3AWTB

Crystal structure of streptomyces tyrosinase in a complex with caddie soaked in a cu(ii)-containing solution for 20 hr: occupancy of cu(ii) is high
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
84
structure length
78
Chain Sequence
b'AAPESFDEVYKGRRIQGRPAHEHGGGYEVFVDGVQLHVMRNADGSWISVVSHYDPVPTPRAAARAAVDELQGAPLLPF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosinase
publication title A molecular mechanism for copper transportation to tyrosinase that is assisted by a metallochaperone, caddie protein
pubmed doi rcsb
source organism Streptomyces castaneoglobisporus
molecule tags Oxidoreductase/metal transport
total genus 17
structure length 78
sequence length 84
ec nomenclature
pdb deposition date 2011-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06236 MelC1 Tyrosinase co-factor MelC1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1880.10 Alpha Beta 2-Layer Sandwich protein ne1242 fold protein ne1242 domain like 3awtB01
2ZWDB 3AWVB 3AWZB 1WXCB 3AWTB 2ZMXB 1WX5B 3AWWB 2ZMYB 3AWXB 3AX0B 3AWYB 2ZMZB 3AWSB 2AHKB 2AHLB 2ZWFB 1WX4B 1WX2B 2JV8A 2ZWEB 2ZWGB 3AWUB
chains in the Genus database with same CATH superfamily
3GKQA 2ZWDB 3AWVB 3VMGA 3AWZB 1WXCB 2DE5A 3AWTB 2ZMXB 4NB9A 2DE7A 4NB8A 4NBDA 4NBBA 1WX5B 4NBEA 1WW9A 1Z02A 4NBHA 3AWWB 2ZMYB 3AWXB 3AX0B 4NBAA 1Z01A 3AWYB 2ZMZB 4NBFA 3AWSB 2DE6A 4NBGA 2AHKB 3VMIA 2AHLB 2ZWFB 1WX4B 1WX2B 2JV8A 2ZWEB 3VMHA 3GCFA 2ZWGB 3AWUB 4NBCA 1Z03A
chains in the Genus database with same CATH topology
2ZWDB 3AWVB 3AWZB 1WXCB 3AWTB 2ZMXB 1WX5B 3AWWB 2ZMYB 3AWXB 3AX0B 3AWYB 2ZMZB 3AWSB 2AHKB 2AHLB 2ZWFB 1WX4B 1WX2B 2JV8A 2ZWEB 2ZWGB 3AWUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZWD B;  3AWV B;  3AWZ B;  1WXC B;  3AWT B;  2ZMX B;  1WX5 B;  3AWW B;  2ZMY B;  3AWX B;  3AX0 B;  3AWY B;  2ZMZ B;  3AWS B;  2AHK B;  2AHL B;  2ZWF B;  1WX4 B;  1WX2 B;  2JV8 A;  2ZWE B;  2ZWG B;  3AWU B; 
#chains in the Genus database with same CATH topology
 3GKQ A;  2ZWD B;  3AWV B;  3VMG A;  3AWZ B;  1WXC B;  2DE5 A;  3AWT B;  2ZMX B;  4NB9 A;  2DE7 A;  4NB8 A;  4NBD A;  4NBB A;  1WX5 B;  4NBE A;  1WW9 A;  1Z02 A;  4NBH A;  3AWW B;  2ZMY B;  3AWX B;  3AX0 B;  4NBA A;  1Z01 A;  3AWY B;  2ZMZ B;  4NBF A;  3AWS B;  2DE6 A;  4NBG A;  2AHK B;  3VMI A;  2AHL B;  2ZWF B;  1WX4 B;  1WX2 B;  2JV8 A;  2ZWE B;  3VMH A;  3GCF A;  2ZWG B;  3AWU B;  4NBC A;  1Z03 A; 
#chains in the Genus database with same CATH homology
 2ZWD B;  3AWV B;  3AWZ B;  1WXC B;  3AWT B;  2ZMX B;  1WX5 B;  3AWW B;  2ZMY B;  3AWX B;  3AX0 B;  3AWY B;  2ZMZ B;  3AWS B;  2AHK B;  2AHL B;  2ZWF B;  1WX4 B;  1WX2 B;  2JV8 A;  2ZWE B;  2ZWG B;  3AWU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...