3AWVB

Crystal structure of streptomyces tyrosinase in a complex with caddie soaked in a cu(ii)-containing solution for 80 hr: occupancy of cua is low
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
84
structure length
78
Chain Sequence
b'AAPESFDEVYKGRRIQGRPAHEHGGGYEVFVDGVQLHVMRNADGSWISVVSHYDPVPTPRAAARAAVDELQGAPLLPF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosinase
publication title A molecular mechanism for copper transportation to tyrosinase that is assisted by a metallochaperone, caddie protein
pubmed doi rcsb
source organism Streptomyces castaneoglobisporus
molecule tags Oxidoreductase/metal transport
total genus 17
structure length 78
sequence length 84
ec nomenclature
pdb deposition date 2011-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06236 MelC1 Tyrosinase co-factor MelC1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1880.10 Alpha Beta 2-Layer Sandwich protein ne1242 fold protein ne1242 domain like 3awvB01
2JV8A 3AWXB 2ZWEB 3AWZB 3AWWB 2ZMXB 1WX5B 2ZWFB 2ZWGB 1WX2B 2ZMYB 3AX0B 3AWSB 1WX4B 3AWYB 3AWVB 3AWUB 2AHKB 1WXCB 2ZWDB 2AHLB 3AWTB 2ZMZB
chains in the Genus database with same CATH superfamily
2JV8A 4NB8A 4NBGA 3VMGA 1Z01A 3AWXB 4NBBA 2ZWEB 3AWZB 3AWWB 2ZMXB 1WX5B 2ZWFB 2ZWGB 3GCFA 4NBCA 4NBHA 1WX2B 4NB9A 2ZMYB 3VMIA 3VMHA 2DE6A 4NBEA 1Z03A 2DE7A 2DE5A 3AX0B 3AWSB 1WX4B 1WW9A 3AWYB 1Z02A 3AWVB 3AWUB 4NBFA 2AHKB 4NBAA 1WXCB 2ZWDB 2AHLB 3AWTB 2ZMZB 4NBDA 3GKQA
chains in the Genus database with same CATH topology
2JV8A 3AWXB 2ZWEB 3AWZB 3AWWB 2ZMXB 1WX5B 2ZWFB 2ZWGB 1WX2B 2ZMYB 3AX0B 3AWSB 1WX4B 3AWYB 3AWVB 3AWUB 2AHKB 1WXCB 2ZWDB 2AHLB 3AWTB 2ZMZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JV8 A;  3AWX B;  2ZWE B;  3AWZ B;  3AWW B;  2ZMX B;  1WX5 B;  2ZWF B;  2ZWG B;  1WX2 B;  2ZMY B;  3AX0 B;  3AWS B;  1WX4 B;  3AWY B;  3AWV B;  3AWU B;  2AHK B;  1WXC B;  2ZWD B;  2AHL B;  3AWT B;  2ZMZ B; 
#chains in the Genus database with same CATH topology
 2JV8 A;  4NB8 A;  4NBG A;  3VMG A;  1Z01 A;  3AWX B;  4NBB A;  2ZWE B;  3AWZ B;  3AWW B;  2ZMX B;  1WX5 B;  2ZWF B;  2ZWG B;  3GCF A;  4NBC A;  4NBH A;  1WX2 B;  4NB9 A;  2ZMY B;  3VMI A;  3VMH A;  2DE6 A;  4NBE A;  1Z03 A;  2DE7 A;  2DE5 A;  3AX0 B;  3AWS B;  1WX4 B;  1WW9 A;  3AWY B;  1Z02 A;  3AWV B;  3AWU B;  4NBF A;  2AHK B;  4NBA A;  1WXC B;  2ZWD B;  2AHL B;  3AWT B;  2ZMZ B;  4NBD A;  3GKQ A; 
#chains in the Genus database with same CATH homology
 2JV8 A;  3AWX B;  2ZWE B;  3AWZ B;  3AWW B;  2ZMX B;  1WX5 B;  2ZWF B;  2ZWG B;  1WX2 B;  2ZMY B;  3AX0 B;  3AWS B;  1WX4 B;  3AWY B;  3AWV B;  3AWU B;  2AHK B;  1WXC B;  2ZWD B;  2AHL B;  3AWT B;  2ZMZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...