3AWFA

Crystal structure of pten-like domain of ci-vsp (236-576)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
315
structure length
304
Chain Sequence
KDGFDLDLTYVTDHVIAMSFPSSNPIGEVSRFFKTKHPDKFRIYNLCSERGYDETKFDNHVYRVMIDDHNVPTLVDLLKFIDDAKVWMTSDPDHVIAIHCKGGKGRTGTLVSSWLLEDGKFDTAKEALEYFGSRRTGDVFQGVETASQIRYVGYFEKIKKNYGGQLPPMKKLKVTGVTITAIQGVGRGNGSDLSMQIVSERQEVLLCKFAEGYNCALQYDATDDCVTCEVKNCPVLAGDIKVRFMSTSKSLPRGYDNCPFYFWFNTSLVEGDHVTLKREEIDNPHKKKTWKIYRDNFTVKLTFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-sensor containing phosphatase
publication title Crystal structure of the cytoplasmic phosphatase and tensin homolog (PTEN)-like region of Ciona intestinalis voltage-sensing phosphatase provides insight into substrate specificity and redox regulation of the phosphoinositide phosphatase activity
pubmed doi rcsb
source organism Ciona intestinalis
molecule tags Hydrolase, membrane protein
total genus 103
structure length 304
sequence length 315
chains with identical sequence B, C
ec nomenclature ec 3.1.3.-:
pdb deposition date 2011-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00782 DSPc Dual specificity phosphatase, catalytic domain
A PF10409 PTEN_C2 C2 domain of PTEN tumour-suppressor protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3awfA02
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3awfA01
2VEUA 2FHCA 5K24A 2MBCA 2C46A 2H04A 5K9WA 2QDPA 4TVVA 2J72A 3SMEA 3D9CA 3GXHA 1ZCLA 3RZ2A 1NZ7A 2H03A 2CNEA 2F6WA 4Y14A 1VHRA 2CM7A 2B4SA 1RPMA 2I6IA 3O4TA 1YTNA 2CM8A 1C84A 3ZV2A 1U26A 3BLUA 2J44A 4QUNA 2NLKA 4MBBA 2B07A 2HY3A 3QCGA 1YGUA 5BZZA 3D42A 4ZN5A 3A5KA 2F6ZA 3S4EA 2CNIA 1FQ1A 4B04A 1ONYA 1XXVA 3F81A 2AZRA 3D1QA 4GRYA 1SUGA 1PA1A 1PYNA 1OEUA 2FJMA 3I80A 1NWLA 5KA9A 4PYHA 2GJTA 1G4WR 3S3EA 4GWFA 3EB1A 2H4GA 1RXDA 4RDDA 1M3GA 5KA7A 2QCJA 2NV5A 3U96A 2SHPA 2I75A 2Q05A 1OEOX 2QBSA 2ZN7A 2HC1A 2HCMA 4RI4A 5KAAA 4I8NA 4RH9A 2ESBA 1NWEA 2BV5A 2PQ5A 4Z6BA 1BZCA 1L8GA 1D5RA 4DGXA 3SR9A 2I5XA 4OHLA 2WGPA 2GWOA 1OEVA 2VEWA 4JMJA 4KYRA 5BX1A 2Y2FA 4ZI4A 5K22A 3NMEA 4WOHA 2HNPA 3S3KA 3I7ZA 4WU3A 1J4XA 2BGDA 3RGQA 2DXPA 3A5JA 4YAAA 1G7FA 5EHPA 4PVGA 2I1YA 3QCCA 1T48A 5K25A 2YDUA 2J43A 2VEVA 5KA1A 2OZ5A 3ZMPA 2G6ZA 2J17A 1V3AA 1YFOA 2A8BA 2CM2A 1ZCKA 1XBOA 2BGEA 4WTYA 4DGPA 1U25A 1C83A 2QEPA 1G1FA 4HRFA 3F99A 4ERCA 3V0EA 2H4KA 1QZ0A 1PTYA 1OHDA 3OMHA 1ONZA 1T4JA 2PSZA 4ICZA 1T49A 2NZ6A 4H34A 4KI9A 1GFYA 1PTTA 4GE6A 2I42A 2I4GA 1JF7A 2F6FA 3V0JA 2Q47A 2I4EA 4D3PA 4GRZA 3O3LA 1GWZA 1QXKA 2VEYA 4NYHA 5LXQB 3RGOA 1PTVA 2CMBA 1C87A 4R0TA 2PA5A 4OHDA 2CFVA 1I9TA 3F9BA 1ZC0A 1Q6MA 4RHGA 1Q6NA 1OHCA 2B4UA 3ZMQA 3EAXA 3QCDA 4OHHA 1OHEA 3D1HA 3AWEA 3F41A 1NO6A 4NWFA 2CJZA 3QCEA 2VEXA 4BPCA 5KA2A 1ECVA 1YTWA 3OLRA 2I3UA 1YGRA 3I36A 3MOWA 2F71A 2FJNA 4RH5A 2AHSA 4BJOA 4R0SA 4GS0A 2HNQA 5KADA 1OETA 1C86A 1G7GA 2YA1A 1BZHA 4QUMA 2J16A 1FPZA 4NNDA 2HB1A 1LARA 4NWGA 1YTSA 3QCKA 1OEMX 3PS5A 3D44A 5K23A 3V0IA 3BM8A 4JMKA 1XM2A 2NT2A 4J51A 1A5YA 3AWFA 4HJQA 1ZZWA 2Y96A 2HXPA 3BLTA 4H1OA 4Y2EA 3EU0A 2B49A 1G1HA 2BIJA 1PXHA 4IKCA 1PH0A 4NX8A 2F6VA 1Q6JA 5BZXA 3QCBA 3QKQA 3RO1A 4S0GA 2HVLA 2NT7A 3QCFA 5IBSA 2QCTA 3S3HA 2QDCA 2H02A 1PTUA 4WU2A 1YN9A 2F46A 3V0DA 3QCHA 2I6OA 5MMZB 2CNGA 1WCHA 2B4OA 2FH7A 3ZM2A 5KABA 3AWGA 1LQFA 2CMAA 3V0FA 1WAXA 2QDMA 1Q6PA 2PBNA 4OHIA 1G1GA 5HDEA 1L8KA 2G59A 2OC3A 2ZMMA 3QCNA 1P15A 2J71A 2P6XA 2I6PA 2R0BA 4JNBA 3ZM3A 2F6TA 4GFUA 2J73A 3QCIA 3MMJA 5K9VA 2I6MA 2C7SA 2P4DA 1C85A 2B3OA 1WRMA 3QCMA 3M4UA 2I3RA 1YPTA 1FPRA 2B4PA 4GE5A 3O4SA 5KA3A 1MKPA 3D1OA 4QAHA 3EZZA 2CMCA 5I6VA 1Q6SA 1EENA 1NL9A 1G4US 1KAKA 1YZ4A 2E0TA 1XXPA 3CM3A 4AZ1A 1EEOA 1I9SA 2HC2A 2F6YA 3BRHA 3LJ8A 2OOQA 1PA9A 4RI5A 1Q6TA 4D3QA 1JLNA 2BZLA 5IBMA 5KA4A 1XRIA 4QBEA 3QCJA 4R30A 3MOZA 3F9AA 2F70A 2CNHA 3GXGA 5EHRA 2IMGA 1YWFA 2M3VA 1Q1MA 2PT0A 1KAVA 4RKKA 5KACA 1U24A 2I4HA 2CM3A 1LYVA 2H4VA 4YR8B 4D3RA 5M43A 4JBCA 3QKPA 3ZM1A 1AAXA 1C88A 2A3KA 5KA8A 5KA0A 2I6JA 4HJPA 3N0AA 4QAPA 1I57A 2OUDA 5BUGA 2QBQA 2PI7A 3V0GA 2RF6A 2GP0A 3O4UA 2YOCA 4ZRTA 3H2XA 1BZJA 1OESA 2JJDA 4KYQA 1R6HA 3S3FA 3V0HA 3EMUA 5AWXA 3ZM0A 2FHBA 2NTAA 2CNFA 4GE2A 2QBPA 3QCLA 3O5XA 1X24A 4OHEA 2FHFA 5J8RA 5GTJA 3B7OA 4QBWA 1NNYA 2QBRA 3CWEA 2J16B 4GFVA 3S4OA
chains in the Genus database with same CATH superfamily
1YN6A 1SVBA 5LUMA 1QR1B 4OAWB 5FO8A 3FCUB 4NRZB 4JVWA 5FB8B 3QQ9C 3LN4B 5DJAA 5EUKA 2DI8A 4YEEA 3CDGA 4BCXA 4PW4A 2C46A 1JWUA 1HEZA 2OZ4L 1QPXA 1Q72L 4OH2A 3P4OB 4Y16B 2X0UA 4P3DB 3SD5A 3ROOB 1JDDA 2ZUVA 3L95B 4GQRA 4FQHA 4LQFH 1JGEB 1C8QA 1NMBH 2ICEC 4BQ9A 4AL8H 3VXSA 4HJEA 3P11L 1EUUA 2O61B 1KLFB 4QTIL 2H03A 3QCZA 1F13A 3P3UA 3BP4B 1ZHNA 1XGTA 1AGEB 1L9QA 1P7QA 2DI9A 5HDRA 4LARH 1H8OA 3ABGA 1P4BH 4QR7A 3W0WE 1YNKL 2Q76A 3SN6N 2XKNB 5HYQB 3RFRA 4PJAF 2V0AA 2NLKA 4KKAC 4P2RA 1C16A 2D9QB 3B3IA 1AS8A 4NS0A 3BLPX 2HY3A 3TNNB 4WTWA 5DURD 4FQCL 2UX7A 3EGXB 3MMEB 1A21A 3WO4B 2UXGA 3DHJA 3IJ8A 3UDWA 4F9PA 3R1GL 4WFGD 3ECVA 3KGTA 1WFJA 4ODTH 5C9JB 4B04A 1HHGA 2HRPL 4KQ4H 5LG6A 3PDOA 4R6UA 1TQVA 4MJIE 1R5IA 5JPMA 2FX7H 3CN1A 3C8HA 3MLSL 4RAHA 4X5WB 2OSXA 4W9DC 3DTXB 3FQNA 1UWYA 1WFUA 1D5IL 3H3PL 4DKFH 2VLKB 3NCMA 1U8PB 1NBZB 3WV0A 1MG3C 2Y0SA 1HTYA 2B5IB 1P69B 2W60B 3KJ4C 2J21A 4G43B 3BIKB 2OI9C 3VDCA 2XPGB 2W92A 3UZVA 4TVPD 1HXMB 4PG9A 5DQJB 5BXFA 2FZ3B 3BP6A 3DJTA 4K8RL 3F7VA 5HXMA 5MP6H 1FFOA 4Y1SA 4Y9FA 5DMGD 4NZFA 3VXNB 2IADA 7PCYA 3VI4F 4GI9A 1U33A 3MRGA 4MDIB 2Y2WA 4NBXB 2EDEA 4ODSL 1HE7A 1DVFC 2BV5A 1FV1A 1YEGL 4R97C 1R3JB 3NIDB 1EA9C 1FGNH 5AKSA 2AXHA 4X6FA 2R29H 4PJEA 4HUMB 1EGJL 4ZTOH 5HDBB 5IV2A 2BY0A 2YD5A 1T1XA 3CFQA 4NZRH 5DRZB 4MKTA 4JKMA 4QO1A 1MVFA 4AITA 1A9EA 4TTDD 2RFXA 2VSCA 4K94H 3HR6A 1CLYH 3MCKA 1H3GA 3V4VA 2HTLC 3F2LA 3I6GA 4LEOA 4PUBL 3FRPB 3GZPA 3DGDA 4ZMNA 1BQUA 5GGRY 5CM1A 3GSOA 4UM9A 3IFNL 5B7MA 5AVXB 3O45B 4XC3H 5BVPH 4FNPA 2JKJA 3BZEB 2R1YA 4OFPA 1N0LB 2GYSA 1G84A 4PVGA 3SEPA 2PXYA 1ASOA 3QZLA 1T48A 5H37H 2Z4QA 4L9DA 2GAZB 4OV5A 4GG8A 4JFZL 3KLQA 5KYWA 5DD5L 5C3TA 4J28A 5IM7A 1FZOB 3FW6A 3LHPH 4U6VH 1QA9B 1BAWA 2ADIB 2EECA 1MHPH 4I3SL 2XLLA 4DIXA 3A4DA 1HDMA 1YY9D 4HEPA 4K5PA 3SPIA 3ZE2F 2ITDA 3RUGB 3G5VB 1IEBB 3ECBB 4H1LH 2DMCA 2ZOLB 2MTPA 3LYRA 4JRXE 4LEXL 4PRBB 1X5HA 3QQ9D 4JHUA 1AO7D 4N85A 5AW6B 3F99A 1IC4L 5L2JA 5JLZA 1QZ0A 2WWKO 2QELA 1IMHC 5C0JA 4UYQA 1K6QH 1PLCA 2VTDA 2ITEA 5TF1H 4FG4A 1OAYH 4KI9A 1GFYA 3MCYA 4WNQB 2Z34A 3P3SA 1WT5C 4AYFB 1QFPA 3HPJB 2E6QA 2VLJD 3HUJB 5AZ2L 4N8CL 1J8KA 1UZGA 1PTVA 2DS4A 2UWEF 4PJHF 2CMBA 5F7EL 4P5MA 2C4XA 3BVNB 3VXUB 2Z92B 1FG2A 1SYVA 1MN4A 2E8YA 4GP8B 1NAML 1UJ3B 3AB0B 3ULAB 4KKAD 2Z1PA 4P9MH 4FQXA 4M02A 4OLWH 2AQQA 1TJHL 3SODB 4HH8A 3D39D 4U1SB 1THCA 3I75A 4OIFA 3FULA 2I85A 3LV3A 1IEAA 4RCAA 1OPGL 1SOKA 2FQFA 2Y2TA 1OHEA 3AWEA 4PVLA 2BSCA 4OGYH 5I1KL 4ZSOE 3RWIA 2OCJA 5T1KD 3TPUA 2XN2A 3CFJA 3PF2A 4G8FB 3OLRA 3NJMA 4JLRB 4CVZA 5H35B 4M61B 4LQFL 5E99H 1BD2A 1I8UA 1U8OA 1NMBL 4H26A 3H4FA 4AL8L 3P30H 5C0BB 4RH5A 3C87A 2X9ZA 1B9KA 4E41A 3KYNA 4Y19D 1F3RB 3MRNB 1I8KB 2BOLA 3RIFK 4ZAKA 5L2KD 1QEXA 3M07A 3V6ZA 1P4BL 5LCVA 4UQBA 2F8OA 4PGEA 1A1NB 5JDSB 1OSZB 3L9YA 3VSTA 1BQHG 2O1AA 5E8NA 3TBSA 4FF9A 5FYKH 2CDEA 4FFZL 2BVPA 1R0AL 4FXTA 1XH1A 3DTDA 4QOKB 3UBGA 3SJVD 4MMYB 3MC0A 1FNEA 1NFIB 2A0LC 3HG4A 2OYMA 2X28A 1T83C 1DVFD 2BHZA 2P42B 4AH2B 4JMKA 3BPCB 3FN9A 4ODTL 2X0VA 1IGTB 3L9EA 4G9FE 4CSSA 1VFBB 2FX7L 1KENL 1AOHA 3CG8A 5A6MA 4GO8A 1FL3A 2EABA 5FDWB 4R5XA 1F0LA 1YJDH 2BWDA 3SY6A 5FFLA 3MRPB 4IKCA 3TEZA 4YDNA 4DKFL 2AJUH 3A6CL 1UXSB 2IANA 3NPSC 1R3IH 3ISWA 2DTMH 3FO0L 2UY6A 4HGKC 2NT7A 2PW2B 3KVQA 4NYLB 5HHNB 3R8QA 2F61A 2AKRB 2AJVH 4P2AA 4KPHH 2HTLD 2CPCA 5I19L 1ORSA 3PPEA 3TWYA 2G75B 2XA3A 5HI3C 5BV7C 2VTEA 2O6FA 2O6EA 5IVNA 4GUOA 1UM5H 5MP6L 4E5XA 2HVKA 4NXKA 1R24B 1TR7A 3NRSA 4L0PB 4B9GA 2QHLA 2A73B 1OEZW 3UTTB 2DMGA 3KW7A 2MQ3A 1NJ9B 2XZCL 4KVCH 4EI0A 1MW3A 1LE5A 4N8VA 3OQ3B 3GJFA 2ZXDA 4M6OH 1I8MB 3BAIA 3VNYA 4DQOH 1KCUH 3P9WB 3T6WA 1GS6X 1U3HB 3N40P 4IBZA 1FGNL 3WIFB 5EU6E 1M6OA 2YSSB 1YUKB 3ZIMA 1YYML 2F5BL 5HYFA 4ZTOL 4F33B 4Y0GA 4NZRL 2ITFA 3G6AA 4Z3IA 1P7HL 2CO7A 2BMKA 3GMRB 1Y07A 3NZHH 2NTFA 4K94L 1CLYL 1ZVSB 2XJLA 3QDME 3I9GH 3PUCA 3QG6A 3T0EE 4U1GB 1G7HB 2HJKA 1GZHA 5AENA 1F6AA 3MV9E 4N5UA 1NEZB 4PJXE 1S7UB 1AKJB 4X4MA 5CU9A 4XC3L 3M7FB 3MREB 2BIOA 5BVPL 2W0FA 2K3HA 3WJJA 2KHAA 4KFZC 5JOEA 1IM3A 2XIBA 2GBUA 2C9SA 5AOLA 2VDLB 4NERA 1Q0XH 3TEYA 3DHMA 1M2OA 3KYKL 1KYOJ 3LHPL 2QMKA 4U6VL 2CO6B 5I76A 1MHPL 3BUBA 1EO5A 3HW7A 3POCA 1I4FA 2NUTA 2XXMB 2W8CA 4PJ7F 1RQ5A 3MTXA 3EDEA 3CGTA 3BAEL 1MDAA 5DHVH 2EUVA 4NP4H 1MJUL 2ROYA 3I9PA 2QSVA 3RPIA 4MQXC 5FS5A 2UXVA 3GSNA 1P5VB 4XHJC 1K6QL 5LB1A 1I3RA 2PKDA 1DO6A 4G70B 5TF1L 3MOZA 4CVLA 5C08D 3MLXH 1OAYL 4Y89A 1WTLA 5MEPA 4X7CC 4UMSA 2CNHA 4KZCA 4OUOA 3D3VB 4GS7C 3V0WH 5EHRA 2AQTA 2Y2YA 5H94B 2GBAA 1FNHA 2EH7H 2JQMA 1S9XA 1THAA 3EH1A 3HS0A 4S1RH 5ISZD 2CR6A 3NJLA 3T04D 1BP3B 5D1XE 1JNNH 1LTXA 2Y6TE 4QRRE 3ALXA 5DQ9B 5DMKB 2HKAA 1RXLA 3EYOA 4AQAA 2DQEL 1G7QA 3FT2B 4GSDH 4F7EB 1UH3A 4DO5A 5DF0A 2H4VA 3DGGB 4Q6IB 4OLWL 2R7EB 3RVTC 1AANA 1G1OA 1LDPH 2FSEB 2A0LD 3F6IA 3TA3C 4BINA 2XG5A 2MEJB 4JFED 4NX0A 1CJYA 4WI0B 1GGTA 5IUSA 2QQQA 3RGVB 5CEZD 1PCXA 3QNYA 4IRSB 3X13A 2AXJA 5I66A 3WL9A 3IMVA 4KNTA 4OGYL 4OIIL 2X2IA 1ZS8A 3DVNB 3PAVA 1FPTH 3AABA 4HS6B 4ZD3H 3CVDA 4HAGA 4QAPA 3QJUB 1IBBA 5I0VA 2G0LA 5E99L 4PJBB 3HBGA 5I1IH 2ZUYA 1BVNP 1AKPA 3V0GA 3P30L 1AQ8A 2M2DA 1VEMA 3EW3B 1K8IB 4U1JA 4EPSA 5GS2D 1DVSA 4H1LB 1ERNA 4U4BA 4HU2A 4NZ8A 3ZT7A 1EAQA 1H15A 3MV7E 4FKEA 1R6HA 5DYFA 2DQFB 4GRLB 3OAUH 3HPLB 1EWHA 1ZSHA 3C6LA 4QHNA 4WSJA 5FYKL 4KKZA 1Q9WB 5CXPA 4UF7C 4GE2A 3DYMA 4QY8B 3BHBA 2H6PB 4JFWA 1QHOA 1ZDSA 2VMFA 5MHSE 1WZLA 1JPGA 5IEKB 4GSUA 4KKNA 4U1KA 3M1BB 3S2AA 1XH3B 4L1SA 3KBFA 2H8PB 2YK1H 4OI9A 3ZK0A 2Y1VA 4DFIA 3PL6C 3SDAB 5IT2H 5IK3A 1PYWA 2OSYA 5J11B 3QUHA 4XNQB 3GXPA 3U2JA 1TTCA 4AMWA 1Z0NA 5G4NA 1IU1A 5CJXC 1CFNB 1DUZB 1HZKA 1H5BB 4H8VA 5FW8A 2AJUL 2XN9B 4X6DA 1CFSB 4AW4A 4D2NA 5K69A 1J8RA 1R3IL 3DK0A 2X4NA 3AU1B 4ZOAA 5K24A 3P54A 5EBLB 1LEIB 1FNFA 1UA3A 4LCVA 1UEYA 2AJVL 4LESA 4KPHL 1EBAA 3NIGE 5MENB 4OF3A 1PW3A 1AHWC 1QI5A 2XACC 5I0ZA 4PR5B 5HVHB 1RUAL 2J72A 2FJFA 3EUDA 2C7UA 1TU2A 4H20H 1R3KB 1UM5L 3CIQA 1HXYB 2GI0A 5G4MA 5EOCH 2HRLA 5E95B 1KN2H 2X4QA 3FUKA 1ED3B 5DO2C 5C8JB 1CLZL 4KVCL 4NWUH 4JNXA 1XEUA 3KWVA 4M6OL 1EV2E 2P80D 1YAZA 1KCUL 5E56A 4MSWB 1W72H 1C7SA 1EAPA 1IGCH 1A65A 1DLFL 2CU9A 1AP2A 3D34A 1XGUB 3U2SA 2ZUSA 4QXTB 4MQ7B 1JYXA 3EH5B 5FUCE 5A2KH 1HH6B 1OB0A 2PO6D 2QPSA 2A74B 1E9OB 2IF7A 3NCJH 4I8DA 5E4IA 1CYXA 2ZOUA 3QQ4A 2QLYA 3U30C 1EO8H 4PM1A 1EFXD 3WXVL 2NXZB 4MQXD 4X5LA 2PP7A 3IPBA 4ZPVB 3NZHL 4XHJD 1H6EA 4AMKH 3I9GL 1XGZA 4JQXC 4LSQH 2G2RB 4PY8I 4QYOA 5D7IB 2Z91A 4DT2A 1WZ1H 1PYNA 2FDBP 2Q9OA 4LLMB 3ASOB 3BUYA 4LIQH 3P2BA 3VGBA 3OJ2C 4BWWA 4KZ0A 4P2QA 4M9PA 4AIXA 4Q14A 4MKMA 3ABLB 4J2XA 3K0WA 2CJSA 3QUZB 3SO3C 5DJZB 1Q0XL 3EBGA 4ZFZA 2BP8A 3WD5H 1BFSA 3SBRA 4LSDA 1B0RA 2FIRT 1NPJA 1UGKA 4RFOH 1LP9B 3RPKA 1BAFH 1CPUA 4P46B 5C0IB 3K4ZA 3SPVB 3T4YB 4C57C 1AXSB 3RVTD 2XCMC 1I7RB 1R6VA 3CHSA 2YUZA 2P47B 2OMYB 3TA3D 5EBMB 1U8HA 3TZVA 4Z7OB 2ZX7A 2LVEA 5GJSL 3IF1A 4RMWA 3T8MA 4NP4L 4UTAA 4YHZL 1UC6A 4RH9A 1J18A 3BMVA 2RJMA 4Z7NE 3O2DH 1RIUH 4JZJA 3EJSA 2AANA 4L4TA 3NP3A 3H3KA 4JRLA 5C0FB 3MLXL 1IBGH 3U6RA 4DGXA 5DD1L 2EXYC 3WOVA 4YUEH 3V0WL 3BX7C 1NQBA 1F3DH 2ESVA 3Q5YA 4NPYA 3NFPB 3ZX1A 5IREA 4N25A 3IGUA 2EH7L 4S1RL 1WBXB 4M7ZB 3K6SB 3DV4A 4ANKA 3BFWA 2DKSA 3MRLA 2GG1A 1JNNL 4G6FD 4XTRC 3MNMA 4PB9H 1JK9A 1XBRA 3VXRE 6TAAA 5CKGA 1PPIA 4GSDL 3UZQA 2P8PA 1EHLH 2X6UA 4ODHL 3QUKB 5EZJA 1I3UA 4HWBH 4ZXBC 5HHOD 1BVOA 2MPVA 3L3HA 3JV5A 2GJ6D 5IMKA 1A3ZA 4Z78B 2A3TA 3EF7A 1G7MB 3MRIA 3SQOH 1ITBB 1DQQB 1IQDB 1QATA 4AT6A 3CHRA 3LQZA 4PJDF 4M6ML 3IGFA 3QCCA 1L7TL 1JF1B 3PL6D 1EQWA 1MW0A 2J43A 1DN2A 3O3AB 1U8NB 5F3FA 1FPTL 3IDGB 4MAZA 5G4OA 4KO7A 1SF5A 3DECA 4MD4A 4ZD3L 4F9LC 2G6ZA 1EZUA 3ZMPA 5I1IL 5E5RB 2A8BA 2I07A 3JTTB 5LJYH 4FAAB 3AGVA 1JNJA 1UXWB 3DX3A 1AZNA 3PGDB 4NQEA 3TCLA 1PZAA 1X7QA 3X1GA 4EKJA 3FQWA 5DHVB 1PTYA 1KBGH 5ABZA 5DRWB 3OAUL 1J0ZA 3F00A 1A6AB 4YDKH 1X6LA 2F53E 2JB6B 2NY7H 4I1RA 1QLRA 2KMWA 3CFNA 1PTTA 1N59A 5DS8B 5DO2D 4DZBB 5HJDA 5CGMA 1CF8H 5SX5K 3WE1A 5F3HA 1OWWA 3CVHH 3IFLH 2YK1L 1MUJB 3ZRFC 4CSZA 4DK3A 2WOBA 1LWRA 4OZGF 2O5XH 4F7CB 4ZQKA 2YXVA 2WCGA 3WS6A 1D5XA 4JZOB 4MS6A 3GNMH 2V2XA 3B2UD 3QI9A 2CFVA 3DNKA 2LLNA 2HLEB 4RHGA 1X5IA 4R3SA 4BHUA 1L0PA 2Q10A 3U46A 4R0LA 2B4UA 3SYPA 1XF4A 4NO5A 2NCMA 3G3LA 2L8AA 1UZ6F 4JO1L 2YHGA 3GXNA 3IMSA 3PIQA 1TOXA 1F4WH 2ARWA 3MBWA 2NZIA 2V7NB 2P7TA 4NRXB 1S7RB 1HHJA 1S7TA 2FL5A 3LRSB 4DGYH 1F02I 2IDFA 4H20L 1T20A 3VH8A 3L3JA 4QRPE 2I3UA 4HKXA 2G0KA 4HCFA 4KTYA 4S0TD 3ZTEA 2YC1B 2I24N 5CEXB 1KN2L 2GSGB 4TULH 5CZKA 2V6HA 1QZ1A 1INEL 3QI9C 4NWUL 1QFUH 4HT1H 4PJ8A 2AVGA 4PGCA 5G5DB 1OETA 1JZ4A 2C8NA 1EFQA 3U1PA 1KB5H 2R2HA 4Z0XB 1ZV5A 1W72L 4DGVH 2GJRA 1G7IB 3DURB 1MI5A 4JEGB 3S7GA 4EI5B 4IBLT 2OS7A 4D0CB 3D1MC 3UAEA 3NCJL 2C3GA 1A6TB 1NFDF 4Q9RH 5DK0B 2QR0B 4PVNA 3D44A 1LQSR 2FH8A 3AADB 1NGQL 1XB3A 1NOAA 2V8LA 5TPWH 1HU8A 4ELDA 1BLNA 2NYKA 4S1SH 1XM2A 3N2JA 3US0A 4XO9A 1JJUA 3Q8BA 1QABA 4PJ8C 5EZLB 1JXJA 2Y96A 1M7UA 4LSQL 1S78C 2V33A 1KIQA 5EV7A 2R51A 4IKKA 3DOHA 3WS3B 4UBDD 2CK0L 2EXYD 4ODVH 5CGYD 4IRJC 2I5YH 5IF0B 4QHLB 1RI8A 4X9GA 3T9WA 1PXHA 1G9NL 1U8JB 1E6JH 3JWNC 3UAJA 1PH0A 2EYSB 2YEVB 1FYTD 3QEHA 2Y7MA 4ORGB 5GSRA 2G5BA 2WJ5A 4XTRD 5CIPH 2CSPA 5LVEA 5IBSA 1MLCA 1ZT1B 1CDJA 1FO0B 3R8BB 3B7RL 3EOAB 4RFOL 2Q6WA 4PG2C 4FL4C 4QXWA 3HHSA 1BAFL 3TASA 5KWYC 3VXMB 2PUQT 2QGDA 4ZXBD 4QLWA 4NUGH 1CBVH 5KOVC 5F7BA 1Q9LA 2PW1B 4NRYA 4OLXH 3HFFA 3FHQA 1JPEA 4XO8A 3O4LE 2OMNA 5TDOB 3O2DL 1RIUL 4NENA 4Y5YB 3LPOA 4HXBL 5GRUL 1YEEH 3RY5A 1JUFA 2FWOB 4X0NA 3WKYA 3VE0A 3WLWD 3GMMA 4BFRA 5ABDE 5KEZA 5C6PB 1MXGA 4YUEL 3VI3A 3VCLA 2EICA 4MCZA 5FFOA 4YBLC 4NKDA 4A2LA 4PJCF 2EDTA 1OT1A 4IBUA 1DZ0A 1Z9SA 3T4AB 5L7XH 1GJIA 1LE9B 1Q9KB 2WNKA 2DEYX 3JTSB 1WAPA 3NJJA 4E0RB 2YBRA 1CR9H 3HFMH 3CZFB 4PLOB 4F8PA 3BFOA 5HTSA 4OI7A 1EHLL 1D7BA 4AWJC 3DBXB 1MCSA 1R47A 4HWBL 3PAZA 2EQDA 2PWEA 5EUOF 1YEHH 1YMME 4PRAB 3UERA 4I48B 3P4NA 3SQOL 2O5ZL 1CS6A 1JN6B 5BS0E 1FPRA 1KTLB 3OKLA 3MTRA 4P2OB 2WINA 4PY7B 4JFYB 3VFSB 3VW3L 2XWDA 3I50H 4E9RA 4J3TA 1EPFA 1NCOA 4ZMVA 4UU9B 1GC1L 2LW3A 1BV8A 3QXDB 2DBJA 1A1OB 3V4UL 2UZPA 2GY5A 2ZOKA 5H8DA 3KPRA 2F15A 2YR3A 1F6LL 1CE6B 3G5YB 3L2LA 3K91A 4OJFH 2YRZA 4Z7WF 4RNRA 1EANA 3E1ZA 5LBSH 1EXUB 1B4RA 1NGWA 2AQNA 2BCKB 4AVHA 1WZAA 1ID2A 1PKQB 4CC4C 1QW9A 1KBGL 3SBWC 2ATKA 4JY5H 4OCXH 4PP2A 5HVGB 2QGCA 2Y7QB 3GB7A 3VJ6A 4K5NA 4YDKL 3F9AA 2NY7L 4Z7UA 2F70A 1D6EB 3PP4H 3DRTA 5FO7B 5CS7A 1S7QA 2WZPD 2WBJA 1CF8L 4JCLA 1GY1A 3IFLL 1A7QL 1F6FB 5KANI 3CMOH 3STBA 4F1SA 2AMUA 4LKXB 3FUJA 3EHBC 2W9LA 2GCYA 4G42A 2V5SA 3JBG7 2Y1ZA 1G7JA 2ZUWA 1G43A 4OIAA 3GNML 4R7NB 1BM3H 1HKLH 2J1YA 1OP5K 4JDTH 3NEEA 4X99A 1Z9NA 4X7DC 1J10A 3CXFA 2XICA 1DBMH 3L7EB 3MR9A 1OGAD 1AGBB 1ROCA 2IEPA 3PWPE 4WI3A 3W0WA 4CA4A 4BKSC 3QC5X 1G7LB 4U3SA 1QAWA 5CP7B 3VXRB 3ZBMA 2DIEA 4U6HA 4CILA 2QEJA 1F4WL 3AROA 1Y6MR 2BNRB 3MRMB 2VDOH 3H7BB 4DGYL 2OULB 4RQQA 1S2EA 1S78D 4H5SB 4LP5A 4LPWA 4L1DA 1XX9C 1XV8A 4H13C 3ZDYB 1TNNA 2Q7NA 1T4WA 2H1PL 2OCCB 4IRJD 5A6LA 4TQEL 1IAIM 4GP5B 1SEBB 4A68A 4J5VA 1E9QA 4TULL 1AFVH 1QFUL 4HT1L 3ZGIA 5DA4A 4MJIA 3UAAA 1KB5L 3AXIA 3MLRH 1N0XL 5FUZL 4KKPA 2TSAA 4DGVL 5CFAA 2XY1A 2P5EE 1GYAA 3U0TA 5AALA 5AWXA 5KYYB 3OR6A 1NBYB 5L0QC 3FONA 1JRHH 3FO9B 2FHBA 2JK5B 5EO0A 4HW6A 2MTAA 2V17H 3CFKB 3LKOB 5K39A 4CNIB 5I1EL 1ZLUK 3TJPA 4Q9RL 1F3JA 4CUCA 5ICYA 4DNLA 3B9AA 5TPWL 2F5AH 1MWAA 4KOBA 4LOFA 5C0DB 3U0PA 1E2WA 4YSSA 3BUPA 5EFIB 3CVHB 4LLUA 3LKSA 2BWIA 4H0IA 2ZUXA 4KQ3H 4FQIH 5EC1A 1OD7A 4ODVL 3ZZQA 2I5YL 3NCBB 5AUMB 4TYUA 1E6JL 1G7PB 1WPCA 2EZ0C 4ZS6C 2BFGA 3CFUA 2AJ3B 5FECB 1MFDH 4F3FB 1KXTA 2VW6A 3KZ8A 2BNUB 5K9WA 3VMOA 2JKNA 4UB0H 5EHFA 4XBPB 5SWZA 2JVUA 3AQXA 3BDBA 3ZHFA 3CN3A 3VRLF 5B3JE 4PH8A 1N4XH 3DSFH 4BH7B 5GGRB 4NUGL 1CBVL 3QP3A 3MHZA 4Y4KC 5ILTH 1JZDC 5HHVL 1QTSA 3CU1A 3E7JA 3MKKA 2VN6A 2LU4A 2XTLA 1YQVH 4XXWC 1XQ4A 3BEWB 2JJUA 2Z31C 3MO1B 1GJUA 1YEEL 5B1AB 3C8KB 4WI6A 2ZG1A 2EYTB 4OD3H 3ZN6A 4YAQA 1E8XA 1W8NA 1R19A 4RRPG 3ARWA 5L7XL 2N3JA 1F2XK 5D6DC 2J8UE 5GZOA 4NUJB 4GT0A 4KJYB 1IAKB 2XV6B 1BZ7B 1CR9L 3HFML 4QRQB 4HCRA 4JY6B 3UADA 3KPLA 4P9HH 3F81A 3HNTH 1E8CA 3NJIA 5IKCB 5CAYB 3OAYK 2GJZA 4D8OA 3RTLA 1T0PB 4J3OG 5EG6C 3IMWA 2ZWLT 5C7XH 5EEUA 2JF1A 3GEFA 1HILB 1A8JH 2WBWB 2YEZB 2AK4E 3IM1A 1VGKB 3EHBD 3K6IA 4OCYH 3KMDA 2KPNA 1A9BB 1BBJB 2J6EH 1GS7A 1VFAA 3AXLA 5ABAA 1CC3A 5CIPB 5FLUA 3E8VA 2W94A 1RSYA 1VADA 2NQ3A 4AGPA 3T2NL 2QDWA 1HHIA 3NH7H 4NXSA 3QJVB 3NN8A 4TNEA 5E00B 1RZIA 3K8LA 2BWQA 4AIEA 4NZTH 4O9HH 4OJFL 1SN2A 4TNGA 5D5MF 5TDPB 2AJZA 4D8PB 5LBSL 5E7BA 1J8HE 3W56A 4K71C 5T8IA 5IQ7H 4YIQB 1K5WA 4FQPA 4MJ2A 3PCYA 5BRZE 4JJOA 3KL5A 4IU3B 2J88H 4N2EA 4OCXL 3VGAC 4RFEA 1G1YA 4NN6C 4OI8A 5D2NE 1KBKA 2XWRA 4WO4B 3V5KB 3PP4L 3WKNA 2QQKH 3IMBA 1NIDA 4YDZA 5DR5H 4C58B 4LAQH 1RLWA 5IW6B 3PP3K 3HE7B 4WFHE 3L4XA 4KTDH 4ZSOA 3PU7A 5HGAA 1SNRA 2DYRB 2D9CA 2D7QA 3CMOL 3BVWA 3LNDA 4QHMB 3SDCB 5EF2A 4WOHA 3H2PA 3Q8AA 4D9QE 2OL3H 3X11A 1PDKA 1F2QA 3EJCA 2ATPA 2WBKA 1CD1B 1TQUA 4WU3A 2O6PA 4PJAB 2ADJA 3NCFB 3RGQA 5E4EB 1HKLL 2PWFA 4JDTL 9PCYA 4CSPA 2OYLA 4FLSA 4AEIL 4BQBA 1DBML 2DQGH 3AG4B 2QL1A 4W93A 1MCLA 2OXGA 1FN4B 5F6IC 4HKJB 4XAKE 5TTRA 5DHDA 4FLOA 2E56A 3E6HB 4LCIH 1TKWB 1FZJA 5HYSA 3QJFB 1KTKE 1ZVNA 3LSOB 4L1LA 4FX5A 4JPKH 1E5ZA 3FH8A 5DJ2A 1O7VA 3FU6A 5GS1C 2XWJB 4GG6A 2BNQB 4DGPA 2EZ0D 1AFVL 1OTSD 4B97A 1ET5A 4MJ5A 2FO4A 3BQUD 3O9WC 4JGJA 3QHZL 4OBSA 3WU1A 4O58L 1H3XA 5D7LB 3MLRL 4WJKB 3V0EA 4L9LA 1KCKA 2QDVA 2WKGA 3GIVA 2DWDB 3BESR 4DETA 4RETB 1P9MC 3SGEH 1BQHB 2GT9A 2WLZA 3B6SB 3H9HA 3VFTB 1JRHL 1QTPA 3WJLA 3NJFA 2IXQA 3FNKA 4Y4KD 1WLHA 2YD7A 5KYUA 4GE6A 3TCXA 2WJ7A 2JSFA 4N0UE 3VI4B 1DSWA 4GRZA 3N41F 1E5YA 1ZHBA 3B5HA 2F5AL 4NKMB 2LU3A 1BJ8A 4Y9CA 4BZ2L 1K3IA 2Z31D 4ISVB 4DGWC 1T22A 5HHPA 5CGBA 3U9UA 3N44F 3VQLA 1CYWA 4R0TA 3L5WA 2C3HA 2ZSVA 4KQ3L 1R34A 5EB9A 3IGKA 2OTWB 2X1PA 1EVUA 3HN5A 3WTWA 4LL4A 3MACL 4XBGB 2EXWD 4GINA 3SQBA 4G8AC 3GMNB 3WJLC 4EEEA 1J1OH 5JNYB 1XEDA 1MFDL 4KC3B 1JRHI 1WEJH 2UZXA 4ODXB 4BUBA 3F41A 3S3JA 5IJCC 4FQLL 2APFA 2IV9A 1QSEE 1RJYA 2OMTA 1T89A 3LTVA 4UDUB 5ICXB 4ECNA 1J7VR 2D2OA 2HKHH 5KA2A 1K5NB 4G8GD 3DSFL 4UDTB 2VDOB 4WHCA 1TTAA 3FTSA 5ILTL 4DJMA 5B8CB 2BHFA 2E9JA 2WXGA 4L5FH 4BA0A 1N6QH 5E2VH 4A2EA 1LK2A 5EU7C 3ZRCC 4GS0A 2D0GA 3ZT5A 3T0EA 4HBCL 3U7WH 4X98B 4JO8A 4IK7A 1OLLA 4TF4A 3S96B 3EJUA 2XV3A 4PJXA 4P4KA 3O81A 2C26A 3P9MB 2WVUA 4N20A 1VACB 5IB2A 4J23A 1BXXA 4EJ1C 4ZMAT 2XXFA 2QZQA 3GXIA 4K3JL 4ZS7L 2FT8A 4HS8H 1T89C 4KQ0A 2CIIA 4G7QB 2KH2B 5F9DC 1XAUA 3ZE2B 4PVMA 4MD5B 3UABA 4NUPA 4PBVC 4R90H 3S34H 4C83B 3V0IA 5GZNC 4LCWD 3QIUD 4CRPA 2P49B 3N91A 1MFAH 4GKSB 4JHBA 1XF3B 2L7JA 3HMXA 5LNEA 1BVZA 4BK4A 5C3LD 3KPSD 2BIIA 1WH0A 3IFPA 1DVUA 3LKQB 1Y0LB 4X50A 4P9HL 3HNTL 1XGRA 4YDLC 5IQNA 1TCMA 3UGUA 5DUPH 1QHPA 2GABA 5J13B 3APDA 4M6NH 4RGND 5C7XL 1TCRA 5DURB 2X40A 4YZWA 4TLTA 3BP7A 5DRNA 1JMXA 3FO1B 4KU1A 4CVKA 5CHNA 5CJQH 4OCYL 1CFTA 2UWEB 1NWPA 4PJHB 2J6EL 4LHUG 1MELA 4NJAH 5ID0A 3RTQA 1IKOP 4N1CA 4WJG3 1R5WB 4H8WC 4PJ9A 3TNMB 5BO1H 2YRPA 5I0YA 2F46A 4GXVH 1TQBB 5ESAB 5LLIC 4XODA 4O9HL 3B9VA 1FFRA 3L3IB 1SN0A 5D1XA 3NSYA 3PJNA 4QRRA 4BSWB 5ESVA 5BW7C 2FH7A 4K5MA 3SCMA 1NCBH 2CKNA 5IQ7L 3WHE0 1DLHB 3ARBA 2J88L 3HTLX 1ZWIB 4MCYA 4Z7QE 2OJZL 3QJOA 3Q2NA 4LRNH 2GJPA 2QQKL 1D2PA 3RWHB 1GZQB 1G1GA 4LVHC 4LAQL 5E5UB 2VQ4A 3O9WD 4KTDL 5CWSA 3M86A 1ETZA 5JYLA 4FNQA 2G59A 4PREA 3V5DA 4D9RD 3OJMB 2WUBH 2MHAA 3VWKA 1BX2A 4PJ5E 3ZYOA 4EUPG 3I02A 4JM2D 2OL3L 1LO2H 1NCAH 1T2XA 4HPYH 3MJ9A 3BKMH 3T0XA 5IEHB 2I6PA 2C9PA 3M1OA 3OPZL 1JWSB 1I1AC 2IG2H 3ARDA 3OJVC 5K9VA 3VVWA 1RUPH 3W39B 3FB6B 4MA3B 3MV7A 2ICWJ 3Q3GB 4KBPA 3P4LA 5C09D 1RPUA 3QQ3A 2VSMB 1AYOA 3EZZA 2BVUA 2CMCA 4FFYH 4CSTA 2ZUQC 4LCIL 3R18A 4FTVA 5T3XE 1U21A 4NQDB 3FFCD 1B9ZA 5BVJB 4UT9A 3BSGA 3FB7A 1MJ8H 4JPKL 4WW2A 2WQAA 4PMEA 4Q52A 3T3PF 3PQYE 3EO1A 3P73A 5DJ6B 1UADC 3JSSA 5DZOA 2HT4C 4PRHA 3ARDC 1S9WA 1TITA 4Y1AD 2X4OB 1RIHH 2Z7ZA 3S8GB 1NIBA 1J5HA 3L4YA 4RI5A 3L4UA 1DE4A 1PGRB 3B7TA 4PV9B 5DJCB 3CX5K 3LXAA 1WIOA 1HEHC 1HQ4A 3QCJA 2E86A 4XXDA 5D96B 5JHDD 4YHIA 5F1NA 1A64A 1CICA 4UAHA 5HYJD 1GOFA 5B38G 3PWLB 3CLWA 4PSRA 4EN2A 1AO7B 3IXAA 1ZV2A 3VFMB 1BIIA 3OZKA 1I9JH 3C09B 2GSMB 4Y2NA 5GJTH 1J0YA 2ADFH 4F7MA 2EDWA 2Y3AA 2I4HA 2WJPA 5FF6B 1CBJA 4XC1L 5HGBB 3ZL2A 3R19A 2ICEB 4W9ZA 4NLAA 2DB8A 2H1XA 4A04A 1FCGA 2I69A 3QUXC 3ZKQD 3OG6B 5F44A 1A1MB 3SGEI 1J1OL 5GZND 2VLJB 3ALWA 1WEJL 4HMCA 2ZXBA 3RIAK 2WVVA 4GJTB 4RA0C 2A3KA 2Z35A 2CA3A 3WJMA 2X1WL 3NRPA 4YX2H 3GI8H 2HKHL 5M94B 4IRZH 1XF2B 4HCIA 5D1ZC 4K7PL 5L88H 4WU7B 5E94B 4QTFA 4Z5RA 5T3ZE 3BVDB 1A7PH 3ZE1E 4L5FL 3D39B 1VPOH 4TLUA 4FP8H 1N6QL 1NMAL 3HI5H 3MA9L 2QVIA 2BH0A 3GSWB 4N6RB 1K4CB 1U2HA 3U7WL 3UIYA 2WXJA 2VSKB 4JQIA 2HG5A 5T1KB 1KJVA 1K3ZA 1XSJA 4BZ1A 4Z77B 2DQJH 4CMMB 5BRPA 2WTZA 1NC4A 4URTB 4F7TB 4HS8L 5ACZA 5I30H 2R1XB 4EIZC 2AM1A 1KYUA 4XZUB 4PJ7B 2ITCB 5EBWB 5JOPE 2O4EA 3DPBA 4DKAA 3QCLA 3KPNB 4GIAA 1MFAL 4JM2F 3NJVA 3QUYC 3FQUB 1EHKB 1XL4A 2QKIB 3A24A 1PY0A 2R0WH 2Y36H 3ARFC 1NNYA 5DUPL 1LWJA 1XB6A 4N0UB 4PRIE 4EDWL 3AY4C 4GOSA 4R9HA 5GXBB 4GFVA 3KPPB 3U1SL 3AAZA 4M6NL 4X5RA 2IAMA 1QBAA 2FGZA 4NM8L 3CZEA 2ED6A 2VLLA 2P5WE 2B4CC 1XGPA 5E6SB 2CXGA 2PETA 2CCVA 3D09A 4XCEA 3TC9A 2QGBA 4V1DD 3N5AA 2BZ7A 1YVLA 4NJAL 4PJFE 4JAMB 5AL8A 1I1AD 2D31B 5BO1L 5SWSA 4B0MM 4GXVL 4XVJH 1ZCLA 4GFTB 3RWEB 3FH5A 4KUCD 1XF5B 2YAPA 4NO2B 3VX0A 4KX9A 2C1PA 5DDHB 1KPRB 2WXLA 1WITA 3T1FB 2VLRB 1E28B 4IU2B 2MFNA 2RACA 5I74C 2CLZB 1NBVH 3FSZA 4OFYD 2J44A 4LRNL 5EU3B 2P26A 3CH1B 4L37B 2COQA 2DOCA 5IMLA 4WW1A 1ETB1 3EYUH 1FE8H 1E2ZA 3MBXH 3NPZB 1TZGH 5GSVA 3HAEG 3FTWA 2WUBL 2PTTA 1ES0B 1IC5L 2MPAH 2VUYA 4FABL 1KNOA 1LO2L 1KFGA 1NCAL 4XO3A 2PNDA 4HPYL 3ZDZE 3BT2H 3BKML 4DP8X 4GRYA 3HKZA 2UAGA 4P5TB 2VTFA 2W07A 1DUYB 4L2LA 4HK0A 1FP5A 1RUPL 4HUXA 1G6RH 2BS8A 4YMPA 1IX2A 1QRNB 2Q87A 1XO8A 3SKNA 5I17B 1KZQA 5KA9A 2KLTA 1PTZA 3MUGA 1AD9A 4QMEA 3S3EA 1WUZA 3EOBA 4PRPD 4YHYC 4UTBA 2WZ0A 5JMOC 1H9VA 2DWTA 2ED8A 4X0KA 4B50A 1M3GA 2F53A 3GBEA 4FFYL 3U96A 1Q0EA 3LZNA 3QHFL 4M8RA 4NNXB 2GUYA 1AD0A 3G04B 5DEFA 3BJ91 1MJ8L 5EO1B 4PJIE 2IPKA 4R96A 3B43A 2J2ZB 3QUXD 1I1RA 2DBLH 5EORH 5EEXA 2ADYA 1HWGB 3BPLB 5T3XL 2IH1B 4RMVA 3WAKA 1N64H 1RIHL 4Q6KA 2GIMA 2UUPA 2VMDA 1S8DA 4DKDC 3I2CH 4K3DH 2GHZA 1L0YA 3LEXB 2AQ1A 2H32H 5D1ZD 4AM0A 3ARRA 5DYOB 1BZCA 2RTTA 3MRQA 4HOMA 2JCCF 4G6AC 2CUAA 4OKDA 2G4GA 3FUIA 1YDPA 4FRWA 2KL6A 4N2BA 5BZDB 3IVKB 2B59A 4UOW0 2BZCA 4AY0A 5JA8B 4W4OA 3CZNA 3JWOC 1JD9A 3HRZB 1Y6NR 1I9JL 1NICA 3NIFE 5GJTL 3UACA 5DSCB 4ZI4A 1MCBA 5A40E 3WUWG 4PU2A 5IVZA 3HI1B 2ADFL 2W81C 3D7PA 4HIIA 4KRNA 3MNWA 4MXQD 5C08B 3UO1H 2CMRH 4JANA 1P7KA 5CBAB 2QQLH 3F8UB 5DGRA 2NRDA 3FMGH 5ACMA 5I24A 5C0AB 1S46A 2XZZA 5HGGS 2F54D 1PFOA 2A1WH 3LVTA 1EHNA 5JIKA 3LZQA 4PCTA 5ISZB 2VDMH 2NY4C 4PIBA 3B5TA 4Y2LA 1UB5A 3QBTB 1U9KA 4HZ1A 1SM3L 3QUYD 4ZRGA 4F2FA 4QJ4B 5K25A 4HDIA 2ZKYA 4ZUTB 5F9WB 3ARFD 3GI8L 2GCAA 4IRZL 4FNUA 3UGEA 2OZ5A 3MV01 1K9TA 3NSCA 4L0ZA 4KMQA 1BOGB 3APNA 3WFEH 3PLYA 5L88L 4GAAA 1A6WH 1A7PL 5D1QC 5E9DE 5I23A 2CM2A 4LLWA 3GMOA 3MFFB 4RWYH 3CVIH 3PPSA 4KUCF 3KR3H 3TEWA 2JV6A 3EYFA 2X3CA 3HI5L 5DQDH 1AOZA 2DYPA 1TZIB 1XGQA 1KIRA 1JTOA 5D6CA 1VRSA 5AKVA 2OSLB 1C83A 4HRFA 4C12A 4Z3JA 2OJEB 2Z0UA 4GQZA 3IDJA 5DHYB 3V4PH 3X12B 3TBTA 2B9BA 2DQJL 3VFWA 2YA2A 3RL1A 2HFFA 5A1AA 4ICZA 4KV5F 1WFIA 4XOAA 3QJHB 3IKCB 3FT0A 4B9FA 4PGZA 5I30L 4W9JC 3AG2B 2PYFA 1V27A 5HHQA 2WNXA 4NNYB 1MQ8A 3BAJA 3K8KA 4P4RB 4Z76B 2HN7B 4WEUD 1KACB 1A2YA 4DGIH 4JUTA 2X4PB 1PAZA 4BQ6A 3QRBA 3QWOA 3T2OA 2Z7YA 1LO5B 5E9NA 4WSKA 5I0WA 2Y36L 4XNXH 3H4HA 4J3OH 3RX8A 4IGBA 2H0EA 2R0ZH 4MNQD 5E51A 4FEIA 3EADA 4YHOH 4MXVE 3LZPA 3U4KA 3O4LA 4KO9A 4I3GA 5E1HB 3QJQB 3BWSA 1HHKA 4N8UA 3SKMA 4XP9H 2D3VA 4HEME 1LYQA 2YGNA 3G5XB 3IRCA 1V3LA 2ZICA 3U7YH 1BYPA 5FUOH 1GOHA 5I2IA 1OGTB 2YWZA 3D85B 4XVJL 3ME0A 4FHJA 2G5RA 4W70A 1J1PH 1UENA 1A8ZA 1Q1PA 3ESMA 5J1AA 3IB4A 5DZNA 1VEPA 4IGBC 4NFDA 5F7WC 4BJOA 4NSKB 4L8SA 1O0VA 3DIVA 3T6QC 1FL5A 2VR5A 5F7KC 4PJDB 4BFIB 3AMKA 1ZLSL 1BD2D 4W68A 3FTGB 3ZL1A 1CT8B 1FFQA 3QR0A 2N7SA 1OK0A 3CUPB 2FEDC 2MNJB 1Z0MA 3O2VH 2Q5BA 2BHUA 1PU0A 2CM5A 2J1ZA 2ED9A 5BS0A 3R7QA 4I18B 2EINB 5FO2A 1PG7H 3MBXL 3PS5A 4J3UA 1TZGL 4RX4A 1BGXH 4PJEF 5K23A 3R06B 3ECQA 4YDIH 4ADIA 2LU5A 1QVOA 2MPAL 4WHDA 3C2AH 1X44A 3BT2L 3LN5B 3GSQB 4HMEA 3MBED 1S9YB 1S7WA 2G5UA 3CIAA 3EU0A 5CMAA 5E23A 2PO6B 1Z2KA 4WUUE 1FAIL 4E9XA 1JGDB 2BOBB 5C07E 1EFXB 2DTSA 5AB2A 1CO1A 5DD6B 2Q7YA 1DEEB 4ZYKA 3WIAA 5FA3B 1IV8A 3IMUA 2OMWA 2LHAA 1DO5A 4OZGB 3H54A 3HR5A 2QDCA 4N3TA 4ODWA 2Y7SA 1YN9A 4WI2A 2QGEA 2GFBB 2NSQA 3ZDXE 3EDDA 2DBLL 5DD0H 4ZW8A 3VFOA 2Z6FA 2NY4D 5MMZB 1N64L 2GIXA 1EXGA 4L1TA 3LPPA 4ZFOL 5KSBE 4PV1C 3NCCB 5LNDA 1X6NA 3BD3A 4K3DL 1HL4A 3IN2A 4NHCH 2PP9A 1TYEB 1Z9MA 3MNZB 4DTGH 2WXPA 4X2UA 1INQB 4IHOA 2OR9H 3FU5A 5D1QD 3RURA 4BYHA 1FJ1A 1J0HA 2WQXA 1FFPA 2YPKB 2H3NB 1TG8A 2RB8A 3C75A 2ZXGA 5JIIA 4OLZH 5C0CA 5E70A 5EIIA 3L3OA 4Y7OC 1HNYA 1L8KA 3IK2A 4F20A 5CN1A 2P6XA 5TGBA 2K3TA 1Y1UA 4KK9D 2VISA 2BZDA 5FGBA 4Y2DA 5JPNB 2W9DL 3RNKA 3U4BH 3UO1L 4E9YA 1L5GA 2QQLL 3GBDA 4HZLB 3FMGL 4M4RB 4BFBD 3WTVA 3MMJA 5J9PA 2K9UA 1ADQA 4FXGA 4MZ2A 2A1WL 4LDLB 2H6OA 2GTZB 1NFDB 2YQ2A 3L4CA 3DRQA 4XBEH 4Y4FB 1G6RB 3GSXB 3GDBA 3OJDA 2P5EA 2TRHA 4L3EE 1SVCP 2FR4A 1A6ZB 1R3LB 3IJ9A 4ILDA 1FNAA 1PEWA 2ICWA 4ZNEE 3BKCH 3CC5B 2JH2A 5KN5B 4R4BA 3TJHC 4MD0A 2E9IA 3L3KB 4O02L 1SJEB 1YYCA 3WFEL 5HHOB 1A6WL 2WXQA 3SGJC 1M3JA 2JFFA 3L17A 1M2VB 4EE2A 1O9WA 2GJ6B 4I2XE 3CVIL 5FGBC 4RWYL 3IKKA 3KR3L 3WHE1 4APXB 5DQDL 5FA4B 5KYXA 1DTUA 4MDJA 2G2PA 3DVGB 4BM7A 4DEUA 2H45A 3CX5J 4CW1B 3PL6B 2J1XA 1KGIA 3HZKB 4XP1L 3V4PL 2BZLA 3SPGA 4WU5A 1RHHA 2BXYA 4ZFOB 5BQ7A 5E24E 2AEOA 4HFUL 5IQOA 4R30A 4JFHE 4P0DA 4BGLA 2H6UA 3UTSB 2H32B 5KS9E 1EMTH 1EEHA 3R4DA 3C5XA 2A6JB 5FX3A 4Q97A 3DSNB 4DGIL 2NW2B 2WXMA 3D05A 3EO0B 3OC8A 5CN2A 1ZEAH 3JV4B 3FFDB 3DGCR 5FB8A 4JREB 1FLTX 3FHAA 3RWJB 2FEDD 2A83B 4P04A 3KW8A 4ACPA 4QNPE 3BW9B 2E74C 2JB5L 4YHOL 4AGNA 1CDHA 2K0RA 4JHAH 1KLUB 3ROOA 1QACA 1YEIH 2B14A 1QG3A 4JBCA 5LNGA 2YPLD 4IBSA 1Q0YH 1JGEA 3DK2A 4OSUH 4PJCB 2KQNA 4HIHA 4CL7A 2V9UA 2O61A 1KLFA 3BAXA 4XP9L 4C56B 1NANH 2VDMB 3AU0A 3BP4A 1AGEA 1RH8A 4EN3D 5L4MA 3U7YL 5FUOL 3FTYA 4MHHG 1SPDA 2WSDA 2XKNA 2IFFH 5HYQA 3WGVB 1I8LC 4XR8C 1J1PL 3V8CA 1G4RA 2J8UA 4GQ9H 5EUOB 1XR8B 2R4RH 2WKOA 3U30B 5IIEB 1CDIA 4E2OA 4X9BA 4HD9A 2BXZA 2EE0A 4Y16C 4OGZA 5D9SA 1NCTA 3HZVB 1CGWA 4U6XB 3BH9B 3MMEA 2JJDA 2WYHA 1FIGH 3M7OA 4OF0A 3SHSA 5C9JA 3O2VL 3V4PB 3GRGA 2EKJA 3W5NA 4LBEB 1UHVA 2HB0A 3CK0H 3VXTB 4AMXA 4G11A 4F2ME 1KUMA 4EUPH 3FL7A 2EDHA 3S98A 1V5JA 3DTXA 4NKOA 5AAWA 1BGXL 3SO3B 5DJ8A 4Z7WB 4YDIL 4OZFH 4J3BA 1AR1B 2VLKA 1Z5HA 1NBZA 1YEFH 3C2AL 4HEPG 4Q74A 4MMXB 4YSEA 4EDXB 3OKEB 4AK1A 5E1AA 4C4KT 1UXMA 2W60A 5GTJA 3BIKA 2WMPB 4G7VH 3L7FB 3D6GA 1W16A 1E4KC 3WIHH 1HXMA 3CWEA 4GEJA 5DQJA 3N1PC 4FNTA 4L4VE 1KIUB 2FZ3A 1J8HA 2NMSA 4C4UA 2V7HB 4J4PC 3VXNA 2NUPB 5BRZA 3X3FH 4YHLL 4KRPB 4PTUA 3RI5F 4X6BA 4M5TA 4MDIA 1WZMA 1XL6A 5HGHB 4GAYB 2PYEB 4B9PA 3G5ZA 2ATAA 4DKEH 3EAKA 3LQMA 2XXCB 2APXA 2B5IC 1O5DT 1P5UB 1AC6A 2AP2A 3CWGA 4DF9A 4YLCA 5DD0L 1RK0B 4NO0D 1O6SB 3ROLB 1FYTB 3MAWA 4YZFF 1E2VA 5GS0H 2WTOA 1F42A 5DRZA 2YMTA 2VDPH 1QPKA 3TJHD 1ASPA 1ND0B 3IDXH 4UQIM 3WN5A 3ZV2A 3QAZB 3JZYA 4ZXBB 3ZHDA 2OR9L 1HCVA 3QRGH 4G80B 1QASA 1ZLWH 2MJWA 4M43H 3LEYH 5JMRA 3FRPA 1I9IH 3IJSB 1HYRC 1OANA 4OLZL 5JHLL 3D0LA 3VD2A 4N0RA 1J87A 2BC4B 5E1IA 2H7WA 3GRWH 1XCXA 1JNHB 3MRDB 3TLRA 7FABH 1TVBA 1X9LA 4U3XA 1N0LA 1H8LA 3WEXB 1USZA 4EAEA 2GAZA 5IHWA 4GH7B 5FYJD 2JQZA 1T2QH 1FZOA 4KHXH 2G9HA 3S36X 1QA9A 1KV3A 2ADIA 3IU3B 4I4WA 1L9SA 1JHLH 3BWAB 5CR8A 2XTJB 3PFQA 3SYCA 4XBEL 1MPAH 3RUGA 1HIMH 1H3PH 4KUZH 1KBBA 2APWA 3ECBA 4I0PA 5TE7H 3VSVA 4ENED 3DO7B 4PRBA 3BKCL 4JW3A 3X2QB 3DHUA 4XGZB 3UYPB 1GGBH 4KO5A 2D3LA 4LLYB 2CHZA 3H8NA 1ORQA 3QEQE 2B2XH 3FQ1A 2WTPA 3ZVVA 2OKMA 1HWHB 3ILEA 5DVPA 1O75A 3LZFH 3N42F 3QORD 4MA8H 5EU5B 1CGUA 4AC4A 3V6OC 2HP4A 3DX8B 1JHKH 4AYFA 1IKNA 3HPJA 3N50A 1FZMB 4M93B 2WB1A 3TTSA 3UTQA 5LGYA 4BDVA 3L4WA 1P4LB 4K8RC 5EC2B 2Z92A 4CDGC 3MOAH 1L8GA 1L9RA 4K2UH 3CBRA 3F84A 3N3EA 4XMWA 1EMTL 1HINH 1X7TA 4WV1A 4HOXA 1YC7A 3DROA 3KHOA 4XMPH 5KG9A 3SZKC 4Y16D 3PWVA 1QSEA 7CGTA 1D7FA 1ZEAL 1YA5A 4N2AA 5BX1A 2H0FA 1F4XH 2DLEA 4UZGA 4E5XG 4MJJA 1OAQH 5E2WH 3Q01A 1SOXA 2X70B 3D07A 3UBXG 3MRCB 2E75C 1XWVA 2EEDA 3FU3A 3I7ZA 3ZRSA 1JI1A 2MOQA 1J4XA 3IXTB 3V9EA 5KUKA 1MFNA 3ARGB 3QDGB 4JHAL 1YEIL 3UJIH 5FK9B 2X2HA 3NSFA 4NIKB 1Q0YL 4R84A 4BEIA 5JW4N 4YK4B 3RWDA 1UJ3C 3AB0C 1HSAB 3NJKA 3O2WL 5KSAC 5C7ZA 3HC2A 1NFKA 1WAEA 1HAWA 4XZ4A 4JE0A 4AG4H 1C12A 4OTXH 1XD0A 2IFFL 1OP3H 2WANA 1OSZA 3MJ7B 1YFOA 4GQ9L 2VITB 1YPZE 2R4RL 3N06B 4J4PD 2IWGA 2X3AA 4N26A 3RWFB 1A5FH 5I6XC 1U25A 1NFIA 4MNHB 1JHTB 2WLNA 4KO6A 3II1A 4OCRH 3AS3A 4AH2A 4D9LH 1A4JB 3BPCA 1FIGL 2ARJQ 4JX0A 3FS9A 3FUMA 1IGTA 4UOW1 4NB7A 2JLLA 5F2FA 3IFOB 4G1MB 2AV1A 3RY6C 3CK0L 1NANI 1OTTD 3HAEH 3RZCC 4JGMA 2BINA 4HUWA 5FDWA 2L7UA 2F6FA 3V0JA 5D5MB 3ALPA 2X89A 4KNQA 2CKBB 4UAOC 4X7FC 3L8QA 1AIZA 3HG0A 4HG4J 1YEFL 3RIKA 4AYMC 4F93B 4YNYA 3IJHB 4W9LC 2OV0A 2PW2A 1CVRA 2QSCH 4NYLA 4LEBA 1CU4H 4RZCB 4UOJA 1L0QA 1W6WA 2AKRA 4G7VL 5BQDA 3WIHL 1TJGL 2O6DA 2G75A 1I1YB 1EZLA 1LEGB 3PV6A 5TE4H 5IB3A 1Q6NA 1Z5LA 3L48A 2YD6A 3QDHA 4FXKA 4WO0A 5FWRA 3X3FL 4I1PA 2A73A 1QSZA 2WCPA 2Z3FA 3UTTA 4PB0H 4OHHA 2IDTA 1NJ9A 4L0YA 3QFJE 1NO6A 4LHUB 1WJ3A 1IM9A 2IQ9L 1I8MA 4DKEL 5MEOB 1FVEA 3D4ZA 1UOWA 1NKRA 1ACXA 1NCIA 1NPNA 3KXFE 3WIFA 3TF4A 3U4EB 4PJ5A 6PAZA 2F19L 4JFFD 3TBWB 5GS0L 1DFBH 1AXTH 3WNOA 2PN5A 4B96A 4AQ1A 4TRPH 1T7ZA 2VDPL 5I1CH 5K1NA 3GMRA 3GT6A 3QFDB 5DZPA 3IDXL 3TVMA 1PD6A 4R83A 1BAGA 4AE1A 1CDCA 1JK8A 2FWUA 5K59F 2H9GB 3QRGL 5FO9A 2P8LA 3WFDH 4AL8C 4M43L 5DMYA 1ETA1 4P8QA 2DL2A 3CSPA 1I9IL 5FCSH 1LWHA 1U3HC 3LRGA 4EZMA 1S7UA 1AKJA 4WK2B 3GXHA 3GRWL 4JZNB 1H6TA 2RH0A 3ZYZA 4EUPB 3O3UN 4HLEA 7FABL 3BM8A 4S0SD 1W9XA 2LAAA 3PQYA 5IUCA 3LIZA 4G7SB 5B21A 1D3CA 2ENQA 4LL1A 1IB5A 2ZTBA 1T2QL 1B0GA 4JRYE 4LLDA 5ANHA 4PGJA 2C3XA 2CO6A 3S35X 3WY1A 5LGKA 3MZTA 3L1EA 1JHLL 2Q2LA 3HB3C 3CFEB 3MV8D 2X4SA 5F9JB 1MPAL 4U1GC 1H3PL 4KUZL 3N41B 5TE7L 3QCBA 4IKJA 4PJGE 2AW2A 3L54A 5KOMC 3HJEA 2QCTA 3P3RA 4JG1H 1U8LA 3MRHA 3N44B 4IS6B 3H6JA 3UAJD 1P5VA 2UUDH 2CGRL 3KNBA 1SEQL 3MQIA 2B2XL 4JFDE 3LN9A 5JYMA 2H02A 3KCPB 3QJRB 4J8RB 1S3KH 5GPRA 2ADGB 3LZFL 3H9SB 1KXHA 2OTUA 4MA8L 5HJBA 2JIXD 4HV8B 4KJQD 5INCA 3ULSA 3VXUD 1KXQA 4N9GB 1HT6A 2I6OA 3D3VA 3OF6D 3FT3A 2PMZA 2R29A 5FGCB 3SDXE 5KSAD 1ZY9A 2FATH 2OMBA 5H94A 1JHKL 3EHBB 3ECUA 4K9EH 2Y5TB 1MEXH 4JFXB 1PQZA 3ZQXA 4CVUA 5D7JC 3PWUB 5DMKA 3OKOB 1BXUA 3MOAL 4G5AA 4K2UL 2QBWA 1HINL 3G6JB 1SLWA 4KHTH 12E8L 4XMPL 5CD5C 4HUVB 5L4IA 5B38B 2RAMA 1QR4A 2FQEA 3LX9A 3EXJA 3RWCB 3RGHA 3WNIA 43CAA 4R2GC 1F4XL 1XT5A 3ZL4L 1MCWM 4WI0A 2BERA 1OAQL 2W9EH 5DS2A 5E2WL 3O6MH 3BIBX 4H7VA 4IRSA 5C0BD 2CGZA 3BAYA 4LO9A 4DEWA 3MYZA 5LDUA 4NWTH 3BVUA 3NABH 2NNAA 4M3HA 4Y5VB 3O3DB 1MVUA 4HS6A 4GRWE 3QCIA 3RZCD 3MLYH 2DQTH 1VIWA 2B15A 1A6UH 2BSBA 1KEGH 1NKGA 2EO1A 3UJIL 2RR3A 3GPEA 1BZ9B 1ZSDA 2Z8RA 3PHOA 4OD2B 4PJBA 4DPCX 4HPHA 3HG1E 2LLGA 4K94C 3M4UA 3OMZA 1XHHA 1K8IA 1ZANH 1M9SA 3D9AH 3O4SA 1ONQA 2DWSA 1KEML 4QOKD 3P0VH 4Q6IC 4CMHC 3EO9H 3VFUA 3IJEA 4GW4B 3QNXB 4AG4L 4OTXL 1EVTC 4NQCD 1EENA 1NCDH 1NL9A 2DQFA 4GRLA 3HPLA 3VFGH 2D7TH 4ETQA 5DHEA 4QTHB 4Y4HA 3C60D 5KTEH 1I7UA 3Q8EA 5IEKA 4MYWB 4OCRL 1JLNA 3TT1L 3VGDA 3M1BA 2Y69B 4DP5X 4D9LL 3VGHA 1W0YT 1MXDA 5INDA 3K71A 4ES8A 1AMXA 1DQVA 4XNQA 1N67A 1FGVH 3JV0A 2OSWA 1X4YA 4L1BA 1FC2D 1CFNA 3IGLA 3BQUB 4X83A 2OMUB 2XN9A 4YN3A 1GGCH 4LASH 3RZWA 4H8WH 4CGTA 5FOBA 2X53A 4Q9CA 4LPYA 1E7UA 2QSCL 3MGTB 1CU4L 1MRFH 1RU9H 1JV5B 3PG2A 3RDTC 5MENA 3MDJA 1OCZB 4HH9A 1SYSB 4N2MA 1PF3A 4JHWH 2A6IA 1U3HD 3OSVA 3SDAC 1R3KA 2NX5B 3T0DA 4MA7H 3C08H 4NQSB 3QKPA 1T1WB 3IT8D 3ZZ1A 4XX1E 3P9LB 1ED3A 2CCLA 4PB0L 2Z31B 5C8JA 1C88A 1J05A 3N1MC 5CCHE 3SDDB 1H5BC 4ZX4A 4KY2A 1M1XB 4HULB 3VXOB 4APQA 1U3NA 4MSWA 3N0AA 1L6ZA 1E27B 3O11A 2VN5A 3UAFA 1UACH 1XGUA 3HB3D 4HJJH 4QXTA 4MQ7A 2QBQA 2LAGB 1HH6A 2A74A 3X1NA 1DFBL 1AXTL 3L08A 1D9KB 1QWUA 4TRPL 4HHAB 1H3TA 3D4YA 3G6DL 4KJPC 5I1CL 4MAYB 4ZPVA 1UB6B 1WWCA 1OY3B 1K4DB 3S5LA 3VMNA 3U6XS 3VXSE 3WFDL 1CWVA 5D7IA 3T3PB 1TIUA 2KZBA 1EEZB 5FM8A 1U8IB 1UUNA 3HAEB 4XB8A 4ZUSB 2AAVA 3NVQA 4UM8B 2AJXH 2UZIH 2MCG1 1XXDC 2A74C 2R9HC 3FUNA 3VD5A 3QUZA 4PJIA 5DJZA 3BKYH 5D7JD 3HZMA 5TQ2L 3UL4A 2CBQA 1JZ6A 2N7BA 4LCCA 4Y19E 5AW1B 4LLVB 3TT3L 3V7AG 2NXZC 1N5YH 4AXWA 2QBRA 5L2KE 5DGQA 5CD5D 4P46A 3TO4A 5C0IA 4BRJA 5JIPA 3Q43A 2VEUA 5IHLB 2HZHA 3FTXA 4H2CA 3RB7A 4LCWB 3QIUB 4HUUB 2OMYA 3FCGA 4K71B 4R2GD 4F58H 4WKXA 1FHNA 3P4MB 3KPSB 3B9KA 5IW1B 4JG1L 4FFVC 3U25A 3SJVE 1MH5B 4PSPA 2YQGA 1YJDC 3LNEA 3V10A 1RZ8B 3VWJA 1VAHA 3MRJA 1JPFA 1S3KL 3O6FB 5IFJB 1LGVA 5FYLE 3RYMA 3T3ME 4FYRA 4RGNB 2BVYA 1GA2A 1OZTG 1SDDB 3OWRA 1IGYB 1SXNA 1GH7A 2QT6A 1MHCB 2FATL 3NFPA 4J3SA 4K9EL 5B1JC 4HIEB 4Z6AT 3K6SA 1MEXL 3QZMA 2BCMA 2N1KA 2QVTA 4RBPH 2I6IA 1BF8A 1T21B 4GW5B 4QAWA 3LH8A 5CJ5A 4QRSA 3DX6A 1YNLL 1QLFA 2GSIB 2R8SL 1G4MA 5TK2A 3RU8L 2WP3O 3H2WA 1U36A 3U82B 5EO9B 4FA8A 2NXYC 3TIEA 1SQMA 1KELH 2NY2B 4O51A 4D0DB 4ZN5A 2R2EB 3CFIC 1E5UI 1G7MA 1QSFB 3PHAA 4CVXB 4ZMOA 2CJUH 2W9EL 4ZMPA 3WUWB 5FV2A 3O6ML 1FQ1A 2B1OA 1IZJA 2SEBB 3SE4C 2VM9A 3MLTB 5E9DA 1JF1A 2BRQA 1CQKA 2VLMD 1Z9PA 3ULVE 3O3AA 3NABL 4JPIA 1QFOA 3BCFA 1E7VA 1H8SA 3IDGA 4M7ZC 2IAAC 3CSFA 2DH3A 5HDWA 3WN6A 2DD8H 3MLYL 1Y18B 1EZVX 1A6UL 1E4WL 2D0FA 3LNIA 5GGTH 5I8KH 4YO0B 3MGAA 3JTTA 3ULVH 3O8XB 4GWFA 3EB1A 4BFEA 1ZANL 2OAAA 1BECA 3D9AL 2M83A 4JRXD 4HU8A 4JM2B 2X4TB 4G9DB 3P0VL 1M7XA 1A47A 3EO9L 1MCPH 3CVBA 3RDTD 1U8QB 2YLKA 4YHMH 2PWHA 3KVDD 3B7UX 1NCDL 4YXLH 2A9CA 2NW3A 2QQNL 2EIDA 1JP5A 2VDKH 5DRWA 3V4VH 5FKPB 4GMTH 4FYTA 3SDAD 1A6AA 3L4VA 4IIQA 2D7TL 3MLZH 1DR9A 4NQXB 5KTEL 5C09B 1A14H 1Z66A 1TSRA 5FGRA 5BJTA 5KW9H 2PQ5A 5IMMA 4RZKA 1MUJA 1CXIA 4YHNB 2F18A 4OCWH 4O2CB 3HZYB 1J9RA 2GBTA 4DGUA 4F7CA 2XBDA 1FGVL 4JZOA 3SR9A 2VXTL 1KCVH 2D8KA 4ANVA 3VD4A 1N26A 1MG2C 1OAXH 4KNUA 2E46A 4HEMA 4JMJA 3IDNB 3ZR5A 4Y1AB 2QPEB 5TH2B 1ICTA 3WFBH 1GGCL 5DVOA 3N04A 1D2OA 4PWKA 3KDPB 4KJPD 1VDGA 2OYKA 1JDAA 5J6GA 1MRFL 1RU9L 1S7XB 1W0WA 4UCFA 3B1TA 2R15A 1JZ3A 3D8MA 3IETB 4NM4H 5JORA 3GHBH 25C8H 1MCRA 1H6FA 1FH5H 3PJLA 2GK0B 4BE6A 1FI8C 3UXFA 4Q4IA 2AZAA 4PGDA 4MA7L 3C08L 3HN3A 3NZ8A 4PRDB 4GYBA 3ULUH 3PAUA 4YAAA 1P1ZB 2GSGA 1LJMA 3PWNB 3NZSA 5CSGA 1MJJB 2X1XR 4NPJA 1QNZH 4TL5A 4ZOBA 3WEBA 5G5DA 4E42B 1SY6A 3M8OH 2W65B 2HFEA 1D5ZB 3P02A 1T0NA 5FYKD 4GLRH 1ZTXE 4NC1C 3UIZA 5L4JA 4Z0XA 4MA1B 2HXAA 2NXZD 2VC2B 3UJTL 2ZWNA 1ACYH 1G7IA 3DURA 4WGKA 3GKWH 3EZJB 4XN1A 2AQ3A 1UACL 1UH4A 4EI5A 2YA0A 4HJJL 1A4CA 5B1BB 1W15A 1JZ2A 4WTYA 1IL1A 1UVQB 1NSNH 2WD0A 4Y5XA 4BZYA 2JI3A 3OX8B 1A6TA 2BVEA 3MUY1 5DK0A 1G1FA 3HC0A 5BMFH 1ITCA 4HLZG 4FFVD 4X9HA 3E6FB 5KVDE 5DZ9A 4FTDA 4W9IC 4XOBA 4JFEE 3AMLA 1XIWC 2XQYA 4KOCA 4WUUA 4PLJC 5D93B 5CEZE 2GC6A 1T49A 4G9FD 1DSFH 1DVQA 1UOKA 2P45B 2YO3A 4E41E 4RAUB 3WS3A 2EIKB 2DYSB 1S7VA 5I1JH 1YEDB 4XRCB 4PGBA 3M17A 5IF0A 3KLHC 1R9FA 1KXVA 3A3YB 3BEVA 3GHEH 4G2AA 1XGYH 2UZIL 1KJ2B 5E6UB 1AGFB 4LCUB 4K5OA 3KM1A 4ORGA 1CXHA 3BKYL 1ZT1A 1TYJA 4A2FA 1N5YL 3BT0A 5F1OB 1FO0A 3Q8FA 4W9HC 4PRHE 4NNPH 1OTUC 4N2OA 4BWTA 4E9VA 2JCCB 3GMLB 3K1KC 3OZ9H 2NXYD 4M8UA 5KSBA 2BSRA 1B2YA 1M4KA 5K9OB 4IBTA 2NZ9D 3DJ9A 3I84A 3UMNA 3ZYIA 4YSTA 3FDWA 4F58L 3QCDA 3A67H 1HOCB 2Y5QA 1QQDB 4P5KB 4Y2OB 4NWFA 1PZBA 3J2PA 4DSYA 2EADA 4Y5YA 4CU7A 4X8CA 4BFGA 4FJ6A 4HS3B 5E2UH 4DUWA 2IANE 1U58A 3GDCA 3HHRB 3QDJB 1A7RH 4LVHB 5EU6D 3UO8B 3OGOE 1HX0A 3MOWA 3NRFA 3B83A 1CDGA 2B20A 2G9KA 1K85A 3INOA 3JZ7A 3OHXC 3MLPA 3P0GB 1A9VA 2XT1B 1AS7A 2XHNA 4V1DB 5FYLL 1G7GA 1UKTA 1DBJH 3T4AA 3NACH 1VFOA 1FVCB 1MZZA 1Q9KA 1YN6B 2A5UA 1Z9OA 4NZUH 4NIYE 1LE9A 4E0RA 1I1AB 5FO8B 4ZFGH 3DMMA 3CZFA 4GEIA 3GD1C 4JFPA 1UOLA 4KVPA 4L2YA 3QDMD 2W95A 5DJAB 4AJWA 4CVMA 5EUKB 1YTSA 3CDGB 1F56A 3QCKA 1MRCH 3DBXA 4L3EA 4Y5YC 3GBNH 2DM7A 4ZNEA 3MV9D 4Q4EA 1KELL 5CJOH 4PRAA 4CADA 4I48A 4OM1H 4FQ1H 2CJUL 4FQHB 1GRWA 1JN6A 1C5BH 2ZUQB 1EDQA 3LH9A 4HJQA 3BH4A 4PY7A 1ZT4B 4U3CA 4HVBA 3WTTA 3BLTA 4JFYA 4UINL 2MKLC 4FG2A 4MCMA 5ALBH 3VFSA 1ZHNB 2Y06H 1P7QB 2DD8L 3VSUA 4UU9A 1SMDA 4IOFC 3QXDA 1A1OA 5FUCC 5I8KL 3ULVL 4OGAC 3IN0A 3C2SA 3GUTB 5IB5B 4DP7X 2IBZX 4RMSA 1A3RH 4GO9A 3O4OC 3VGGA 4P2RB 5KAQG 1EXUA 2OXHB 1MCPL 3SD2A 1GSMA 2IQAA 2O5YL 3FQXA 3FBKA 5FV1L 4YHML 2X41A 4YXLL 3E3QC 4X4ME 2VDKL 3V4VL 3F5WA 3LPFA 1G9NC 1Z3GL 4GMTL 2XA8H 4P2OC 2N7AA 1WD8A 1D6EA 1HHGB 3PHQA 4KX7A 5IQMA 5FO7A 1IAMA 1R5IB 1L9MA 1A14L 4PRPB 1B90A 1SXSA 4F2EA 4EKXA 1UM6H 4TUJA 2VORA 1B3JA 3AWGA 4UIMB 4Z8FH 1JZEA 2CDGB 2E4TA 3FQNB 3FQ2A 5KW9L 1HKFA 3QIWD 3A6BH 4LKXA 4N2HA 1UKSA 2XWCA 4OCWL 1OOWA 2BS9A 3KDMB 1MFEL 1JTTA 4UTCA 1Q6PA 4MHHI 5CKAA 2PBNA 3U9WA 2P43B 3QUXB 2IPUG 1KCVL 4TQ8A 4R7NA 4XMUA 2A6KB 3WY4A 4LSSH 1OAXL 4B9YA 1LP9F 3MCLH 4N90E 3RNQB 5HDEA 3FU7A 3WFBL 4U1MA 4J6RL 1AGBA 1QX1A 3BGMA 3BP6B 3F7VB 4E9TA 3HZ3A 4ZODA 1TXKA 1ZTMA 3KBPA 3S4SA 3QXUA 2A4ZA 1I7ZA 1XIWD 5I1AB 3MRGB 3JUZA 4PLJD 2BNRA 3MRMA 4NM4L 4U2ZA 3H7BA 25C8L 2P9RA 5E08H 4L18A 2WNWA 2Z0BA 3LKPA 1FH5L 2O26U 2VT0A 4JHZA 4Z9KB 1A0QH 4LB8A 2JJSA 1BVKB 2XRAH 3DDGA 3ULUL 5EPMB 1TJMA 3L3DA 3PJSB 4X6FB 2F7QA 4PJEB 1VFUA 1PNDA 1YRKA 2HUHA 4PRNB 1MIMH 5IV2B 3M8OL 2F7PA 1VCBC 4IJTA 4Z3FA 3WNMA 1MKPA 1T1XB 1UWXK 2JWYA 3D06A 3KLSA 4XO4A 2X09A 1JPST 5EULV 4DVBA 5DEGB 5CP3H 2XVBA 3GKWL 1A9EB 2HJLA 4QHKJ 5KYYA 2RFXB 4QIRA 1NBYA 3BRDA 3CM3A 4B9IA 1ZTXL 2VDKB 1E5AA 1NSNL 3MCKB 3V4VB 2EIZB 4CNIA 3I6GB 3LJ8A 5MHSD 1PA9A 4K3EH 2FQDA 1YEJH 4OLYL 2OMZB 3BSHA 1NCWL 3NFNB 2C4FT 4L4VA 3VD0A 2YKLH 5EF1A 2R1YB 5EFIA 3CVHA 3N85H 2PXYB 5E1GA 1Q8MA 2Z4QB 4OZHE 5I1JL 5LQBH 1BXVA 4GG8B 4PJXF 4GLRI 1KIPA 3U36A 1A6VH 5KYWB 4ZIYA 1RUKH 4XH2B 1QO3B 3VXMD 1G7PA 4HJ1A 3GHEL 1HDMB 4DPRA 4JGUA 4HC1H 5FECA 5HDQH 2Y68A 4WI4A 5JW5B 1ZVHA 5LCVL 2BNUA 1E6OH 1XBDA 4NNPL 4NN5B 4DCQB 1EJ8A 5AW3B 2J55A 2GJJA 3OZ9L 1ZRUA 3X14A 4K3GA 3Q2WA 3KYAA 4JKPH 4BH7A 5KYNA 2VDNH 4FLHA 2HRGA 3DO3A 3C8DA 3HE6C 2JJTC 3NEOA 5DU7A 5HP5A 2D3NA 3A67L 2AEIT 3EFDH 1JGVL 3SO5A 3OLIA 2DDQH 3E8UL 1O7SA 4O2FA 1FBIH 5IQ9B 1OE2A 3C8KA 4X6DE 5E2UL 4BUCA 4GKNA 1A7RL 5SV4A 4YSQA 4IOFD 1UFGA 5BUGA 4M48H 2H5UA 1FG2B 1SYVB 2EYTA 4OGAD 2AXFA 4MJ6A 1MNUH 3ETBJ 4FQXB 5E6IA 1DBJL 3NACL 1H3UA 4JBSA 4WCYH 1JBJA 1E0DA 5JO5B 4AGQA 1IAKA 4GRMA 1MCIA 3EMUA 3Q48A 4QRQA 4IEFB 1IEAB 3K4DA 3ZQ9A 4JY6A 4IDLA 1Y6KR 4P2OD 5FAAA 3S5ZA 2CNFA 1KV7A 1MRCL 3GBNL 5FM5O 4K23H 5IKCA 3TPUB 4DEPB 3CFJB 4ZNCD 4UILH 1NDTA 3PV7A 3VDAA 4CVZB 5HYSG 4FQ1L 5I1LB 1X24A 1YY8A 3QEQA 2WO3B 1BD2B 1FVDB 2GKIA 3WKPA 5A16A 1HILA 1C5BL 2YEZA 3V7MA 1VGKA 1TETH 1KCSL 1N9PA 4X4XA 1A9BA 1BBJA 2BY1A 3LXBA 4KROD 4L3CA 1NC2A 1UWGH 2Y06L 2AF2A 3TESA 4HMDA 4ZAKB 4CC0A 2B8OT 4L29B 4PGEB 1NUDA 1R4XA 3TBSB 1A3RL 5TDPA 2CDEB 2XVLA 2XYBA 2BVPB 4D8PA 4WHTB 5HGDB 1U3JA 4YIQA 3GMPA 4KI1A 3WO3B 3MBEB 2BSTA 1U4FA 3CLEL 2OPCA 4IU3A 4TSCH 5EA0L 3QGVA 1GW0A 1KBPA 5ICZA 3MUUA 3WKQA 3QULA 2XA8L 2WO4A 4ONGH 5IHUH 3WXWL 3CBKB 4WO4A 4Y8DC 3V5KA 3NDZE 4IKIA 1WTGT 4R97B 3ZJAA 1CFQA 3CSTA 1FL3B 3L4ZA 2QSTA 4Z8FL 1VHRA 2ICCA 2JI2A 3SDCA 4QHMA 1PX4A 5IQLA 1S5IL 4E36A 2UY6B 5KVGE 3S2CA 1CD1A 3VXRD 1B0IA 2VUOA 3MRKA 4FQQA 4MASA 4PJAA 4IJ3B 5JQ6H 1UTDA 1ORSB 2IO5A 2UXFA 3K6OA 3MCLL 4HWUA 3TYGH 5JIDA 2R0KH 5BOJA 4C54A 4NBYB 2WO2B 4WO4C 2YAOA 4YHPB 4L4TE 3S4EA 2ERJB 1XMEB 4E5XB 4ATWA 1FN4A 4UTAH 4JL2A 2APBA 3UBXB 3GSNL 4FA7B 3NIGF 1YPZA 3CCHB 3HE7C 3RFZA 3DYOA 5E08L 1SJVA 3KHQA 4KKBC 3COOA 1NZRA 4NQVA 4LDCA 2AQSA 4Q0XH 4TOYL 4GSXA 4LT7A 1RP9A 3GLDA 2EE9A 3QJFA 1QMUA 2XRAL 4JPSA 5KBMA 3MU3A 3T08A 2E5EA 2EDJA 2E27H 2BNQA 1QYGH 4BQ8A 4FMKA 4HGWB 4IHBA 1NCUA 3QW9A 4U1NA 2X10A 2F08A 4NUQA 1BDYA 4HOZA 1XSOA 5FYJU 2CLVB 5DUBA 4MWFA 3G6AB 5HHME 4AUUA 2CO7B 2BMKB 5L8LB 4U33A 4BSJA 4JG0H 1BQHA 2NTFB 3B6SA 3MPCA 3FC8A 2X3BA 2HTKC 3NFSH 3PREA 3QWRA 4GBXA 4RH4A 5F0LB 2GK2A 4LL9A 3FF7A 3HE6D 1R5VB 5KAAA 1F6AB 2EUZA 4K3EL 4YDJB 5D2LE 2NLJB 2ESBA 1YEJL 4HOWA 2HVBA 4ZPTB 3F7YA 2IDSA 2W0FB 2YKLL 4RDQF 1KCLA 1IM3B 3VGEA 4MLSA 3N85L 1QI4A 1E4HA 5F70A 3BGFB 5LQBL 2OR8A 2OTWA 1A6VL 2J25A 1RUKL 3ARUA 4MMZA 3QFJA 2EDKA 4YEFA 4PWEA 5I1DB 3GMNA 1B4JH 1BJ1J 1I4FB 3KG5A 3NMEA 2HNPA 5HDQL 3QR2A 4YHKH 2FIKA 4NAQA 5EH1A 3KXFA 1WIUA 4ZDHB 1E6OL 3SGKA 3RPIB 4UDUA 4HSCX 4QF5A 1OGPA 2ZJSH 2ZNWA 4UDTA 4QRPD 4JKPL 2CD0A 2RMNA 5B8CA 3S88L 1I9EA 5TDNB 3HMWH 5MI0B 1DVZA 2YDUA 2DDQL 4LVOB 2EEFA 2H2PC 4Z7NF 2VMJA 1Q9OA 2UUOA 1FBIL 1X5GA 4FG0A 2VN3A 3U79A 1S9XB 3NEXA 1F45A 3HS0B 5I75C 3DIFA 3SYOA 1YNKH 4M48L 1M57B 3EJTA 5D4IA 3I9IA 1Q1JL 2YPLB 3KGRA 3EYOB 4AQAB 2I25N 1G7QB 2V3FA 1NCGA 4KDTA 4NUMA 1ODUA 1TVHB 4MD5A 1MNUL 1EK3A 4C83A 1G87A 5FOJA 4G72B 5AVRB 3HCVA 3ZTCC 4EN3B 1OGAE 1UH2A 2XG5B 4FQCH 3PABA 1T5WB 1P6AB 4RSYA 3R1GH 5I66B 2P4AB 2GQHA 4HAFA 4XN5A 2C4FU 4YH6A 1ZS8B 2I42A 4K23L 3S0PA 3N42B 2I4GA 1BQKA 1WYJA 4UILL 1HL9A 4LMQE 1BYNA 1HSBB 3HRPA 1GWZA 3QXAA 2C9AA