3AWFA

Crystal structure of pten-like domain of ci-vsp (236-576)
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
315
structure length
304
Chain Sequence
b'KDGFDLDLTYVTDHVIAMSFPSSNPIGEVSRFFKTKHPDKFRIYNLCSERGYDETKFDNHVYRVMIDDHNVPTLVDLLKFIDDAKVWMTSDPDHVIAIHCKGGKGRTGTLVSSWLLEDGKFDTAKEALEYFGSRRTGDVFQGVETASQIRYVGYFEKIKKNYGGQLPPMKKLKVTGVTITAIQGVGRGNGSDLSMQIVSERQEVLLCKFAEGYNCALQYDATDDCVTCEVKNCPVLAGDIKVRFMSTSKSLPRGYDNCPFYFWFNTSLVEGDHVTLKREEIDNPHKKKTWKIYRDNFTVKLTFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Voltage-sensor containing phosphatase
molecule tags Hydrolase, membrane protein
source organism Ciona intestinalis
publication title Crystal structure of the cytoplasmic phosphatase and tensin homolog (PTEN)-like region of Ciona intestinalis voltage-sensing phosphatase provides insight into substrate specificity and redox regulation of the phosphoinositide phosphatase activity
pubmed doi rcsb
total genus 103
structure length 304
sequence length 315
chains with identical sequence B, C
ec nomenclature ec 3.1.3.-:
pdb deposition date 2011-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00782 DSPc Dual specificity phosphatase, catalytic domain
A PF10409 PTEN_C2 C2 domain of PTEN tumour-suppressor protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1110 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3awfA02
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3awfA01
4H34A 2B4UA 2IMGA 4NWFA 4GE2A 4TVVA 2HCMA 2H02A 3F99A 2H4VA 1OESA 3A5KA 2I4HA 2OOQA 3QCEA 5KABA 1U24A 2CM8A 1WRMA 1BZJA 4WTYA 5LXQB 4GWFA 1T49A 1KAVA 1SUGA 2AZRA 1PTYA 3D42A 4JMJA 2PI7A 1YGUA 2QBQA 1M3GA 3M4UA 4GFVA 3B7OA 2PBNA 3BLTA 4ICZA 5KA0A 2VEWA 1G1HA 1PA1A 1RXDA 2VEVA 2H4KA 2H4GA 1R6HA 4I8NA 1EEOA 1XBOA 5K9WA 2J43A 2A3KA 1PXHA 4QAPA 2NZ6A 2I6JA 1C87A 3BM8A 2I3RA 2H04A 1ZCLA 1ZCKA 4BJOA 2R0BA 4D3QA 5KA1A 2F70A 2FHBA 4ERCA 2YA1A 1U26A 4KYQA 3V0HA 2F6WA 5K9VA 3S4OA 2I6MA 3RGQA 2HC2A 2VEUA 2PQ5A 3OMHA 3QCBA 4NWGA 5KA9A 2B4SA 2SHPA 1C84A 4HRFA 3V0DA 4AZ1A 5BUGA 2F71A 1OHCA 3ZM2A 3S3HA 2H03A 3D1HA 2P4DA 2QBRA 4RKKA 2HY3A 1Q6MA 1JLNA 2GWOA 1ECVA 2B4OA 4PYHA 4MBBA 4R0SA 2J16A 2QDMA 1VHRA 1OEVA 4QBEA 1QZ0A 2Q05A 2HB1A 2I4GA 4RI4A 2QDCA 2CMCA 3LJ8A 2I4EA 1LARA 1Q6NA 4GE5A 1J4XA 4WU2A 3O4SA 2NTAA 4GS0A 3F9BA 2OZ5A 2RF6A 3I7ZA 2NV5A 2CM7A 4NYHA 1L8GA 2F6ZA 1Q6TA 2F6TA 2YDUA 1OHEA 1BZHA 2CJZA 3O3LA 5HDEA 3O4TA 1WAXA 2F6YA 1L8KA 2G59A 3S3EA 1U25A 5K22A 3RZ2A 1NZ7A 3NMEA 1Q6PA 4Z6BA 1NWEA 2CMAA 4HJPA 1I57A 1ZZWA 3QCKA 1C83A 1FPRA 2I5XA 3AWFA 4KYRA 4NX8A 1LYVA 4QUNA 4D3RA 3QCIA 2C7SA 1C86A 3U96A 2HVLA 5GTJA 5KA4A 1MKPA 1YFOA 2Y2FA 4RH9A 3ZMPA 1G7GA 1PTTA 1NNYA 3QCMA 4GE6A 3EMUA 1KAKA 1NO6A 3QCCA 4ZN5A 3GXGA 3ZV2A 2I6OA 1JF7A 3BLUA 3S4EA 4RDDA 4KI9A 4GRYA 4Y2EA 4Y14A 2FHFA 1FPZA 1G1GA 4H1OA 1ONYA 2GP0A 1PTUA 2I42A 2J72A 4OHHA 3MMJA 3O4UA 1I9SA 3V0IA 4GRZA 3V0FA 4ZRTA 3F41A 2J17A 1YWFA 1YZ4A 3V0JA 1I9TA 1OEUA 5KA3A 2BGDA 5J8RA 3ZMQA 2A8BA 1LQFA 3D1QA 2ZN7A 1G4WR 2QBPA 2GJTA 2QCJA 5K24A 1Q6JA 4OHLA 5KACA 2CNFA 3MOWA 1OEMX 1PA9A 2CM3A 3O5XA 2I6IA 1XXVA 2QDPA 2BV5A 1ONZA 2OC3A 2F46A 3I80A 1YPTA 3N0AA 5EHPA 3OLRA 4NNDA 2FJMA 1Q6SA 2CFVA 2C46A 2J44A 2Y96A 1FQ1A 3H2XA 4YR8B 2Q47A 1WCHA 3EU0A 3EB1A 3RGOA 2CMBA 2FH7A 3BRHA 4DGPA 1C88A 3F81A 1OEOX 1QXKA 2QCTA 4QUMA 4PVGA 2J16B 2M3VA 5EHRA 1OETA 2HC1A 1PYNA 1C85A 2PSZA 2NT7A 3QCNA 3SR9A 4DGXA 2MBCA 3AWGA 3QCFA 2I6PA 2J71A 3PS5A 2I3UA 2F6FA 3EZZA 5KA2A 3D1OA 3V0GA 4R30A 5M43A 2CNIA 3V0EA 1ZC0A 3S3FA 4RHGA 3F9AA 5AWXA 4OHDA 4WOHA 1NWLA 2J73A 4ZI4A 5KA8A 4J51A 2JJDA 1PH0A 5KA7A 4B04A 2QBSA 2FHCA 2VEYA 2G6ZA 3QCLA 3ZM3A 2E0TA 4S0GA 4GFUA 1YTSA 2I1YA 2WGPA 3QCGA 2BIJA 2I75A 1Q1MA 5K25A 4IKCA 2B49A 3RO1A 2YOCA 1OHDA 3QKQA 4QBWA 2PA5A 1GWZA 1BZCA 2HXPA 3GXHA 5KAAA 1GFYA 5BX1A 4RH5A 2CNEA 1A5YA 2OUDA 2F6VA 2HNQA 5KADA 5MMZB 1YGRA 1T48A 1YTWA 4JMKA 4BPCA 2B3OA 1G4US 2B4PA 5K23A 5IBSA 3QCHA 3QCDA 1YN9A 1AAXA 3D9CA 3ZM0A 2BGEA 1T4JA 1RPMA 2NLKA 3ZM1A 4JBCA 1X24A 2PT0A 2QEPA 3QCJA 2CNHA 3S3KA 1G7FA 2HNPA 4OHIA 2BZLA 2NT2A 3A5JA 1XXPA 1D5RA 1EENA 2VEXA 5BZXA 1NL9A 2B07A 2CM2A 2FJNA 4D3PA 3EAXA 4JNBA 2ESBA 2ZMMA 3D44A 3QKPA 4RI5A 4OHEA 1XRIA 3MOZA 5I6VA 4QAHA 3CM3A 2AHSA 4HJQA 3I36A 1V3AA 4R0TA 1YTNA 1G1FA 1XM2A 2CNGA 2P6XA 2DXPA 4YAAA 3AWEA 3SMEA 1P15A 1PTVA 5IBMA 4WU3A 5BZZA 3CWEA
chains in the Genus database with same CATH superfamily
3ARGD 2FEDC 1UZ8B 4IJ3B 5C0CD 3SD5A 2DI8A 4XNAA 1P7BA 5KAQG 4XMTA 3O6KL 4HKJA 1EVUA 2SODB 5FKAB 3X14B 3P3RA 4WWPA 4LOEA 4S1QL 1LEKA 4M6AA 3PL6D 3AXLB 5DMIL 1DQJA 3RU8L 1NC2A 2H3XC 3JWNH 2CM8A 2NY5H 1WAAF 3RZWA 3N06B 4EIZC 5IHBA 4RGNB 1KAVA 2W65A 3NA4A 2H8PB 1QYGL 3DSFH 4L8SA 3NCMA 4OF5A 4LP5A 1BPLB 2V7HA 3DUHA 3P2DA 3ALXA 3NCJL 3B7OA 5GXBB 4IRSC 3WUWG 1J05B 2YR3A 4LKXB 5FO7B 3VWJB 5C08A 3P40A 1SDDA 1PA1A 4XO5A 3ZO9A 2C3HA 3U46A 2X2YA 2OTWB 3CN1A 4PTTA 2WIMA 3BAEL 4KH2A 2CKBA 4ZUVB 4UU9A 3RNQA 3TBSA 4FXKB 2FWOB 4O02B 3GBML 1TPXB 3AQYA 5JNYA 4HBCH 5C6PB 4AL8H 3MXWL 3VXMD 3BPOC 2DTMH 1T5WB 3IJEA 4QRPB 3I3DA 3BP4B 4MD4A 1YPZA 3FRPA 3O4LB 5IMKA 3RURA 3HG1B 4L4VB 4MS8D 5CJOL 4OV6F 1MHPH 3T3PB 5KTEH 2X6UA 4TVPL 3K91A 1EAPA 1CTNA 1ZCKA 3RDTD 3L1OH 4WUKL 3V0VB 5I66B 3FT2A 1KXVA 1KCUH 1YY8B 4UCFA 2GCYA 2B59B 4TQEH 1FH5H 1I9JH 2YA1A 1W8EA 3MRMA 1NEZG 5GRXG 1CD8A 4HXAL 4ZUWB 3BWAA 2F74B 1ZAGA 5IP4A 2P8LB 5DJDA 3RGQA 2ODHA 3OMNB 2EDTA 5D4QA 3DXAB 2EAEA 4NWGA 2B4SA 3DARA 1SFDA 2X4TB 5CEYA 1UB6B 1T1ZA 2X4UA 1IGFL 3S36H 4FTVB 1YEKL 3TCXA 1UEMA 1TZAA 3ECVA 3CPLB 4ZFFA 1X5GA 2UAGA 2P26A 4OIFA 3T65B 5JHDE 3O2DA 1Z7JA 3QDGD 4K94H 2HY3A 1Q6MA 2HX8A 1MIEH 2ORBH 1N18A 3ARDA 4KKLD 1IGJA 2C9VA 2QPDB 2LT9A 4ELMB 4YXLH 1NCWL 4M43L 5BRZE 1X9LA 3LKPB 1ECZA 4FXGB 2VL5B 1CFQB 1CXEA 2YOAA 2F7RA 1FZJB 3GKZA 2I4GA 2XJAA 1KBGH 3IGUA 3LS4H 5AOJA 1LO4L 4ZS6D 1A7QH 5FYKH 2GJRA 5DHMC 2XY2A 2W0FA 3F7KA 4L8DB 4UV7L 2OSYA 2C3VA 2A6DB 2GC5A 4I5BA 3TIEB 2A9MH 3L5XL 1KSRA 2AKRB 6PAZA 4JM0A 3Q8AA 5HHNA 3NCYP 1FSKC 5C0CA 4YWGH 3WSQH 1LWHA 4P49A 4BA8A 4NYHA 3HS9A 1G9HA 4KUCD 4NI3A 5CUSL 4LSPL 4TVSa 4XZUA 4CDGC 3GBNH 3MLYL 1S7VA 3RZCB 4FKHA 4DP6X 4FOMA 1U8HB 1NCGA 1BQ5A 4M6ML 3J8F7 3MLWH 3Q1SL 4MAYB 2VUKA 3WLBB 4ZFOL 1JZ3A 2OXHA 5D7SL 5DR5H 1J5OL 2XACC 3WE1A 4J3OG 4L5FE 4NO0D 5DI8A 5KZCB 4LHUB 4YBHA 3EBHA 3SN6N 1UXWA 5B8CA 5JUEL 5BXFA 3U4KA 4B27A 4AGNA 2C7UB 1HL9A 4XBEL 4BDVB 4BQCA 3ZHKA 4GKSB 1S9YB 2BOBB 1MHCA 4L37B 1HZLA 1SJEB 4BJLA 3HS0B 4NX8A 4G8IB 1NFKA 2NSXA 4QUNA 2VR3A 4ORZC 4IU2A 4X6DF 3TBTA 4ZT1A 4PRBA 2HG5B 3ARBD 3BZ4A 1AO7A 2BCKA 4F2ME 1C86A 2JELL 4C56D 1IC5H 1OLLA 2GW5A 3R06A 5A2KH 5DEJA 4YQXH 1CFVH 2FGWH 4QT5B 3OC8A 4FI7A 5J11B 4K71C 1DYZA 2PLTA 1CWVA 1MXGA 2ADJB 1IZKA 1WBYA 1YUHB 2J3SA 3MBEB 5FHBL 2H6PA 4GXVH 3T4YB 2V7HB 3QCCA 1HQRA 1M3JA 4ZW6A 1S7RA 1UZ6E 3BYTA 4ORGB 5EU5B 1BYOA 1JWMB 1UUNA 2F6AA 4KI5C 2XTSA 3U46B 4OJAA 3VXPA 4F24A 4Y14A 3B2XA 1CFSB 1LEGB 2F5AH 4ZPTB 3I6GB 3FU3A 5D70L 1OP5H 1W72L 2Z31D 3FYIB 4ZFZA 2WXHA 4OV5A 2NZIA 3DURB 1PMYA 1DO6A 4YE4H 2Y7QA 3TA3A 1ZDQA 2B4CC 3UAAA 4OKVB 5A1AA 2JIXB 3GSVB 1YPZB 3FRPB 5IMKB 2WANA 1RUQH 3P9LB 4XO3A 1NEZB 2D7PA 3CHOA 4C56E 2LAGB 1R0AL 3QZPA 3CH1A 5CILL 2Z4TA 5BNXD 4DP7X 1T1WA 3S0PA 4RRPA 2WXOA 3LIZL 3ZYJA 2WQXA 1RZKC 4IOIB 3WO4B 4ZSOA 3QCUL 3DA0A 4X99A 2D7OA 1MFBL 1N9PA 1XB6A 4EI5D 4MASA 4HJTA 2K9UA 2DICA 3SYAA 3V4PB 2QCJA 4FA8A 2BP8B 2V5YA 2B1HL 4PJ9A 4ONFH 4JM2C 2AITA 1PA9A 4HUWA 4I48A 1JE6A 1X5MA 4ODHL 2E7MA 3OBAA 2Y2YA 4ZFQA 4TVUA 3ARED 4DKEH 5F3BB 5D7HA 2VLJD 3AXLA 1YY9D 1QZ1A 2FQFA 5DS8A 5A6MA 1YUKB 5C7XH 1ASPA 3WE6B 3FJTA 3MJ7B 2C46A 3O45B 3NZHL 3OLGA 2NQ3A 4Y2DD 3SY0B 5I6KA 4PBWD 3APNA 3X1BA 4G6KL 4FNRA 5BCAA 4DPRA 3KWVA 4WEBH 1ZVYA 2FH7A 2WUBH 4DGPA 3FUIA 3BZEA 2C3VB 3EXJA 1A4KB 2AM2A 5T1LA 1QSEB 1T6VN 3EUUA 3LTVA 2HLAA 1GCFA 4PG2C 1EFXA 2YRZA 5DTFB 3CH8A 1JGEB 5A7EA 4ODWA 1OW0C 1ZPLA 1KCVH 4YHOL 2HFEA 4JE4B 1HXMA 1MCOH 3POHA 4QMEA 1D5BB 2FK9A 4QGTA 1DJIA 5DS2A 5IROC 1VESA 5DVPA 3LXAA 3W39B 5KG9B 4N1HB 4E41D 5A2JH 2XTLA 4DZ8B 2I3UA 1IM3B 1IGCH 2VLJE 4XMLH 2Y7MA 5FKAA 3VFRA 4PJEA 3D0VB 3V0GA 5FYLL 1VADB 1UXWB 1NBYB 3EJJX 2F61A 2P7TA 3RL1A 1SJHB 3MV8D 5GS0L 3QYNA 4QKXB 1A7RL 4RHGA 1P2CB 1IUZA 3AJ7A 1Z32X 4YR6A 1DEEB 3RVXC 4YZWA 4AYFA 3TBBA 3BO8B 4E9LA 1AO7E 2FCBA 4GAYA 1KXTA 4F2MA 3C60C 1L9QA 5DRZA 5MEOB 3KLHD 2ZG3A 2PYED 2VXUH 3VQ1C 2XTJC 3IN0A 1J86A 1UKQA 1U8JB 3AU0A 1VAHA 2EH8L 1WT5C 2G3NA 5D70H 2EVHA 1ZVNA 2EQDA 1SGKA 1QEWB 3MLUH 1JPFA 4EKXA 2XA8H 1T80A 2F53D 2R1YA 4ZPVA 1PU0A 5EMYA 2ZOLB 3TT1L 5ILTL 4LFHG 2V9RA 3K6SB 2WGPA 3RZCD 2DQHH 2FX8H 4NQUA 5D1XB 4CU8A 1BVLA 1BQHA 2XFGB 3JWNE 5JLZA 1JUFB 1V05A 2OTUA 5FHBH 1SVCP 3BEWA 3CLEH 2GCYB 1HU8A 3OR7A 1A4AA 1EAJA 3QFJA 4JGUA 1AG6A 3ZM5A 2YC1B 1FV1B 3CZFA 1FNSL 3SPHA 4ZUWA 2OMVA 4WY7L 3HN3A 2WSPA 3HTLX 5FW7A 4MD5A 1XGQA 2MNWA 1Z5HA 1N2RA 3WIAA 1ZLSH 2WW8A 3GXHA 1MNUL 3P1VA 4LSSH 3HC0A 5D1XC 3U30C 3L3KB 1YYLL 3BH9B 1TKWA 2UYLA 2VCOA 5JDSB 1I1RA 3LB6D 1EUUA 3H6JA 3QDJA 1YECL 3IU3A 5CZXD 5TE4L 5C9JB 1YNKL 5J0BA 4LQ1A 4UM8A 4PRIA 3R4RA 4KI5F 4S1RH 1YTWA 1M7UA 3DWTA 3O0RL 2EO7A 4YDJA 2DY2A 2LABA 3WHXA 5JQ6L 1Q1JH 5EC1B 1YFOA 5I0XA 4IOIA 4P05A 1FFQA 2GC7C 1OLZA 2LQRA 5C0EA 4CVKA 3NJNA 2ED8A 2IOMA 5IOPB 2VAJA 4XVOA 4X99B 5D96C 3RIAF 3VTAA 1EHLL 3NSDA 4YUEL 1IQWH 3QXTA 2BGEA 5F9OH 4YSAA 4X9FA 3E6HB 5D6CA 5ABAA 2JKNA 2NLKA 3CZGA 1OSEA 4UIMA 5CSZB 1NBVH 3WG7B 4N0FA 1D6VL 3TVMA 4GG8A 1LO5A 3GMMB 3RVUC 3X1EA 3GF8A 1NWPA 3TBYB 4TVPD 3RVWC 1I31A 2ADGB 1NSNL 4PR5B 3UBXG 5GQBA 3TIDA 5D7LA 2X28A 1IBYA 3EAKA 1AJ7H 3WIHH 1RZGA 3WE6A 3V0WH 4G7YL 1KLFB 5F0MB 2VOSA 4MQXC 3RA7H 3VXNB 3MLRL 1CVSC 2FJNA 4N5EC 3PAYA 3ATBA 4Y2LA 3QKPA 2Z9TA 1T7VA 3GI8L 4OHEA 2QV2A 4FQLL 3UABA 1XRIA 4D9LH 4N2BA 5D4HA 4NSKB 2UX6A 1OWWA 3TGXA 3U4BH 1N59A 1W16A 3ARVA 3V52H 2YD7A 4LCIL 3RTQA 4OCRH 3SE3C 3V7MA 1EFXB 2J20A 5CZVH 2IH1B 4LDEB 1UUSA 2CDFB 3MBWA 3HLAB 4L29B 3ZE2F 4DKAA 3QEGL 4HAFA 3EYFA 4OCSH 4PB9L 4UUJA 3KPPB 5AW2B 1VACA 2R23A 1XQ4A 3D2TA 1MHCB 3P3TA 3N42F 3O4LE 1Q1PA 3P9LA 2WGNB 1UCTA 3BAXA 3NIFB 4NQDB 4C54A 5B1BB 2KKQA 2XSKA 1QFWH 3QPKA 4B9ZA 3ABMB 4TVVA 1YUHA 4BUBA 3TYGL 5E5LA 3O2VL 3ZL2A 2VISB 3JYCA 1VRSA 1K72A 2JKIS 3MV9A 2VJ0A 1EV2E 4OZ4B 2IADA 2XV2A 5JXEC 1UQSA 4Y5VB 2XXGA 5TDNA 1PG7X 2IMNA 2YJQA 1MFDL 3BVTA 4UF7C 3F6JA 3OF6D 3WJMB 3BO8A 2BO0A 4DVBB 4NCC2 3ZLQC 2ZIDA 2IGLA 4AQEB 1XR9A 1NCWH 4JFEB 2Q86B 2LFEA 3CFJA 4KVPA 5INDA 3V4PA 5AWNL 3G04B 1NDTA 3PWJA 4GFVA 3BRFA 4TUJB 5JPNA 2A6IB 4ICZA 2WWKT 4Y19B 2LGNA 5MEPB 4IIQA 3ZMEA 4Z7QB 4MDJB 3L5IA 3ARBC 5DZNA 4J6IA 4M3KB 5FECA 5C09B 3CFNA 5DS8B 2A3KA 3O4LD 2X6VA 5KANI 2BMKB 1KY7A 3MLZL 4WHYG 1ZLVK 5I74B 4HGWB 3L4YA 3BC9A 4KFMA 5DGRA 2BSEA 4ALAC 1S46A 1NEZA 3U9PH 4FYSA 4OJDH 3LPGA 4XN9A 5GGTA 1MVUA 1XGQB 3JVFC 3ZL4H 3U82B 5DMIH 4EN3C 3BP6A 3DMMB 4HJUA 1SN2A 4X8XA 1YA5A 5DUMH 3U25A 1I7TA 2AXGB 1F3RB 1YMMB 1JK9B 1INQA 2WLLB 2ZKXA 3CFBB 3CWGA 4ZI8A 4GW5A 1J18A 3CSPA 3DROA 3F7YA 3G08B 2Z6FA 4GO9A 4XP4L 3CZSA 2VEUA 2B1AL 1VCBC 3DMMC 1NIAA 3PP3H 4IK6A 2HPOA 4KNTA 4PWHA 4X7TA 3C5ZC 4DZ8A 4HRFA 1KDJA 2VDKL 4NO3B 3SDXE 4JN2B 1P3DA 4YDLC 1RUAL 2AZUA 5IBLC 4PJBF 3H2WA 3ABZA 3V4UH 4Y9CA 4O02H 3CU1A 5GRUL 1DJYA 4YR6B 3GC3A 1UWXK 4PRBB 3D85D 4R0SA 2J16A 4GBXD 3ZE2B 5F1KC 1IQDB 1G1KA 5I1JL 1MW1A 1NAKH 2ROXA 4UIKH 1OB0A 3AZUA 3PFUA 4YH6A 5GGQH 2ZAGA 4L8CB 2FJHA 5CIPA 1YEJL 3BN9D 4RQQB 5I16A 1GJUA 3QUML 3HNSH 4HA1A 1K5NB 5JHLL 1GGBH 2HWZL 3FT3A 4OZIF 1IE5A 1LARA 1WBYB 1RZKL 1Q6NA 1IEHA 3PHQB 4CA4A 4WU2A 3LD8B 5CN1A 3V10A 2NTAA 3VXOB 4GBXB 4JM2B 4KJYA 3D85B 1S7RB 4F5CA 5JYMA 1QLEB 4NI6A 1Q6TA 2A9NH 2Z1KA 2CD0A 4OM1H 1U3NA 4JO5A 4AOFA 3ILQC 2YXVA 5BVJA 4GFXA 4F7MA 3LDBC 1UD4A 3QRGH 5TK2A 1THCA 3SKMB 2GUYA 4K5OA 2AJXH 4MHHI 4GAAA 5DCCA 3GWJA 4BUGA 1WGVA 3IB4A 2ZXWB 2XZCH 3S35H 2G59A 5EULV 3BESR 4LOFA 4L3EA 4Q9RH 1DR9A 1BD2E 2LR4A 4QRSA 3MSPA 4XNQB 1LE9B 3PUCA 3RHWK 1QLEH 4NHUA 4FZ8L 3CFMA 1ZV5A 1EFXD 4QD2E 5J6HB 3S98A 1GXEA 3PJNA 5GISL 2C5DC 1H15B 3BSZH 5ID0A 3U7WL 2QZQA 3LSOB 1URLA 3KWUA 1BXAA 3U48A 2QADC 3TO4D 1QLFA 3ZQXA 4KXZH 4D9RE 2FQEA 2VIRA 4K3JL 4XCYB 1OP5K 2R39A 2HVLA 3W0WB 4Y2DA 4H4NA 1HHIA 3BGMB 2WXGA 2IOIA 3KXFB 3BFQG 1NICA 4FI6A 3GLZA 5DHYB 2QQKL 1G0YR 3UPAA 1TZHB 1U8IA 2QKSA 3P4MB 4PJ7A 2FIRT 4ZW7A 3F04A 3WN5A 4PJBA 1TU2A 2DQTH 1AGEA 4ZN5A 4CKQA 4DW2L 2P8MA 4GO6B 4D7BA 2BZ7A 1E2ZA 1U8OA 1AZVA 3UZVB 3CU7A 1KDIA 3OKLA 2XVGA 3M1BA 1PZCA 3PNWA 5JOEA 2GT9B 3D05A 1E3XA 2VXVL 3SBWC 5IIEB 2C4FU 3IFPA 2YA0A 1TXKA 5FF6A 1EBAA 1FHGA 1GKEA 4N9OB 2CCLA 1BZ8A 3V4VB 2QQNH 1M2VA 3GI9H 3QPQD 5ALBH 4MMZC 3VXQA 1KT2B 3NQKA 1NOFA 4UTAL 1MFCH 3LVTA 5JIKA 3F41A 1FNGA 2WLIA 3ARBA 1FYTB 1W6WA 4MNGE 1ZTMA 3QRFM 2X0WA 1DVZA 2HB0A 3BSZL 2GABA 1G94A 1BQRA 5G5DB 1TCRB 3GD1C 4HKXA 1CFNB 5I75B 2E7LC 2GSIB 1MQ8A 3QFJE 4XP5L 4GLRI 3NH7H 1L9RA 4U6HB 3S88L 4JPWH 5LCVL 4ELME 3COOA 3MLSH 4MA3A 1DQVA 5F6HI 4OF8A 3I75A 5KBPA 3GEFA 3KYKH 1A4CA 2WLNA 4NO3A 2HN7A 3ZX1A 2AFNA 3VA2C 1PW3A 4F33B 2A6KA 3NQIA 1C1EL 3CVIL 2BSTA 3VYPA 5CR1A 2PR4H 3ARZA 4PJ6A 2WXFA 2CGZA 4P9ML 3SE3A 3MRBB 4IDLA 1FO0A 2YQBA 4MXQD 5ID1A 2H8PA 1Q6SA 4LXFA 5LCVA 4EN3D 4QUOA 1ACXA 1M3IA 5DK0A 2VC2B 4LKXA 5FK9B 1JGDB 4NQXB 2PO6D 5CS7A 3D4GA 4QY8B 2V8LA 3QE5A 3RGOA 2KS0A 2VLRA 2HH0H 2WLKA 5CGYD 5JO5B 5LKNA 4MZ3A 4CADA 5LLIC 1OGAA 5DVLA 1T1YA 3D07A 1JZ8A 2OYPA 1KPUB 3IU4L 3CXFA 3CZJA 3IJYA 1C85A 2UZXB 1VACB 1ZEAL 4YHPB 2R29L 1MY7A 5BRZA 1IGYA 3ZDXE 2R15A 1II4E 3AWGA 3IXTA 3J07A 3EH5B 2J71A 4DVBA 2RCSH 1MQKL 1OTUC 2L0DA 2NUTA 5BS0E 1Q38A 3OG4B 1IEBA 4XB8A 5INDB 5J06A 5KVMC 1E8CA 2IANA 4YBLC 4DP8X 5FO7A 2IADB 3VWJA 2JFGA 1FORH 1JFQH 3M7FB 1K4DA 4UM8B 2A83B 4JRYA 2DJUA 2MOGA 3LNGA 5AKSA 5FM8A 3V0EA 4D0DA 1SNRA 1WPCA 4LRIC 1F02I 3S2CA 5CD5D 4AQEA 1MJ8L 2J73A 1PNDA 1ZIAA 4U6VL 1UB5B 2OMXA 4XC3L 3MYJB 1IBDA 3PL6C 4KQ3H 1QLRB 1NWOA 4E9WA 3KM2A 3CFKB 1AD9B 4QO1B 4A7QA 2N4IA 1GS8A 2X4PA 5I75C 2CLZA 1VDGA 2UZYB 4WW2C 5D7IB 2DBLL 1MI5E 4KGJA 4MMYB 4PUBH 1CFTA 2GSMB 5EBLA 2J5LB 3NDYE 5TE7H 3ZM3A 3I50L 5D6CB 1PCXA 4BHUI 4F57H 2DLHA 7TAAA 3OPZL 4GFUA 1J10A 1J9TA 4I9WE 1CK0L 2KDYA 4I1PA 1OGAD 5H37G 4JANB 2AI0L 3NEOA 5E5MB 3WS3A 4W4OC 5ABDE 3ILQD 2I75A 2BMKA 4P23A 2WC7A 3F6LA 3NEXA 2AV7B 3VGBA 2EYTB 3VI3E 1UD3A 4FXLA 3ZTNL 4KPHL 1WQVT 1I3VA 1U8OB 2PPCA 1KLGA 3SODB 3UZVA 1G7LB 4B9FA 3MJWA 1L9OA 3DBXB 1RZGB 1MZYA 4UNTA 1A9EB 4LDCA 1ZVSA 2R2EB 2NNFA 4PBXA 3CXDL 3KPSA 4NN6B 1R3LA 4HS8L 2J6EL 2Q1EA 3RWDA 3BE1L 1CR9H 1MFNA 1K4CA 4L8BB 2DJMA 2CNEA 4N28A 1L5GB 2QADD 3ZK0A 4HJSA 1A25A 1K6QL 2BVQB 2D7NA 3RBSA 2AGJL 3K1KC 4LL9A 4JMKA 3F00A 4FD0A 3QI9D 3TNMA 4JFOB 3QAZC 3BPOB 5DGQA 5INCB 5SWZD 4P5TA 3MV11 2V33A 4LIQH 4IHOB 2QR0B 1BEXA 3RKDC 2HKHH 2Z7YA 4E9VA 1YEFH 2MCPH 2AXFB 3V5HB 1ILSA 3T0VA 1SJXA 4XVSH 4QRSB 3D30A 1DBJL 2NNCA 5IREA 3ARDD 3LCYA 3DV6B 1TETH 2MHAB 1RPMA 3JWDL 3E3QE 1EO7A 1X9UA 4PLJC 5K9JL 1JN6B 4MB3A 2R8SH 4FQPA 3C2SA 2V5RA 1U8NB 1OP3H 1BQLL 4B6ZA 2EXWC 3BRDA 3P3YA 1G7FA 1I75A 2BXZA 4BYHA 4Q2ZA 5T1JA 4WTWA 1XB8A 2XJKA 2VGLM 1FPTL 1FDLH 5CR8A 2AJSH 2R69L 4EKJA 3VE0A 1G7JB 1Z3GH 2H6OA 5ECGA 3CFJB 1G7IA 5FC9A 3B7RL 3P9MA 2FB4H 1X4ZA 3GXDA 4OCYL 4XXWC 2YRPA 4NZ8A 4JHVA 1YNTA 5DJZA 3QRBA 4HH9B 4OW6A 1CTOA 3WUWA 1CDHA 3KYKL 4BFNA 4GRLD 2DN7A 1D5MB 5IROA 3RWHA 2Z35A 3MREB 1BVOA 5AW1B 4NHUB 1VZHA 1FAIH 1MHEB 4QDIA 4YZFF 4L1SA 4Q8BA 2G9HA 3ATAA 4X4ZA 1PF3A 1TZIB 5ICUA 2XC8A 2PCXA 3BAIA 1FG9C 3HG4A 2BRRL 5IG7A 1NFDE 4QRRE 4RCAA 3HC3H 1FFNA 4YXHH 1Z66A 2RMNA 1JHLH 3NP3A 4PM1A 5BUPA 3VQMA 5F97E 5FX3A 4JFZL 2C9UA 4HC1L 1G43A 3GHPA 5EZPA 5KZCD 1ETA1 2ITFA 5E9DA 4URKA 2JH2A 3U1SL 5IBMA 5DRNA 5KYNA 3EOTL 5IB3B 2DQGL 3NN8A 4IEFA 2ZOOA 3AUWB 3SGDH 4B0MB 1G1OA 1IC1A 2HCMA 4NC2B 2AI0H 3FB7A 1EANA 2WLIB 4XN2A 4NT6B 3CVIH 2JKSA 3CAFA 2XQYA 4HUKB 2XT1B 1OM3L 3SPJA 1MUJB 2BP3A 2XQBH 1RFDL 2PO6C 4GWFA 2HLFD 4JY4A 5EIQA 5I0VA 1PTYA 5DZLA 1N5AA 4A7SA 5KTEL 4GNKB 4HUWB 2X4PB 3VH8B 5I6MA 4X7SL 4YZFE 2Y7OA 5G4MA 5FWQA 4HWBH 5LBVA 4XPGH 5KA0A 3F7VB 1R34A 1PD0A 2GT9A 1PKQE 4WWKA 5F3FA 3FOLA 5CSBA 4HBCL 3NCWA 2VMDA 2Y1YA 3KGRA 4FF9A 4NDMB 4D2NA 3UG4A 2IPTH 3KPLA 2LHAA 3HS0C 2Y23A 3EFDL 5E70A 3D69B 4H0HB 2F2HA 2GJ6D 2DYPD 4G8GB 5J9PA 2BCMA 1HEHC 3SE6A 3U7WH 2A6DA 1KPVA 2DQHL 4OKDA 2Q87A 3VFMB 5H94B 4M8RA 5LQBH 3BMWA 4RISL 2WQSA 4ZO8A 4HH8A 4J6RH 5EZLA 2YMXL 1ZCLA 4U6XA 4UOJA 1CK0H 1MLCB 2FX9L 3BZFB 1U3HC 3L5HA 3O2DH 4O2FA 1WAAA 5EU4A 4CADB 4Y4HD 5LHDA 3WUZA 2J55A 4YDKH 2FHBA 5AVRB 2IG2L 3CZLA 1B88A 1ID2A 3KBFA 4GSDL 3V0HA 4JCLA 3GRWL 2FJGB 4RX4A 2IV8A 5J7CC 1CGYA 5CZRA 4MJ4A 3N41B 3B1TA 5ICZA 4TTGA 1AY1H 1FVEA 4IGBB 3TNMB 4AYMC 4LHUD 3ZU8A 4MFHA 4D8OA 5KA9A 1KELH 4DO4A 4L3EB 5CILH 4OD1H 4GG6B 4M7KH 2Y69B 1JXFA 5I1LA 1JNNL 3AT8A 4YDVA 5GRWA 3QULB 1FZMA 2ZKHH 4NO2B 1WK0A 4X8GA 5IMMA 5ID1B 5FYLD 5DD1H 1JTOA 2NY1B 5GZNA 4KMQA 1QPKA 4DT2A 3PP4H 4YBQD 1JV2A 1RK7A 2PYFA 4M4RB 4HKBA 5E6IB 5E9AA 4HHAB 3UGEA 1A0QL 4FZ8H 4I87A 3H2PA 5C07A 1QZ0A 4DGIL 2WWMC 4DEUA 1RUKL 5MEQB 3RIAK 2BSSA 3G5XB 5CBAA 5EEUA 3JTTA 3LKPA 5HGGS 3FQWB 2EIZA 3HZYB 2MOQA 3OAZK 3SQBA 2BP5M 5L4JA 4DP9X 2P44B 4PJ5D 1DBAL 2DMKA 2CM7A 3QJQB 4JGMA 3PL6B 3QG7H 2YDUA 2EE6A 4OB5H 4POZD 3RKDD 3BFWA 4LCCA 4ODSL 1KB9K 4Z7UB 3QCVL 1BZHA 4I3GA 3E3QC 1MJUH 3BAKA 1SHMA 2I7OA 2HG0A 4OLZL 4TLKA 5HHVH 3OKYA 1OOWA 2I7SA 4HUCA 2O6PA 5FWRA 4ZW8A 3GSVA 1PZ2A 1WAXA 1RJZB 3B2MA 2VXVH 4N3TA 3VJ6B 4ANVA 4AYGA 1X6LA 4EVNB 4FFZH 3GB7A 1Q0XL 4PQXA 2WNXA 2NQDA 4NOBA 4Z7VF 2Y72A 5L4FA 4Z3JA 1NC4B 3BDXA 3DV4B 2OXHB 3O8XB 5KYYB 1ZXQA 4XN5A 2DWYA 2XVLA 5F7MC 3MRJB 4P5KB 2EDNA 4DP4X 2K70A 4JFXB 5AVZB 2APSA 3K2IA 2ZP8A 3MO1A 1HILA 1Z5LA 1JYXA 2H3NA 3O3UN 3QNFA 4AWJC 1UWGH 4NCC1 4NN7B 1W0VB 4HK3J 2ZWSA 4GKSA 2FUQA 4I5BB 1OAXH 1BIIA 1OTUD 3QZWA 5DMGD 4U3HA 3WSQL 4KKRA 4ETQB 2UWEF 1IAII 4QRPD 3VFGL 1ET5A 1D6VH 1TKWB 1G7GA 2HN7B 5AOLA 5HHQB 1SY6L 1MWAL 1PTTA 4GIOA 4EI5A 1BLNA 5JPMA 5I1KL 3FDWA 5DD6B 3K4AA 3VH8A 2NLJA 4I13B 3C60A 1NO6A 1USZA 1NGWA 4KJWC 2J8UF 3C5SB 1K8DA 4MAYA 2ZF9A 3WLBA 4MXWH 3NIGB 1CF8L 1XH2A 2FD6H 4IMLB 4TS6A 4HWBL 3BLUA 2MPAH 4GMSL 4BQBA 3ZHLA 1B4JH 4TUUA 4JKKA 1TTFA 1UACH 3WEOA 1U3HA 2C3XA 3D0LB 2XBZA 5IWLA 1P5UB 4S1DC 4DGIH 5DDHB 3GNML 1JZDC 2QSTA 3HG2A 3WXVH 4PGCA 1N5YL 2OTPA 5C8JA 1WFTA 4F7PA 4O5LH 3UYPB 3KEDA 4P3WA 3BZEB 2IH9A 3PJSB 5AKRA 1MF2L 3O6FA 4LDLB 1GZQB 4Q6IA 3DTXB 1AQDA 4BA0A 4QTHB 3TCLA 1JPGB 3N91A 2Z31A 5FUZL 2BCKB 4ADGA 4OF7A 3IJHA 2VR7A 5HPOA 4LSSL 5FGCB 5HI4C 5E95B 1RHFA 3I3BA 4Y4FB 2VDOH 1MFEL 1IKNC 1OCCB 3D25B 4FYTA 4C12A 4K0OA 3D5OF 4QHNA 3MR9B 4WJ5B 4ANKA 4X0NA 4WRLA 4NNYA 2ZN7A 4MJ5A 3STBA 2CUHA 4TVPH 5K24A 1HSAB 2ZX6A 2JB6B 3NJHA 4UB0L 1HOCB 4QXUL 1OEMX 1MCJA 3CX5K 3V0AC 2YLHA 1IFGA 1G9MH 2F58L 1OAUL 4KRPB 4J3XA 4U3SB 4X6CA 1XEUA 2L7EA 3UAFA 4M6MH 1G7IB 2EUZA 1CE6B 3N0AA 1XCTA 4WKZA 3UDWA 3C5JA 2VB5A 4FYQA 3T9WA 3TN0A 1PAZA 2R0WH 3RIFK 1SMDA 4QYOB 4ENEC 1TJMA 1GOGA 4FZEH 5B39B 1ZSDA 1IC7L 5EU6E 4N0RA 4WFGD 4JMXA 4YR8B 1BAWA 1VGEL 2MRYA 2X4RB 5DEFA 2K6YA 2TAAA 3HB3B 3EU0A 3WS3B 3S3DB 2BERA 3CNKA 1Y18A 5DD3L 4LCIH 3B56A 3KJ4B 2EIZB 1KENH 4JHAH 4KUCF 3RIKA 1NUFA 5B1JA 3LN5B 1KUMA 1CICD 1JYVA 5HDQH 3VFOA 1QFHA 3B5GA 3DNKA 4W93A 2RA1A 3BISA 3C5ZA 2PTUA 3AGWA 3WJJC 2PSZA 5IFAL 4R96A 3QCNA 1A9EA 2Y36L 4PJHF 2W9DL 2CPUA 4JRXD 3WJMA 2IGTA 1WFNA 2H7WA 3GI8H 3QUYB 5HYIA 4F2FA 3SDXB 4JFYB 4PLKC 4TOYH 3KW7A 4YFLI 4PS4H 5I26A 4HEME 5CFAA 1L5GA 4DUWA 3THMH 4NGHL 2JKXA 3DX1A 3DUUB 1RLWA 4MB1A 3D3VA 2IALA 3QWRA 5DD5L 5DWUH 2KLSA 5KSBF 1DP0A 4IIQB 4MMXA 3FTVA 1KY6A 3QGVA 5I9QC 1A1OA 5EIIG 5KYUA 2DLIA 5EU6D 4UQ2B 3I02B 5EC2A 4CDHA 2AK4E 1C8QA 1LE5B 1JF5A 2WYZA 1KTLB 3Q5OA 3CLWA 4XP1L 4E42B 3ULUL 1G6VK 1R6VA 4ZUUB 3BH8B 3J2PA 4MJIA 2YUVA 5J13B 3DRTA 2PNDA 2X5OA 3EYUL 3WXVL 4X9YA 1S7XA 2RR3A 2AANA 3ZUNC 2BC4B 3BSHA 5CJOH 1FZMB 3TT1H 4Y9FA 4LQFH 4JZNB 4R7XA 1F3DJ 1RJYA 2XQ0A 4K94C 4PJAF 5C0FB 5HVHC 5I5IA 3BXNA 4ZMXA 1XSOA 5CJ8A 4D8PB 4TN9A 3GPEA 4PTUB 5DD6A 2VMEA 2E9GA 2YBRB 3QW9A 2M1KA 1DLHB 3WN6A 2BDNL 1CDGA 5D1ZD 3U9PL 3DIDA 4MYPA 3WNJA 5DJCB 1F4WL 2V0AA 2X6CA 1WS8A 4QBWA 4N6RB 3AG2B 1WC7B 3QXDB 2PA5A 5DT1H 1U3ZA 1CDBA 1BQHB 4LGPB 3GJFH 5JLZB 1MNUH 4HU8A 2CBPA 4WI6A 4HMCA 1FIGL 4YIQB 3T4AC 4ZW5A 3UTTE 1MEXL 1UKTA 2V3FA 4CJ1A 3T1FA 1Q8MA 4B7LA 3MJ9A 4RFNB 1U8MB 2FAUA 3N1PC 3B2PA 4KY1L 4ECNA 1ZPUA 3A3YB 3FFCD 1QD0A 3I3EA 4RMTA 3BUBA 1WS7A 4BCYA 2HSIA 3S4SB 3V6FB 1BQUA 3LPWA 5JW5A 1R4XA 3C6LA 2K7PA 2B20A 2B4PA 1Z3RA 2O6DA 5E6ZA 5DRWA 3I9AA 1AZBA 5HVWA 3MLUL 4NQDA 2WZPA 3TO2B 2Z0BA 1JJUA 1SHSA 3LNFA 5LBSH 3HG5A 5AYUH 1IFHL 5K9OB 1HWHB 5DZJA 2O6CA 3AT9A 3CVHH 3ASWA 4XH2B 1IAOA 5F44A 1TLMA 1NMCB 3SQBB 5AB0A 4MX7A 2A2QT 3HR5B 3T3ME 3SDYL 4IJ3C 1MUJA 5I15H 4XNXL 2HNPA 4JVUA 3APFA 1CICA 5DJ8B 5CBAB 2X89A 2NT2A 4NUJB 1S9KC 3X12A 2R4SL 1M1SA 2QVKA 3LKSA 3V6OE 4Q9CA 4WW2B 3SDCB 2PXYA 2WAQA 1B0IA 3QJFB 3ZMNA 2YKLL 5MEPA 3W37A 4BZ2H 5ITBH 2WN3A 4EBQL 2BY3A 2B1HH 2AJZB 2C7FA 1KEML 2XQBL 1QBLH 3MRLA 1J9RA 3BQUD 2HFTA 2BVPB 4DO6A 2ATPA 5AW8B 3HI5H 1AKJA 3NJKA 4MCMA 2AQQA 4R2GC 3BIKA 3KYOB 4NQCA 4FQJL 1LO0L 3BMVA 1ZHNB 4WAFA 2DQGH 5EO0B 3VWJC 2YUWA 2V3EA 5FOBA 3I36A 3GZQA 1XMEB 4ISVA 5E00B 4IRSD 4AIZB 4P2AA 2X42A 2YPLD 2IDSA 3NSXA 5I30H 2DTSA 1UA3A 3ARDB 1OQXA 1W7KA 3IDMA 5E24E 1V7NH 4Z78A 1YQ2A 2D73A 4OCNC 4ETQA 5L6YL 1HHGA 5IB4B 2IH1A 1JPGA 4YXHL 2O26U 3UYOD 3VUAA 1UT9A 4LVNC 1MFCL 3N5AA 4P5MA 2CALA 3A6CL 5F7WC 5CGBA 3ILDA 4TXVB 1PX3A 4BWTA 4HQQH 3GXNA 1EX0A 4N5UA 4G80A 2FIKB 1I7RA 3RTLA 4F8PA 2OR9L 5I1GH 1M7XA 3LEXA 5HGBB 1NKGA 5FYJU 3K6IA 1WRMA 1D6EA 4B5ZA 5IQNA 4NO0A 4NNXA 4U1HA 2RFXA 4ZAKC 5JDJA 2BIMA 2DYRB 2VQ4A 2Z8WC 4ODVH 1JZHA 4PGCB 2WBJC 3IN2A 4ZYKA 2K9FB 2P3YA 3NAAL 3NRQA 1M3GA 3QNXA 4F9LC 2N1TE 1E90A 4N0UB 4QCIA 2VO5A 2ZXCA 1SF5A 3F62A 2NR6A 4RAUA 2PBNA 3LQAL 2EO1A 5A6LA 2QQLL 3B8YA 5GS0H 2DI7A 2O4EA 2D4FA 1KGIA 3SCMC 5JR1H 2H4GA 2VITA 5FYKE 4ZAKB 1MG2C 3BXNB 4BUHA 5I16B 5K9WA 1XCTB 4ALAH 1GGCH 1P84J 3L7EA 3QQ9D 4GT0A 1RP8A 1IKNA 4PP2A 1L6ZA 5LN8A 2IDUA 3F8UB 1A9BB 3F7RA 4L18A 2YFNA 1X5KA 2W91A 4OFVA 2NY7L 2K3TA 5GGVL 2WTZA 1HFUA 3P0GB 4HIQA 5HJDA 2VLKE 1MIML 1GVIA 1Y18B 1AO7B 2A6KB 3SDDC 2AEIT 2R0BA 4WSKA 4HWZB 4P4RB 2RBLA 3S3JA 3R06B 1IO4C 5EIVA 4U3SA 3UACA 3MLSL 1NFDB 4NQVB 3N55A 3OSKA 4W70A 1YEDB 5DZPA 3HI1B 5TF1L 4BZYA 1XGUA 2J2ZB 3Q1SH 5IKCB 5E03A 3NH7L 5I17A 1NH6A 1I8IA 1OM9A 5EDSA 2I6MA 5JIDA 2XPCA 4MXWL 3QUYA 1P4IL 4H0GA 3C6SA 3HNTL 4OFIA 1B4TA 3ZHFA 4MCYB 4P2QD 4PRDB 5FYKD 4DN4L 3CTTA 5BUGA 1LDPH 4LLDB 5L6YH 5T1MA 4JRYB 4PHXA 4X9HA 3FMGL 4Z95H 1O5ZA 1KBPA 4KJQC 3H0TA 4DKTA 2MMXA 2VDQL 3FTUA 3LRMA 3NCFB 1OTSD 5HYEA 3E6FA 5D2NA 3THML 2MTAA 3NCJH 3DYPA 4X98A 3VWKB 2XY1A 1ROWA 4N2OA 1XDTT 2H3NB 1D7BA 3ULVF 4P2RD 2ZKYA 2OL3L 3E0GA 1IGYB 3V2AR 1ZA6A 3OPZH 3R7RA 3TVMD 4HD5A 4LCWD 5HVGB 3QWOB 1LILA 5ETUA 5TE7L 1M7IB 4OGZA 1G1YA 4GW1B 3UP1A 1TU2B 3EFFA 5IV2A 5JORB 4Z1PA 2AV1B 2IANB 2Q76A 4TLTA 2ZXBA 3O4SA 4JGJA 5C0IA 2DWSA 3ME0A 5SWSD 4K9EC 1JZ7A 4YGVA 1R0AH 4CVWA 3H3KA 4FMKA 5BPPA 2A38A 4X6DE 4DUVA 2UUOA 2B4CL 1QP1A 3TV3L 3BLBA 4ZNCD 4L0YA 4QHPA 1U8CA 1OAQH 1DVFA 1DANU 3W82A 1AXSA 3VFSB 1B2YA 1JNHA 3TJHC 4WENB 1DL7H 2DWDA 2NR6C 3R4DA 1ZJBA 5FYKL 4O5LL 2KZWA 3GXFA 4WTZA 1QVOB 5DJ6A 4AEHH 1OE3A 3P69A 5EWIL 2YD9A 2R29H 2GPZA 1NWEA 1AGCB 4HUMB 2CMAA 4XNBA 1AZRA 2CHZA 3BZ4B 3BH8A 2PWHA 4MJIB 4NCDA 1DBKL 4H26B 5I1DA 1UM5L 2NZ9C 4N0YL 3MOBH 4J3OC 1MIEL 2ORBL 1VJSA 4FQXA 4D3RA 3JBG7 5M94B 3BCDA 4L37A 5IVXF 4HIEA 3B83A 4Z7VE 3UAJA 1ED3A 3VM5A 1DVTA 2UY7A 3FU7B 3MJ9L 1RZIB 4UOW0 2WLJA 5GTJA 2XOTA 4R90H 4RESB 1USQA 4K9JA 1WZAA 4F33A 1S7VB 1HAWA 4YPGB 4CMHB 5C0AB 3RZCA 3Q6GH 1A4BA 1VFAA 4W9ZA 5IT2L 4GE6A 2YA2A 2AQ3A 1IAOB 3GSNB 4I4WB 2L04A 5F9WC 2EH7H 4BK8A 2DDQL 3IETB 1JBVA 2VERN 2FBOJ 4M7JH 3T8VA 1DHKA 15C8H 4Y5YA 2PW1B 3I50H 5KBMA 3D50A 3WMQA 2XQYK 1U93A 4QJ5B 4FXGC 3WY4A 1CVRA 1KJVA 4KRPC 2EACA 4ZTOH 1RULH 1D9KB 3L08A 1QHOA 4ODXA 3IKKA 1A6UH 3VD5A 3OR6B 1MREL 3U0WL 1FLRH 4KK5C 2E75C 3B5TA 2H6UA 5GZNC 2IQ9L 3T0DA 1XH0A 3W0WD 1AGBA 1MHEA 2YSTA 3II1A 1B4RA 1Z9LA 4MQSB 2YXFA 4GIPD 2GY5A 1G9MC 2VLRD 2OMWB 4FZEL 4KC3B 4GRZA 4YSQA 5JMOC 5FM4A 4BCZA 2LVEA 1YWFA 4NFCA 2Q3ZA 4Z3IA 3PP3K 2Z91A 4ELMA 1MRFL 3S8WA 3F05A 1OEUA 3H9SA 3BLPX 1ULVA 4Y4KB 3IDMB 3MRKA 3B6SB 1BP3B 3U9UA 4HKZA 1W91A 4H1LA 4XRCA 1RUPL 5HYQA 3UH8A 1A6AB 1I9IH 3WCYA 4XR8C 1BG9A 1E3ZA 1QYGH 1D5MA 2VDML 5MI0B 4PLOB 2EXTA 5AVWB 3S2AA 4HULB 5B38B 5CBEB 5AALA 1BOGA 3K7UA 4MCZA 3QK0A 4U1KB 1OKEA 1V3KA 1NL0L 2X1OA 1LK3H 4K8RH 5FS5A 4F91B 1YJDL 2O93L 3QDMA 3ESPA 5JW4N 3ECWA 1KV7A 4GG6E 3GMPA 4ES8A 3G5VB 3ARFA 4BWUA 1J8SA 3HOGA 1WA0X 3LEVH 2WIIB 3TU6A 3TF7C 2ZKHL 3D51A 4UQAA 5E8PB 4XPBL 3WJJA 4XVTL 4XBGB 1XCQA 2W0KA 2BVPA 4OZIA 3IJ8A 3MRBA 3S48A 4P23B 3A22A 4GW4A 1XSIA 4NNPL 2VMJA 3KVPA 3V9FA 1XAUA 4AVHA 3IDGB 1QW9A 2YXMA 2W8CA 3VGAB 4CAGA 1NBVL 3D34A 3CQFA 4QRTB 1DLHA 1AVAA 2QCTA 2APTA 3L1OL 4WUKH 5E99H 2ZG1A 4FQCL 4BDVA 4P23D 1MHPL 1KPVB 2YWYA 2RD0A 4J2QA 2NT7A 1FJ1B 2JJVA 4RRPG 4K55A 4FABH 2V37A 2P5WB 4L9DA 3RGVD 4IU2B 2X2IA 4IKJA 3IYLW 3KPQB 4C55A 2VDQB 4FTVE 2H26B 4HZAA 1AQKL 1WISA 4AL8L 4F8QA 1S7WA 1KIPB 2VABA 3CX2A 3VFSA 4PJ5B 1OGTB 2DB8A 1B4LA 3FCTB 1TO5A 3FU5A 4MWFB 5F88B 3V6OA 2I9TA 2E8YA 3CV5A 1UT2A 1PKQB 4QXTA 2IFFL 3HE7D 4HWZA 4LLUA 5JW4R 1TJHH 5SWQB 2KZKA 4YJZL 1Z9SB 2CIKA 2JLLA 1UWFA 3B5HA 4AYBA 1O9VA 5LJYH 5AWXA 2IBZX 1KGUA 1XGUB 3HAEA 4WOHA 4FMFA 4ODUA 1F58L 4FQ1H 5K9KA 1K3ZA 4JJ5A 5HBBA 5C08E 2ZKWA 3VNZA 4OT1L 4XPBH 1AACA 2JJDA 4DGYH 5KA7A 1TIUA 4JO3L 1JPFB 4X7SH 3WS6C 4B04A 3L48A 4YDVB 3CDZB 3BKYH 1QBAA 2XG4B 1YQVH 3RHWF 3L3GB 3V6ZA 3KXFE 3OWRA 1YTSA 4PU2A 1NFDF 3X11B 4MMZB 1HJBC 5AAPA 4YHPA 4Z7IA 5K25A 3SJVE 2WZ6A 4KI5E 3RPKA 4WFEE 2O5YH 3GSNH 2BVYA 4L3ED 4QAMB 3B3IB 1NIBA 5EUKB 3FTYA 5CJXC 5DFAA 4ONHB 4NUPA 3DBSA 4AVKA 1YNTB 2CA3A 2JI3A 4UZSA 2IFGA 1E4XH 2BINA 4GRWF 4HWUA 1FG2A 2FZ3A 4L3FA 2WUCH 2R4RL 1U30A 3AG3B 1P4BH 1ZE3H 5ADOH 4FHJA 4GSXA 2IPTL 3OZ9H 5HXMA 4Y4HB 2V9UA 1GFYA 2E56A 3BKJH 4JJHA 2H1XA 1U42A 4NM8H 1CGWA 2FSDA 3KEHA 3QG6B 5I17B 2W95A 1BZ9B 2K0RA 2BSCA 4HMEA 3SGEH 4NJAL 4WFHE 5H35B 1A47A 4R83A 2PR9A 1BMWA 2PXYC 4MQ7B 3ROLA 4Z3FA 4HZ1A 2CO2A 2ZSVB 3BP7B 3JQOB 2NY2D 3ZKNC 4PD4J 2FJFB 4PLJD 3MNMA 3MGOA 3VJ6A 2A6IA 1CYWA 4AKPA 1A6WL 3HFMH 4LASH 1TDQA 5D1XA 3FFCA 4JEGB 3SYPA 2VRQA 2OYKA 3UCQA 4ACTA 3ZR6A 3W38A 2NW2A 3AMKA 1GCYA 1IEAA 3PGCA 3O45A 4YVNA 2OI9B 2CJUL 1YG9A 4G6MH 5EU3A 1ZHKA 3B9VA 3P30H 4WI2A 3TN0C 3DJTA 4JFPB 4MZIA 4HJ0D 5GGSY 1NKOA 1HOEA 3KLHC 2WSDA 2J56A 1F86A 4G9DA 1PEWA 5HHVL 2WQAA 3O3AA 1CE1L 4PJ9D 1GL4B 5C0JA 1N8ZB 4AUJA 2FNBA 2CNHA 3VMPA 3MPCA 4PVMA 2QVIA 1UH3A 5IB2B 2PN5A 2W60A 4IBSA 5EUOA 3ZE0E 5DU7A 4Q0XL 5D96B 1XXPA 1QFWM 1QMUA 1A1MB 1R17A 2CLVA 3I6LE 4FGMA 1TLKA 1WTGT 2DWTA 3BCFA 5CLWA 1EENA 3CFDB 3WIFA 5JHDA 2XTJB 3Q13A 4D0BA 5IQOA 2UXTA 4DTGL 3TURA 3K6FA 2VZUA 4HS6B 3GHBL 1R3JA 3G6JB 3MNVB 5BW7A 1Q72H 1M42A 3OJ2C 4LRIA 4B9JA 4H8VA 4EPSA 4XNMA 1R3KA 4GKZB 4CVMA 3RTQB 5TQ0L 5FCSH 1Q9LB 3CM3A 5HHOD 2FR4A 3MBWB 1D9KD 2EXSA 4OZFA 1E50A 3ROOB 2KQNA 4OFYA 4KH9A 3B9EA 4OF3A 1OAZH 1TZGH 1WF5A 1XM2A 2BNUA 1FZKA 1AHWB 1P4LB 1KXTB 2IWFA 4YHZL 5MEOA 5CZXC 4G8EA 1ZGLA 2OQJB 3L3JA 4GG8B 4P46C 4U0QB 2H4EA 3IDIA 4OCSL 1A4JA 4NKOA 5IOKA 1S8DB 4EO5A 4P3CH 5EZOH 2HLFC 2ZZUT 4NYLB 5DRXB 1KB3A 3CWEA 5IW1A 1L0YA 4M7LT 3HE6D 4EIUA 4JE0A 3CC5B 4I2XA 4GE2A 3UJTL 3OHXA 4TL4A 3QWRD 5AFAA 3KWWB 4XMVA 3PFQA 4K8RL 4D9LL 1CBVL 3OLIA 1QOKA 4UZGA 1OESA 4QRQA 2Z91B 3FNKA 43CAB 4V2BA 3CVCA 1C87A 5L4MA 4P2QB 4MDIB 4UAOC 1BZJA 2H1PH 3RWFB 1RMFL 2F19H 4KMTL 4NNYB 3ESVF 4UDUB 3T6WA 3OX8A 4JMJA 3RILA 2Y9RT 4WI0B 5HHOE 4MJID 1W8OA 2NDFA 3MRGA 2M83A 3CDZA 4KV5F 4QTHA 5CU9A 1GIGL 3A47A 2GTWA 5CLTA 3VD9A 1D3CA 2J1ZA 5T1DL 3SKMA 4BFGA 1PL3A 5TDPA 3MROB 4YHMH 1TUPA 1G1HA 2IGFL 3QQNA 3AS1A 2VL4A 4WEBL 5EO1A 4I3RL 2UUDK 3STLA 4DPCX 1EEOA 4I77L 1XBOA 3HC3L 3BVNA 4EUPA 1G84A 4MAZA 2F9BT 4GS7B 3PHSA 1OAKH 5IBLD 4KZEL 4DCQB 4XO9A 1PZSA 5E2UL 2HYMA 3LJ3A 4MJ5B 2I6JA 4Y5VA 4MJ6A 4L4TE 5I1GL 2I3RA 2X70A 4KROD 2H04A 3IVKA 1KMGA 3T0EE 1HESA 5CCHE 3C2AH 4LFHD 3RI5K 4ODBD 1RFDH 1L6PA 3QIWD 6FABH 1T04B 2NY7H 5GGVH 3KPMA 4HIIA 1S4IA 2CJ3A 3QNZA 2AJSL 2R69H 4RSVA 2F7PA 1YEGH 2WBJB 4GRWH 1CJYA 4D9QD 2EEFA 4LCWB 2J21A 3LKNA 2QLVB 1PNCA 4PG2A 2N3JA 5B3NA 4KK5D 4KFZC 4NBXB 3O8XA 3WNIA 3FCTA 3L7FA 3UBHA 2DI9A 3VACA 2EVIA 3SPVA 2QKIC 4QR7A 1FVEB 5AD0B 5I1HL 4B0MM 1OE1A 5HPMB 2PUQT 2ZUWA 4AGMA 5IIEA 2EDLA 4OLXH 1C5BH 3C5ZB 4WU5B 4YE4L 4YS4A 2FJHB 4WI5A 4RDQG 2K45A 3RWEB 4X0KB 1SXBA 1ZLWK 5EB9A 3H54A 3CMOL 1BMGA 4N8PA 4MB4A 1HEZB 1Y6MR 1T5XB 3IDGA 1PG7L 2X3CA 2R0KH 1UCBL 3RNQB 2XG4A 2GBAA 5JPMB 1VFAB 2ADFL 3F7YB 1ORSB 2CDEA 4PJAA 4WUUD 5A2BA 2NTFB 1J4XA 4B9CA 3CX5J 4KVNL 2JCWA 2EYRB 2NDGA 5I6XB 4XN4A 4C4KT 1MHHB 1Z9MA 3EJSA 1QR4A 2ALAA 5KYUB 4RAHA 1W15A 2IJ0C 1FQ9C 2DKSA 2F6ZA 1ZLWH 4YQXL 4K4KA 4EIGB 4KHXH 2W0LA 3QI9B 5A40E 5B21A 3HBQA 3HZYA 4ICXA 3EO1B 4NKQB 3SEPA 1D9KA 1CGVA 1NCJA 3T8XB 5TDNB 3DTXA 4QWWD 2ICWI 2YO3A 4PVLA 4Z7AA 2X10A 4WO4B 3CN3A 1QTPA 5GSRA 4N90E 2CGRL 2CIKB 4TSCH 3R7QA 5JHMA 3NACL 1GGBL 4F57L 3RZCC 2G5RA 2JCCB 2F00A 3CSTA 4HKBB 3HCVB 4FFTA 4FQQB 5IQLA 3T0AA 4NYLA 1T0MB 4TSBH 3MRHA 5PAZA 4NP4H 1T2XA 2WVTA 5LN4A 3AQDA 1LYVA 2EC9U 4K7FA 1GYWA 3PHQA 4KJPD 1NUGA 5L7XH 1TNNA 3RTQC 3W0WE 3RUGE 2XYCA 2EZ0C 5FM5O 1YN7B 2PMZA 4KTDL 3VG9C 4ELKA 2F1AA 3CBKB 4PJ8D 1L3WA 1OSZB 1Y0LB 3OKOB 4FQHB 4H25B 4Z76A 1G5GA 3GLEA 4RH9A 1UJ3B 1GZPB 3NZUA 3A5VA 4ONGH 4OM0L 3T1FB 1CCZA 2GAZA 3OZ9L 1A66A 2ZICA 4F7MB 3ULVD 1YN6A 3L5WA 1KAKA 2R4RH 4WEUD 5F89B 1HSBA 3BPLC 3NIDE 2DD8L 1UWEL 5EEWA 4K7PH 3N9GH 1TZHA 1U8IB 4AL8C 4YAQB 4LARH 3S4EA 1C5DA 4S2SA 5HHMB 5T1DH 4BZ1A 5DHVB 1J9CT 4E2OA 1AGEB 1JF1B 4N8CH 5F1OB 2OBGA 3KH3A 1J48A 1ZEAH 5F9JB 5DRWB 3WD5L 4Y1TA 3NJXA 2RQ8A 3VQLA 1CGSL 4QTIL 1WJ3A 3HE6C 3FQ1A 1VEMA 1IGIL 3C8KB 2CA4A 3GTTA 4KXCA 5D2NC 1PTUA 3CPLA 4CN1A 5D7KD 3NJGA 4Z0XB 3REWB 3HFFA 3RWCA 4JN2A 1R3KB 5EHFA 1OZTG 3BSGA 3C8HA 4DGYL 4MHHG 4PGDA 3KYAA 4ZRTA 5BW7C 4A2LA 1CE1H 1WO2A 3EO9L 4NQQA 4XTRC 3SDCD 5L7XL 1I1AD 2ZCHL 2J17A 4PREB 1NGXA 4H88L 3GIZL 3HE6B 5D7EA 3UC0L 3ZDYF 4HPHA 4OI9A 1CUOA 4ZMWA 2UWEB 4M48H 2YMTA 2DAVA 1IQDA 4YNYB 1XF4B 3U6XS 2CKBL 3UMTA 4KK9D 3W2DH 4TSCL 3FO9A 2QPEB 1N8ZA 2F7QA 1R24B 1XD1A 1U33A 5KACA 2CNFA 1N26A 3WY3A 1JDCA 1PZUB 3FOMA 1KTJA 3Q6FA 5LCVH 3WL9A 1DDTA 4EN3B 3GSWA 1W8NA 4UTCA 1IMHC 2ESVD 3RQ3A 3BIKB 3KYOA 1X5YA 4NLHA 4F93B 1Q72L 3AITA 3IDYB 4NS0A 5J57B 2RFXB 1MLBA 2E7DA 5FPIA 2P8PA 3NESA 5B38G 4M93C 3DXAE 1KB5A 2ICES 1IC7H 2PPFA 4A2HA 5EHPA 3ZJAA 2FBJL 2F54A 4PEEA 1NCBL 1SF3A 3G6JA 3RNKB 1HHHB 4DETA 2IDQA 1O7VA 2Z64C 3MLVL 4Q52A 2NY0C 4FG0A 1T5XA 3H2XA 3O41A 1LDSA 4HJJH 2C26A 1DVSA 4I18B 4PRHB 1CXHA 3A4EA 5B8CB 2X4OA 5E7BA 2I6PA 2N01B 2C9SA 2VDRB 1T2QH 3BQUC 4K73A 4AQZA 4JFDA 1EAPB 3B2VL 3MLXL 3ECUA 3EDKA 5GGSA 2CJTA 3BWSA 1PYNA 1G6RA 1GYVA 1U36A 1JPTH 4KKCD 3WIIL 3VI3F 1IC4L 1XBRA 3NA9H 1V27A 2UZXA 4FLSA 1JXGA 3PWNA 4PJ8A 1HWGB 5EBGA 3DXAA 3N04A 4FRWA 2VKWA 2ZUVA 3N1FC 4POUB 3KWWA 5CJXA 2X41A 1WT5A 3AM8C 2XWBA 3RRQA 3IBOA 1AJ7L 3WIHL 1X7QB 5DRZB 1BWMA 2NY2B 3QUGA 2YGQA 5C9KA 3UPCA 4ZFFB 1UB5A 2OMXB 1KCSH 3Q2NA 2YEVB 3KPMB 4HIIB 1FGVL 1HXYB 4JFFE 4OGXL 4OCMC 1LGVA 4NQXA 4AKQA 1JYWA 2IF7A 3DGGB 1QEWA 4JFUA 1TMCB 4QGYA 3SD2A 4AITA 4RGNE 4ZO7A 4UQCA 4PRID 4D0DB 1PIFA 3STZA 3ZKQD 5ICYB 3RDTB 5F8RC 2H41A 3JWOC 1A2YA 4WKXA 1G7MA 2QBSA 4AIOA 3T3MB 2KHAA 1N5YH 1RK1A 2G6ZA 2WK2A 5EPMB 4JDTL 2VDLB 4IBUA 3EYQC 3MJ8A 2Q10A 4GMTL 1DQKA 2HAZA 2BIJA 5DC0A 3X2QB 2W0FB 3NRPA 1KPRB 4WV1A 3ZL4L 4ZX3A 5K9QI 2GTZB 4UM9D 1EGJL 1MFUA 1T04A 4G3YH 4BD4A 2PXYB 3NCEB 3O81A 4JRXB 5AG9A 1F4YH 2OJEA 3Q2WA 1MCKA 1KLUB 5FFOA 1CGTA 3F5WA 3MRLB 3FQXB 4JFSA 3QWQB 3FH7A 4FQXD 1NLDH 2CBQA 1QA9A 1E9PA 2ALWA 5LWYH 1BFOA 4UQBA 4TVPE 2H2SC 4JZOB 4LESA 4PP1D 2OUDA 3RIFF 1Q9LA 2BDNH 3I6LD 2CLZB 5IUCA 3VI3A 2NY5L 2R7EA 3O4OC 5F96L 3ZOAA 1LEIA 1YGRA 5ISZE 1XWVA 3C6EA 1AAJA 2O1AA 3LH9A 4WWKC 5AZEH 3K72A 4R4NC 4WI3A 2B3OA 5I73C 4RDBA 4O00A 1WHOA 1OTTC 2BNRB 4LQFL 5HI3C 2VTDA 2QPSA 3NJIA 5IJKC 2BX5A 3EW3B 1A4JB 4NKOB 1AZNA 3BWZA 4PMEA 2AV7A 3W81A 1MI5A 4YSCA 4JG1L 7FABL 2V7NB 1ZVHA 5C71A 4K3HA 3UAEA 4JN1L 2KPWA 1SMAA 1TVDA 4KITB 1TOXA 3QIWC 3T6ZA 3U79A 1JL8A 3N43B 5LGYA 4ZUSA 4HUVB 2QELA 4GAFB 1AI1L 1DBAH 2K1MA 4J23A 2OV0A 5I8OL 5GGRY 3PAVA 2GI7A 3Q44A 2JNZA 4PBDA 4U1HB 3IJEB 4PRPE 1KLFA 3UTSD 5BOPA 1I3GH 2ED9A 3MZTA 3H3PL 2CWRA 4XH2A 2JTYA 2C8NA 2OTUB 4Y4FD 3PHOB 4APXA 4YK4C 3GBEA 4QF1B 4Y16C 1U8MA 1QW8A 1RUMH 3H42L 4Q2ZB 4RZCB 3SZKC 3ABLB 1A7PH 4XCNB 3RNKA 5CF3A 4LT7A 2OMVB 4AGOA 4D3PA 4N68A 1KTRL 2YD2A 4XI5C 3SYCA 1HSBB 2QR0A 3OHMB 4X6DB 2ZMMA 4DHLA 1AFVH 5KN5B 4U33A 3E8UH 3RL1B 3V95A 5H4ZA 4PIRF 1THAA 2E4FA 3BH9A 4AMKL 4EI6A 2YAPA 4UV4H 4HCFA 1RK0A 5CMAB 3L13A 5B1CA 12E8L 3P3SA 2H45A 1E30A 1VKXA 1NTDA 4FTVA 3VI4F 4HLJA 2J1XA 4N86A 2CNGA 1KELL 2WQVA 2VDQH 4X80H 4RMRA 4EZJA 4YAAA 4A66A 5TGBB 2BM3A 2Y66A 4I0CC 4TQ8A 5EBWB 4Z6AT 4MS6A 3VMNA 3SBWA 1NQBA 1OHQA 1U4EA 4PWEA 3WS6A 3FO2A 1TFPA 4OQTA 3K6SA 5IR1A 2IG2H 3QJTB 1XTMA 3M17A 4C4KO 4WSJA 3TA4D 3BEVB 3FSOA 3K1DA 1YMHA 4UINH 4P4KB 4I48B 3U2SA 4CC4C 1RERA 4Z7WB 5FYJH 2ZX8A 1O6TA 3MRIA 3MGAA 4P2RA 1UEYA 2P80D 2QZ5A 4GUCA 2OSXA 2DS4A 4NT6A 3SDDA 1JWUB 3AADB 4IGBD 5J56B 1M71A 1KLGB 4NZTL 5IVZB 3UOAB 3T04D 4DPAX 4Y19D 2VC2L 2ZAIA 1N2RB 2HT3D 4FHKA 5CBEA 2FH8A 1RZJL 3HEIB 5I6PA 1EWHA 1O9ZA 1R24A 2IDCA 4HX1A 4F3FB 5DD1L 1MH5B 2BY0A 1SY6H 4UT9L 2VEWA 2VMFA 4EN3A 2EEXA 1RXDA 2F53A 1HE8A 2K8QA 3GJEB 4J7RA 4J3VA 1VENA 4OGXH 1TTUA 2NCMA 4N2IA 3UL4A 2QMJA 2DMGA 2VLKB 2PO6A 4P46B 4FFVD 1UWGL 1NLBH 4JPVH 1MJJA 4PD4K 4XNUL 12E8H 3V6OC 4L8SC 4DK3A 4IRJA 5C0AD 1YO4A 4X5LA 2GJ6B 1U41A 3KCWA 1IJ9A 3L3DB 4G8GD 4BXVA 3F84A 3WKQA 2NZ6A 4NQDD 4QDGA 4GW5B 4NN5C 3F5WB 5B38A 1NCOA 4FULA 3FO9B 4G8IA 2VQUA 4MCZB 5IUSA 4JY4B 3O6KH 5DQJB 2XKUA 4HK0A 2Q5BA 3QZWB 3D0VA 3UFIA 2VORA 5I74C 5KSBA 4OGYL 4BV1A 1NC2D 3FONA 2P7TB 3KMDA 1T2QL 2HKAA 1NCDL 3ES6B 3F01A 3H53A 3S4OA 1AP2A 3J7HA 5K1NA 2HC2A 3TNNB 3DK2A 2NQCA 3HVNA 2B9AA 4PGJA 4UT6A 4A2FA 4WO4A 5GSRB 3HZVB 1QFWL 4WU7A 3VCLB 4TNVK 3US1A 3MBEA 2YN3A 1LDPL 4IMLA 4TNVF 3JV6B 3QH3A 5D1XD 6CGTA 5E1QA 1NCBH 2R1WB 3PWPA 1UOLA 5DDHA 1XV8A 2DV6A 3RB5A 5DUPL 2ZKMX 4B3VA 3HKZA 4WWOA 3BQUA 4HIEB 3FO1A 4WGKA 2Z92B 2WXMA 4R3SA 3ZZQA 4FS0A 2OI9C 4ZTOL 3BPNC 4MBBA 5IMMB 3P0VL 3NCXA 4X2UA 3ZDZB 1MIMH 4I18A 1OSZA 4FQHA 4Z76B 2Q05A 5HYJB 1NUNB 4K2UL 5J5EA 3LHPL 3VD3A 1PZDA 1PLGL 3D39A 1PY9A 3K6NA 3QAZB 2O61B 2VABB 5E8DL 1M9WA 4UANA 2WOYA 3CZUB 5E6IC 5TE4H 1Q6JA 3H2QA 1NFDA 4AEIH 3TJHD 4JQIL 2NY4D 5LWYL 2YSSA 1I8IB 3KBHE 3N1GC 2BOCB 3G5XA 4M62H 4ZD3H 4K5PA 1LL1A 1KTDB 4MNGA 1U3YA 2GJZB 3NRSA 4Z8FH 2O5XL 5T1KD 2YPVL 1SMOA 4XNXH 2VXTL 4RNRA 3TBWB 5C97A 5JIIA 3OR6A 1A6ZB 2BZDA 1G7HB 3NSJA 4NQCD 4FFYA 2ODIA 4XCFH 5A16B 1NJ9A 1SYSA 3FTXA 1LP9E 2BRRH 2O30A 4RAVB 5IFJB 2FWOA 2BY1A 3DO7B 1RUKH 2YEZB 1MVYA 5EWIH 1KBWA 4Y8DC 1RJZA 4EZLA 1UJ3C 3K46A 2VAAB 3TFBA 1WWAX 4J4PC 3SE4C 2GK2A 4LRNH 5I0WA 4JDTH 1RZQA 4OD2A 3N85L 1SN5A 3D1QA 2VO8A 4QYOA 1QQDA 4LPCA 5I76A 2LVCA 1G7MB 4M43H 4Y2DB 3FOLB 1AYOA 4F58L 4Z18A 2B9BA 1SLVA 3BEVA 3QR0A 4IBLT 3MNWB 5KS9F 1R33A 3QXAA 4MBOA 1NM4A 1RV6X 1ITBB 1R5VB 2RIKA 5F1SA 5HI5C 2BVTA 1MKPA 1ICTA 2P80A 1QI3A 3D1MC 3N3EA 3PWLB 3H9HA 4JG5A 1AR1C 3T1WA 1MEXH 3ZMPA 1E67A 5CAYB 1EXHA 1NPJA 5D71H 1PLBA 4RQQA 4I3SH 5DMKA 1JXKA 1DQTA 4M62L 2VR4A 2HFGH 1W72A 4JNXA 4AM0A 1C12A 1SXZA 2QVFB 3QHTC 4FNUA 1X6NA 2AQNA 4GBXA 4EQ3A 3ARQA 3MRDB 1DFBL 2WP3O 5K69A 5TFSL 3HKFA 4N6QA 2BNRA 4X7TB 3B2VH 3MLXH 4HS6A 3RAJL 4HVBA 4H40A 4AZ8B 2XA8L 1LK2B 4OLZH 4KQ3L 2C4XA 5B3JE 1J8HB 1O7DE 5E2WL 4PW4A 2MH4A 3GDBA 3MOAH 1MJ8H 1P2CA 3H8NA 2UZPA 1U8LB 3OLDA 3ZQ9A 5JIMA 1CD0A 2V2TB 1I7ZB 2XWCA 3M7OA 5A2LH 4R7LA 2CNYA 1Z2KA 1J0KA 4JDEA 3UXFA 1T89C 3B9DA 1ES0A 3QYMA 2Z31B 2EE2A 3QDGE 2HVJA 3IAGC 2OCCB 3F7PC 3IDXL 3K8KA 3S36X 3VD0A 1YZ4A 1JGIA 4FTDA 1S7WB 2HT3C 1RZ7L 5D2LE 4GQ9H 1S5HB 5E2TH 3GMQA 3UTOA 3ZZ1A 4POYA 3PAZA 4KHTL 4YSEA 4ODHH 5T5NG 1MCNA 2GIYA 1T7YA 2CBMA 2JWYA 4A2GA 3I9GH 3MBED 5GRJH 5JQHC 4LLAA 3OF6A 3O5XA 5E94B 3G04A 1BDYA 4HIXH 2H1PL 4OCYH 3SIKA 3HI5L 4ZZKA 5BO0D 5FLUA 5C6WH 2OC3A 4Y5XC 2NPLX 3LNHA 3WTXA 2UUPA 3IPFA 5A2CA 3ARRA 4XB3A 5HDBE 3BQUB 4PJBB 2B4CH 4I2XE 2AJ3A 1S7QB 2BP0B 4WI0A 3WY2A 2DQIL 1M57B 1T66D 4N8VA 2P5WE 1M71B 5JDSA 3UPRB 3N42B 4QRPA 5CEXB 3WNPA 4CSPA 1EHXA 5ENWB 5J11C 5DUBA 4ZG1A 3LQAH 2B5IB 1JHLL 2V9QA 1I8MA 5CD3B 2N0MA 1P5VA 5IW6A 3C6LB 5B39A 4MQTB 3N40F 3AGVA 3BRHA 4PRPD 3UTSE 1KIQA 4P2OB 4FQ2H 4IU3A 1GZHA 5L9DH 1S7TB 3CUPA 2ENYA 1F41A 2ENQA 1WFOA 2FX9H 3HA0A 3OKMA 1EZVX 4QOKA 2PO6B 3NPSC 1JK9A 2ARJA 4GBXC 4QRRB 5EBWA 2EICA 3FHAA 1J5CA 1IV8A 1ZWIB 4KQ4L 2OL3A 3UEZA 1JD7A 5CEYB 1HKLL 5ESAB 5A16A 3Q9PA 3EZZA 4CRPA 5HTSA 2H0EA 2OK0H 5KA2A 3U4AA 4Y16A 3BP7A 4F7TB 3K2KA 2YZ1A 3LKSB 1CL7H 4CVXB 3EJPA 1KIPA 2WLYA 2O5XH 3F9AA 5T5FL 4ZBJA 2KI6A 2PTTB 4PJDE 2JQAA 1KULA 4X5WA 4J1UB 1F4AA 4NUGH 1VA9A 4OCXH 1X7TA 1DVFC 4BFJA 2GK0A 4IRJC 4J2XA 1E4WH 4AYEC 2A99A 4L5FL 4WNJA 4Q6IC 1LE5A 3VXUD 1WE5A 4LLYB 1P6FA 3H9SE 2IMMA 4A2MA 4NQCB 4QKTA 1HNYA 2DEYX 4AVJA 4ZUSB 4HUVA 4MCNA 3PRZA 5E7FA 4ESKA 1H9DA 2ZUQB 3LKRA 1YC7A 2AVFA 1R9FA 1FN4A 1U6AL 2BC4A 2FLMA 2YMOA 5EA0H 1Q1MA 4HG4K 1BFSA 5PCYA 3NFSH 3HHMA 4KO5A 4OJEH 2WZ0A 1A1MA 2HFGL 5C0NC 1GC1C 4JO3H 4Y1SA 3OG6B 1QSEA 4QTFA 1HTYA 1KENL 1A3ZA 3OHXC 4FFZA 4LSTL 4DKFH 1U8HA 2FD6L 1CF8H 2DMBA 1RPKA 4PS7A 4MKMA 3LS5H 1BQKA 2P43B 4QXGL 5E9DE 1KEGH 3OB0K 4XE5B 4AM0Q 3E9TA 1LLAA 4M5YH 3QAQA 1EZLA 4AV0A 4ODUB 4GXFA 4RFEB 3ES6A 1GYUA 3IGFA 2HRPH 3OZLA 3VB8A 4ZOCA 3GUTA 1RCYA 1N6QH 4UQ3B 2E47A 1FBIL 2VR6A 3EYVA 4X0KA 3K3QA 5AQ0A 1H15A 3MX0B 1IBGH 1UWYA 2IWEA 2ZSWB 4ZQKA 2W0PA 2XWZA 1ADWA 4Q6YA 3QIBB 4X7FC 4WKZB 1QI5A 1RIHH 1F00I 4WFED 1MAMH 2QSQA 5AW6B 3G5YA 1SBSL 4NAMA 5IFAH 4JCWA 4DEPB 2MKWA 4QRFA 3HBGA 3VWJD 3BD3A 3CSBA 3IGKA 1QTSA 4JKPL 2YPVA 5LNGA 1QPXA 2H6PB 2WXJA 5F1NA 3P02A 4PRPA 3ZDWA 5B3JF 3LZRA 3QCJA 1JF6A 3IS1X 1KIRB 5IM7A 4BZ2A 3QUXB 3WI9A 1JUFA 1RZ8B 1MCWM 1R3IL 1Y0LA 4K3JH 5AAWA 1YNTF 2AK4B 5MENA 5JHLH 4J3WA 3Q2LA 5KUMA 1LD9A 3ABKB 5FA4B 2BOCA 3O3BB 1E7VA 2CR3A 2N1KA 3PGFL 3EDJA 2B15A 2CUIA 2WN2A 4P4KC 4BZ2L 5JXEA 4DEWA 3MOQA 1DJGA 4MJHA 3HC0B 1CC3A 1U8JA 4P46D 1Z9PA 5ENWA 1E2WA 1IILE 4YX2H 1GA2A 1N0LA 3FT0A 2VAAA 5EU7E 4WGWB 1IM9A 3SSGA 4HOMA 3SDAA 5GZOD 2IANE 5L2JA 3RY5A 3VRLF 2BSRA 1BF8A 2EDQA 3ZDXB 1L4IA 2HRPL 1T83A 2VW7A 1IEAB 2OSLA 4LEXL 3SDYH 3OAWA 2P48B 1Y1DA 1LYQA 3AQXA 3FPYA 1G1FA 3ZTJH 2VSDA 2X38A 3NG5A 1EJOL 1HVXA 4U6YB 3I74A 5BOZG 1E2VA 1V7ML 2N56A 1HL4A 1H8SA 2I25N 4FLQA 4OZIE 2VDOL 2G75A 1KN4L 2D7TH 2DQFA 1P15A 4OBSA 1PTVA 1E27B 4HSQA 4OI7A 1HINL 3B7YA 3GMRB 3HG1D 4L4VD 1KN2L 3FULA 1XGRB 3GSNL 1S5IL 2J88L 3Q01A 4U1LA 3L6FB 4FG4A 3PYZA 5FB8B 1KWKA 1RJYB 2UYLB 3KXFD 1ES0B 1GOHA 1C12B 3Q2CA 4KMTH 1AP2B 5GJSH 2D9CA 1KOAA 1PQZA 3HNSL 2H4VA 1TO4A 4W9CC 4EZMA 5CO1A 3RU8H 1E9OA 4S1DD 5E4IA 5IWLC 2L8AA 5TQ2H 2ICWJ 4E9RA 1DQLL 3MJ7A 3D42A 2FECI 3DGCR 2OR7A 3C75A 1KTKE 5D8JL 1DSFH 2FGZA 2ZXDA 4H5SA 1MJUL 3D39E 2VLLB 1TITA 4LCUB 4E9SA 4RFOL 4X6EA 3LNEA 2VEVA 2VE6A 3LQMA 5E9NA 4YHZH 2WVSA 4F9PC 1RL1A 4UNVA 4P06A 3DVGB 2NZ1A 1JI1A 3I6GA 4JPKH 4M5SA 4HUNB 4F2EA 1T3FB 2PWGA 4JFOA 1N59B 3T3PF 4FQIH 1NDMB 3INUL 2QFRA 2A73B 3ZR5A 3Q06A 2WINB 3IJSA 3V5HA 2EIDA 3DHJA 3BIAX 1TJGH 1EHNA 4IS6A 3BM8A 3IXTB 3T5WA 3C8DA 3OKNB 3MMEB 1CQYA 2Q3XA 4IU3B 1QLFB 4BFRA 4G71B 5KA1A 1G6RB 4D0CA 2K6ZA 4OY9A 5JPMC 3WFCH 2WTOA 1NDGB 5GGUA 3W2DL 3U83A 3LZQA 2YGOA 2P5EB 4NRXA 2P8PB 4OH2A 4YHNA 4FQ2L 3C6SB 3FQTB 3PQYE 3UAJC 2LU3A 3L4VA 3FB6A 3S5LG 4NPJA 4RA0C 2AEWA 3PUUA 3QJZA 4ZFZB 4OV5B 3KJ6H 4XVTH 4EMZA 3SY6A 1GGTA 1P9MC 2V17H 4H8WC 1AOHA 5DFVC 4U2ZA 5I8EB 3W1ZA 3QCTH 4EIBA 1SRDA 3AVEA 4N9GA 4XPAL 3JT0A 4Y5YB 5J1TC 3QCVH 1HQ4B 4OLWL 1AY1L 3RKPA 5CKAA 4HHAA 2JMRA 3WXWL 2P4DA 5IW3A 3L4ZA 2AXJA 2HT4C 3WEXB 2X9XA 4OIIL 3CH1B 5KSBE 4FQLH 4W4NA 1ECVA 4M02A 3ET9F 4QHUB 5BQ7B 1A9BA 4LL1A 1BVLB 5CCKH 4L1HA 1NL0H 1MELA 2JKRM 1M2OA 1R5VA 4I0PC 5I1JH 1UJ3A 3D4CA 5KUKA 1B0RB 3VFUB 4QBEA 5TDOA 3EJRA 3CVDA 5F7KC 5IV2B 3MJ8B 3L9BA 5KBDA 4PJGF 4PRHD 5TH2A 2OAAA 4HJIA 3L4TA 5IKCA 4HXBL 1CDYA 2XKNA 3FT1A 4FYRA 5AUMA 5TF0A 3VRIB 3GZOA 3N9GL 5HY9B 1WICA 4CMHC 1BLIA 1WVZA 3QIBD 2MSPA 4UILH 2W1NA 5F7YC 1DVFB 1O5PA 4N2MA 4NM4L 4CVXA 1YMMA 3MRDA 3NBNA 2J8UB 3CFTA 1S6NA 1T66C 1ACYH 5LBSA 1W6LA 4WK4B 1SOXA 1RZPA 5KS9B 5A2FA 2HJKB 4HT1L 3SHSA 1ILUA 3ZVVA 3ZW3A 4PBVC 1QFPA 3QI9A 1UH4A 5IOPA 2EKJA 1ZA6B 1Q6PA 4AXWB 2A77L 3VYOA 3F7VA 3GMRA 1COBA 3I2CL 3SE9H 2YAEA 3CFCL 4UT7H 2E0PA 4QXWA 4NDMA 3M1CA 4Y9EA 4HIHB 2R0ZL 5HYJE 3AROA 3EYVB 5D1ZC 4OZFG 1JGVL 3NPSB 4R5XA 1S5HA 3D69A 2MNUA 5LAPA 1GY2A 2BVEA 2ADGA 2UXFA 5FUZH 2EYRA 4KJQD 3ZO0A 2AEPL 1LNUA 3RWIB 5IJVA 4HV8B 3KYMB 1EEHA 1OK0A 4GI9A 4RWYL 5IEKA 3QQDB 1HDMA 3MNZA 4IDJL 2QDVA 1DZ0A 1QRNE 4KUZH 3E1F1 3DDFA 4QXGH 1KEGL 3GMNA 3AU1A 1DANT 2EDYA 3NAAH 4I3RH 2G0KA 2UX7A 2ED7A 1PZBA 2QJDA 3DPDA 3FQWA 4HW6A 2FLBT 5D5MB 4FC3E 5AL0A 1ANUA 3MGTA 1WAAE 4TM9A 5CGYC 1NMAL 1YYCA 3OMIB 4NQVA 4WQOA 4JO2H 1QRNB 2UVEA 3BZDA 5JQ6H 3CVHB 3A0OA 3RI5F 4MS8C 1I53A 2X2UA 4XGZA 5F2FA 5B7FA 5BZWA 1ID5I 1T4KA 3VX1A 2XNAB 4LNVA 1J5DA 4M93B 3MRRB 4L5FH 3H56A 3AFLA 4PJFA 2WO3B 5IK3B 3S7GA 2LTQB 1YN7A 2E7CA 2FYYB 1JIBA 1V7NL 3QDGA 1QLRA 1PYWA 3BJ91 3E6FB 3D4YA 3HBZA 1NGQL 5F71A 1T4WA 1XGYH 1WDAA 3SKNB 2HT2D 1CL7L 3ISWA 1LO0H 1EVTC 4P2OC 3NEEA 1A3QA 1HILB 4XCNA 5BRZD 3KGTA 4JL1A 4Z7NB 3FH8A 4NN6C 1BXXA 3CFIC 4QEGA 4ZJ9A 5ESVA 2Z3FA 4HZLB 4G7SB 4JQXA 2VDMH 5J4MA 4JRL<