN8A 1ULSA 4LVCA 4UVEA 1H0KA 2GASA 1BG6A 3V5NA 4XQCA 3OM9A 3TSCA 3OHSX 3VPFA 6ADHA 1XA0A 2O4UX 1B7GO 3L4SO 1C0PA 5I7FA 3EVNA 3CH6A 4JIGA 5IG2A 3ONFA 1ISMA 4XQGA 5TS3A 4DQXA 1JWAB 3D64A 3LLSA 5LDGA 1GUFA 4CMKA 3ZCXA 3H4VA 4BGEA 5JCJD 3QLJA 1GUZA 1L1FA 1SC6A 2C2YA 4EITA 3JYLA 4U6SA 3ROPA 4L74A 2AG8A 1ZK3A 4JGBA 1FDSA 3V1YA 4B8WA 1ISGA 1TVEA 3KZVA 5F3RA 3W4KA 2VQ3A 4HY3A 3KSUA 3UHAA 5AQ1A 2GYYA 9LDBA 1BW9A 3HDQA 1E3WB 1ADGA 1EK5A 3DTYA 4FC7A 4FGWA 3SBOA 3ZH2A 4BNZA 5AYVA 2NU9A 5IN4A 3KYDA 5KVQA 4CLOB 1AXEA 3UF0A 1HE3A 1J6UA 3DAGA 3FRJA 3CSDA 5GZ3A 3H7AA 4BO2A 3JYOA 1JN0A 1ZNQO 2NADA 5EPOA 1DC4A 5KCZA 4Q3AA 2FSSA 3AW9A 1C1XB 3SX2A 1JKFA 5T67A 3L6DA 4HADA 4J4TA 3MOGA 1U4SA 4RO0A 1ZXBA 4O59O 3R0IA 3GFGA 5TC4A 1YQDA 3MJSA 5HWSA 5A4DA 4DPKA 3FPLA 2NLOA 3I6QA 4F46A 1KY4A 4OXKA 5CPBA 5L4NA 4K26A 3K30A 3V2GA 4BB5A 1Z74A 4RVFA 4EGFA 4AJHA 2PGDA 1GPDG 2HMVA 1RM4A 4BMVA 4J4BA 4XR9A 1ZIDA 3C7CB 3NUGA 1Y81A 3RI3A 3DMTC 2PKRA 4FFLA 3UW3A 3EW7A 1PX0A 4CJXA 4BNJA 3OEWA 3GVPA 3OSUA 4OL9A 4OO3A 5JAZA 4AG3A 1I3NA 1N92A 2RHCA 4DMLA 1SPXA 3H9EO 1M66A 3ROQA 1GY8A 4ZICA 1EK6A 4MP3A 3E8XA 4MIOA 1KBZA 2ILTA 4Q9NA 3KRTA 1Y8QA 2VHYA 3O03A 4P22A 3TOZA 1DJNA 3WXBA 2G0TA 2HMWA 1FDTA 3DL2A 4YAEA 1NASA 5K9ZA 4J0EA 4YWJA 4JP2A 3QQPA 5MGBA 4J7CA 1XKQA 2H5LA 4OM8A 4RF5A 5IZCA 4JLWA 2BGLA 2BFOA 4RPLA 1P1IA 4AJEA 4N5LA 2X6TA 3EUWA 3EDMA 4ID9A 2X9NA 4M89A 4NK4A 3OQ1A 4R54A 3AUSA 1P1JA 3ANMA 4R1NA 4YA6A 1XU9A 2GZ1A 2RHRA 4N18A 3HE3A 2Q99A 2RH8A 4GL4A 4CMIA 1R66A 5T8KA 3BXXA 1T24A 1U4OA 2Z5LA 1NTOA 2C2XA 4G81A 2GDZA 5T5QA 3BTSA 5A1TA 1JU9A 3PHIA 2B5WA 3E82A 4KDEA 4Z9YA 1KEPA 1U3TA 4WLEA 4IDCA 1EFKA 3KV3O 1QXSA 2NU7A 1UJMA 4KQWA 1UDAA 1ONNA 5AVOA 3ZWAA 2GPTA 3D4PA 1F8GA 4BIIA 3SJ7A 3ETGA 3TNLA 4D44A 5A9RA 1ONOA 5G0VA 4HFRA 5A06A 5L7TA 1P9LA 1PZFA 3RU7A 2WYWA 2WMDA 2NV6A 4RPGA 1GQ2A 3UOGA 4ONEA 5DZSA 4Z0TA 3EAGA 3FNFA 4R9SA 3DZBA 4WCFC 1AUPA 1U7HA 2HMTA 1MGOA 3L4BC 3O4RA 1VLLA 4CMJA 1NWCA 1UR5A 1H2BA 4CUJA 3U3XA 4CQMD 1ZVMA 1SOWA 1B15A 1YBVA 4RF2A 3GY0A 1EVZA 4MIYA 5F21A 1VJ1A 5IAAA 3GK3A 1V3TA 4ND1A 2AE1A 1JQBA 2V6FA 4FJ2A 3ZU5A 1B14A 4IDAA 3MJCA 4YAIA 3M1LA 1GPJA 1WWKA 4J91A 3RUEA 4DIBA 2OXIA 5DP1A 2UAGA 5JFOA 4IUYA 3B1JA 4LRSB 5A5FA 2WWRA 3C1TA 3HJAA 2HK8A 4KTTE 3AJRA 4BNYA 3DFZA 2CDBA 2YDXA 5JAMA 3DFUA 3GGOA 3NRCA 1Z75A 1NVGA 4IJWA 5FEUA 3NDRA 1TI7A 3PFWO 2JKVA 1IPFA 4IJVA 4NH4A 4WCFA 3DMYA 3K6JA 1R6DA 4XJTA 1FJHA 4CM8B 1DDOA 5FI3A 4YT5A 1C1XA 3KSZO 2HJSA 3M2TA 3QWAA 4XDZA 2ZYDA 4OAQA 4CMEA 1GD1O 1ZBQA 2SCUA 5EERA 4CM3A 5JXWA 2GZ2A 5IDYA 4ZN6A 1P1HA 3ZNPA 2VZ0A 1LLCA 1R12A 4IDFA 3RBVA 4YTEA 3EZLA 2C0CA 2WEKA 1IZ0A 2AMFA 1UAYA 1DC5A 2AQIA 3IDSA 4RZIA 3INRA 4Z9XA 4YAGA 4ND4A 3S55A 1DO8A 5BSEA 1X0XA 4JBHA 2PFGA 1DHTA 2AXQA 2Q1UA 1G1AA 3JYQA 4GKVA 3D1LA 1RKXA 4PG8A 5L3ZA 2NQTA 4EI2A 3TFOA 1U2GA 3UGKA 2VHZA 4C7JA 1EDZA 3PHHA 3Q9UA 3DBRA 4E5YA 4QO8A 4KQXA 4YRAA 3WYBA 1N7HA 3JQAD 2Q49A 2EXXA 2E37A 2PH5A 4BO5A 4RDIA 1DLJA 4BMSA 1D8AA 4FSHA 4CMEC 3ANLA 2NWQA 3ICCA 4EW6A 3V8BA 3S2FA 3AY6A 3V1UA 2V6MA 4CQLB 5A9SB 4I08A 3HWRA 3IIEA 4DA9A 2UUPA 1EUDA 3CKYA 4DWVA 2LDXA 5L4LA 1E5LA 3I4CA 4PRKA 4D46A 1HLPA 3FSRA 1KYQA 3G0OA 3NT2A 3PQDA 1XQ1A 1KEUA 3WGGA 2OO5A 1RPNA 3OEYA 3GZ4A 4G5HA 1E77A 2P68A 4NU5A 1XDWA 5FFFA 1QR6A 1NQAO 1IHXA 1XR3A 1B8VA 2RIRA 3KM0A 3OJLA 3VH3A 3WB9A 3JD1A 4UREA 3I5MA 2X22A 2OHXA 1GADO 4HFNA 1KEWA 3RUHA 3E9NA 4FW8A 1QLHA 3ZWBA 3TL2A 4J1NA 3WLFA 1GFSA 1O89A 3EY4A 4CQMA 5CG1A 3MJVA 2B36A 3GNSA 4WK6A 1DIRA 1U2DA 3WOHA 2W2LD 1T4BA 4R3WA 1XELA 4ESOA 2AG5A 3DDNA 3Q9NA 3W6ZA 5TQVA 2WDZA 3KHUA 4LW8A 4J90A 3GEDA 4RQUA 5JNLA 4XKJA 3I9OA 3RASA 2C20A 2GLXA 4J43A 5AXAA 1ML3A 1LDBA 1R0LA 1SBYA 2ZTUA 4OHUA 5JCJA 3DQPA 3RFVA 4PLZA 4J16A 1K6JA 2FPGA 3ZWOA 4BHTA 4CLDA 1IOLA 5BR7A 4BO6A 1ZK1A 1CETA 1OC4A 2I6TA 5L45A 3VC7A 4BUCA 3VH4A 2H1SA 3CTMA 4TVOA 5JMPA 1TA4A 2HK7A 2NUAA 3PWZA 4HKTA 4YT8A 4PZEA 3N7UA 1VKOA 4WPGA 3GNQA 2ZTLA 4JJFA 1B0AA 1YGYA 1T2EA 1YRLA 3ZWVA 3K9QO 4LSWA 1U9JA 2QRKA 2WD8A 1X7GA 3BMOA 3JQ9C 1YO6A 3BMCA 5DCYA 4R41A 4NK5A 2CZCA 4U0KA 3H9GA 4K6CA 1YOVA 3LQFA 1H6DA 4D3SA 4FR5A 3VPSA 4BO3A 3S2GA 3WNQA 2I99A 3JQAA 5DDIP 2YHIB 3IMFA 4CODB 1KVTA 2A92A 2XPCA 4RV9A 3NAQA 4FOOA 5L53A 4D43A 2X9VA 1N8KA 3UCXA 1PGPA 3P19A 2JAPA 2UUOA 2NTJA 1H93A 1S7CA 2EV9A 1C1DA 2OL4A 4BNIA 1Y8RA 3N58A 4ALNA 4OXYA 1Y5RA 3OECA 3GN2A 3U49A 5C7IO 4WKGA 4GWKA 1YS4A 3I23A 5L9AA 3COSA 1O9BA 5K6AC 4IMRA 1H9BA 1SZJG 2BMAA 3PEFA 4WJZA 3WX0A 4YCAA 2B0JA 3PYLA 3I83A 4HWKA 3JV7A 2OZPA 4XYEA 4ND3A 2IRWA 3GFBA 2QZ9A 4OQYA 3HDJA 1CQIA 3SC6A 3TZQA 5HS6A 4CR6A 1QYDA 2DQ4A 1UUFA 1KOLA 4AJLA 2JCYA 3STHA 3BMNB 4R01A 4AJ1A 2X5KO 4XQEA 1B26A 1Y7TA 4OXNA 4BO8A 3ZI0A 5IJZA 4IIUA 4OGWA 1VE9A 3QP9A 3QRWA 4DMMA 3KO8A 3L9XA 3WGOA 4CM5A 2G82A 3LDHA 3QWBA 2X0RA 3AM4A 2X5JO 4BB6A 1NVMB 2XOXA 2I3GA 3E48A 5ENVA 4CMBA 3EC7A 4CM1A 4JQCA 4B7XA 2VT2A 1I2CA 1ZUD1 3H9JA 3UN1A 2AE2A 2X1HA 4YRDA 4MIEA 3ETDA 3AU8A 4XJSA 4W9NA 4E5KA 4CMHA 4B8ZA 3K31A 1G0NA 2WE7A 3MJ4A 5G0WA 1A4UA 1IHYA 1LSSA 3A1NA 3TF5A 4YAJA 2EF1A 3LT2A 2IZ1A 3GG2A 1RM5A 2BLLA 2OOSA 3RKUA 4EYEA 1XYGA 2GNAA 1YL7A 3K8ZA 4IDGA 2FPIA 3ZWXA 2VTDA 3HFSA 2CVOA 2YV2A 1X15A 4E0BA 1EEHA 4IZHA 5TNXA 3KVOA 1YH3A 3X2FA 4JK3A 4CMCA 1PR3A 1EBUA 4WNCA 5KJFA 4XX0A 4FN4A 4J1TA 3DHNA 4RPHA 3ST7A 2JFGA 4DPLA 3ENKA 3N74A 1YBAA 4CV3A 1EE9A 3OP4A 3ZNQA 3DBVO 1HLDA 2WYUA 3TWOA 4IDBA 1U8FO 1T2AA 4DLBA 1FDVA 3WJAA 4RLHA 1UDBA 1YL5A 3FTPA 3ZV6A 1VC2A 3S2EA 4ZU3A 1DC6A 5CDSA 5EQDA 1V0JA 3QJ5A 5BSFA 3GEMA 5BQFA 1JKJA 1MFPA 3JQFA 4GWGA 4RQTA 1OI7A 4Q39A 1CDOA 3HHPA 4J6FA 4F6CA 3CE6A 1W73A 4CL8A 2ZQYA 2ZATA 3M1AA 3DZHA 3ONEA 4Y98A 4Y6RA 1P3DA 3NDJA 4Z9FA 4MVJP 3OJEA 2WD7B 4C7KA 2DBQA 1JTVA 3U4HA 1I3MA 1HE4A 1ZXLA 2W2LA 4DLLA 1YB5A 3GMSA 3ETEA 2AEFA 3QVWA 5L4SA 2EJVA 4JNKA 3PJFA 1WPQA 1CRWG 5L7WA 4GLOA 1B16A 1K5HA 2VHVA 3O8QA 1VI2A 1YQXA 2GERA 3ZWCA 2GN9A 4FOSA 5I8WA 3AY3A 3NTRA 4IDDA 4M8SA 2DT5A 4O63O 2PD3A 3GDOA 1ZSNA 4UVGA 4EEXA 3JCZA 2DAPA 1W0CA 5A03A 3W8EA 3F6YA 4BS9A 5JY6A 2PWZA 3UAGA 5CDUA 3IKVA 1ULUA 4R9RA 4ALJA 4ALKA 1O94A 4RPJA 5LDHA 1U3WA 2B83A 1X7HA 5EQFA 1HDOA 5T8KC 5FF9A 2Q2VA 3O38A 3RD5A 5BT9A 5IDXA 2QZZA 3KETA 4QTZA 3VH2A 8LDHA 4IGFA 4FD3A 1JVBA 1LEHA 3V2UA 4WGGA 1E3JA 4PFJA 3NT5A 4XIYA 3RU9A 5TGDA 1UXGA 3GPDG 3ITDA 4URFA 2IDZA 2D0IA 2IODA 1C0IA 4GI2A 3WBFA 4LCEA 3GRPA 3GHYA 2CMDA 3F3SA 2BELA 3CPSA 1EVYA 1I5RA 9LDTA 5B37A 3SLKA 4DUPA 1N9GA 3DBHB 1OAAA 2DC1A 2AQKA 2IYOA 4IDEA 2O7QA 1BGVA 2EEZA 4CUZA 1LDMA 3AM3A 4HP8A 5AXDA 5IFLA 2FR1A 2W90A 3BAZA 3BMQB 4NFHA 3SC4A 4BV9A 3RJ5A 3A14A 1M75A 3Q1LA 4XB1A 2LDBA 1NFFA 1PIWA 2HU2A 4BGUA 2Q1WA 4YEDA 1YE3A 3PIDA 1YKFA 1NPDA 5COBA 4MVJH 3P7MA 3MOIA 5H82A 2FZEA 4DGSA 3HDHA 5G0UA 1JKIA 1GUYA 1QV6A 4R1UA 4MKXA 2Z95A 3GG9A 1LA2A 1A9ZA 1E1KA 2YY7A 4RORA 3WJ7A 1H2HA 3H3JA 1R4MA 3FHLA 4WCFB 3VOSA 4CV2A 4E2XA 4YJHB 4M86A 2GGSA 2B35A 2VWGA 3PDJA 3C24A 1JAXA 1ZCJA 3W8FA 4E12A 1WMAA 4BNGA 1I2ZA 1EQUA 2IYPA 1MA0A 1WP4A 4DYDA 5I9MA 2VRCA 5EL0A 4IIVA 4TQGA 4YJGB 4EDFA 3B1FA 4PLHA 1O0SA 1J0XO 1HDZA 4B3JA 4G65A 1NR7A 2P9CA 3DOCA 4U0JA 1DIBA 1MP0A 3ZWPA 3GN1A 5BNTA 1E7WA 1ADBA 4ZHSA 1ISIA 4QSMA 4BNVA 2DFVA 3WYEA 4EJ0A 1PJ3A 2VUUA 5TRTA 1LQTA 4IM7A 5CHEA 4DPMA 4D41A 1C3VA 3AUTA 4BNTA 1ARZA 4NBWA 3I52A 3KEOA 1LRLA 4MVJD 4RL6A 4IJUA 3K73O 4PLTA 2A35A 3EHEA 4IMPA 4OSOA 1P1RA 3ZDFA 1BDMA 1KVSA 2D2IA 2OORA 4L75A 4E13A 4I1IA 3PIIA 3E5RA 2ET6A 4FPXA 3HADA 3ROKA 2Q4EA 2CNBA 4QQRA 4TKMA 4Z3KA 3I9KA 1E7QA 5IN5A 1XSEA 5COAA 3WBBA 1YXMA 2EKLA 4M55A 4BNMA 1E6EA 3RUIA 3MEQA 1H6AA 2B5VA 3ORFA 1MXFA 2C59A 5KTKA 3U0BA 4A73A 3JQDA 5KNLA 1LTHR 1Q0LA 5L51A 3QHAA 4ILKA 1HETA 1ZMOA 5CEEA 1KETA 1OOEA 4GMGA 4B7CA 1EVJA 1BWSA 1XGKA 5IDWA 1C14A 3KTDA 1LDEA 4CMIB 3T7EA 2A4KA 2O48X 3L9WA 2ZB4A 4D7AA 2QX7A 4ZQHA 3L77A 3TFQA 5BSGA 4AJIA 4FB5A 3KBOA 3TJRA 4F45A 1EFLA 1UXJA 3A28A 3F1KA 1LRJA 4GX5A 4XYGA 1BRMA 1B3BA 4E4YA 2Q2WA 4BKUA 4PGFA 3G17A 2NSDA 1QV7A 2VCYA 3AM5A 2AEJA 3GNTA 2CDAA 2PLAA 4WASA 3ULKA 1DIAA 2E48A 1LLDA 1GCUA 1R37A 4JP3A 3RCBA 3GH3A 3Q2IA 4WEOA 4XGIA 4LMPA 1MG0A 3U9LA 5AOVA 3QWHA 3TZKA 3WTCA 3WYCA 3I1JA 3TL3A 2CFCA 3R1IA 1HDYA 3IUSA 4FCCA 2X9GA 1A72A 1DAPA 3QWIA 2HO5A 1DFIA 3BMOB 4OOEA 4R5MA 3OFSA 4H3VA 4CPDA 4DYVA 4NU6A 4W7IA 4QFCA 1YQGA 3M6IA 4J1SA 2R00C 3DBLB 4GBJA 1PS0A 1I33A 5CPFA 1EZ4A 2QRJA 3JQBA 4O0LA 2EGGA 1P77A 1WDLA 1N9GB 1ZK2A 3DBHA 3LF1A 2O2SA 4TKLA 1FF9A 2C07A 2Z1NA 1CQJA 4L73A 4L76A 4E5PA 2WSBA 3E6AA 4P4LA 3GOHA 4WE3A 1XU7A 1OFGA 3INGA 1T25A 3Q6IA 4ZRNA 4XD2A 2WD7A 1EUZA 4BV8A 4FQ8A 5KKCA 3OJFA 4ND2A 4U6QA 1Y8RB 3FI9A 3U4DA 4WOKA 3GAZA 1SCUA 4UVIA 2JD2A 4NIMA 3VDQA 3WGYA 4CM8A 5EN4A 1PU2A 2P2SA 1WNTA 1YL6A 3PGJA 2W98A 1PJLA 2FY8A 4PG6A 1N1EA 1ZJZA 4GX0A 3ZU2A 4NBTA 1ZEMA 1DRWA 4IJKA 2VTEA 4PG7A 1KC3A 1M2WA 5ADHA 5I9NA 4DIOA 2B4RO 1BW9B 3H9UA 5JAQA 4WLVA 5L40A 2PTGA 2QW8A 2YUTA 1T2CA 1FK8A 2JD1A 3BMNA 2JAHA 3TN7A 2PV7A 3VPGA 2ZTVA 3AFNA 4LCJA 1MC5A 3GMDA 4CLRA 2XXJA 3VZPA 4FJ0A 1B8PA 1LDYA 1P31A 4AICA 5ICMA 1RWBA 4WLFA 3FNEA 2ZJ0A 3W4IA 2GN4A 2QHXA 3JYNA 4RVUA 3RBXA 2PK3A 3OQBA 2NM0A 1K6IA 1ZJYA 2NVBA 1IL0A 1MUUA 4UAGA 2RBEA 1YOVB 1PJQA 2A9FA 1A7KA 4HV4A 3DHYA 3FCOA 4GVXA 3VZRA 1E3IA 4FFMA 3BMCB 5A9SA 2TMGA 1W8DA 1G6KA 5THQA 1Q0HA 2I66A 4EUHA 2HK9A 1LLUA 2H6EA 2Q3EA 3EGOA 3RQSA 1I2BA 1DIGA 3RC2A 3D4OA 1E1MA 4N54A 3RUCA 4LGVA 1XIVA 1CYDA 4PG4A 1JW9B 2VYVA 1HEUA 4QT0A 1PR9A 5F5LA 3NX4A 5CEFA 1O8CA 3QVSA 2JHFA 1VM6A 5TSDA 4EZBA 2GO1A 3H8VA 5KKAA 2ZCUA 4FDAA 4JN6B 2Y68A 1GCOA 3DZGA 4RJTA 2YQ5A 1PGJA 2H9IA 3OH8A 4PLFA 5GZ6A 5ITWA 1IY8A 5T6BA 4CLXA 7MDHA 2GUGA 3WR5A 1E3SA 5I7EA 3DXFA 2VNAA 4MINA 4D0SA 2F1KA 1I36A 3T7CA 1O5IA 1H9AA 1K89A 4E5MA 4YRBA 4N5MA 1PEDA 1V6AA 2AQ8A 3K2EA 3OICA 3ROMA 3EZYA 1B3RA 1RM3A 4L8VA 3RROA 1RM0A 3MJEA 2FMUA 5U4QA 3WGZA 2RAFA 5ICSA 3KEQA 1V3VA 3KB6A 4H15A 2D8AA 4DC0A 5B12A 2O7SA 1GQQA 4GX1A 4E5NA 2Q46A 4HNGA 5JO9A 4M87A 3QVXA 5HBRA 5ES3A 4R69A 3PFFA 4B3IA 1AGNA 2DBVO 3OIGA 2A94A 2BFPA 4CMAA 5CFZA 5DBGA 1N1GA 5GZ1A 1WXDA 4IQGA 3QY9A 3KXDA 1NNUA 1PJTA 1G0OA 3H2ZA 1DOHA 2ZJ1A 3DB2A 3T4XA 1NVTA 3BZUA 3AI1A 3GVIA 4GLLA 3QSGA 1XQ6A 3FBGA 3C1OA 4FFOA 3INTA 1EE2A 5CEJA 4YPOA 3DHEA 3DONA 4BKQA 1P1KA 4M49A 1NBOA 4NI5A 4OQZA 2NQ8A 4U8GA 2Y99A 1AHHA 2BHLA 3K5PA 5I9LA 3ZW9A 1NYTA 2PD4A 1SB9A 3JQBC 4BKOA 1D3AA 1ONPA 2BI8A 4I9UA 4UULA 2B4QA 4E6PA 5DCWA 1CF2O 2ZK7A 5EESA 2Y1OA 3DBRB 3JQ8B 3Q0EA 2FOIA 3AY7A 5I7VA 2ZQZA 4H7PA 4W82A 3GUCA 4JBGA 2JFFA 5B4VA 3FF4A 5JYDA 1M6HA 2Y0DA 4UEKA 4RZHA 2ZTMA 1BDBA 4NJMA 2D4AA 2EJWA 2CVZA 5KJCA 2EWMA 3ZV3A 2B37A 3B70A 1NAHA 2CD9A 3OQ6A 2Q2QA 3VZSA 3WNVA 5FWNA 2RH4A 4A10A 3D7LA 4KP7A 3RUDA 3SXPA 4YDRA 4HUJA 3P5SA 2VWHA 4D79A 3DAFA 1T4DA 2BKAA 1ADCA 3VHRA 3GUYA 1WZIA 4II2A 4J3FA 4WLNA 1B8UA 4YJFA 3WGTA 4IINA 3KSDO 4RCVA 4E33A 3AI3A 3AK4A 3CZMA 2GZ3A 3PGXA 3E9MA 4MVJG 3VAZA 4BL5A 1PL8A 3WG9A 2X0NA 4NFYA 3KYCB 2V6GA 3IS3A 1X0VA 3AI2A 2G76A 3O8QB 3AUUA 1HSOA 2OBNA 4IS2A 1PJCA 2OP0A 5LCXA 4KDFA 4K6FA 4R1TA 3WMWA 4O5OA 1IUKA 4K9DA 3RFTA 3TRIA 1IZ9A 2HJRA 5IXYA 4KZPA 4QUKA 3UUWA 1EDOA 4RPKA 2DU8A 5I8ZA 2Y1EA 1PL6A 1R4MB 4S1VA 2GR9A 2NTNA 3S2IA 4WLUA 1E1LA 1GV0A 1MG5A 4BO7A 5A3JA 1AXGA 1K3TA 4UEOA 1E7MA 3D3EA 2JCVA 5J23A 2VYNA 2JHGA 1AN9A 3GQVA 4ND5A 2QIOA 3D0OA 1LBEA 1D1SA 3F46A 4F6LA 4WNIA 5U1PA 3NDIA 3TZHA 3VZQA 3PJEA 2JL1A 1O6ZA 4BKRA 2HMSA 3JD3A 1HDXA 1WDMA 5KOIA 4Z3DA 3F9IA 3AOEC 1BXZA 3A4VA 3IAHA 3VKVA 1GQYA 1Q2XA 3LZ6A 4OJNA 3P2OA 2PZLA 4DBZA 1HRDA 1HTBA 4XCVA 1VJ0A 5DCUA 3RBZA 3BIOA 2DUUA 3WFIA 4D42A 1LQUA 3H5AA 3ZU4A 1DPGA 2Y05A 1PZEA 3BMQA 3D3WA 1Q1NA 3PPIA 4LISA 4FFPA 1CJCA 2W4QA 4CM4A 2HUNA 1EBFA 3WGIA 1UXIA 3LU1A 4DQVA 1T1RA 1Z6ZA 3LK7A 1LJ8A 4J4HA 4OSPA 2GD1O 3PYMA 4ROSA 4PLVA 2P5UA 1A71A 4PZCA 2D5AA 3ZHZA 3JYPA 3OMLA 4I5DA 5FI5A 3Q11A 1V9LA 4TSKA 2JFHA 3JQ7A 4YT2A 3F5SA 1H94A 5BNFA 1ISFA 3VVBA 3WIEA 3E1KA 3WQRA 2HKIA 4QFDA 4CQMB 1PQPA 5JCXA 5C5IA 3ABIA 3QIVA 2ZB7A 5A05A 4B4WA 4KUGA 1WZEA 2ZCVA 1B2LA 3U4IA 3BTUA 5F5NA 4BNWA 2C7GA 1U1IA 3BHJA 3PZBA 2EW8A 1NHGA 1PZGA 5JC8A 2FPPA 4AJJA 3GAFA 1I8TA 1J49A 4W9NC 4BO0A 4X54A 2H63A 4A0SA 4AJPA 4JJGA 4ZQBA 1VPDA 2Y1FA 4CM9A 1NR1A 3PYXA 4RDHA 2D5CA 2B4TO 4YQZA 1XHLA 3S8MA 4R51A 3ON5A 3PVZA 4N5NA 2W8ZA 1XWFA 4NHEA 3W4JA 3OIFA 2EW2A 4YAKA 1K0UA 3QV1A 4Q3EA 4RVGA 4W6ZA 4J2OA 3FTNA 1NXQA 4RVDA 3S1LA 2C7VA 4GH5A 2AEMA 3I9NA 4CLHA 1BVUA 4NJOA 2TMDA 1ZK0A 3G49A 1RYEA 3U5TA 5HRUA 4PVDA 4P4NA 2PY6A 4IXWA 2PD6A 2XAAA 4MJLA 3IC5A 3JQCA 2EKPA 4UUMA 2ZYGA 5JDCC 3E5MA 3DBLA 4Q3BA 3ZU3A 4PLPA 4FS3A 4J1QA 2UDPA 1ISJA 4UUPA 1X14A 5B4UA 5DBFA 3PWKA 3VVCA 5C3MA 5DULA 3H9QA 3D5TA 3RVDA 1E3WA 1LDNA 3F1LA 5JDIC 5TJ9A 2IZ0A 2ZB8A 3ADOA 1LLQA 3E9QA 4ZGWA 1E3LA 4DLAA 1PSDA 1ORRA 1Q7BA 3JD2A 3VPXA 4D45A 2WM3A 3ONDA 1ZO8A 3WS7A 5EIOA 4QXMA 2OMEA 6LDHA 4P38A 1YB4A 4AJOA 4KWHA 3BTVA 4XR4A 4BO1A 3JQGA 4R3NA 4YJGA 4F3YA 1QRRA 4E2YA 5G4KA 2G1UA 4XGKA 1ADFA 3RC7A 1PWXA 2J5QA 5DOZA 4FFRA 1Y5MA 2Y0CA 3C8MA 2I3AA 3O9ZA 4CV0A 4Y8VA 2X0JA 3M2PA 3NTOA 5IZ4A 1P45A 3TQHA 3TDKA 1SB8A 5DT9A 3ZHYA 2J3JA 4O6VA 3DC2A 4E32A 3U62A 3TPCA 1F17A 3GHHA 4CLRB 1QORA 2QG4A 1YJ8A 1X7DA 2X7HA 2GCGA 1V35A 1FMCA 4E2WA 3FBTA 4TRMA 1Z7EA 2AA3A 1BXKA 1XLTA 1ZW1A 3IUPA 4NJMB 2NTVA 1DHRA 1WW8A 3WGQA 2DPHA 3OJ0A 4BVAA 4HXYA 4CR8A 5IDQA 1QYCA 5DP2A 4Q3DA 4GGOA 2DFDA 2VUSA 2Y1CA 3GLQA 3DZKA 1PTJA 1X13A 2YDYA 3ZWYA 1GZ3A 1XEAA 2O3RA 3ZV4A 1L7EA 2R6JA 4Z0PA 5A02A 4QX6A 2HDHA 4J0FA 2O50A 4FIZA 2DM6A 1C0KA 3NKLA 4I5GA 2BF7A 3UH1A 2AQHA 4WEQA 5DBIA 4IQ0A 1F14A 4TMFA 1QKIA 4J9UE 3RUAA 3OJOA 4RF4A 3BHMA 1A7AA 2J3IA 4KOAA 4MO2A 4TRJA 4TZTA 4H16A 4IY1A 1Y6JA 5JDCA 4MVJM 1QLJA 2BD0A 2X5OA 2EP5A 2PA3A 3IP1A 5ER6A 5BSHA 1E92A 2J3HA 5H83A 1H6CA 3FWZA 1ZH8A 5CDTA 2DTEA 1MV8A 4BNLA 5IF3A 1N5DA 1ENOA 1Q0QA 1HZJA 5C7LO 3NTQA 5JMWA 4YACA 3K92A 4MOWA 1HDCA 3P2YA 3Q2KA 2J3KA 2OFPA 4B3HA 3AU9A 1NHWA 3HDYA 3RSHA 2NNLD 3DMTA 1R4NB 1HT0A 4BNUA 1Z45A 2O3UA 3WGHA 1JA9A 5HTOA 2JD0A 5F1PA 5TT1A 1UAGA 4NBUA 4U5QA 5DN9A 3QVOA 4YVFA 4BGIA 4YJHA 2AHRA 4DIFA 3H5RA 4DBVO 3T4EA 1U5AA 5K6AA 2PNFA 1YDWA 3IKTA 1LXCA 4A03A 2CUKA 5ILGA 1QYXA 3ZWMA 2FSVA 2OBYA 3GRKA 4MPDA 5H81A 1PWZA 2F00A 1BVRA 3QA9A 4E2ZA 1ZSVA 3GF4A 4JJIA 4E30A 3O26A 1PJ2A 1GAEO 2DTDA 3VKUA 2PKQO 2IXBA 5JY1A 3EMKA 2FR0A 1F12A 3AFMA 5JBIA 4AJKA 1DIHA 4IXTA 4TZKA 4BMNA 7ADHA 2HAEA 3CUKA 3WWZA 5A5EA 1XCBA 2VUTA 5EJ2A 4EBFA 2VYND 1PGQA 2P4HX 5KVVA 1E0DA 3SJUA 1GYQA 2W2KB 3JD4A 4PCVA 4ALIA 4LK3A 4Y67A 1Y1PA 3DOJA 4IQ8A 4Z6KA 1GV1A 4M54A 4RLSA 5TT0A 1U3UA 5JLAA 1UZLA 3L6OO 4EJMA 4PZDA 1A27A 5COQA 5FYDA 2O23A 1R15A 1GZ6A 4YB8A 1HL3A 2OGUA 3WICA 1NP3A 1I30A 2CSUA 1YDEA 3UVEA 4MVJE 1LX6A 2EHDA 4NBVA 4EEZA 4P8RA 3L4BA 1R0KA 1LSUA 4DREA 4A5OA 1OBFO 1YWGO 4XQ9A 3DZIA 1KIFA 1LDGA 1CERA 1R0SA 3AOEA 5TJHA 3ZGYA 3LT0A 2X58A 1X1TA 2EP7A 1ZEJA 3HZZA 1JDJA 3PHGA 2YYYA 3MTJA 2NACA 5DNAA 1Z7BA 1P33A 2R00A 4CM7A 3H5NA 2X8LA 2P91A 2BH9A 3H6KA 1LNQA 2HMUA 5DOVA 5EMHA 3HG7A 1JAYA 3KYDB 4IBOA 1DRUA 4HNHA 4L4SA 5CDYA 5CG2A 1IYZA 3G3EA 5JPIA 1IB6A 1E5QA 2IXAA 1TT5B 4IPTA 4GSLA 3L07A 1I10A 1MB4A 4JROA 4ZJUA 1VSUA 5DF1A 1SMKA 3B6ZA 1DAOA 4I5FA 2ZYAA 3DZJA 3PQEA 1E1NA 5C7OO 3WLEA 1QG6A 3GPIA 4QO7A 1T1SA 2ZIZA 2CF6A 2PZMA 2VNSA 4R5HA 4ALLA 1FDWA 2C29D 2O4CA 2QYSA 5L95A 3I9JA 4B4OA 1GYRA 2Y0EA 3WSVA 4PVCA 3RIHA 1TT7A 5A04A 2VT3A 4U7WA 3U09A 1GDHA 3HSKA 4E3ZA 2V6BA 3GT0A 3TOXA 3FNHA 1PGNA 4UVHA 3GR6A 1YJQA 1BXGB 4A27A 2BGMA 4I9HA 2E49A 1W6UA 2C82A 1BHSA 2HRZA 3G1TA 4BGVA 1DRVA 3GDGA 4I5EA 2BFMA 1D7OA 1H5QA 1YONA 2XF8A 3JD0A 3JQ8A 1Z73A 4JXKA 1DFGA 5T57A 2VOJA 1H6BA 1VSVA 2FP4A 3RKRA 1E6UA 1NQ5A 2G17A 4LVUA 1A4IA 3BYZA 4DXHA 2Z1MA 4AJ2A 3ZW8A 3FNGA 1LI4A 4TRRA 4INAA 2FWMX 1WMBA 1QP8A 2X4GA 3FPCA 1Y8QB 5JE8A 2BRUA 1VJTA 1QSGA 3JQGB 1LU9A 5AXCA 1EQ2A 3H65A 5TF4A 3ZNNA 4BO9A 3Q3CA 2B69A 3U4CA 2C54A 3R3JA 2YHUA 5LC1A 2GN6A 3D3WB 2IZZA 1L7DA 1LSOA 2YV1A 5A9TA 2DLDA 1HYHA 3F47A 1J5PA 3ZHXA 2Q1SA 4PLWA 4CM4B 4YJFB 3GVCA 4LN1A 5BNIA 1UP6A 1UP7A 2EERA 3SEFA 3ZWNA 1PJSA 3NEPX 4OIMA 2DBRA 5KJEA 2CVQA 3GA0A 5B1YA 1ISHA 4L9RA 2FR8A 4NG5A 4ZQGA 3UXYA 3WFJA 3AWDA 4Z0HO 3VDRA 4DQUA 1BSVA 1P0CA 5A3VA 1X1EA 4OKIA 1UH5A 3C7AA 3CMCO 4W4TA 4FBGA 1RJWA 2ZB3A 1TLTA 3L6EA 2NU8A 1I0ZA 4MVJA 4NZ9A 2VZ8A 2J8ZA 1A5ZA 3DTTA 2UV8A 3GZNB 4BNXA 4ITUA 5B4TA 3LC7O 2QRLA 4NQZA 4ZA2A 3ITKA 3HB4X 4XA8A 1AHIA 3WQSB 4Q3CA 3KUXA 5K0ZA 3PTZA 3LSYA 1MFZA 5GMOA 1K2WA 3A06A 1I32A 2X86A 2DUWA 1GEEA 4A26A 1FXSA 4B7UA 3QW2A 1E6WA 4HFJA 3OF2A 2HLPA 3GGPA 4FC6A 5ER9A 3NT4A 3EYWA 1HWYA 2J5RA 2PR2A 3PRJA 4RVHA 4UEJA 3CINA 2IE0A 4ZD6A 4DRYA 3VH1A 4KMSA 3OIDA 4L0QA 2WYVA 4XYBA 4IGEA 4W7HA 2CY0A 4MKRA 2Y1DA 1PQUA 4GVLA 3W6UA 4AL4A 3V1TC 4D3FA 1DXYA 1UXHA 3LF2A 1KY5A 2PZJA 3SVTA 3RC9A 5HM8A 3ASUA 1ID1A 1V3UA 1MC4A 3AUAA 1LC0A 2YZ7A 4CR7A 3IJRA 1QMGA 4Y6SA 1Y9EA 4R4JA 3RFXA 4TROA 3C85A 1GEGA 2ZKLA 4KWIA 1M67A 3ZWWA 3E03A 5L7YA 4NFSA 3ZZNA 1UXKA 1HYGA 1AE1A 3DO5A 3QVTA 5KVSA 3JQ7B 1FDUA 3WDSA 5U9CA 1F06A 3CIFA 4N7RA 2VRCD 1KVQA 4IS3A 5JAIA 2I76A 2PKQP 3GC6A 2FHSA 4BOYA 3C3XA 3LC1O 3PLRA 2YFQA 4KUHA 1NFQA 2YV3A 4YBZA 3H2SA 8ADHA 3OA2A 4YQYA 1BTOA 4PLCA 4Y9DA 4XEHA 3NGXA 2Q45A 3CXRA 3H3FA 2VZ9A 1NFRA 5GY7A 3DOOA 2WJPA 4MDHA 1PJBA 1KEVA 1MX3A 1IULA 1GL3A 1ZFNA 4CUKA 4GKBA 1OC2A 2VHXA 1E7SA 2Y1GA 4XRGA 4CV1A 1GTMA 3W1VA 2DKNA 3R3SA 2X0IA 4J2HA 1JVSA 5JSFA 5KWEA 3I9MA 1UDCA 2O2YA 3CMMA 1ENPA 2Y93A 3I6IA 4HBGA 2HRBA 2YHIA 3CZRA 3PWSA 4J7XA 1WLYA 4J9VA 3ASVA 4EUEA 1UZNA 3R6DA 4CM9D 4L4RA 4YJDA 4E31A 2E6UX 4WECA 4B4VA 1Q7CA 1WVGA 2NU6A 3HB5X 4Q3NA 1U28A 5AXBA 3WIDA 2P9EA 4CMGA 1CEQA 1BXGA 2NVUA 4YYZA 3OETA 4J49A 1MXHA 3MTGA 1U3VA 3PZRA 1DSSG 2I9PA 1DC3A 3ENNA 3WQQA 3C1AA 1F0YA 3TZCA 5HS4A 3BTOA 4W99A 3C7DB 2C5EA 3OA0A 3ZV5A 4AVYA 1GU7A 1M76A 4MKZA 5ILOA 3IL2A 4OKNA 1ENZA 2Y67A 1EVIA 4P4GA 4WUVA 4R68A 4XB2A 3RWBA 4A7PA 4OYRA 4R1SA 1WAMA 1ENYA 1D4FA 4I9NA 2I5PO 5G4LA 1LC3A 5HA5A 3GEGA 1D1TA 1Q7GA 1N2SA 1SEPA 3MCVA 4B79A 4QEDA 5CAEA 3ZHBA 4YT4A 2DTXA 3JQFC 1NQOA 5CP8A 2QQ5A 5I7SA 4NDNE 4XZ3A 1HKUA 3FR7A 4ZQEA 1DB3A 1SNYA 3HUDA 1NPTO 1I3KA 3B20A 4PLGA 5TLSA 2GRAA 4GGPA 1SAYA 3IQDB 1PZHA 1KVRA 2QYTA 4OOFA 2EGHA 1E7RA 2HSDA 4HX5A 4FGSA 3IJPA 1U5CA 4GPD1 2HQ1A 3UCFA 2D3TA 1PS9A 4AFNA 1A9YA 2VOEA 2VRBA 5G4KB 1IE3A 2O3QA 1LUAA 2E4AA 1TEHA 1HZZA 1P74A 4RF3A 2IEDA 2WTBA 4BNFA 3FWNA 3KLMX 4KTVE 1DFHA 3MWDB 1HXHA 1NWHA 1DEHA 2EIHA 1KERA 3NJ4A 3PJGA 4S3MA 1YBMA 3OBBA 1JLLA 4A2CA 3PHLA 1KVUA 2AW5A 1U7TA 4PRLA 1DLIA 3MZ0A 3V2HA 3DAPA 3AOGA 1PS8A 3JSAA 3K96A 1TB4A 4AJ4A 1MLDA 2VN8A 3UFXA 1SO8A 5IZCC 1K6XA 2VYVD 3I3OA 3NJ8A 4BQRA 4GSKA 4YR9A 4DVJA 4BKPA 4ALMA 3PP8A 5F1OA 4RGBA 1M6WA 3NV9A 1S6YA 3RC1A 1N7GA 5ITVA 1J4AA 2I67A 1HDGO 1VL6A 3G1UA 2DVMA 1F8FA 2PGLA 3HN2A 1UZMA 3DWFA 4B4UA 3SLGA 3KLPX 4MP6A 2FZWA 1O95A 1DBVO 1W4ZA 2J6IA 4XRRA 5KIAA 2HCTA 3W8DA 2FN7A 4L4XA
chains in the Genus database with same CATH superfamily
3E9RA 3RAJA 4ZJZA 4LDQA 4H6XA 4WN9B 3PIRA 3CRQA 2CZQA 4DLTA 2OLJA 1ZAYA 1NRIA 3WSWA 5JS6A 3L7YA 5G0TA 4EUNA 3H5TA 4A91A 1SEVA 3SQDA 4MQ5A 3MTAA 2N9UA 2OCKA 3LUAA 1GTJ1 1C8VB 1IC6A 1OR8A 1OSNA 1G7CA 2UVDA 3L7KA 4X7PA 1Z5NA 1V6CA 1SR8A 2QGZA 4IIXA 1JLRA 2VSXA 1PG0A 1GAQA 1IZZA 3HY6A 2DQKA 3ZTTA 2OQRA 3GVXA 3K5HA 1OXXK 4KFSA 5JZOA 3PNKA 2HLDA 3ADPA 4FXOA 2QDKA 5BV2P 5AHXA 2MHCA 3FD8A 2I7DA 3H42B 2JJYA 2F9LA 1M1UA 4KXNA 4RMIA 1DVRA 3K9HA 3P2EA 2QQ0A 3PENA 1YB6A 2XWJI 1RWQA 2BGGA 4N49A 2RHHA 1GNRA 4Q9JA 4B85A 1QX3A 3KSAC 3ZBTA 2FQYA 1YTUA 2AXPA 4C05A 5DLQC 2XJ9A 3PC4A 4LG1A 4US2R 2NNWB 3FTQA 4NCIA 3I2GA 5MGNA 3THXB 3PJDA 4W1PA 1RXWA 1V8FA 1Z47A 5CVCA 2I65A 4M37A 1JYEA 1R4NA 1UADA 4NMHA 2G5PA 3DLIA 2OPBA 3L0DA 3FKQA 5DYGA 1P1FA 2B1IA 3QLEA 3D6UA 2YWJA 1P8AA 3EDYA 4OHWA 2PSFA 4RK7A 4RVSA 3LLVA 3TTSA 2IHVA 5I01A 3EBOA 3LY7A 4PNPA 2XMBA 4GX2A 4CF4A 3I61A 4AY2A 3GRYA 3KJIA 5HJEA 1MW8X 1YB1A 3IHTA 1RCFA 4P4UA 4UU0A 4ZDJA 5E95A 1Y4SA 5THKA 2NXEA 3T52A 3ZUPA 1KC1A 2OO3A 3HSYA 1Z2NX 4EGCB 2FRDA 3KOUA 3F7OA 3QE3A 2PUTA 2Q6OA 4U6NA 3EQ8A 3E18A 5TQJA 2ZEJA 3AEUB 3IPRA 3LPCA 4TVBA 3LOQA 1TCBA 3RT1A 3TLZA 1E9FA 3IP5A 4DHEA 1GPWB 3B2QA 2V65A 3GD7A 3A2LA 3RBAA 3S5JA 1J8YF 2J0UA 2ZRIA 2WU4A 4P33A 5FI1B 5CBKA 3HVIA 2NVWA 4TVSA 5BY2A 1L4EA 3HCPA 4G0XA 1CULC 4JWKA 1L5KA 5AOBA 1Q22A 2P3QA 3PXXA 4KAJA 3WRWA 1KHTA 1YAJA 1NQTA 2CCGA 3ZE0B 2E82A 2C8VA 4N3CA 4NKRA 4NYMR 4UATA 2CF5A 2GK3A 3EH2A 5CDGA 3PFCA 3EXHB 4HS9A 4F9FA 3D8UA 4WDRA 2W2KA 4WVFA 1MRSA 1J21A 3LC2O 4QRDA 2DFPA 4K9OA 1G8YA 2A0KA 2CDRA 2OILA 3NGMA 3ZG6A 3NBZC 1EMDA 2JGFA 3SYRA 4ZOLA 1EPUA 1OMOA 1PQWA 2Q50A 3I04A 4L3VA 3WLKX 4JI1B 2FN9A 3CNLA 2DHQA 5JC1A 1CWUA 1IPEA 1SCBA 3PEWA 4QJ3A 4IJ5A 2XXAB 2X6QA 2LWIA 4ODIA 1Q95A 3VTZA 5FBVB 4PY2A 5FLEX 1L4HA 4M36A 4HRXA 2C4TA 5AW9A 1KYZA 5HGXA 5D2CA 3NHAA 4N01A 5H68A 4G1UC 1XWWA 4I50A 4Q4JB 1TPZA 4R9UC 2WNIA 5T7BA 2DPGA 1NLYA 1PR0A 2VXBA 3PX7A 4LSMA 5KINB 4Z1OA 2OUIA 1E1YA 3N8NA 2H0AA 4U3JA 3RRZA 1FSFA 3OU2A 2LW7A 4UQPA 2VHWA 4MV9A 1C8LA 1VLJA 2WJWA 1E98A 1ZJWA 3LUGA 4IXMA 4WJKB 3TGLA 5HQ3B 1P18A 3E3MA 4J7UA 5B58C 3C5WP 4D8WA 3GJTA 3OIVA 1QUFA 5DGHA 3ANXA 2ZRHA 4C78A 2O3TA 3IR5A 4EHBA 3GLFA 2XEXA 3SS8A 5TX7A 2I3BA 5JW6A 5IUKC 3PR1A 4NNOA 3WADA 2GPWA 1RW4A 1JDBB 1WUYA 1E9SA 3WTBA 4RD4A 1F4PA 3MK31 3K1YA 2C4MA 4XVQA 4ZPXA 2V55B 4YV1A 3MHPA 1SQ6A 1D5CA 1CXZA 1DZIA 3VSBA 1G8HA 4MUHA 2H2DA 1Z82A 4KO4S 3AFHA 4MEJA 3KKLA 1A5TA 4LJSA 3SXUA 4K1LA 4XYLA 5FFNA 2ODEA 3S1AA 4BNKA 3GZNA 1QE5A 2ECOA 3ZLUA 4I8XA 3DC7A 1KJQA 5BV0A 5JYEA 1KDTA 1RZUA 2J9XB 1HF3A 1UIRA 1JHOA 1U11A 2GN8A 4LVCA 2Q29A 3VO1A 2GASA 1BG6A 1NQXA 1V16B 3OZAA 4UUBA 4LF6B 1RZ3A 1SG6A 1EH5A 3OHSX 4HAVA 2QMZA 4X7BA 5DV9A 2H1HA 4C2BA 3NBYC 4YMTA 1W7AA 2XECA 4K1XA 3ILSA 3L4SO 4HJRA 1R8YA 1R9MA 5LQNA 4B3RB 4R1NA 1C0PA 1S2DA 2DULA 3MYRA 2HDOA 4HYYA 1SIWA 1ISMA 4GOLD 4IDPA 5T4FA 3UA4A 5EI5A 5DEOA 5FCDA 3LLSA 5C35A 1IOZA 3GRZA 4UFNA 3CLKA 3JRNA 4FOTA 5JCJD 1L1FA 3NBAA 4RVNA 3Q3JB 1Y5NA 4U6SA 3VR1A 3ZDYB 3AERA 4TLMB 5KSWB 1GQFA 1O3YA 1SJ9A 1JHPA 5C1DA 3A9UA 4L74A 1T91A 4KGVA 2B78A 4KR9A 1G2PA 2WINI 2VHEA 3ZZ0A 5HKKA 3B6KA 1FQWA 2Z8YM 4OHRA 1FDSA 3V1YA 5CDFA 3W2GA 4OBEA 1NF3A 3KZVA 2XAUA 1NSTA 4LSGA 1TTHA 1I80A 5H70A 2VQ3A 4HY3A 3KSUA 5B3AA 2EEPA 4FFSA 4PICA 1I7NA 2PS1A 1S89A 4TPKA 1BW9A 3LDUA 4CTOA 9LDBA 1IUNA 1BQ3A 5KEIA 5ELXA 1Y8AA 2IPLA 1ADGA 2HWKA 2CMKA 4FC7A 2FW1A 3SBOA 4CT4B 1KEKA 5IVHA 2MDTA 5KU1A 1UMBA 3O1LA 1J0CA 5AYVA 5LQJA 5IN4A 4KN8A 1K92A 1PV2A 3F9RA 4LTNA 5KVQA 2BGWA 1OVGA 1E4EA 1FFSA 6YASA 2PUFA 4DCNA 2BLNA 2Q9AA 4HWTA 4XASA 3H7AA 3ISJA 4OA5A 2CHGA 4D56A 4F3RA 2IEYA 4F5WA 2R6GA 1ZNQO 1DC4A 2O8CA 5AIAA 4D81A 1C1XB 3P1JA 4OH7A 4ZVNA 3B9RA 4MWTA 1XVAA 2QUZA 1VKHA 4P6VF 3MOGA 5T67A 3SX2A 3RRBA 3WK9A 2OBMA 3IB3A 4X1KA 4O59O 2GPYA 1JV2B 5BV7A 1YQDA 2VK8A 4R83A 1AK2A 3MJSA 4N9QA 2DFLA 5GONB 4PZUA 4DCGA 5HWSA 2HX1A 5JNVA 4CKWA 3C5CA 1SCDA 1FU7A 1VE6A 4EHIA 1NVFA 2NLOA 3I6QA 4YMHA 4YXWD 3ELDA 4ZKDA 4Z4CA 1DQNA 4KKVA 2Z0MA 4GC5A 5LVAA 1KY4A 1Z6QA 3I04M 2AIRA 3H11A 4K26A 1UOOA 3K30A 4MRRA 3V6LA 3WWDA 1P2UA 1QO7A 2ABWA 3GA5A 1P4AA 1K5PA 4RTSA 1GPDG 3EFBA 5E6RA 2Z6VA 3E9YA 3BG5A 3N2EA 4HDRA 4J4BA 3C7CB 1T3TA 1KYWA 1Y81A 4H60A 2AI3A 5FKJA 2I1WA 3LBFA 3SC2A 4AWBA 5FWYB 2PKRA 2ZYIA 3EGVA 3TRDA 1ZUHA 2BEKA 1WVMA 4XQ0A 1NKVA 3WGJA 3GVPA 3H9BA 5DTJA 2ZU6A 1K27A 4RM3A 3OSUA 3ABQB 3D4BA 3PNLA 4LE0A 4WINA 4LXGA 4NOKA 4AG3A 3DTVB 3MGCA 2QK4A 3KOYA 4F96A 2I91A 3MINA 3HCAA 3HCFA 5ERXA 3ASYA 3CR7A 5DWVA 1WZCA 1QHFA 1TJ4A 3ESCA 4Z1MD 1AHNA 1KEZA 3E8XA 4MIOA 3L0PA 2ECPA 5SYMA 4GYJA 3QLVC 4YQFA 1DJNA 4QPDA 5LB4A 1CVIA 1EP3B 1ZAKA 3WXBA 1EQAA 1PT9A 4AYTA 2WP8J 5K9ZA 5HILA 4KPGA 7REQA 3PA8A 2XODA 5KNBH 3L7CA 2R8ZA 3Q1KA 5CJ2A 1G20A 5MGBA 1YACA 3D8SA 1X2EA 2H5LA 3G9ZA 5KDDA 4N41A 4JLNA 4J8PA 2BFOA 3DCJA 1U0RA 1P1IA 4EUKA 2GPJA 4BWGA 2X6TA 5HFJA 3CYFA 3SE0A 1D4ZA 2GRUA 5AM4A 1I4WA 2C9DA 1WPRA 4QXRA 4R54A 1S4QA 4CEHA 4AJ9A 2O14A 2X8BA 4KC0A 3TIFA 1TVKB 3ANMA 3HA7A 3KOMA 1TCCA 1B42A 2NGRA 2Z9DA 3LZCA 3Q9SA 1B8OA 2G3YA 3LCUA 4YA6A 4A8JC 2JFXA 1FRFS 3KFLA 4ZVMA 3VSDA 2QLLA 1CR1A 1BKDR 1T0BA 2RH8A 5CCBA 1XXHA 4K2HA 3ZU6A 1XMVA 4CMIA 3N2ZB 1R66A 4O8ZA 4RUKA 4XWTA 5F4ZA 4WOBA 5T8KA 2WQ6A 2Z5LA 1H1LA 3H8JA 4OHCA 3QBTA 4AC9A 3J81k 3FUWA 5T5QA 3RG2A 2ZRKA 3BXOA 1JU9A 1X8LA 4M4SA 4KDEA 3E82A 4WXEA 4Z9YA 4Z5XA 3ZGZA 2R7NA 2QUAA 3DXXA 3KAPA 3KXKA 3MBKA 4G36A 4JY7A 2BP7A 2WIKA 2PZEA 1TM4E 4JH0A 3EJ6A 3T38A 1K4YA 3KV3O 1UJMA 1P91A 5TMBA 1OAOC 1A4RA 4FYHA 3ZWAA 1F8GA 2VBIA 1CLUA 4YWHA 5JXHA 1N0UA 3N6RA 1JIUA 2CVHA 3GFPA 1VPLA 4Q9IA 1NYLA 4B35A 4UHBA 1GFIA 4HFRA 1L5LA 2CMGA 1GP2A 4Q4CA 3AP3A 4RV4A 3H13A 2UYGA 3IOCA 3ROFA 5EAIA 2NN3C 5A3QA 4KXVA 2OBFA 5K0EA 4PPYA 4NPHA 2OPHA 2Z56A 3C3EA 1C8KA 3UHPA 3CR8A 5J2TB 3DEIA 4ONEA 2JGJA 1U2ZA 1B0UA 1QK4A 2VQSA 3ACDA 3EAGA 3FNFA 621PA 5ISMA 1JLSA 5FA6A 2VDVE 1CZLA 1EKXA 1RBQA 2WKSA 3Q0TA 4E2FA 4M1EA 421PA 3V8EA 1VLLA 4D9IA 1NRWA 2C83A 1V48A 2P2ZA 4XIFA 5E1MA 3EEBA 1TA0A 2Q5IA 2IH4A 4K9KA 1B15A 1VBNA 1YBVA 2PVSA 3T9DA 4PTZA 3EZ7A 4XDHA 2Q41A 3GY0A 3DE2X 3EZ9A 3LCJA 4X60A 3VDXA 2OG1A 3MW8A 1QVWA 2AH5A 2RJ3A 2WF6A 4ND1A 4OBWA 4YJ3A 2UUBB 2V6FA 2WHRA 3VV3A 3MJCA 3OZXA 3WWOA 3M1LA 4BX0A 1YZLA 3UATA 4KN6A 1KDOA 3C3YA 5BQPA 4DIBA 2OXIA 3ZCTA 4M0UA 2UAGA 4MWBA 3FUXA 1OLOA 4B7ZA 1CRPA 3B1JA 2VAMA 3EF1A 1MB9A 5A5FA 1GSOA 1UKAA 2OO5C 5JAPA 3KOWA 2JNWA 4L3WA 5SY6A 3NP7A 4JMPA 1XCPA 1Q74A 4NTZA 3LYHA 3NRCA 1NVGA 1XVLA 2QMQA 2VYQA 3ME5A 3BD9A 3OE7D 3R0QA 4PZLA 4Q7JB 4BFLA 2JKVA 1I7QB 1IPFA 4YRGA 3T7DA 1HQCA 1JR2A 2C3MA 4XJTA 4NICA 1DDOA 1GKLA 3M2TA 1SXJE 1I51A 4OAQA 1W88A 3MTIA 2OCAA 2FSUA 4HYTA 2YZGA 3DCYA 4ZN6A 4OGKA 1P1HA 1XL1A 2BFEB 2NZVG 2AOUA 4OGFA 2IWHA 4FE3A 4ENUA 2WP0A 4YTEA 5C81A 3L01A 4HNRA 1CJVC 1QPZA 3KJHA 3OEHA 4LWQA 4PNEA 4MR7B 4Z9XA 3INRA 2XUGA 5BSEA 4QG7A 3FYUC 2Q1UA 4Q21A 5G40A 5KKNB 3HYCA 2ANCA 2Z1DA 3Q6MA 4DQXA 4PG8A 4IYJA 1TGVA 2NQTA 3CW2A 4S24A 3ERCA 1NIPA 1N77A 1D2RA 2I03A 3Q9UA 4UASA 2ZULA 1TK2A 4LJKA 3L40A 3TW4A 1T6BY 1JHVA 2Q8NA 4HB0A 2PH7A 2IH2A 1Y80A 1N7HA 2A0UA 2QAIA 4ZO9A 5SICE 4UJ3A 4X20A 3Q87B 3N28A 1L5ZA 3R4CA 4HQ0A 4P0QB 2O8EA 2AOTB 1QE3A 1P5RA 4HOYA 5JEEA 1DLJA 2V96A 4DLPA 2OFWA 4L15A 5D3QA 1PR5A 4EW6A 1C81A 2NWQA 2DWUA 1XRSB 4C7XA 3VU9A 1VGQA 1VL1A 3G2HA 3HHEA 4RLFA 4ZYZA 3V1UA 2VDLB 4YS6A 4YCSA 3OT1A 4CQLB 3M5CA 5I4KA 1K7CA 4RH3A 4RKYA 4GEGA 3HWRA 3VX3A 1YDMA 4MW2A 2XH8A 3MAAC 3WGKA 2G07A 3VAYA 3TOCA 3KQOA 3Q2OA 3HN6A 1JMKC 1L8XA 1NDQA 3UJ8A 3I4CA 4MMYB 3B8EA 3QPBA 4BMCA 1A95A 4D4MA 3FSRA 4D4HA 1G8FA 1UZAA 4AW9A 3BK1A 5H4HA 4ZEMA 3HKBA 2REBA 1JXMA 2OO5A 3S44A 2XQKA 3V8PA 5DWQA 4P82A 4HHEA 1G55A 1K5DA 3QFRA 4WZBB 4QUAA 1X80A 1ZYUA 5FFFA 1QR6A 5MN4A 1NQAO 3WOVA 4W63A 2H2HA 4IWNA 3VH3A 5BRJA 5JASA 5JS7A 2MSKA 3T3GA 1OQAA 4U4AA 4UREA 5DTRA 4LOJA 4Q1BA 4C1NA 1SVUA 1TF7A 3C8UA 1QLHA 5EPUA 2EARA 3TL2A 5K99A 5C8XA 4J1NA 5B6JA 5KNBA 2NZWA 3WLFA 3DM5A 3EY4A 1LBSA 4RTQA 5CG1A 3K7EA 3V48A 3GNSA 5AM3A 2QN7A 4IOKA 1IONA 3WOHA 4LYDA 1TX4B 4WGFA 3EFOB 5HCUA 4EYGA 2CXRA 1UOQA 4R3WA 3C4VA 4LRQA 4RADA 3Q9NA 3W6ZA 5TQVA 2WDZA 1WEKA 1FVFA 4LDAA 1EDDA 4LW8A 4PQRA 1ACMA 3GEDA 2IZOA 4UMVA 1VOTA 3V7WA 5BV1A 3LHSA 3I9OA 1NXXA 5HW0A 5JNLA 1XNGA 4WXHA 3LXRA 5L3VA 2IY8A 5AXAA 3W77A 2K4MA 4D9BA 2W2TA 1NU8A 1FNSA 2A1UB 4PBSA 1UBJS 1IOLA 2CLHB 3HUUA 4JITA 2C7QA 2H7XA 2I6TA 4ZANA 3ONNA 3L4KA 3KFXA 2RJOA 2ZSKA 4KXLA 3VH4A 4TWBA 5JMPA 2NUAA 2KW5A 1XTSA 4X93A 1SXPA 4PZEA 4ZIRB 1U8ZA 2J9FB 2QIPA 3RSLA 2GFHA 2W6CX 2X2FA 5CLQA 1NE7A 2LE0A 1Z2PX 4ERXA 4HGQA 3KQLA 1W4BA 3K9QO 4S04A 2WU8A 3GBPA 3MS4A 2BFFA 5DCYA 3IEVA 2QF7A 3FGPA 1D0IA 3N2GA 2X0EA 2JHCA 4ZAWA 2GD6A 4AZWA 4K6CA 3TM4A 4DANA 4D3SA 4J1TC 3MCTA 1NMYA 4FR5A 5E1DA 3VPSA 2JVJA 1OB2A 5I7HA 5D8DA 2GFIA 4CKEA 4RA6B 1O87A 3FH0A 3NVAA 1IQUA 5KYTA 1Y48E 4JYCA 3TIVA 5E1OA 1KVTA 3CVVA 1J2EA 3CM0A 1UKEA 2XPCA 4YP9A 4UPEA 1GPH1 2HCJB 4ZOCA 1G8KA 3S2SA 4X00A 2IYYA 3PKJA 2QGFA 4G09A 5D1NA 3UCXA 1GNSA 1XYYA 2UUOA 2R8PA 1QIMA 3BCSA 5AVUA 2X1MA 3NBXX 4H7EA 1QIFA 4BNIA 3KQQA 1L5QA 4ZAVA 1Y5RA 4M9RA 1JMVA 1RQXA 2MSCB 2Q9CA 1WG8A 4GKAA 1O9BA 4ZC1A 3IERA 4IMRA 3EXHA 3PDIB 5JSQA 3WX0A 4RMNA 4YCAA 3DEZA 2B0JA 2B7LA 1VIDA 3F6BX 4V24A 4HWKA 2VK2A 1VGVA 2OZPA 5I7WA 1W2WB 4XYEA 1R0XA 1MT0A 1WEHA 2XE4A 2ZJ3A 2P78A 5CJPA 3QPAA 2QZ9A 4NZMA 3SC6A 1CQIA 3W9YA 3KKOA 2OA0A 4CG3A 5A3SA 2DFNA 1RMTA 4OK6A 1QFXA 4OMCA 1KOLA 4BZWA 1RKVA 2B8TA 3OLVA 4QOGA 1DQZA 4L2IB 4L5YA 1TKRA 4AECA 3BD7A 3B38A 5LIPA 1E2FA 3L92A 5ELLA 3UYLA 2JK1A 2F2TA 4J0QA 4XQEA 2Z04A 4OXNA 4WD3A 5IJZA 1DUVG 2BAGA 3K4PA 3QP9A 1JG3A 3RV3A 4QHSA 5IJ0A 2YIVX 2G82A 3VX4A 3BK2A 3AM4A 3LKBA 4DR6B 4P7KA 2VTBA 2NIPA 3SNKA 1JG7A 1NVMB 4GOND 4KRGA 2D62A 2I3GA 5ENVA 4EG3A 2H4ZA 2A58A 4QUBA 3EC7A 3EQ2A 4RGQA 5CA0B 2YY6A 4POAA 1MAWA 1FRQA 2QVXX 4EI7A 4BVBA 2XB8A 2EYQA 2ZITA 4MTLA 3B60A 1ZUD1 1USVA 1TYCA 3DAHA 3KAJA 1MNAA 2IOFA 2X1HA 4YRDA 3ETDA 1EFRD 3FVRA 3IPXA 1CDZA 4W9NA 1AZLA 3AVTA 1EB8A 2RHTA 4XCQA 5FR2A 1TCUA 5G41A 4B8ZA 1OW3B 1XVVA 2WAMA 2WE7A 4B3XA 1FLNA 1GGVA 5J4HA 1IHYA 1LSSA 4EGQA 3NEAA 1V45E 1WCYA 1EK0A 4JP1A 1B23P 4KX5A 3LT2A 3WHKA 2CJPA 2IZ1A 3F4KA 3DDWA 1RM5A 4BUJA 2O1WA 3PA6A 5LNK1 1SUBA 4RZUA 1XDSA 3WE7A 3ZWXA 3BF7A 2XUFA 3HFSA 4LYYA 1NRJB 2CVOA 2OE2A 3FOFC 3T5CA 4E0BA 1E4OA 1IM8A 1E2MA 2EZ9A 4TKUB 5C4IA 1JJFA 5TNXA 2IX3A 2JLXA 3KVOA 3X2FA 2FQQA 4N03A 1A69A 2ZWIA 3EPPA 3NG1A 4JK3A 5FDFA 1AQNA 3HCNA 1RKQA 4ARSA 2WJZB 3DHNA 1VMKA 2QRZA 3OQVA 4LKRA 5FL7A 4Z7OB 2A7XA 2BZSA 2IU6A 3ENKA 3N74A 1SRRA 1YBAA 2X3UA 3N6XA 1P72A 2O2HA 3ER8A 3OP4A 2JH9A 2QZPA 3K9WA 5EY5B 3AEQA 3NV7A 4PAOA 3F78A 3TWOA 5SZHB 3B3FA 3IBFA 1U8FO 3ORRA 3TKAA 2X0DA 6CHYA 4ER7A 3WJAA 1HRKA 4H7JA 3CPJB 3ZV6A 1Y1QA 2AI2A 2X9LA 3MA0A 1VC2A 4TWJA 5CIWA 3S2EA 5INTA 1TA9A 4IYRA 3QJ5A 1WKVA 1WOMA 5F2EA 3OJXA 1CTQA 1MFPA 3MTDA 3D3KA 3WYNA 5CFMA 3U7HB 4G8DA 2OCXA 1CDOA 2Q2OA 2YIDA 3HHPA 4J6FA 2Q4RA 4JB0A 4Q01A 1AZWA 4WOPA 5C1IA 3IXLA 4FMPA 4CFSA 3DZHA 1MX5A 2HZ7A 3HH8A 3I34X 3ONEA 1P3DA 1SC1A 4M60A 4Y98A 2HBZA 3C43A 2G1AA 4MVJP 4C30A 3U3JA 3CVJA 3HR8A 2GF0A 3U4HA 1SM4A 5H1YA 2W2LA 2WQZA 1BMQA 1PRYA 1RVDA 3QVWA 5IDVA 2BZ1A 4QM6A 1T5TA 5L4SA 1M1NB 3G0IA 3ILYA 1P62B 4ASUA 2EJVA 3M6AA 4EJ2A 3DFIA 3N0WA 1QU2A 2H5IA 1KQNA 1LJUA 1VI2A 1N2IA 1L4NA 2ILVA 3AY3A 4IDDA 2P2YA 4W5NA 4JBNA 2J30A 3U9SA 1RRKA 4O63O 5TMDA 3F6EX 1QRDA 3GDOA 3ZGNA 4BATA 4QELA 3ZDDA 4QQKA 3EGDA 4UVGA 3U3KA 4HAZA 3SE7A 5CITA 1O08A 3THXA 2W0SA 3D7RA 4H0CA 4J6EA 3W5HA 1A8HA 1RYZA 2A1TR 4CTMA 5ITZA 4BS9A 1WB9A 1CFZA 1OWLA 3RRFA 3UAGA 5CDUA 4B84A 1N6KA 3RSQA 1VB5A 1G21B 1U8UA 1XF9A 2QZZA 3C15C 1K7YA 1CR0A 2XWSA 4MB6A 5ALWA 1U4NA 1N0IA 1RJGA 3HY3A 4FD3A 4TMXA 1CBUA 4BLTA 2WVGA 5HR5A 1E3JA 4PFJA 3NT5A 4MULA 1PDVA 3C6BA 1F2TA 1WKCA 1TKBA 3D1JA 1NW4A 4IHQA 1YRBA 1Z8FA 3SC2B 5FUYA 5BSVA 1AV6A 2JZNA 1FIUA 1NXSA 4GE3A 1ECJA 1JFFB 5TGDA 3ITDA 1MC1A 4P3KA 4C0LA 2JLWA 2QQFA 1UJCA 2O0LA 4EA8A 5JCOA 3UHOA 2D0IA 1SD5A 4I8DA 1C0IA 4J76A 1Y98A 1U1GA 2Z83A 3WBFA 5KYWB 1TZJA 3B9PA 1HL7A 2FLKA 3B48A 4V3BA 4QFMA 1NSFA 3AKDA 1GG8A 3F9CA 1ZC4A 2CMDA 2FK7A 2OBXA 3CUUA 1RVV1 4FYIA 3CPSA 4Y0AA 5HK8A 2FKAA 3EPJA 1G2QA 2XDAA 1P1CA 4A0HA 2P6PA 1OAAA 1YR1A 4PANA 4PFQA 4UBMA 5ALVA 3BJIC 4IDEA 2DH6A 1BGVA 2EEZA 1CRLA 3ND6A 3QX9A 1LDMA 1Q19A 3IDQA 5IAKA 3T1YB 1AK1A 1KPHA 3K1JA 1LZKA 4I4TB 4R0MA 5IFLA 3HTXA 1TU0A 2W90A 4NFHA 3ZXYA 3ZXIA 2D7DA 2LXNA 4I81A 1F60A 2LDBA 4E5UA 3ESZA 1PIWA 3L0YA 5ALYA 3JVUA 4KE7A 4WERA 3VV2A 5EJFA 2FMTA 1JIIA 3ZDBA 3PIDA 4EWLA 4Z0NA 3CPHA 1YKFA 4XARA 2HRRA 4MVJH 1XD9A 1T9ZA 4DGSA 4JC4A 3H4MA 3REGA 4Q7KA 1P7PA 4MKXA 3H2BA 2Z95A 3WMRA 3GG9A 3NYRA 2BEVA 5ERGB 1Y3IA 2QWXA 1TLFA 2JI8A 2Z4TA 2JBWA 3FBWA 3LBYA 4RORA 4US0R 4DMRA 1YA6A 3SEAA 1CY0A 3I6BA 2AWOA 2QQEA 4QPCA 4E2XA 1NR5A 1PR1A 4AY3A 1N2BA 3RRNA 2G0AA 1CUVA 1MJGA 3PDJA 3C24A 1IK6A 1JAXA 3TSZA 5EJ7A 3VSEA 1I2ZA 3PRKE 3KOOA 4K81B 1MA0A 1WP4A 4DYDA 5I9MA 1MO2A 2VRCA 1NMQA 3R3XA 4UXHA 4WNAA 5JXGA 4YQEA 1EVLA 3DP9A 2JC3A 3I3SR 1O0SA 4ZYLA 3OLZA 3L7IA 4WCVA 1JSZA 1ZN2A 2B4KA 4B3JA 1TYZA 1KH2A 3MG9A 4O08A 4UDOA 4GG1A 1DIBA 2PA0A 4DXAA 4KVFA 1IJEA 1C4OA 1MIOA 3O74A 4LGMA 4R1QA 3GDWA 4MW9A 2DFVA 3WYEA 3RTGA 5FP0A 1F2VA 4WBNB 4ARBA 5EG5A 3PD1A 1LQTA 1SK8A 3HUEA 13PKA 4IM7A 4QRHA 3NIBA 1DKMA 1K75A 5CJJA 4DPMA 3T3OA 1C5KA 2WYOA 1MGPA 1ARZA 4GOJA 4MVJD 1LRLA 2JIPA 1G18A 1IZ7A 2ZIXB 4HMOA 4PLTA 2HEGA 5LQUA 4IMPA 2IEGA 4UTVA 1SOUA 2ISCA 4LC0A 1QOZA 7YASA 2QI9C 4KMMA 2W37A 1L1EA 4L75A 4UE2A 5DTQA 5BWMA 2CMHA 1Z83A 3NHKA 2ZSJA 3FRHA 2W22A 2FPLA 1Z4PX 2H48A 3CH7A 3HADA 3B89A 4IGKA 2FX2A 1SUDA 2P9FA 3L2OB 4IIJA 3V4ZA 1WOYA 2CXOA 4MAFA 3K0BA 2BIFA 3EAQA 3IVXA 2ZS7A 5COAA 2PXAA 5KB3A 4AJJA 1ESNA 1UBUS 4B4KA 2FEPA 4BNMA 1E66A 1EM8A 4EQZA 4QGSA 3MEQA 3D4IA 2D13A 2ZJ6A 1R5BA 1S7GA 5HNKA 2GTIA 3IUMA 2Y6VA 3JQDA 4KACA 2GYVA 5FTMA 4R71A 2FLVA 2VKQA 1H5NA 5KX5B 3O8DA 1R4AA 3P52A 2ZJFA 1DV1A 3RAEC 3H0EA 3TJMA 1OOEA 5REQB 2DPLA 4MPRA 4OL0A 4WQMA 4HT3B 4PXYA 1AN0A 2QY9A 3WXMA 5IDWA 3DS8A 1XTUA 1EEXB 3KTDA 1T6XA 3CC8A 2EZUA 4GOOD 1KAHA 2V8OA 2ECKA 4KFTA 4D7AA 3WWPA 3EXEB 2FFRA 3RDPA 4B3GA 4NECA 4MKHA 2ZS8A 5DB4A 3RT9A 4YH1A 4AJIA 4PTYA 2ZUVA 1WTAA 1CR6A 5FAKA 3A28A 1LRJA 1NW3A 2DX7A 5A4IS 1B3BA 2XCOA 4DBLE 2FJPA 2PUBA 1SBIA 2B21A 4OI4A 1P2SA 2X13A 4JLUA 4RENA 4YCNA 1GVHA 2VCYA 2XDYA 3O2SB 4WOCA 1RXYA 1MAVA 4ZT5A 2DLNA 4MUMA 2XUPA 1P3Y1 1ZQ9A 2NU9B 1M5RA 1K7SN 3GRVA 4MJ7A 2E48A 5DI3B 4BV2A 1E1QD 1SXHA 2Q9BA 3AH8A 1YOBA 2I80A 1LLDA 4DJJA 1G7SA 1V41E 4TTQA 1GGEA 4JP3A 2IIQA 1YR2A 3GH3A 3Q2IA 4NE9A 4WEOA 4XVCA 1MG0A 4X97A 2QV0A 1FFYA 2AZTA 3R41A 4QASA 5K51A 1A98A 3BF8A 1MPTA 1TFRA 1UJBA 4MICA 1HDYA 1N5MA 4HTFB 2Z6QA 1DO0A 2C5GA 4FCCA 1Z35A 2X9GA 4LQCA 8MHTA 2DYKA 4NH0A 1DAPA 1WY7A 5D7NA 2B25A 2XNDA 1DFIA 1E9DA 2BFFB 1QH8A 2LPMA 4PHFA 4UZSA 3UJCA 2D0OB 3THSA 4B76A 2Y6UA 4H3VA 5KOJB 4CPDA 1F7UA 2GDJA 1LPNA 1XTZA 3HZHA 4R8LA 1QRSA 2VSOA 3D2BA 4TLCA 5CXXA 3TKLA 3D8TA 3JQBA 3BILA 4PC7A 2EGGA 1OH6A 1WIWA 4LJ9A 1L7BA 1ZK2A 5GM2A 2I4TA 2O2SA 1LVUA 2XNCA 2BHNA 3GARA 3QYJA 4G5QA 4UHJA 4B73A 3X44A 5BSKA 4M0EA 3F8TA 4MVYA 3E6AA 1O8BA 4P4LA 1RWNA 1G60A 3MMZA 4WE3A 4A6EA 1XXLA 1YZYA 1VDMA 5IT4A 3F5FA 2R7LA 5AJTA 4J0KA 4D6YA 1UKBA 3IAFA 4F3KA 1PFGA 2YW2A 3NS7A 1XJ0A 3L41A 2ZBEA 3B6IA 1HUQA 2WG0A 3K6RA 5KKCA 3L4JA 3WDKA 3U4DA 1J2JA 4LYHA 3DYIA 4WOKA 1NNEA 4UTNA 3UAWA 3UO8B 5AVYA 3OX2A 3LPDA 4UVIA 4GW3A 3L4EA 3P4XA 4O4JB 4UCFA 1U6IA 4IIDA 3HKDB 3ICEA 2I8LA 2FXVA 1WNTA 1BFKA 1YL6A 1P7CA 2GEBA 2O0HA 2WAAA 3GW8A 4N8SA 4O4HA 5CA1F 5IU6A 2FY8A 2JLUA 2CK3D 4O0MA 3KJNA 2ZRDA 3GUUA 4NBTA 2R87A 4IJKA 2VTEA 3MUFA 4LNUA 3ZBPA 2ZRFA 2PKEA 4D9CA 4EVIA 3RADC 4PG7A 3KR2A 2GBFA 5ADHA 2QUHA 1JRLA 3HZRA 4L5AA 1KDYA 1BW9B 4MLPA 3NHZA 2WUVA 1FBTA 2ZVPX 2QW8A 5L40A 2IQIA 1V4BA 4XUDA 2H85A 2JD1A 5I5GA 2D7CA 3TN7A 5CA0F 3HGQA 2XLBA 4M9UA 2WIBA 1BS2A 1J20A 3KJXA 2PV7A 1VG8A 1BWQA 1TVKA 2ZTVA 1Y8CA 2D1FA 4DCOA 4YASA 4RTNA 1EDEA 1UM8A 2GM3A 2ATXA 4DXDA 2C9OA 1RWBA 3JAWB 3KE9A 2ZJ0A 4XEUA 1W1UA 3U7QA 3K35A 3JYNA 2CD7A 4IOMA 5HRCA 1XEFA 3SQOA 1K6IA 1ZJYA 3EZNA 2YIJA 3TEMA 1NJ6A 1T10A 1KMQA 3LXXA 3R6LA 2A9FA 2HLDD 4I0WB 4OKSA 3SY8A 5L3QB 3DHYA 2C5SA 5HGJA 1L9XA 2BBWA 3F97A 3VZRA 4MQLA 1CUYA 1XEWY 4E94A 4F4CA 4QBGB 3PC6A 5JZBA 1L4FA 1SZPA 2DJ5A 3AJDA 3E53A 3GUHA 3PUIA 2H6EA 1H0RA 2Q3EA 2R1TA 1JHDA 1M8GA 1I2BA 1J0BA 1WLSA 3LUJA 4IIEA 4XVHA 3VPDA 3JX9A 1XVUA 4A2PA 4BAZA 1E1MA 4N54A 1M34A 3RUCA 2FPKA 4HI0E 4LGVA 3AL3A 4IR7A 4PG4A 2E4VA 3U3OA 3VUFA 2SKCA 6PFKA 1HEUA 4YGYA 1PR9A 3R6WA 1J1UA 3NX4A 4A8PA 5FWYA 3I37X 4AZ3B 4AIRA 1VM6A 3QKRA 4XPZA 3Q5GA 5IBQA 5TSDA 4DS3A 4TKUA 1ID8A 2ZFUA 4RKWA 1KK1A 5KKAA 4XJVA 4JN6B 5KNDD 3NH9A 5JJBA 2H2WA 4QYWA 4RCZA 2UUAB 3DZGA 2V59A 1VECA 4RELA 1T3SA 1KIAA 2ZPAA 4TWAA 2H9IA 3FZYA 3FYUA 4XX0B 3AKZA 3WYAA 4LY0A 2ENUA 4B47A 5E9JA 1VFPA 2VCHA 7MDHA 4LHEA 3PDIA 2R1VB 5HPYB 3BFJA 5HM6A 5AVSA 1YFKA 1IN8A 3MPUA 4LQLA 4RA9B 2F4NA 4QGAA 4CT5A 3B51X 1PR4A 1I36A 4BJHB 4A6DA 1O5IA 1H4TA 2VYFA 1RLIA 4ZEXA 1S9HA 4Z4QA 1OZGA 3CF6R 1QANA 4JI5B 2R8RA 3PNVA 3MVEA 3A25A 1C80A 2VATA 3D6TB 3OY2A 5EMLA 4H1TA 3RHSA 4HTAA 3ROMA 5E7JA 4AX8A 4BX2A 2Z2ZA 4EVQA 5AVZA 1LKZA 4MCJA 1E3QA 5EZYB 2XQGA 2F1RA 2VJBA 1U63A 1RM3A 5LB2A 3ZZTA 1KP9A 1VE7A 2ORYA 3I12A 3MJEA 3UWMA 2CCJA 3I9FA 2W2MA 4HLUC 3W7VA 5BN3B 4TT3A 1YCHA 4ZAGA 3NTXA 4DC0A 1DEXA 2EX4A 2WY2D 4OQMA 4NOLA 4E7PA 2CLEB 3CZAA 3K9NA 5JO9A 3T9FA 3Q3GE 4L1KA 2FV8A 1QFMA 4WBNA 3PFFA 3WIVA 1KQOA 5ULLA 3T3DA 1AGNA 3KEGA 4JGIA 4MI9A 2BMDA 2Q4TA 3OIGA 4RKQA 2A94A 5AK5A 2XCRB 5T6MA 2ZBPA 1KJ8A 1N1GA 3Q85A 4JR1A 5DBGA 3RNLA 5LP6F 2GAJA 2EDAA 1NT4A 2PRIA 2ZB2A 4AKSA 1NNUA 1QHHA 1ZGHA 1ZIYA 5FT9A 4GQBA 3DB2A 5KAMA 1NVTA 3ET4A 1O0BA 2ID8A 3GVIA 5CTAA 5D51S 1W36C 1OFUX 3RC8A 3C1OA 1A9QA 1KNXA 2FSHA 1DI0A 1JYSA 1UJ6A 3HP4A 2FPSA 3C6KA 1KTVA 5DM70 3QSYA 3TVYA 3MS7A 1HFJA 1OUMA 2IUTA 5KHAA 2QTZA 2BKVA 2GHTA 4LZZA 4KE9A 5JJLA 1TAHA 3HKEB 4HX2A 4Z99A 3ESQA 2MIIA 2W4IA 2OXTA 7ABPA 1II0A 4AQ7A 4TOIA 3W5JA 1FB5A 2PD4A 3JVEA 2R7KA 1L5FA 3IQXA 4E6PA 4RK1A 1XZBA 2EBUA 4HEA6 4HVCA 5BW6B 2Y1OA 3DBRB 1D8TA 3JQ8B 4HDNB 3GJ0A 3N0VA 2EBFX 1TOAA 3O95A 4S2UA 4KQFA 4W82A 3GUCA 5JJIA 1P2TA 5EXSA 3ZCVA 2D7JA 3FF4A 3RF6A 4B2PA 2G63A 1M6HA 4UEKA 1DC8A 4RKEA 3BGIA 4C04A 1ITZA 1JFFA 1U3FA 1WD5A 3HCCA 4JLOA 1YZHA 5GIPE 4OLAA 1N78A 4JENA 4B87A 2HW8A 2GM9A 1EWVA 2P65A 2PSJA 2ST1A 4WI1A 5KJCA 1UANA 1IDOA 3ZE8A 3ZEAA 2XRZA 4DCSA 1PWYE 3OQ6A 1UQUA 3KUDA 1RWMA 5JSUA 2REQB 2HBRA 3IQGX 1N2OA 4A10A 3L1VA 3D7LA 3AETB 3O21A 4D79A 1TIBA 1ADCA 2J48A 1DRJA 1R0BA 4MGKR 2IHBA 3GUYA 2OFFA 3UH0A 4J3FA 4DYHA 5HKBA 2LIPA 2A3NA 2PSEA 3IIMA 2YRXA 3WGTA 3NWOA 1F2DA 5JRDS 4E33A 1L4UA 3AK4A 2QBYB 3ADKA 4QBKA 1D03A 2HQRA 4XGRA 5HXAA 1RTTA 3F2IA 5ALQA 4MVXA 3KYCB 1XO1A 3F3KA 2AD1A 3RPEA 2V6GA 4DXHA 2W6PA 1IIRA 3O8QB 2OP0A 2WD9A 1AS0A 1DDIA 2WUGA 3O9VA 2EC5A 5AHKA 4OX9Y 3NIGB 3NNNA 2J3QA 4KWTA 1GLNA 1IUKA 1XZHA 2VI5A 4UNSA 1C3XA 2OXFA 4AZVA 2OK7A 1VGRA 2B82A 1T5HX 1TD1A 4QUKA 1XMJA 4EMTA 3BSWA 1EDOA 3QY0A 4RPKA 3UUWA 2ZVQX 3HM2A 2AZXA 3DTNA 4HDMB 3RVRA 2P90A 1JA1A 4R8RA 4WLUA 3X1WA 4Q47A 5AKJA 4BO7A 4PR0A 2CVPA 1QTIA 2WAXA 1Z17A 3KZ1E 1CQZA 3DD1A 3DDUA 3G2QA 3PT9A 2OQVA 1F51E 1MJGM 2EP8A 2GPBA 2JCVA 5J23A 4UBJA 4WNAB 5CH3A