3AWFA

Crystal structure of pten-like domain of ci-vsp (236-576)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
315
structure length
304
Chain Sequence
KDGFDLDLTYVTDHVIAMSFPSSNPIGEVSRFFKTKHPDKFRIYNLCSERGYDETKFDNHVYRVMIDDHNVPTLVDLLKFIDDAKVWMTSDPDHVIAIHCKGGKGRTGTLVSSWLLEDGKFDTAKEALEYFGSRRTGDVFQGVETASQIRYVGYFEKIKKNYGGQLPPMKKLKVTGVTITAIQGVGRGNGSDLSMQIVSERQEVLLCKFAEGYNCALQYDATDDCVTCEVKNCPVLAGDIKVRFMSTSKSLPRGYDNCPFYFWFNTSLVEGDHVTLKREEIDNPHKKKTWKIYRDNFTVKLTFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the cytoplasmic phosphatase and tensin homolog (PTEN)-like region of Ciona intestinalis voltage-sensing phosphatase provides insight into substrate specificity and redox regulation of the phosphoinositide phosphatase activity
pubmed doi rcsb
source organism Ciona intestinalis
molecule tags Hydrolase, membrane protein
molecule keywords Voltage-sensor containing phosphatase
total genus 103
structure length 304
sequence length 315
chains with identical sequence B, C
ec nomenclature ec 3.1.3.-:
pdb deposition date 2011-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00782 DSPc Dual specificity phosphatase, catalytic domain
A PF10409 PTEN_C2 C2 domain of PTEN tumour-suppressor protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3awfA02
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3awfA01
3V0DA 1ECVA 5KA1A 3SMEA 3V0HA 5I6VA 2F6ZA 3M4UA 1OEOX 4TVVA 1J4XA 1NNYA 4GE2A 5J8RA 4J51A 2I3UA 1YWFA 2H4GA 4RKKA 3D1HA 2OZ5A 2B4OA 1C85A 3D1OA 1QXKA 2HC1A 2H4KA 1FQ1A 3I80A 1BZHA 1OEVA 3RO1A 5KABA 5M43A 3QCIA 2BV5A 1GWZA 1Q6SA 1OESA 2CMCA 3MOZA 4OHLA 2VEWA 1NWLA 3U96A 3I7ZA 2QCJA 5HDEA 2OC3A 1I57A 3O3LA 4NWFA 1ZC0A 1U26A 4KYQA 1C87A 1Q6JA 2I5XA 2VEXA 2I6PA 2I6MA 4R0SA 2I6IA 5BZZA 2OUDA 5K23A 1L8KA 3OMHA 1GFYA 5KA4A 4PYHA 2NT2A 2B3OA 5K24A 3OLRA 3D42A 2CM8A 3EU0A 1YTWA 2F71A 5KA8A 3AWGA 4BJOA 4QBWA 3QCMA 3ZM2A 1M3GA 2CM2A 1FPZA 2HVLA 2R0BA 3B7OA 2E0TA 3QKQA 1A5YA 4JMJA 2I3RA 4OHEA 3SR9A 2Y2FA 3QCFA 2IMGA 2J72A 1KAVA 2HY3A 4QUNA 3QCLA 2I6OA 1KAKA 5K25A 3O4SA 2G59A 2RF6A 4YR8B 5BUGA 2CMBA 2I4HA 1RXDA 1G1HA 5KA0A 3QCGA 1ONZA 2ESBA 4WU3A 5EHRA 5KA3A 3F99A 4D3QA 3BM8A 3QCBA 2FJMA 4MBBA 4HRFA 2QBRA 1WRMA 3D9CA 1ZCKA 2HNQA 2F6FA 1YGRA 3EMUA 1OHEA 1FPRA 2H03A 1PXHA 1NO6A 2FJNA 1G1GA 3V0FA 2FHCA 4R30A 5K9WA 1NZ7A 3S3HA 4BPCA 1BZCA 5KAAA 5K22A 4NNDA 2F6TA 2VEYA 3EAXA 3EB1A 4D3PA 2B4UA 3S4OA 4GE6A 2Q05A 4I8NA 5LXQB 3A5JA 1G1FA 1G7GA 3ZV2A 2CM3A 2QDCA 3NMEA 1PTVA 2B4SA 4WOHA 5IBMA 4IKCA 4B04A 1T4JA 4RHGA 2QDMA 3F81A 1G7FA 1YZ4A 3A5KA 2M3VA 3PS5A 3S3KA 2QBQA 4ZRTA 2QBSA 1EENA 1U24A 2CMAA 2J44A 2P6XA 4GFVA 4QAPA 1NL9A 3BLTA 4NYHA 4QUMA 2B4PA 1C88A 4DGXA 1I9TA 4WU2A 2HXPA 2BGDA 4YAAA 2I4EA 2I75A 3LJ8A 4PVGA 2J71A 3S3FA 1L8GA 3QCKA 2NLKA 3QCHA 1ZZWA 3RGQA 2HNPA 5IBSA 1SUGA 2PBNA 2B07A 2F70A 1NWEA 3H2XA 2G6ZA 2CFVA 1OHCA 4HJPA 4OHIA 4GS0A 2I1YA 4S0GA 1YN9A 4NX8A 2A8BA 5GTJA 2A3KA 4OHHA 3RGOA 4ERCA 2F46A 1Q6NA 2SHPA 1ONYA 2C46A 2CNGA 3I36A 4JNBA 2F6WA 2F6YA 2FHBA 5KA2A 4RI4A 1XM2A 5KA9A 5KADA 2GWOA 3GXGA 4D3RA 4KYRA 1MKPA 1JLNA 2FH7A 3GXHA 1G4US 1U25A 1PA9A 4QAHA 4JMKA 3QKPA 5KACA 1XXPA 4ZN5A 1Q6MA 1Q1MA 2B49A 3CWEA 1LARA 3ZM1A 1WAXA 2PT0A 3QCNA 3BRHA 4GFUA 4Y2EA 5AWXA 4GE5A 1X24A 2HCMA 3QCDA 3CM3A 3AWFA 1Q6PA 1C86A 1XRIA 3RZ2A 1D5RA 4GRZA 3V0JA 2AZRA 3QCEA 4RI5A 2J17A 3V0IA 5EHPA 3BLUA 2CNHA 2GP0A 4GRYA 1OETA 2PQ5A 2BZLA 2PSZA 3F9BA 1YGUA 1Q6TA 2YA1A 1R6HA 4RH5A 2P4DA 3V0EA 1YPTA 4GWFA 1JF7A 4Z6BA 2C7SA 2WGPA 3F41A 4HJQA 3O4TA 2CJZA 2OOQA 2NZ6A 1VHRA 2H04A 2QEPA 1QZ0A 1BZJA 2F6VA 4RDDA 3QCJA 2J16B 2NT7A 1PTYA 2J43A 4OHDA 3ZMPA 2PA5A 3F9AA 3N0AA 2I6JA 1OEMX 1PH0A 1T48A 2Y96A 3ZM0A 1P15A 1LYVA 2CNIA 2Q47A 2AHSA 2MBCA 2PI7A 1AAXA 5MMZB 3ZMQA 1XXVA 1YTSA 2DXPA 2FHFA 1ZCLA 4H34A 2HB1A 4JBCA 1PYNA 4Y14A 1YFOA 4ZI4A 1XBOA 2CM7A 2CNFA 1PTTA 1RPMA 4ICZA 2ZMMA 1YTNA 3D1QA 2H02A 1C84A 1PTUA 4AZ1A 4WTYA 2NTAA 2VEUA 2QCTA 1G4WR 2HC2A 2YDUA 1LQFA 1OEUA 3O4UA 2J16A 1EEOA 3D44A 5BZXA 4QBEA 3S3EA 2BGEA 4NWGA 1V3AA 2GJTA 3AWEA 5KA7A 1WCHA 2ZN7A 3ZM3A 3S4EA 2I4GA 4KI9A 2BIJA 2H4VA 3QCCA 4R0TA 1C83A 3MOWA 2CNEA 2J73A 2QBPA 3EZZA 1T49A 3MMJA 5BX1A 2NV5A 2QDPA 2I42A 1I9SA 4RH9A 4DGPA 4H1OA 2VEVA 3O5XA 5K9VA 1OHDA 2JJDA 1PA1A 3V0GA 2YOCA
chains in the Genus database with same CATH superfamily
2GB2A 3HZ3A 2DB8A 1NCOA 2X4PA 3WY1A 3VI3F 5T1KA 5FO8B 5A2LH 3BD4A 4HEPG 3T0DA 2ZAHA 4QD2E 4MJIA 2FK9A 4IRZH 1NNYA 5I1KH 2F53E 2FECI 3QIUD 2E59A 5GGSB 3TCLB 4C47A 1RI8A 3HHSB 4RMWA 5DRXB 4F1SA 3D18A 3U4KA 4PJDE 1LP9B 2AAVA 5I66B 2OZ5A 2QHRL 5I1IH 5D9SA 3OKMB 3C8KB 3DO4A 3UTSB 5FHAL 2HC1A 3QPXL 5DS8A 2J88H 3C5ZA 3BPOB 1QW9A 4L8SB 2GJZA 3NDZE 4GAGH 2BFGA 1P4BL 2RCSL 2QMKA 1MI5E 3DSNA 1LO4H 4UQ2B 3VWJC 4E42A 3ZO9A 5JIHA 3AADB 1G1CA 4HAGA 1NC2B 4L0PB 4YE0A 4O51A 3K6FA 2VN3A 4ALAL 3VCLB 3BCFA 3GTVA 2OCCB 1KB9J 3HBQA 1G4RA 3RTQD 2WKOF 2DAVA 1KLFB 1OGAB 4LKXB 1SYSA 5CZVH 2P42B 4NDMA 1IRAY 4QXGH 3IRZA 5LWYH 2FD6L 1SHMA 2ZZUT 1DQLL 2GT9B 1HC1A 2R27A 3FPYA 4X2UA 2UUPA 5ALBL 4C57C 3UZEA 4G8IA 2QKIA 1INDL 3MA9H 2JKSA 5HHNA 1DUYB 1U8HB 4R0SA 1IC1A 3CC5A 1ZVSA 3Q9PA 4ETYA 4PM1A 4Z0BL 1IZJA 3S3DB 1CE6A 1OIOA 2OKMA 4OD3L 1OP3K 4KZEH 2OP4L 1XF1A 2CUMA 5L9DL 2JK5A 1JNLL 3ROLB 3T3MF 4D9LH 3QUZB 3FQXB 2EQDA 2Q9OA 3OHXC 4OV5B 1A6AB 4B3VA 1X9UA 3SPVA 3CFTA 3ULVC 3L3OA 4JM2A 3MCKA 2R1WA 2MNJB 3Q48A 1H3PL 3N2AA 1ND0A 4M5ZL 1QLRA 5IHHA 1TENA 2GEQA 5KA8A 4MMXA 1FAIH 1YEKH 1N0XH 1OD9A 3LX9A 2KLTA 4JR9L 2ZOUA 4N2KA 3GI8L 4GNKB 4M7LL 4NENA 4ZFGL 3MRMB 4G8GA 3R19A 5J1SC 4MXQC 2QADC 3SDYH 2XVKA 3GS7A 4PJGB 2OFQA 3ARSA 1KWGA 1CZ8L 3K8MA 1LVEA 4FQJH 5E51A 3SDAA 3ZUNC 2Y5TB 4N68A 1AXTH 2H47C 1NGYA 5D6CB 5IIEB 1ONQA 5DYOB 1FFPB 4R84A 2ZXBA 3Q05A 3T4YA 2GCBA 3T2LA 4TVPD 4LRNL 2NDFA 1KEGL 5C6TH 2APSA 5CINH 3STZB 1AKJA 4BSJA 4D2NA 3E8VA 2FT7A 2V7NB 3PY9A 1BX2A 5L2KB 4U6HA 5LDUA 1MUJB 3GHPA 1F11B 4GKOA 5KA0A 3TF4A 2H1PH 3KXFE 4Z3EA 4K3GA 4PJAF 4U1IB 3MBED 4PJ7E 4N87A 1F8TH 2XZQL 4OJFH 5CLWA 4YZWA 3DX9B 4MDJA 4AMXA 1Y6MR 3KHQA 3MBEA 2Z6FA 4TMPA 4ZW5A 4JPWH 5AVSB 3IDNA 3RZCD 3ZUCA 1JD9A 2HKAA 3GO1H 4QPEA 3P69A 1R3KB 4N4YB 1XL6A 5MENA 3VXPB 4XP5L 2CAKA 1ID2A 5DRZB 5F6IC 3UAEA 1LO2L 4OR1A 1G94A 2F00A 1S3RA 4KV5E 3U2JA 1OE1A 2Y7NA 5DJXB 1FPRA 4FFZH 4HIHB 1SUJA 1S5HB 3LKNA 2OX5A 3MRPA 4M6OL 3ZQXA 1N2RB 5CJOH 4PB0L 1QTYT 1R5IB 4KJYB 2E7LA 2GI0A 1PIFA 4JUTA 5FCUH 3U30B 4XODA 3EJTA 1ECYA 4AC2A 1WO2A 3EFOB 4P9HL 2Z8RA 4XMKH 1LP9E 2CK0L 3AS3A 3ETSA 3FRUB 4HT1L 1VFBA 1A25A 2P9RA 4FQLL 4O02H 3TNNB 3QPQC 5K9QG 1OAQL 1FIGH 3PWLB 4ODUB 4D9RE 3L4XA 4FNLL 2V2WB 1G1FA 4P3CH 4AQ1C 1UXWA 1CU4H 1D6VL 1XGYL 3O3EB 2B4SA 3LN5A 4MASA 2BHFA 1H5BC 4IBLT 4IKCA 4HG4K 4GRMB 1MFEH 4RX4D 1MFUA 2CLZB 4JHAH 2VIRB 1OQOA 5CILH 4ZFQA 2Y07H 5EA0L 4MAYA 4Z3IA 4AGPA 4J4PA 3OKEB 3EOBB 1ZLWH 3SGJC 3VM7A 4UDUA 1KCSL 3EYVA 3JYCA 4N6RB 1KEGH 2VLKA 3SBPA 5E08L 4WFFD 5F97E 4M1CC 3GBML 1NL9A 3QPKA 1M42A 4IRSD 3I74A 5EZJA 4ZUWA 1UEYA 4Y4KD 1U3HD 5IGXH 2R23A 2SODB 4PJHF 3JSSA 4Y5VC 2R2EB 2HG0A 1HILA 4F7PA 1M53A 2VDOH 3GMRA 4WHTB 5E6SB 2VMJA 4NKOA 1HKFA 1E42A 1YN6A 2ZF8A 1Y6NR 2F58L 3BP6B 2FQEA 5I6XB 5D7JA 4WUUA 4FXTA 3TZVB 2HLEB 3N06B 4X7CC 2J21A 3I9GH 3IWVA 4M1GL 4OLYL 1H6FA 2NNAB 1F58L 5T3XD 4F1ZA 1L7IL 3VE0B 4N22A 3N6YA 4QRQA 1AGFA 4BA8A 4I48A 4MS8D 2Y06H 1WA1X 4X6DE 5F1OB 4NM8H 3OXRA 2NLJB 3EJYC 1EZVY 5D1XC 2ZAGA 4KDTA 3MA7B 1OHCA 2VDPL 4OLUL 3JWDC 5FKPB 2OSLA 2G3NA 2XYCA 1TQCB 2ZOWA 4FJZA 4ZFFB 4CN6A 3ZM6A 3U4EB 4OLXL 1B0GA 5DXWA 2JSFA 4DTGL 3EG9A 1EHKB 3F5WA 4F27A 2K1MA 4Z7QB 1EFXD 1U8NA 5ISZE 1AANA 3QC5X 3HI5L 1ERNA 4U3XA 5HXMA 3IDXL 5IJKA 4C54A 3I36A 1TVHA 2AEPH 4DW2H 5EBLB 2OYKA 2XUWA 4CVUA 4Q8BA 4OCWH 3N9GH 5BCAA 1CFSA 1XGRB 4ZMZA 1XH0A 3PIQB 4R4FH 3FUHA 3SDCA 4TRPH 1FFNB 1KBBA 2IWGA 5L6YH 2VDKB 3ESNA 4LGPB 3KMDA 2B16A 4XE5B 2OJ1A 3TEUA 1ZT1B 3FCUB 4WY7H 1N7MH 2FLRT 3F83A 5J12C 2XTSA 2FO4B 3CK0L 4XMUA 3FN0L 5IVNA 1DANU 4S1DC 5FR3A 5LUMA 5LXGH 2VN6A 4MJ2A 3BYYA 1MCFA 1Q0XH 1KIQA 1DDHB 5MEQB 2FBJL 1NDMB 2FBRA 3THMH 2ZWYA 3RVWC 4M4RB 3MCLH 3TJEH 4BH7B 1X24A 5A16A 1LD9B 3CFEB 1E5ZA 1SJHA 4JZOA 5D7JD 3HZYA 4ES9A 2PW1A 2WYZA 5CBAB 2P49B 1BLNA 1U33A 2BNQB 1G9MH 2HFGL 3FO2B 3P73A 2WMPB 4W68A 1IBFA 2JI3A 3OWEA 4OLVL 6PCYA 1HL5A 1D5RA 1C5BL 1S7XB 5L4IA 3IFPB 3KPRD 5IMLA 2ZYSA 2N0MA 3B6SA 4JGUA 4OCSH 5C08B 4RGNE 1HNGA 4GRYA 4M7ZB 4FQCL 4KQ0A 2CDEA 3P4NB 2O1AA 2UXGA 1AHKA 2F8XC 2EDNA 5C3LD 4UTBA 3KDMA 2HMID 1BW8A 3DV4B 3V0WL 1QVOA 5JW4R 1T20A 1A7PH 2VR7A 3QZWG 1HEHC 1FL5B 3VFSB 3IDYC 4L1TA 5CGTA 2HH0H 5C09D 3PHAA 4HW6A 2L3BA 1LXMA 2WGPA 4JJHA 3KYKL 1HXYB 5FUCE 3FTZA 2N0KA 3GFUA 4N2CA 4HPHA 3HFMH 4WW1B 4WHDA 3MRGB 4IKIA 4Y9BA 4HPYH 4WU7A 4RIRA 4EOWH 2EYSB 3TIEB 2WYHA 1AAJA 1AGDB 2WAQA 1A6UL 3SYOA 3SPHA 2OTWA 2O72A 2A4EA 4U1MA 2YPVH 3WENA 3WKYA 4NUGH 3WS6A 1SOQA 4MSWB 4A2DA 1V05A 3FOLA 3SBQA 1EQWA 1XF5B 2BVOB 4PV8B 2CNIA 1DEEB 3DX8A 3I6LD 1TOXA 1WICA 1G0DA 1UT2A 1KJ2A 4HYTB 1OHQA 4PY7A 3X13B 5KYNA 1JRHH 1B2YA 1SXAA 3LD8C 4ZMYA 2WTZA 1N70A 3BDXA 5EOTB 1ZY9A 3E8UL 1VGKA 4ZXBA 2XN0A 1MVYA 3L9BA 3V8OA 3BKJH 4IHOA 3EYSL 2X6BA 4UIMB 1Z0NA 4UT6A 3D85A 3UC0H 4ELMA 1SOSA 4ZOBA 1WZKA 2CO4A 1CD1B 2GI7A 2P5WD 5HGDA 3WOVA 3AQZA 4KKCD 4ZMQA 1BQ5A 3I02B 1DQDL 4OLEA 2ATKA 3BMWA 5GS1C 2WLHA 2IBGA 2G2PA 5I15H 3I2CL 3U7YL 1ROCA 3ZKND 1NCHA 4MA3B 4XVUC 4I89A 4KQ4H 2LVEA 2UY7A 5LLIC 5DHDA 4TYUA 1WWCA 2FB4H 1SM3L 3ZR5A 3NK3A 4QGYA 1REIA 1BVNP 4P3WA 4P0DA 1CVSC 1DJSA 1R3JB 3LN9A 5E8PB 4YNYB 4WFEE 4O4YH 2GIXA 3IYLW 1QBBA 3O6FD 3O9WD 4WWNA 3TCLA 4AQ8C 5AOZA 3L2MA 1QNIA 2GJTA 3DPBA 3MXVH 2W59A 2RMNA 3OC8A 4O2FA 4XOCA 2PXYA 1N5AB 5HHVH 5E9DB 5GISL 4L1DA 1EXUB 5DRNB 1QHQA 5KBKA 4BWTA 4NWUL 3L5JA 3CZKA 1FNGA 3L3JB 4N2MA 4FHBD 2ZX6A 2C3WA 5DZAA 4L8SA 4DPCX 2NSQA 4BH8A 1KB5H 2AQRA 4QYAA 2DQGL 4OD1L 2F1BA 4WWID 4AUJA 4IOSA 4CMHC 5DEFB 3VTTA 2NV5A 2WNGA 3SIKA 3CE1A 4FG2A 4UQIM 5D7SH 1NMBL 2O5YL 3NJFA 4Z7WB 2H3XC 4FE9A 2F53A 5E1QA 1OTTC 1UT9A 4X4XB 3H7BB 3I6KA 4LKXA 1KLFA 3AT8A 4W1TA 3S48A 4OZFG 3ILEA 4HZ1A 2IC2A 1TLMA 4ZMWA 1TTRA 3EO0A 2AEPL 4N0UA 4CRPA 2GSGB 4ABVA 3KW8A 5DJAB 1KF9B 2NXYB 3E1F1 2YOCA 3IBEA 1FRGH 2HTLD 4KKAC 4N2HA 5KS9B 1C5DB 4LMQE 3B7TA 2OYPA 1XB8A 3GBNH 2X3AA 4LGRB 1NGQL 5TDNB 1UKTA 2ICWJ 1JCKA 4GUOA 2P8MA 4GUCA 1I1CA 2YD8A 2F7IA 1PG7L 3MREA 2ISDA 1AGBA 1SGKA 1GYUA 1Q8MA 4AL8L 3ARUA 1SVCP 4TN9A 1TTUA 4TQEL 4UINH 1A14H 4C55A 4XN8A 3BKJL 4JKMA 1MCQA 4N90E 3QFJA 2ZOLB 1E67A 1F58H 2VDLH 3M6DA 2QGCA 1JRHL 1Q9OB 3NVQA 2AJZA 1ODAA 3UTTE 2BV5A 4CN4A 4PWFA 2KBGA 3D39D 3HZKA 1VESA 1KCWA 3WIAA 5FS5A 4MQXD 1RULH 1OESA 5BS0E 5AAMC 1JMZA 4DZBB 5IIEA 4A68A 2VEWA 1E9OB 2X12A 3ARGD 1IBHA 4EE2A 1FFPA 2Q7YA 2Q10A 2C8NA 3X1EA 4GRLA 3EH3B 2WWNA 5KN5B 4U6VH 3KPOA 3REWB 5C0ND 3FTWA 3LAFA 3KJ6H 3T77A 4KYQA 2VJ8A 1ZA3B 3NFNB 3QWQB 3X1FA 4YX2L 5C0BE 3IXTB 2BCKA 5TFSL 4KO9A 3CZGA 2JELH 4U6HB 1EFXB 4NM4H 2JJSA 4YK4B 5LBSA 3BUPA 4N5EC 5F7HA 3KM2A 1SF3A 3PHOA 3PWPB 4LHUD 2IFFL 5C08E 1KGYE 1DFXA 3JZYA 4S1RL 4X5WB 1XBRA 3ZTEA 2ZOKB 3KPLA 4UZUA 1XHHA 3LIUA 3K6NA 5CMAB 1CDCA 3ULVL 3BKMH 4J28A 1M2OA 2VXUH 3NPSB 4XOBA 4KHTH 1EZVX 5T1LB 2BHYA 3QHTC 3MRNB 2CM8A 1JGUL 4FMVA 3RWCB 3TCTA 4BFJA 4GXUM 1UOWA 3R4RA 2W0FB 1F4HA 2WWOA 5JHLH 3VYNA 1JPGB 3HN3A 1OSPL 3W1ZA 1OP3H 5GGVH 3ZDXB 4I85A 5I1AA 2AKRB 2J57A 4XPBH 3UZVB 4G9DB 4HWBL 3BXNA 4UTAL 1S9VB 2ADGA 5DRZA 1DUZB 5DJ6A 5HDLA 2WXPA 4JVUA 4OCLC 1W2KT 2V5TA 1UASA 4HK3N 1INEH 3C60A 5D7IA 4CU7A 3ZIYA 1RJZA 1VA9A 3AB0B 1KTDA 3O2VL 3EOAB 2GC6A 4TL4A 1BMGA 1M3JA 3QUZC 3EO9L 1OW0C 1ZTMA 5BRQA 3B83A 3EFOA 2IPTH 4YFDB 4L8CA 2F1EA 3UBXG 4CVXB 4Y4HB 5EU6E 1LK3L 5IW3A 1YEGH 4HXAH 4XP6L 4HIXL 4G6AC 1KAVA 1CFNA 2J5WA 3KGSA 4J3XA 4FG6D 2J4WH 3BQUC 4P5RA 4WCYL 1FYTD 2OSYA 2AQNA 3TNMB 1IC7L 4TLTA 1EDQA 4TSBH 3HMXA 4NSKA 2JKIS 1A7OH 4HX1A 3CN1A 2NQ3A 4OGYL 4S2SA 4F5CE 2Y2YA 1UXWB 5TPWL 4H1LA 4OCMC 4TSBL 3OR6B 3L95A 2XNAB 2X2YA 4HEMA 4WK2B 1T0NA 1MHHA 4TRPL 5CWSA 1UWXK 3EXLA 1MAJA 2NY1D 4ANVA 2DEXX 2OZ4L 3LS5L 4QOKE 1BQKA 1JV5A 1ZWIA 1INEL 3LPFA 3RI5F 2N59A 1YGRA 1E4JA 4IU2A 1HZKA 1OOWA 4HS3A 1IGIL 4LRIC 3O2VH 1MHPL 2HKFH 3VVVA 4JO2H 1WD9A 3SCMC 1X5AA 1NCJA 4G43A 5CP3H 3GLAA 4ZUWB 4R30A 4RMQA 4FQQB 1NGZB 4OGAC 2R9HD 4V2BA 2FECL 2JVUA 3CDZA 2EDOA 2E7BA 4OZ4A 3VFNB 1AXSA 1UA3A 1BQLL 2XKUA 2PLTA 4A67A 1ZHNA 3UZEC 5EOCH 4V1DB 4OUUB 2CMRH 5GS0L 3EAXA 4LOUD 1EJFA 2NNAA 3RB7A 3VYOA 3WIFB 1B0RB 3CVHL 1RMFL 4I48B 4NLHA 5LXQB 2WD0A 4JREB 1P0SE 4XCYB 2B7DT 3PU7A 3IPFA 2VTFA 4N6QA 3CLFL 3ECWA 4NLAA 5J3HD 2R29H 1ZT4A 3WS3B 3HB3B 3I6SA 1U3HB 4JKNA 4GO9A 3GRWA 3UCRA 3FHAA 1LWRA 1L6XA 3FS9A 5FKPA 1HIMH 3RWIA 4WNJA 1FV1A 3AC0A 3S96B 2EEXA 1PSKH 1RZJH 2CRYA 5HDBE 5B38G 5FGCB 3LEVL 5LBVA 4OJAA 5MENE 4GBXB 1NPJA 3AGWA 4JG1H 5DQDL 2NXZC 4X5QA 1MJUL 5E95B 5EBLA 2YKKA 5IMMA 3CX2A 2W1NA 3H9ZA 1U3YA 3KBPA 1NCBL 1NBQA 2QQKH 2WO2B 2VZ3A 4FQPA 4PS4L 2DJMA 2WPGA 2P5WB 4PW3A 3T5WA 4QUMA 2HRGA 1AR1B 2XN1A 3RGVD 3SDDD 1BAFL 2QSTA 2XWTB 3HB3C 1MVUB 1GGUA 5C0AD 3RP1A 4C58B 5EU4A 4X8XA 2MCG1 1CN4A 2Y36L 4Q97A 3P3RA 2L7EA 1AIZA 2XWRA 3QCKA 3PHQB 4OZIE 3NZ8B 1LILA 3TN0C 5T3XE 4J1UA 3UJJH 4OZFH 1KIQB 4LCCC 5MEQA 3Q8BA 4MHHG 5HYFA 4OY9A 1QBML 2ZKWA 3CBRA 4GPVA 3UX9B 4BEIA 4PLNC 2WWMD 4XMKL 4BH7A 3LVEA 4BKTC 3FK3A 3TYFA 4XP4H 1AZNA 4K8RD 5E8EA 4P3CL 4OGQC 2FJFB 1T1ZA 1U8CA 5J1AB 3RWEB 1ZD6A 2E7LC 1T0PB 3K72A 4FNTA 5IHUL 4WW2C 5KVEE 1B2WL 2I07B 5DURD 2R69L 1HHGB 5I2IB 5HJBA 2QVIA 1UUNA 3RZCB 5DQ9A 2FGWH 3ZZSA 4JCLA 4BINA 3NACL 4BRVA 3LOWA 3CUPA 1P6WA 2JQMA 3IB4A 4WTQA 4CSZA 3VRJA 1XCXA 4DP8X 1QVOB 3US9A 5GISH 1RHFA 3D4YA 1BF2A 3UTSD 1F5WA 1FSKB 3TF7C 1XAKA 1G6RB 1NCGA 1T21A 4UTBL 5I5RA 3R8BB 5CN3A 5IQOA 4TV3A 1PA9A 1E6OH 3HR6A 2CIIB 4XGZB 1HXYA 3A24A 2BP8A 1Z9OA 1MCRA 2O61A 4NNXB 3CFDA 3L4VA 1DBJL 3MRGA 5BZDA 2BFVL 3ZM1A 5DZVA 5FM5M 3NH7H 1ZK9A 4RIRB 2G5RA 2PT0A 3ZO0A 2BSTA 1KTBA 2ZKHL 4DO4A 1K8DB 2DWTA 1QAWA 1PZ2A 3LPGA 5JA8B 1MHCB 1JHLH 5TDPB 4DKDC 4RNRA 1QHOA 3BIBX 2WXGA 1FZJA 2BWIA 4Y16B 1HHHB 3FB8A 4A55A 1BZQK 3FJTA 2F9BT 2LR4A 1UB6B 2DQUH 4P5KB 5GGRB 1I1AD 2H1LM 1A7QH 2LU3A 5BV7H 2J8HA 3V0JA 1DO6A 3UPRA 4PY7B 2H32H 4OFPA 3M46A 2E7CA 5E00A 3JXAA 1N4XL 3FTYA 1EDYA 1T5WB 4Z3GA 3N55A 2I9TA 2DQHL 2KZWA 1LM8V 4UT6H 3P30H 3CMOL 3F9BA 3ILDA 4QXTB 5D7HA 4OB5L 1ADQH 4ELMB 1EX0A 1PFCA 3KJ6L 4CU6A 4GAFB 3VFMB 1TJIH 3GZKA 3EXJA 3AY4C 3H54A 1NUFA 2QELA 1DQQA 3BOVA 1L0QA 2N7SA 4MA7L 3AABA 4L9LC 1KCSH 3RGVC 3SDDC 1R4XA 5JIPA 1GZHA 1WV7T 1E50A 5AW2B 5D55A 2EDHA 1GS6X 1YC8A 2F74A 3GSOA 3MV9D 4WAFA 2X4QB 4XPTH 2DJ4A 3MLYH 2A5UA 5DHMC 1FHGA 4JG0H 4PRPD 3QR0A 4Z5RA 3MV9A 5IJKC 3KWTA 5E8PA 2QFPA 5A3IC 3T09A 3T1FB 2ENSA 1LEKA 2IH3B 4BIKA 1NUNB 2ZCLL 3C9NA 3CNKA 3WTTA 4Q6IB 1CCZA 3H6JA 4FLHA 2VL5B 3KXFD 4DN4L 5E9DA 4IQHA 5JZ7D 1A9EB 2AQTA 2ORBL 5CP7B 5D70H 4OFYD 1O9ZA 4FQLH 4ZDHA 2Y22A 4EZLA 5KVMC 3L3JA 2B4CH 4PRDA 4PW9A 1IT9L 1OGSA 3MZTA 4GKLA 4KRLB 5BRZA 5SV3A 3N44B 1NFAA 4P3DA 1FG9C 3ZMQA 2WYIA 1E6OL 3QQDB 2MQGA 5I1LB 5HYSB 4R5VA 1MPAL 3IGFA 3QNZA 2DBJA 4ONFL 3RWJA 3HN7A 4OKVB 3QR2A 4FQCH 2OV0A 4Z7WA 4Z7NE 4W9LC 5I1IL 2XA3A 3PYCA 5DJZA 4UILH 4WNQA 4ZO9A 1FVEB 1TTFA 2WLZA 3NTCH 4EVNA 2QSVA 1IEAB 4JZJA 3PUCA 3BH8B 3TA4D 3WUWB 2HFTA 2IADA 3BKCH 1WP6A 4N0UB 3EIFA 1GCFA 3NEOA 3HG2A 3SBRA 2VWEC 3U25A 2VEUA 5AVXB 4YDKL 5KS9A 3MNVB 4YLCA 3MV7B 5B21A 1TTBA 1YEIH 3NJHA 5TQ2L 3DV6B 5TDNA 3L1GA 5GS0C 1I7UA 3NK4A 3FN0H 1LE5B 2DQGH 2P8MB 1EEYB 4KUZH 4Z18A 4YPJA 5CJ5A 4ODXB 2A9DA 1AGBB 3FT4B 4L4TE 3MLZH 4HPOH 1MW3A 1XMEB 2WLLB 1X7QB 3D30A 5IHBA 1T0MB 2H7WA 5TH2B 1LDPH 1T5KA 5FFGA 2WLIB 3MLXH 3QGVA 3B7UX 2BIJA 4FMKA 1QSEE 4KY1L 2ZNWA 3QCCA 4NZUH 3T6ZA 3B8SA 2J73A 5D1ZD 1IBBA 4ZNEE 1CDJA 1Z9SB 4CL7A 1ET5A 2EH8L 4C56D 5C0JB 4GQ9H 2QDPA 1JI1A 5L2JB 3MLPA 4ZRGA 3K6SA 2JFHA 1BAGA 5DJ8B 1JD7A 4HF5L 4RH9A 4JHWH 1IAKB 4N2IA 1BPLB 1OCZB 4NJ9H 4GRLB 4NQDD 2IV9A 4PMEA 4H1OA 3KNBA 3FSOA 4NNPL 3REWA 3VD4A 1ZKAA 2HT4C 2Q0ZX 3BX7C 1KGWA 4P9ML 5JYMA 1J1OL 2OLDA 4ZUTB 1ZA3A 1FPTH 2ICWB 2W5PA 4M5ZH 3E8UH 1I4FA 3M7OA 4L9DA 4JFOA 2BMKB 3V0HA 1ACCA 5K39B 5J89A 1HWHB 2HT3C 1WEJL 2NY7H 4L4JA 1OVZA 1HIML 5KBDA 2ZOKA 3KPLB 2WOYA 4WI5A 4IMLB 3OKOB 4UOZA 3FB6A 1IBYA 3FYIB 2XWBB 3L3GA 2AK4D 1E4WH 2ESVA 2NOYA 3RWCA 4KAQH 1N0XL 2XV0A 4S1QL 2B4OA 1FPTL 4NO0A 1U8MA 2JNZA 4MBOA 3RX9A 4GG6F 3L9RA 3UZVA 3WFEL 1FBIL 3BXNB 2Z31D 3M45A 3MNWB 3B5TA 2CM5A 1DUZA 3VGGA 1A3RL 2FX9L 3QUXB 1PKQB 2J1WA 5F9DC 5D2NA 2PR4L 1PDKA 2R4SL 2DZEA 1GRWA 4HBCH 2HJLB 2BC4A 1NWLA 1WTGT 4BUGA 1XH1A 3BUYA 4Z1PA 2QCJA 5GS1A 4L8CB 4AITA 1I1RA 2UXVA 3FL7A 2D7OA 1NCDH 3MOAL 2W95A 3RLSA 4LLUB 2NUTA 1I57A 3W5MA 2VLJA 1U26A 3QA3A 3HMXL 1U8LB 1OE3A 3NCMA 3VI3E 4Z7AA 4RWYL 4FQ1L 4NZRH 2EVGA 3CFNA 3RDTC 4J23A 3ET9F 2L4OA 4H1LH 4U6XB 2PTTB 3BEWB 3BSZH 3OMHA 4LVHC 2NY6D 4YL9A 1VEMA 4ZMNA 4H5SB 1MCNA 2VT0A 1AJ7L 3AUVA 5CWSB 1H8SA 4JKPL 2FYYB 5EORH 1MEXL 2PKDA 4PV9B 1P7KB 4F7CB 3MGTB 3VGAC 4D0DA 4HLEA 1FPZA 1JV5B 2G4GA 2YPLE 4JFFA 1R24A 4B96A 1A6WL 4IU2B 4NN7C 3UFIA 4CSTA 1F1GA 2OL3B 3LSOB 1AG6A 2YMTA 1OSZA 3B9KD 4HS6A 4Z8FH 2NXYC 3RIFK 4WLCA 5HI4C 5FLUA 1I1AA 3GZPA 5MP6L 1WZMA 3RGVB 3SDDB 3DO7A 4WKXA 5B1JA 3BWSA 2OMNA 3MJ7B 1RUQL 4E5XG 2PWEA 2YZ8A 3VFNA 2JFCA 1BQSA 3LQAH 4MXVE 2DJUA 2V9TA 1TJMA 4N8VA 3FT0A 3GK8L 4JANA 5LJYH 4LL4A 3DMMD 3P4MA 3BUDA 1P7QD 3BP4B 4ZO6A 4ZUSA 2W9EH 4RQQB 4QTIH 4AI7A 1FQ9C 1I3GL 2Y1AA 4PY8J 3WIFA 2OK0H 1RXDA 1J86A 4X7DC 4AK1A 2OA9A 5KUKA 5CCKH 3NAAH 4QXVA 3HE7C 5I1DA 1ZT4B 3BN9D 3WS3A 3UZQA 3BAEH 3QCBA 3RPIA 1U9KA 1U4EA 2V7HA 3QHFH 4AUUA 2FJMA 5C2UB 4EIBA 3TT1L 1PAMA 3RWIB 1ID5I 2VSCA 2NY5C 5DJ0B 3TBBA 1ZA6A 5IM7B 2HFFA 4B9PA 2IWFA 1AZUA 3HR5A 4FEMA 3B2PA 1G9NL 1NC4D 1CFMA 3N43F 3LZFH 4J3UA 4X6CB 2AK1H 3GIZL 4GBXA 4GKSA 3WFCL 1MNNA 4OFKA 5HHQB 4PREB 5GXBB 4NO0D 3BESR 4N2NA 3ZPDA 5AB0A 4KTGA 3FZUC 1A7QL 5BUAA 3VXQA 2DLGA 3BVDB 3ATEA 2FHCA 1YYMH 5AVZB 1CT8A 5L8KB 2WNXA 4PJ6A 2XWTA 3KGTA 1KB5A 2XZZA 3SDAD 2EE6A 3VVWA 2NY6C 2XPCA 5EU4B 4H8WL 1S7WA 1M6UA 2I24N 3PWPD 4M93C 1TJGL 3MLUL 1ZHBA 1U58B 4LAQL 3P9LA 4PG2A 1FLTX 5DMJB 1R47A 1QTSA 1UZ8B 3EYQC 2DW5A 1TETL 2OCJA 3AM8C 5JNYB 2XIDA 4HLJA 3Q5OA 1INQB 2O6DA 1SVZA 4XN5A 3GMMB 3NBNA 3ZDXF 1H19A 3GSNA 4ODBD 3RB5A 1VERA 3IJEB 1E2WA 4IKJA 2DF3A 1AS8A 2PYEB 1TZ8A 4YJZL 1X5LA 4MB3A 4AG4L 1CLOL 4GG6A 3WXVH 5CD5C 2OZ4H 3X1NA 4FTVD 4IIQA 4TTGA 3FU7B 2LFGA 2BNUB 1RK0A 3V4VB 1PAZA 3FCGA 3O4LB 3CC1A 2EDXA 4HUKB 2HYMA 2D7QA 4FYQA 4OZGF 3ARGC 2CDFA 2JCCE 3BQVA 5T1DL 5FW8A 2E6JA 3OZ9L 2Z4QB 4KUZL 3EYFA 3D8MA 3QWOA 1U24A 3RZCA 3UAJC 3QEHA 4C4KT 5MP6H 3INOA 3RFZC 3T8XA 4C59B 5BO1H 5ACLA 1WWBX 4FJ6A 5JW4N 3BLKA 4YOKA 1X7SA 4NO2A 4ZTPL 4BZ2H 1Z5HA 1GTFA 1CGWA 2H6PB 3VFVB 3D3VB 3CXHK 3OG6B 4FRWA 1MQKL 2E56A 3IDGB 2YEZA 2F15A 1IAOA 2CKNA 4JPQA 4XGZA 3X3FL 5DQJA 4Y4KA 4ORGB 1NH6A 2QQLH 3ZTJH 4P23A 2O61B 1M7XA 3DKHA 1HWGB 1KEMH 3VGFA 3IS0X 4YHIA 3L8QA 3ZM5A 2F70A 3IF1A 5FO7A 4B9GA 1BG9A 4EI6B 4M3HA 4L4TA 4RGNC 4YSPA 4YDNA 2G6ZA 3APCA 5DMKA 3GUTB 4U2YA 1IGML 3O81A 4FQIL 2FH8A 3DUUA 4Q14A 3O3AA 1NBYA 4LHUB 2QZQA 1BFTA 1IKOP 3MFFA 1T1YB 4HUWA 5HHOA 4PS3A 2ZXCA 3SYQA 5B39B 1UB6A 4P5KA 5DO8A 1YEHL 4M43L 2A3KA 1GYWA 1JGUH 2F46A 4ERCA 2DL2A 5L0QB 2YO3A 4JB9H 2PF6A 2H9GB 3I6GB 4AVKA 4Z7QE 2B0SH 3S3BB 2Y7SA 1WBYB 3IJSA 2EUVA 3PE9A 4RI4A 1YMHA 3MRBA 1JBJA 1T5WA 2GWOA 3TBYA 3GXGA 5IJCC 4FYTA 1AHWA 2I26N 3IMRA 2J5LB 3ARXA 1NCBH 1ET7A 4PS4H 3IU4H 3UG4A 4XNQB 1S7SA 3H6AA 1QSEB 1E5UI 1BZDA 2D31B 5I82A 2AS5M 2GIMA 3QNXB 3QO0B 1LEGA 1TDQA 2WNWA 3VMOA 5MHSE 2BERA 4YFEA 1KWKA 4IBZA 1E4KA 4Y19A 2D7PA 3QEGH 2OMWA 3V9FA 3HC3H 3L9YA 4UTCA 1IILE 3QCUL 5DO2D 1UZ6F 2F74B 3GSOB 3IDMA 4GIOA 5MEPB 3UBXA 1A6ZA 3U1SH 5FYLE 4HUUB 4Y5YB 4AGMA 4UUJB 4XC1H 3UXFA 5CZXD 4FI6A 4Z5RB 4NP4L 2IALA 2XN9D 4GE5A 1YY9D 3BPNC 3B2MA 1QX1A 2A6IA 5I74B 4XMPH 5ANMB 4X6BB 4M6ML 1U2HA 2BPBA 2FEEL 2J2ZB 2CSPA 3QEGL 1Q6PA 2NQCA 3GLDA 5CP7A 4AIOA 4U33A 2B5IB 3HCVB 4K3JH 4GB9A 3L45A 3AQXA 1MHPH 1ORQB 4P3DB 2ITCB 2IQAA 1DQTA 2IIJA 4GXVH 5D96C 1IC4L 1QFOA 3D4CA 3WN6A 5HHPB 1ZSDB 1BPVA 4E41D 2EXWC 2CO6A 2NSMA 3LS5H 4P2QD 3S5LB 1QABA 3IXAA 4DPBX 3QARA 3MV7E 4M7LT 4HWUA 2O6CA 4ODVH 5C7XH 2MRYA 2WIMA 3T3PE 1BZ9B 4EVNB 1J5DA 5DUBA 1P1ZB 4R7DA 5E8NA 5IJVA 2Y69B 1ZE3C 2HRHA 4AYEC 2IADB 5E6UB 4GWFA 4J3OH 5LB1A 3LHAA 1QFUH 1PJ9A 3N41F 3LZOA 1UAGA 1SDDA 4RGMB 2W0KA 3MNVA 4G9FE 4XBPB 2X6UA 2OI9B 4L8DA 4BGDA 4OI7A 1HESA 5E9DD 2J1ZA 3FUEA 4DP7X 3LKOB 1JZ4A 3FTGB 4F7MA 1ASQA 3PV6A 2J8UE 3L3IB 3HAEB 3VXRA 4E9SA 3F9AA 5LXVA 3S35L 5F7EH 1X7QA 2IDQA 1PEWA 1KJ2L 4APQA 4Y1TA 1NLDH 2W91A 3A6CH 3QXDA 2CGRH 5HHVL 2DTML 1H15A 1GC1L 4PWEA 3BKCL 4Q2ZB 4NRYA 2RGSA 1XXVA 1VJSA 4JKKA 2FHFA 4M9OA 3JBG7 4RZCB 1F13A 4L9LA 2VE6A 4ZQTA 3PWNB 4X5LA 4JFDA 3VTMA 4KFMA 5FYKD 1IVLA 4N3UA 1USZA 4NQDE 4HHGA 4I1PA 2R0KH 3O8XA 4OCWL 3F7VA 2APWA 2WQUA 4CMMA 4OCRH 1C9SA 1JGIA 1LJMA 3OGCB 2FIRT 5IFJA 3HI1B 3L1OH 25C8L 5IVOA 2Y68A 3OG4B 2A9BA 5DTFA 5GZOA 3WXVL 5JHLL 1ILSA 3VUAA 4HOMA 3EOYG 5SWSD 3UO1H 1DLHB 4JFOB 4X4MA 1XF4A 1O0VA 3W11D 4A2MA 4HIJA 1TZAA 1HYSD 4NNYB 3HG1A 2J16A 3BFOA 2V3EA 2BW5A 3NSCA 4K73A 4XZ4A 4KKNA 4MYWB 5EC1B 2WINA 4XH2A 4ZQKB 4ACPA 3CZJA 3RU8H 4YHNA 2XWBA 3KE0A 4DN3H 3HG1D 1OF2B 4BGLA 2V2TB 2R56L 4Y5XB 1U2CA 2V5RA 1BBDH 1FL6B 1PLGH 2J5LC 5JMRA 4QRUA 4MNGB 1Q38A 3SQBA 1VGEL 2MOGA 2CA3A 1URIA 3L5WA 5SX4H 4YDZA 1DVFB 3T6VA 1MW2A 2X40A 1YYML 3Q44A 4UAOC 3EJZD 5J11C 3BISA 4KVNH 4PVLA 1AR2A 3MV7D 5D2NB 5GZNA 3X14A 1HE8A 1I7TA 2VSMB 2P28B 3QDGD 2X89A 2ATPB 1XGTA 3B2UD 2HKHH 2R56H 2XQBL 3WD5H 3O2DL 1S7TB 2ZPKH 4IIZA 4DCQA 5ID0A 4LLUA 4TPRH 1GZHC 5BV7L 1KTJA 2WQVA 4HGMA 1HHJB 1CLZH 5DT1L 1NIBA 5TF1L 5C0EA 1HXKA 5E4AA 3T2NL 2NY1B 3U30C 3VFOB 5LCVA 3SGKA 3ZL4L 1AO7B 4QRRA 4LK4A 1FRGL 3BRFA 3LB6D 1CGVA 3VQ1C 4UNUA 3H42L 4NKDA 1T1XA 3H3BC 5JDJA 2ICEC 4Y1AA 5ENWB 2EO9A 4QRSB 3QUKA 2Q8AH 3B8YA 4P5SA 3CZEA 4IRSB 1MH5B 1Q72L 1PS3A 2ENYA 3CZLA 1CDUA 3NFPA 5GRWA 5J5EA 4L3AA 2WCGA 5JW3H 4YO0B 4LBEA 1MJ8L 1TTAA 1TXKA 3WSQH 1XSOA 5FKAA 4YSSA 3I80A 1P7KA 1HN1A 3MYJA 4F7CA 2X9ZA 4ZS7L 4YWGH 4CMHB 4KY1H 1KYFA 3P1VA 5AOMA 3PAUA 1FVDB 4TVPH 2NY1C 2VM3A 1VFOA 3DBXA 3UBFA 4CADA 3U0WH 1GWZA 4YHZL 4Y9GA 1OKEA 3FU6A 3D07A 4AQZA 3FRPB 2OI9C 2VZTA 4K94L 4PRAB 3RGVA 3SDDA 3NJGA 4B9FA 1HVXA 3U0WL 3I7ZA 3L48A 4Q58C 4ISVB 2VDMB 1T66C 2D4DA 4TULH 5AVYB 2OC3A 2ZKXA 2YPKB 2J8OA 1OCRB 5HHME 4L1HA 4AC4A 1MOEA 1JXKA 2DWDB 2ADFL 1J8KA 1GAFH 1MG2C 3RWHA 4JKPH 2KYIA 1W15A 2NY0D 4R4NC 3VO0A 5A2JH 2F8VA 5CGBA 3WNJA 4LNRA 3EOTH 1W80A 4R4FL 2BLFA 4JY6B 3TFBA 4OF7A 1JIBA 2ARJA 2OUDA 5K23A 5E1HB 2APFA 1ZGLA 4UILL 3F7QA 1XD1A 4DW2L 1JSYA 4NRZA 2FE0A 3OZLA 3CHXA 5DFWH 5CXPA 4L3EA 1OAYL 5KJRH 4J3OF 4HHWA 1ZA6B 4JDVB 2A4ZA 4KC3B 5IM7A 1WGVA 3KEHA 1TFHA 3LZLA 2CLRA 4U6YA 4QBWA 3LEXA 3T65B 1K2DB 3JWOL 3LNGA 2CK2A 1EHNA 4EDXA 1NSNL 1QSFA 2HVLA 2LTQC 5L2KE 3PP3H 3BZ4B 4PREA 4RDQF 1PTZA 4M03A 3DA0A 1RLWA 5DFVC 5IB1B 4N1EA 3HLAB 4HBCL 3O6KL 5EOCJ 4H20H 3KVDD 4XBMA 3V4PL 2CJSA 4HZAA 1GC1C 3BSZA 4A2EA 4GEJA 4KKCC 3WMPA 4BUBA 1FZKB 1XD0A 4X9GA 5I8EB 4X6CF 1S6NA 4D3CH 5HJ3A 3MBWA 4XVJH 4ESKA 2VDNH 1A7NH 4W9CC 3QULB 3WFEH 3IDIA 1NJ9A 4WUKL 4IOSD 1G7LA 4Z7OB 1EDHA 2A1WL 4HV4A 4B60A 1UEMA 1F6FB 2UY6B 2MIZA 5C92A 5FYJE 3V2AR 2B9AA 1JGDB 3O4SA 2Y2WA 1CBVH 1I3RA 5JR1H 4TNVK 2Q86B 1KN4L 4X5PA 2X1PA 3O4LE 5FHBL 2V8MA 5CZKA 4GW4A 3VX1A 2OXGA 4AEHH 5JDSA 3MNZA 1A65A 1ZT7B 1KYAA 1YQVL 2AK4B 4QLWA 3W5NA 2EXTA 2PYEE 4WRLA 3RQ3A 3RVXD 3QXVA 1X5HA 4D0CB 3V5DB 3FQRB 2QR0B 1QO3A 3M07A 2ZE0A 3V0WH 3F85A 3BUBA 1MCCA 5T1MB 1JNJA 3CFBA 3E80A 1G7IA 3C6LC 1JPFB 3GEFA 5I8CA 2A9NH 1VFAB 3TBTB 2HH0L 3ZQ9A 1TKWA 2HNQA 3AREA 1DJIA 2WANA 1LQBC 3QXUA 2KHAA 3SB3A 1Z7JA 1ZJBA 4LOFA 5HGGS 2HSIA 4Q0XH 2X5PA 4LKCB 1LL1A 2AEQH 4JDTH 1G1GA 3SGDH 4LPWA 4PWKA 5AKTA 5C0BD 1WT5C 1Y1UA 2HKFL 1U8KB 1Y18A 3QUMH 2H6PA 3VFVA 4OM1L 3RNQA 4AL8H 4ETQA 4OLVH 3GJFB 3QVAA 3QS2A 4MJJA 3MVNA 4NFBA 2D73A 4JREC 5DQJB 4BPCA 4UNVA 3OMAB 4H8VA 4PJ5E 3MSPA 2LAAA 3SDXE 3GGWB 1SMDA 3C60D 2JTDA 2DI7A 4MXWH 3EB1A 4YHIB 4EDWH 2DQ6A 3LY6A 1QBLH 1RIVH 5C0CD 4JJOA 4FTVA 2ZUYA 2PPAA 3ZKXB 4LLDA 2Q05A 2VTEA 1IKFH 1YMMB 3IDYB 1N6UA 4JK0D 4L4TB 3PJSA 3VGAB 3ZDYE 4BHUI 2P52A 2YMXL 2P46B 4O58L 5ERWB 1JYXA 2CA4A 1Q9WA 3ZHFA 4WOHA 4NN7B 5KS9F 5DGRA 4IEFB 3WGUB 4KVPA 1V55B 4LB8A 3KGRA 4K8RL 3SKMB 1T1YA 3MXVL 5C2BL 3A5KA 1BVKB 3MRHB 4KHXL 1JK9A 3MRQA 4YSOA 3X3GL 2BHZA 4FA6A 3WE6A 2DEWX 1A4BA 3KWVA 5D2NE 4O2CA 2VR9A 3FCSA 3KAAA 4LCUB 3WJMA 2J7LA 1CF1A 1CD9B 4PJFB 1P84K 2CALA 3BVTA 3K2IA 4H0IA 4JHVA 4NYHA 1AHWB 5ISZD 1WFIA 4XCEB 3TBSA 1ZE3H 2HJKA 1HH9A 1SYVB 3AU0A 2HXPA 4YAAA 2DI8A 3K6OA 3VNZA 1WH0A 1MIML 1FO0L 1UYWL 2ICES 3Q1EA 4JFZH 3WNIA 4PVGA 2VDPH 5EU6B 4WI6A 2NW2A 3IJ8A 3OSKA 1ZPUA 2Y4SA 4AKQA 4F8NA 1F6AA 3TGXA 2DQTL 3TYGL 4MCNA 3RGQA 2EZ0C 3G6JB 3CU7A 4AM0Q 2DQFB 1A6ZB 5ESQB 4MXVF 2AW2A 4MAZA 3TEWA 4J5VA 1YECH 4GLRH 3V4LA 4GG8A 2GBVA 2WVUA 1BZOA 2AI0H 1NWEA 4RISH 2KLSA 4BRJA 3GMPB 1DJGA 2DIJA 3J8F7 2FNWA 1MDAA 4X6BA 3PP4H 3EJJX 1QI5A 2CGYA 4PJCE 3BIAX 3KWXA 5INDB 1NM4A 2ZT9C 3WO4B 2J2ZA 4QRRD 5DT1H 2XQYG 2CO1A 4NM4L 1Q0YH 2IPUK 4PEEA 5LBGA 3RVXC 2B1HH 1OB1B 3N40P 4YN3A 4FEIA 1DBAH 2XU9A 2YMOA 3I6LE 4GBXC 4XHJD 3TU6A 1GKEA 2W81C 2ZUUA 3RX8A 1FIEA 1JNLH 4JX0A 5KA2A 4LVEA 2HAZA 3MROA 4N8CH 1ZCRA 3C6LD 4XN7A 2H1XA 1FZMA 4IOIB 5A2BA 3BO8A 5FLVA 1KYOJ 1U21A 4NHCL 3CVCA 1JZ6A 2EC9U 4JHAL 5CILL 2JFFA 3ZE0B 4IGBB 1NCCH 2PMZA 1D5XB 3MKKA 3C5XA 1LO5A 1OEZW 1G7JA 1P1ZA 4R7DB 3QORB 5IJVB 1SDYA 3N85H 5F96L 4E0RA 2DWSA 4QAHA 1ZHLB 2D7TH 4KK6D 3EDFA 4PTTB 1BOGB 3PPSA 1KENL 5FW7A 1E9QA 5D2LE 2JF1A 2GIYA 1A1OB 3MLTB 5C09E 2HPTA 2AI0L 2X41A 2CCLA 3G6DL 3W9EA 1WS8A 3LKOA 3CH1B 1IGMH 4FQIH 1JNHB 4WENB 2EIBA 3O6LH 2HCMA 5ADOL 32C2A 1PD1A 3BRDA 1VACB 4JFED 4K7FB 3BDBA 5CSGA 4P48A 1KGXA 3AWFA 3QJSB 1U42A 5I0DA 1DZ0A 3TIDA 3TONA 3DTDA 1G43A 3OKKB 4NOBA 3ARGA 2BXYA 4UQEA 2FEJA 1KIPB 1MCWM 3DNKA 1V3JA 2PPCA 3WELA 2AZRA 1NPNA 3B9KA 4Z7UE 3U82B 2DYPA 3V79C 4AYBA 2KC0A 3WJLC 4E9VA 4XB8A 4AIEA 3FT3B 2PQ5A 5CNHA 4EN3C 5IBLD 2AJSH 1WBZB 3U2SB 3H4FA 3PWNA 2BIQA 2IF7A 2OMUB 4JFDB 5DD1H 3VXME 5ICUA 3O8XB 2D3LA 4WY7L 3IGUA 4MZRA 2Z8VC 5E8OA 1LEIA 1RIUH 3ZYIA 3GDCA 4GSRA 4Z7UA 2ZSVB 3TN0B 5EUOB 3F00A 4DKTA 2FJHB 3VI3B 1Q0XL 5FGBA 3VXNA 1I3VA 1DLHA 2E76C 1EHAA 2WO4A 3FO0H 4G6JH 5HY9B 4URTB 1XF4B 3ZE2E 4LP4A 4L05A 1JTOA 1G7HA 3L5XL 1D5IL 1UWEL 4AQAB 2IPTL 3V6FA 3VFWB 4PR5A 3RDJA 1SXBA 2EC9T 3TWCL 1TJHL 5C0RH 1I1FA 3ARRA 5JW3L 4QRBA 4UDTA 4DTGH 1OF2A 2H0FA 1FG2A 1T48A 4DP4X 1FL6A 4J12A 1TETH 4K4KA 1V7NL 2ENJA 3RVTC 4BBWA 4QRTA 5SWSB 2Y36H 4JDEB 1J8HE 5I15L 4ZPTB 4KK6C 2VXVL 2AERT 3F12B 4ORZC 5IVZB 1QYGH 3AAZB 5DVKA 1LE9A 1N8OE 1GIGH 2VW4A 1YUHA 1EO8H 3WNKA 5I1GL 3X14B 1YFOA 1DBML 1D5BB 2Z31A 3TBWA 4LCIH 4S1QH 1JVLA 3VU2A 2F08A 5F0LB 2YOAA 5I1JH 5F3BA 1H3PH 1WVZA 1JZIA 1NBZA 4NP4H 4UM9A 3UTQA 2IXQA 1Z5LB 2R15A 2Y7MA 5HYJB 1IGJA 2J6EH 3GI8H 2WCSA 5FUOH 3SZKC 3ZK0A 3SGEH 2IBZY 4QYOB 4GUPB 4PGZA 3VWJA 3LB6C 4IOFC 5IB4B 2WXQA 4U3SB 3V52L 1RSFA 1MQ8A 4N0FB 3RKPA 3IDUA 4OAWA 1QWNA 5CIPH 2W9DH 3SJVE 1J5IA 4MJIB 5AYUL 1T6BX 2WSKA 3RBSA 5FHBH 3RL2B 3CVHH 1IGFH 1GGCH 1T3FA 1OM3H 1YN7B 3VH8A 2W92A 5AD0B 4Y1AB 2OS7A 1IQWL 5ENWA 3S8FB 1RUKH 2Y67A 1OQXA 2ZUQB 5KA7A 1URLA 4JQVA 3U46A 1ORSA 4FULA 2NCEA 3UTSA 5IWLC 4DKEH 3OQ3B 4YO0A 1KB3A 1NGWB 5FIEA 1JFQH 3ZTNH 5CEXB 2HT2D 2APVA 2OL3L 1UOLA 3CHOA 4LL1A 3DSNB 2TRHA 1RLBA 3KLHC 1DSYA 4AQ1A 2D3VA 3BN3B 3ERXA 2VZUA 4LDCA 2IGTA 3A4DA 3HAEG 5F9WB 3O9WB 3NABH 4HIPA 4BSVB 5ITBL 1F4AA 1JERA 4HV8A 2PCYA 3UCQA 4KTYA 3N1FC 3SBWA 4NDMB 3M8OH 3MRRA 5K9VA 2WXIA 1XXFC 3SGDI 3FO1A 4ENED 3T3MB 2VLRD 4QJ5B 3L4UA 4K07A 5IQLA 3RAJL 1MXDA 1SXZA 3MJ9L 4ZFZB 1BZ7A 3SMEA 1U8HA 3VACA 7FABH 4PJ9B 2F5BH 4JY6A 4X9BA 4XMXA 1WYJA 2BOCA 1N3NB 1R5WB 4R97C 4XVTL 4GKZA 4JRYA 1LMKA 4S1SH 2AQQA 3IETB 3ROLA 3CQPA 3K1KC 4IS6B 3WMQA 3AGVA 1EV2E 4L3EB 5M94B 4W9DC 2C1PA 5AW8B 5T5FH 2F7QA 4KRMB 4BK5A 1QFUL 3CBKB 3RAJH 1FJ1A 5DK2A 1A9BB 2IVFC 1FCCA 4P57A 1OLLA 1KB5L 4FHKA 2KH2B 3MRMA 3N91A 4LQFH 1YMME 1MW1A 4R5TA 2WZ0A 5EWIH 4E68A 1QUPA 3QJOA 3VFGH 5IB1A 3S4SA 3TV8A 3UG5A 4HH9B 4MKMA 4NUQA 3FFCD 5T33H 1W91A 4L1SA 5DK0B 4DFHA 3RUGE 4G1EB 2MWCA 4WI3A 3HPJB 5AW3B 1MFDL 4K3JL 3Q6FB 1ZC0A 2K6WA 1SY6L 1AKJB 2H2SD 2UY6A 4H88H 3S88H 1E6JH 1BD2D 1CBJA 2YAPA 4JCMA 5KANG 2R1YB 4LIQL 5J6GB 4XO5A 1ITCA 5F93C 2GITB 3OB0H 2C9UA 2WIIB 5F7BA 3SDCC 2MQCA 4P4KC 3S0PA 1N68A 4G8FA 8CGTA 2NT2A 5JIKA 2IAMD 3QHZL 4OGXL 1JGEA 2OBGA 2Y06L 4QHMB 3JUZA 1GGYA 1WAEA 1MRFH 1JCVA 3SYAA 4K2UL 4G7SB 2P5PA 4X7SH 2NYYD 3L3HB 1KT2A 4KKLC 1UA7A 5E8DH 3APFA 3QCTL 4U7KA 4E2OA 5I8CB 1DANT 2JCCA 5DWUL 1UCBH 1J8HA 4ABWA 2FJUB 1RFDH 2NY4B 1QPPA 3FSZA 4RRPA 1CBVL 5DFTA 3VFTA 5A2CA 2KMWA 3WKML 1XF2B 4WI2A 5A1AA 2OX5B 3MRPB 4JO8A 4JQIA 4TUKL 3VFPA 4AQOA 3TA3A 1GS8A 4JY5H 2DQIL 3U48A 5C70A 3CDYA 4PBXA 1J5OH 1I8MB 5D7KE 4HDIA 4ETQB 3HE6D 1JHLL 4NPJA 4Y2OB 4X7TB 1VEOA 2GAZA 3V55A 3PXHA 2DIBA 5C97A 1XSIA 2X4RB 5HI3C 3TPKA 4K5OA 2Y66A 1VFBB 4NP9A 1VFMA 1BD2A 3EJZC 2F68X 3OAUL 4ONGH 3GK8H 2VLJD 3CAFA 1A1MA 3GIVA 4FTVB 4UQAA 1OSEA 1U91B 3AU1B 1TZGH 3PJSB 5IJBC 1AQHA 1FNFA 3L5XH 1TQBC 5CKGA 3BM8A 1CXLA 1H3WM 3WY3A 3BIKA 5GSVB 4GMSL 2MOVA 5E0QA 3DO3A 3T6XA 2VM4A 4HHAB 4GRMA 4IEFA 4LOUC 3VA6A 5F9WC 1F90H 4N2BA 2AHIA 2X09A 1CXIA 1KCVL 4BA0A 4IRJB 4OZHB 5GGTL 3DTUB 4K7PX 1JK9B 5EULV 2NR6A 3VJ6B 1BVLA 2IH1A 1FE8H 4BFKA 3ZYJA 2H2SC 2RIKA 3LRHA 4PIBA 4JS7A 4O2CB 4NXSA 3IEAA 2QVTA 1JF5A 1TQVA 4Y16C 6CGTA 2ESVD 3Q1SL 2BS71 5E2VH 3ML9A 1XB6A 3R8QA 6PAZA 2NPLX 2AEOA 3B9DA 2R2EA 1TQBB 1YYLH 1BAWA 1HILB 2EDFA 2EIJB 1I1YA 2MQ0A 2NYKA 4F7PB 1YEFL 2UUDK 5LGHL 3MUUA 4NKOB 3ASWA 1YN6B 1NZ7A 1HQ4B 2C3VB 2HX8A 1KCUH 3LH2H 2AXWA 1F6AB 5BXFB 1MJJB 4M7ZC 3R18A 1BZCA 3CD4A 4G8GE 5FAAA 5SX4I 4ZW3A 5CEZL 4UYQA 1XZ0A 4EIUA 4UT7H 4OFYA 4KQ3L 3PFUA 4H0GA 4KK5D 4HC1A 1A1NA 5LAPA 2FSEB 2ZKMX 4J3TA 1GZQB 3F7YA 4B27A 1WAAA 2IOMA 4LOEA 1UXSA 5KSBE 1FFQA 4DAGH 3ZN6A 4PGEA 1QG3A 2Y6SD 1VIWA 4LSVH 3U4EA 4XHJC 4DP5X 2F1AA 3F5WB 4WTXA 4GQPH 5HTSA 3C6EA 4K0OA 3FOMA 4JO1H 5DC2A 3BD5A 5D72H 1WD8A 4XNAA 4Z7VF 2DKSA 2PNDA 4WSKA 2VXTL 3IN0A 3DTXB 1CLYH 3EYSH 1E27B 1JJUA 4I4WB 1A4JA 3ILQD 1XR9B 1WBXB 1XIWD 4HZLB 2AJYL 1FGVL 1AY1H 1RZ7H 4Y7MA 1N6QH 2G0KA 3PIQA 4NZTL 5DURB 1XL4A 3BVVA 1C88A 4XHQA 4WWKC 4BKSC 1D7FA 1DN0B 1CZ8H 3WKPA 1K8IA 2XKNA 1D5XA 3D34A 1GR7A 1CL7H 3NZUA 4WTZA 5ES4B 3DOSB 2BINA 5IVXF 1O9VA 5D71L 4IBSA 3DROB 1L8GA 1Z2KA 1X5KA 4ONHB 4AH2A 2NLKA 4D8OA 4OZFB 2HNPA 3NCJL 3ZDXE 3K0YA 3VXUB 1G1YA 5BV7C 5I18L 4KITB 1R75A 1QYGL 3QWNA 5GRZA 1EH9A 2ZSWB 2AV7B 4NQSA 1Z3RA 2NY7L 5HI5D 5A16B 3TASA 3CFEA 1SJHB 1LLAA 1EZSA 3CVHA 8PAZA 3S8WA 2UWEB 4C83B 4K7FA 4OF5A 1BLNB 2FQGA 2DBLL 3LVTA 3EZ8A 2ZOTA 4OZGE 2RALA 3AG2B 3OKKA 4DP2X 1HSAB 3DWTA 1AGEA 4R7NB 5C6WH 5BZWA 3CIAA 2WBJD 4OUOA 4I3GA 3M17A 5IMLB 2X38A 3ZZLA 1UJ3A 4HGKC 3PG2A 5C08A 1I8LC 4OCXL 2XV2A 3BH9A 1PY0A 1UURA 2VAAB 4L5FL 1FGSA 4KTDL 5EF2A 3MLZL 3U2SA 3VYPA 1SY6A 1J05B 3GMLB 4H2CA 4PS8A 5D1QC 4TUJB 3EBIA 1PD0A 4ES8A 5DUMH 1VPOL 1RJLA 2DD8L 1G4US 2TAAA 5GHWH 1U25A 4M7JL 2F7OA 1IFRA 1YSOA 3RVWD 3QRGL 1XXPA 1NWOA 4ZN5A 3QEQA 4OM0L 4XN1A 4QRPA 5I73C 1Q6MA 1I3UA 2IDCA 3GJEB 3MLVH 4FXGA 5CF3A 5GGUA 4HS8L 4OBSA 4XE0A 3UJIL 5AAMA 3FN3A 1OAZL 1OWWA 4XP4L 4DVRH 1EAPB 2R2BB 4L3ED 3QYNA 1HZHH 5D7IF 2EDBA 4HFWA 2FH6A 5EPMA 1KTCA 4HS8H 5IQNA 2NX5E 4NYLB 3CFMA 3GTTA 2CE6A 2A38A 4F37K 2Q8BL 3NRQA 2YUZA 5JQ6L 4QCIB 5HGHA 4YBHA 1R3LB 1L5GB 3QDJD 5J3HC 3S8GB 2KPNA 1XF5A 2XWZA 3I84A 3PCYA 5KEZA 3FQ2A 4LU5L 2M1KA 1GQYA 3DHUA 4PBVC 4PCKA 4WKZA 1RKRA 1H3XA 3AAZA 3MGAA 3E9TA 3FUFA 4AQEB 2PWDA 2GP0A 1B4RA 4HJSA 1E90A 2EE3A 4XXCA 5E7BA 1UQSB 2PXYD 3PL6C 4HAFA 1AFVH 3JQOB 4P07A 4AJYV 4C56E 2WXOA 1KV3A 3Q06A 4WI4A 1RUPH 3VW3H 4RH5A 1LP9F 4R7LA 1NBZB 1ZDQA 5IHZB 3CN3A 2VXUL 4YHOL 3ZTDC 2IXQB 4E41A 2D2OA 3RKDC 1F97A 4QYOA 2MMXA 1GSMA 5FXCH 2Y24A 3TA3D 1JYNA 3SKNA 1VHRA 4OTXL 5BVJB 2PR4H 1CUOA 1CXFA 1C1EL 2GJ6B 3C6SB 2CIKA 4U3SA 4AJVA 4XVSH 3SE4A 4OAWB 1MAMH 2J8UB 2H26A 4I18A 4M4PA 1PZAA 3H9SD 5IT2L 1KFAH 1IAIL 4X7SL 1G9NC 2QZ5A 3MLYL 1I9JL 3QG7L 4JFWA 3GS0A 1E40A 1YG9A 3DPBB 4GSXA 3F58H 2DQCH 2ICEB 2NW3B 2VERN 4BWWA 4K9EC 3HE7B 1T1WA 3WJLA 3P3SA 4F3FA 2APTA 1AC0A 1J11A 1NGWA 3ENEA 1JUFB 4XP1H 2FO1A 4WUKH 1IBGL 2HVJB 2G9HB 4I1RA 5EC2A 2NY3B 5GRVK 4BH8B 3OKLB 2VYRE 5E8DL 4FLSA 5F1NA 5IGXL 3BWUF 1ETB1 5EBWB 3SQRA 1Z9NA 5F7DA 3AY2A 3QG7H 4MAUL 5SWZE 4K5MA 1DJWA 1G6RL 1S3KH 1CGSL 3HUJE 4HQQL 4Q7DA 2ZXDA 4NB7A 1HTYA 3DHPA 3C08L 3MJ6A 2CNFA 4N2OA 4X4XA 5EOQL 1KXQE 1OPGL 2V6HA 3LZFL 3FUNA 3D0VA 3QUMB 4QTFA 4IU3A 5FFOA 4AKOA 3P9MB 5E9DE 4XCFL 2V9UA 3U9UA 1NAMA 43CAA 1X6NA 1YDPA 4U1KA 4I8DA 2OULB 5JO5A 1P53A 1C5DA 1SLVA 2UZYB 2C3XA 1JPST 3KZ8A 1PEZA 1O75A 3MRIA 2YDUA 4IDLA 3LNIA 5AOJA 5LG6A 2H45A 1M7DB 5LO7A 3ETBJ 2OJZL 2Y3NA 1E4XI 3ZBMA 3V6ZA 1F3JB 2FJSA 4PJCF 2HG5B 5ICYA 4IS6A 2Q2LA 1A7OL 2ZWLT 2BW4A 3D08A 3D18B 2XFXA 3NEXA 4MZ3A 4XNBA 4TM9A 2I4GA 3QFJB 4E41E 5DS8B 2EDMA 1KGCE 3C5ZB 4P06A 4TTDD 3V4PB 1C83A 3B3IA 3H9SA 4HXAL 4XP6H 2BIMA 4OIIH 2HUEA 5IW6A 4QIRA 2MQ3A 2IEPA 2OZNA 1IIKA 3LH8A 3S4SB 1RJCA 2QQLL 5GJSL 4DP9X 4YEEA 1KOAA 4MXWL 4LSSH 4N2LA 5IOPB 2V9RA 4R0LA 2VXQA 3QZWA 3KYNB 3S36H 3IWUA 3EF7A 1ZTXE 2M26A 2V5SA 1WUZA 2IMMA 3T2OA 1TITA 3PWJA 5E9AA 3CGTA 3HPJA 5FC9A 1UACH 4WI8A 1S9XB 5A6LA 1B2WH 3MGOB 3RIFF 3TFKC 1UKQA 4RSYA 5K33A 3L4WA 3N1QC 3QJHA 1ZLUK 3REVA 2GT9A 3NFNA 5IB3B 3QRFM 1AR1D 1IGCL 3GF8A 4HMDA 4XBEL 1MKFA 2QKIB 4POUB 1A6VH 4H26B 3CC5B 5ICZB 4L2YA 4PRIE 2CM6A 4G9FA 2WIIA 4RFOH 4RX4A 3LN4B 1J4XA 2JK5B 4PJXE 1U93A 5ILTH 4K23H 1A7RL 1HHIB 1RERA 4J51A 1HNFA 2H4GA 2ORBH 5D70L 3L3OB 4Y5VB 5F44A 5FECA 1G5AA 3L3HA 4LF3B 2X4UB 1QHPA 1OPGH 2DMCA 4MD5B 3WHXB 2PCPA 1PZCA 4WFFE 2MCAA 4DOHE 3EJSA 2Z34A 3NIFB 1ZHKA 2AGJH 2H0JA 3EYUL 2NZIA 3HE7D 2C4XA 4FA8A 2F8OA 2WQ8A 1J1PH 3C60B 3FFCE 1T2QH 4LVHB 1UFUA 2AM2A 1JF1B 1JHTB 1FO0A 1R19A 3NCWA 1A3RH 2X05A 5JPMA 3WN5A 2WWKO 4WEUD 2W9LA 1IFGA 1ONQB 1KBWA 3INUL 4ZO8A 5DYOA 3RA7H 3CLFH 2ZCKH 3QK0A 1RZ8A 3AW5A 3OAYH 3T4YB 4QNPE 4NX0A 3QAQA 4Y4HA 2Q7NA 3I9IA 3LEVH 4F2MB 5D4HA 5HGBA 3D6GA 3HC4L 1EAJA 1Q6JA 3KG5A 1LNUB 2V37A 1ZRUA 3HW7A 4H1LG 5DJYA 3RFZB 2I6PA 1BMZA 2PPEA 2GJJA 5DWUH 1OPOA 3PUUA 4WDIB 3KYKH 4FYRA 2W0LA 5KYUB 2VO5A 4KUCD 1CURA 2DQJH 5KA4A 4H1LB 3VXTA 2QGBA 3N42B 5I6MA 1W6LA 4CSPA 5FYJH 3DX9A 5B38B 5I23A 3D42A 4ZSOA 1DFBH 1JWSB 1NINA 2I9LB 1Z9PA 1NLBL 1DQLH 1RHHB 2EACA 4IBVA 5KUMA 2HP4A 3ZX1A 1FO0H 1XTMA 2VM9A 3BP5B 3QCMA 1D3CA 4U1GB 4HJJL 3EBHA 3QJQB 1BVLB 2IH1B 2JJVA 3DHJA 2R0BA 1V7NH 3I50H 3V6BR 4HFUL 2A6KB 4E9QA 1Q1PA 3VMPA 2EO1A 2X9WA 1H6EA 5IB2A 4PJAA 4LASL 5DEGB 2WZPA 1R5IA 3PP3K 4KJYA 3V6OA 4ENEC 2QKIC 3SEPA 2IGLA 2DWYA 2Y5EA 4P2OB 4PJ9C 1NGZA 4R8WL 4HKZA 2EJ1A 4UT9A 4L8BA 1J12A 4YZFE 3O45A 2C9AA 3RWGA 4F33A 2IMGA 2VRKA 5C0FA 5BOJA 5IQ9A 1MJJA 4AM0A 1TMQA 4YSEA 5BMFL 1PY9A 5CFAA 4YR8B 1DEDA 4V1DA 5BUGA 2HRPH 2KI6A 4BFIA 1IAMA 3ZYZA 5JORA 3U7AA 3PWPE 2DWEB 4L2LA 1V7MH 4AYMC 4A7VA 2XX1A 2Q87A 4CDGC 2FIKA 2WSPA 2YRPA 3Q1SH 5E2VL 4EUPA 2D8KA 4CNIB 4GXFA 4TS6A 1BP3B 1VKXB 1AE6H 4BK5C 1FV1B 4XMLH 1BIHA 3LXBA 4YXKL 1BCIA 5DUPH 4HRFA 3BT2H 2V3DA 4JCWA 4KQ4L 1IM3A 5K59F 3S37X 1MN4A 2VW7A 2LTQB 3FOMB 2PO6B 4YQXH 5MEND 1LK2B 2FL5A 4B6ZA 4N6RA 2F6FA 5E5MA 4MQSB 4KTDH 4OZHE 2JCCF 1HL9A 1KC5H 3B56A 4DQAA 5JHAA 4LSUL 1TZHB 1SFHA 5IMMB 2B4CC 4RESB 2FX8H 1WBXA 1PZ5B 3UC0L 2P5WA 4K5LA 1FYTA 1NFIA 2X53A 1HH6B 4NGHL 2OSXA 3F7LA 4PG9B 2X1WL 1M3IA 3BP6A 5KSVB 1SHXA 4JFQB 4O5LL 1PVHA 2K6ZA 3OSVA 4PJ5B 2FUQA 4P46D 1JPSH 3NZ8A 5EZLA 4IKNA 1OTTD 3S4OA 1NIEA 1HCVA 3QI9A 1NCCL 5IESL 4WV1C 5ESVB 5E7FA 2AV7A 3MZGB 3VGDA 3B3BA 4A39A 1PTVA 5IUSA 4JZJC 4YIQA 5E8EB 3WKMH 1CGTA 4BZ2A 3CFKB 4HEPA 2F7PA 1X5MA 3PP4L 1L7TL 1M6OA 5IBTH 4YX2H 1YZ4A 2AMGA 3K72B 1GMIA 3MU3A 4UM8B 1WIUA 2ILLA 2DMBA 2I07A 2EXSA 2ITFA 4Y0GA 5J13B 3ULSA 3HAEH 2ZCZA 3P30L 4JG5A 2CCWA 1J18A 1UJ3B 3IJYB 4XWGL 2G2RB 5HYSG 1RP8A 4JM2D 4P2QE 1X4YA 2KLRA 2JMRA 5FM4A 3RX5A 1RV6X 2VDRH 1A3ZA 4KDTC 3AVEA 1DN2A 3Q2NA 1K5NA 2X1OA 3B1TA 4LARH 2OJEB 2VDLL 4PJHB 2JLLA 4GYBA 4ZUVA 4H0LC 4MRCA 1RURL 2XV6B 4NNXA 4NQEB 3WL9B 1V54B 2ZYRA 1GOHA 5K69A 2EDJA 4LVOC 3KXFB 3NIFE 4DGYL 3OJDA 5DR5L 3SGJA 4FLOA 2DM4A 1LDPL 1U41A 1EO5A 1KG0A 3BH4A 4JZOB 1JNNL 4Y1AE 2YLHA 2PW1B 3T04D 1FZJB 1NMBH 2JKLA 2O5YH 5JUEH 1HHHA 4NX8A 4XTRD 4QDGA 1PMYA 2PWHA 3PPEA 2A8BA 5F7EL 2EH7L 1ZDSA 2G5BB 1IKNC 2GJ6D 3H9SE 3JZ7A 5CLXA 4JO5A 1KB9K 2SHPA 1RIUL 1JGVH 3IU3A 4QOKB 4WKZB 2E7MA 2E9BA 3QIBD 3DI3B 4TTDC 3GSVA 2ZXAA 5CJXA 3EAKA 4K15A 1E9PA 4Y5XC 3S34L 4EXKA 1NBVH 3KDMB 4GSQA 4XVTH 3RVUD 3MR9B 2F54B 3IS1X 4MJ4A 1GPOL 3CLEH 1JPTH 2FTAA 5CJ8A 3CZFA 1MKPA 4HJJH 5LCVH 1JLNA 2JFGA 4XPBL 3OKDA 5I6XC 1L9SA 4DUWA 4Z7WF 4WWPA 2IPKB 4KMQA 3EO9H 3BFWA 2NT0A 2YK1H 1RJYB 3PLYA 5F6HJ 1A6PA 3GHBH 3N5AA 5AW9B 3VG0H 4HC1L 3NZHH 2JKTM 2XJAA 1M9WA 1TZGL 4JNXA 3JV5A 1WAXA 1U92A 1UD8A 2V3FA 2IBZX 3CDGA 3DVIA 4UYPA 5DR5H 3ZSSA 3QCNA 3CFCH 5BRPA 5FV2A 2HWZH 3CFJA 4ONGL 2J3SA 4NZ8A 1KIRA 2QPUA 4MLSA 1NANH 3QCDA 4PLOB 2NMSA 4DN4H 4YDLB 3CMGA 2NXZB 1ZPLA 4HIIA 3C9NB 3O6LL 2NW3A 2F18A 3WHE0 2PYFA 4XZUB 3QAZB 1T1WB 2XETA 4LLYA 2HTKD 2YEQA 3DX8B 4PRDB 1FHNA 1KELH 1UADC 5BRZB 1S7RB 2R4RL 2BNRA 5ELIA 5LBSH 2Q3XA 3SO3B 3QCEA 3G04B 5CD5D 2RQEA 1RD6A 3D25B 3D39E 2CNHA 4NUPA 3SQOL 5GGTA 1IQWH 4E9WA 4FABL 2OPCA 1WDAA 4G6KL 3RY5A 3GXIA 4V11A 2IAMB 4B97A 4LPCA 4UIMA 3DGGB 3SODB 3PDDA 4KI5C 4CGTA 1F86A 3QO1B 4JL2A 2P5EB 4LCCB 3BD3A 3LKRB 1RZJL 4KI5E 1IEAA 2QV2A 3JWNH 4IU3B 3SKOA 3WUWA 5JW4Q 2ATKB 4I2XA 3QXTA 4YE4H 1NAMB 43CAB 4PSRA 1KN4H 3SN6N 4QJ3B 2ITDB 3O6KH 3F62A 1P5UA 5FUOL 3V4PH 2Y07L 1N6VA 2UY7B 5EA0H 5HDQL 1ZV9A 2CNZA 3FU9A 4UOQA 3ZE1B 1LE5A 1M7DA 1GJUA 1JE6A 2AXFB 3GJFH 3G5ZB 5TE4H 5AB2A 2YXFA 4LGSB 3DMMB 1YECL 4A04A 5CZVL 2FAUA 2FX8L 1FF5A 5DC9B 1ZANH 2DKMA 1MSPA 3AB0C 5FB8A 4O2FB 2WHVA 4A37A 2VOSA 2EIZB 2ID5A 2PXYB 4U1JB 4WZ9A 4OCYL 5TH2A 3SYCA 5B1CA 3QUXD 5HDWA 4TQEH 1ULVA 2C1OB 3IMBA 1ZXKA 5BRZE 1CB4A 3BGAA 1DVTA 3ARBC 3QDGE 4LCWA 4H8UA 5IW6B 1R3HA 3FQTA 4LU5H 5D7LB 4XPFH 2H6UA 5E2WH 2EDEA 3WV0A 3QUYA 1EERB 3L16A 5C0JA 3DYPA 1UYWH 4ALAC 3QZWB 3G6JF 3KYNA 1XBOA 4CVKA 1HDMA 3QDMB 5LCVL 1IV8A 1FN4B 2F53B 4PY8I 5DMGC 4LPTA 4PJIA 5C07B 1JN6A 3H7BA 2ZF9A 4PRPA 1DBBH 1S9XA 1J0HA 4KX7A 1CDHA 3MJ9A 5F6HI 3TT3L 4OZIF 3LK7A 2WQSA 2NTFB 2WQAA 4YUEH 2N3JA 4OF8A 4MFHA 4LCYB 3REVB 4HU2A 3ZGIA 4MNGE 2NY6B 1OARH 3G5YA 1Q94B 1GAFL 3D5OF 1PLCA 4XN9A 2QCTA 4M7JH 4H26A 5B1JC 4OFVA 3D87B 4E9RA 3K8LA 2HTLC 1CK0H 3RPBA 3LN4A 1OEUA 4PRPE 1BEYL 1U2YA 5FK9A 2XIBA 5BZXA 3OKOA 1CQKA 2BO0A 5FGRA 4NO5A 1SM3H 3ZHKA 5FO2A 4A63A 4S10A 2CG9X 3TT3H 1MFAH 2HFEB 2YMXH 1JZGA 15C8L 3PL6B 5KYWA 2ZOLA 3HS0A 3LRGA 1UJ3C 3DYOA 4HCRH 2RA1A 3L9RB 4EDWL 2X88A 2CJTA 4X6EA 3MNWA 4YXHL 2OR7A 4HBQA 3SPJA 3L2LA 2H0PA 3CWGA 4HQQH 4Z23A 1XCQB 2ZUTA 2W60A 1JHTA 3OGOE 4XC3L 5JPMB 3W0WE 1P4IH 3SY0A 2HJLA 1M1XA 4XAKE 5CFHA 5KSUB 1GGBL 1IC0A 4NXKA 2E3VA 4DKEL 5GS1B 3P0VL 1JZ2A 4XN4A 1UUSA 2HKHL 5CR1A 5JXAH 5HGBB 3U9WA 2DQDH 1MIEL 2I60H 4AV0A 4G8GD 1U8LA 1ZS8A 3IXTA 4TF4A 5D1XD 1ASOA 5E6YA 3ML8A 4AWJC 5K93A 5I6VA 3NCYS 3SJVA 3KPNB 4XP1L 1WCBB 3D7PA 2QBWA 4Y9EA 5AKSA 3BPCA 3GTNA 4JDZB 4ZW7A 4ODHH 2DKUA 5C07E 4OI9A 2K7PA 5L7XH 3I3BA 2PUQT 1J1PL 4KH9A 2NX5B 4PJIF 5DD3L 4AZ8B 1G9NH 4OLZH 3P77A 2I9LA 4YL4A 1WK0A 3R4DA 5JYLA 4KK8C 4W70A 4JE0A 1CDGA 5PCYA 1G7QA 3D2TA 5I1AB 4PV9A 1WWWX 2MPVA 4UB0L 3ZKXC 3B2XA 3QDGB 5FA3B 1RSYA 5DD5H 3A0OA 2EKSA 1SJEB 3AM8A 3D39A 4EPSA 2GSIA 2A6KA 3VXSD 1HEJC 4KJWC 4WFGD 5D7IB 3ZRFC 1AQ8A 2EC8A 5DEGA 1YO4A 4OHLA 3EOAA 4R5XA 4KKZA 3H7LA 4OCRL 2X42A 3DO7B 4P2OA 4X4ZA 3KL0A 2Z35A 3LQAL 2N1TE 4YK4C 1R9FA 3QIWC 3FW6A 4GAJL 3DMMC 3DRTA 5T8IA 4NWFA 2H5UA 5C0IA 4N8VB 2WBKA 2ZKYA 1Y0LB 1CFNB 4IGBC 3KEDA 1IGIH 3MKGA 1UHVA 2GK0B 3HZVA 3QQXA 1NFKA 5EH1A 1OALA 1P3DA 2CHNA 4HCRL 4LPYA 2YUVA 4XO3A 1EEHA 3RJOA 1SQ2N 3Q6GH 1YJDC 2DI9A 2MKLC 4DEPB 3AACA 1DR9A 2XVGA 2V7HB 5GJSH 4CNIA 4HKBB 1VKXA 3JWNC 1BVOA 3CIQA 3ZE0F 3FCTB 1KTLA 3GHEL 1SQMA 1U3NA 4R96A 4OZGB 1S7QB 4L3EE 1RPUA 3AWGA 4BJOA 3NFSL 5DLML 1FE8L 1EUTA 1H3TA 3NCYP 4X6CA 5B39G 2AANA 5C2BH 3OMNB 3EGSA 1KCVH 2R0WH 1TZHA 5D7SL 1IEBB 4FJYA 4HS3B 2OTPA 3HMWH 1BF8A 5AWNH 5DC4B 2WTPA 4YGAB 1DQVA 4G43B 3IVKA 1HH6A 2QLVB 2RD0A 2VLRE 4KKQA 3BWAB 5H37G 3N1GC 3QQNA 5HHOE 1F8TL 4OJFL 2EVIA 2PTUA 3S4SG 3EHBD 3V4UL 4WWKB 1WGOA 1S7WB 5IMOB 4Y2DC 4EZMA 5I71C 4PJ5A 1A22B 2HY3A 1VF5C 5EZLB 5HVFB 1PQZA 2X4NB 4YBQD 1B4JH 3LPPA 1JZEA 3CSFA 3NIDB 5HVHC 5ETUB 5CEYB 3ARQA 1B0RA 3UC2A 4N0YH 4A66A 3S37H 4PW4A 1ZIAA 4GI9A 4MD0A 4UMGA 1TQUA 5EHRA 5KA3A 3STLB 3PHSA 1ADQA 5BVPH 2F54E 4FA7B 3KH3A 3CFKA 1U95A 3ARBB 4HKXA 5CD3B 3KCPA 4L0ZA 3C60C 4IIQB 5H35B 1OLZA 3S96A 4A2FA 3WN5C 2BNUA 5I1EL 2X4TA 2PP9A 4TOYL 4YHYB 1EBPA 1QSVA 3L54A 5ESAA 1WRMA 1X5JA 4UM8A 2XY2A 3BAYA 4DGIH 1CD0A 2MPAL 3SOTA 3ULSB 3SYPA 1XAUA 5F9AC 1OHEA 4Y8DC 3U6XS 4H44C 4OCNC 3T8VA 1E4XH 4JN2A 4M9PA 3UTPD 4DKAA 2P45B 4AIXA 1NMCB 4P9MH 1X9RA 2OYMA 5CEZE 4KXAA 4U1HB 4PJHE 1K5NB 2YHGA 4OKDA 4KJWD 3EFDH 4OTXH 2YEZB 2DQCL 4PJCA 1INDH 2YPLA 4JFFE 5M7QA 1X9QA 5KAAA 2PP8A 5ISZB 3PAYA 4KY2A 5D7IE 5G4MA 4U0RB 1GXEA 4NQEA 1KELL 4GXUN 1SY6H 3WL9A 5IT2H 1DO5A 4D9RD 1JI2A 4AT6B 2PWGA 4KZ0A 3KXFA 4F80A 4D9LL 1HOCA 1TU2B 3R0NA 1IJNA 4DO6A 1I3GH 4EIZC 5K5YA 4CKQA 3QFDA 2EE0A 1XXDC 1QZNA 1S5IL 2FJFA 5T3ZH 4B04A 3DUUB 3QIUC 1T4JA 2K9FB 3HC0A 2B2XL 5F9JB 4U1GC 3U9PL 4NPKA 4HUWB 5HHOB 4L29B 4YHOH 1KGUA 1CR9L 4U3CA 4UT7L 2MTPA 4ZRTA 1SN5A 1HHGA 4NCC2 5I2IA 1OK8A