3AWVB

Crystal structure of streptomyces tyrosinase in a complex with caddie soaked in a cu(ii)-containing solution for 80 hr: occupancy of cua is low
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
84
structure length
78
Chain Sequence
AAPESFDEVYKGRRIQGRPAHEHGGGYEVFVDGVQLHVMRNADGSWISVVSHYDPVPTPRAAARAAVDELQGAPLLPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosinase
publication title A molecular mechanism for copper transportation to tyrosinase that is assisted by a metallochaperone, caddie protein
pubmed doi rcsb
source organism Streptomyces castaneoglobisporus
molecule tags Oxidoreductase/metal transport
total genus 17
structure length 78
sequence length 84
ec nomenclature
pdb deposition date 2011-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06236 MelC1 Tyrosinase co-factor MelC1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1880.10 Alpha Beta 2-Layer Sandwich protein ne1242 fold protein ne1242 domain like 3awvB01
1WX5B 2ZWDB 3AWZB 2ZWFB 2JV8A 2ZMYB 3AWUB 3AX0B 1WX2B 3AWXB 2ZMXB 2AHLB 3AWTB 1WX4B 2ZWEB 1WXCB 2ZMZB 3AWSB 3AWYB 2AHKB 2ZWGB 3AWWB 3AWVB
chains in the Genus database with same CATH superfamily
1WX5B 2DE6A 1Z03A 2ZWDB 3AWZB 2ZWFB 2JV8A 3GKQA 4NBGA 4NBCA 4NBDA 2ZMYB 1Z02A 3AWUB 3AX0B 1WX2B 3AWXB 4NBAA 4NBFA 1WW9A 3GCFA 2ZMXB 4NBBA 2AHLB 4NB8A 3AWTB 2DE5A 1WX4B 2ZWEB 1WXCB 2ZMZB 4NBHA 3AWSB 3AWYB 2AHKB 3VMHA 2DE7A 2ZWGB 1Z01A 4NB9A 3VMGA 3VMIA 3AWWB 4NBEA 3AWVB
chains in the Genus database with same CATH topology
1WX5B 2ZWDB 3AWZB 2ZWFB 2JV8A 2ZMYB 3AWUB 3AX0B 1WX2B 3AWXB 2ZMXB 2AHLB 3AWTB 1WX4B 2ZWEB 1WXCB 2ZMZB 3AWSB 3AWYB 2AHKB 2ZWGB 3AWWB 3AWVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WX5 B;  2ZWD B;  3AWZ B;  2ZWF B;  2JV8 A;  2ZMY B;  3AWU B;  3AX0 B;  1WX2 B;  3AWX B;  2ZMX B;  2AHL B;  3AWT B;  1WX4 B;  2ZWE B;  1WXC B;  2ZMZ B;  3AWS B;  3AWY B;  2AHK B;  2ZWG B;  3AWW B;  3AWV B; 
#chains in the Genus database with same CATH topology
 1WX5 B;  2DE6 A;  1Z03 A;  2ZWD B;  3AWZ B;  2ZWF B;  2JV8 A;  3GKQ A;  4NBG A;  4NBC A;  4NBD A;  2ZMY B;  1Z02 A;  3AWU B;  3AX0 B;  1WX2 B;  3AWX B;  4NBA A;  4NBF A;  1WW9 A;  3GCF A;  2ZMX B;  4NBB A;  2AHL B;  4NB8 A;  3AWT B;  2DE5 A;  1WX4 B;  2ZWE B;  1WXC B;  2ZMZ B;  4NBH A;  3AWS B;  3AWY B;  2AHK B;  3VMH A;  2DE7 A;  2ZWG B;  1Z01 A;  4NB9 A;  3VMG A;  3VMI A;  3AWW B;  4NBE A;  3AWV B; 
#chains in the Genus database with same CATH homology
 1WX5 B;  2ZWD B;  3AWZ B;  2ZWF B;  2JV8 A;  2ZMY B;  3AWU B;  3AX0 B;  1WX2 B;  3AWX B;  2ZMX B;  2AHL B;  3AWT B;  1WX4 B;  2ZWE B;  1WXC B;  2ZMZ B;  3AWS B;  3AWY B;  2AHK B;  2ZWG B;  3AWW B;  3AWV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...