3AWSB

Crystal structure of streptomyces tyrosinase in a complex with caddie soaked in a cu(ii)-containing solution for 20 hr: occupancy of cu(ii) is low
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
84
structure length
78
Chain Sequence
b'AAPESFDEVYKGRRIQGRPAHEHGGGYEVFVDGVQLHVMRNADGSWISVVSHYDPVPTPRAAARAAVDELQGAPLLPF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosinase
publication title A molecular mechanism for copper transportation to tyrosinase that is assisted by a metallochaperone, caddie protein
pubmed doi rcsb
source organism Streptomyces castaneoglobisporus
molecule tags Oxidoreductase/metal transport
total genus 17
structure length 78
sequence length 84
ec nomenclature
pdb deposition date 2011-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06236 MelC1 Tyrosinase co-factor MelC1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1880.10 Alpha Beta 2-Layer Sandwich protein ne1242 fold protein ne1242 domain like 3awsB01
1WX4B 3AX0B 3AWXB 2ZWFB 2AHLB 3AWYB 2ZWGB 3AWZB 1WX5B 2ZWDB 2ZWEB 1WX2B 3AWWB 2ZMYB 3AWTB 2AHKB 2JV8A 2ZMZB 3AWVB 1WXCB 2ZMXB 3AWSB 3AWUB
chains in the Genus database with same CATH superfamily
1WX4B 4NB9A 4NBEA 3AX0B 3AWXB 2ZWFB 2AHLB 3AWYB 4NBCA 2ZWGB 3AWZB 4NBAA 1WX5B 2ZWDB 2ZWEB 1WX2B 3VMGA 3GCFA 3AWWB 2ZMYB 3AWTB 4NBDA 4NBBA 2AHKB 2JV8A 4NB8A 1Z03A 1Z02A 4NBGA 1Z01A 4NBHA 2ZMZB 2DE7A 2DE5A 1WXCB 2ZMXB 3AWSB 3AWUB 1WW9A 3AWVB 4NBFA 2DE6A 3VMIA 3VMHA 3GKQA
chains in the Genus database with same CATH topology
1WX4B 3AX0B 3AWXB 2ZWFB 2AHLB 3AWYB 2ZWGB 3AWZB 1WX5B 2ZWDB 2ZWEB 1WX2B 3AWWB 2ZMYB 3AWTB 2AHKB 2JV8A 2ZMZB 3AWVB 1WXCB 2ZMXB 3AWSB 3AWUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WX4 B;  3AX0 B;  3AWX B;  2ZWF B;  2AHL B;  3AWY B;  2ZWG B;  3AWZ B;  1WX5 B;  2ZWD B;  2ZWE B;  1WX2 B;  3AWW B;  2ZMY B;  3AWT B;  2AHK B;  2JV8 A;  2ZMZ B;  3AWV B;  1WXC B;  2ZMX B;  3AWS B;  3AWU B; 
#chains in the Genus database with same CATH topology
 1WX4 B;  4NB9 A;  4NBE A;  3AX0 B;  3AWX B;  2ZWF B;  2AHL B;  3AWY B;  4NBC A;  2ZWG B;  3AWZ B;  4NBA A;  1WX5 B;  2ZWD B;  2ZWE B;  1WX2 B;  3VMG A;  3GCF A;  3AWW B;  2ZMY B;  3AWT B;  4NBD A;  4NBB A;  2AHK B;  2JV8 A;  4NB8 A;  1Z03 A;  1Z02 A;  4NBG A;  1Z01 A;  4NBH A;  2ZMZ B;  2DE7 A;  2DE5 A;  1WXC B;  2ZMX B;  3AWS B;  3AWU B;  1WW9 A;  3AWV B;  4NBF A;  2DE6 A;  3VMI A;  3VMH A;  3GKQ A; 
#chains in the Genus database with same CATH homology
 1WX4 B;  3AX0 B;  3AWX B;  2ZWF B;  2AHL B;  3AWY B;  2ZWG B;  3AWZ B;  1WX5 B;  2ZWD B;  2ZWE B;  1WX2 B;  3AWW B;  2ZMY B;  3AWT B;  2AHK B;  2JV8 A;  2ZMZ B;  3AWV B;  1WXC B;  2ZMX B;  3AWS B;  3AWU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...