3AWTB

Crystal structure of streptomyces tyrosinase in a complex with caddie soaked in a cu(ii)-containing solution for 20 hr: occupancy of cu(ii) is high
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
84
structure length
78
Chain Sequence
AAPESFDEVYKGRRIQGRPAHEHGGGYEVFVDGVQLHVMRNADGSWISVVSHYDPVPTPRAAARAAVDELQGAPLLPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosinase
publication title A molecular mechanism for copper transportation to tyrosinase that is assisted by a metallochaperone, caddie protein
pubmed doi rcsb
source organism Streptomyces castaneoglobisporus
molecule tags Oxidoreductase/metal transport
total genus 17
structure length 78
sequence length 84
ec nomenclature
pdb deposition date 2011-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06236 MelC1 Tyrosinase co-factor MelC1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1880.10 Alpha Beta 2-Layer Sandwich protein ne1242 fold protein ne1242 domain like 3awtB01
1WX2B 3AWXB 2AHKB 3AWVB 2JV8A 3AWWB 2ZMZB 2ZWGB 3AWTB 3AWYB 2ZMYB 1WX4B 2ZWDB 3AWZB 1WXCB 2ZWFB 2AHLB 3AWUB 3AWSB 2ZMXB 1WX5B 2ZWEB 3AX0B
chains in the Genus database with same CATH superfamily
1WX2B 3GKQA 3AWXB 3VMHA 1WW9A 2AHKB 3AWVB 1Z03A 2JV8A 3VMIA 3VMGA 3GCFA 3AWWB 1Z02A 4NBGA 2ZMZB 2ZWGB 2DE6A 3AWTB 3AWYB 2ZMYB 1Z01A 4NBCA 1WX4B 2ZWDB 3AWZB 4NB9A 4NBBA 2ZWFB 4NBHA 2AHLB 4NBAA 3AWUB 2DE5A 4NBEA 4NBFA 3AWSB 2ZMXB 3AX0B 1WX5B 4NB8A 2DE7A 4NBDA 2ZWEB 1WXCB
chains in the Genus database with same CATH topology
1WX2B 3AWXB 2AHKB 3AWVB 2JV8A 3AWWB 2ZMZB 2ZWGB 3AWTB 3AWYB 2ZMYB 1WX4B 2ZWDB 3AWZB 1WXCB 2ZWFB 2AHLB 3AWUB 3AWSB 2ZMXB 1WX5B 2ZWEB 3AX0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WX2 B;  3AWX B;  2AHK B;  3AWV B;  2JV8 A;  3AWW B;  2ZMZ B;  2ZWG B;  3AWT B;  3AWY B;  2ZMY B;  1WX4 B;  2ZWD B;  3AWZ B;  1WXC B;  2ZWF B;  2AHL B;  3AWU B;  3AWS B;  2ZMX B;  1WX5 B;  2ZWE B;  3AX0 B; 
#chains in the Genus database with same CATH topology
 1WX2 B;  3GKQ A;  3AWX B;  3VMH A;  1WW9 A;  2AHK B;  3AWV B;  1Z03 A;  2JV8 A;  3VMI A;  3VMG A;  3GCF A;  3AWW B;  1Z02 A;  4NBG A;  2ZMZ B;  2ZWG B;  2DE6 A;  3AWT B;  3AWY B;  2ZMY B;  1Z01 A;  4NBC A;  1WX4 B;  2ZWD B;  3AWZ B;  4NB9 A;  4NBB A;  2ZWF B;  4NBH A;  2AHL B;  4NBA A;  3AWU B;  2DE5 A;  4NBE A;  4NBF A;  3AWS B;  2ZMX B;  3AX0 B;  1WX5 B;  4NB8 A;  2DE7 A;  4NBD A;  2ZWE B;  1WXC B; 
#chains in the Genus database with same CATH homology
 1WX2 B;  3AWX B;  2AHK B;  3AWV B;  2JV8 A;  3AWW B;  2ZMZ B;  2ZWG B;  3AWT B;  3AWY B;  2ZMY B;  1WX4 B;  2ZWD B;  3AWZ B;  1WXC B;  2ZWF B;  2AHL B;  3AWU B;  3AWS B;  2ZMX B;  1WX5 B;  2ZWE B;  3AX0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...